4U45A

Map4k4 in complex with inhibitor (compound 25)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
300
structure length
289
Chain Sequence
DIDLSSLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPDDQLWLVMEFCGAGSITDLVKNTKGNTLKEDWIAYISREILRGLAHLHIHHVIHRDIKGQNVLLTENAEVKLVDFGVSANTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPSTEQLLKHPFIRDQPNERQVRIQLKDHIDRTRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fragment-based identification and optimization of a class of potent pyrrolo[2,1-f][1,2,4]triazine MAP4K4 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase kinase kinase kinase 4
total genus 93
structure length 289
sequence length 300
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4u45A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4u45A01
4TWOA 5IUGA 3BU6A 4AF3A 4HVHA 4YLLA 5C03A 2C5OA 3C4XA 4HGTA 3PPZA 2JBOA 4AZFA 2PE0A 3IDPA 5CSHA 1KOAA 3G51A 3C7QA 1H24A 2BAKA 2RG6A 4RJ3A 5K9IA 5I9VA 2JD5A 2F7EE 3E5AA 4UMUA 2XIXA 1ZRZA 2QOKA 2R0UA 3FI4A 3G2FA 4U97A 5HCYA 3CPCA 4LOPA 4UY9A 2B7AA 2BRHA 3IDBA 4E4NA 5ETCA 3Q9ZA 4K6ZA 1SM2A 4RIOA 3UJGA 4WNKA 1E9HA 4ANMA 3A4PA 4E20A 1R78A 3ELJA 3PJ1A 3G90X 3U51A 3A8WA 4C59A 1Q8UA 5JQ5A 3OCTA 4RRVA 3BQCA 4YZDA 1UKIA 5E4HA 4K11A 2ESMA 5AR7A 2IW8A 1ND4A 4FV1A 4CSVA 2YCFA 3QD4A 1JLUE 3SVVA 2ITZA 4D4RA 5KKRC 2XJ1A 4BYJA 1B39A 4FV2A 2B0QA 3FZOA 4ERWA 1U5QA 4O0WA 4QT1A 5DYJA 2C4GA 3FXWA 1BKXA 2V7OA 3L8VA 3Q4TA 4ITIA 4RVTA 3R8UA 2AUHA 1QCFA 3PYYA 3R8MA 1YI6A 3CR0A 2PSQA 4DN5A 4EH9A 3DNDA 4RSSA 5CI7A 4ALVA 4ZTHA 2X39A 3OWKA 1H25A 1LEZA 5IDNA 2C0IA 4GYIA 3WOWA 3ULZA 2Z60A 2W1HA 3TDWA 4JX3A 4KABA 5J9ZA 1IR3A 3LCTA 4HCTA 5DRDA 2Y7JA 3CP9A 2A0CX 3FKOA 3EZRA 3GT8A 5HO6A 5IA5A 3ZUVA 3V5QA 2C30A 3ZH8A 3NDMA 2PZ5A 3II5A 5KCVA 3C0HA 4CV8A 1FVTA 4PTEA 3QKLA 3JY0A 3BKBA 2YITA 1W84A 3KF4A 4PMTA 4PQNA 2YM8A 1FGKA 1SMHA 3EHAA 4HGLA 2C6MA 3W2OA 5CEMA 3MFTA 4FVQA 4IADA 1URCA 1XJDA 4IAAA 2HIWA 4RJ5A 5EW9A 3RPOA 3SHEA 3VUDA 3HMIA 3POOA 5J9YA 1XH6A 3LIJA 4D1ZA 2JIVA 4XV1A 4TRLA 4GUBA 4WSYA 5CVGA 5BX0A 3S95A 3DXPA 4Y95A 1XWSA 4RVKA 3CGFA 4B8LA 2X7GA 2FSMX 2G2HA 3CTHA 3GQLA 3VW8A 2VN9A 4XV3A 4A4LA 4CLIA 3UOJA 3IPHA 4UEUA 2IZRA 4KS8A 1UA2A 1MQ4A 5AWMA 4YHTA 4DG2E 1YWRA 1KSWA 1UNGA 4YSMA 1WBOA 2QCSA 1QL6A 2ZJWA 1IAJA 4ZZNA 4JL9A 3CKWA 3L9LA 5H8BA 1R39A 4OTIA 3OW4A 3D5VA 4R1YA 4R3PA 3UQFA 3LCSA 4BI0A 3KK8A 3C4ZA 4O27B 1SYKA 2OXYA 2CNQA 4HYUA 3CPBA 4G5JA 1JQHA 4AXAA 4IXPA 3GU5A 4ZSJA 3DBDA 4BDCA 4EYMA 3ORKA 4F63A 1ZYDA 2OJJA 4RZWA 4BGGA 4MBIA 1Y91A 4FOBA 4JVGA 3RALA 4F0GA 5KMMA 3I0QA 4RBLA 3ZDUA 4L44A 1MRUA 1RDQE 3GU6A 4WNMA 5E1EA 2ONLA 4F65A 4KIKB 4HOKA 4J96A 4O81A 4Z3VA 4JRVA 3UYSA 3VBXA 3QQKA 3ZZEA 4GFGA 3E63A 3HYHA 1MP8A 3HMPA 2IG7A 4IJPA 3VS0A 4RT7A 2XBAA 2HW7A 2ITNA 3LM0A 2JDVA 3LXLA 1H28A 4TWCA 5TKDA 4E6QA 2PUNA 3WF8A 4DGMA 3FHRA 4RC2A 3V5PA 4E3CA 5I3RA 3T3UA 4MXZA 4R1VA 4S32A 3IS5A 4QP4A 4TYEA 3OWLA 3BLRA 3R02A 3PP1A 4E5AX 4L3JA 1UV5A 1YDRE 3EFLA 4N6YA 4FSMA 3VNTA 3G6GA 3RAKA 3CC6A 4QMOA 3ZDIA 3LFBA 2WMBA 4YZNA 3RMFA 5EFQA 4RJ8A 3O50A 4NM7A 3W33A 2OJGA 3DBEA 3PXYA 4Q5EA 1A9UA 4IM0A 5E8VA 5J5TA 5HU3A 5JT2A 4I0RA 1UU3A 2GU8A 3ZFYA 3OBGA 4FKVA 4NM3A 4AOIA 5ETFA 1ZMUA 2UZDA 1G3NA 3CQEA 5LCJA 4V0GA 3PVBA 4RQKA 3OTUA 3HNGA 4ASXA 5HNGA 5IQIA 2UV2A 4WA9A 1OKVA 3EYGA 4YZBA 3UO6A 1OVEA 1NT2A 3I5ZA 3DLSA 4KBKA 4EOPA 1H8FA 3IOKA 4EOJA 2GS7A 4MEDA 4EJNA 4QO9A 5HI2A 4F9YA 1YXXA 2W1DA 4XG9A 3T8OA 1JKTA 1BLXA 2IN6A 3OMVA 3MFSA 4XH6A 1K2PA 3RAIA 3V6SA 1TVOA 2B9JA 2Y9QA 3ZC6A 3Q6UA 2LAVA 1PXNA 3AC1A 2X7FA 3PIZA 3SOCA 1U59A 4BRXA 1PW2A 4NCTC 4U45A 2X0GA 2ZDUA 3RPSA 3ORNA 3GFWA 3IK3A 3QD3A 3TNHA 3K3JA 2HZ4A 4FUXA 3BV3A 3HMNA 4N70A 5H3QA 5KZIA 3ZXTA 3BE9A 2GNGA 2PVRA 4XOZA 2VWUA 3ZSGA 2GQGA 4MWHA 4O1PA 4GK3A 3QFVA 3V8SA 4BKYA 2QO2A 1X8BA 2YN8A 4NCTA 2Y4IB 2HXQA 1WVYA 5M53A 4NIFA 1M17A 1PKDA 2CSNA 3C4WA 4RA4A 4DGGA 4KIPA 2YWPA 4ENXA 1OKYA 2WTJA 3LM5A 5DMZA 3GB2A 3EB0A 5KMOA 5AAGA 3HV4A 4P2KA 2GPHA 3QAME 5M44A 1YQJA 1WBPA 5EW3A 3GXLA 3PP0A 4UWYA 2JDOA 4E93A 3R71A 4EWHA 3TKUA 5JGDA 4NK9A 4QD6A 3EH9A 4FC0A 4MNFA 3ZTXA 5LQFA 5H2UA 1YOLA 4HNFA 5E8SA 5TOZA 1I44A 3BEGA 4UWCA 4OBOA 4MVFA 1UNHA 1XH8A 3FAAA 4J7BA 2J5FA 3TV4A 4AG8A 4TYIA 3GUBA 4F7JA 1JNKA 2WQNA 1OIYA 3E92A 5DRBA 3W8LA 4BDDA 4IX3A 1Y6AA 4HW7A 4R7BA 4WG5A 4KWPA 3NCZA 3P9JA 4PL5A 4OTFA 1OPLA 3BEAA 3OG7A 5FEDA 3BIZA 3EQPA 5DA3A 3NUPA 4CT2A 4BB4A 4YP8A 3UBDA 1AGWA 3DBCA 4KBCA 3JS2A 3R6XA 3FYJX 4I5MA 3HRBA 5DWRA 3MW1A 4LUDA 4GU6A 4OAVB 3EQDA 5FTGA 4K9YA 4QP2A 5JRSA 3V3VA 2QG7A 5FGKA 1Q8WA 1VJYA 5A3XA 2JKKA 1DAYA 3QZHA 3ZZWA 5H8GA 2J5EA 4BCOA 3WYXA 5AEPA 3DBQA 4CKIA 4AGDA 5CALA 3GCQA 4FMQA 3BX5A 2WKMA 4F6SA 3NS9A 4AP7A 4R5SA 3GEQA 4GT3A 3UP7A 3WE8A 1H1QA 3NGAA 3MVLA 4FK6A 1P5EA 4DC2A 4FOCA 4IHPA 5I9ZA 2BDWA 4IMYA 4TWPA 4A07A 3DQXA 4WG4A 4LMUA 4F6WA 5IEYA 3G0EA 4CFUA 3LMIA 2XS0A 2YACA 5ANKA 4AW0A 2C5XA 4DH8A 3VBQA 1OZ1A 4IWQA 4KNBA 1VEBA 3LE6A 5DE2A 3U4UA 1NVRA 3QXOA 3DPKA 1Q99A 3LFEA 2BILB 3D15A 4FR4A 4BZDA 2ZV2A 1VZOA 3SX9A 2J4ZA 2OIBA 4RA5A 2C0OA 4G6NA 5BVOA 4IB3A 4PV0A 3VW6A 3MDYA 3CY3A 4GIIA 1KE5A 3OEZA 4YPSA 4FZ6A 4CEGA 2Y6OA 5FBOA 4FEUA 4ZMFA 3ZLXA 5HG7A 5ETIA 2B9FA 5K4IA 3HUBA 3Q5IA 3F5UA 4FTTA 3QXPA 4BTFA 4YUQA 5FQDC 5ANOA 2WMTA 3QCXA 4PNKA 4G3GA 3EWHA 5HHWA 4ZS0A 4GG7A 2OFUA 1B38A 2R64A 1JVPP 3IQ7A 4ANBA 4YSJA 2WNTA 3NNXA 3POZA 3U9NA 1PKGA 4ACMA 1OIUA 4GK4A 5IQBA 3Q4ZA 3A7FA 1WAKA 4AN2A 1XO2B 4QYEA 4PP9A 4Z16A 4XS2A 3IW8A 5HG5A 3WI6A 3C5UA 4BTKA 4BWPA 3K5VA 2IZSA 3P23A 3P78A 4O0RA 5CU6A 3AMYA 2UW5A 3H9FA 3B2WA 4NZWB 1JKLA 2VGPA 3UG2A 4BF2A 3PWYA 3R9OA 4A4OA 5CENA 1A48A 3GVUA 4MXYA 3IO7A 3FWQA 4DHFA 2OZOA 3LJ0A 3MTLA 3ORTA 2QHNA 3NYNA 3I6UA 3QHWA 4FIGA 5F9EA 3TNPC 1O6KA 4U0IA 5BUJA 4O0VA 3AT4A 4BDAA 2WQOA 1W0XC 3OXZA 3ZLWA 1YOMA 3QZFA 5DVRA 3PA3A 3VF9A 3F3UA 4FSYA 3KCFA 4M0YA 4CZYB 5AR5A 3KEXA 2BKZA 4FL1A 4HJOA 4C62A 5AX3A 3O17A 3QTIA 1STCE 4J52A 3ZHPC 4EBWA 4MYGA 2C6TA 2BZJA 2Y6MA 3NIZA 3G0FA 4FIHA 5E7RA 4DFYA 5HIDA 4AGUA 4WBOA 1J91A 3OW3A 1APME 2PU8A 3FE3A 3SG9A 4QYFA 2HENA 4L52A 3NRMA 3QC4A 2Z02A 4HCVA 4IBMA 4R77A 1M7NA 5B2KA 5AR4A 3ZM4A 2E9UA 2BZIB 4EZ3A 3RTPA 5KO1A 3QLGA 1CKIA 4NYEA 2CGVA 4JG7A 4GT4A 4C2VA 4D0WA 2PYWA 3MH1A 5CY3A 4ZJVA 2GFSA 3ORMA 2YABA 1CKJA 3ZFMA 5ITAA 3UNJA 4ZSEA 2IW9A 2XEYA 4LM5A 2CHLA 3HP2A 4FKWA 3O8TA 4GSBA 4JDHA 4TNDA 3TN8A 4XJ0A 4YC3A 3RCJA 3RPYA 3U4WA 3BHVA 3LLTA 4BHNA 3FMNA 3G9NA 3QWKA 5K5XA 3B8RA 2YM7A 4IVDA 3JVSA 3NVMB 1F3MC 2W4JA 3KMUA 1RE8A 2CJMA 5KMJA 5JFXA 1CTPE 4AQCA 4G6OA 1DM2A 5LVNA 3AC4A 3QKMA 2OLCA 5IQAA 3LZBA 3TZ7A 3R1QA 3LOKA 3UOHA 1GJOA 5DH3A 3MH3A 2OXDA 3OUNB 5E90A 3QGWA 2IO6A 4ZSLA 4YTFA 3ZONA 4FNZA 4UV0A 4EK3A 1NVQA 3WZJA 4I3ZA 4DFXE 3PA5A 4BCFA 4ZMEA 4USEA 2UW8A 1YHSA 2YAAA 4II5A 4Z7HA 3VS2A 1PYXA 4BCMA 5EKNA 5IU2A 4GS6A 3DJ7A 3ITZA 4BVUA 3NAXA 2UZOA 4G17A 4AZEA 2W9FB 2Z8CA 3ZRMA 4APPA 5I9WA 2Z7QA 4FEWA 3N4VA 4M67A 4PMSA 4CT1A 3C5IA 3V51A 4BWXA 5L2WA 4C35A 2J9MA 4C2WA 3A60A 3ZC5A 5K5NA 1QPJA 2O65A 4ACDA 2PUIA 2P2IA 3KXNA 1WBVA 4YBJA 3I6WA 4C4EA 4FI1A 2G15A 3U87A 2FSLX 2BZKB 1L8TA 2PULA 3MY0A 3RPVA 1SVGA 5B7VA 4TXCA 4B6LA 4FG9A 3F9NA 4I6FA 2UZLA 4YLKA 3R01A 3GI3A 3HA6A 2BRNA 5LWMA 3QU0A 4CFWA 5E8TA 3CQWA 4PX6A 2CGWA 1GZOA 4FKLA 1ZYCA 3PPJA 4ZIMA 2XVDA 5JKGA 2YIRA 2WU7A 4OTPA 1WVWA 3QKKA 3CD8A 2Q83A 1XH9A 4E4LA 4AA4A 4DTKA 4YO4A 2VWWA 5IUHA 4K8AA 4Y5HA 4J1RA 4FKIA 4EH2A 2QODA 3GC8A 4MK0A 2QG5A 3NAYA 4BDEA 5HCXA 4CG9A 2J90A 5EK7A 2C6IA 4AFJA 3FMHA 5CAOA 2O63A 2R3MA 4NTSA 3FSKA 4BTJA 1WVXA 5ACBC 4M7IA 3D7ZA 3WARA 4IDVA 1UU7A 1OL6A 2J2IB 4AGWA 5KKRB 5AP4A 4B4LA 4EK4A 4JT3A 2BTRA 4G9CA 4PP7A 4HGEA 4ZSAA 3ALNA 3KA0A 3DJ6A 4PL4A 3NUYA 4AZWA 3LQ5A 2Y8OA 1OGUA 3R63A 4USDA 1OKZA 4C3PA 5C8MA 1M7QA 2VWIA 4FA2A 5F4NA 4XUFA 4BCJA 5CI6A 5JSMA 4F7NA 2HY0A 4XLVA 1OKWA 2WTWA 3VUHA 4IZYA 3TT0A 5CXHA 4DAWA 2G2IA 5JH6A 3VJOA 1V1KA 4WG3A 5E8ZA 3R8PA 4F4PA 4C4JA 5HGIA 1Y57A 3H0YA 2CMWA 3WZUA 4FSQA 3RWPA 4CTBA 2F2CB 3FQEA 2ETMA 4O83A 4EZ5A 1MQBA 4I93A 3R83A 2PWLA 2OZAA 3DK3A 2QOQA 3F3TA 3AG9A 3PWDA 2XKCA 4G2FA 2RFEA 4JQ8A 2W99B 5FM2A 2R7BA 4YC8A 2XK3A 3W16A 2I0EA 3HVCA 4G3FA 5L6PA 3MB6A 3W10A 5ACKA 3SXFA 5GHVA 3AC8A 3L9PA 2I1MA 3WILA 2XIKA 3DAJA 3ZRKA 4EOIA 3PRIA 5EYKA 4RIYA 4AT4A 4X6RA 4KSQA 5HE0A 4BDIA 1KV2A 3OXTA 3PY1A 3MY5A 4AACA 3RPRA 2EUFB 1ZWSA 4EK6A 5M07A 4YNOA 1YOJA 3DB8A 4EOKA 3GNIB 3NWWA 4BDBA 3K54A 1TQMA 4G16A 3D0EA 4MD8E 2PMOX 1V0BA 1BX6A 4KD1A 3MWUA 2VX3A 4XRJA 4EOSA 5CT0A 1YRPA 2WAJA 4I20A 3D7TB 3R7UA 3QC9A 5AP1A 2J0KA 3HZTA 3O96A 3NVKI 5DI1A 3D2IA 4U41A 3ZEPA 2BRMA 4M8TA 4A9RA 3BLQA 4EQCA 3MI9A 5ANDA 1H1SA 1H4LA 4I0SA 1ZOGA 3PZHA 4ACCA 4ANOA 5T3QA 1PHKA 1OBDA 2ZV7A 4HZSA 4ZTRA 3NUAA 5CU2A 5AUWA 4E6DA 3AC2A 5L4QA 1ERKA 2GS2A 5DT0A 4FZFB 2XIYA 1JAMA 3NUNA 1XBAA 1YXSA 4U42A 3QCSA 4PPCA 1JWHA 4OBPA 3EN5A 4HNIA 3IKAA 4MKCA 4DH1A 5HD4A 5LMKC 3Q6WA 4M68A 1ZLTA 5CAVA 1KE8A 3GU8A 3T9IA 3ZU7A 3E3BX 3E3PA 4HYSA 4QTEA 4CLJA 3BYSA 4JBOA 4F6UA 1YKRA 4Y46A 3OHTA 4ALWA 1XR1A 4I0TA 2J0LA 2I0YA 2YJSA 3OWJA 3Q4UA 4L7SA 3K5UA 3N9XA 5C26A 2B54A 3MPTA 1URWA 4UZDA 4ZZMA 4AE9A 4EH5A 4M3QA 3SLSA 4CNHA 4L01A 2YCRA 2VX1A 3MTFA 2J50A 2W1GA 4I4EA 1H26A 4LQMA 4TY1A 2QVSE 4X2GA 5HBEA 3COHA 2GDOA 5AM7A 5J7BA 5LVOA 1LEWA 3AMBA 4DLJA 2OXXA 1U4DA 2BRGA 4K2RA 3TIZA 4I22A 4DYMA 1ZYSA 5HZNA 2X2MA 4JDJA 1GNGA 4OUCA 4EK5A 4GRBA 1BI8A 3HV5A 3ZMMA 4AW1A 3EFWA 4XG2A 5HOAA 2R3IA 1PXMA 4L46A 4W9WA 1RW8A 5KUPA 5E9EA 2VV9A 3BYUA 3Q96A 4XG7A 4YJQA 5L8KA 3FMDA 5DT4A 4BBEA 3VF8A 2W4OA 4NUSA 4AS0A 4FL3A 2A27A 3BELA 4F64A 4MD9E 4R3CA 3RWQA 5BVFA 3S1HA 4FVRA 4FKPA 5ANEA 3KRLA 2WQBA 1WMKA 3U8WA 4QYHA 3OBJA 3I7BA 2VWBA 2DWBA 5HE3A 3UZRA 4ANLA 4CRLA 3NMUF 5BVNA 4EH4A 4DFNA 2PZPA 3FZSA 2ERKA 5AUVA 4BYIA 4E4MA 5HLNA 5HX8A 3HMMA 2QR8A 2OIDA 1M2RA 5IPJA 4DBXA 4WKQA 3DTCA 5EM6A 3FQSA 3QUPA 2V55A 4I5PA 2YIXA 5C4KA 2C3LA 3F5GA 4G1WA 4GG5A 3F7WA 4DGLC 4XRLA 2VTHA 3MGYA 3MJ2A 4OLIA 3RZBA 3SAYA 3DAKA 5HG8A 2Y4PA 4E6CA 4UN0C 5I5ZA 4KSPA 4A9UA 5IG1A 1J7LA 3JY9A 2OIQA 5L2IA 2EXCX 5GINE 2VTSA 2UZNA 3F3VA 5ANJA 5CQUA 3PJ8A 4LMNA 2R3HA 4FKTA 4FKSA 4QTDA 1WBWA 2JFMA 2PY3A 3QRUA 2E9NA 4XV9A 2HZIA 2VTOA 5G6VA 5J95A 3ZS5A 4O82A 3GC0A 3R9NA 2YDJA 5AP5A 3R8ZA 2GNHA 2R3NA 2Q0NA 2QOIA 2WELA 4QPAA 4DEEA 3KXXA 4TNBA 3NPCA 4U3YA 4XHKB 4X3FC 5BPYA 2YERA 4USFA 4QNYA 3P86A 4U6RA 5J9LA 4CGAA 4CYJA 5EQYA 4UYAA 1MRYA 2WZJA 3D2KA 1KWPA 1GZNA 1ZARA 3EFKA 4UMTA 3F5PA 4H3BA 4MXOA 4DG3E 5C01A 4EHVA 4F1TA 4IAIA 5CU3A 5EQPA 4DFUA 4DH5A 1FQ1B 2I40A 4CFMA 1IEPA 2XIZA 2XK4A 3BBTB 4WUAA 1GAGA 3VBTA 4C34A 3FLZA 3HL7A 4EUTA 4Q5HA 4WBBB 4FNWA 4GW8A 2WTDA 3ULIA 3R1YA 2BROA 4RLKA 5JK3A 4TW9A 5EG3A 4YTCA 3G15A 2VWVA 3RHXA 2ZMCA 3EIDA 3LPBA 2ZYBA 3FXXA 4N6ZA 4QNAA 4I1ZA 3MIYA 4M13A 4ZOGA 2VWYA 3L9NA 4ZTSA 3TUDA 1KE6A 4YZCA 4QMNA 1YWVA 3CQUA 3PG1A 4FIJA 3AD4A 3QA0A 4DFLA 3BHTA 2I7QA 3NCGA 5JRQA 3MN3A 4FKQA 1YDTE 5HCZA 4CCBA 5HO7A 2VGOA 3UPZA 1HCLA 2QNJA 2JLDA 2PVKA 4QMUA 2CN5A 2C3JA 4W4YA 4QYGA 1SVHA 4AN9A 4NIFB 3PPKA 4I24A 3F66A 4M66A 4X3JA 3LFDA 3UC4A 2XB7A 1LR4A 5FXQA 1H08A 3KL8A 1CM8A 3RAHA 2P33A 4QQTA 5I0BA 2W96B 3P7AA 1P14A 3EFJA 3DV3A 4JRNA 3F2AA 3CIKA 4CRSA 2YISA 4PF4A 3AMAA 3R00A 1FBNA 2YIWA 3UO4A 3BBWA 5M57A 1W7HA 3L8SA 3RM6A 3UQGA 5EM5A 4S31A 1YWNA 3MJ1A 4TL0A 5A6NA 1PY5A 5B0XA 3C4EA 5M4UA 2IJMA 2QLUA 4FGRA 4PY1A 2W5BA 4OT6A 4YGAA 5HTIA 3P0MA 1Q3DA 4IANA 4IZ5A 4HPUE 4L42A 5IA1A 5I4NA 4FV0A 4RWKA 3WF6A 4IVBA 1WFCA 2X1NA 2XIRA 3TIYA 3OWPA 3ERKA 3PA4A 5EYMA 3D7TA 4I6HA 5LOHA 3PLAE 4V04A 3O8UA 3DKGA 4D0XA 3FLNC 3SW4A 2QQ7A 3DBFA 4PMMA 2AYPA 2QC6A 4ZK5A 4O7ZA 4QP6A 4KBAA 4M12A 3BGZA 3TTIA 5E92A 2YZLA 5T6KA 4A9YA 4BDKA 3PSDA 3KRXA 3HDMA 2GTMA 2P0CA 5HLPA 3RNIA 1E1VA 1HCKA 2YJRA 5L6WL 4TTHB 3ENHA 3TNWA 4BDFA 2UW0A 3KRJA 3DGKA 2PZYA 3R2YA 2C3KA 4QTBA 3DY7A 1WZYA 3PFQA 4EQMA 5HNIX 4EJ7A 3GENA 5DIAA 1FMKA 1REJA 5KE0A 3WIKA 5IMEA 1MRVA 3OOGA 5IA0A 4OTQA 3NW7A 4FGBA 5EKOA 3TZ8A 2PVYA 3QQUA 2V62A 3VHKA 4E6AA 2RFNA 2XRWA 3ENMA 4I6BA 2XKDA 3Q9WA 4QQJA 3QGYA 4OTGA 1YVJA 5FTOA 2OZAB 3ZO2A 4EZ7A 5CX9A 4EH7A 4IAYA 3QZIA 4ASDA 2F2UA 3HAVA 3COIA 2C1AA 2VNYA 3DFCB 2IZUA 2RSVA 3Q3BA 5AUUA 4F1MA 3F2NA 2XF0A 4ASZA 5HORA 3TDVA 3G33A 5AJQA 4FEVA 4ALUA 2OW3A 2WGJA 3Q9YA 3QTZA 2O5KA 3FY2A 4P5ZA 2BVAA 3TJCA 4GH2A 4XG3A 3TUCA 3I4BA 3FPQA 4RWJA 2ZB0A 3R7OA 4JX7A 2JDTA 2XNGA 4S2ZA 2B55A 1EH4A 2WTVA 3GP0A 5AMNA 4YJVA 4C8BA 4C38A 3ZEWA 4EUUA 2VTJA 5IF1A 3VBWA 5KMIA 4MH7A 1UKHA 1WBSA 5GZ9A 2RIOA 5CEKA 4G3CA 1R1WA 2XZSA 5GJDA 3QQJA 3KRWA 1PXLA 3GOPA 3QA8A 3VRYA 1Q41A 4AT5A 3ZCLA 4R78A 3UZPA 4C57A 4GFMA 4FODA 2QONA 5E8WA 2CDZA 1S9JA 4D58A 2G2FA 4U9AA 2Y4IC 3MH2A 3O0GA 4RWLA 4ZY5A 5KBRA 3MH0A 3QBNA 3ZSIA 2XUUA 2GMXA 4CQEA 2F57A 2DS1A 4C4GA 3FHIA 5JGAA 3GCUA 5IH5A 2HXLA 4FTCA 3TV7A 3GC9A 4FZAB 3W18A 3W2PA 5AA9A 2CNVA 3QCYA 3SD0A 3L8XA 5HTBA 3IW4A 5IQDA 5HKMA 5EQEA 3QYZA 2WMAA 3NX8A 2C1BA 4EOQA 3HV6A 4DTBA 3CE3A 2HOGA 5HICA 1REKA 1XH4A 3AGLA 1OL7A 2OBJA 4GT5A 3W55A 4E5BA 4JAIA 1RJBA 1TQPA 2O8YA 3C0GA 4EWQA 4MXXA 3RZFA 5A14A 4UXLA 5BVEA 2IPXA 2P4IA 3FI2A 3Q60A 1TKIA 4LG4A 2QD9A 3AT2A 3MA6A 4JS8A 3HX4A 1GIHA 1H1WA 3ODYX 3QTSA 5IKWA 3BQRA 3MYGA 4FSZA 5A4CA 5BUEA 1KUTA 2GQSA 4FTRA 1GIIA 4E7WA 2R3OA 3LQ8A 4F08A 3QRJA 2CN8A 2H34A 4FSWA 4IACA 5T68A 3RK7A 3UODA 4LFIA 4ZTLA 2VTIA 4L9IA 3UIXA 2V0DA 3BWJA 3KCKA 4XLIA 2C6LA 4QMTA 4X2NA 2R4BA 4NM5A 5KBQA 2RFSA 4UBAA 2YIQA 1HOWA 3ODZX 2J51A 2C6KA 2BCJA 4L53A 5C4LA 3PXFA 3SC1A 4IB5A 4BKJA 4RMZA 3FKLA 1W8CA 5LVLA 1Z57A 3W2SA 3U6HA 2CPKE 4L00A 4UB7A 1J1BA 4JNWA 1XKKA 2BRBA 3ZUTA 4JDKA 3DK6A 4FTKA 4EL9A 2CCIA 4RIXA 3T9TA 5BUIA 1GY3A 3D9VA 3TXOA 3VS7A 1YXUA 2C6EA 3DKOA 2ZAZA 2UVYA 4AA5A 1R0PA 5IH6A 1DAWA 2X6EA 3HKOA 2X2KA 4IDTA 4CFVA 2QOFA 2WHBA 3DTWA 1H00A 2JDRA 5CU4A 4FNYA 3R8LA 3SKCA 5CSXA 5DT3A 2DYLA 2DQ7X 4PL3A 4XV2A 4RVLA 3R0TA 1SNUA 4PDSA 4H3PA 4BCIA 5AUXA 3LVPA 2YM3A 3NUXA 5FWKK 4J8NA 3O23A 3FXZA 5LVPA 4BI2A 3UNKA 2XJ2A 3FL4A 3H4JA 2VRXA 3IGGA 3QRIA 2FA2A 4D1SA 4IZAA 4YC6A 2WMXA 4YTIA 2QKRA 1NW1A 4GK2A 5KHXA 4IWOA 4FTQA 4L6QA 4WHZA 4A7CA 4W4WA 3CEKA 1O6YA 4O84A 5AM6A 4F9WA 2VTQA 3MB7A 2UW7A 4GIHA 3EKNA 1LUFA 2W5HA 3E64A 5FBNC 3ZO1A 5IA4A 3BHUA 2XNPA 3EQBA 4L3PA 4HVGA 3Q2MA 5DR2A 2JKQA 2UZUE 2W1ZA 2ZV8A 3Q9XA 5CF6A 4RC4A 3ZYAA 1JPAA 4FUYA 4IC8A 4YLJA 5D10A 4D2WA 1ZXEA 3M11A 3HV3A 2BDFA 1NY3A 1OECA 2CKEA 3OCSA 4O22A 4ONAA 2WXVA 3V04A 3VC4A 4FTAA 2ITPA 3E88A 2BIYA 3RBWA 2QKWB 3PVWA 4C02A 2I0HA 1Y8GA 3THBA 1M52A 4D55A 5IA2A 4GMYA 3P08A 5D41A 2PMIA 3NSZA 2X9EA 4BDGA 3D5XA 3LFQA 4U8ZA 3HUCA 5HBJA 2QURA 2F9GA 3A7HA 2JDSA 3MV5A 4R8QA 3RNYA 2Z2WA 2Q0BA 1J7IA 4DEIA 5J79A 4EOOA 3OUKA 4IH8A 4XOYA 5TE0A 2WB8A 4MX9A 3VAPA 4O0UA 3LAUA 5IZFA 3ANQA 1PMNA 3BE2A 4EONA 4O86A 4G3EA 4N4SA 5HE1A 2P2HA 3FJQE 3PLSA 1P4OA 4O0XA 2XH5A 3C0IA 2YM6A 3MS9A 2X2LA 1H01A 3FLWA 2NNWB 2B9IA 3L1SA 1YI4A 3UIBA 1SVEA 2UW9A 2ONLC 3COKA 4CYIA 4IQ6A 3RM7A 4QMMA 3C9WA 2YM5A 3MSSA 4J71A 5AP2A 1YXTA 2WEVA 2VTAA 3DFAA 4GYGA 3IOPA 5KMLA 4WRGA 4O7TA 3DK7A 3FLQA 3QQHA 4I6QA 4FKJA 5AR2A 3GCVA 4TWNA 4WNOA 4AOTA 1Q62A 4C36A 3MVMA 3Q2JA 3GU4A 5M55A 4DGNA 4AUAA 4P5QA 4C61A 4R7IA 5AADA 3F2RA 3PE1A 5AP7A 2WMQA 5DOSA 3ZXZA 1GZ8A 4FKRA 4QQCA 4IM2A 4DGOA 2X8EA 4FYOA 4IWPA 5BMSA 2VD5A 3ORZA 3OCBA 4ANNA 4FVPA 4BC6A 3LXPA 1BMKA 2UZBA 3V01A 2VTRA 4X7QA 2IWIA 5H8EA 2XYNA 5LWNA 4X6QC 3HMOA 5C9CA 2C6OA 3B8QA 4D5HA 2ZM3A 3W2RA 4ITJA 5L2SA 3D5UA 4FNXA 4UMRA 5ANGA 4PRJA 3EN9A 3R7GA 2WMUA 3KFAA 4D2SA 5CU0A 3MESA 4H1JA 3ZFXA 5EM8A 3DKFA 4ENYA 3D5WA 5J8IA 3EN7A 3UO5A 2PZIA 4I94A 3KXGA 1PXKA 4PTGA 2ETRA 4YURA 3UGCA 4FT5A 3FLSA 2XK8A 3PY0A 1YW2A 3BZ3A 4HPTE 5GNKA 5KZ0A 4DITA 5A46A 3FKNA 3S3IA 4PPAA 4MHAA 4OGRA 1M2PA 3KMMA 4O7YA 1GIJA 5CEQA 4CG8A 4TKSA 3EMGA 2UUEA 3BPRA 2R3LA 2NRYA 4FIIA 3Q53A 3LCOA 2OO8X 3GCSA 4Q2AA 4DEBA 3D94A 3M42A 3OP5A 3BLHA 4JBPA 5FUTA 4EC8A 3TZ9A 5HNBA 4RX5A 4KIQA 4MXAA 5EHLA 4L8MA 2OH4A 3CTJA 4FF8A 2QOBA 2XCHA 2PVLA 3KC3A 4IFCA 4F9CA 4OR5A 1PXOA 2E9OA 4F9AA 1P4FA 2B1PA 2FH9A 4IZ7A 3ZLSA 1BL7A 3WF7A 5FDPA 4YHJA 3DLZA 4L68A 2HW6A 2R3KA 2BTSA 3CCNA 4H1MA 4IB0A 4LGDA 4V0GB 3TL8A 3UMXA 4LV5A 2W1IA 4KS7A 4QMZA 5GJGA 2W1EA 2PVHA 4DTAA 2FB8A 2VO0A 4J53A 5I9YA 5FP6A 3FEGA 2KTYA 4J98A 3E7VA 4BCNA 2ITTA 4Y5QA 5CWZA 1PYEA 4EK8A 1R0EA 4JI9A 4WD5A 4O96A 4IW0A 4AZVA 2JAMA 2E9PA 3UOKA 2XNMA 4FYNA 3NZ0A 4FZ7A 4IFGA 4NTTA 1FPUA 5CT7A 5JZNA 3U54A 4O7WA 3HGKA 4RFYA 4JBVA 3BU3A 4CV9A 1OIQA 1PRYA 4O6EA 3PTGA 5M06A 4HYIA 3JXWA 2XRUA 3JYAA 5L2TA 4C3RA 3S0OA 3R7YA 4JJRA 2BHHA 4RQVA 4QMLA 3VUIA 5M4FA 4MBLA 3W2CA 5EYDA 4ZY4A 4XCUA 2H6DA 4ORKA 2IZTA 5CNOA 3UPXA 3M2WA 3VQHA 3P7BA 4O0TA 4U81A 3E87A 4PDPA 3QTUA 2OF4A 2JBPA 5L2QA 3UVPA 5JFSA 4AE6A 4O1OA 3Q04A 3U6JA 4EOMA 3W2QA 4EQUA 2VWXA 4FT0A 4PNIA 5AV4A 1ZMVA 2J0IA 4FG8A 1J3HA 4AGCA 4BZNA 1JSUA 2C0TA 4YJOA 4RJ7A 3I1AA 3C1XA 5HG9A 5J87A 4G3DA 2Z7SA 2UZWE 3EQIA 4ANSA 3QRKA 4IWDA 2GHMA 5CYIA 5B2LA 4D2RA 5A4TA 5AV1A 1PXIA 3DAEA 2JKOA 3IW7A 2XNNA 4HYHA 4IJ9A 2B53A 4BDHA 3E93A 4YR8A 3TUBA 3HA8A 1U54A 3O8PA 3EL7A 2E2BA 2X8IA 1BYGA 3LFFA 3OXIA 3REPA 3CSVA 4E5WA 3HRFA 4U40A 2YCQA 1JSVA 3RINA 4ASEA 5CAPA 4LI5A 2YM4A 3NW5A 2CLXA 4RGJA 4WO5A 2BUJA 4DINA 1J1CA 5CAQA 3BYVA 3VO3A 3P4KA 3KXZA 4KUJA 4FV5A 4G31A 4AW5A 4D1XA 1U5RA 4RPVA 4KIKA 2OJFE 4RWIA 4IC7A 4RIXB 4U3ZA 4U80A 4BGQA 3FL5A 5CZIA 3E8EA 1UU8A 1H27A 3KXMA 3EOCA 5E8XA 2WMWA 2Y0AA 3V5LA 4RLLA 1S9IA 1M14A 5C8NA 2X4ZA 2PPQA 5EDPA 5K3YA 2BFXA 3KKVA 3CJFA 5J7HA 3SXSA 5D1JA 2GHGA 3QD2B 4L3LA 5TO8A 4CZTA 1YDSE 5M09A 4X3FB 3D14A 4K33A 5KX8A 3BYOA 2QHMA 3L8PA 3S00A 4FIEA 2O2UA 3NR9A 3VHEA 4JQEA 5K0KA 4XX9A 5HIBA 2F7ZE 4YZ9A 3OOMA 3O71A 4QMQA 3C4FA 4FKGA 4IX5A 5ETAA 5J5SA 4BZOA 5ICPA 1M2QA 1FOTA 2R0IA 3KVXA 2WQEA 4IM3A 4OW8A 4QTCA 4RX9A 5I3OA 3UNZA 4BWKA 3WE4A 2XK6A 2I6LA 2UZTA 2XNBA 4KB8A 1RQQA 1OBGA 4J8MA 5JFWA 4IIRA 3F69A 4CMOA 4KRDA 2VUWA 2ZB1A 3QCQA 4AN3A 1PMEA 4AX8A 4GU9A 3CKXA 5CS6A 2PMNX 3NLBA 5EHYA 3IW6A 4LRMA 1LP4A 2ITVA 3DDQA 5DN3A 5CEIA 3LLAA 3DQWA 3LFAA 3LMHA 4JLCA 2RG5A 3A62A 4DEHA 4I4FA 2P55A 4FV7A 3KB7A 4FV8A 4R3RA 4U43A 3RK9A 5HTCA 4F9BA 1ZZLA 3RK5A 4C4IA 4Q9ZA 4LGHA 4X2KA 2WIHA 3ROYA 2C5NA 4ZS4A 1QPDA 2YCSA 3PRFA 4Y73A 3FDNA 2HCKA 4F70A 5AP3A 5EI6A 3TM0A 5TR6A 1F0QA 4O6LA 3DZOA 3FMLA 5D7VA 4S30A 3KULB 3LW0A 3A7JA 1IRKA 1V0PA 3M1SA 4LL0A 2PL0A 3G9LX 4G34A 3TJDA 2XMYA 4FSUA 4FTIA 4FSTA 3R9RA 3HRCA 4K18A 2B9HA 3C51A 2VNWA 3NNVA 1AD5A 1CKPA 3VVHA 1UVRA 2O64A 3LFSA 4L67A 4NFMA 4EHZA 3U55A 1I09A 4DFZE 5CTPA 3FQHA 3RKBA 4TN6A 1FVRA 3VQUA 2RF9A 2CLQA 3QF9A 4D5KA 4NFNA 4CVAA 4XP0A 4FTMA 3VUGA 2GNIA 3FZRA 3PXZA 5JN2A 4ERKA 4WT6A 2ZVAA 3U6IA 2JKMA 3DNEA 4RFMA 5CSVA 5HVKA 3V5TA 1FMOE 4CZUA 5LMBA 3HDNA 4JR3A 3KY2A 5DEWA 4JIAA 3MVJA 4F09A 3SG8A 4NM0A 3PJCA 3FPMA 3WBLA 2ZOQA 4YJUA 4P90A 3I7CA 2UW4A 5E8YA 1OIRA 5BYLA 5B2MA 3TEIA 3VS4A 4I21A 4ZTMA 4BKZA 3PDTA 4HGSA 5CF5A 3E7OA 3JPVA 3GGFA 4GJ2A 4UXQA 3Q4CA 4NKSA 5CQWA 4IB1A 4E1ZA 4BL1A 4OBQA 5A4EA 3UIUA 4QP7A 3I60A 2I0VA 1Q8YA 4FE2A 2JFLA 2W0JA 2BMCA 2QU6A 1UNLA 2RL5A 3LJ2A 4GV1A 3R28A 4BDJA 3PSBA 5M4IA 2ZV9A 4R5YA 3R73A 4UYNA 1UU9A 2G01A 2VX0A 4FK3A 4D2PA 2PVFA 1VR2A 1W83A 3EN4A 4V01A 4AU8A 4AWIA 2C68A 1GZKA 4NSTA 4O7NA 4C58A 3R04A 2BPMA 3UVQA 2CGXA 5HU9A 3I81A 4EH3A 4J97A 3FMJA 5DGZA 3WZKA 4BCGA 4WOVA 4DEGA 2J7TA 3A8XA 3MY1A 4UZHA 3JR1A 1IA8A 2ITYA 4RC3A 2IVUA 3RCDA 3QD0A 5CZHA 1YHVA 2YDKA 2NO3A 2XBJA 2PE2A 5FTQA 5AIKA 3DXNA 2WEIA 4YHFA 5F1ZA 4YMJA 5GZ8A 2OG8A 1ZYLA 4LRKA 4LL5A 4JBQA 4ZZOA 3DOGA 4FG7A 5HD7A 3TZMA 4RZVA 1FGIA 2B4SB 4BHZA 5DBXA 2CNUA 4G9RA 3EKKA 5BVDA 4CFFA 1QPEA 2YDIA 4F0FA 2YIYA 4FSRA 4TT7A 5DEYA 4OAUC 4FT3A 5EDQA 3WYYA 5FP5A 2OSCA 3KN5A 3KQ7A 4M69B 4M97A 5JFVA 4NT4A 5F20A 4YJPA 5H9BA 3RVGA 3VS3A 3FC1X 1Q8ZA 3DB6A 5AUTA 2E9VA 3HV7A 4KAOA 3V8TA 1PF8A 1ZAOA 3QTRA 4QP9A 3G6HA 3PVGA 4GVAA 1PJKA 4ZXTA 3SA0A 5CANA 1KV1A 2Z7LA 3JUHA 3LHJA 3EL8A 4Y72A 1G8SA 5AUYA 4K1BA 4MAOA 4FZDB 3PJ2A 5A4LA 1OPJA 1Q4LA 5CXZA 3A4OX 4NEUA 5AV0A 3A99A 2VTPA 4H05A 4ZY6A 4APCA 3ORXA 1JBPE 3FBVA 2GNJA 2HZ0A 5DR6A 3V5WA 3PIXA 3BHYA 5HQ0A 5TF9A 3KGAA 4DEDA 3G5DA 3AGMA 1ZOHA 4Z9LA 2WFYA 3ET7A 4ITHA 5LCKA 5DNRA 5M4CA 4GCJA 3UMWA 1CDKA 4IVAA 4DG0E 3U9CA 3EQRA 4MBJA 3OT8A 3ZO4A 3IW5A 4CCUA 3KF7A 4YNEA 2PK9A 3SOAA 3SXRA 3QHRA 2NPQA 1WBNA 4NWMA 2SRCA 3SDJA 4YU2A 3ORLA 3BCEA 4S34A 5AP6A 3GFEA 4IAKA 2JGZA 4ZLZA 2H96A 4LOOA 3PJ3A 4YJTA 2QU5A 4RJ4A 4DLIA 4CFXA 2CKQA 4LGGA 3VUMA 4BIEA 4DH7A 3HECA 4JOAA 3IG7A 2VTNA 3FMKA 2F4JA 2PUPA 3CBLA 2RFDA 4FL2A 4MF0A 1BI7A 4W4XA 4QMSA 2JAVA 4FKOA 5AV3A 1OL2A 4QPMA 3F7ZA 4UMPA 1MUOA 3AD5A 3R2BA 3N4TA 3AT3A 3LXNA 3AXWA 2JIIA 3R8VA 3BGPA 2Z7RA 3FC2A 3R1NA 4FV9A 3UG1A 1Q3WA 2WOUA 4I23A 4U79A 4JAJA 4WRSA 4IEBA 2ZM1A 2CCHA 1XH5A 2ITXA 4M69A 4Q9SA 4O91A 3GQIA 1SNXA 3B2TA 1Y6BA 2YHVA 4DCEA 4U5JA 5J1WA 2KULA 5HX6A 2ZM4A 5I9UA 4QTAA 3R9HA 4ID7A 4O7LA 1G5SA 2O3PA 4PTCA 3QLFA 5L6OA 2OJ9A 4D2VA 2W7XA 2OI4X 4BR3A 3PSCA 2ERZE 3GCPA 2PE1A 2XEZA 4RIYB 5FRIA 4A4XA 3FI8A 3A61A 3DA6A 4WNPA 5AR3A 3QX2A 4GKIA 3EN6A 1ZY5A 5CEPA 4KA3A 4DF3A 4MXCA 4L43A 1WBTA 4H58A 1YXVA 3AC5A 2PVNA 2UVXA 1JOWB 4NKAA 2ZDTA 4KKHA 4GKHA 3W32A 1T46A 3VUKA 2G1TA 2H9VA 3PXRA 3ZRLA 3I5NA 3OFMA 1P2AA 4DH3A 4BBFA 2EVAA 3UE4A 4E26A 4Z55A 3TWJA 5E1SA 2PMLX 4E4XA 3CD3A 3GC7A 3T3VA 3FI3A 3VULA 4BI1A 2VTLA 4M15A 5EH0A 2XYUA 3R21A 4NW6A 4I5HA 4PUZA 2A2AA 2GQRA 2XCKA 4BICA 4A9TA 4TZRA 3ZSHA 4E8AA 4M14A 3R7IA 3ANRA 4Y83A 3RJCA 4NJ3A 3R9DA 5BQ0A 3KU2A 2R9SA 4FT9A 3KK9A 3OEFX 2C5VA 5M08A 5K4JA 5TT7A 2VU3A 2HWOA 1L3RE 1Q61A 1OPKA 5CLPA 3SRVB 2J0MB 3ZO3A 5KNJA 4RVMA 3EQGA 2X8DA 3BYMA 5AIRA 3C4CA 3FLYA 1OL1A 1QMZA 2LGCA 2A1AB 2PUUA 2GNLA 3GOKA 1FVVA 3OD6X 5L8JA 2PZRA 5J1VA 1XHAA 3NNWA 4O7SA 1E1XA 5EI8A 2VO6A 4F0IA 5A9UA 4ZEGA 3P7CA 5F94A 5LMKA 2VWZA 1IA9A 4PWNA 2R7IA 3HEGA 5GZAA 4EH6A 5EW8A 3ZBFA 3H30A 1UWHA 4I5CA 1DS5A 5DLSA 3NEWA 4FKUA 3S2PA 4EKKA 3NNUA 1NVSA 4FEXA 3FV8A 3PXQA 5LARA 2ACXA 5BNJA 4N0SA 4TPTA 3E62A 5IEXA 3PUPA 5CVHA 3NUUA 2W1CA 2V7AA 2HAKA 5HEZA 1J7UA 2CKOA 2BDJA 4LYNA 2NRUA 2XK9A 4ZJIA 4DEAA 2YA9A 3UZTA 2BIKB 3N4UA 4XYFA 4ARKA 2YZAA 3QX4A 5BVWA 3QQGA 3UTOA 4ACGA 3ACJA 3ORPA 4J99A 3UVRA 3ATSA 3OS3A 3QALE 5D7AA 4EYJA 3MPMA 4GVJA 5FM3A 5HVJA 3QUEA 4G5PA 4XG6A 4AZTA 4X0MA 4XNEA 4CMTA 3DDPA 3FUPA 5LXMA 2IW6A 1Z9XA 1YHWA 1QPCA 4BCKA 4BFMA 3DXQA 1IASA 3HAMA 2JC6A 2R3FA 3DT1A 2OGVA 4RG0A 2WU6A 2BR1A 3BWFA 4NU1A 4D4SA 1IAHA 2CGUA 3FSFA 5A4QA 5IQGA 2GNFA 2XNEA 4FV3A 2W5AA 3F6XA 3QQLA 1KOBA 3P1AA 4TYGA 3OY1A 4IX4A 2BHEA 2FSOX 4RIWB 1Q24A 4C33A 3SQQA 4X2JA 2WPAA 5CVFA 5IQFA 2XNOA 3IECA 5KMNA 3MVHA 3ALOA 3O7LB 2FYSA 3R30A 3L9MA 4RX8A 2R5TA 4YZMA 1H0WA 1Y8YA 3QUDA 4QP1A 4O7VA 3O7LD 3OZ6A 5EM7A 4UMQA 2YLEA 4DBNA 3KREA 4G6LA 4F7LA 5E91A 2NP8A 2VAGA 1XBBA 4EI4A 5CASA 5A54A 4CTCA 3BV2A 2H8HA 3ZBXA 3UDBA 4F1OA 2A19B 2ETKA 2C47A 5C1QB 3PXKA 3GU7A 3HP5A 2XJ0A 3MPAA 4Z7GA 5C8KA 5IEVA 2BZHB 4XP2A 4QMWA 3KULA 4JG8A 4MNEB 2EXEA 4CMUA 3FZPA 4FSNA 3KMWA 5I9XA 3V5JA 4MWIA 4FV6A 4QP3A 2WMVA 5CSPA 3LXKA 5DR9A 3QZGA 3SV0A 5EOBA 5JEBA 5AP0A 3IONA 2CKPA 1BL6A 4H3QA 3TKHA 2QO9A 3F3ZA 4JDIA 4AW2A 4ZTQA 4GFOA 5AA8A 4JQ7A 1ZZ2A 2OF2A 2XA4A 2QOOA 4ZSGA 2QO7A 1PMVA 3CS9A 1Q8TA 3ACKA 2QOCA 1PXJA 2R3QA 3LFNA 2FGIA 3UOLA 4MQ2A 5F95A 3DKCA 4C3FA 2J6MA 4J95A 3E8DA 2PTKA 4DA5A 3COMA 3OF0A 5FDXA 4D4YA 2F49A 3PE2A 2FUMA 2UZVA 5AR8A 3BHHA 4I41A 2XM8A 4NH1A 3OT3A 4FICA 4BTMA 4O7RA 4LV8A 4AT3A 1JSTA 1ATPE 5GJFA 5BMMA 1W98A 1OITA 3QL8A 5CSWA 1PMUA 3E8CA 5KMKA 4EHGA 2HK5A 2EXMA 2DUVA 1K9AA 2UVZA 2QOLA 5EI2A 4HVSA 5JZJA 2R3JA 3VS5A 5LVMA 3DJ5A 3LKMA 4XEYA 4RIWA 4B8MA 4JG6A 2ITWA 2C5YA 3Q52A 4GJ3A 2IVTA 3SGCA 3AD6A 3IGOA 2AC5A 5D9HA 4CFNA 1KE7A 2JIUA 2YLFA 3BGQA 4W8DA 3ETAA 5DFPA 4GUEA 4TYJA 4NL0A 4YJRA 4X21A 4C4FA 5CAUA 3PG3A 4KIOA 3SRVA 4EEVA 2V5QA 1Z5MA 4IVCA 4W9XA 4XBRA 1OMWA 4BCPA 4UALA 2JITA 4YTHA 4D9UA 3TI1A 4C4HA 3ORIA 2REIA 3RP9A 4W4VA 5FLFA 4AFEA 2OWBA 4ZLYA 3Q32A 3P5KA 4O38A 3FYKX 4AA0A 4OTDA 4PPBA 2QI8A 3EQHA 2R3PA 4LRJA 2WOTA 1T45A 4CXAA 4P7EA 2ZMDA 2UW3A 3A2CA 4OT5A 3KN6A 3PZEA 4ZLOA 1BUHA 1V0OA 3WF5A 2ITUA 5HBHA 5AAEA 1K3AA 2XKEA 3H3CA 3NUSA 4YJNA 3V6RA 4B0GA 1U46A 3C13A 4HVIA 4MF1A 5JMSA 3A7IA 4L45A 2VZ6A 3D83A 4TYHA 1IG1A 3IDCA 3TTJA 5A6OA 5AFVA 4BY9E 2XM9A 4QMPA 3VWAA 4FX3A 1NXKA 5L3AA 3BU5A 3EZVA 4KKEA 5IDPA 3UIMA 1DI9A 3F82A 4EKLA 2R2PA 4CKRA 4OTRA 4MTAA 3JVRA 4X3FA 3LCDA 2F7XE 4O0SA 4O2PA 4XP3A 3RGFA 5HO8A 5FXRA 3SW7A 2BKKA 4DE4A 4I92A 2OFVA 4ZTNA 4JIKA 1H0VA 2O0UA 4BIBA 1SZMA 3P79A 4F99A 4O2ZA 1ZMWA 3ATTA 3HLLA 3LQ3A 3NYOA 4YPDA 3MA3A 4HZRA 3V8WA 3ZM9A 5IQEA 2JEDA 3PVUA 4B99A 2W1FA 4UX9A 2UW6A 3DU8A 3QTWA 4JXFA 3QRTA 3WZEA 4ZP5A 3MFRA 4RJ6A 4EORA 3DS6A 3LCKA 4YO6A 3TV6A 4H36A 4ANQA 5BYYA 4D4VA 3RAWA 5IISA 4FTNA 2X7OA 3F5XA 5IMXA 1O6LA 2WTKB 2IVVA 3OVVA 3FZTA 3KXHA 5GIPE 5FEEA 2VTMA 2VO3A 2W4KA 4QMYA 4DT8A 1GOLA 5EHOA 4XG8A 4QPSA 2IVSA 2WQMA 4FTLA 4OTWA 4QRCA 1F5QA 4JR7A 4HCUA 2HYYA 1U54B 2QLQA 3QTXA 4Y8DA 3TACA 3CXWA 4PDYA 2BAQA 4MQ1A 4KRCA 5IUIA 5DHJA 4FBXA 3F88A 5DPVA 4HVDA 3WZDA 3ZUUA 2R3GA 3EJ1A 4LUEA 3MIAA 2X4FA 5CNNA 4WUNA 3O2MA 2PVJA 4C37A 1ZY4A 3ROCA 4BCHA 1OM1A 4BIDA 3TNQB 3BI6A 3CLYA 4EOLA 5M51A 3FMMA 1CMKE 2AC3A 2HWPA 2C6DA 1A06A 3GBZA 2OH0E 4M0ZA 2HZNA 3ZLYA 1Q97A 3AQVA 3Q5ZA 3QWJA 4BCQA 5FEQA 3CJGA 5LJJA 2X81A 4MD7E 5BYZA 4A06A 1NA7A 5E8UA 1R3CA 5KHWA 4MCVA 4NJDA 4M84A 5EDRA 2ITQA 4B9DA 2OU7A 2PVMA 4QYYA 3OROA 5IH4A 2XP2A 3K3IA 3VIDA 4E73A 4U44A 3E8NA 4ACHA 2RGPA 2X9FA 5EYCA 4C0TA 3OC1A 2PHKA 5CF8A 1PXPA 3N51A 1OUKA 3C50A 3EYHA 3FMEA 4QP8A 2W17A 4AOJA 5AV2A 1FINA 3AC3A 3EQFA 3OCGA 1UWJA 5HVYA 2BFYA 5CF4A 4B7TA 2OICA 3CY2A 1WCCA 4A9SA 2ITOA 2YAKA 3LJ1A 4MNEA 4X2FA 2WO6A 4F7SA 3VS6A 4BGHA 2X6DA 5IQCA 4NW5A 1O9UA 4OTHA 4BN1A 4FTOA 4IAFA 3VUTA 2R3RA 5LMAA 1JKSA 3S4QA 4EBVA 3UC3A 2YFXA 4GEOA 5JGBA 2V22A 3WIGA 5HESA 3NYXA 4W8EA 4D2TA 4EH8A 2GFCA 3UP2A 2FO0A 2GHLA 5L8LA 2GS6A 1OI9A 3OY3A 2HY81 3F3WA 5ANIA 5IQHA 2C69A 5DG5A 3MFUA 4H39A 3I79A 3OTVA 4QOXA 1CSNA 5AAFA 4DFBA 5JQ8A 3TCPA 4QMVA 4CD0A 3W1FA 3D4QA 3MBLA 3UQCA 4N57A 4IE9A 4FIFA 4RX7A 1TQIA 1KE9A 4XG4A 4EC9A 2YEXA 5C27A 4S33A 2G9XA 4BBMA 3R7VA 4KINA 3EQCA 3VBVA 3ZOSA 2VO7A 1Q5KA 1AQ1A 3CGOA 3NYVA 3QQFA 4C7TA 1OL5A 3O51A 3VS1A 2WMRA 2FVDA 3VJNA 5CEOA 5D11A 5HE2A 3H10A 2QR7A 1H1RA 1XBCA 2EB3A 1LPUA 4K0YA 2W05A 4CQGA 2BAJA 2WTCA 3FZ1A 4CKJA 4L7FA 1H1PA 2WMSA 4K77A 5K0XA 3DCVA 5M56A 2W9ZB 2W06A 2EB2A 5FD2A 5IA3A 4FT7A 5G1XA 2EWAA 4WSQA 4XMOA 3TKIA 3KVWA 2FSTX 4LOQA 1XQZA 3W8QA 3AOXA 3BRBA 3DZQA 1VYZA 3VBYA 4YJSA 2HELA 4FTUA 5AX9A 5FG8A 4P4CA 4FV4A 4EHEA 1DI8A 3R1SA 4FTJA 3H9OA 3NIEA 4DT9A 1VYWA 2WTKC 1OB3A 4RFZA 1ZYJA 3H0ZA 3PY3A 4QMXA 4KKGA 1ZOEA 2WTIA 3LMGA 3UYTA 3K2LA 2EU9A 2C3IB 2GCDA 4IAZA 4R7HA 5HLWA 2OJIA 5EOLA 4PMPA 3R22A 2RKUA 3VRZA 2GSFA 3FY0A 1JKKA 4GL9A 4WIHA 1OUYA 4IX6A 3LFCA 4XBUA 2WIPA 4Y85A 4YBKA 3VN9A 3NW6A 4FEQA 2GTNA 4ZJJA 4D9TA 4O21A 3CTQA 3QTQA 3A7GA 5D12A 4U7ZA 3WF9A 2B52A 4O0YA 2XKFA 2WD1A 2J0JA 2XK7A 5AUZA 1G8AA 1B6CB 4V05A 2BALA 2VTTA 4R6VA 3I0OA 4D28A 4DCAA 2P3GX 3RI1A 1W82A 3F61A 4ZAUA 5HIEA 1YI3A 3PIYA 1H07A 3KRRA 2UZEA 4QQ5A 4TYHB 4UWBA 1XH7A 2OK1A 5BVKA 2OKRA 3R7EA 3TNIA 3H9RA 2QOHA 3RHKA 2YWVA 5FXSA 4PDOA 5GIOE 3QYWA 3TG1A 4AAAA 3ID6C 2A4LA 4AZSA
chains in the Genus database with same CATH superfamily
4TWOA 5IUGA 3BU6A 4AF3A 4HVHA 4YLLA 5C03A 2C5OA 3C4XA 4HGTA 3PPZA 2JBOA 4AZFA 2PE0A 3IDPA 5CSHA 1KOAA 3G51A 3C7QA 1H24A 2BAKA 2RG6A 4RJ3A 5K9IA 5I9VA 2JD5A 2F7EE 3E5AA 4UMUA 2XIXA 1ZRZA 2QOKA 2R0UA 3FI4A 3G2FA 4U97A 5HCYA 3CPCA 4LOPA 4UY9A 2B7AA 2BRHA 3IDBA 4E4NA 5ETCA 3Q9ZA 4K6ZA 1SM2A 4RIOA 3UJGA 4WNKA 1E9HA 4ANMA 3A4PA 4E20A 1R78A 3ELJA 3PJ1A 3G90X 3U51A 3A8WA 4C59A 1Q8UA 5JQ5A 3OCTA 4RRVA 3BQCA 4YZDA 1UKIA 5E4HA 4K11A 2ESMA 5AR7A 2IW8A 1ND4A 4FV1A 4CSVA 2YCFA 3QD4A 1JLUE 3SVVA 2ITZA 4D4RA 5KKRC 2XJ1A 4BYJA 1B39A 4FV2A 2B0QA 3FZOA 4ERWA 1U5QA 4O0WA 4QT1A 5DYJA 2C4GA 3FXWA 1BKXA 2V7OA 3L8VA 3Q4TA 4ITIA 4RVTA 3R8UA 2AUHA 1QCFA 3PYYA 3R8MA 1YI6A 3CR0A 2PSQA 4DN5A 4EH9A 3DNDA 4RSSA 5CI7A 4ALVA 4ZTHA 2X39A 3OWKA 1H25A 1LEZA 5IDNA 2C0IA 4GYIA 3WOWA 3ULZA 2Z60A 2W1HA 3TDWA 4JX3A 4KABA 5J9ZA 1IR3A 3LCTA 4HCTA 5DRDA 2Y7JA 3CP9A 2A0CX 3FKOA 3EZRA 3GT8A 5HO6A 5IA5A 3ZUVA 3AKLA 3V5QA 2C30A 3ZH8A 3NDMA 2PZ5A 3II5A 5KCVA 3C0HA 4CV8A 3W0SA 1FVTA 4PTEA 3QKLA 3JY0A 3BKBA 2YITA 1W84A 3KF4A 4PMTA 4PQNA 2YM8A 1FGKA 1SMHA 3EHAA 4HGLA 4AAYA 2C6MA 3W2OA 5CEMA 3MFTA 4FVQA 4IADA 1URCA 1XJDA 4IAAA 2HIWA 4RJ5A 5EW9A 3RPOA 3SHEA 3VUDA 3HMIA 3POOA 5J9YA 1XH6A 3LIJA 4D1ZA 2JIVA 4XV1A 4TRLA 4GUBA 4WSYA 5CVGA 5BX0A 3S95A 3DXPA 4Y95A 1XWSA 4RVKA 3CGFA 4B8LA 2X7GA 2FSMX 2G2HA 3CTHA 3GQLA 3VW8A 2VN9A 4XV3A 4A4LA 4CLIA 3UOJA 3IPHA 4UEUA 2IZRA 4KS8A 1UA2A 1MQ4A 5AWMA 4YHTA 4DG2E 1YWRA 1KSWA 1UNGA 4YSMA 1WBOA 2QCSA 1QL6A 2ZJWA 1IAJA 4ZZNA 4JL9A 3CKWA 3L9LA 5H8BA 1R39A 4OTIA 3OW4A 3D5VA 4R1YA 4R3PA 3UQFA 3VONA 3LCSA 4BI0A 3KK8A 3C4ZA 4O27B 1SYKA 2OXYA 2CNQA 4HYUA 3CPBA 4G5JA 1JQHA 4AXAA 4IXPA 3GU5A 4DHZA 4ZSJA 3DBDA 4BDCA 4EYMA 3ORKA 4F63A 1ZYDA 2OJJA 4RZWA 4BGGA 4MBIA 1Y91A 4FOBA 4JVGA 3RALA 4F0GA 5KMMA 3I0QA 4RBLA 3ZDUA 4L44A 1MRUA 1RDQE 3GU6A 4WNMA 5E1EA 2ONLA 4F65A 4KIKB 4HOKA 4J96A 4O81A 4Z3VA 4JRVA 3UYSA 3VBXA 3QQKA 3ZZEA 4GFGA 3E63A 3HYHA 1MP8A 3HMPA 2IG7A 4IJPA 3VS0A 4RT7A 2XBAA 2HW7A 2ITNA 3LM0A 2JDVA 3LXLA 1H28A 4TWCA 5TKDA 4E6QA 2PUNA 3WF8A 4DGMA 3FHRA 4RC2A 3V5PA 4E3CA 5I3RA 3T3UA 4MXZA 4R1VA 4S32A 3IS5A 4QP4A 4TYEA 3OWLA 3BLRA 3R02A 3PP1A 4E5AX 4L3JA 1UV5A 1YDRE 3EFLA 4N6YA 4FSMA 3VNTA 3G6GA 3RAKA 3CC6A 4QMOA 3ZDIA 3LFBA 2WMBA 4YZNA 3RMFA 5EFQA 4RJ8A 3O50A 4NM7A 3W33A 2OJGA 3DBEA 3PXYA 4Q5EA 1A9UA 4IM0A 5E8VA 5J5TA 5HU3A 5JT2A 4I0RA 1UU3A 2GU8A 3ZFYA 3OBGA 4FKVA 4NM3A 4AOIA 5ETFA 4QDEA 1ZMUA 2UZDA 1G3NA 3CQEA 5LCJA 4V0GA 3PVBA 4RQKA 3OTUA 3HNGA 4ASXA 5HNGA 5IQIA 2UV2A 4WA9A 1OKVA 3EYGA 4YZBA 3UO6A 3W0MA 1OVEA 1NT2A 3I5ZA 3DLSA 4KBKA 4EOPA 1H8FA 3IOKA 4EOJA 2GS7A 4MEDA 4EJNA 4QO9A 5HI2A 4F9YA 1YXXA 2W1DA 4XG9A 3T8OA 1JKTA 1BLXA 2IN6A 3OMVA 3MFSA 4XH6A 1K2PA 3RAIA 3V6SA 1TVOA 2B9JA 2Y9QA 3ZC6A 3Q6UA 2LAVA 1PXNA 3AC1A 2X7FA 3PIZA 3SOCA 1U59A 4BRXA 1PW2A 4NCTC 4U45A 2X0GA 2ZDUA 3RPSA 3ORNA 3GFWA 3IK3A 3QD3A 3TNHA 4MUQA 3K3JA 2HZ4A 4FUXA 3BV3A 3HMNA 4N70A 5H3QA 5KZIA 3ZXTA 3BE9A 2GNGA 2PVRA 4XOZA 2VWUA 3ZSGA 2GQGA 4MWHA 4O1PA 4GK3A 3QFVA 3V8SA 4BKYA 2QO2A 1X8BA 2YN8A 4NCTA 2Y4IB 2HXQA 1WVYA 5M53A 4NIFA 1M17A 1PKDA 2CSNA 3C4WA 4RA4A 4DGGA 4KIPA 2YWPA 4ENXA 1OKYA 2WTJA 3LM5A 5DMZA 3GB2A 3EB0A 5KMOA 5AAGA 3HV4A 4P2KA 2GPHA 3QAME 5M44A 1YQJA 1WBPA 5EW3A 3GXLA 3PP0A 4UWYA 2JDOA 4E93A 3R71A 4EWHA 3TKUA 5JGDA 4NK9A 4QD6A 4AQKA 3EH9A 4DDGA 4FC0A 4MNFA 3ZTXA 5LQFA 5H2UA 1YOLA 4HNFA 5E8SA 5TOZA 1I44A 3BEGA 4UWCA 4OBOA 4MVFA 1UNHA 1XH8A 3FAAA 4J7BA 2J5FA 3TV4A 4AG8A 4TYIA 3GUBA 4F7JA 1JNKA 2WQNA 1OIYA 3E92A 5DRBA 3W8LA 4BDDA 4IX3A 1Y6AA 4HW7A 4R7BA 4WG5A 4KWPA 3NCZA 3P9JA 4PL5A 4OTFA 1OPLA 3BEAA 3OG7A 5FEDA 3BIZA 3EQPA 5DA3A 3NUPA 4CT2A 4BB4A 4YP8A 3UBDA 1AGWA 3DBCA 4KBCA 3JS2A 2XARA 3UDTA 3R6XA 3FYJX 4I5MA 3HRBA 5BV3A 5DWRA 3MW1A 4LUDA 4GU6A 4OAVB 3PFYA 3EQDA 5FTGA 4K9YA 4QP2A 5JRSA 3V3VA 2QG7A 5FGKA 1Q8WA 1VJYA 5A3XA 2JKKA 1DAYA 3QZHA 3ZZWA 5H8GA 2J5EA 4BCOA 3WYXA 5AEPA 3DBQA 4CKIA 4AGDA 5CALA 3GCQA 4FMQA 3BX5A 2WKMA 4F6SA 3NS9A 4AP7A 4R5SA 3GEQA 4GT3A 3UP7A 3WE8A 1H1QA 3NGAA 3MVLA 4FK6A 1P5EA 4DC2A 4FOCA 4IHPA 5I9ZA 2BDWA 4IMYA 4TWPA 4A07A 3DQXA 4WG4A 4LMUA 4F6WA 5IEYA 3G0EA 4CFUA 3LMIA 2XS0A 2YACA 5ANKA 4AW0A 2C5XA 4DH8A 3VBQA 1OZ1A 4IWQA 4KNBA 1VEBA 3LE6A 5DE2A 3U4UA 1NVRA 3QXOA 3DPKA 1Q99A 3LFEA 2BILB 3D15A 4FR4A 4BZDA 2ZV2A 4O4BB 1VZOA 3SX9A 2J4ZA 2OIBA 4RA5A 2C0OA 4G6NA 5BVOA 4IB3A 4PV0A 3VW6A 3MDYA 3CY3A 4GIIA 1KE5A 3OEZA 4YPSA 4FZ6A 4CEGA 2Y6OA 5FBOA 4FEUA 4ZMFA 3ZLXA 5HG7A 5ETIA 2B9FA 5K4IA 3HUBA 3Q5IA 3F5UA 4FTTA 3QXPA 4BTFA 4YUQA 5FQDC 5ANOA 2WMTA 3QCXA 4PNKA 4G3GA 3EWHA 5HHWA 4ZS0A 4GG7A 2OFUA 1B38A 2R64A 1JVPP 3IQ7A 4ANBA 4YSJA 2WNTA 3NNXA 3POZA 3U9NA 1PKGA 4ACMA 1OIUA 4GK4A 5IQBA 3Q4ZA 3A7FA 1WAKA 4AN2A 1XO2B 4QYEA 4PP9A 4Z16A 4XS2A 3IW8A 5HG5A 3WI6A 3C5UA 4BTKA 4BWPA 3K5VA 2IZSA 3P23A 3P78A 4O0RA 5CU6A 3AMYA 2UW5A 3H9FA 3B2WA 4NZWB 1JKLA 2VGPA 3UG2A 4BF2A 3UDZA 3PWYA 3R9OA 4A4OA 5CENA 1A48A 3GVUA 4MXYA 3IO7A 3FWQA 4DHFA 2OZOA 3LJ0A 3MTLA 3ORTA 2QHNA 3NYNA 3I6UA 3QHWA 4FIGA 5F9EA 3TNPC 1O6KA 4U0IA 5BUJA 4O0VA 3AT4A 4BDAA 2WQOA 1W0XC 3OXZA 3ZLWA 1YOMA 3QZFA 5DVRA 3PA3A 3VF9A 3F3UA 4FSYA 3KCFA 4M0YA 4CZYB 5AR5A 3KEXA 2BKZA 4FL1A 4AXCA 4HJOA 4C62A 5AX3A 3O17A 3QTIA 1STCE 4J52A 3ZHPC 4EBWA 4MYGA 2C6TA 2BZJA 2Y6MA 3NIZA 3G0FA 4FIHA 5E7RA 4DFYA 5HIDA 4AGUA 4WBOA 1J91A 3OW3A 1APME 2PU8A 3FE3A 3SG9A 4QYFA 2HENA 4L52A 3NRMA 3QC4A 2Z02A 4HCVA 4IBMA 4R77A 1M7NA 5B2KA 5AR4A 3ZM4A 2E9UA 2BZIB 4EZ3A 3RTPA 5KO1A 3QLGA 1CKIA 4NYEA 2CGVA 4JG7A 4GT4A 4C2VA 4D0WA 2PYWA 3MH1A 5CY3A 4ZJVA 2GFSA 3ORMA 2YABA 1CKJA 3ZFMA 5ITAA 3UNJA 4ZSEA 2IW9A 2XEYA 4LM5A 2CHLA 3HP2A 4FKWA 3O8TA 4GSBA 4JDHA 4TNDA 3TN8A 4XJ0A 4YC3A 3RCJA 3RPYA 3U4WA 3BHVA 3LLTA 4BHNA 3FMNA 3G9NA 3QWKA 5K5XA 3B8RA 2YM7A 4IVDA 3TMOA 3JVSA 3NVMB 1F3MC 2W4JA 3KMUA 1RE8A 2CJMA 5KMJA 5JFXA 1CTPE 4AQCA 4G6OA 1DM2A 5LVNA 3AC4A 3QKMA 2OLCA 5IQAA 3LZBA 3TZ7A 3R1QA 3LOKA 3UOHA 1GJOA 5DH3A 3MH3A 2OXDA 3OUNB 5E90A 3QGWA 2IO6A 4ZSLA 4YTFA 3ZONA 4FNZA 4UV0A 4EK3A 1NVQA 3WZJA 4I3ZA 4DFXE 3PA5A 4BCFA 4ZMEA 4USEA 2UW8A 1YHSA 2YAAA 4II5A 4Z7HA 3VS2A 1PYXA 4BCMA 5EKNA 5IU2A 4GS6A 3DJ7A 3ITZA 4BVUA 3NAXA 2UZOA 4G17A 4AZEA 2W9FB 2Z8CA 3ZRMA 4APPA 5I9WA 2Z7QA 4FEWA 3N4VA 4M67A 4PMSA 4CT1A 3C5IA 3V51A 4BWXA 5L2WA 4AXFA 4C35A 2J9MA 4C2WA 3A60A 3ZC5A 5K5NA 1QPJA 2O65A 4ACDA 2PUIA 2P2IA 3KXNA 1WBVA 4YBJA 3I6WA 4C4EA 4FI1A 2G15A 3U87A 2FSLX 2BZKB 1L8TA 2PULA 3MY0A 3RPVA 1SVGA 5B7VA 4TXCA 4B6LA 4FG9A 3F9NA 4I6FA 2UZLA 4YLKA 3R01A 3AKJA 3GI3A 3HA6A 2BRNA 5LWMA 3QU0A 4CFWA 5E8TA 3CQWA 4PX6A 2CGWA 1GZOA 4FKLA 1ZYCA 3PPJA 4ZIMA 4FJVA 2XVDA 5JKGA 2YIRA 2WU7A 4OTPA 1WVWA 3QKKA 3CD8A 2Q83A 1XH9A 4E4LA 4AA4A 4DTKA 4YO4A 2VWWA 5IUHA 4K8AA 4Y5HA 4J1RA 4FKIA 4EH2A 4AXDA 2QODA 3GC8A 4MK0A 2QG5A 3NAYA 4BDEA 5HCXA 4CG9A 2J90A 5EK7A 2C6IA 4AFJA 3FMHA 5CAOA 2O63A 2R3MA 4NTSA 3FSKA 4BTJA 1WVXA 5ACBC 4M7IA 3D7ZA 3WARA 4IDVA 1UU7A 1OL6A 2J2IB 4AGWA 5KKRB 5AP4A 4B4LA 4EK4A 4JT3A 2BTRA 4G9CA 4PP7A 4HGEA 4ZSAA 3ALNA 3KA0A 3DJ6A 4PL4A 3NUYA 4AZWA 3LQ5A 2Y8OA 1OGUA 3R63A 4USDA 1OKZA 4C3PA 5C8MA 1M7QA 2VWIA 4FA2A 5F4NA 4XUFA 4BCJA 2XANA 5CI6A 5JSMA 4F7NA 2HY0A 4XLVA 1OKWA 2WTWA 3VUHA 4IZYA 3TT0A 5CXHA 4DAWA 4I6LA 2G2IA 5JH6A 3VJOA 1V1KA 4WG3A 5E8ZA 3R8PA 4F4PA 4C4JA 5HGIA 1Y57A 3H0YA 2CMWA 3WZUA 3BLAA 4FSQA 3RWPA 4CTBA 2F2CB 3FQEA 2ETMA 4O83A 4EZ5A 1MQBA 4I93A 3R83A 2PWLA 2OZAA 3DK3A 2QOQA 3F3TA 3AG9A 3PWDA 2XKCA 4G2FA 2RFEA 4JQ8A 2W99B 1W2DA 2R7BA 5FM2A 4YC8A 2XK3A 3W16A 2I0EA 3HVCA 4G3FA 5L6PA 3MB6A 3W10A 5ACKA 3SXFA 5GHVA 3AC8A 3L9PA 2I1MA 3WILA 2XIKA 3DAJA 3ZRKA 4EOIA 3PRIA 5EYKA 4RIYA 4AT4A 4X6RA 4KSQA 5HE0A 4BDIA 1KV2A 3OXTA 3PY1A 3MY5A 4AACA 3RPRA 2EUFB 1ZWSA 4EK6A 5M07A 4YNOA 1YOJA 3DB8A 4EOKA 3GNIB 3NWWA 4BDBA 3K54A 1TQMA 4G16A 3D0EA 4MD8E 2PMOX 1V0BA 1BX6A 4KD1A 3MWUA 2VX3A 4XRJA 4EOSA 5CT0A 1YRPA 2WAJA 4I20A 3D7TB 3R7UA 3QC9A 5AP1A 2J0KA 3HZTA 3O96A 3NVKI 5DI1A 3D2IA 4U41A 3ZEPA 2BRMA 4M8TA 4A9RA 3BLQA 4EQCA 3MI9A 5ANDA 1H1SA 1H4LA 4I0SA 1ZOGA 3PZHA 4ACCA 4ANOA 5T3QA 1PHKA 1OBDA 2ZV7A 4HZSA 4ZTRA 3NUAA 5CU2A 5AUWA 4E6DA 3AC2A 5L4QA 1ERKA 2GS2A 5DT0A 4FZFB 2XIYA 1JAMA 3NUNA 1XBAA 1YXSA 4U42A 3QCSA 4PPCA 1JWHA 4OBPA 3EN5A 4HNIA 3IKAA 4MKCA 4DH1A 5HD4A 5LMKC 3Q6WA 4M68A 1ZLTA 5CAVA 1KE8A 3GU8A 3T9IA 3ZU7A 3E3BX 3E3PA 4HYSA 4QTEA 4CLJA 3BYSA 4JBOA 3W0PA 4F6UA 1YKRA 4Y46A 3OHTA 4ALWA 1XR1A 4I0TA 2J0LA 2I0YA 2YJSA 3OWJA 3Q4UA 4L7SA 3K5UA 3N9XA 5C26A 2B54A 3MPTA 4LDTA 1URWA 4UZDA 4ZZMA 4AE9A 4EH5A 4M3QA 3SLSA 4CNHA 4L01A 2YCRA 2VX1A 3MTFA 2J50A 2W1GA 4I4EA 1H26A 4LQMA 4TY1A 2QVSE 4X2GA 5HBEA 3COHA 2GDOA 5AM7A 5J7BA 5LVOA 1LEWA 3AMBA 4DLJA 2OXXA 1U4DA 2BRGA 4K2RA 3TIZA 4I22A 4DYMA 1ZYSA 5HZNA 2X2MA 4JDJA 1GNGA 4OUCA 4EK5A 4GRBA 1BI8A 3HV5A 3ZMMA 4AW1A 3EFWA 4XG2A 5HOAA 2R3IA 1PXMA 4L46A 4W9WA 1RW8A 5KUPA 5E9EA 2VV9A 3BYUA 3Q96A 4XG7A 4YJQA 5L8KA 3FMDA 5DT4A 4BBEA 3VF8A 2W4OA 4NUSA 4AS0A 4FL3A 2A27A 3BELA 4F64A 4MD9E 4R3CA 3RWQA 5BVFA 3S1HA 4FVRA 4FKPA 5ANEA 3KRLA 2WQBA 1WMKA 3U8WA 4QYHA 3OBJA 3I7BA 2VWBA 2DWBA 5HE3A 3UZRA 4ANLA 4CRLA 3NMUF 5BVNA 4EH4A 4DFNA 2PZPA 3FZSA 2ERKA 5AUVA 4BYIA 4E4MA 5HLNA 5HX8A 3HMMA 2QR8A 2OIDA 1M2RA 5IPJA 4DBXA 4WKQA 3DTCA 5EM6A 3FQSA 3QUPA 2V55A 4I5PA 2YIXA 5C4KA 2C3LA 3F5GA 4G1WA 4GG5A 3F7WA 4DGLC 4XRLA 2VTHA 3MGYA 3MJ2A 4OLIA 3RZBA 3SAYA 3DAKA 5HG8A 2Y4PA 4E6CA 4UN0C 5I5ZA 4KSPA 4A9UA 5IG1A 1J7LA 3JY9A 2OIQA 5L2IA 2EXCX 5GINE 2VTSA 2UZNA 3F3VA 5ANJA 5CQUA 3PJ8A 3KIOC 4LMNA 2R3HA 4FKTA 4FKSA 4QTDA 1WBWA 2JFMA 2PY3A 3QRUA 2E9NA 4XV9A 2HZIA 2VTOA 5G6VA 5J95A 3ZS5A 4O82A 4QEBA 3GC0A 3R9NA 2YDJA 5AP5A 3R8ZA 2GNHA 2R3NA 2Q0NA 2QOIA 2WELA 4QPAA 4DEEA 3KXXA 4TNBA 3NPCA 4U3YA 4XHKB 4X3FC 5BPYA 2YERA 4USFA 4QNYA 3P86A 4U6RA 5J9LA 4CGAA 4CYJA 5EQYA 4UYAA 1MRYA 2WZJA 3D2KA 1KWPA 1GZNA 1ZARA 3EFKA 4UMTA 3F5PA 4H3BA 4MXOA 4DG3E 5C01A 4EHVA 4F1TA 4IAIA 5CU3A 5EQPA 4DFUA 4DH5A 1FQ1B 2I40A 4CFMA 1IEPA 2XIZA 2XK4A 3BBTB 4WUAA 1GAGA 3VBTA 4C34A 3FLZA 3HL7A 4EUTA 4Q5HA 4WBBB 4FNWA 4GW8A 2WTDA 3ULIA 3R1YA 2BROA 4RLKA 5JK3A 4TW9A 5EG3A 4YTCA 3G15A 2VWVA 3RHXA 2ZMCA 3EIDA 3LPBA 2ZYBA 3FXXA 4N6ZA 4QNAA 4I1ZA 3MIYA 4M13A 4ZOGA 2VWYA 3L9NA 4ZTSA 3TUDA 1KE6A 4YZCA 4QMNA 1YWVA 3CQUA 1ST0A 3PG1A 4FIJA 3AD4A 3QA0A 4DFLA 3BHTA 2I7QA 3NCGA 5JRQA 3MN3A 4FKQA 1YDTE 5HCZA 4CCBA 5HO7A 2VGOA 3UPZA 1HCLA 2QNJA 2JLDA 2PVKA 4QMUA 2CN5A 2C3JA 4W4YA 4QYGA 1SVHA 4AN9A 4NIFB 3PPKA 4I24A 3F66A 4M66A 4X3JA 3LFDA 3UC4A 2XB7A 1LR4A 5FXQA 1H08A 2ZFYA 3KL8A 1CM8A 3RAHA 2P33A 4QQTA 5I0BA 2W96B 3P7AA 1P14A 3EFJA 3DV3A 4JRNA 3F2AA 3CIKA 4CRSA 2YISA 4PF4A 3AMAA 3R00A 1FBNA 2YIWA 3UO4A 3BBWA 5M57A 1W7HA 3L8SA 3RM6A 3UQGA 5EM5A 4S31A 1YWNA 3MJ1A 4TL0A 5A6NA 1PY5A 5B0XA 3C4EA 5M4UA 3AKKA 2IJMA 2QLUA 4FGRA 4PY1A 2W5BA 4OT6A 4YGAA 5HTIA 3P0MA 1Q3DA 4IANA 4IZ5A 4HPUE 4L42A 5IA1A 5I4NA 4FV0A 4RWKA 3WF6A 2NYAA 4IVBA 1WFCA 2X1NA 2XIRA 3TIYA 3OWPA 3ERKA 3PA4A 5EYMA 3D7TA 4I6HA 5LOHA 3PLAE 4V04A 3O8UA 3DKGA 4D0XA 3FLNC 3SW4A 2QQ7A 3DBFA 4PMMA 2AYPA 2QC6A 4ZK5A 4O7ZA 4QP6A 4KBAA 4M12A 3BGZA 3TTIA 5E92A 2YZLA 5T6KA 4A9YA 4BDKA 3PSDA 3KRXA 3HDMA 2GTMA 2P0CA 5HLPA 3RNIA 1E1VA 1HCKA 2YJRA 5L6WL 4TTHB 3ENHA 3TNWA 4BDFA 2UW0A 3KRJA 3DGKA 2PZYA 3R2YA 2C3KA 4QTBA 3DY7A 1WZYA 3PFQA 4EQMA 5HNIX 4EJ7A 3GENA 5DIAA 1FMKA 1REJA 5KE0A 3WIKA 5IMEA 1MRVA 3OOGA 4FRFA 4OTQA 5IA0A 3NW7A 4FGBA 5EKOA 3TZ8A 2PVYA 3QQUA 2V62A 3VHKA 4E6AA 2RFNA 2XRWA 3ENMA 1ST4A 4I6BA 2XKDA 3Q9WA 4QQJA 3QGYA 4OTGA 1YVJA 5FTOA 2OZAB 3ZO2A 4EZ7A 5CX9A 4EH7A 4IAYA 3QZIA 4ASDA 2F2UA 3HAVA 3COIA 2C1AA 2VNYA 3DFCB 2IZUA 2RSVA 3Q3BA 5AUUA 4F1MA 3F2NA 2XF0A 4ASZA 5HORA 3TDVA 3G33A 5AJQA 4FEVA 4ALUA 2OW3A 4BJJB 2WGJA 3Q9YA 3QTZA 2O5KA 4O4CA 3FY2A 4P5ZA 2BVAA 3TJCA 4GH2A 4XG3A 3TUCA 3I4BA 3FPQA 4RWJA 2ZB0A 3R7OA 4JX7A 2JDTA 2XNGA 4S2ZA 2B55A 1EH4A 2WTVA 3GP0A 5AMNA 4YJVA 4C8BA 4C38A 3ZEWA 4EUUA 2VTJA 5IF1A 3VBWA 5KMIA 4MH7A 2A98A 1UKHA 1WBSA 5GZ9A 2RIOA 5CEKA 4G3CA 1R1WA 2XZSA 5GJDA 3QQJA 3KRWA 1PXLA 3GOPA 3QA8A 3VRYA 4DHJA 1Q41A 4AT5A 3ZCLA 4R78A 3UZPA 4C57A 4GFMA 4FODA 2QONA 5E8WA 1OGYA 2CDZA 1S9JA 4D58A 2XAOA 2G2FA 4U9AA 2Y4IC 3MH2A 3O0GA 4RWLA 4ZY5A 5KBRA 3MH0A 3QBNA 3ZSIA 2XUUA 2GMXA 4CQEA 2F57A 2DS1A 4C4GA 3FHIA 5JGAA 2X0OA 3GCUA 2HXLA 4FTCA 5IH5A 3TV7A 3GC9A 4FZAB 3W18A 3W2PA 5AA9A 2CNVA 3QCYA 3SD0A 3L8XA 5HTBA 3IW4A 5IQDA 5HKMA 5EQEA 3QYZA 2WMAA 3NX8A 2C1BA 4EOQA 3HV6A 4DTBA 3CE3A 2HOGA 5HICA 1REKA 1XH4A 3AGLA 1OL7A 2OBJA 4GT5A 3W55A 4E5BA 4JAIA 1RJBA 1TQPA 2O8YA 3C0GA 4EWQA 4MXXA 3RZFA 5A14A 4LV7A 4UXLA 5BVEA 2IPXA 2P4IA 3FI2A 3Q60A 1TKIA 4LG4A 2QD9A 3AT2A 3MA6A 4JS8A 3HX4A 1GIHA 1H1WA 3ODYX 3QTSA 5IKWA 3BQRA 3MYGA 4FSZA 5A4CA 5BUEA 1KUTA 2GQSA 4FTRA 1GIIA 4E7WA 2R3OA 3LQ8A 4F08A 3QRJA 2CN8A 2H34A 4FSWA 4IACA 5T68A 3RK7A 3UODA 4LFIA 4F78A 4ZTLA 2VTIA 4L9IA 3UIXA 2V0DA 3BWJA 3KCKA 4XLIA 2C6LA 4QMTA 4X2NA 2R4BA 4NM5A 5KBQA 2RFSA 4UBAA 2YIQA 1HOWA 3ODZX 2J51A 2C6KA 2BCJA 4L53A 5C4LA 3PXFA 3SC1A 4IB5A 4BKJA 4RMZA 3FKLA 1W8CA 5LVLA 1Z57A 3W2SA 3U6HA 2CPKE 4L00A 4O4FA 4UB7A 1J1BA 4JNWA 1XKKA 2BRBA 3ZUTA 4JDKA 3DK6A 4FTKA 4EL9A 2CCIA 4RIXA 3T9TA 5BUIA 3BL7A 1GY3A 3D9VA 3TXOA 3VS7A 1YXUA 2C6EA 3DKOA 2ZAZA 2UVYA 4AA5A 1R0PA 5IH6A 1DAWA 2X6EA 3HKOA 2X2KA 4IDTA 4CFVA 2QOFA 2WHBA 3DTWA 1H00A 2JDRA 5CU4A 4FNYA 3R8LA 3SKCA 5CSXA 5DT3A 2DYLA 2DQ7X 4PL3A 4XV2A 4RVLA 3R0TA 1SNUA 4PDSA 4H3PA 4BCIA 3W0RA 5AUXA 3LVPA 2YM3A 3NUXA 5FWKK 4J8NA 3O23A 3FXZA 5LVPA 4BI2A 3UNKA 2XJ2A 3FL4A 3H4JA 2VRXA 3IGGA 3QRIA 2FA2A 4D1SA 4IZAA 4YC6A 2WMXA 4YTIA 4JMQA 2QKRA 1NW1A 4GK2A 5KHXA 4IWOA 4FTQA 4L6QA 4WHZA 4A7CA 4W4WA 3CEKA 1O6YA 4O84A 5AM6A 4F9WA 2VTQA 3MB7A 2UW7A 4GIHA 3EKNA 1LUFA 2W5HA 3E64A 5FBNC 3ZO1A 5IA4A 3BHUA 2XNPA 3EQBA