4U45A

Map4k4 in complex with inhibitor (compound 25)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
300
structure length
289
Chain Sequence
DIDLSSLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPDDQLWLVMEFCGAGSITDLVKNTKGNTLKEDWIAYISREILRGLAHLHIHHVIHRDIKGQNVLLTENAEVKLVDFGVSANTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPSTEQLLKHPFIRDQPNERQVRIQLKDHIDRTRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase kinase kinase kinase 4
publication title Fragment-based identification and optimization of a class of potent pyrrolo[2,1-f][1,2,4]triazine MAP4K4 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 93
structure length 289
sequence length 300
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4u45A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4u45A01
1F0QA 2OIBA 2VGOA 1PKDA 4FTQA 5KZIA 3HV6A 4Z7GA 3F6XA 4GV1A 3ZXZA 1PKGA 2HZIA 3MPTA 4FKJA 4J95A 4WT6A 3BU5A 3UG2A 3WZUA 4CXAA 4DTKA 2G01A 2KULA 1H8FA 3T3VA 4HVHA 3DAKA 3P78A 2BDFA 3Q3BA 4MXZA 1STCE 4ZOGA 4HVDA 3R2BA 1DI9A 5FEEA 4BCJA 5I9UA 1H28A 2I0HA 4FSYA 3S0OA 5TKDA 3CKXA 3QD2B 2C69A 3EJ1A 4W4YA 5GJDA 3SXFA 3MH3A 4FKTA 4FYOA 3FQEA 5HG8A 3ERKA 4AG8A 3IKAA 3PXKA 3MVLA 4RA5A 3G33A 4JI9A 3GENA 5M07A 3V3VA 4AOTA 4GMYA 4K0YA 1YXTA 4O0VA 4P5QA 1XBAA 4FIJA 3FMJA 3NIZA 3BHTA 3R7EA 3BYSA 5AP4A 4KBCA 5CSPA 3COHA 3V5PA 4YJVA 2HY0A 3R1NA 3PVUA 5ANDA 5ACKA 4IHPA 5CT7A 4NU1A 2DQ7X 5JRSA 4PPBA 3UC3A 4CEGA 3D5WA 4UMUA 2XVDA 1ERKA 2BKZA 2VTLA 3G9NA 3HMNA 4RT7A 3HA8A 4DCEA 4DH5A 1PXNA 1Q5KA 1JNKA 2HOGA 4DEIA 3R01A 4DEEA 2A0CX 3UQGA 4LI5A 5E8TA 2W5AA 3SOCA 4W9WA 4XV9A 4F1TA 5HTCA 2CKOA 4JVGA 3KFAA 4EK5A 3DJ7A 5ANEA 2UZUE 1CM8A 2VUWA 4QQJA 5M56A 3DBCA 2R0IA 3Q60A 4ZSAA 4R8QA 1YOLA 3M42A 2VWXA 4WHZA 4MNEB 2VD5A 3D9VA 2PPQA 5D7AA 4BDEA 2UVZA 1U4DA 1ZOGA 4GVAA 5M51A 3K5VA 2X8DA 3OT3A 5J9ZA 1A48A 1Z5MA 4JQ7A 3ZS5A 3MTLA 2VTTA 4GG5A 4BIEA 2VWUA 4EJ7A 4PUZA 4XEYA 4QP9A 3QCQA 4Y73A 2VWVA 3HP5A 4MQ2A 3BWFA 4AZWA 4EKKA 4EK3A 4C4JA 2Y0AA 3AC5A 1FPUA 3PXYA 3DLZA 3MJ1A 3TZ9A 4BI0A 5EYDA 4YZMA 4PNIA 3OZ6A 1IG1A 3Q4ZA 4IIRA 4HZRA 5D11A 3NEWA 3VWAA 1OBGA 3R9RA 2JDRA 3Q6WA 4WNOA 4AGDA 3HDMA 3GFEA 3OXTA 2FVDA 1JKSA 2QURA 2XNGA 2ZV2A 3FMLA 1WFCA 2C47A 4IVAA 3FPMA 4MHAA 5HIBA 2ITVA 4JNWA 2XM9A 2YIQA 1GY3A 3BRBA 1XKKA 2B55A 4LGGA 5G6VA 2OJIA 5HICA 4DEDA 3G0FA 5I9VA 3EN7A 5JT2A 4FSNA 4YNEA 5L8KA 4WUAA 3C50A 3R7OA 2J0IA 3MTFA 5CSWA 3GCVA 4E6AA 2V5QA 4FKWA 2OO8X 3FHRA 3QHRA 4HNFA 4GUEA 4IAFA 5L2QA 5DR2A 4RBLA 5CWZA 4XP3A 3F3UA 3NMUF 4OT5A 3ETAA 1LP4A 2DS1A 1FMOE 3KRJA 1AD5A 3FKLA 4LL5A 3UTOA 2Y4IC 2WGJA 4OBPA 4C4IA 4CCUA 1URWA 2JDTA 5IUHA 3LMHA 3Q32A 4KAOA 2ETMA 3Q4TA 2UZDA 4RC4A 3COKA 4C8BA 3OOGA 4CTBA 1UKHA 3WYYA 4XG3A 4E4XA 4FSZA 1YDTE 4QYGA 4IADA 5HLPA 4NCTC 5DYJA 3VUHA 4DFUA 4IM0A 3A2CA 1PXJA 2C6LA 2UZTA 3E3PA 3FY0A 4FV8A 3VUTA 1H1WA 5IEYA 4TN6A 5JN2A 3PIYA 4G3FA 4MK0A 5AJQA 4CNHA 4D2PA 2GMXA 1RQQA 3NCZA 2R3RA 3KCFA 4M7IA 5HU9A 3WZDA 3C0HA 2ITNA 3A4PA 3PP0A 2R3KA 3ODZX 1NVRA 3LLAA 4V0GA 5E4HA 1H0WA 4W9XA 3TJCA 4B8LA 3EN4A 4YTHA 5AM7A 3KMMA 3VW6A 1CKJA 4GUBA 2BZHB 1A9UA 4BC6A 4FNXA 3U54A 3C4CA 3I81A 5EG3A 5AUWA 3PA4A 3TJDA 2AC3A 5CAVA 1MP8A 1OZ1A 2GNGA 2FH9A 4HYSA 3A7JA 3FEGA 3BEAA 3TNQB 4DBXA 4A4OA 4O0TA 5EHOA 1FGKA 3H9RA 3HMPA 2PUNA 1KV1A 3PA5A 4XH6A 5AP0A 2X0GA 3FMHA 2B54A 3MIAA 4EBVA 3RALA 3IW5A 4TW9A 3U6IA 4CFWA 3OCGA 3R1SA 3EIDA 4I5MA 3QUEA 3R02A 5AV1A 3ZSGA 1H26A 2YWPA 4CLIA 2FSLX 4RFZA 2I0VA 5I3RA 5HOAA 4X6RA 5LVOA 3E63A 5I5ZA 2WD1A 3QQUA 5EDPA 3QTRA 1W8CA 2FO0A 3TZ7A 4BTKA 4FTMA 4IQ6A 3II5A 2WHBA 4FODA 2F2CB 4F9AA 3KMWA 4DE4A 3N9XA 4I20A 4BCHA 3BBTB 3LXPA 1XO2B 4IVBA 1XHAA 5HCXA 2PSQA 3Q9WA 4F0IA 5DVRA 2XRWA 3JYAA 2W1GA 3SV0A 3UOKA 3ALOA 3V8SA 4JIKA 4GEOA 1JKKA 4KKEA 5F4NA 5EQPA 1VR2A 3TUCA 2GS2A 1T45A 3B2WA 4NIFA 4QMTA 4ALVA 3AC2A 2VTHA 3BU3A 4KIKB 3O7LD 4J71A 1YW2A 1ZMUA 4H3BA 4I6BA 4RX8A 3W10A 3UIUA 4FKQA 3PJ2A 5F20A 5HNBA 3Q2MA 4ZZNA 4ORKA 3CJFA 5M4FA 2ITUA 5EM5A 5BMMA 1IEPA 3VF9A 2VTPA 3D2IA 3P5KA 3MFUA 3JUHA 3NUXA 5HO8A 4B9DA 2I0EA 4EHVA 5EYMA 2J90A 1H00A 1H27A 4XUFA 3TKHA 1PW2A 4MKCA 3D83A 4FE2A 4NWMA 1H1RA 1GOLA 4FK3A 5CF6A 2YCSA 5DBXA 3CXWA 4GW8A 1PJKA 4FTCA 3TIZA 5K5XA 2P4IA 4A9SA 4BDDA 4YBKA 5IQDA 4CV8A 1ZWSA 5FP6A 5C26A 4I4FA 5HG5A 2REIA 3M11A 3HEGA 3PG1A 2HW6A 3MDYA 4RVLA 5CU4A 3I5ZA 3LVPA 2CHLA 2F57A 2IZSA 3C7QA 4ONAA 2YIRA 4QMPA 4MH7A 1E9HA 4EOSA 4B0GA 4KNBA 2R7BA 1R39A 2C5OA 3IO7A 3BYMA 1R1WA 5AUZA 2Z7QA 4N6ZA 5HD4A 1UA2A 2JDVA 3AC3A 3COMA 2A19B 3MVJA 4L52A 4X2FA 2OI4X 3D0EA 3O71A 1MRVA 4WNPA 5ANIA 4F0FA 4YZCA 3VS2A 3ZXTA 2X9FA 4NFMA 4CQEA 3PXZA 3EL7A 5CVGA 2WTKC 4KIQA 3G90X 3LJ1A 4O22A 4UV0A 4IC8A 4JAIA 4FNYA 3H3CA 2VO0A 5ETFA 4M69A 3QD3A 2B9JA 5CSHA 4F6UA 3L9LA 3R0TA 3Q2JA 2WQBA 5FUTA 4RLKA 2VO7A 3D94A 3NW6A 4PQNA 2C6TA 3O17A 4PDYA 3Q9ZA 4G31A 2Y6MA 4NM3A 2BCJA 1IA9A 3THBA 4C02A 1G5SA 3A8XA 3S3IA 5B2MA 3F2NA 2I6LA 3EH9A 5IQBA 5M53A 3BE2A 5FDXA 1WBWA 3FC1X 5IUIA 5A6NA 2BHEA 1WBOA 4DT9A 4BDFA 1U5QA 4JJRA 2C6OA 4DYMA 2WB8A 4EUUA 5F1ZA 2QR8A 4RIXB 2XNEA 1XH4A 4HZSA 1E1VA 2WAJA 1X8BA 3GCSA 3HECA 4CD0A 3V5WA 5L2IA 1LR4A 3FSFA 5FRIA 2NRYA 5LMAA 4PDOA 2GQGA 3ZFYA 2C5YA 3P9JA 4AZFA 5CEPA 3QXOA 3R8UA 4BCNA 3IDBA 5KUPA 1CDKA 1ATPE 5E92A 5BMSA 4ACHA 5C8NA 3HRCA 4XG8A 3R8VA 2GSFA 2FSOX 5FBOA 3OS3A 5BQ0A 5GHVA 3HZTA 3MPAA 3RKBA 3U9NA 4AT3A 4FTIA 3BX5A 2QOLA 4O0SA 4BDAA 4P2KA 5IQEA 2W5HA 4EYMA 3GCQA 1Q8YA 3PVGA 4C2VA 4KD1A 2GCDA 4JR3A 3NAXA 4MD7E 5CNOA 4BCIA 2X7FA 5IMXA 4MBIA 4EOLA 3Q5ZA 4GT5A 3TN8A 4DLJA 3MA3A 4GK3A 3FI4A 2HWOA 4BGHA 2JKMA 5KNJA 3OXZA 4AGWA 3DLSA 3QRUA 2XK3A 4H39A 4ZSGA 3P79A 4CFXA 1OITA 5L6WL 2CN8A 5JGDA 1NW1A 5AV3A 1H01A 4GCJA 2OSCA 2VO6A 4RIOA 4W4XA 5CU2A 2Z8CA 4TPTA 4OTWA 4NKSA 2X4ZA 3NYOA 1PMEA 4NT4A 4EL9A 3UMXA 2HZNA 4EC9A 4FNZA 4O2ZA 4O0UA 5JK3A 5D9HA 1CKIA 5A4LA 3PZHA 3BGQA 4IM2A 4R3CA 3VQHA 3AC4A 3LMGA 2HZ0A 3Q04A 3HP2A 3I4BA 4X3FC 3RI1A 4USDA 4I24A 2RIOA 3QTXA 3FZRA 3KN5A 5EYCA 4ZMFA 2XJ2A 4C7TA 3O8PA 4S30A 3LQ5A 2VGPA 4FKIA 4D1ZA 5JMSA 4TY1A 5TE0A 4KIOA 4BF2A 2CJMA 5GNKA 2XNOA 2IJMA 4U8ZA 2X4FA 3ACKA 4NW6A 4R5YA 5M08A 2OXDA 4YJPA 2JFMA 4AN2A 3AQVA 3ATTA 1WAKA 3PWYA 4K8AA 3LCDA 2JIIA 4D1XA 4E4LA 4PDPA 4BYJA 3SVVA 3FI8A 4O7TA 5D1JA 4Y85A 4Q9ZA 2A2AA 1NY3A 2XH5A 2J5EA 4R5SA 4AOIA 5HBJA 2QODA 3E8EA 3BU6A 3TDWA 4QD6A 5AUYA 3R8LA 2XK6A 5J9LA 3V6RA 4U3ZA 3TDVA 3LZBA 2ITWA 3V8TA 1JKLA 3WE4A 4N0SA 2IZRA 3PUPA 3RK5A 5I3OA 5LWMA 3PY1A 2J0LA 2YABA 3L8VA 3UVPA 4APPA 2ZDUA 2JFLA 4UXLA 2GHGA 2PYWA 1SYKA 4C2WA 4FKUA 3F66A 4YSMA 3DNDA 2O8YA 2WQEA 3ZLSA 4D4YA 4ACMA 3OY1A 3R21A 4O1OA 3UYSA 2PVHA 3EB0A 4J53A 3ZBFA 1SVEA 3ANQA 4X0MA 2I0YA 1WCCA 4YP8A 1H25A 2YM6A 3MH2A 3ORNA 3DXNA 4G2FA 3TZMA 3UMWA 3O51A 2J7TA 3CLYA 3UVRA 2BVAA 4XG6A 2XM8A 3NSZA 5KMLA 5LJJA 3VBVA 4O0YA 5EKNA 4NH1A 4U40A 4TXCA 2XBAA 3DPKA 3F69A 4DG0E 1U59A 1JWHA 5JRQA 1JKTA 4XP2A 2X2LA 1V0BA 4FOBA 3KRWA 5IA1A 2RFNA 4PMSA 4O7RA 5J9YA 3AMBA 4PDSA 4PTEA 4BICA 1BI8A 3MFSA 3Q53A 5K4IA 4O86A 2R3PA 4CTCA 4R7BA 4AW0A 5AFVA 3FYKX 4S31A 4F08A 3V5QA 5J1WA 1NVSA 3BELA 4RWJA 4XV2A 4ZY6A 2X6DA 3P23A 2J0JA 4I5HA 4F1OA 5HIEA 3EHAA 4PY1A 3LAUA 4QNYA 3FZOA 5L8LA 3UOHA 5BYYA 5AV4A 4ANMA 5HIDA 3SC1A 4FUXA 2G2HA 2XYNA 3C9WA 4LOPA 5HO6A 1F5QA 1ZLTA 3VS6A 1M14A 1TQIA 2PVNA 4BDHA 3BV2A 4XRLA 1UKIA 2V22A 2YDJA 1U54B 4ITIA 5DPVA 3RTPA 4DINA 5TT7A 3ZM4A 3AD5A 2QG5A 3NZ0A 4FT9A 2XK7A 2WU6A 3HNGA 1RW8A 2UW0A 1ZYJA 3KF4A 3RHKA 1GZKA 2W5BA 1F3MC 5CZIA 1SVGA 4QMUA 4YHTA 3WBLA 4C59A 2HXQA 3HL7A 2W1FA 2R4BA 4QRCA 2BDWA 4BFMA 3QTUA 4UWCA 3BKBA 1UNLA 1MRYA 2C5XA 4K1BA 3CY3A 3C4EA 4C61A 3TV6A 5LMKC 5TOZA 5AMNA 4C58A 4BBFA 2PZ5A 2XIZA 3IOPA 4IVDA 5HORA 1WZYA 3UVQA 4EZ3A 3N4UA 2C68A 5CEMA 3C4ZA 4EZ7A 5EI2A 2GU8A 5KMJA 2YM8A 4AFEA 3QTWA 4K9YA 5AA9A 4HVSA 2VO3A 1Z57A 4JRNA 2WMUA 4W4VA 1UU8A 3QKMA 5ANGA 5ETAA 5M06A 4G9CA 2ZM4A 1GIIA 3P0MA 2YACA 3KL8A 4UMTA 3O8TA 4O6EA 4XLIA 4M13A 3PIZA 4DFLA 4XG9A 5CU3A 4NYEA 3F3VA 3UPZA 5B2KA 3DFAA 3F2AA 4XRJA 5ANJA 3L9NA 3EMGA 3R71A 5J7HA 2XB7A 3CQUA 4BY9E 4U6RA 3TCPA 3S00A 1OVEA 3ORMA 5ACBC 4IAAA 3LOKA 4AX8A 3ATSA 4O2PA 4H05A 2ETRA 4IXPA 1XH6A 5HD7A 4F9CA 4DN5A 4EH2A 4LRKA 4FV3A 4JDJA 4GIIA 3RNYA 4D4RA 2OICA 4HJOA 5DA3A 3H4JA 3E87A 3BI6A 4YGAA 4BDCA 4ZAUA 2C30A 4AZVA 4ZS0A 4FV4A 2ACXA 3ZSIA 3FI3A 3NWWA 2Y4IB 3C51A 3WF7A 2XNBA 2B9IA 3IW4A 5AM6A 5J5SA 5M4IA 4WOVA 4O83A 3E62A 5CENA 5HTIA 1H1PA 1H07A 3NUUA 4RFYA 4FICA 5GJFA 5L4QA 4FT7A 3JXWA 3SG8A 3A99A 2QONA 3E8DA 3FV8A 4HCUA 2ESMA 2HYYA 2O3PA 2P33A 3DJ5A 3RK7A 1W82A 3H9OA 3ULIA 2OXXA 2W17A 4TYHB 3FLNC 3TL8A 3FUPA 4EORA 4YJNA 2UUEA 4WBOA 4AW2A 4FIGA 4L67A 3F7WA 3LIJA 4PMPA 3OXIA 5BVKA 4KSPA 4BTMA 2W99B 2CCIA 5JFWA 1H1QA 3L8PA 4MXOA 4S32A 4QYFA 3UODA 2UZLA 3VBYA 3TTJA 5FXRA 1OIQA 2CGVA 1XR1A 2WMVA 3ZHPC 2QO9A 3FKNA 4DG3E 2OWBA 3LKMA 1JSUA 3HMIA 3QRTA 5HNIX 4FIHA 4I6QA 4ZTNA 2B1PA 4EH6A 2QCSA 4C3FA 1I09A 1FINA 5ANOA 3F88A 3SRVA 2QOIA 2UZEA 2Y9QA 1Z9XA 3U4WA 4XV1A 3UZRA 2R3JA 4P90A 2W4KA 2WMRA 2BR1A 1NA7A 5DT4A 5HZNA 2IG7A 3QZHA 1TKIA 5CANA 4F65A 2ZDTA 4TYJA 2Q83A 2WMAA 2OZAA 4ID7A 4L01A 5BX0A 2A27A 2OFVA 4CMOA 1XQZA 2X1NA 3F2RA 4BKZA 3N4VA 4PF4A 5EYKA 2PTKA 3R9HA 4GU9A 3IQ7A 4PMMA 2QOOA 4D9UA 4DG2E 3EQGA 2XS0A 4A9UA 3PA3A 2IZTA 4JG8A 2WXVA 4K6ZA 4MQ1A 3PE1A 4P5ZA 4UBAA 2PVYA 3RVGA 3ORTA 4DC2A 4W8DA 5K5NA 5IF1A 3FXZA 4D1SA 4DF3A 4H58A 3CE3A 4BWXA 3R30A 2UZWE 3FL4A 3KULA 4E8AA 5IISA 3W2QA 4N57A 3KXZA 3B8RA 3TKIA 3FC2A 2XZSA 1P4FA 5FWKK 4FKRA 5LVNA 3OC1A 2XKDA 4RRVA 3VS5A 3ENMA 3VBWA 2GS6A 3ENHA 4WNKA 2AYPA 4ASZA 1YHSA 1MUOA 5M55A 4J99A 4JRVA 3ZRMA 4GKHA 2V55A 5E8SA 4BCFA 4CYIA 4IW0A 4WRSA 3SX9A 3ZSHA 3PPZA 1DAWA 5CF8A 5BUJA 3QC9A 3TNIA 5KBRA 2VWBA 4YC3A 4ZZMA 4M14A 3C5IA 2JBOA 2R5TA 3OUNB 3VUIA 4LQMA 4N6YA 3JY9A 3BLQA 4ZJVA 2C3IB 3EQCA 3VHEA 4O38A 2QC6A 4R3RA 3N4TA 2BZKB 4DGGA 3P7BA 3QCYA 4RWKA 2XK9A 3UO6A 2W0JA 2XIKA 2RF9A 5HG7A 2CKEA 2QU6A 1PXIA 2O65A 3CD8A 1H1SA 2GFCA 1J91A 1V0PA 4FZ6A 2HXLA 3BHHA 4AFJA 3C13A 3C4FA 5AP7A 3LFFA 4DH3A 5DNRA 4E4NA 4FYNA 4DLIA 3F5UA 4J8MA 3NNVA 4F9WA 5A9UA 2YWVA 4OTQA 1PY5A 5F9EA 4YMJA 3WI6A 2FUMA 3OG7A 4OUCA 4PX6A 3AMYA 4QMNA 4LL0A 2YERA 2GHMA 2WTKB 4FKSA 4ASEA 4EOOA 3NUPA 3TWJA 4TRLA 2VWYA 3HUCA 5FXQA 2JITA 4FSQA 1XJDA 3PPJA 3FJQE 3VUMA 4KRCA 3DV3A 2O2UA 4FG8A 4I3ZA 3BYUA 4IWOA 5AP6A 4CT1A 5CXZA 4BKJA 3A4OX 5FG8A 2IWIA 3KC3A 4N4SA 3BQRA 4HGEA 2JIUA 4RJ8A 4BZNA 2YIYA 1TVOA 2PWLA 3VF8A 4MD9E 1AQ1A 4IEBA 2EXCX 4FIIA 1YXXA 1OBDA 3EKKA 4M3QA 1YQJA 4L00A 1ZAOA 2R3IA 2XUUA 3GI3A 4MNEA 2EXEA 2RFSA 2ZM1A 5HE0A 5AAEA 5KHXA 4XG4A 5ITAA 3GUBA 5K0KA 3BIZA 4BTFA 3R7UA 4GT4A 2O63A 3UOJA 2EUFB 4FZFB 3QTIA 5AR5A 4CRLA 3MFRA 3QU0A 2YFXA 3AC8A 5IQIA 3G0EA 3FLSA 4DBNA 1SM2A 4YTCA 3VS1A 3ZFXA 4J97A 3S1HA 4O84A 2QHNA 3K3JA 4IVCA 4NJDA 5JFXA 2BAJA 5AA8A 2G2IA 4BDBA 4Z9LA 4CKJA 3RM6A 2JKQA 5H2UA 3GP0A 3RMFA 4G16A 4F0GA 2H9VA 3F82A 5IU2A 1ZYCA 4IC7A 2F7XE 2WMSA 1G8SA 3R63A 2FSTX 3OFMA 2NP8A 2X9EA 3MV5A 4OTIA 5DEWA 4RC2A 5E90A 1OL5A 2UW8A 1IASA 4RVMA 4N70A 1ZY4A 4ERKA 1Q8WA 2J51A 2W1ZA 2YCQA 3EZVA 3RBWA 4U97A 3W16A 3GC9A 5CF5A 5JFVA 3EYGA 1P4OA 2PMIA 4UX9A 5KCVA 2JBPA 3BGPA 4GFOA 5LOHA 1ZYLA 2E2BA 2RGPA 5DRBA 5CVHA 2G15A 1OPLA 3UIXA 3WARA 2PMLX 5HU3A 4OAVB 2XP2A 4FF8A 4FK6A 2HY81 4RFMA 3A7IA 5AR7A 4RLLA 5C8KA 1IRKA 1HCKA 5TO8A 3NRMA 3AD4A 2VTOA 3QF9A 2B9FA 4GG7A 2WMXA 4IZAA 2XEZA 4WA9A 4RQVA 3SDJA 4U9AA 3RJCA 4HPTE 3KREA 2W96B 4QP4A 1XH8A 1LPUA 3Q9YA 1WBTA 3DGKA 2PK9A 4PTCA 4X2NA 4DHFA 5HKMA 2JKOA 4D2RA 3EOCA 1H08A 4XG7A 5LWNA 5LXMA 3WF8A 5AP2A 2BTSA 3R73A 4X3FB 5CEKA 3LCKA 5BYZA 3V8WA 5L2WA 2ONLA 4YJOA 4FV1A 3AXWA 4JOAA 4ZS4A 3DT1A 3PLAE 3CCNA 2P55A 3E8NA 4F9BA 2BRBA 4FEQA 3GGFA 5M57A 3C5UA 5M4CA 1M2PA 5CAPA 4FBXA 4MCVA 5E8WA 4HGSA 2CGXA 3IW8A 4YR8A 4Y46A 1VJYA 5LMBA 2C3JA 5JSMA 2OZOA 3R7IA 1YI6A 1Y8YA 2EVAA 4PL3A 2OJGA 2RG6A 3U9CA 3OBJA 2WU7A 4TT7A 1KV2A 2YA9A 3HUBA 3ZO4A 4BTJA 3HVCA 3CY2A 4QNAA 1FBNA 3LFNA 3F3TA 3QXPA 2OLCA 4EWHA 3U87A 3CD3A 4I5PA 4X2GA 4EC8A 3HMMA 2PUPA 4R1VA 2YM4A 3R1YA 4MNFA 2R7IA 3VBXA 4GK2A 3FZTA 4UYAA 3R9DA 3AT4A 3TUBA 3P86A 4E6CA 4YZBA 3DK7A 2W7XA 4L43A 3W32A 2XCKA 3W2CA 3ZFMA 2GQSA 3VS3A 2VTMA 3POZA 4C62A 2W06A 4NFNA 4JBPA 2VWWA 2Z7LA 4OLIA 4IWQA 4CYJA 2CNUA 4JDKA 3W18A 4DEAA 3MSSA 4YHJA 1YVJA 4R3PA 3CPBA 3O96A 4YHFA 2VWZA 3I60A 2UZBA 2WTVA 4IFGA 5H8EA 3R8PA 3NVMB 3R28A 5AP1A 2CKQA 2YJSA 4A4XA 1JQHA 5IH6A 2W1EA 3CBLA 4KKGA 2PY3A 4V0GB 5A4EA 2X39A 5HTBA 5E8ZA 3NVKI 2Z2WA 3BHYA 3PY3A 4RG0A 4HW7A 3LXKA 5IQAA 3FZSA 2EU9A 1S9JA 2QR7A 1PMVA 3UNJA 3PJCA 3LFQA 3QRKA 4LRJA 4C36A 3QCSA 3QA8A 4KIKA 4G5JA 3UO5A 3F9NA 5EOBA 2GFSA 3FXWA 3ZZEA 2BUJA 5BVFA 4OTFA 3HDNA 2LAVA 4QTDA 5DLSA 3DKGA 1J7IA 3IW7A 3QC4A 3I5NA 4XJ0A 4CGAA 5HEZA 4IX4A 3EN9A 3TXOA 3ZC5A 3D5XA 3BGZA 4BZOA 4JX3A 3MI9A 1K3AA 4FG9A 4MEDA 5EK7A 4BCOA 4CZYB 2IW6A 2QU5A 4PMTA 4EOQA 3QWKA 5CU6A 3ZRLA 4AAAA 1YKRA 4YJUA 4F7SA 5AV2A 3CTJA 4XP0A 2WIPA 2YJRA 4LUDA 4RIWB 1Q62A 2XK8A 2ZB0A 2C6EA 3Q9XA 4WKQA 4FKOA 1G3NA 4FZAB 3LFCA 3AMAA 2C0IA 4FNWA 3Q4CA 2R2PA 4J1RA 3SLSA 4AT5A 3R9NA 3CIKA 4G34A 1FOTA 4GYGA 5EW8A 4FR4A 4O1PA 3MVMA 4WG3A 5K9IA 3Q52A 4ACGA 3CC6A 3GNIB 4FT3A 4MF1A 5CLPA 3RCDA 5A4CA 2CLXA 2GNJA 2YM3A 3Q6UA 1WBPA 2IN6A 2PMNX 4I0TA 3WILA 2OU7A 5FD2A 5CALA 3D2KA 2QOQA 4NZWB 3PRFA 4YC8A 2ZV7A 3V6SA 2XIXA 3BWJA 4TYEA 4IX3A 5C1QB 3UQFA 1K2PA 3RZFA 5BPYA 2YAKA 2YDKA 3TIYA 4D4SA 4FC0A 1FQ1B 4OBQA 3ZMMA 4AQCA 5G1XA 1KE6A 4QMZA 5IA3A 5DRDA 1B39A 4UWBA 2GPHA 3NCGA 4YJSA 2WFYA 3DY7A 2BFYA 4OTDA 4MXYA 5J87A 3DK6A 3UNKA 4D2WA 4TTHB 4ZIMA 3FQSA 3TNPC 3W1FA 1YXUA 2HIWA 4BCMA 4D2TA 4MF0A 1KE7A 2UW3A 4GJ2A 4WD5A 4JDHA 4ANBA 4D0WA 4GU6A 4RIXA 3EN5A 3DAEA 3NR9A 1IAJA 3KXGA 5E9EA 3F5GA 3PJ3A 4TZRA 5LCJA 3IW6A 3ZDIA 5LVMA 3E5AA 3LFDA 1OL1A 2YIWA 4JDIA 5A4TA 3ZYAA 1R0PA 1Y57A 3AG9A 3SD0A 2IPXA 4QPAA 3VJOA 4KBAA 5BYLA 1UU3A 1YWNA 1Q8UA 4IB1A 2F2UA 4JR7A 3A60A 3EQPA 2AUHA 2OJJA 5C01A 3K54A 3PXFA 4ERWA 4IWDA 2OBJA 1PXLA 3GOPA 3MY0A 4O21A 3KK9A 1GZ8A 3H30A 2C1BA 2YM7A 4A9TA 5CU0A 4EQUA 3UBDA 2IVTA 4XHKB 2JD5A 5FBNC 3PTGA 4EBWA 4K18A 3V5LA 3GU5A 3DBQA 4HNIA 4QMMA 2BPMA 2I1MA 1S9IA 2P2IA 3OROA 3EFLA 4D28A 4HYUA 4L68A 3A7FA 4B7TA 5L6PA 2XK4A 3FY2A 3KCKA 4C0TA 4ZSJA 2V7OA 3D7ZA 2YLFA 4A07A 3RPSA 4FVRA 2R9SA 2WO6A 3EN6A 1OUKA 4CFFA 2B0QA 4U42A 4O0WA 2XKEA 3KEXA 2C3KA 1P5EA 5ANKA 1OKVA 3HV7A 4TL0A 4DTAA 3IK3A 3TNWA 2VX0A 4USEA 4ENYA 2J4ZA 4TYIA 4QP7A 2P3GX 5HO7A 1YRPA 3DBEA 1LUFA 2JDSA 1PXOA 4E5AX 4U0IA 5EH0A 4AA0A 3QFVA 2VN9A 2ZVAA 2UW9A 3ELJA 3F3WA 5DI1A 5ETIA 5IA0A 2F7ZE 2PE2A 2ZM3A 3ZH8A 4UMQA 1LEZA 3ZZWA 4AS0A 3FKOA 2E9PA 3RPYA 4CG9A 1Q3WA 4M66A 5EHLA 3SXRA 5AUXA 4ZMEA 4MTAA 4YJRA 4D4VA 3DBDA 3NYXA 5EI6A 5JQ5A 3PJ1A 3V04A 1RE8A 4QP3A 4RIYA 4NTSA 4FTRA 2BTRA 3LPBA 3OP5A 5CEIA 1JSTA 3WF9A 2R3NA 3GB2A 1ZMVA 3DZQA 1YI4A 3O2MA 4C3PA 2BKKA 1UNHA 4QP1A 2J2IB 4FEXA 2Y4PA 1BX6A 3EQBA 4FZ7A 5FDPA 1YWRA 3A61A 5DMZA 3GCPA 4JS8A 2YCFA 3LFEA 4FV6A 2C6KA 1EH4A 3WF6A 4QTEA 4FSRA 1DM2A 2WQNA 1R0EA 4L6QA 4D5KA 4JT3A 5DH3A 4QQTA 1Q99A 2R3OA 2VZ6A 3DQXA 4F6SA 2IW8A 2H6DA 4GKIA 4YO4A 4OTRA 3D7TB 4G17A 5AP5A 3ITZA 2KTYA 4XBRA 2BROA 3FLWA 4Y83A 3SW4A 3QQLA 4X7QA 2Q0NA 5A6OA 2FB8A 3CQWA 4QMVA 2QOKA 3VUGA 3ACJA 2OGVA 4PWNA 2W4JA 1OMWA 3QALE 4E5WA 4UN0C 3B2TA 4G6OA 4M0YA 4J8NA 4J96A 5BVWA 4RSSA 3FSKA 2WTIA 3PG3A 3QZIA 4QTAA 4CT2A 3FQHA 2V0DA 4C34A 4QMLA 3QWJA 4CVAA 2WOTA 3ZO3A 4RZWA 3HX4A 4G3GA 4ZJJA 2WMTA 2BAKA 4GFGA 1PRYA 1OL7A 3KGAA 4QTBA 4RJ6A 4EI4A 1JPAA 2PZRA 3AGMA 4I0SA 4M0ZA 3ZEPA 5KMKA 4FTAA 4KWPA 1UNGA 2CPKE 4XOYA 3NNWA 1WMKA 3JVRA 2WELA 4QYEA 4CFMA 4L7SA 1BUHA 4L7FA 3KXHA 4DGNA 4RVKA 2X81A 1VEBA 4AE6A 5J7BA 4M8TA 5CI7A 4MBJA 2ITYA 3FZPA 3TKUA 4R7HA 4EQMA 1U46A 4PNKA 3MGYA 4CG8A 1TQPA 4M97A 1OIYA 4CKRA 4FZDB 4YLJA 4IDTA 4QOXA 4JX7A 3GVUA 1FMKA 4NL0A 4G3DA 5HE3A 3MH1A 5DOSA 4G3EA 4I5CA 3S2PA 4B8MA 2ERZE 1U54A 1HCLA 2OIQA 2QO7A 3RNIA 3SA0A 4FEUA 4OGRA 3FLQA 2X7OA 1JVPP 2C0TA 2PE0A 2YITA 3JY0A 1FVTA 4PPCA 3ZOSA 5AEPA 4O7VA 2FA2A 5KE0A 4XX9A 2JAMA 4C4GA 1WBSA 4LRMA 4MWHA 3VULA 1MQBA 4IAYA 4ZTRA 3UE4A 3DAJA 4APCA 4ENXA 4F63A 4FA2A 2F9GA 1QMZA 4U44A 3ZBXA 4RZVA 4EH3A 5AIKA 5C27A 3KXNA 3WIGA 5JQ8A 4I0RA 3NW7A 1WBNA 5D41A 4BZDA 3UIBA 4JBVA 1ZOHA 3FE3A 5FM2A 4EWQA 2BZJA 5E7RA 4D0XA 1BI7A 4RX9A 3IDCA 5IPJA 5IQCA 4FL1A 4RX5A 1OUYA 2OH0E 4EOIA 4DH8A 4XNEA 5ICPA 3I79A 4UALA 3MB6A 4G5PA 4XLVA 4AN3A 3VS7A 2F49A 4IAZA 4DFZE 3UPXA 3LQ8A 2UV2A 3WIKA 5T68A 4ARKA 4WRGA 4E20A 3KA0A 4CFUA 2OJFE 2OKRA 4WUNA 2VAGA 4OTPA 4FTOA 2JC6A 1PF8A 2ZV8A 4FTKA 3LXLA 4KS7A 2RFDA 2XRUA 4O91A 3POOA 5EDRA 2QQ7A 2PVLA 3MFTA 5IH4A 5EI8A 2ZMDA 4L3PA 1K9AA 5AAFA 1ZZ2A 3ZM9A 3DQWA 4O6LA 4FTUA 2F7EE 4P7EA 4BCQA 1M7NA 1W98A 4JXFA 4NSTA 1XWSA 3QLGA 2EXMA 3CR0A 2W1HA 3DDQA 5GZ9A 3UIMA 3FPQA 5KMOA 1GJOA 3MA6A 2YN8A 4EOKA 5HNGA 1M2QA 3IGOA 5E1SA 2BFXA 4YZ9A 4O82A 2G1TA 2ZJWA 3L8XA 5T6KA 2VTNA 4O96A 4PL4A 5HVKA 3OEFX 3O8UA 2NO3A 4J98A 1BL6A 3RPOA 3T3UA 2FSMX 2JDOA 3C1XA 2VU3A 3CKWA 2C1AA 1SNUA 3VJNA 2NNWB 5IA2A 4BI2A 4LFIA 3GU8A 3QQJA 3M1SA 3OEZA 3PPKA 3QX2A 2CDZA 4HPUE 4QP6A 5IA5A 5EQYA 4RJ7A 1KWPA 4FTTA 2WMWA 3BQCA 2CKPA 4HCTA 3OVVA 3GCUA 3PSCA 2ERKA 5LVPA 4I21A 5KZ0A 3LM0A 3NUYA 4NCTA 1SZMA 2W9FB 3ET7A 4TYHA 5FXSA 3I1AA 4CSVA 3PE2A 3R6XA 1PMUA 4IB3A 4RWLA 2ITQA 2C6IA 1ZARA 3NX8A 4D9TA 5CAOA 4LOQA 3I6WA 4GRBA 4MXAA 3QRJA 1SNXA 1IR3A 1I44A 3AC1A 1KE8A 3FMMA 1H4LA 3PFQA 1OKWA 2ITZA 4UMRA 3HMOA 1OM1A 4MXCA 1Y6BA 1ZRZA 2XCHA 4YBJA 5HCYA 2PVJA 2BZIB 3DB6A 4ZSEA 3BZ3A 2E9VA 4C57A 4H1JA 2HELA 4E7WA 1AGWA 3Q96A 3WF5A 3DKFA 1REJA 2RKUA 4ZTLA 1JLUE 3DKCA 3NIEA 3TACA 4E93A 2C4GA 2PULA 4C4HA 1LEWA 2ITXA 2VTRA 4K2RA 3VVHA 5C9CA 3UZPA 4NW5A 4QP8A 5EM6A 4RC3A 5FEDA 3ZC6A 3RINA 4EJNA 2PZYA 4QTCA 2CGUA 4BHNA 3OWJA 1H0VA 3E7OA 1Y8GA 5C8MA 5IEVA 1B38A 3QBNA 4RQKA 5EDQA 3U6JA 5AUUA 4K33A 2BIKB 3U8WA 2OH4A 4AN9A 3EQFA 3U51A 1YHWA 4L45A 1BMKA 4KB8A 4ZY4A 3G6HA 3TV7A 2OG8A 3V5JA 3NNUA 2YHVA 2YIXA 1GNGA 5JZJA 3MY5A 3RPVA 2YM5A 3DZOA 1UVRA 2OJ9A 3JS2A 3QUDA 5IKWA 3VQUA 4X2JA 3EZRA 2XNNA 4M12A 3ROYA 5HX8A 3OWKA 3QQFA 4Y5QA 4AA5A 3FAAA 5CSXA 4LMUA 2YCRA 4LG4A 5F94A 3FLYA 5IUGA 3R83A 4AW1A 2JEDA 4HGTA 4YJQA 3REPA 5D12A 2QLUA 5DIAA 4RJ3A 4GS6A 1TQMA 5FEQA 4CZUA 4B6LA 1UU7A 3QKLA 4BKYA 4CLJA 5LCKA 2O0UA 3UDBA 4AOJA 3HV5A 5LVLA 3P7CA 3QTZA 4UY9A 4A9YA 2B52A 1RDQE 4IJPA 4ANQA 2OK1A 4I6FA 5AAGA 3EYHA 2R3LA 4F7JA 4IZ7A 4JL9A 5B2LA 2PVRA 3PYYA 1BYGA 4BIBA 2CNQA 4DH1A 4F4PA 3UG1A 4UMPA 3MW1A 3KXMA 2E9OA 4AZTA 3KMUA 4BIDA 2A4LA 4KA3A 4IZYA 3ZUUA 4BDGA 2ZYBA 3LXNA 5CSVA 4O7WA 1W0XC 4XG2A 1KOBA 5CAUA 4UZHA 4ANOA 2WTCA 3T9TA 3C4XA 3DK3A 3I0OA 1XBBA 3RAIA 1U5RA 2PU8A 4V01A 2AC5A 4CKIA 3P7AA 2JLDA 4FT0A 4O81A 1VYWA 3PJ8A 4Q2AA 4AT4A 2Z02A 4WIHA 5B7VA 3SGCA 4KABA 5GIPE 4NTTA 1YOMA 5HHWA 4QQCA 3QX4A 1KSWA 2QI8A 2UZNA 2YZAA 4FUYA 3RK9A 3GQLA 4EHEA 2J6MA 3KRRA 3ORLA 3CS9A 4U79A 2XJ0A 5EW9A 5FGKA 4FEWA 5GINE 5J5TA 5A3XA 3NNXA 4YU2A 4S33A 5H3QA 1YDRE 1T46A 3E7VA 1GAGA 3HYHA 3GXLA 2JGZA 2X8IA 3MS9A 4J7BA 4MVFA 2J50A 2WIHA 4O0XA 2QG7A 1M2RA 3DJ6A 5CTPA 4QMQA 3IOKA 3VS4A 3LMIA 4G1WA 2XJ1A 3MBLA 4UZDA 4YZNA 1OIUA 1JOWB 1DS5A 2VTSA 2UW6A 2C6DA 2XIYA 4TWCA 3I6UA 5FTQA 4YUQA 5K3YA 3SOAA 4NJ3A 2WTWA 5IQFA 3ORIA 2GNIA 3KVXA 4U43A 3PDTA 4V05A 2UVXA 3EQHA 3KF7A 5AP3A 4Q9SA 5AR3A 2H34A 4LMNA 5AUVA 3S95A 4G9RA 2UW5A 3E88A 3FMDA 4GK4A 1XH7A 4V04A 3ROCA 3W2SA 4B4LA 3KRXA 2FGIA 2GNHA 3CPCA 3WOWA 2IW9A 2QKWB 2PVMA 3QTSA 4XS2A 3VHKA 4IE9A 4S34A 5L3AA 3KQ7A 5DFPA 1J3HA 4TWOA 3DFCB 4E73A 4EK4A 4IACA 5CVFA 3DCVA 2VTJA 3MIYA 3RZBA 4I23A 3LJ0A 3GQIA 1WBVA 3SQQA 5J95A 5TR6A 4NM0A 4DGMA 4F7LA 4EYJA 2W05A 2P2HA 3GC7A 4MWIA 4ZP5A 5HBEA 3SAYA 2GDOA 2UVYA 2WOUA 3G51A 4IFCA 3C0GA 2VTAA 4LV5A 2J9MA 3F7ZA 4O7YA 3NUSA 2ETKA 5HE2A 3R1QA 4G6LA 3RP9A 5CASA 4QMWA 3WYXA 3OTUA 4ALWA 3EFWA 1REKA 2QOCA 4D58A 3GT8A 3QZFA 4IX5A 2VNYA 3ANRA 3L9PA 4EK8A 3ZONA 4AP7A 2WKMA 5AR2A 3ZLWA 3OCBA 2IVUA 3FBVA 1PYXA 2QNJA 3RAHA 4EH5A 1ZYDA 4LGHA 3L9MA 4OTGA 4PTGA 2BIYA 2GHLA 2GTMA 4TNBA 3RCJA 4FSMA 5BNJA 5FLFA 4FV0A 4A06A 4AUAA 4DEBA 4X3FA 1UWJA 3AT3A 3FMKA 4USFA 3Q5IA 4C4FA 4HYIA 3W8QA 4HYHA 3FL5A 2I7QA 3OW3A 4FV7A 4RJ4A 4YNOA 3E92A 4BB4A 3RAKA 3GOKA 3ODYX 4TKSA 5DN3A 3QL8A 5KHWA 3BHUA 1Q41A 2I40A 4PV0A 2PVKA 2PZPA 2SRCA 4H3PA 3BV3A 3HV4A 1OB3A 4NM5A 2YZLA 4Q5HA 2EWAA 4RA4A 2BRHA 3PWDA 4ZZOA 3NYVA 1O9UA 4FSWA 2QO2A 1Q3DA 2RFEA 4NUSA 4UYNA 4C38A 5T3QA 4OBOA 3PIXA 4GJ3A 5GZAA 2VWIA 3UP7A 4X21A 4C33A 2OF4A 3LHJA 3LCSA 3PY0A 3Q4UA 3UNZA 3CGOA 2OXYA 3RM7A 4YC6A 5JFSA 3OD6X 1YHVA 1R78A 5KX8A 4DGOA 5L2TA 3ZDUA 2ZAZA 4W8EA 4Y72A 3ZEWA 3DS6A 4TYGA 4YJTA 5BUIA 4YURA 2WMQA 5E8VA 4I1ZA 3HRBA 4JAJA 4BCPA 4M68A 5C4KA 5F95A 5FTGA 3BEGA 2Z7RA 2IVSA 5CY3A 4UXQA 2PL0A 3QQHA 5E1EA 4IAKA 4BHZA 3GU6A 4XYFA 3QTQA 1J7UA 3OTVA 2NRUA 3HRFA 3OOMA 4YZDA 2X8EA 3G2FA 4ITJA 3UOLA 3TI1A 2QVSE 4UEUA 5KBQA 2O64A 5KKRC 1YXSA 3COIA 2F4JA 3ZTXA 3G9LX 3FWQA 5GZ8A 4CQGA 1L8TA 1GIJA 3QCXA 4ALUA 3HKOA 3BPRA 1J7LA 3NGAA 1CKPA 3DA6A 5IDNA 2WEVA 3FMEA 3D14A 1J1BA 2DWBA 5DE2A 3E8CA 1GZNA 2UW4A 4F09A 4NM7A 1SMHA 2B7AA 1IA8A 2RSVA 3EQDA 1P14A 3OCSA 5FTOA 2XEYA 5HCZA 4DH7A 2Z60A 1DAYA 4YO6A 1QCFA 2XNPA 2PUUA 3KB7A 4FKPA 5GIOE 4ASXA 4FGBA 3KY2A 5EM8A 2ZMCA 1OECA 4FTJA 5L2SA 4GT3A 5ETCA 4FKVA 2VX3A 4PP9A 1ZYSA 4U80A 2XF0A 2OW3A 3W33A 3JPVA 3D4QA 2XKCA 4UWYA 5C03A 4F70A 4RIWA 4DITA 4FTNA 4HVIA 4IDVA 4AW5A 2X2MA 4NEUA 2BALA 3OWLA 1GIHA 3FHIA 4X2KA 1Q61A 3LFBA 3QRIA 5AR4A 2Q0BA 5HBHA 4U41A 1Q8ZA 2HK5A 3LFAA 1PMNA 4R1YA 4FIEA 2BAQA 5HQ0A 3PVWA 2A1AB 4H36A 5E8XA 1Y91A 4I41A 4E4MA 1B6CB 1QPDA 2IZUA 3H0YA 4BL1A 4EHGA 5JGBA 3N51A 5DG5A 2VX1A 5E8UA 3EQIA 3KXXA 3VC4A 4E6DA 3MVHA 1Q97A 2QOFA 3E3BX 4NIFB 5EW3A 3HAMA 3BCEA 1QL6A 4BR3A 3W8LA 4AZEA 3ZO2A 1ZOEA 4KINA 4CFVA 4DAWA 4EUTA 3QQGA 4L8MA 4F9YA 2PZIA 3R9OA 2B53A 2ITTA 5LMKA 1IAHA 3EFKA 4LGDA 1PHKA 5I4NA 3VS0A 5J1VA 5TF9A 4X3JA 1Q8TA 3G15A 1FGIA 2BILB 3JR1A 4O7NA 3NLBA 5CEQA 3VBQA 3ORZA 5CZHA 1QPCA 1OPJA 2E9UA 4CV9A 1FVRA 2NPQA 4FI1A 4D2VA 5CT0A 5KMMA 3R04A 2LGCA 1UU9A 3ZCLA 2W1CA 5E8YA 4I22A 2GNFA 2PHKA 3BLHA 3FMNA 3QA0A 3ORKA 3U4UA 4AA4A 3FYJX 3AGLA 2HWPA 2WPAA 4IB0A 1J1CA 3R7VA 3A7HA 1NXKA 4IH8A 5CEOA 2WTJA 1VZOA 5L8JA 4ZLYA 1PXMA 2PMOX 3UP2A 5J79A 1OKZA 3QGYA 2YLEA 3ZUTA 3TNHA 4JBOA 3NYNA 1DI8A 4KKHA 3KVWA 4I94A 3VN9A 2WQMA 3CTQA 4TWPA 3TTIA 2O5KA 4I92A 5CNNA 3LLTA 4ZTSA 2G2FA 3M2WA 4JQ8A 3BLRA 4AGCA 4IBMA 4XMOA 4AXAA 4K11A 2YDIA 4WNMA 2VV9A 4JBQA 5K0XA 3HA6A 2JIVA 4GSBA 4O0RA 4FL3A 5AX3A 5H8BA 3PSDA 2JKKA 2R0UA 4L3JA 4JG6A 4RWIA 3MWUA 5K4JA 3MESA 4C3RA 4NKAA 2BRGA 5AIRA 3DB8A 4M69B 3QGWA 4FKLA 2CGWA 4FTLA 1RJBA 5JGAA 4O7SA 2XIRA 5M44A 3I7BA 2HW7A 5HESA 3RWPA 3UO4A 4FT5A 2BMCA 3BBWA 2XKFA 3IPHA 4OW8A 4YTFA 2R3MA 4PRJA 4RPVA 1OKYA 2B4SB 4U45A 3SHEA 4FOCA 3UC4A 1YI3A 3B8QA 4OAUC 3GU4A 3U55A 4TNDA 5EOLA 1OI9A 2EB3A 4W4WA 1NT2A 4IANA 2WZJA 2V7AA 4BI1A 4Z7HA 4Z3VA 3UZTA 5H9BA 3CQEA 4L44A 1V0OA 4R6VA 4ZTHA 4YSJA 3ZUVA 3GU7A 4FSUA 4IMYA 3LE6A 2PE1A 3MJ2A 1FVVA 3OMVA 4C4EA 5JEBA 5IQGA 4WSQA 1JAMA 5BVDA 4QMYA 1XH9A 2UZVA 3SW7A 2CNVA 3P1AA 3O0GA 3JVSA 4XV3A 4JQEA 3PLSA 4AF3A 2QOHA 3IGGA 4ZTMA 4YLLA 2CN5A 3OY3A 4BWPA 3KRLA 4DCAA 5C4LA 3FLZA 5CQWA 4ZJIA 3BYOA 1VYZA 4ANSA 3RPRA 5IEXA 1BKXA 1Y6AA 4MAOA 3H9FA 1BLXA 3D15A 3G5DA 4G3CA 5AV0A 4FEVA 1Q4LA 2R3QA 5FQDC 1CSNA 4ACCA 1OL6A 2UZOA 5IDPA 2VRXA 3FXXA 4M15A 3RAWA 4IAIA 4BYIA 2YEXA 5I9WA 2YISA 4U81A 3VUDA 2Y8OA 5EQEA 3P4KA 5DR9A 1PXPA 2CCHA 3LJ2A 4K77A 4FG7A 1PYEA 5HVJA 1O6LA 2CMWA 3RHXA 2IVVA 1HOWA 3F5PA 1M7QA 4D5HA 4BWKA 4AZSA 4G6NA 2HENA 5HG9A 4DGLC 4BBMA 3GC8A 3KKVA 3NS9A 4Y5HA 4XOZA 5FM3A 4I93A 3WZJA 3CP9A 4ZTQA 3D7TA 3KU2A 4KSQA 2B9HA 4ZXTA 4MXXA 1KOAA 2ITOA 3VAPA 4GL9A 4BDIA 4X6QC 3CEKA 2X6EA 4MD8E 4QT1A 5B0XA 4UB7A 4J52A 3DDPA 3IDPA 2ONLC 3O7LB 5I9XA 4O7LA 1ND4A 4RIYB 4DFNA 3QD0A 3LQ3A 4BBEA 4GFMA 4FMQA 3OBGA 1QPEA 1WVYA 4H1MA 4AACA 4DEGA 2IO6A 3ORXA 4FVQA 2J0KA 3QKKA 4FKGA 4II5A 4ZEGA 3ZLYA 2OF2A 4DEHA 5DEYA 3TM0A 3DBFA 1UWHA 4QO9A 3GFWA 4L46A 3VUKA 4E3CA 1APME 2FYSA 4L42A 3HLLA 4P4CA 4JLCA 4D2SA 3C4WA 1G8AA 3I0QA 2GNLA 3QLFA 4YPDA 3F61A 3CSVA 3WE8A 3PP1A 3L1SA 3QD4A 1YOJA 5IH5A 3TZ8A 4IZ5A 5D10A 1KUTA 3QYWA 3HV3A 4AWIA 3NW5A 3R8ZA 2R3HA 4OTHA 3D5VA 4RJ5A 4IWPA 3VNTA 4ANLA 2VTQA 2QLQA 4R7IA 3R7YA 2WNTA 4DFYA 1OIRA 3EL8A 2BHHA 5A46A 3C0IA 3R8MA 4XBUA 4QMOA 4LUEA 3IG7A 4MX9A 2QOBA 5KMIA 2E9NA 3UJGA 4CCBA 4FV5A 4TWNA 4PPAA 1W7HA 4LOOA 3ORPA 5EM7A 4FGRA 3VIDA 5DR6A 1W84A 4EHZA 3VW8A 3GEQA 3UQCA 4BRXA 4F64A 4ZSLA 3BHVA 4WG5A 3ZRKA 2HAKA 4A9RA 2BRNA 5JZNA 3F5XA 3R00A 3MPMA 3DNEA 3E64A 3GBZA 3OT8A 4QYYA 3ZO1A 3W2RA 5LQFA 2PUIA 4DTBA 4GVJA 4JIAA 5IQHA 5M09A 3TT0A 5HLNA 5BUEA 3FDNA 2DYLA 2ZB1A 5HE1A 5JKGA 1GZOA 3OUKA 1MRUA 4Z55A 4BDJA 3NUAA 3QYZA 1M17A 4QMSA 5CAQA 1O6KA 1O6YA 3WZEA 3MN3A 4FSTA 3LCTA 4FV9A 4RVTA 1UV5A 4E26A 5LARA 5HX6A 5KO1A 3LCOA 5DT3A 1ZMWA 1M52A 4FIFA 1H24A 4M84A 4AE9A 2BRMA 4EONA 3AOXA 5H8GA 5HI2A 1ZXEA 1R3CA 3NUNA 3ZU7A 5CF4A 2C5VA 2GS7A 1WVXA 2CSNA 3AT2A 3DTWA 3I7CA 4FV2A 4IB5A 4CZTA 3PXRA 3W2PA 5CX9A 1P2AA 2QKRA 2P0CA 2X2KA 4IX6A 4KUJA 2BDJA 3PRIA 4IJ9A 1OGUA 4ITHA 3DXQA 5AADA 4YTIA 4ZLZA 4EH8A 3MY1A 4D55A 3IS5A 1OPKA 4WSYA 3V01A 5GJGA 2XYUA 4L53A 2W1DA 2C3LA 3SXSA 4GH2A 3HGKA 2W1IA 3CGFA 3HAVA 3BYVA 2XBJA 4CMTA 3CJGA 4O7ZA 4EH7A 4GYIA 3QAME 3OW4A 4BGQA 4C35A 3R22A 1CTPE 4OR5A 4QQ5A 3G6GA 2CLQA 4RGJA 3UGCA 1JSVA 2EB2A 2PVFA 4E5BA 5BVNA 2VNWA 4EH9A 3V5TA 2H96A 3OHTA 4YLKA 2W9ZB 1URCA 4QP2A 1SVHA 4HGLA 4EOJA 4L9IA 2DUVA 3D5UA 4HOKA 3GC0A 4RMZA 3DKOA 4LV8A 1BL7A 2C6MA 3FI2A 2ZOQA 3A62A 4O27B 3TUDA 2XA4A 5FP5A 3PSBA 5CYIA 1QPJA 3TV4A 4DA5A 3QHWA 4KRDA 4GIHA 5A54A 1XH5A 5J8IA 3VRYA 3K3IA 4E6QA 5I0BA 5I9ZA 4EOMA 4FL2A 4QMXA 4YPSA 4CFNA 5D7VA 2GTNA 3NAYA 5IMEA 3ULZA 4B99A 2WTDA 3TEIA 3QQKA 3S4QA 4ACDA 4WG4A 5IZFA 5CQUA 3R7GA 5BVEA 3W2OA 2RL5A 4EZ5A 3LM5A 3NPCA 4QPSA 4CRSA 2G9XA 3DXPA 3ID6C 1E1XA 2VTIA 3A7GA 3BE9A 5IG1A 5L6OA 3H10A 3MYGA 5IA4A 3W55A 5EKOA 3VRZA 4EOPA 3F3ZA 4A4LA 4ZLOA 2YAAA 5AR8A 3A8WA 1KE5A 2J5FA 3KN6A 3EWHA 3LW0A 4NK9A 4QPMA 4WO5A 3H0ZA 1NVQA 2QD9A 4OT6A 4R77A 4R78A 3SKCA 3PZEA 3RWQA 4AU8A 4Y95A 3DOGA 2H8HA 3UYTA 2Y7JA 3CTHA 3MH0A 3O50A 4KIPA 2WEIA 4Q5EA 4QYHA 3IONA 3L8SA 5I9YA 4F6WA 4BCKA 3P08A 1L3RE 4H3QA 3OWPA 5EFQA 4PL5A 3EQRA 4BGGA 4DFXE 1YXVA 5CI6A 3O23A 3VBTA 5CXHA 4U5JA 3T8OA 4E1ZA 2JAVA 5AWMA 4F99A 4A7CA 4ANNA 4BVUA 3EKNA 4MYGA 5DGZA 5KKRB 2XNMA 2C0OA 3R2YA 5E91A 2UW7A 2QHMA 3ALNA 5DHJA 2ZV9A 3TG1A 3V51A 4C37A 1PXKA 4DT8A 2V62A 5EHYA 5JH6A 3WZKA 1Q24A 3EFJA 2OIDA 4PP7A 4BN1A 2HZ4A 4U3YA 4M67A 5A14A 4BDKA 4EQCA 5DWRA 2Y6OA 4KBKA 4EH4A 4F1MA 5AUTA 5M4UA 1OL2A 4L3LA 1CMKE 3OCTA 3VO3A 3E93A 5CS6A 3U6HA 5HGIA 3ZLXA 3AD6A 4XCUA 1KE9A 3SRVB 4BCGA 4JG7A 2R3FA 1A06A 2C5NA 3NDMA 4KS8A 3SG9A 3OF0A 5DT0A 3FZ1A 4EK6A 2Z7SA 4IM3A 4AGUA 3K2LA 4WBBB 3KK8A 1ZY5A 2OFUA 2J0MB 2OZAB 4ASDA 5AX9A 3QZGA 4RX7A 2WMBA 5BVOA 2ITPA 2RG5A 5KMNA 4DFBA 4I6HA 1MQ4A 4EKLA 4ZK5A 1XBCA 4LM5A 4F7NA 1YDSE 5HVYA 2HCKA 1YWVA 4U7ZA 5A4QA 4Y8DA 3DU8A 3K5UA 4FVPA 3PXQA 1V1KA 4S2ZA 3QUPA 1W83A 1JBPE 3IECA 3PVBA 3DTCA 4FX3A 2W4OA 2WQOA 5HLWA 4I4EA 3LFSA 2XMYA 2GQRA 2X7GA 3T9IA 4LYNA 2R3GA 4ZY5A 3RGFA 3KULB 4MBLA 4EEVA 4HVGA 2R64A 4Z16A 4HCVA 1WVWA 3MB7A 1ZZLA 4CMUA
chains in the Genus database with same CATH superfamily
1F0QA 2OIBA 2VGOA 1PKDA 4FTQA 5KZIA 3HV6A 4Z7GA 3F6XA 4GV1A 3ZXZA 3W0PA 1PKGA 2HZIA 3MPTA 4FKJA 4J95A 4WT6A 3BU5A 3UG2A 3WZUA 4CXAA 4DTKA 2G01A 2KULA 1H8FA 3T3VA 4HVHA 3DAKA 3P78A 2BDFA 3Q3BA 4MXZA 1STCE 4ZOGA 4O4FA 4HVDA 3R2BA 1DI9A 5FEEA 4BCJA 5I9UA 1H28A 2I0HA 4FSYA 3S0OA 5TKDA 2X0PA 3CKXA 3QD2B 2C69A 3EJ1A 4W4YA 5GJDA 3SXFA 3MH3A 4FKTA 4FYOA 3FQEA 5HG8A 3ERKA 1G8KA 4AG8A 3IKAA 3PXKA 3MVLA 4RA5A 3G33A 4JI9A 3GENA 5M07A 3V3VA 4AOTA 4GMYA 4K0YA 1YXTA 4O0VA 4P5QA 1XBAA 4FIJA 3FMJA 3NIZA 3BHTA 3R7EA 3BYSA 5AP4A 4KBCA 5CSPA 3COHA 3V5PA 4YJVA 2HY0A 3R1NA 3PVUA 5ANDA 5ACKA 4IHPA 5CT7A 4NU1A 2DQ7X 5JRSA 4PPBA 3UC3A 4CEGA 3D5WA 4UMUA 2XVDA 1ERKA 2BKZA 2VTLA 3G9NA 3HMNA 4RT7A 3HA8A 4DCEA 4DH5A 1PXNA 1Q5KA 1JNKA 2HOGA 4DEIA 3R01A 4DEEA 2A0CX 3UQGA 4LI5A 5E8TA 2W5AA 3SOCA 4W9WA 4XV9A 4F1TA 5HTCA 2CKOA 4JVGA 3KFAA 4EK5A 3DJ7A 5ANEA 2UZUE 1CM8A 2VUWA 4QQJA 5M56A 3DBCA 2R0IA 3Q60A 4ZSAA 4R8QA 1YOLA 3M42A 2XAOA 2VWXA 4WHZA 4MNEB 2VD5A 3D9VA 2PPQA 5D7AA 4BDEA 2UVZA 1U4DA 1ZOGA 4GVAA 5M51A 3K5VA 2X8DA 3OT3A 5J9ZA 1A48A 1Z5MA 4JQ7A 3ZS5A 3MTLA 2VTTA 4GG5A 4BIEA 2VWUA 4EJ7A 4PUZA 4XEYA 4QP9A 3QCQA 4Y73A 2VWVA 3HP5A 4MQ2A 3BWFA 4AZWA 4EKKA 4EK3A 4C4JA 2Y0AA 3AC5A 1FPUA 3PXYA 3DLZA 3MJ1A 3TZ9A 4BI0A 5EYDA 4YZMA 4PNIA 3OZ6A 1IG1A 3Q4ZA 4IIRA 4HZRA 5D11A 3NEWA 3VWAA 1OBGA 3R9RA 2JDRA 3Q6WA 4WNOA 4AGDA 3HDMA 3GFEA 3OXTA 2FVDA 1JKSA 2QURA 2XNGA 2ZV2A 3FMLA 1WFCA 2C47A 4IVAA 3FPMA 4MHAA 5HIBA 2ITVA 4JNWA 2XM9A 2YIQA 1GY3A 3BRBA 1XKKA 2B55A 4LGGA 5G6VA 2OJIA 5HICA 4DEDA 3G0FA 5I9VA 3EN7A 5JT2A 4FSNA 4YNEA 5L8KA 4WUAA 3C50A 3R7OA 2J0IA 3MTFA 5CSWA 3GCVA 4E6AA 2V5QA 4FKWA 2OO8X 3FHRA 3QHRA 4HNFA 4GUEA 4IAFA 5L2QA 2IEWA 5DR2A 4RBLA 5CWZA 4XP3A 3F3UA 3NMUF 4OT5A 3ETAA 1LP4A 2DS1A 1FMOE 3KRJA 1AD5A 3FKLA 4LL5A 3UTOA 2Y4IC 2WGJA 4OBPA 4C4IA 4CCUA 1URWA 2JDTA 5IUHA 3LMHA 3Q32A 4KAOA 2ETMA 3Q4TA 2UZDA 4RC4A 3COKA 4C8BA 3OOGA 4CTBA 1UKHA 3WYYA 4XG3A 4E4XA 4FSZA 1YDTE 4QYGA 4IADA 5HLPA 4NCTC 5DYJA 3VUHA 4DFUA 4IM0A 3A2CA 1PXJA 2C6LA 2UZTA 3E3PA 3FY0A 4FV8A 3VUTA 1H1WA 5IEYA 4TN6A 5JN2A 3PIYA 4G3FA 4MK0A 5AJQA 4CNHA 4D2PA 2GMXA 1RQQA 3NCZA 2R3RA 3KCFA 4M7IA 5HU9A 3WZDA 3C0HA 2ITNA 3A4PA 3PP0A 2R3KA 3ODZX 1NVRA 3LLAA 4V0GA 5E4HA 1H0WA 4W9XA 3TJCA 4B8LA 3EN4A 4YTHA 5AM7A 3KMMA 3VW6A 1CKJA 4GUBA 2BZHB 1A9UA 4BC6A 4FNXA 3U54A 3C4CA 3I81A 5EG3A 5AUWA 4MUQA 3PA4A 3TJDA 2AC3A 5CAVA 1MP8A 1OZ1A 2GNGA 2FH9A 1VLRA 4HYSA 3A7JA 3FEGA 3BEAA 3TNQB 4DBXA 4A4OA 4O0TA 5EHOA 1FGKA 3H9RA 3HMPA 2PUNA 1KV1A 3PA5A 4XH6A 5AP0A 2X0GA 3FMHA 2B54A 3MIAA 4EBVA 3RALA 3IW5A 4TW9A 3U6IA 4CFWA 4DDIA 3OCGA 3R1SA 3EIDA 4I5MA 3QUEA 3R02A 5AV1A 3ZSGA 1H26A 2YWPA 4CLIA 2FSLX 4RFZA 2I0VA 5I3RA 5HOAA 4X6RA 5LVOA 3E63A 5I5ZA 2WD1A 3QQUA 5EDPA 3NFGB 3QTRA 1W8CA 2FO0A 3TZ7A 4BTKA 4FTMA 4IQ6A 3II5A 2WHBA 4FODA 2F2CB 4F9AA 3KMWA 4DE4A 3N9XA 4I20A 4BCHA 3BBTB 3LXPA 1XO2B 4IVBA 1XHAA 5HCXA 2PSQA 3Q9WA 4F0IA 5DVRA 2XANA 2XRWA 3JYAA 2W1GA 3SV0A 3UOKA 3ALOA 3V8SA 4JIKA 4GEOA 1JKKA 4KKEA 5F4NA 5EQPA 1VR2A 3TUCA 2GS2A 1T45A 3B2WA 4NIFA 4QMTA 4ALVA 3AC2A 2VTHA 3BU3A 4KIKB 3O7LD 4J71A 1YW2A 1ZMUA 4H3BA 4I6BA 4RX8A 3W10A 3UIUA 4FKQA 3PJ2A 5F20A 4AXFA 5HNBA 3Q2MA 4ZZNA 4ORKA 3CJFA 5M4FA 2ITUA 5EM5A 5BMMA 1IEPA 3VF9A 2VTPA 3D2IA 3P5KA 3MFUA 3JUHA 3NUXA 5HO8A 4B9DA 2I0EA 4EHVA 5EYMA 2J90A 1H00A 1H27A 4XUFA 3TKHA 1PW2A 4MKCA 3D83A 4FE2A 4NWMA 1H1RA 1GOLA 4FK3A 5CF6A 2YCSA 5DBXA 3CXWA 4GW8A 1PJKA 4FTCA 3TIZA 5K5XA 2P4IA 4A9SA 4BDDA 4YBKA 5IQDA 4CV8A 1ZWSA 5FP6A 5C26A 4I4FA 5HG5A 2REIA 3M11A 3HEGA 3PG1A 2HW6A 3MDYA 4RVLA 5CU4A 3I5ZA 3LVPA 2CHLA 2F57A 2IZSA 3C7QA 4ONAA 2YIRA 4QMPA 4MH7A 1E9HA 4EOSA 4B0GA 4KNBA 2R7BA 1R39A 2C5OA 3IO7A 3BYMA 1R1WA 5AUZA 2Z7QA 4N6ZA 5HD4A 1UA2A 2JDVA 3AC3A 3COMA 2A19B 3MVJA 4L52A 4X2FA 2OI4X 3D0EA 3O71A 1MRVA 4WNPA 5ANIA 4F0FA 4YZCA 3VS2A 3ZXTA 2X9FA 4NFMA 4CQEA 3PXZA 3EL7A 5CVGA 2WTKC 4KIQA 3G90X 3LJ1A 4O22A 4UV0A 4IC8A 4JAIA 4FNYA 3H3CA 2VO0A 5ETFA 4M69A 3QD3A 2B9JA 5CSHA 4F6UA 3L9LA 3R0TA 3Q2JA 2WQBA 5FUTA 4RLKA 2VO7A 3D94A 3NW6A 4PQNA 2C6TA 3O17A 4PDYA 3Q9ZA 4G31A 2Y6MA 4NM3A 2BCJA 1IA9A 3THBA 4C02A 1G5SA 3A8XA 3S3IA 5B2MA 3F2NA 2I6LA 3EH9A 5IQBA 5M53A 3BE2A 5FDXA 1WBWA 3FC1X 5IUIA 5A6NA 2BHEA 1WBOA 4DT9A 4BDFA 1U5QA 4JJRA 2C6OA 4DYMA 2WB8A 4EUUA 5F1ZA 2QR8A 4RIXB 2XNEA 1XH4A 4HZSA 1E1VA 2WAJA 1X8BA 3GCSA 3HECA 4CD0A 3V5WA 5L2IA 1LR4A 3FSFA 5FRIA 2NRYA 5LMAA 4PDOA 2GQGA 3ZFYA 2C5YA 3P9JA 4AZFA 5CEPA 3QXOA 3R8UA 4BCNA 3IDBA 5KUPA 1CDKA 1ATPE 5E92A 5BMSA 4ACHA 5C8NA 3HRCA 4XG8A 3R8VA 2GSFA 2FSOX 5FBOA 3OS3A 5BQ0A 5GHVA 3HZTA 3MPAA 3RKBA 3U9NA 4AT3A 4FTIA 3BX5A 2QOLA 4O0SA 4BDAA 4P2KA 5IQEA 2W5HA 4EYMA 3GCQA 1Q8YA 3PVGA 4C2VA 4KD1A 2GCDA 4JR3A 3NAXA 4MD7E 5CNOA 4BCIA 2X7FA 2A98A 4MBIA 4EOLA 3Q5ZA 4GT5A 3TN8A 4DLJA 3MA3A 4GK3A 3FI4A 2HWOA 4BGHA 2JKMA 5KNJA 3OXZA 4AGWA 3DLSA 3QRUA 2XK3A 4H39A 4ZSGA 3P79A 4CFXA 1OITA 5L6WL 2CN8A 5JGDA 1NW1A 5AV3A 1H01A 4GCJA 2OSCA 2VO6A 4RIOA 4W4XA 5CU2A 2Z8CA 4TPTA 4OTWA 4NKSA 2X4ZA 3NYOA 1PMEA 4NT4A 4EL9A 3UMXA 2HZNA 4EC9A 4FNZA 4O2ZA 4O0UA 5JK3A 5D9HA 1CKIA 5A4LA 3PZHA 3BGQA 4IM2A 4R3CA 3VQHA 3AC4A 3LMGA 2HZ0A 3Q04A 3HP2A 3I4BA 4X3FC 3RI1A 4USDA 4I24A 2RIOA 3QTXA 3FZRA 3KN5A 5EYCA 4ZMFA 2XJ2A 4C7TA 3O8PA 4S30A 3LQ5A 2VGPA 4FKIA 4D1ZA 5JMSA 4TY1A 5TE0A 4KIOA 4BF2A 2CJMA 5GNKA 2XNOA 2IJMA 4U8ZA 2X4FA 3ACKA 4NW6A 4R5YA 5M08A 2OXDA 4YJPA 2JFMA 4AN2A 3AQVA 3ATTA 1WAKA 3PWYA 4K8AA 3LCDA 2JIIA 4D1XA 4E4LA 4DHZA 4PDPA 4BYJA 3SVVA 3FI8A 4O7TA 5D1JA 4Y85A 4Q9ZA 2A2AA 1NY3A 2XH5A 2J5EA 4R5SA 4AOIA 5HBJA 2QODA 3E8EA 3BU6A 3TDWA 4QD6A 5AUYA 3R8LA 2XK6A 5J9LA 3V6RA 4U3ZA 3TDVA 3LZBA 2ITWA 3V8TA 1JKLA 3WE4A 4N0SA 2IZRA 3PUPA 3RK5A 5I3OA 5LWMA 3PY1A 2J0LA 2YABA 3L8VA 3UVPA 4APPA 2ZDUA 2JFLA 4UXLA 2GHGA 2PYWA 1SYKA 4C2WA 4FKUA 3F66A 4YSMA 3DNDA 2O8YA 2WQEA 3ZLSA 4D4YA 4ACMA 3OY1A 3R21A 4O1OA 3UYSA 2PVHA 3EB0A 4J53A 3ZBFA 1SVEA 3ANQA 4X0MA 2I0YA 1WCCA 4YP8A 1H25A 2YM6A 3MH2A 3ORNA 3DXNA 4G2FA 3TZMA 3UMWA 3O51A 2J7TA 3CLYA 3UVRA 2BVAA 4XG6A 2XM8A 3NSZA 5KMLA 5LJJA 3VBVA 4O0YA 5EKNA 4NH1A 4U40A 4TXCA 2XBAA 3DPKA 3F69A 4DG0E 1U59A 1JWHA 5JRQA 1JKTA 4XP2A 2X2LA 1V0BA 4FOBA 3KRWA 5IA1A 2RFNA 4PMSA 4O7RA 5J9YA 3AMBA 4PDSA 4PTEA 4BICA 1BI8A 3MFSA 3Q53A 5K4IA 4O86A 4BJJA 2R3PA 4CTCA 4R7BA 4AW0A 5AFVA 3FYKX 4S31A 4F08A 3V5QA 5J1WA 1NVSA 3BELA 4RWJA 4XV2A 4ZY6A 2X6DA 3P23A 2J0JA 4I5HA 4F1OA 5HIEA 3EHAA 4PY1A 3LAUA 4QNYA 3FZOA 5L8LA 3UOHA 5BYYA 5AV4A 4ANMA 5HIDA 3SC1A 5BV3A 4FUXA 2G2HA 2XYNA 3C9WA 4LOPA 3W0RA 5HO6A 1F5QA 1ZLTA 3VS6A 1M14A 1TQIA 2PVNA 4BDHA 3BV2A 4XRLA 1UKIA 2V22A 2YDJA 1U54B 4ITIA 5DPVA 3RTPA 4DINA 5TT7A 3ZM4A 3AD5A 2QG5A 3NZ0A 4FT9A 2XK7A 2WU6A 3HNGA 1RW8A 2UW0A 1ZYJA 3KF4A 3RHKA 1GZKA 2W5BA 1F3MC 5CZIA 1SVGA 4QMUA 4YHTA 3WBLA 4C59A 2HXQA 3HL7A 2W1FA 2R4BA 4QRCA 2BDWA 4BFMA 3QTUA 4UWCA 3BKBA 1UNLA 1MRYA 2C5XA 4K1BA 3CY3A 3C4EA 4C61A 3TV6A 5LMKC 5TOZA 5AMNA 4C58A 4BBFA 2PZ5A 2XIZA 3IOPA 4IVDA 5HORA 1WZYA 3UVQA 4EZ3A 3N4UA 2C68A 5CEMA 3C4ZA 4EZ7A 5EI2A 4LV7A 2GU8A 5KMJA 2YM8A 4AFEA 3QTWA 4K9YA 5AA9A 4HVSA 2VO3A 1Z57A 4JRNA 2WMUA 4W4VA 1UU8A 3QKMA 5ANGA 5ETAA 5M06A 4G9CA 2ZM4A 1GIIA 3P0MA 2YACA 3KL8A 4UMTA 3O8TA 4O6EA 4XLIA 4M13A 3PIZA 4DFLA 4XG9A 5CU3A 4NYEA 3F3VA 3UPZA 5B2KA 3DFAA 3F2AA 4XRJA 5ANJA 3L9NA 3EMGA 3R71A 5J7HA 2XB7A 3CQUA 4BY9E 4U6RA 3TCPA 3BL7A 3S00A 1OVEA 3ORMA 5ACBC 4IAAA 3LOKA 4AX8A 3ATSA 4O2PA 4H05A 2ETRA 4IXPA 1XH6A 5HD7A 4F9CA 4DN5A 4EH2A 4LRKA 4FV3A 4JDJA 4GIIA 3RNYA 4D4RA 2OICA 4HJOA 5DA3A 3H4JA 3E87A 3BI6A 4YGAA 4BDCA 4ZAUA 2C30A 4AZVA 4ZS0A 4FV4A 2ACXA 3ZSIA 3FI3A 3NWWA 2Y4IB 3C51A 3WF7A 2XNBA 2B9IA 3IW4A 5AM6A 5J5SA 5M4IA 4WOVA 4O83A 3E62A 5CENA 5HTIA 1H1PA 1H07A 3NUUA 4RFYA 4FICA 5GJFA 5L4QA 4FT7A 3JXWA 3SG8A 3A99A 2QONA 3E8DA 3FV8A 4HCUA 2ESMA 2HYYA 2O3PA 2P33A 3DJ5A 3RK7A 1W82A 3H9OA 3ULIA 2OXXA 2W17A 4TYHB 3FLNC 3TL8A 3FUPA 4EORA 4YJNA 2UUEA 4WBOA 4AW2A 4FIGA 4L67A 3F7WA 3LIJA 4PMPA 3OXIA 5BVKA 4KSPA 4BTMA 2W99B 2CCIA 5JFWA 1TFFA 1H1QA 3L8PA 4MXOA 3ML1A 4S32A 4QYFA 3UODA 2UZLA 3VBYA 3TTJA 5FXRA 1OIQA 2CGVA 1XR1A 2WMVA 3ZHPC 2QO9A 3FKNA 4DG3E 2OWBA 3LKMA 1JSUA 3HMIA 3QRTA 5HNIX 4FIHA 4I6QA 4ZTNA 2B1PA 4EH6A 4QEBA 2QCSA 4C3FA 4FJVA 3PFYA 1I09A 1FINA 5ANOA 3F88A 3SRVA 2QOIA 2UZEA 2Y9QA 1Z9XA 3U4WA 4XV1A 3UZRA 2R3JA 4P90A 2W4KA 2WMRA 2BR1A 1NA7A 5DT4A 5HZNA 2IG7A 3QZHA 1TKIA 5CANA 4F65A 2ZDTA 4TYJA 2Q83A 2WMAA 2OZAA 4ID7A 4L01A 5BX0A 2A27A 2OFVA 4CMOA 1XQZA 2X1NA 3F2RA 4BKZA 3N4VA 4PF4A 5EYKA 2PTKA 3R9HA 4GU9A 3IQ7A 4PMMA 2QOOA 4D9UA 4DG2E 4AXDA 3EQGA 2XS0A 4A9UA 3PA3A 2IZTA 4JG8A 2WXVA 4K6ZA 4MQ1A 3PE1A 4P5ZA 4UBAA 2PVYA 3RVGA 3ORTA 4DC2A 4W8DA 5K5NA 5IF1A 3FXZA 4D1SA 4DF3A 4H58A 3CE3A 4BWXA 3R30A 2UZWE 3FL4A 3KULA 4E8AA 5IISA 3W2QA 4N57A 3KXZA 3B8RA 3TKIA 3FC2A 2XZSA 1P4FA 5FWKK 4FKRA 5LVNA 3OC1A 2XKDA 4RRVA 3VS5A 3ENMA 3VBWA 2GS6A 3ENHA 4WNKA 2AYPA 4ASZA 1YHSA 1MUOA 5M55A 4J99A 4JRVA 4O4EA 3ZRMA 4GKHA 2V55A 5E8SA 4BCFA 4CYIA 4IW0A 4WRSA 3SX9A 3ZSHA 3PPZA 1DAWA 5CF8A 5BUJA 3QC9A 3AKKA 3TNIA 5KBRA 2VWBA 4YC3A 4ZZMA 4M14A 3C5IA 2JBOA 2R5TA 3OUNB 3VUIA 4LQMA 4N6YA 3JY9A 3BLQA 4ZJVA 2C3IB 3EQCA 3VHEA 4O38A 2QC6A 4R3RA 3N4TA 2BZKB 4DGGA 3P7BA 3QCYA 4RWKA 2XK9A 3UO6A 2W0JA 2XIKA 2RF9A 5HG7A 2CKEA 2QU6A 1PXIA 2O65A 3CD8A 1H1SA 2GFCA 1J91A 1V0PA 4FZ6A 2HXLA 3BHHA 4AFJA 3C13A 3C4FA 5AP7A 3LFFA 4DH3A 5DNRA 4E4NA 4FYNA 4DLIA 3F5UA 4J8MA 3NNVA 4F9WA 5A9UA 2YWVA 4OTQA 1PY5A 5F9EA 4YMJA 3WI6A 2FUMA 3OG7A 4OUCA 4PX6A 3AMYA 4QMNA 4LL0A 2YERA 2GHMA 2WTKB 4FKSA 4ASEA 4EOOA 3NUPA 3TWJA 4TRLA 2VWYA 3HUCA 5FXQA 2JITA 4FSQA 1XJDA 3PPJA 3FJQE 3VUMA 4KRCA 3DV3A 2O2UA 4FG8A 4I3ZA 3BYUA 4IWOA 5AP6A 4CT1A 5CXZA 4BKJA 3A4OX 5FG8A 2IWIA 3KC3A 4N4SA 3BQRA 4HGEA 2JIUA 4RJ8A 4BZNA 2YIYA 1TVOA 2PWLA 3VF8A 4MD9E 1AQ1A 4IEBA 2EXCX 4FIIA 1YXXA 1OBDA 3EKKA 4M3QA 1YQJA 4L00A 1ZAOA 2R3IA 2XUUA 3GI3A 4MNEA 2EXEA 2RFSA 2ZM1A 5HE0A 5AAEA 5KHXA 4XG4A 5ITAA 3GUBA 5K0KA 3BIZA 4BTFA 3R7UA 4GT4A 2O63A 3UOJA 2EUFB 4FZFB 3QTIA 5AR5A 4CRLA 3MFRA 3QU0A 2YFXA 3AC8A 5IQIA 3G0EA 3FLSA 4DBNA 1SM2A 4YTCA 3VS1A 3ZFXA 4J97A 3S1HA 4O84A 2QHNA 3K3JA 4IVCA 4NJDA 5JFXA 2BAJA 5AA8A 2G2IA 4BDBA 4Z9LA 4CKJA 3RM6A 2JKQA 5H2UA 3GP0A 3RMFA 4G16A 4F0GA 2H9VA 3F82A 5IU2A 1ZYCA 4IC7A 2F7XE 2WMSA 1G8SA 3R63A 2FSTX 3OFMA 2NP8A 2X9EA 3MV5A 4OTIA 5DEWA 4RC2A 5E90A 1OL5A 2UW8A 1IASA 4RVMA 4N70A 1ZY4A 4ERKA 1Q8WA 2XARA 2J51A 2W1ZA 2YCQA 3EZVA 3RBWA 4U97A 3W16A 3GC9A 5CF5A 5JFVA 3EYGA 1P4OA 2PMIA 4UX9A 5KCVA 2JBPA 3BGPA 4GFOA 5LOHA 1ZYLA 2E2BA 2RGPA 5DRBA 5CVHA 2G15A 1OPLA 3UIXA 3WARA 2PMLX 5HU3A 4OAVB 2XP2A 4FF8A 4FK6A 2HY81 4RFMA 3A7IA 5AR7A 4RLLA 5C8KA 1IRKA 1HCKA 5TO8A 3NRMA 3AD4A 2VTOA 3QF9A 2B9FA 4GG7A 2WMXA 4IZAA 2XEZA 4WA9A 4RQVA 3SDJA 4U9AA 3UDZA 3RJCA 4HPTE 3KREA 2W96B 4QP4A 1XH8A 1LPUA 3Q9YA 1WBTA 3DGKA 2PK9A 4PTCA 4X2NA 4DHFA 5HKMA 2JKOA 4D2RA 3EOCA 1H08A 4XG7A 5LWNA 5LXMA 3WF8A 5AP2A 2BTSA 3R73A 4X3FB 5CEKA 3LCKA 5BYZA 3V8WA 5L2WA 2ONLA 4YJOA 4FV1A 3AXWA 4JOAA 4ZS4A 3DT1A 3PLAE 3CCNA 2P55A 3E8NA 4F9BA 2BRBA 4FEQA 3GGFA 5M57A 3C5UA 5M4CA 1M2PA 5CAPA 4FBXA 4MCVA 5E8WA 4HGSA 2CGXA 3IW8A 4YR8A 4Y46A 1VJYA 5LMBA 2C3JA 5JSMA 2OZOA 3R7IA 1YI6A 1Y8YA 2EVAA 4PL3A 2OJGA 2RG6A 3U9CA 3OBJA 2WU7A 4TT7A 1KV2A 2YA9A 3HUBA 3ZO4A 4BTJA 3HVCA 3CY2A 4QNAA 1FBNA 3LFNA 3F3TA 3QXPA 2OLCA 4EWHA 3U87A 3CD3A 4I5PA 4X2GA 4EC8A 3HMMA 2PUPA 4R1VA 2YM4A 3R1YA 4MNFA 2R7IA 3VBXA 4GK2A 3FZTA 4UYAA 3R9DA 3AT4A 3TUBA 3P86A 4E6CA 4YZBA 3DK7A 2W7XA 4L43A 3W32A 2XCKA 3W2CA 3ZFMA 2GQSA 3VS3A 2VTMA 3POZA 4C62A 2W06A 4NFNA 4JBPA 1ST4A 2VWWA 2Z7LA 4OLIA 4IWQA 4CYJA 2CNUA 4JDKA 3W18A 4DEAA 3MSSA 4YHJA 1YVJA 4R3PA 3CPBA 3O96A 4YHFA 2VWZA 3I60A 2UZBA 2WTVA 4IFGA 5H8EA 3R8PA 3NVMB 3R28A 5AP1A 2CKQA 2YJSA 4A4XA 1JQHA 5IH6A 2W1EA 3CBLA 4KKGA 2PY3A 4V0GB 5A4EA 2X39A 5HTBA 5E8ZA 3NVKI 2Z2WA 3BHYA 3PY3A 4RG0A 4HW7A 3LXKA 5IQAA 3FZSA 2EU9A 1S9JA 2QR7A 4AAYA 1PMVA 3UNJA 3PJCA 3LFQA 3QRKA 4LRJA 4C36A 3QCSA 3QA8A 4KIKA 4G5JA 3UO5A 3F9NA 5EOBA 2GFSA 3FXWA 3ZZEA 2BUJA 5BVFA 4OTFA 3HDNA 2LAVA 4QTDA 5DLSA 3DKGA 1J7IA 3IW7A 3QC4A 3I5NA 4XJ0A 4CGAA 5HEZA 4IX4A 3EN9A 3TXOA 3ZC5A 3D5XA 3BGZA 4BZOA 4JX3A 3MI9A 1K3AA 4FG9A 4MEDA 5EK7A 4BCOA 4CZYB 2IW6A 4AXCA 2QU5A 4PMTA 4EOQA 3QWKA 5CU6A 3ZRLA 4AAAA 1YKRA 4YJUA 4F7SA 5AV2A 3CTJA 4XP0A 2WIPA 2YJRA 4LUDA 4RIWB 1Q62A 2XK8A 2ZB0A 2C6EA 3Q9XA 4WKQA 4FKOA 1G3NA 4FZAB 3LFCA 3AMAA 2C0IA 4FNWA 3Q4CA 2R2PA 4J1RA 3SLSA 4AT5A 3R9NA 3CIKA 4G34A 1FOTA 4GYGA 5EW8A 4FR4A 4O1PA 4QDVA 3MVMA 4WG3A 5K9IA 3Q52A 4ACGA 3CC6A 3GNIB 4FT3A 4MF1A 5CLPA 3RCDA 5A4CA 2CLXA 2GNJA 2YM3A 3Q6UA 1WBPA 2IN6A 2PMNX 4I0TA 3WILA 2OU7A 5FD2A 5CALA 3D2KA 2QOQA 4NZWB 3PRFA 4YC8A 2ZV7A 3V6SA 2XIXA 3BWJA 4TYEA 4IX3A 5C1QB 3UQFA 1K2PA 3RZFA 5BPYA 2YAKA 2YDKA 3TIYA 4D4SA 4FC0A 1FQ1B 4OBQA 3ZMMA 4AQCA 5G1XA 1KE6A 2X0OA 4QMZA 5IA3A 5DRDA 3UDTA 1B39A 4UWBA 2GPHA 3NCGA 4YJSA 2WFYA 3DY7A 2BFYA 4OTDA 4MXYA 5J87A 3DK6A 3UNKA 4D2WA 4TTHB 4ZIMA 3FQSA 3TNPC 3W1FA 1YXUA 2HIWA 4BCMA 4D2TA 4MF0A 1KE7A 2UW3A 4GJ2A 4WD5A 4JDHA 4ANBA 4D0WA 4GU6A 4RIXA 3EN5A 3DAEA 3NR9A 1IAJA 3KXGA 5E9EA 3F5GA 3PJ3A 4TZRA 5LCJA 3IW6A 3ZDIA 5LVMA 3E5AA 3LFDA 1OL1A 2YIWA 4JDIA 5A4TA 3ZYAA 1R0PA 1Y57A 3AG9A 3SD0A 3KIOC 2IPXA 4QPAA 3VJOA 4KBAA 5BYLA 1UU3A 1YWNA 1Q8UA 4IB1A 2F2UA 4JR7A 3A60A 3EQPA 2AUHA 2OJJA 5C01A 3K54A 3PXFA 4ERWA 4IWDA 2OBJA 1PXLA 3GOPA 3MY0A 4O21A 3KK9A 1GZ8A 3H30A 2C1BA 2YM7A 4A9TA 5CU0A 4EQUA 3UBDA 2IVTA 4XHKB 2JD5A 5FBNC 3PTGA 4EBWA 4K18A 3V5LA 3GU5A 3DBQA 4HNIA 4QMMA 2BPMA 2I1MA 1S9IA 2P2IA 3OROA 3EFLA 4D28A 4HYUA 4L68A 3A7FA 4B7TA 5L6PA 2XK4A 3FY2A 3KCKA 4C0TA 4ZSJA 2V7OA 3D7ZA 2YLFA 4A07A 3RPSA 4FVRA 2R9SA 2WO6A 3EN6A 1OUKA 4CFFA 2B0QA