4U45A

Map4k4 in complex with inhibitor (compound 25)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
300
structure length
289
Chain Sequence
DIDLSSLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPDDQLWLVMEFCGAGSITDLVKNTKGNTLKEDWIAYISREILRGLAHLHIHHVIHRDIKGQNVLLTENAEVKLVDFGVSANTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPSTEQLLKHPFIRDQPNERQVRIQLKDHIDRTRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase kinase kinase kinase 4
publication title Fragment-based identification and optimization of a class of potent pyrrolo[2,1-f][1,2,4]triazine MAP4K4 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 93
structure length 289
sequence length 300
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4u45A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4u45A01
3HA8A 3P78A 5J95A 4BDDA 1XH6A 2WTWA 4X3JA 1MUOA 3W2CA 1OL2A 4IZAA 4CGAA 1ZZ2A 3NAXA 3V5WA 4AQCA 5DE2A 2OH4A 2UW4A 4FKRA 4D1SA 2ZV7A 3F3TA 4L68A 4EOSA 3AC4A 3LCOA 3QRJA 3DGKA 5BVKA 5FXRA 3WIKA 3DOGA 3DKFA 3ZBFA 3NRMA 4PP9A 1A9UA 3WF5A 2X7GA 5FTOA 2A2AA 2ZMDA 2OLCA 3OMVA 2CNQA 3R1SA 4I21A 4RX9A 4QTBA 5JZJA 3BBTB 2B52A 3QCYA 4FKGA 1BL7A 4PMTA 1RW8A 5IG1A 4RIXB 4I5MA 3SXSA 1RDQE 3TL8A 2FSLX 3A8WA 4RJ4A 5CSXA 4EH3A 4EK5A 1WAKA 3A7IA 3Q9XA 3C7QA 3UZTA 3AG9A 5EHOA 1UKHA 5H8EA 5HO6A 3DK3A 2XIYA 3E64A 3LOKA 3FZTA 1FGIA 4MNEB 3T9TA 3P1AA 4I22A 3VC4A 1W83A 3D7TA 5CLPA 4RQVA 4D2TA 3UPZA 4CFXA 3H3CA 4FTQA 2PZPA 1Q8TA 4H36A 2CGXA 3EKNA 4J98A 4YZDA 5GJGA 4Y8DA 4IJPA 2VNYA 4P7EA 3P86A 3DK6A 2Q0BA 4JAJA 3F69A 4J8NA 4L45A 4DBNA 5IUGA 4ZTQA 2OH0E 3WF6A 2WQBA 4A4LA 4BICA 1RJBA 5BVDA 4ZOGA 5M57A 2QHMA 1VEBA 5M06A 2WTKB 4NZWB 4AFJA 3RK7A 5CEOA 4MHAA 3QHWA 4QPMA 2IW9A 2CLXA 4HGTA 3FUPA 4IZ7A 5FD2A 5JSMA 3KMWA 2IG7A 2WQMA 2BKZA 1KOAA 3NVMB 4V0GB 5J5TA 4GFMA 4PL5A 2ZMCA 3VJNA 2BZHB 3AT4A 1JSTA 2Q0NA 4K18A 3TN8A 2PVLA 3DU8A 2XP2A 5CZIA 3SDJA 3AMBA 4BB4A 4BFMA 4ARKA 4ZSEA 4YSMA 1K3AA 3F6XA 5BYYA 1JKTA 3FZSA 4E4NA 3IDBA 4XG4A 3F3ZA 2JAMA 3E92A 3RPOA 2JLDA 3RPSA 3SC1A 5JFSA 2WTCA 2QOIA 4F7JA 1ZAOA 3FLZA 1R3CA 2OIQA 3GCUA 4ACHA 4ZK5A 2SRCA 3RTPA 2J5FA 2X81A 3KK9A 4I0RA 1H8FA 4MNFA 3ORPA 4OTRA 4O21A 1Q97A 2VTRA 1UKIA 2OZOA 3H9FA 3IPHA 4OTFA 3RWPA 3N4UA 5IZFA 4PDYA 1ZOHA 3LJ0A 3R04A 3VS1A 4PL4A 3ZO2A 4YZNA 2JGZA 2ERZE 4S33A 4WA9A 4FZFB 3TNWA 3KGAA 3R7VA 3LCSA 4EZ5A 3TNPC 1XHAA 3UP7A 3NR9A 5IA1A 3R7IA 2R3IA 2UZOA 4CCBA 5E8ZA 4OTDA 3HV6A 5B7VA 5M44A 5HESA 4RC4A 4G5JA 2CLQA 5CU2A 4MH7A 1SM2A 4CMOA 2C6KA 2YJSA 1P14A 1WCCA 4W9XA 4O96A 1XO2B 5FQDC 5AX9A 3V6SA 5HZNA 2CKOA 3SOAA 3FSFA 5J1VA 1CMKE 1GZNA 3HV5A 4HJOA 4RX7A 5IH4A 4D9UA 3DXNA 1YRPA 3LQ3A 3EL7A 2WB8A 2ZVAA 3LCKA 1YI3A 3VRYA 4YUQA 3NCGA 4MXYA 4WNPA 3PXQA 3TKHA 2Z7LA 3UIBA 4CG9A 2JKOA 5AAEA 4RVTA 2X7OA 3JVSA 2YHVA 4FTNA 4ASZA 3QD0A 5EFQA 1I09A 2AUHA 3DKCA 5JQ5A 4NYEA 5E1EA 4FSZA 3UYTA 3E7VA 3UDBA 5K5XA 5FDXA 2YZLA 2PVRA 1TQMA 4UZDA 2E2BA 4YJTA 4D55A 3L1SA 2HZIA 3NNXA 3NPCA 3PLSA 4OTPA 1REJA 3AC5A 3ZONA 5CEQA 4ZJJA 4CZYB 5IISA 4LL5A 2Y4IB 4G17A 1Q62A 4EOQA 4BWKA 3ROYA 1V1KA 4H3PA 1OUKA 2XRWA 3LFBA 4JJRA 5BUIA 4I24A 3QCSA 2YN8A 2GDOA 4I20A 5EW9A 3P0MA 4L3LA 4M69A 1U54B 3GCQA 3QGWA 4IVDA 4MXCA 3ZRLA 1H26A 4FTLA 3UTOA 4E6QA 2OICA 1NXKA 4HPUE 3D14A 1J1BA 2GQRA 3EQGA 4O82A 3BV3A 4O91A 2PVJA 3IKAA 3OTVA 4NH1A 5CU6A 3MN3A 5LVMA 4Y5HA 4Z55A 3ZH8A 2G2HA 3E3PA 3TT0A 1H27A 3ELJA 2ITZA 2F9GA 3DB8A 1TKIA 4AT4A 3FYKX 2C3IB 3IW8A 1B39A 3F3UA 3NUNA 3D2KA 4AGCA 2I6LA 4F9AA 5JRQA 1KE7A 2W1HA 3ETAA 2XNGA 4K11A 4NIFA 3BGPA 3SV0A 2ONLA 4F4PA 4IX5A 5M53A 4D2VA 2C30A 2RFNA 3OBJA 3ZXTA 3BPRA 3GNIB 3TDVA 2PZRA 3FV8A 1O6KA 3I0QA 2W1FA 5HCZA 4HGLA 3UODA 3GP0A 4IACA 4BZDA 2W99B 3MWUA 2JKKA 3KN5A 3NIEA 4R8QA 4O7ZA 5DR2A 1PW2A 4O86A 2X2MA 2A19B 2IVVA 2CCHA 4RJ5A 4H05A 2FYSA 5IA4A 2J50A 2XNMA 1OBGA 3AXWA 3S0OA 1OIQA 5AV3A 2W5AA 2J0KA 4E6AA 4FKUA 1IASA 3FMDA 2R3PA 3OHTA 5F1ZA 4TT7A 3VBXA 2X0GA 3QUDA 3W2QA 4HCUA 1BI8A 4GIIA 4CFNA 3WE4A 4UWCA 2QODA 4D2SA 4IAAA 4FTTA 3EYHA 4A9TA 5H8GA 3VUMA 3TIYA 4ZS0A 1NVSA 1X8BA 2NP8A 3UVQA 5IDNA 3REPA 3ERKA 3OZ6A 5ANJA 3PJ3A 4IBMA 3NUAA 2IWIA 1CKJA 4RBLA 5E7RA 4RIYA 2B9HA 3Q4CA 4O0RA 2UZBA 5ANDA 4UALA 4TL0A 4TWOA 3QUEA 2X9FA 2J6MA 4XG7A 1P5EA 3R8UA 4BN1A 2A1AB 2IVSA 4U3YA 4C2WA 3GVUA 3DTCA 2QOKA 4K0YA 3SW7A 3CPCA 4BKYA 1XBAA 4I5HA 3QYWA 2VO3A 3QALE 3TWJA 2RKUA 3GFEA 4FKIA 5CNOA 5E90A 3LMHA 2LAVA 3OWJA 4TYHB 4I92A 5TKDA 1FQ1B 5CU0A 1H1SA 1KE9A 2Z2WA 3QTXA 3MV5A 4LOPA 1YKRA 4G3GA 5M51A 4GKIA 3LCTA 4RWLA 4PPAA 5AAFA 4BCIA 4E6DA 3ROCA 4O81A 5DH3A 5IQFA 3KVXA 2XBAA 3DA6A 3LFQA 3PG1A 3JYAA 4IJ9A 4DH1A 5FXQA 3TZ7A 4J96A 4RC2A 5M08A 4QTCA 4BI0A 3PZEA 3ANRA 4MWIA 5EM6A 4C4GA 3VF8A 4EOPA 2JAVA 2C5XA 3MVMA 3G0EA 4F7NA 3NSZA 3NUXA 4KSPA 4DGLC 5ANIA 4FV8A 4JQEA 2PTKA 3E63A 4IVAA 5CVFA 3U6JA 2FVDA 2XYNA 3PG3A 3UE4A 2Z7QA 3KF7A 3O7LB 4BKJA 4DFXE 1JKLA 4Y95A 3PXKA 4ERWA 2JDRA 4E1ZA 2W17A 3DV3A 5HCXA 4E4LA 3MVLA 2AYPA 1UNHA 2ITXA 2UZEA 5D9HA 2C3JA 2R3OA 5HNBA 4GIHA 4BGGA 4PTGA 1FMKA 4JIAA 5CI6A 2JKQA 4CT2A 4O6EA 4BTJA 4G2FA 5M4FA 4GT5A 5AP6A 1ATPE 5EKNA 4YC3A 3EQBA 4MXXA 2XM9A 3EOCA 3HL7A 1NVRA 5AV1A 1BMKA 5CT7A 2X4FA 3ANQA 3B2WA 2QG7A 3CJFA 3QXOA 3EZRA 2RFSA 3E8DA 4I5CA 4AGWA 3C4XA 5C01A 2EWAA 2PSQA 3JPVA 2HAKA 5EM7A 4DE4A 4U5JA 3FAAA 3DJ5A 3GB2A 4C0TA 3U6IA 3EN6A 2C68A 3PY3A 1NT2A 5EDQA 3LFAA 4W8DA 5EDPA 4FL3A 4J1RA 4ZZNA 4QQJA 3SXRA 3WBLA 3FPMA 4A9SA 2GQSA 3N4VA 2I7QA 3H9RA 1OZ1A 2BR1A 2QCSA 3QTWA 3HDMA 4QMVA 3F7ZA 4RRVA 3BLHA 1H24A 3OCSA 3PXZA 1APME 1OITA 3QTSA 4HCVA 2XNEA 4QMWA 4UYAA 2YEXA 4JG8A 4R78A 5C27A 5M4CA 1G8SA 3KXMA 2WMBA 4M67A 2QOBA 4QNAA 4O7RA 3DK7A 2UVYA 1H25A 1PJKA 1OM1A 2WOTA 5JRSA 4L3JA 4E3CA 3COHA 1RE8A 2XEYA 4RJ3A 1OL5A 2R5TA 4ACCA 3CSVA 4JX7A 4BTFA 4FIFA 4GUEA 4LMNA 4NK9A 4AW1A 1E9HA 3QLGA 4KAOA 5HIEA 4C37A 5A54A 3AC2A 3PA4A 3GT8A 4C4IA 2P2IA 5KUPA 1FVVA 2H9VA 4L8MA 1XH4A 4OBQA 5M55A 4C8BA 5LJJA 2BTSA 4IFCA 4HW7A 4JQ8A 4DEBA 4YTFA 2W05A 4IH8A 4I6BA 4NM7A 3FMLA 1YXSA 2PVHA 4AA4A 3R0TA 4XV9A 4AWIA 4EHVA 5CEPA 4JG7A 3PA5A 4ZP5A 4II5A 4F0FA 5C8KA 4OT6A 3TIZA 4RJ7A 4C35A 4OAVB 4D4VA 2QOFA 5D1JA 5DT4A 3OUNB 2WKMA 3UIXA 1SYKA 1DAYA 4DGGA 5A4CA 2WQNA 4H39A 5TE0A 3ZTXA 3NEWA 2BRNA 2WOUA 3DLSA 4HGEA 5BUJA 4NM5A 4QP8A 4PL3A 3LM0A 4I3ZA 3BHHA 5ICPA 4W4WA 1M7QA 3VS6A 2JEDA 3FY2A 5D12A 3FMEA 4MD8E 5EW8A 2VWBA 4HYUA 3R9OA 4FKWA 4QMNA 4MX9A 3K2LA 1H07A 2X9EA 3RNIA 4YO4A 3ZM9A 3CEKA 4C62A 4ZZOA 5J7BA 5LARA 4AZEA 4L3PA 5K4IA 4XG3A 2VWIA 3TCPA 2QR7A 1OIYA 4RJ6A 4EC9A 1OL6A 3VBVA 3TUDA 4M69B 3AD6A 3HLLA 3GU5A 2UZDA 4RQKA 4U43A 3ZLXA 3KREA 2C0OA 1O6YA 2HZNA 3R83A 4O7VA 4WBBB 2OJJA 2C6TA 2XK9A 1U4DA 2ZV2A 4GL9A 4LQMA 3U87A 3W2SA 2UW8A 4G6NA 4YJSA 3NUYA 3GGFA 4TXCA 4IB5A 1Q8WA 3RHXA 4O7WA 3WYYA 1VYZA 3UIMA 4S2ZA 4S30A 2J4ZA 2VAGA 3FKLA 3RBWA 2C3LA 4AF3A 3KXHA 3QQFA 3D15A 4QNYA 3QTIA 4BCMA 3Q9YA 3TNQB 4O7SA 4RIWB 2XIZA 3PVWA 5A9UA 4ACMA 1YXUA 4PTCA 1AGWA 3BZ3A 1Y8YA 2YIQA 3QLFA 5D7AA 3VF9A 5CEIA 4LRKA 3UC3A 5GIOE 4XV1A 4S31A 2AC5A 3TV7A 3RM6A 3HKOA 3OEZA 5CNNA 4I6QA 4KKEA 3T3VA 4IEBA 3DBEA 2G15A 2P55A 3IW6A 5E1SA 3R22A 4QT1A 5HVYA 3ZS5A 4KIQA 1Y6BA 5FM2A 2WMTA 2VX1A 2R2PA 3RHKA 3KRXA 4XMOA 4AU8A 3OEFX 5E4HA 3KXNA 3DAJA 3IDCA 4ZLOA 3W18A 3LXKA 1M2PA 1QPDA 4EONA 3U9CA 3MA6A 3UVPA 2YCQA 4I4EA 3PXYA 3HDNA 1KV2A 4RJ8A 5AP4A 4QQTA 3VBTA 4O27B 3ZM4A 3ZCLA 4QMTA 1OL1A 4QPSA 4BDEA 4DCAA 2CKQA 4UMQA 1OPKA 3WARA 3PE1A 4W9WA 5I9WA 3D2IA 3H0YA 5CXHA 4FG9A 3LMIA 2XJ0A 4EK4A 4UY9A 2VWVA 2UUEA 3AC3A 4WSYA 4QMUA 2WMQA 2HZ0A 1OPJA 2XS0A 4PDPA 3FLYA 3P23A 3EFKA 4FV0A 4FV9A 1PXMA 4L42A 2Y0AA 3F66A 4JI9A 5AV2A 3W8QA 3ZO4A 4GYGA 3FL4A 1YQJA 5CAVA 3RINA 4DYMA 3NYXA 3BWJA 4ID7A 4GU9A 3D5WA 1H08A 2W4OA 5DRDA 5HO8A 5L6PA 2QR8A 3ODZX 3Q53A 5DNRA 5IUHA 5A3XA 4E93A 2R64A 3MDYA 4KD1A 4FYNA 4FICA 3RALA 3HEGA 3ZU7A 1KE5A 4P2KA 3HMNA 3CJGA 5IQAA 3PPZA 2EXMA 2ZAZA 4QYEA 4U81A 4UZHA 3C50A 2PE0A 4WRGA 2ITTA 4Y72A 3COKA 2HXQA 2IZUA 2YZAA 2BRBA 3LPBA 5BVWA 1KV1A 3W33A 3BQCA 2YIXA 4A9UA 4KRCA 4FX3A 4BCGA 1LUFA 2UZLA 3JUHA 5EQEA 1OIRA 2OXDA 5C9CA 5HG5A 4RA5A 2JFMA 2UZWE 1NVQA 3OW3A 2YIRA 4YZ9A 4CG8A 4DN5A 3F9NA 3PSCA 2BUJA 2BIYA 4F08A 3I5ZA 3PVBA 2HY81 3THBA 2EVAA 1KUTA 1WBTA 3HMIA 5DWRA 4F0GA 1UVRA 4CT1A 5HEZA 2FSMX 2PVKA 5CASA 4MEDA 4JL9A 2XKCA 3BWFA 5DMZA 3V5QA 5BMMA 4EK3A 1MRVA 5J9LA 2GHLA 3NX8A 4YR8A 3PIYA 3O71A 5HU9A 5EI6A 4FVQA 1R1WA 1BYGA 4AZTA 3HRBA 2QC6A 4FKJA 5J9YA 5CS6A 2QG5A 5CF8A 4R3PA 3IW5A 3K5UA 4RVKA 5AP3A 1KE6A 2UZTA 3R7UA 2V62A 3TACA 3R00A 4I0TA 4ENYA 3FZPA 4MF0A 1B6CB 3ZXZA 4D4YA 3R1QA 2RG5A 5AP7A 3DAKA 5G6VA 3KL8A 3RCJA 3H10A 4O7NA 2J0LA 4QMLA 1J1CA 4XP3A 4BCNA 3ZSIA 1EH4A 4GH2A 3AC8A 1I44A 4QYHA 2Z02A 3F2RA 4GCJA 3DZQA 4JR3A 4L44A 5J87A 5E92A 2W1ZA 4FV1A 3ZLWA 3ZLYA 4S34A 3FQHA 4YJPA 2PZYA 2XK8A 5AUYA 3DCVA 5KMIA 5I9UA 5KZIA 2QOCA 1RQQA 1YOMA 2UVZA 3QU0A 3F2NA 4DGNA 3R8PA 5KZ0A 3WE8A 1MRYA 4J52A 5KMJA 4BWXA 2YLEA 4F6UA 1YHSA 3LFNA 2X39A 4FKVA 5E8SA 4BCJA 1STCE 4KIOA 5CT0A 4FGBA 2EB3A 4IDTA 3WF9A 3BELA 4DINA 2XBJA 3HRFA 3OCTA 4X2FA 1V0BA 2BCJA 4DF3A 4FL2A 2ITWA 4J53A 1SNXA 3ZRMA 4WO5A 4EQCA 2HENA 2R3LA 1O6LA 4DH8A 4IFGA 3SW4A 4L7SA 3WF7A 3NNUA 4KIPA 4NT4A 4YHFA 3RAWA 4ZLYA 4C4HA 3QCXA 3HZTA 3EB0A 4Q5EA 5HKMA 4XG9A 5I5ZA 3PJ1A 1SVEA 3KULB 3SKCA 4WG5A 1IEPA 3BKBA 3Q6UA 4AOJA 4FTOA 3DQXA 3DKOA 3QC9A 5AV0A 3C0GA 4TYEA 4I94A 2FSTX 4QRCA 3V5JA 2VTIA 4BWPA 2J7TA 5HTBA 1GIIA 4WG4A 3DJ6A 3LIJA 1P4OA 4BZNA 4J97A 5AP5A 3ZOSA 3VBQA 2RIOA 1XH8A 5B2KA 3LCDA 2VO7A 2W9ZB 1Q3DA 4D5HA 4CLJA 2XZSA 5HLPA 4BGQA 5KMOA 5HVKA 5CALA 3MI9A 4IC8A 5DT0A 4PUZA 5E9EA 3MFUA 2QLQA 2YM3A 4FTKA 2XCKA 4MKCA 4FYOA 2W7XA 3DQWA 3ENMA 5L6WL 4C3RA 3R9RA 3MFTA 3CTHA 5EM5A 2DWBA 5JT2A 5JFWA 4W4VA 5FP5A 4FV3A 3H9OA 4NM0A 4RLKA 3Q3BA 3UOJA 4M0YA 4GMYA 2QKRA 4P90A 3IK3A 1R0PA 3A7FA 4NEUA 4JBOA 3ACKA 4U7ZA 3SQQA 3UBDA 5L6OA 2JIIA 3E8EA 3TKUA 4YHJA 1Y91A 3GEQA 4QP2A 3KFAA 1U59A 2V7AA 3PSBA 3HRCA 3NGAA 4N70A 4YURA 4AT5A 4BBEA 4U42A 3L8PA 4EKKA 3A7GA 1BX6A 3SVVA 2YCFA 1W8CA 3HECA 2IO6A 2VN9A 4EQMA 5E8YA 3G2FA 4IAZA 2QONA 4CFFA 2ZM3A 5HORA 1LPUA 1GAGA 4NJDA 5GZ9A 1YW2A 2WU6A 3QWJA 5AUTA 2CGWA 2WTKC 3DXQA 1ZMVA 3DBFA 4FIJA 4BIDA 3BYOA 2R3HA 3KRRA 2W9FB 4LL0A 3K54A 5HD7A 2IVTA 1P4FA 3D5VA 5IUIA 3O96A 4JX3A 3LFFA 4UX9A 4FSWA 2GS7A 1UU7A 3TXOA 3VRZA 4WUNA 3ZLSA 3AMYA 3DB6A 1GJOA 2VZ6A 2QOQA 5IEXA 4CTBA 3QZFA 3NW7A 3R2BA 3LFEA 1YI6A 2X2KA 5HE0A 4IZ5A 3QQKA 5E8XA 4DHFA 2VTAA 3PIXA 5GIPE 5HG7A 5IQDA 4AE9A 5JQ8A 2ZM4A 4QP3A 3COIA 4WNMA 3VBWA 2GNIA 2R3QA 4V04A 4FTCA 5CAQA 3BHVA 3FKNA 3LXPA 3OD6X 4F7SA 3HMMA 3MY1A 4AOTA 2XK7A 4XRJA 3IOKA 3HMPA 5CSWA 2PE2A 4AA0A 4MD9E 3BYSA 5A6OA 1T46A 1BLXA 4EEVA 3ORXA 4DFBA 1ZY4A 3LAUA 1JKSA 4FKTA 4PPBA 1H0VA 2OF4A 4OTQA 3PJCA 4V05A 5M4IA 4KKGA 3NMUF 4FL1A 4BDGA 1Q4LA 3HV7A 5M4UA 2VTHA 4IWOA 4G1WA 3EN7A 3ZFXA 1HOWA 1FPUA 1PYEA 2ACXA 2BROA 3OWLA 1L3RE 5B2LA 4BCKA 3R71A 5ACBC 4YZMA 4Y73A 3FPQA 3FI2A 2VX0A 3CTQA 4GV1A 4IAKA 1WBNA 4IM0A 3FXZA 4K6ZA 4CMTA 3MPTA 5JEBA 4QYFA 3PVUA 4Q5HA 4ANMA 5IA3A 3OXIA 3O23A 3MTLA 3KN6A 3SOCA 4UWYA 5IMXA 3F3WA 4O0SA 4AGUA 5AA9A 3QZIA 4QP7A 1R78A 5HIBA 5BNJA 3UZRA 5CX9A 4DC2A 4DH5A 4R77A 2DYLA 3EQRA 1PKGA 3ORMA 1JOWB 5LCKA 4TKSA 2GTMA 2BZKB 3LE6A 2WXVA 4XG8A 5DLSA 3N4TA 2CMWA 4CKIA 2GMXA 3R30A 5CF6A 4TZRA 3UNJA 4ITIA 4QTAA 5HBHA 3MY5A 2B0QA 5LWNA 4L00A 5TF9A 4C02A 5IA2A 3NUPA 2PUNA 2B4SB 2J51A 5FXSA 1CDKA 3EKKA 1ZYJA 4EBWA 3C1XA 4YPSA 4FGRA 4AW5A 3OF0A 5AWMA 2Y4IC 3WIGA 3POZA 3FMKA 3GOPA 2VGPA 3FMJA 3VUKA 2W1GA 4WBOA 4DTAA 4AZWA 4JBPA 2JD5A 4U80A 3UOLA 2VX3A 4EK6A 5IQIA 2PMIA 3ZSHA 5J9ZA 3PYYA 2PL0A 4FV4A 4NL0A 2IW6A 4D2WA 4HGSA 1Z9XA 4Q9SA 4DGMA 4KS8A 5L2TA 2Y6OA 5GJDA 4DFZE 2PVMA 5L2IA 3RP9A 5IQHA 3O7LD 3SLSA 4YJUA 3PZHA 5H2UA 5C8NA 5EKOA 1SNUA 1Y57A 2XEZA 3OUKA 4QMXA 2VO6A 4NFNA 5KBQA 4A7CA 5ETFA 4J95A 3VS7A 3O17A 2DS1A 2R9SA 4ANOA 5HX8A 2CKPA 2RL5A 1UNLA 2HYYA 4CCUA 4BVUA 4ZSAA 2VGOA 2YM4A 3EFJA 1IAJA 3F2AA 2BDFA 3KXXA 3CXWA 5HCYA 3TM0A 2X8EA 4GEOA 1CKIA 3GQLA 1YDRE 1SVHA 1ZZLA 3KRJA 4I1ZA 4XX9A 2CNVA 4DT9A 2BFYA 2UZNA 3K3JA 4E8AA 5IQGA 4FZ7A 5LMKC 4R1VA 4GFGA 3MH0A 5GJFA 3E87A 3VS0A 4BDFA 4I6HA 1CKPA 4RC3A 2WTVA 2JFLA 4ALUA 3ZUVA 3IQ7A 3BQRA 4FVPA 4LFIA 4PF4A 5DN3A 4YU2A 1OGUA 2UVXA 5DA3A 3ZBXA 3PA3A 3TKIA 2G01A 5KHXA 5M09A 2HOGA 4H1JA 3OOMA 1ZYCA 3PXFA 5J8IA 3BE2A 4NCTC 4DLJA 3GENA 3QCQA 4C33A 2YACA 3LFDA 1QCFA 3MYGA 1ZOEA 2JC6A 3F82A 4G9RA 5AJQA 3VW6A 4D9TA 5HLWA 3VVHA 4C2VA 2C69A 3OT8A 4X6RA 2YCSA 4FSTA 2OG8A 3Q5ZA 2I1MA 4M3QA 4U8ZA 3R1NA 3DPKA 2XKFA 3PPJA 2BALA 2QOHA 3F3VA 2Z8CA 2O2UA 3B8RA 3EN9A 2YM8A 4G16A 2X6EA 3EWHA 2JBOA 3UMWA 4G6OA 4CVAA 1ZWSA 3W16A 3NNWA 4XLIA 3GXLA 3SD0A 4R6VA 4UBAA 4YGAA 4Z7HA 3UNZA 2PULA 3DDQA 3R73A 3QRKA 3UQGA 2BDJA 4QQ5A 5EH0A 4EH8A 3RJCA 2PVYA 4YJQA 3RI1A 3TJCA 2ITUA 1Q8ZA 5A4EA 3I7CA 1PMNA 5HNIX 4BDAA 2QO9A 2REIA 4EBVA 4FI1A 4ZMFA 2WIPA 2ERKA 3OXTA 4MQ1A 3FZRA 3RAIA 3V8SA 4W4XA 4NSTA 5L4QA 3WILA 2J0JA 2YIWA 4FTIA 4L52A 4LI5A 2W4JA 3OXZA 3C13A 2CHLA 1FVRA 2E9UA 4IX4A 3FLWA 3VULA 4FT5A 4CRLA 5IEVA 4Y85A 5FEDA 5IPJA 3U55A 2WTDA 3HVCA 3CGOA 5EYKA 3ID6C 2OGVA 5AUZA 2PHKA 1MRUA 2XIKA 4FG7A 1Q5KA 3QQHA 2XIXA 5JMSA 3IDPA 4O2ZA 5AX3A 2OJIA 3P9JA 3ODYX 3PDTA 5TR6A 4C3FA 3R63A 4KUJA 2E9NA 1Q3WA 4F70A 1PXNA 1UU9A 5FGKA 1Q99A 1YXXA 3I5NA 5EI2A 1ZMUA 3FC1X 3IECA 4WNKA 3D7TB 3R28A 1YWNA 5KMKA 1GIHA 2YCRA 4L9IA 2IZSA 3R9HA 4FEUA 2A27A 4GG7A 3VNTA 4KBCA 1OKVA 2B53A 4X2NA 1WBOA 3GQIA 2QVSE 3NWWA 5BX0A 3FI8A 3SG9A 5FDPA 4DBXA 3T8OA 2HXLA 4OUCA 3CY2A 3I79A 3M1SA 3EQCA 3MIYA 4ANBA 4EUUA 1J7LA 3AC1A 3L8XA 3LFSA 4G3CA 1Z5MA 3A4OX 3NUUA 1QMZA 3QRTA 4RG0A 4OAUC 4FEQA 4Q9ZA 4CZUA 4CQEA 2XM8A 4ITHA 2OIDA 2UW0A 3QWKA 5K0XA 4M97A 3TI1A 3DY7A 4KB8A 1WBWA 5KNJA 5AMNA 1GZKA 3Q9WA 4XBRA 2IN6A 2WELA 4NW6A 3EQDA 4ZTHA 3R1YA 3ZFYA 5A4LA 4EHGA 2BILB 4FV5A 3QC4A 2QOLA 4IE9A 5ANEA 3T3UA 5ITAA 3W10A 3M11A 2W5BA 2GNHA 4KWPA 3L9MA 4I93A 4FZDB 3R01A 2X6DA 3DZOA 5DIAA 3S3IA 4ZY5A 4QO9A 4FNWA 4AN2A 4F63A 1OI9A 4UMRA 4LG4A 1OKWA 4RFMA 3BEGA 5F9EA 1PXIA 5LCJA 4C59A 4D1XA 2CN8A 3RKBA 4J71A 3CCNA 3EJ1A 3WOWA 5AEPA 2NRUA 2IZRA 1BUHA 2WPAA 4NTTA 4ZY6A 2C47A 1JAMA 2R3MA 4ORKA 3PRIA 3VUTA 1Q8UA 3BHTA 2RG6A 4A06A 2FB8A 3KCKA 4U0IA 4DTKA 2BHEA 2UW7A 5CSVA 3V5TA 4YNEA 3HV3A 3COMA 4D2PA 4BGHA 3MH3A 3MA3A 2Y4PA 2WZJA 3RNYA 2F2UA 2VTMA 3OBGA 4GG5A 5IF1A 3OY1A 1YHWA 4EOOA 3FMNA 2YERA 5F94A 1URWA 3DBCA 3A60A 2ZV9A 5CWZA 4N4SA 2QKWB 4IAYA 4QMMA 4UYNA 4BYIA 5JFXA 2O64A 2OZAA 4RGJA 4EH6A 1GOLA 4F6WA 3A8XA 2QNJA 5BMSA 2VTLA 4YLLA 4BC6A 2O65A 2CJMA 2HIWA 2W96B 2UV2A 3QA0A 4BZOA 4EH7A 2RSVA 1O9UA 2UW9A 3EN5A 4IWQA 4LGHA 4PY1A 5T3QA 3QYZA 4X2GA 3VIDA 4KIKA 4NM3A 2XCHA 5LOHA 3BI6A 3BYMA 4M84A 4WT6A 2VD5A 3ORKA 5HQ0A 3GCVA 2EB2A 1ZXEA 4AW0A 1ZRZA 4I41A 4E5AX 4E5WA 4RIOA 1FOTA 4IW0A 5HBJA 4C4JA 3QFVA 2EUFB 4TY1A 4ACDA 4XLVA 5KKRB 3MBLA 3KU2A 5FEQA 1W0XC 4X3FA 4KSQA 5I9YA 3NYVA 4C38A 1YOJA 2XK3A 3KVWA 4DEEA 4OTIA 4F7LA 2ITOA 4YC6A 5HICA 2GNFA 3EFWA 2XVDA 3E3BX 2CGUA 1W7HA 3Q96A 4EORA 1TVOA 4O0YA 2VTNA 4W8EA 4DCEA 5HO7A 1KSWA 4AE6A 3TNHA 5AADA 3BYVA 4OGRA 2PUIA 4TPTA 3KCFA 1KWPA 5BQ0A 2GHMA 3FY0A 4LV8A 1M2QA 4IXPA 3FQEA 2I0HA 3CD3A 3F7WA 2ZJWA 4CV9A 4PRJA 3C5UA 5AP0A 4JBVA 2ZDTA 4XG6A 2X4ZA 4FT7A 4EZ7A 3F5GA 1PYXA 4GK4A 4R3CA 2ONLC 4QP4A 3UIUA 1DM2A 3VHKA 3KY2A 4OTGA 5AR5A 1ZOGA 2YM6A 4JDIA 3VUHA 4LGDA 4LGGA 3DKGA 1DAWA 3BHYA 4O22A 2AC3A 4FKOA 3DLZA 4CFUA 1IA8A 4NIFB 4QMOA 4O7LA 3I1AA 3FMHA 5EOBA 3VJOA 2P4IA 3G0FA 4R3RA 2HK5A 4O1PA 4C61A 2OI4X 4MCVA 2WNTA 4QTDA 3WZJA 1F0QA 3CPBA 3QUPA 3BLQA 3VW8A 1IAHA 1L8TA 3PIZA 4AFEA 4M14A 3N9XA 4MAOA 3PSDA 4YLKA 2R7IA 4EOIA 3G9LX 4HPTE 4CKJA 3FHIA 5CU3A 2Z60A 3G6GA 4HNIA 1WFCA 3SX9A 4YSJA 5HTIA 3MS9A 3FLSA 2QQ7A 3ZDIA 3OWPA 2B55A 5LVLA 5GINE 2WGJA 2ESMA 4XNEA 2OF2A 4FNZA 4YC8A 3T9IA 3F5UA 1Z57A 1PXPA 4FIEA 4DEHA 3CQUA 1ZYSA 2OJGA 4AZSA 4I5PA 4BCFA 5KHWA 4ZSJA 3FI3A 4YPDA 3MPMA 4YP8A 1UWHA 4RIYB 1OMWA 4EZ3A 4UMPA 4ZLZA 4V0GA 4D28A 5EK7A 4LYNA 4O1OA 1DI9A 2IJMA 4R7BA 4EKLA 3VUGA 2G2FA 4ONAA 4FSYA 2F57A 4RT7A 5I3OA 3LM5A 2NPQA 5TOZA 1G8AA 3MGYA 2RFEA 5HTCA 2WMVA 4XUFA 3QQJA 2VWYA 2X7FA 2NO3A 3R02A 3B8QA 4HZRA 2YDKA 3A99A 2V55A 4RVLA 5AP2A 3IONA 5CAUA 4FT9A 4GS6A 2I0VA 1M2RA 2CN5A 2WEVA 3OROA 4P5ZA 4QOXA 3BHUA 5CQUA 3KQ7A 1JWHA 2O5KA 3OFMA 4EL9A 3UYSA 2PZIA 4FK6A 4LUDA 2VWUA 3G6HA 3R21A 1JQHA 4RWIA 1J7IA 2O3PA 4IAFA 4L67A 3CR0A 4JXFA 5CVHA 2I40A 3RK5A 4BDJA 2Y6MA 3NCZA 5J1WA 1FBNA 5EYMA 5K3YA 1XR1A 4K2RA 4B0GA 1E1VA 4YZCA 1U5RA 3HMOA 4K1BA 1MQ4A 2R3RA 3D4QA 4D4RA 4OT5A 4YBKA 4OTWA 4R1YA 4FSQA 1R39A 1VZOA 3LZBA 4XOYA 3TG1A 5D10A 2F4JA 4G34A 3PE2A 4GRBA 5CI7A 3L9NA 4RX5A 5CSHA 3DBDA 3LHJA 2OBJA 2P3GX 4BF2A 3NNVA 4LOQA 5TT7A 2BAQA 4ZTNA 5LVPA 4K8AA 3Q2JA 3ORNA 4TWNA 4HVDA 4G6LA 3JR1A 5EHYA 3GC7A 5AR7A 5T6KA 2QLUA 3RGFA 4BCPA 5EYDA 3QD3A 3A61A 3QL8A 3ORTA 2XA4A 2HELA 5CENA 4K9YA 4WG3A 4U6RA 5HE1A 3MJ1A 4L43A 4WIHA 3UG1A 5C4KA 4GT4A 3NVKI 4IC7A 2BHHA 4BCHA 2HY0A 3JY0A 2YDIA 4IWDA 3E62A 2WMUA 3EFLA 5LMBA 3ITZA 1REKA 3ATSA 5EG3A 2PMOX 3G15A 2XKDA 5BVEA 4DITA 4ZMEA 5IH5A 3UP2A 2Q83A 4MXOA 2C3KA 2OKRA 4FSRA 4FTMA 3PPKA 5DR6A 2YA9A 3ZUUA 3R7GA 4YTIA 4U3ZA 3F5PA 4WNOA 4AAAA 1GZ8A 2VNWA 1PRYA 4ANSA 3MTFA 1NY3A 3R8MA 1H28A 4C7TA 2BFXA 4JQ7A 4RFZA 2XK4A 4H3QA 5AUXA 5L8KA 1VYWA 3CTJA 4CQGA 3DAEA 3TZ8A 3DDPA 3KMMA 3Q60A 4IM3A 3UMXA 3IGGA 3RPRA 1WVWA 4RA4A 5HG9A 4DAWA 2YITA 5JGDA 1BKXA 3I7BA 4YO6A 5CZHA 4ZXTA 3VUIA 2E9OA 4A07A 2GCDA 2GSFA 2VTPA 5JGBA 5DFPA 1U54A 5EQPA 1PXLA 5D41A 2FO0A 2WTIA 3E7OA 4YZBA 5K5NA 1JBPE 5JGAA 1UU3A 3PRFA 3OVVA 5CEKA 5HD4A 4FMQA 4RLLA 5BVFA 2J2IB 2W1DA 3KRLA 5KMNA 3R2YA 1Q61A 4OR5A 4C34A 1J91A 2WFYA 4F9YA 4RZWA 3WZEA 3IW4A 4FKPA 5FTGA 3JY9A 4M0ZA 3GC9A 4EH5A 3W2RA 3VS5A 1HCKA 4E73A 4NW5A 2OZAB 1P2AA 3RVGA 2FSOX 3A62A 4L7FA 2PPQA 2JIUA 1VR2A 4KS7A 4FNYA 4Z7GA 5EQYA 1H00A 3TDWA 3TV4A 3QF9A 5IQEA 4WHZA 3BCEA 4EQUA 3EMGA 1Q8YA 5CANA 3LLAA 4USFA 4IDVA 5D7VA 2VTOA 4N6YA 4BBFA 5LXMA 2BRHA 3VO3A 1UV5A 3O8PA 4D58A 3C4FA 3G90X 4RWKA 2QOOA 4CYJA 2UW3A 4HVHA 4FV7A 3UQFA 3LJ1A 5EW3A 5FUTA 4WUAA 1JLUE 2HZ4A 5E91A 4AN9A 2KULA 4AACA 3ZEPA 3RAKA 1QL6A 3D5UA 3LXNA 4D0WA 2OXXA 4U79A 2OFUA 3CD8A 4QQCA 4TW9A 5BPYA 1YDSE 4GU6A 5JH6A 4IB0A 3MVHA 2VTQA 4GW8A 4NU1A 1PMVA 2JDOA 3I60A 5LWMA 2FGIA 2W4KA 3FZ1A 3LLTA 4AA5A 4M68A 5KCVA 5HLNA 3QRIA 1H0WA 4UXQA 2ETKA 2XRUA 4UB7A 3DBQA 3FXWA 4IQ6A 4O0WA 1JVPP 4XP2A 3DFCB 1ND4A 4F0IA 2IPXA 5H3QA 4ALWA 2O0UA 3R8ZA 5BVNA 3RAHA 3QQGA 3GOKA 5I4NA 2R3FA 2WMRA 4CKRA 2Z7SA 4JT3A 2XKEA 4TYHA 2J5EA 4UN0C 5AM7A 1XKKA 4I0SA 3PVGA 1FMOE 1YVJA 5I0BA 4GK3A 3C5IA 3QAME 2W06A 2YJRA 3C0HA 3GU7A 5ANKA 4AW2A 4XG2A 3OS3A 3U9NA 3HAMA 3AT3A 3MB7A 3GC0A 2P33A 1LEWA 5JZNA 4P4CA 1YOLA 2ITQA 3P79A 2Z7RA 2BAKA 1XWSA 3FSKA 5IH6A 3O50A 4OBPA 1A48A 1GZOA 2OK1A 4D0XA 4A9YA 3ATTA 3GCPA 3CKXA 2J9MA 2XIRA 4MBJA 3QGYA 5C4LA 2F2CB 2F49A 1GY3A 1U5QA 4E4MA 2W1EA 2OWBA 2VWXA 1XQZA 3U4UA 3EQIA 5CQWA 3OP5A 3TJDA 2C0IA 3UOHA 5CSPA 5J5SA 2PUUA 2J0IA 2X8IA 4DEIA 1K9AA 2CCIA 3BGQA 3VN9A 2WMAA 4AS0A 4IANA 3IO7A 4TWCA 5E8WA 3OW4A 1OPLA 4G3DA 2WHBA 1OUYA 3A4PA 3NDMA 2G9XA 3P7BA 4IWPA 3FLNC 3H0ZA 4H58A 5ETCA 3TTIA 4EOLA 1JSVA 2J0MB 4FUXA 4ZS4A 3R8LA 4ANQA 4FOCA 3E93A 4B8MA 3DNDA 5A6NA 4WD5A 4M7IA 3RCDA 3PP0A 3ZC5A 3FYJX 2XH5A 3P5KA 4CYIA 2WAJA 3PWYA 4BI2A 5GNKA 1IR3A 2YISA 3A7HA 3MY0A 5DI1A 3UGCA 3S1HA 1CTPE 3A2CA 4J7BA 5C03A 3TUBA 3EL8A 5HNGA 3V8TA 4PMMA 4KINA 4JRVA 4GSBA 2I0EA 3FLQA 4KRDA 3V01A 4D1ZA 4F1MA 3KF4A 4QMQA 4QTEA 5CXZA 2V0DA 4ZJVA 5M56A 4FK3A 4MD7E 5FBOA 3FXXA 4TRLA 3L9LA 3Q6WA 4RPVA 4F64A 5IKWA 1LP4A 2PYWA 2VO0A 5C1QB 1WBSA 2X2LA 3K3IA 3I4BA 4YLJA 5K4JA 4G5PA 1ZY5A 1H4LA 3FZOA 4LMUA 1M17A 4U44A 4IX3A 2R3JA 1FVTA 3BX5A 4KNBA 2QI8A 3SG8A 3V3VA 4I4FA 3CP9A 3EHAA 4OTHA 3CE3A 4U40A 3TV6A 3VS2A 3MPAA 1NW1A 4ZTSA 5ETAA 4DH7A 3HUBA 3AT2A 3SAYA 4MQ2A 2Y7JA 4PNIA 3P7AA 3S2PA 4F9CA 1W84A 3LJ2A 3U4WA 2VRXA 3LQ5A 4R5SA 2WQEA 1IA9A 2R4BA 4BHZA 1R0EA 4UEUA 4F65A 2UZUE 4FR4A 5D11A 4KKHA 4DEDA 5I3RA 4FBXA 2VUWA 3P7CA 3W55A 4IZYA 3HV4A 2E9PA 2CKEA 4D5KA 4E20A 2R3GA 5L8LA 4U9AA 4ENXA 3E88A 4M66A 4MBIA 4PNKA 3Q5IA 2B9JA 2YLFA 4FUYA 1JKKA 4XRLA 2C6DA 1M7NA 2HWPA 1OKZA 3QKMA 4JS8A 4FIIA 5FP6A 3OC1A 3E8CA 5AFVA 2C1BA 1YXTA 4NFMA 4CFVA 4FSNA 2XNNA 1PHKA 3Q32A 4IX6A 4A4OA 4E5BA 2F7EE 3WZKA 4FTUA 1PXKA 2B54A 3ET7A 4RFYA 2V22A 4W4YA 5HGIA 3EH9A 2XF0A 3ZRKA 5GZ8A 2GNGA 3NW6A 3HAVA 2C4GA 3RPVA 5FM3A 1JPAA 1YDTE 4FC0A 1OB3A 3D83A 4GYIA 2GFCA 5DOSA 4GJ3A 3RM7A 2BDWA 2YIYA 4IVCA 3IG7A 4F1TA 1H1RA 3ACJA 3BU6A 3CIKA 1UU8A 3R6XA 4GVJA 4BRXA 5BUEA 2OW3A 4QD6A 5C8MA 4BBMA 2GQGA 3HX4A 3NIZA 1XH9A 4GFOA 4L53A 4ZTMA 4EOJA 2UZVA 4MK0A 3UO4A 4LRJA 2ZB1A 3PJ8A 1QPEA 2B9IA 3PWDA 4JNWA 4LUEA 3R9NA 2DUVA 1F5QA 2XJ2A 2CSNA 3CKWA 3K5VA 5BYZA 2OXYA 4QP6A 4F99A 3NUSA 3QQUA 4FEWA 2QD9A 5L2SA 5G1XA 1XBBA 4LOOA 2HWOA 5E8VA 5CYIA 1PMEA 2F7XE 3NAYA 3PXRA 1K2PA 3O8TA 4R5YA 4DTBA 4NKAA 4Z3VA 4J99A 4X0MA 4DGOA 4Z16A 3ZZEA 3WZDA 3Q52A 1OECA 4FODA 1W98A 4L6QA 5AR3A 3GU8A 4CFMA 4O7TA 2O8YA 4QMSA 5AP1A 4E4XA 3EQPA 4FNXA 2ITPA 2ITNA 2W1CA 3EYGA 3PLAE 3S00A 3U54A 3QTUA 2VTJA 4MXAA 4YJRA 2YDJA 5HOAA 5CAOA 2FH9A 3D94A 4BTMA 5CF5A 3WYXA 4RIWA 2OSCA 3R7EA 5A4TA 3EIDA 2X1NA 5EHLA 3I0OA 3LXLA 4ALVA 2ITYA 3GU6A 1LR4A 1LEZA 3LVPA 4ITJA 2VTSA 3O8UA 5JN2A 2C6MA 3CY3A 3WZUA 2YAAA 5HBEA 3V6RA 3QD2B 5IEYA 4NJ3A 2Y9QA 4EWQA 1U46A 1M52A 1KE8A 4BI1A 4BY9E 3Q4TA 4LRMA 4PWNA 4F1OA 4PP7A 3W32A 3QTRA 2XJ1A 3MFSA 3W1FA 5KBRA 3VQHA 4QMPA 2I0YA 3MJ2A 3QQLA 4J8MA 5LVNA 3EQHA 4I23A 4ZIMA 1UA2A 4JR7A 1G5SA 3PTGA 3FL5A 2CDZA 4HVGA 1TQIA 3MB6A 4A9RA 4XOZA 4JBQA 3UOKA 5LQFA 4JDHA 4YJOA 5FG8A 1OKYA 2A4LA 2KTYA 3QTZA 4ACGA 4HOKA 2R3NA 3G51A 3O0GA 5F4NA 4DA5A 2H8HA 3CGFA 4CNHA 3AMAA 5AA8A 4ZY4A 4MVFA 5IU2A 5KE0A 2C5VA 1SZMA 2GS2A 1GIJA 3BBWA 4KBKA 3TUCA 3RPYA 1CM8A 4JRNA 3S4QA 5IA0A 1XJDA 3H30A 3BU5A 2WMXA 2YWPA 1YWRA 4QMZA 5DPVA 5LVOA 2CGVA 2JKMA 4UV0A 2QO7A 5J7HA 1QPJA 2GTNA 3QD4A 4PMSA 2PK9A 4WKQA 5JK3A 4O84A 4FKLA 5AR8A 4APCA 1IRKA 2JBPA 3EN4A 1V0OA 3HYHA 3V51A 1MP8A 4ASDA 4C58A 4CZTA 4O0XA 1KOBA 1GNGA 3JS2A 4PX6A 4BKZA 1Y8GA 5ETIA 2OU7A 3HP5A 5DBXA 4FOBA 3LFCA 4BIBA 4EYMA 5FLFA 2YAKA 3OCBA 5DT3A 4EJNA 5DHJA 4QYYA 3R8VA 3QKKA 1WBPA 4O38A 4BTKA 2QO2A 5FRIA 4U97A 5AUVA 5IA5A 1TQPA 4AOIA 3AD4A 1AQ1A 4UXLA 2B9FA 3C0IA 3FDNA 2ETMA 4FV2A 2YM5A 4WRSA 3PY1A 5BVOA 3OG7A 2G2IA 1OIUA 3AOXA 5DR9A 2QURA 1MQBA 1WBVA 3RZBA 4TN6A 3ZYAA 3IGOA 4HCTA 4NWMA 4M15A 3AD5A 3UO6A 5A46A 4TWPA 3PFQA 2R0UA 4H1MA 4C4FA 1S9IA 1DI8A 2NRYA 2OFVA 2PVFA 3CQEA 3DT1A 1ZMWA 2C6LA 4P5QA 2E9VA 3AQVA 4QP9A 3ULIA 1PY5A 2GNJA 5I9VA 2H6DA 4FEVA 2C5NA 4IVBA 4MYGA 1CSNA 3M42A 5HE3A 3TTJA 3PY0A 4G31A 4BCOA 2ZDUA 1IG1A 3UZPA 4AP7A 4AUAA 5DEYA 4DG2E 3SRVA 3V04A 3HUCA 4YJVA 2EU9A 1JNKA 3W2PA 4CD0A 5CAPA 5GZAA 3Q2MA 1JSUA 4OW8A 4K33A 5FWKK 2BVAA 3KRWA 4C4EA 4ANLA 1WMKA 4QYGA 4FKQA 3RMFA 5IMEA 3ZC6A 5FBNC 4EH4A 1YXVA 4F9BA 4OBOA 3OCGA 4Q2AA 4CSVA 3JVRA 4GUBA 4XYFA 3R9DA 3W2OA 5AUUA 4OLIA 5AIKA 4ZSLA 4LV5A 2B1PA 5FTQA 4PDOA 4GJ2A 3C9WA 2BKKA 2W1IA 2ZYBA 2ETRA 4X21A 3ZMMA 4TTHB 1PMUA 3DJ7A 2C0TA 4O0UA 4O2PA 5ACKA 2A0CX 5HG8A 3D9VA 2XNBA 2CNUA 3TEIA 5HI2A 3OY3A 5F95A 3ZZWA 3QZHA 3N51A 3V8WA 4QP1A 5JFVA 5DRBA 3GBZA 2GPHA 4BDBA 3CBLA 2WTJA 3EQFA 3V5LA 2ZOQA 5EOLA 3ZFMA 2DQ7X 4JVGA 4M12A 5H8BA 1AD5A 3LMGA 4QMYA 3C4EA 3KKVA 3BRBA 1NA7A 1J3HA 4FT0A 4R7IA 4XHKB 3VBYA 2HCKA 5HE2A 1HCLA 4FTAA 4KBAA 5A4QA 3MFRA 3WF8A 4FTJA 2PY3A 3FE3A 3GCSA 2YFXA 4IIRA 5B0XA 3KXZA 2QU5A 5EM8A 4BDHA 4IMYA 4HVIA 1OVEA 2JDTA 4CXAA 5KKRC 5KMMA 3BE9A 3C4WA 2ZB0A 1S9JA 3QRUA 2ITVA 3QKLA 2BRGA 3WI6A 3VHEA 5IDPA 2VU3A 4UWBA 2XNOA 4JDJA 2P2HA 2V7OA 4JG6A 4BR3A 3KULA 4RZVA 4ZZMA 2BTRA 3BV2A 3TNIA 4PPCA 3DNEA 2R3KA 4X7QA 4BYJA 4N6ZA 2UW6A 2XB7A 4XV3A 2WO6A 1T45A 1ZYDA 5AAGA 3FEGA 3MH2A 4B99A 3C4ZA 3LQ8A 3NYNA 1WZYA 5DEWA 3F61A 1J7UA 5AIRA 2G1TA 2YM7A 4XS2A 3POOA 4O0VA 1PKDA 3QA8A 2GNLA 4DEGA 1B38A 4E26A 2EXEA 2OJFE 4U45A 4F09A 1FINA 5HU3A 3VS4A 3PJ2A 3AGLA 4E6CA 3MW1A 5M07A 4O7YA 3HP2A 3KXGA 3OT3A 4BIEA 4ANNA 3FMMA 4Y46A 3DS6A 1H1PA 4RWJA 3ULZA 4QPAA 3GC8A 4JDKA 3QZGA 4WOVA 4Z9LA 4FVRA 5B2MA 4CTCA 3QHRA 1WVYA 5CVGA 3KA0A 3M2WA 3OOGA 4JLCA 2OJ9A 1OL7A 3HNGA 3NYOA 4HNFA 4ZEGA 3OWKA 2J90A 3IW7A 4RIXA 2BIKB 3FJQE 2PWLA 4EH9A 2HW7A 4RX8A 4I6FA 1V0PA 3UQCA 3CLYA 1WVXA 5KMLA 4X6QC 4DT8A 2XYUA 4AT3A 4FTRA 5HIDA 2BPMA 3VAPA 5CTPA 4M13A 4C3PA 5C26A 5IQBA 3GU4A 1UWJA 2IZTA 3UC4A 2PE1A 3ZSGA 3NW5A 4MNEA 2OO8X 3ZO3A 4D2RA 4DG0E 3ALOA 3KEXA 2JIVA 2YABA 5TO8A 4F9WA 1VJYA 2R0IA 3FC2A 5ANGA 1BL6A 5FEEA 3F88A 4HYIA 3QX4A 4BHNA 3CQWA 3ALNA 3BEAA 4MF1A 5L2QA 2GU8A 4FV6A 2JDVA 3KC3A 4O6LA 3G5DA 4ZTLA 3R7OA 3II5A 2RFDA 3FHRA 3NZ0A 3UVRA 1Q41A 4DG3E 4EK8A 3FQSA 4IAIA 4GKHA 4DFYA 4X2JA 4AG8A 4XP0A 2OIBA 5A14A 4JAIA 3UJGA 3KK8A 4S32A 1XH7A 2O63A 4DH3A 4BDCA 5KX8A 3VUDA 4ERKA 4CRSA 3JXWA 4FSUA 2BZIB 3GI3A 3ORLA 3R7YA 4EI4A 1PXJA 2IW8A 3MVJA 4NTSA 2C1AA 4HYHA 4TNDA 3KB7A 4PV0A 2PVNA 4B7TA 3Q4ZA 4G9CA 4YJNA 4ASXA 2V5QA 1Q24A 4EWHA 4GVAA 2WEIA 3E5AA 4U41A 4E7WA 5DYJA 4B8LA 5CU4A 4MXZA 3HGKA 3UPXA 4DLIA 2Y8OA 2WMWA 4EUTA 4FIHA 3RZFA 3BLRA 4L46A 3ENHA 4ZTRA 4FEXA 4RMZA 5IQCA 4BDIA 4BCQA 2PMNX 5EI8A 2GHGA 2W5HA 1F3MC 2IVUA 1Y6AA 3DFAA 4FKSA 3C51A 3NS9A 4CFWA 5K0KA 5I9ZA 4AGDA 4B6LA 3ZDUA 5J79A 1PF8A 3QXPA 2WIHA 2PU8A 2RF9A 3VS3A 5CY3A 4PDSA 5DG5A 4O83A 3RK9A 4PMPA 3L8VA 4TYJA 1URCA 2X8DA 3MSSA 4YBJA 2GS6A 4ZAUA 4CMUA 3ORIA 2BMCA 3CC6A 3P08A 2HW6A 2VV9A 4YMJA 1DS5A 3H4JA 3KMUA 3AGMA 2BRMA 2F7ZE 3TZMA 3O51A 3RWQA 4EYJA 1M14A 3D7ZA 3MIAA 2C5YA 2LGCA 3GUBA 3G33A 2C5OA 4V01A 4AX8A 4DEAA 4FG8A 2EXCX 5EYCA 4G3EA 4FZAB 4X2KA 4BDKA 5E8TA 2UW5A 3U51A 5CF4A 3UO5A 2C6IA 3D0EA 3I6WA 4MWHA 4TYIA 1W82A 5H9BA 4EHZA 3MH1A 3BGZA 4EOMA 3BU3A 4MBLA 2XUUA 4LM5A 5LMAA 3ZO1A 4GK2A 4MTAA 5L8JA 2BZJA 3L9PA 4PQNA 3ORZA 4AZFA 3U6HA 3MESA 3QX2A 3B2TA 5BYLA 2WMSA 5E8UA 4KABA 5EDRA 5CEMA 4USEA 1FGKA 1YWVA 4RVMA 2QHNA 2VWZA 3OTUA 4AZVA 3I81A 4XBUA 1YHVA 2XK6A 3IOPA 3PUPA 3SRVB 3O2MA 3SGCA 1SVGA 4JIKA 2ZV8A 3EZVA 4YHTA 1PXOA 4EOKA 1G3NA 4FSMA 4K77A 3Q04A 5HVJA 4IM2A 2RGPA 2CPKE 4FE2A 3IS5A 5HX6A 4PTEA 2H96A 2WU7A 4GT3A 4Y83A 3BYUA 2R7BA 3NLBA 4EHEA 4IB3A 3DTWA 4N0SA 3SXFA 4YTHA 2BAJA 4YNOA 4XJ0A 4ASEA 4XH6A 4APPA 5L3AA 1ZARA 4EC8A 2VWWA 3FWQA 2JDSA 3LKMA 4B9DA 4AXAA 5F20A 3CS9A 4XEYA 2C6OA 3W8LA 4IHPA 4G3FA 2WD1A 4FT3A 4WSQA 2VTTA 4AN3A 4EH2A 4NKSA 4F6SA 5AV4A 3FBVA 4CV8A 5KO1A 2FUMA 2NNWB 5AR4A 4UMUA 3FI4A 2P0CA 4HYSA 3S95A 4FZ6A 5HHWA 1UNGA 1SMHA 4TYGA 4IB1A 3C4CA 3G9NA 4L01A 4CEGA 3V5PA 4RSSA 3Q4UA 4FF8A 3E8NA 1YI4A 2H34A 3F5XA 4O0TA 2PMLX 2XNPA 3U8WA 5GHVA 3QBNA 3VWAA 4Y5QA 4B4LA 1BI7A 1QPCA 4HZSA 4NUSA 3LW0A 3Q9ZA 5T68A 5K9IA 2ZM1A 5DGZA 3ZEWA 3QTQA 4CLIA 1E1XA 4TNBA 5AM6A 2GFSA 5L2WA 2W0JA 2B7AA 4FIGA 4ZSGA 4FA2A 4ZJIA 4C36A 4JOAA 4KIKB 4D4SA 4DFUA 3PP1A 4R7HA 5LMKA 1A06A 2PZ5A 3SA0A 1XH5A 1H1QA 3P4KA 4X3FC 3I6UA 3ZHPC 4IADA 3D5XA 3SHEA 1H01A 3BIZA 5AR2A 4H3BA 5I9XA 3GFWA 3FKOA 3UG2A 4HVSA 4UMTA 4XV2A 3UNKA 1ZLTA 2FA2A 4N57A 4M8TA 4EJ7A 2QU6A 4DFNA 1OBDA 3HA6A 4BL1A 4KA3A 4XCUA 3ZUTA 4DFLA 2WQOA 3A7JA 4X3FB 1H1WA 3TZ9A 4NCTA 4A4XA 4YTCA 4C57A 5DVRA 1ZYLA 5AUWA 5JKGA 3DXPA 1XBCA 1ERKA 4USDA 2XMYA 3L8SA 3VQUA 2YWVA 2PUPA 5ANOA 2JITA 2C6EA
chains in the Genus database with same CATH superfamily
3HA8A 3P78A 5J95A 4BDDA 1XH6A 2WTWA 4X3JA 1MUOA 3W2CA 4AXFA 1OL2A 4IZAA 4CGAA 1ZZ2A 3NAXA 3V5WA 4AQCA 5DE2A 2OH4A 2UW4A 4FKRA 4D1SA 2ZV7A 3F3TA 4L68A 4EOSA 3AC4A 3LCOA 3QRJA 3DGKA 5BVKA 5FXRA 3WIKA 3DOGA 3DKFA 3ZBFA 3NRMA 4PP9A 1A9UA 3WF5A 2X7GA 5FTOA 2A2AA 2ZMDA 1ST0A 2OLCA 3OMVA 2CNQA 3R1SA 4I21A 4RX9A 4QTBA 5JZJA 3BBTB 2B52A 3QCYA 4FKGA 1BL7A 4PMTA 1RW8A 5IG1A 4RIXB 4I5MA 3SXSA 1RDQE 3TL8A 2FSLX 3A8WA 4RJ4A 5CSXA 4EH3A 4EK5A 1WAKA 3A7IA 3Q9XA 3C7QA 3UZTA 3AG9A 5EHOA 1UKHA 5H8EA 5HO6A 3DK3A 2XIYA 3E64A 3LOKA 3FZTA 1FGIA 4MNEB 3T9TA 3P1AA 3W0QA 4I22A 3VC4A 1W83A 3D7TA 5CLPA 4RQVA 4D2TA 3UPZA 4CFXA 3H3CA 4FTQA 2PZPA 1Q8TA 4H36A 2CGXA 3EKNA 4J98A 4YZDA 5GJGA 4Y8DA 4IJPA 2VNYA 4P7EA 3P86A 3DK6A 2Q0BA 4JAJA 3F69A 4J8NA 4L45A 4DBNA 5IUGA 4ZTQA 2OH0E 3WF6A 2WQBA 4A4LA 4BICA 1RJBA 5BVDA 4ZOGA 5M57A 2QHMA 1VEBA 5M06A 2WTKB 4NZWB 4AFJA 3RK7A 5CEOA 4MHAA 3QHWA 4QPMA 2IW9A 2CLXA 4HGTA 3FUPA 4IZ7A 5FD2A 5JSMA 3KMWA 2IG7A 2WQMA 2BKZA 1KOAA 3NVMB 4V0GB 5J5TA 4GFMA 4PL5A 2ZMCA 3VJNA 2BZHB 3AT4A 1JSTA 2Q0NA 4K18A 3TN8A 2PVLA 3DU8A 2XP2A 5CZIA 3SDJA 3AMBA 4BB4A 4BFMA 4ARKA 4ZSEA 4YSMA 1K3AA 3F6XA 5BYYA 1JKTA 3FZSA 4E4NA 3IDBA 4XG4A 3F3ZA 2JAMA 3E92A 3RPOA 2JLDA 3RPSA 3SC1A 5JFSA 2WTCA 2QOIA 4F7JA 1ZAOA 3FLZA 1R3CA 2OIQA 3GCUA 4ACHA 4ZK5A 2SRCA 3RTPA 2J5FA 2X81A 3KK9A 4I0RA 1H8FA 4MNFA 3ORPA 4OTRA 4O21A 1Q97A 2VTRA 1UKIA 2OZOA 3H9FA 3IPHA 4OTFA 3RWPA 3N4UA 5IZFA 4PDYA 1ZOHA 3LJ0A 3R04A 3VS1A 4PL4A 3ZO2A 4YZNA 2JGZA 4AQKA 2ERZE 4S33A 4WA9A 4FZFB 3TNWA 3KGAA 3R7VA 3LCSA 4EZ5A 3TNPC 1XHAA 3UP7A 3NR9A 5IA1A 3R7IA 2R3IA 2UZOA 4CCBA 5E8ZA 4OTDA 3HV6A 5B7VA 5M44A 5HESA 4RC4A 4G5JA 2CLQA 5CU2A 4MH7A 1SM2A 1OGYA 4CMOA 2C6KA 2YJSA 1P14A 1WCCA 4W9XA 4O96A 1XO2B 5FQDC 5AX9A 3V6SA 5HZNA 2CKOA 3SOAA 3FSFA 5J1VA 1CMKE 1GZNA 3HV5A 4HJOA 4RX7A 5IH4A 4D9UA 3DXNA 1YRPA 3LQ3A 4QEBA 3EL7A 4AXEA 2WB8A 2ZVAA 3LCKA 1YI3A 3VRYA 4YUQA 3NCGA 4MXYA 4WNPA 3PXQA 3TKHA 2Z7LA 3UIBA 4CG9A 2JKOA 5AAEA 4RVTA 2X7OA 3JVSA 2YHVA 1VLRA 4FTNA 4ASZA 3QD0A 5EFQA 1I09A 2AUHA 3DKCA 5JQ5A 4NYEA 5E1EA 4FSZA 3UYTA 3E7VA 3UDBA 5K5XA 5FDXA 2YZLA 2PVRA 1TQMA 4UZDA 2E2BA 4YJTA 4D55A 3L1SA 2HZIA 2IEWA 3NNXA 3NPCA 3PLSA 1REJA 3AC5A 4OTPA 5CEQA 4ZJJA 4CZYB 5IISA 4LL5A 2Y4IB 4G17A 1Q62A 4EOQA 4BWKA 3ROYA 1V1KA 4H3PA 1OUKA 2XRWA 3LFBA 4JJRA 5BUIA 4I24A 3QCSA 2YN8A 2GDOA 4I20A 5EW9A 3P0MA 4L3LA 4M69A 1U54B 3GCQA 3QGWA 4IVDA 4MXCA 3ZRLA 1H26A 4FTLA 3UTOA 4E6QA 2OICA 1NXKA 4HPUE 3D14A 1J1BA 2GQRA 3EQGA 4O82A 3BV3A 4O91A 2PVJA 3IKAA 3OTVA 4NH1A 5CU6A 3MN3A 5LVMA 4Y5HA 2XALA 4Z55A 3ZH8A 2G2HA 3E3PA 3TT0A 1H27A 3ELJA 2ITZA 2F9GA 3DB8A 1TKIA 4AT4A 3FYKX 2C3IB 3IW8A 1B39A 3F3UA 3NUNA 3D2KA 4AGCA 2I6LA 4F9AA 5JRQA 1KE7A 2W1HA 3ETAA 2XNGA 4K11A 4NIFA 3BGPA 3SV0A 2ONLA 4F4PA 2X0OA 4IX5A 5M53A 4D2VA 2C30A 2RFNA 3OBJA 3ZXTA 3BPRA 3GNIB 3TDVA 2PZRA 3FV8A 1O6KA 3I0QA 2W1FA 5HCZA 4HGLA 3UODA 3GP0A 4IACA 4BZDA 2W99B 3MWUA 2JKKA 3KN5A 3NIEA 4R8QA 4O7ZA 5DR2A 1PW2A 4O86A 2X2MA 1XMMA 2A19B 2IVVA 2CCHA 4RJ5A 4H05A 2FYSA 5IA4A 2J50A 2XNMA 1OBGA 3AXWA 3S0OA 1OIQA 5AV3A 2W5AA 2J0KA 4E6AA 4FKUA 1IASA 3FMDA 2R3PA 3OHTA 5F1ZA 4TT7A 3VBXA 2X0GA 3QUDA 3W2QA 4HCUA 1BI8A 4DHJA 4GIIA 4CFNA 3WE4A 4UWCA 2QODA 4D2SA 4IAAA 4FTTA 3EYHA 4A9TA 5H8GA 3VUMA 3TIYA 4ZS0A 1NVSA 1X8BA 2NP8A 3UVQA 5IDNA 3REPA 3ERKA 4F78A 3OZ6A 5ANJA 3PJ3A 4IBMA 3NUAA 2IWIA 1CKJA 4RBLA 5E7RA 4RIYA 2B9HA 3Q4CA 4O0RA 2UZBA 5ANDA 4UALA 4TL0A 4TWOA 3QUEA 2X9FA 2J6MA 4XG7A 1P5EA 3R8UA 4BN1A 2A1AB 2IVSA 4U3YA 4C2WA 3GVUA 3DTCA 2QOKA 4K0YA 3SW7A 3CPCA 4BKYA 1XBAA 4I5HA 3QYWA 2VO3A 3QALE 3TWJA 2RKUA 3GFEA 4FKIA 5CNOA 2XAMA 5E90A 3LMHA 2LAVA 3OWJA 3UDZA 4TYHB 4I92A 5TKDA 1FQ1B 5CU0A 1H1SA 1KE9A 2Z2WA 3QTXA 3MV5A 4LOPA 1YKRA 4G3GA 5M51A 4GKIA 3LCTA 4RWLA 4PPAA 5AAFA 4BCIA 4E6DA 3ROCA 4O81A 5DH3A 5IQFA 3KVXA 2XBAA 3DA6A 3LFQA 3PG1A 3JYAA 4IJ9A 4DH1A 5FXQA 3TZ7A 4J96A 4RC2A 5M08A 4QTCA 4BI0A 3PZEA 3ANRA 4MWIA 5EM6A 4C4GA 4QDVA 3VF8A 4EOPA 2JAVA 2C5XA 3MVMA 3G0EA 4F7NA 3NSZA 3NUXA 4KSPA 4DGLC 5ANIA 4FV8A 4JQEA 2PTKA 3E63A 4IVAA 5CVFA 3U6JA 2FVDA 2XYNA 3PG3A 3UE4A 2Z7QA 3KF7A 3O7LB 4BKJA 4DFXE 1JKLA 4Y95A 4LV7A 3PXKA 4ERWA 2JDRA 4E1ZA 2W17A 3DV3A 5HCXA 4E4LA 3MVLA 2AYPA 1UNHA 2ITXA 2UZEA 5D9HA 2C3JA 2R3OA 5HNBA 4GIHA 4BGGA 4PTGA 1FMKA 4JIAA 5CI6A 2JKQA 4CT2A 4O6EA 4BTJA 4G2FA 5M4FA 4DHIB 4GT5A 5AP6A 1ATPE 5EKNA 4YC3A 3EQBA 4MXXA 2XM9A 3EOCA 3HL7A 1NVRA 5AV1A 3BL9A 1BMKA 5CT7A 2X4FA 3ANQA 3B2WA 2QG7A 3CJFA 3QXOA 3EZRA 2RFSA 3E8DA 4I5CA 4AGWA 3C4XA 5C01A 2EWAA 2PSQA 3JPVA 2HAKA 5EM7A 4DE4A 4U5JA 3FAAA 3DJ5A 3GB2A 4C0TA 3U6IA 3EN6A 2C68A 3PY3A 1NT2A 5EDQA 3LFAA 4W8DA 5EDPA 4FL3A 4J1RA 4ZZNA 4QQJA 3SXRA 3WBLA 3FPMA 4A9SA 2GQSA 3N4VA 2I7QA 3H9RA 1OZ1A 2BR1A 2QCSA 3QTWA 3HDMA 4QMVA 3F7ZA 4RRVA 3BLHA 1H24A 3OCSA 3PXZA 1APME 1OITA 3QTSA 4HCVA 2XNEA 4QMWA 4UYAA 2YEXA 4JG8A 4R78A 5C27A 5M4CA 1G8SA 3KXMA 2WMBA 4M67A 2QOBA 4QNAA 4O7RA 3DK7A 2UVYA 1H25A 1PJKA 1OM1A 2WOTA 5JRSA 4L3JA 4E3CA 3COHA 1RE8A 2XEYA 4RJ3A 1OL5A 2R5TA 4ACCA 3CSVA 4JX7A 4BTFA 4FIFA 4GUEA 4LMNA 4NK9A 4AW1A 1E9HA 3QLGA 4KAOA 5HIEA 4C37A 5A54A 3AC2A 3PA4A 3GT8A 4C4IA 2P2IA 5KUPA 1FVVA 2H9VA 4L8MA 1XH4A 4OBQA 5M55A 4C8BA 5LJJA 3AKJA 2BTSA 4IFCA 4HW7A 4JQ8A 4DEBA 4YTFA 2W05A 4IH8A 4I6BA 4NM7A 3FMLA 1YXSA 2PVHA 4AA4A 3R0TA 4XV9A 4AWIA 4EHVA 5CEPA 4JG7A 3PA5A 4ZP5A 4II5A 4F0FA 5C8KA 4OT6A 3TIZA 4RJ7A 4C35A 4OAVB 4D4VA 2QOFA 5D1JA 5DT4A 3OUNB 2WKMA 3UIXA 1SYKA 1DAYA 4DGGA 5A4CA 2WQNA 4H39A 5TE0A 3ZTXA 3NEWA 2BRNA 2WOUA 3DLSA 4HGEA 5BUJA 4NM5A 4QP8A 4PL3A 3LM0A 4I3ZA 3BHHA 5ICPA 4W4WA 1M7QA 3VS6A 3W0NA 2JEDA 3FY2A 5D12A 3FMEA 4MD8E 5EW8A 2VWBA 4HYUA 3R9OA 3P5JC 4FKWA 4QMNA 4MX9A 3K2LA 1H07A 2X9EA 3RNIA 4YO4A 3ZM9A 4BJJA 3CEKA 4C62A 4ZZOA 5J7BA 5LARA 4AZEA 4L3PA 5K4IA 4XG3A 2VWIA 3TCPA 2QR7A 1OIYA 4RJ6A 4EC9A 1OL6A 3VBVA 3TUDA 4M69B 3AD6A 3HLLA 3GU5A 2UZDA 4RQKA 4U43A 3ZLXA 3KREA 2C0OA 1O6YA 2HZNA 3R83A 4O7VA 4O4EA 4WBBB 2OJJA 2C6TA 2XK9A 1U4DA 2ZV2A 4GL9A 4LQMA 3U87A 3W2SA 2UW8A 4G6NA 4YJSA 3NUYA 3GGFA 4TXCA 4IB5A 1Q8WA 3RHXA 4O7WA 3WYYA 1VYZA 3UIMA 4S2ZA 4S30A 2J4ZA 2VAGA 3FKLA 3RBWA 2C3LA 4AF3A 3KXHA 3QQFA 3D15A 4QNYA 3QTIA 4BCMA 3Q9YA 2ZFYA 3TNQB 4O7SA 4RIWB 3UDSA 2XIZA 3PVWA 5A9UA 4ACMA 1YXUA 4PTCA 1AGWA 3BZ3A 1Y8YA 2YIQA 3QLFA 5D7AA 3VF9A 5CEIA 4LRKA 3UC3A 5GIOE 4XV1A 4S31A 2AC5A 3TV7A 3RM6A 3HKOA 3OEZA 5CNNA 4I6QA 4KKEA 3T3VA 4IEBA 3DBEA 2G15A 2P55A 3IW6A 5E1SA 3R22A 4QT1A 5HVYA 3ZS5A 4KIQA 1Y6BA 5FM2A 2WMTA 2VX1A 2R2PA 3RHKA 3KRXA 4XMOA 4AU8A 3OEFX 5E4HA 3KXNA 3DAJA 3IDCA 4ZLOA 3W18A 3LXKA 1M2PA 1QPDA 4EONA 3U9CA 3MA6A 3UVPA 2YCQA 4I4EA 3PXYA 3HDNA 1KV2A 4RJ8A 5AP4A 4QQTA 3VBTA 4O27B 3ZM4A 3ZCLA 4QMTA 1OL1A 4QPSA 4BDEA 3W0OA 4DCAA 2CKQA 4UMQA 1XMLA 1OPKA 3WARA 3PE1A 4W9WA 5I9WA 3D2IA 3H0YA 5CXHA 4FG9A 3LMIA 2XJ0A 4EK4A 4UY9A 2VWVA 2UUEA 3AC3A 4WSYA 4QMUA 2WMQA 2HZ0A 1OPJA 2XS0A 4PDPA 3FLYA 3P23A 3EFKA 4FV0A 4FV9A 1PXMA 4L42A 2Y0AA 3F66A 4JI9A 5AV2A 3W8QA 3ZO4A 4GYGA 3FL4A 1YQJA 5CAVA 3RINA 4DYMA 3NYXA 3BWJA 4ID7A 4GU9A 3D5WA 1H08A 2W4OA 5DRDA 5HO8A 5L6PA 2QR8A 3ODZX 3Q53A 5DNRA 5IUHA 5A3XA 4E93A 2R64A 3MDYA 4KD1A 4FYNA 4FICA 3RALA 3HEGA 3ZU7A 3UDTA 1KE5A 4P2KA 3HMNA 3CJGA 5IQAA 3PPZA 2EXMA 2ZAZA 4QYEA 4U81A 4UZHA 3C50A 2PE0A 4WRGA 2ITTA 4Y72A 3COKA 2HXQA 2IZUA 2YZAA 2BRBA 3LPBA 5BVWA 1KV1A 3W33A 3BQCA 2YIXA 4A9UA 4KRCA 4FX3A 4BCGA 1LUFA 2UZLA 3JUHA 5EQEA 1OIRA 2OXDA 5C9CA 5HG5A 4RA5A 4O4CA 2JFMA 2UZWE 4DDIA 1NVQA 3OW3A 2YIRA 4YZ9A 4CG8A 4DN5A 3F9NA 3PSCA 2BUJA 2BIYA 4F08A 3I5ZA 3PVBA 2HY81 3THBA 2EVAA 1KUTA 1WBTA 3HMIA 5DWRA 4F0GA 1UVRA 4CT1A 5HEZA 2FSMX 2PVKA 5CASA 4MEDA 4JL9A 2XKCA 3BWFA 5DMZA 3V5QA 5BMMA 4EK3A 1MRVA 5J9LA 2GHLA 2AEGA 3NX8A 4YR8A 3PIYA 3O71A 5HU9A 5EI6A 4FVQA 1R1WA 1BYGA 4AZTA 3HRBA 2QC6A 4FKJA 5J9YA 5CS6A 2QG5A 5CF8A 4R3PA 3IW5A 3K5UA 4RVKA 5AP3A 1KE6A 2UZTA 3R7UA 2V62A 3TACA 3R00A 4I0TA 4ENYA 3FZPA 4MF0A 1B6CB 3ZXZA 4D4YA 3R1QA 2RG5A 5AP7A 3DAKA 5G6VA 3KL8A 3RCJA 3H10A 4O7NA 2J0LA 4QMLA 1J1CA 4XP3A 4BCNA 3ZSIA 1EH4A 4GH2A 3AC8A 1I44A 4QYHA 2Z02A 3F2RA 4GCJA 3DZQA 4JR3A 4L44A 5J87A 5E92A 2W1ZA 4FV1A 3ZLWA 3ZLYA 4S34A 3FQHA 4YJPA 2PZYA 2XK8A 5AUYA 3DCVA 5KMIA 5I9UA 5KZIA 2QOCA 1RQQA 1YOMA 2UVZA 3QU0A 3F2NA 4DGNA 3R8PA 5KZ0A 3WE8A 1MRYA 4J52A 5KMJA 4BWXA 2YLEA 4F6UA 1YHSA 3LFNA 2X39A 4FKVA 5E8SA 4BCJA 1STCE 4KIOA 5CT0A 4FGBA 2EB3A 4IDTA 3WF9A 3BELA 4DINA 2XBJA 3HRFA 3OCTA 4X2FA 1V0BA 2BCJA 4DF3A 4FL2A 2ITWA 4J53A 1SNXA 3ZRMA 4WO5A 4EQCA 2HENA 2R3LA 1O6LA 4DH8A 4IFGA 3SW4A 4L7SA 3WF7A 3NNUA 4KIPA 4NT4A 4YHFA 3RAWA 4ZLYA 4C4HA 3QCXA 3HZTA 3EB0A 4Q5EA 5HKMA 4XG9A 5I5ZA 3PJ1A 1SVEA 3KULB 3SKCA 4WG5A 1IEPA 3BKBA 3Q6UA 4AOJA 4FTOA 3DQXA 3DKOA 3QC9A 5AV0A 3C0GA 3W0MA 4TYEA 4I94A 2FSTX 4QRCA 3V5JA 2VTIA 4BWPA 2J7TA 5HTBA 1GIIA 4WG4A 3DJ6A 3LIJA 1P4OA 4BZNA 4J97A 5AP5A 3ZOSA 3VBQA 2RIOA 1XH8A 5B2KA 3LCDA 2VO7A 2W9ZB 1Q3DA 4D5HA 4CLJA 2XZSA 5HLPA 4BGQA 5KMOA 5HVKA 5CALA 3MI9A 4IC8A 5DT0A 4PUZA 5E9EA 3MFUA 2QLQA 2YM3A 4FTKA 2XCKA 4MKCA 4FYOA 2W7XA 3DQWA 3ENMA 5L6WL 4C3RA 3R9RA 3MFTA 3CTHA 5EM5A 2DWBA 5JT2A 5JFWA 4W4VA 5FP5A 4FV3A 3H9OA 4NM0A 4RLKA 3Q3BA 3UOJA 4M0YA 4GMYA 2QKRA 4P90A 3IK3A 1R0PA 3A7FA 4NEUA 4JBOA 3ACKA 4U7ZA 3SQQA 3UBDA 5L6OA 2JIIA 3E8EA 3TKUA 4YHJA 1Y91A 3GEQA 4QP2A 3KFAA 1U59A 2V7AA 3PSBA 3HRCA 3NGAA 4N70A 4YURA 4AT5A 4BBEA 4U42A 3L8PA 4EKKA 3A7GA 1BX6A 3SVVA 2YCFA 1W8CA 3HECA 2IO6A 2VN9A 4EQMA 5E8YA 3G2FA 4IAZA 2QONA 4CFFA 2ZM3A 5HORA 1LPUA 1GAGA 4NJDA 5GZ9A 1YW2A 2WU6A 3QWJA 5AUTA 2CGWA 2WTKC 3DXQA 1ZMVA 3DBFA 4FIJA 4BIDA 3BYOA 2R3HA 3KRRA 2W9FB 4LL0A 3K54A 5HD7A 2IVTA 1P4FA 3D5VA 5IUIA 3O96A 4JX3A 3LFFA 4UX9A 4FSWA 2GS7A 1UU7A 3TXOA 3VRZA 4WUNA 3ZLSA 3AMYA 3DB6A 1GJOA 2VZ6A 2QOQA 5IEXA 4CTBA 3QZFA 3NW7A 3R2BA 3LFEA 1YI6A 2X2KA 5HE0A 4IZ5A 3QQKA 5E8XA 4DHFA 2VTAA 3PIXA 5GIPE 5HG7A 5IQDA 4AE9A 5JQ8A 2ZM4A 4QP3A 3COIA 4WNMA 3VBWA 2GNIA 2R3QA 4V04A 4FTCA 5CAQA 3BHVA 3FKNA 3LXPA 3OD6X 4F7SA 3HMMA 3MY1A 4AOTA 2XK7A 4XRJA 3IOKA 2A98A 3HMPA 5CSWA 2PE2A 4AA0A 4MD9E 3BYSA 5A6OA 1T46A 1BLXA 4EEVA 3ORXA 4DFBA 1ZY4A 3LAUA 1JKSA 4FKTA 4PPBA 1H0VA 2OF4A 4OTQA 3PJCA 4V05A 5M4IA 4KKGA 3NMUF 4FL1A 4BDGA 1Q4LA 3HV7A 5M4UA 2VTHA 4IWOA 4G1WA 3EN7A 3ZFXA 1HOWA 1FPUA 1PYEA 2ACXA 2BROA 3OWLA 1ST4A 1L3RE 5B2LA 4BCKA 3R71A 5ACBC 4YZMA 4Y73A 3FPQA 3FI2A 2VX0A 3CTQA 4GV1A 4IAKA 1WBNA 4IM0A 3FXZA 4K6ZA 4CMTA 3MPTA 5JEBA 4QYFA 3PVUA 4Q5HA 4ANMA 5IA3A 3OXIA 3O23A 3MTLA 3KN6A 3SOCA 4UWYA 5IMXA 3F3WA 4O0SA 4AGUA 5AA9A 3QZIA 4QP7A 1R78A 5HIBA 5BNJA 3UZRA 5CX9A 4DC2A 4DH5A 4R77A 2DYLA 3EQRA 1PKGA 3ORMA 1JOWB 5LCKA 4TKSA 2GTMA 2BZKB 3LE6A 2WXVA 4XG8A 5DLSA 3N4TA 2CMWA 4CKIA 2GMXA 3R30A 5CF6A 4TZRA 3UNJA 4ITIA 4QTAA 5HBHA 3MY5A 2B0QA 5LWNA 4L00A 5TF9A 4C02A 5IA2A 3NUPA 2PUNA 2B4SB 2J51A 1W2FA 1CDKA 3EKKA 5FXSA 1ZYJA 4EBWA 3C1XA 4YPSA 4FGRA 4AW5A 3OF0A 5AWMA 2Y4IC 3WIGA 3POZA 3FMKA 3GOPA 2VGPA 3FMJA 3VUKA 2W1GA 4WBOA 4DTAA 4AZWA 4JBPA 2JD5A 4U80A 3UOLA 2VX3A 4EK6A 5IQIA 2PMIA 3ZSHA 5J9ZA 3PYYA 2PL0A 4FV4A 4NL0A 2IW6A 4D2WA 4HGSA 1Z9XA 4Q9SA 4DGMA 4KS8A 5L2TA 2Y6OA 5GJDA 4DFZE 2PVMA 5L2IA 3RP9A 5IQHA 3O7LD 3SLSA 4YJUA 3PZHA 5H2UA 5C8NA 5EKOA 1SNUA 1Y57A 2XEZA 3OUKA 4QMXA 2VO6A 4NFNA 5KBQA 4A7CA 5ETFA 4J95A 3VS7A 3O17A 2DS1A 2R9SA 4ANOA 5HX8A 2CKPA 4AXDA 2RL5A 1UNLA 2HYYA 4CCUA 4BVUA 4ZSAA 2VGOA 2YM4A 3EFJA 1IAJA 3F2AA 2BDFA 3KXXA 3CXWA 5HCYA 3TM0A 2X8EA 4GEOA 1CKIA 3GQLA 1YDRE 1SVHA 1ZZLA 3KRJA 4I1ZA 4XX9A 2CNVA 4DT9A 2BFYA 2UZNA 3K3JA 4E8AA 5IQGA 4FZ7A 5LMKC 4R1VA 4GFGA 3MH0A 5GJFA 3E87A 3VS0A 4BDFA 4I6HA 1CKPA 4RC3A 2WTVA 2JFLA 4ALUA 3ZUVA 3IQ7A 3BQRA 4FVPA 4LFIA 4PF4A 1W2DA 5DN3A 4YU2A 1OGUA 2UVXA 5DA3A 3ZBXA 3PA3A 3TKIA 2G01A 5KHXA 5M09A 2HOGA 4H1JA 3OOMA 1ZYCA 3PXFA 5J8IA 3BE2A 4NCTC 4DLJA 3GENA 3QCQA 4C33A 2YACA 3LFDA 1QCFA 3MYGA 1ZOEA 2JC6A 3F82A 4G9RA 5AJQA 3VW6A 4D9TA 5HLWA 3VVHA 4C2VA 2C69A 3OT8A 4X6RA 2YCSA 4FSTA 2OG8A 3Q5ZA 2I1MA 4M3QA 4U8ZA 3R1NA 3DPKA 2XKFA 3PPJA 2BALA 2QOHA 3F3VA 2Z8CA 2O2UA 3B8RA 3EN9A 2YM8A 4G16A 2X6EA 3EWHA 2JBOA 3UMWA 4G6OA 4CVAA 1ZWSA 3W16A 3NNWA 4XLIA 3GXLA 3SD0A 4R6VA 4UBAA 4YGAA 4Z7HA 3UNZA 2PULA 3DDQA 3R73A 3QRKA 3UQGA 2BDJA 4QQ5A 5EH0A 4EH8A 3RJCA 2PVYA 4YJQA 3RI1A 3TJCA 2ITUA 1Q8ZA 5A4EA 3I7CA 1PMNA 5HNIX 4BDAA 2QO9A 2REIA 4EBVA 4FI1A 4ZMFA 2WIPA 2ERKA 3OXTA 4MQ1A 3FZRA 3RAIA 3V8SA 4W4XA 4NSTA 5L4QA 3WILA 2J0JA 2YIWA 4FTIA 4L52A 4LI5A 2W4JA 3OXZA 3C13A 2CHLA 1FVRA 2E9UA 4IX4A 3FLWA 3VULA 4FT5A 4CRLA 5IEVA 4Y85A 5FEDA 5IPJA 3U55A 2WTDA 3HVCA 3CGOA 5EYKA 3ID6C 2OGVA 5AUZA 2PHKA 1MRUA 2XIKA 4FG7A 1Q5KA 3QQHA 2XIXA 5JMSA 3IDPA 4O2ZA 5AX3A 1G8KA 2OJIA 3P9JA 3ODYX 3PDTA 5TR6A 4C3FA 3R63A 4KUJA 2E9NA 1Q3WA 4F70A 1PXNA 1UU9A 5FGKA 1Q99A 1YXXA 3I5NA 5EI2A 1ZMUA 3FC1X 3IECA 4WNKA 3D7TB 3R28A 1YWNA 5KMKA 1GIHA 2YCRA 4L9IA 2IZSA 3R9HA 4FEUA 2A27A 4GG7A 3VNTA 4KBCA 1OKVA 2B53A 4X2NA 1WBOA 3GQIA 2QVSE 3NWWA 5BX0A 3FI8A 3SG9A 5FDPA 4DBXA 3T8OA 2HXLA 4OUCA 3CY2A 3I79A 3M1SA 3EQCA 3MIYA 4ANBA 4EUUA 1J7LA 3AC1A 3L8XA 3LFSA 4G3CA 1Z5MA 3A4OX 3NUUA 1QMZA 3QRTA 4RG0A 4OAUC 4FEQA 4Q9ZA 4CZUA 4CQEA 2XM8A 4ITHA 2OIDA 2UW0A 3QWKA 5K0XA 4M97A 3TI1A 3DY7A 4KB8A 1WBWA 5KNJA 5AMNA 1GZKA 3Q9WA 4XBRA 2IN6A 2WELA 4NW6A 3EQDA 4ZTHA 3R1YA 3ZFYA 5A4LA 4EHGA 2BILB 4FV5A 3QC4A 2QOLA 4IE9A 5ANEA 3T3UA 5ITAA 3W10A 3M11A 2W5BA 2GNHA 4KWPA 3L9MA 4I93A 4FZDB 3R01A 2X6DA 3DZOA 5DIAA 3S3IA 4ZY5A 4QO9A 4FNWA 4AN2A 4F63A 1OI9A 4UMRA 4LG4A 1OKWA 4RFMA 3BEGA 5F9EA 1PXIA 5LCJA 4C59A 4D1XA 2CN8A 3RKBA 4J71A 3CCNA 3EJ1A 3WOWA 5AEPA 2NRUA 2IZRA 1BUHA 2WPAA 4NTTA 4ZY6A 2C47A 1JAMA 2R3MA 4ORKA 3PRIA 3VUTA 1Q8UA 3BHTA 2RG6A 4A06A 2FB8A 3KCKA 4U0IA 4DTKA 2BHEA 2UW7A 5CSVA 3V5TA 4YNEA 3HV3A 3COMA 4D2PA