4U45A

Map4k4 in complex with inhibitor (compound 25)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
300
structure length
289
Chain Sequence
DIDLSSLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPDDQLWLVMEFCGAGSITDLVKNTKGNTLKEDWIAYISREILRGLAHLHIHHVIHRDIKGQNVLLTENAEVKLVDFGVSANTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPSTEQLLKHPFIRDQPNERQVRIQLKDHIDRTRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase kinase kinase kinase 4
publication title Fragment-based identification and optimization of a class of potent pyrrolo[2,1-f][1,2,4]triazine MAP4K4 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 93
structure length 289
sequence length 300
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4u45A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4u45A01
1ND4A 5GJFA 3NUAA 3A4OX 3FMLA 3WI6A 4KRDA 3QUPA 3K3IA 5BYZA 4ZLOA 5AAEA 3U9CA 3G9NA 4AGCA 2CGWA 3ZXTA 1H8FA 2PVFA 4L68A 4IB5A 5CSPA 4I23A 2GHLA 3R2BA 1MRVA 1WCCA 4YSJA 1IR3A 4Y46A 4NJ3A 3NUSA 3P79A 1OITA 4O0SA 2YIRA 5BMSA 2HXQA 3IW4A 1XH4A 5AIRA 3QWJA 4FIHA 3HMIA 2WQMA 4BCQA 5M08A 1R39A 2YJRA 1BUHA 3FY0A 5CEKA 2O2UA 3MESA 3MIYA 2UZBA 3UIBA 5ETAA 4X3FB 2QC6A 2VZ6A 3AD6A 5TKDA 2OJGA 2QR7A 5CAVA 3F5XA 5FDPA 4FNYA 4TWPA 2B1PA 2PHKA 5HO6A 5DYJA 1CSNA 4U9AA 3M2WA 3I5ZA 1GZ8A 4R1VA 2W9FB 5IUIA 3UE4A 5G6VA 2XIYA 2R9SA 1Q41A 4NZWB 1UKHA 5D9HA 4CGAA 4RX7A 1F0QA 4IAZA 2PPQA 2O8YA 3BCEA 2WEIA 3OTUA 4L52A 4QMVA 4CFWA 4TW9A 3C4CA 2V7AA 4EJ7A 3D0EA 4U45A 3FMHA 3TJCA 3V5TA 3NW6A 4QMPA 2X7GA 3DZOA 4UWCA 4DT9A 2IZSA 3NCGA 5M4CA 4BC6A 4EHEA 5LOHA 4JVGA 4ZLYA 3B8QA 3QQUA 4CCUA 3OT8A 2CMWA 2PMNX 4PY1A 1PMNA 1YWRA 2Y4IB 3ZRMA 3IONA 4LOPA 4TT7A 3HMOA 4QTCA 3P0MA 2DYLA 1KE9A 2ZOQA 4MK0A 4YGAA 2H8HA 5D10A 3VW6A 4D9TA 4EOQA 5BUEA 5CF4A 2X4FA 5FXSA 3F2NA 3FC2A 4KB8A 3BYUA 4IWOA 3R8MA 4E6QA 2XF0A 3BQRA 2X2MA 2X8DA 4PUZA 1SVGA 1GAGA 1JKKA 5ANKA 3A2CA 4E5AX 4TYEA 3EFJA 5IQGA 3OW3A 1YXXA 2RF9A 1XBBA 3AGMA 3FMEA 1Q3WA 3S95A 2JIUA 4EOIA 4GVJA 3JY0A 4Q5EA 2QOOA 4YC8A 1LUFA 4EZ3A 4KSPA 4E8AA 3IDCA 4M8TA 1Y6BA 3LFBA 3F66A 1OB3A 2Y8OA 4U6RA 4DN5A 3WZKA 1IA9A 2VWYA 3LQ5A 4G5PA 4NM7A 3T8OA 2Z7RA 4FICA 2C3KA 4PX6A 5AP2A 3D2IA 1VYZA 1P5EA 5KMOA 2CSNA 3CTJA 3NSZA 3IG7A 4BDHA 3FUPA 3P1AA 2W5BA 2Z60A 3BE2A 4UZDA 3GC9A 5CQWA 4UYAA 2DS1A 4LMNA 1QPJA 3IDPA 4GG5A 4AW5A 3TUDA 3E8NA 3WF5A 4Y8DA 4MD9E 1ZMUA 2WMXA 2VTMA 2WMQA 3UNJA 5C8KA 5IA1A 5FTGA 4RIYB 1IG1A 4NW5A 5D12A 1PXNA 2XIXA 4BHZA 4A4XA 2F57A 4DEAA 4ANQA 2QOHA 2GSFA 4BTFA 5JFVA 4WRSA 5DR2A 3R63A 2H96A 3IW6A 5DEWA 4FV9A 1I44A 4QP7A 5FEDA 3L9NA 2J0JA 3W2QA 3DNDA 2YCQA 3FE3A 4JQEA 5I3OA 5AEPA 5FG8A 4EYMA 4BBFA 4N6YA 4DEGA 1H24A 3OOMA 2OK1A 4MWHA 2C1BA 4RG0A 3TIZA 3NUNA 1PMUA 2C6MA 2YITA 2HELA 2VTTA 3MJ1A 3SDJA 4AZTA 2AC5A 4UY9A 4DG0E 3HP2A 4D28A 1OIUA 4CCBA 1IEPA 4OAVB 3GNIB 1YDSE 1WBSA 1TQMA 2WEVA 3GCVA 3OMVA 5HORA 3HMPA 4EH2A 2YACA 4C2VA 2GNJA 3DDPA 5KMJA 1UU9A 1UNHA 2FUMA 3F2RA 3K5VA 2BMCA 2G2IA 3Q53A 2X4ZA 1SVHA 4FTJA 1Y8GA 3GC8A 1ZYJA 4YC6A 3ZOSA 2VX3A 4P2KA 3QBNA 4CMUA 5EHLA 4CKJA 4C3RA 4O22A 3ZFXA 1ZOEA 4PL4A 4LG4A 1PXLA 4K0YA 3LFFA 3OP5A 4QNAA 2P3GX 4FR4A 4RLLA 5H8EA 4FNWA 4H3BA 5KMKA 2CCIA 4A9TA 3MN3A 5LVOA 4O7YA 4O0UA 2QU6A 4GVAA 2QG5A 4IQ6A 2C0TA 4NKSA 3P7AA 3IGOA 5KMNA 4OBOA 3C13A 1AQ1A 2HZNA 3E3BX 4U40A 1DAYA 2PUPA 3LJ2A 3NNVA 5E7RA 5BVDA 4WNPA 4E6AA 3UDBA 4HGEA 3U51A 1OKVA 3A7HA 5EI2A 5JGAA 4I4EA 4L44A 4JLCA 2GFCA 4CLJA 3WYXA 5J9ZA 5L8LA 4H3PA 5KZ0A 3QD4A 4XG9A 3RAKA 3H10A 4U80A 3TTIA 3PDTA 3ZXZA 4MKCA 3AT4A 3OVVA 5HNGA 3BWFA 4E4LA 1LR4A 3EN6A 2QLQA 3MVJA 4FI1A 4B8MA 2IW9A 3EWHA 3MVMA 4X3JA 3DXNA 4FTAA 3TEIA 4F9YA 2WMSA 4CG9A 2J50A 4BCMA 1JKLA 2VWUA 4HZSA 3R7UA 3VF9A 1H1QA 3QTUA 4EC8A 4FTIA 5EKOA 3PXRA 5A9UA 3DLSA 3E5AA 3ORKA 4F99A 2ITPA 3F6XA 4K8AA 3LAUA 3Q96A 3ORZA 5K3YA 5CENA 1BI8A 2GNIA 3GU5A 1WVYA 4FT7A 4YZBA 2XJ2A 4FYNA 2C6LA 3PXQA 4WBOA 4YJQA 4WSQA 5ICPA 4E3CA 2FVDA 2OZAA 3VS5A 1ZAOA 3FZPA 4DE4A 4DBXA 4XV3A 2FSTX 4I5MA 5HG5A 4EKKA 2JGZA 4YBKA 2B54A 4K77A 4IVCA 3WZJA 4OTFA 3LXPA 4GCJA 2XBJA 2WTIA 3EKKA 3QFVA 4TYJA 4EK6A 5IISA 4MF0A 3UG1A 4ZXTA 4GYGA 3VO3A 1OL6A 4LL0A 4QYHA 2X81A 4L43A 5FP5A 4BY9E 3P78A 4Y72A 5EHYA 3H9FA 5AR5A 3PLSA 4ANOA 2CPKE 3MPMA 3KMUA 4GW8A 3SXFA 3FKNA 4B99A 3HDNA 1O6LA 2ITQA 4Q9ZA 2JFMA 2WO6A 5I9UA 3U6IA 1BYGA 2CGVA 1OPKA 1PYXA 2F49A 3DFCB 3PWYA 2QURA 4IZAA 4KKEA 4C35A 3FY2A 4R6VA 2VTOA 2IWIA 1VYWA 2OWBA 4JDHA 3LXNA 2GFSA 4LMUA 3M42A 1DAWA 4TYIA 3UVPA 2EB3A 4FTRA 3KVWA 4CTBA 3GT8A 4UEUA 5KMLA 3TNWA 1F5QA 2BHEA 1OKWA 2BROA 2HWPA 3QTRA 4EH5A 3Q9WA 3ZC5A 2ITTA 4JBPA 3ORXA 5IA4A 4FX3A 4O0XA 4BCFA 3CY3A 4X2JA 2HW6A 3F3WA 3EH9A 4ANBA 2XS0A 3O8PA 4IWQA 3MH2A 5BVNA 4O7RA 4DTAA 5AM6A 5BPYA 1PXIA 3VJNA 4EUTA 4I5HA 4I93A 5EFQA 1NW1A 5ANEA 3BEGA 3ZSHA 2JLDA 5E90A 3LOKA 3H9OA 4FV8A 4EEVA 5E8TA 3ZLSA 3FLQA 1Q4LA 2BZJA 1H27A 2PE1A 2VWXA 1RDQE 3CP9A 4X6RA 3KXZA 3PY3A 4I21A 4BDKA 3QLFA 2DQ7X 3MDYA 4PF4A 4RJ6A 5H8BA 3M1SA 5LVMA 3SV0A 2HY81 3O23A 2HZ4A 3R9OA 3ZUVA 5IF1A 4F64A 4C34A 4O91A 3UP2A 4AFEA 3NWWA 3BRBA 5DR6A 5HIBA 1CKIA 2RG6A 2ZDTA 4ACGA 3TV7A 3AMBA 5CANA 4XLIA 3PVUA 2BPMA 4O27B 4RJ3A 1BKXA 2W4OA 5IA5A 2J6MA 2GNLA 2Z7QA 3VRZA 4QMYA 4BGGA 1MP8A 3ZMMA 1UKIA 4MF1A 3R73A 5ANGA 2X6EA 4BCKA 4IAKA 2PUUA 2J51A 2F7XE 3Q4UA 5DG5A 5AP5A 3OT3A 4ALUA 4FOCA 4GUBA 3IKAA 3LJ1A 3BHHA 3VF8A 3I7BA 4QMOA 4EOPA 5BMMA 3ZM4A 5FM3A 2VTNA 3FSFA 3R71A 3MA3A 3SKCA 4XOZA 4EUUA 2WQEA 4FEQA 1YOJA 4CFXA 2W99B 4O0VA 4PP9A 5DHJA 2JDRA 3RINA 4PNKA 4YTHA 5F4NA 5LVPA 2W1DA 1F3MC 2JITA 5GZ9A 3TNIA 1MUOA 4I5PA 4A9UA 3MV5A 4M69A 4CFMA 3SG8A 4O86A 1Q24A 2WXVA 5HVJA 3ZH8A 4OTHA 1YXTA 4FTUA 1XH6A 3BEAA 4HYUA 4BKJA 4UWBA 3MGYA 3OCGA 3R7EA 2WMVA 3FZTA 1J7IA 3CGFA 3N51A 1URCA 2C6TA 4CFVA 5A4TA 3ORPA 1XHAA 1GIHA 4CV8A 2QO7A 4I1ZA 4R7IA 1NXKA 4BFMA 4IM0A 2ITVA 3DS6A 5EW3A 4XCUA 3C1XA 4ASXA 4C58A 4DLJA 5HQ0A 5LWMA 5M56A 3F69A 3AGLA 2E2BA 2ZJWA 5FWKK 5CASA 1GZKA 1JQHA 3BV3A 4DAWA 2GTMA 4PPAA 2C6DA 4IJ9A 4KAOA 1H01A 2PZPA 3VUDA 3HMMA 2WMUA 3A4PA 5E8ZA 3UQFA 3EQIA 2PK9A 5AADA 4YLKA 3UP7A 2XK8A 5I9ZA 1OIRA 2YERA 3G90X 4FVQA 4GL9A 5AA8A 3F5GA 5JGDA 3TIYA 3BYMA 4HYIA 3C4WA 3O51A 3OCSA 3PJ2A 2ZB0A 5FBOA 5AR7A 4LV8A 1OPJA 4CZUA 1NVRA 2YAKA 2ERKA 1P4OA 3GU8A 3NPCA 4R5SA 3FMDA 1UU3A 3AMAA 4ALWA 2J5FA 4XEYA 4RBLA 3RPYA 3EQBA 3P7BA 4IDVA 4L3LA 4M15A 1VJYA 2R2PA 4WT6A 1YQJA 3G2FA 2R64A 4WOVA 4O0YA 4W8EA 3NCZA 5AV2A 2B0QA 2H34A 4FSNA 3VC4A 4AUAA 2EVAA 1W98A 4JDIA 4BIDA 2B4SB 3OF0A 4LM5A 2R3HA 1W82A 4EH4A 2X0GA 4IB1A 5BYLA 2Y0AA 2XNOA 4PWNA 2X7OA 3DCVA 5KNJA 4GFOA 5IUGA 2C47A 2W05A 4O1PA 4D4YA 3CCNA 3C9WA 3COHA 4NM5A 3MVLA 4FIIA 3NYVA 2OIQA 4QQ5A 3V5JA 3QXPA 3FI4A 3HL7A 4EOSA 3DK6A 2QD9A 2OXDA 3G51A 3OZ6A 4RA4A 5KCVA 4DG3E 1H26A 3R7IA 1WAKA 4RLKA 4DITA 3N9XA 3OXTA 3HECA 5FEQA 2VTPA 2CNUA 3OWJA 1ZXEA 2OFUA 3UO4A 4ZAUA 3S1HA 3RM6A 3QHRA 2WAJA 4RIWB 4FG7A 1JPAA 1YRPA 3AC2A 3DJ5A 3ZU7A 2GQSA 4ANSA 3FI8A 4DF3A 4O2ZA 1A9UA 4U3ZA 2YDKA 3VS3A 1L3RE 3DK7A 3QX4A 3MS9A 3ZLWA 5K0XA 4L6QA 4YJNA 1U5RA 5HESA 3WZDA 1PXKA 2XA4A 5ANJA 4B7TA 2IW8A 4OW8A 2XNPA 3CSVA 4LV5A 3QQJA 3H9RA 4FTLA 4OT5A 2VTLA 4DC2A 2CKPA 5JKGA 2HENA 3KVXA 4ZSJA 2NPQA 3DPKA 4II5A 3VW8A 4WIHA 1JNKA 5E9EA 4Z9LA 3EL8A 4USDA 3LKMA 2V5QA 2JAVA 3ZONA 3QC9A 4LRMA 5GNKA 1S9IA 1YKRA 3IECA 5EM5A 3EQHA 5B0XA 4YJOA 5ANIA 4I24A 5BUJA 3ZDUA 2BR1A 1VEBA 2C3IB 5H2UA 4AN2A 3MY1A 2YIQA 2WMRA 2YLFA 4QP4A 4X21A 1V0BA 4FKWA 3DBCA 4FZ7A 3CKWA 2PVKA 2FSMX 3BV2A 1PMVA 3BPRA 4C3PA 5E1EA 3ORMA 2PUNA 1KWPA 3DAJA 3PY0A 5KBQA 3RPVA 3I6WA 3FZ1A 3MPAA 1LEWA 2R3IA 1VR2A 2UZOA 4IX4A 3BHYA 4K9YA 4U81A 3QCQA 5BVKA 5HLNA 3DQXA 3GB2A 2P55A 2JC6A 2QOLA 4JBOA 4NM0A 3T3VA 3TUBA 2WIHA 5EI8A 4UX9A 5EH0A 2QHMA 3EFWA 5HHWA 1IA8A 2IVTA 3BE9A 4A9RA 4G3CA 4JNWA 2FH9A 3PVBA 1PYEA 4Y83A 3ZBXA 4AWIA 3KULA 5CYIA 4QQCA 5L2WA 3OROA 4I0RA 5BVEA 5AV1A 5HNBA 4N70A 4I4FA 3DTCA 2OJ9A 4XP0A 3EYHA 3MSSA 2VO0A 2YABA 3GOKA 5I9VA 4E6CA 4G3EA 4FKRA 1G8AA 4M0YA 5HGIA 5JRSA 4C36A 4F1MA 4X2FA 4XP3A 5T6KA 1T46A 4QMLA 3ZYAA 4NUSA 3SRVB 4EH6A 3R8PA 2PZRA 2ITWA 3KRJA 3E92A 3NEWA 2WMAA 3NYOA 4IJPA 1ZY5A 4N0SA 5K4IA 2R3QA 3PIXA 4P5ZA 4FTTA 2HZIA 3R21A 4UWYA 3RZFA 3VAPA 3WIKA 4NFNA 4PQNA 1K3AA 2HZ0A 4RVLA 2ZM4A 3GI3A 5FM2A 3VUMA 2JDTA 1J1CA 4QTAA 5CEPA 1YI6A 1A06A 1WMKA 2OF4A 3E7VA 4FV3A 4MXCA 1CDKA 3FKLA 4X7QA 3W8QA 4EBVA 1P14A 4JS8A 1V1KA 4EH9A 2QOFA 2ETRA 4M67A 3CS9A 3LJ0A 3I4BA 3IOPA 4G3FA 5EQEA 2C1AA 3I81A 2PZIA 4RWIA 2UZNA 5KZIA 4G6LA 4DGMA 4CFFA 5TE0A 2JBPA 3FV8A 2ONLA 4KWPA 4YO4A 2UVZA 2BRHA 4AA4A 3CJGA 3FXXA 4NIFA 3K54A 4C7TA 3TTJA 5EM7A 4QD6A 4IB0A 3P08A 1MQ4A 3KRXA 1U46A 3FMKA 2PL0A 5GZAA 4FEVA 1GJOA 4E4XA 4ZJJA 3LFQA 4JG8A 5BVFA 3GQIA 1JKSA 3JVSA 5FQDC 4E5BA 4YMJA 4XP2A 3Q5IA 3TG1A 5JGBA 1ERKA 3VBTA 3UO6A 2I6LA 3UNKA 5FUTA 4BF2A 2UZVA 4FT5A 2C69A 2BZIB 5L6OA 1BL6A 3Q52A 4IE9A 2XEZA 2WFYA 2BFXA 4D55A 2XK6A 4GIHA 2W9ZB 1XO2B 2C6IA 1VZOA 2YM6A 3NR9A 3NW7A 4ZTHA 3SAYA 3SG9A 2C3JA 3FI3A 3LCKA 3II5A 3L9LA 5J7BA 3TT0A 3FMJA 2VN9A 4FODA 4AOIA 5M4FA 3UOJA 5EOLA 3A7FA 4FA2A 3D7TA 5KO1A 5AV4A 5CT0A 2WGJA 3A8XA 4MXZA 3UIXA 4O2PA 1U59A 2YM5A 4KKGA 1ZMWA 3QKKA 4W4VA 2UVXA 2R3PA 1OKZA 4C4FA 5JFXA 3R22A 4NL0A 4HYSA 2CKOA 1MQBA 4Z3VA 4F6SA 4WG5A 5HEZA 3REPA 1W0XC 4P5QA 3W2SA 3VBVA 5F20A 4TL0A 3UZPA 2O3PA 2ITYA 3DB8A 2RGPA 5BX0A 2CNVA 5CEIA 2NRYA 3L9MA 4O38A 2GQGA 1Q5KA 4EYJA 4PMTA 1Q8YA 3TNPC 2WD1A 3TZMA 4JR7A 3ZLYA 4R8QA 1H1SA 5GJDA 4IWDA 4F7LA 3ZLXA 4IVDA 3R0TA 3KXNA 4FL3A 4OT6A 4YPSA 4I6FA 5G1XA 2C3LA 3MJ2A 3RNIA 1WFCA 3U8WA 3DFAA 2GQRA 3VUTA 1OVEA 2W1CA 2WMTA 4IEBA 4W8DA 3TM0A 2YEXA 4FNZA 4R7HA 4YR8A 3JXWA 1OBDA 4E7WA 4CQEA 3ANRA 3R1NA 3D5VA 2XNBA 3FLWA 2VRXA 4WO5A 4C4IA 3H0YA 3GU6A 4P90A 4XG4A 2W1ZA 3G9LX 4QQTA 2I40A 2XKFA 3SVVA 3OWLA 5I3RA 4ZZOA 2GNGA 5DT0A 5E4HA 3PSCA 5A54A 5HU3A 4LUDA 1ZY4A 2RSVA 5KX8A 1PRYA 1XBCA 4CKIA 4FL1A 5FP6A 4RZVA 2XJ0A 4F65A 2V62A 4G17A 3RTPA 3ZEPA 1Y57A 3MPTA 4QMUA 2HCKA 1NA7A 3QZIA 4HGSA 5E8XA 3EJ1A 1RW8A 2YJSA 2GS6A 2VTQA 3V5QA 1H28A 1M52A 3MVHA 5J1VA 4FYOA 2XYNA 4QMXA 2PUIA 5CF5A 3JY9A 4PDYA 5LJJA 4JDJA 4RT7A 3L8PA 2PMOX 2B9FA 2WTVA 3ULZA 4BBMA 1SMHA 3AG9A 4BCPA 2UW5A 5KHWA 5AV3A 1QCFA 4FZ6A 3EQRA 3RNYA 2OICA 2X7FA 5IH5A 5F94A 4MVFA 4RX8A 2UZEA 5I5ZA 4FBXA 5JEBA 3VBQA 3W1FA 1WBPA 3ID6C 4UZHA 1OUKA 1Z9XA 4WD5A 2PYWA 4BZNA 2AYPA 4OBPA 3VS0A 3W16A 2Y6MA 4CFNA 4NSTA 4J8MA 1TVOA 3CQEA 4RVKA 3DBFA 3C4FA 2WTCA 4RZWA 3TWJA 1FVRA 3ZBFA 4DBNA 3D9VA 3FQHA 3BHUA 3NW5A 4KIPA 4W4WA 3A7IA 3BGQA 2GU8A 3CGOA 4FZFB 5DIAA 1H00A 1YOLA 3B2TA 4XOYA 3FXWA 3HRCA 3P86A 3LCTA 2WOTA 4X2GA 4AOTA 3UODA 3QTQA 1PXPA 1SNXA 1XQZA 2IW6A 4LQMA 4ASEA 2GNFA 4C33A 2XIKA 1Q61A 4JQ8A 4RJ8A 5C9CA 4BHNA 5HCXA 3GC7A 3E8DA 2QHNA 4EH7A 5IA2A 5GINE 2DWBA 5DOSA 4F70A 3VBYA 4XHKB 4MD8E 4RJ7A 3EN7A 3W2OA 2A2AA 3EFKA 2XM8A 2YA9A 4MBJA 4QTDA 3CD8A 3D7ZA 3HLLA 2QLUA 4L46A 2JKOA 4IB3A 5T3QA 4YUQA 4NTTA 3PYYA 1YVJA 3GCPA 4TYHA 5E8WA 2W1FA 4G3DA 3NAYA 4IDTA 4QTBA 4FT3A 3VQUA 4RC2A 2PTKA 3KK8A 4ITHA 4ACCA 1R0PA 4QT1A 2BIKB 2AC3A 3MW1A 3V51A 3QC4A 4BDBA 4EWQA 4YJUA 2X9FA 4RJ4A 3QZHA 5HBJA 5EKNA 2XKEA 3F3ZA 4DFXE 3BI6A 1NVQA 2G9XA 3UYTA 4JXFA 3S0OA 4F6WA 4C59A 5AUVA 4JOAA 3A61A 3HAVA 5C4KA 2OKRA 3ITZA 1M2RA 5LARA 5IDPA 4GT4A 4IFCA 2UW8A 2CKQA 3BKBA 4FV4A 4MCVA 4DGNA 2VX1A 2WIPA 3HEGA 4C62A 1V0OA 2ITNA 2UW0A 4EOJA 5EQYA 4S30A 3L1SA 5AR3A 4Z7GA 5D7AA 3D83A 3EOCA 5AAGA 3PJ8A 3Q4TA 2R3RA 5M57A 2IZTA 3B2WA 3G5DA 3VS4A 4ALVA 2YDJA 2FB8A 2R3GA 4BZOA 2OU7A 4GIIA 3ZO3A 2ITZA 3OC1A 3NX8A 4L00A 4FKOA 4F63A 2NO3A 3OS3A 4ZIMA 4EHZA 1UWJA 4MXYA 3HMNA 4CZTA 5HU9A 3F88A 5HVYA 3UO5A 4BDAA 1LP4A 3MTLA 4FVRA 2Z8CA 4AN9A 4BI1A 4HPTE 3NNUA 2VUWA 2B55A 5EG3A 5CTPA 4CNHA 2NNWB 2O0UA 1Y91A 4GK4A 2UZLA 3R7OA 4APPA 2JIIA 5CU3A 3QWKA 3PA4A 4XG3A 4ZSAA 2PMIA 3UVQA 4IM2A 4FMQA 3V01A 2QOBA 5BNJA 5DMZA 3COKA 3UQGA 4BCHA 3QTXA 5HNIX 5IEVA 4KRCA 5K5NA 4GEOA 1KE8A 4DFUA 4XG8A 1V0PA 2OIBA 3W2RA 3I5NA 3RKBA 4K2RA 1H1WA 1J3HA 4TWOA 4QP2A 5HLWA 1O9UA 2XCHA 4XS2A 4FSMA 4AT5A 3VUHA 3OY1A 4NT4A 4R1YA 4YZ9A 4PNIA 1REKA 3QLGA 4ACDA 3MH1A 3TACA 4ZJIA 4OGRA 3CY2A 4C3FA 3A8WA 3LZBA 5M44A 5H9BA 1ZARA 4FTNA 1GZNA 3DOGA 4I0SA 2HY0A 4O7WA 3BHTA 4X3FC 4MQ1A 5CLPA 4BDCA 1UU7A 4XG2A 5FGKA 1ZOGA 3G6GA 2I0HA 4GJ2A 4F1OA 4JX3A 5ANDA 1REJA 3WOWA 2PY3A 3NUPA 3ZTXA 4E93A 2W5HA 4E1ZA 4F08A 4B6LA 4ZS4A 5CVHA 2XJ1A 5HZNA 5CEOA 1Q8ZA 4BCIA 5M09A 4BDGA 2OJFE 1FVTA 4FV0A 4EWHA 4O83A 3AT3A 2XIRA 5ACBC 3Q6UA 3BHVA 3PUPA 3QXOA 4NJDA 3FHIA 3AMYA 5AM7A 3TZ7A 4D2TA 3SGCA 4JQ7A 4IAFA 1M17A 2CJMA 2VWZA 1OZ1A 2W5AA 4D5HA 4L3PA 3QD2B 3RK5A 4PTCA 1UVRA 5F9EA 3DV3A 5JN2A 4LGDA 2R7BA 3KRWA 1SNUA 2Y4IC 3UZTA 1B38A 2Y7JA 5IQCA 2Z02A 2PZ5A 2B9JA 2QI8A 2Z7SA 4ZSGA 2Y9QA 5KKRB 3FQSA 2I7QA 3O2MA 2ZM1A 3FL5A 5JZJA 1WBTA 4YU2A 3DU8A 4HYHA 4JBQA 5JH6A 5IH6A 3QQKA 2YZLA 2WTDA 3QU0A 3N4VA 1IRKA 3TV6A 3P23A 3AC1A 4K1BA 4F0IA 4FF8A 5L2TA 2C0IA 2WKMA 2WZJA 5DNRA 2VD5A 3VS7A 4D2PA 1J7UA 4XV2A 4NK9A 3KY2A 2WNTA 2VWIA 4ZTRA 4AW0A 1XH7A 3KMMA 1FMKA 4TYHB 4GS6A 4AG8A 2YZAA 1YXUA 3Q5ZA 4O7TA 4APCA 5EM6A 4EOLA 2WTJA 3DTWA 4USFA 4WRGA 1HCLA 2A1AB 5IU2A 4I41A 5J79A 3GENA 4V05A 3HV5A 4HCTA 4HW7A 3C5UA 3L8SA 3UG2A 1SVEA 1UA2A 4BL1A 2CGXA 1E9HA 3R30A 3RPOA 4CVAA 1I09A 4FKGA 4M0ZA 4C4HA 2OO8X 3A60A 3NIEA 2XKCA 4GT5A 3QALE 3KB7A 5DA3A 4ZMEA 3LFDA 2C5YA 4YJTA 4HNFA 3RHXA 3EFLA 2YWVA 3AT2A 4NCTC 4YLLA 2WU6A 1QPCA 2BAJA 4C02A 2OI4X 1U5QA 3CJFA 5DRDA 3DQWA 3EL7A 2DUVA 2UW6A 2X2KA 4PDOA 4X6QC 4XMOA 2J4ZA 2HK5A 4DGOA 4G9CA 5IPJA 2F2UA 4WBBB 3BU5A 3F3TA 4O0TA 3HA6A 3FPMA 4AE9A 5IEYA 2HXLA 2WPAA 1U54A 5A4QA 4J97A 3RMFA 4MHAA 5DH3A 4AGDA 4MXAA 1OL1A 3MYGA 5E92A 4D0WA 3VBWA 1GY3A 2KULA 3E63A 4QRCA 4BBEA 4EQMA 3TL8A 1ZRZA 3ZDIA 4H1JA 5D41A 5E1SA 4ITJA 2GS2A 4S2ZA 3LXLA 4M84A 5DEYA 4U42A 4DH7A 4F09A 5TO8A 3ZEWA 5AMNA 2WQOA 3C7QA 5JZNA 4UMQA 2YM4A 2X9EA 4AFJA 5A6NA 3ODYX 2QKWB 4JT3A 4KBCA 3BLQA 4XV9A 3E8CA 3WE4A 4A4OA 5IG1A 3QUEA 4HVSA 3OD6X 5DRBA 3UOLA 4I3ZA 3L8XA 1J1BA 1OUYA 3DKGA 2VTSA 3DT1A 3KRRA 4ACHA 1Q99A 3R9DA 4BKZA 5KMMA 5LVNA 4OTDA 4CT2A 4DHFA 4ZY4A 4J7BA 5FLFA 2X8IA 1STCE 4PL3A 5CNNA 5HX6A 3GFEA 1JWHA 3LFEA 4ZLZA 4W4YA 2BZHB 3HP5A 4YURA 1PY5A 4CRSA 3D94A 2ZAZA 3OHTA 4EH8A 4DT8A 3KMWA 3JYAA 3OFMA 2B7AA 1FVVA 5CALA 4H1MA 4L01A 1YWVA 2WMWA 2GS7A 3CR0A 1S9JA 4XX9A 1OKYA 3F5PA 4EOKA 3DBEA 3GU7A 5KMIA 2XK7A 1WBNA 4BKYA 2UW9A 3EHAA 4F0FA 5J5SA 3DZQA 3KCKA 3LMGA 1G5SA 3Q2MA 5CSVA 3S2PA 3HRBA 4DH3A 3CTQA 3BX5A 3UPZA 2JKKA 3DKCA 2YWPA 5L2QA 2WMBA 4IH8A 5AP6A 3WYYA 1PMEA 3OCTA 3VHKA 4UMRA 1FGKA 3G0FA 4TKSA 3FBVA 4G31A 3QF9A 4J98A 5CZIA 1Q8TA 4CT1A 4UYNA 3V5LA 4RX5A 5AWMA 4DCEA 4C2WA 3ZC6A 4KIKA 3ZS5A 2KTYA 3EB0A 4HOKA 3F9NA 4FIJA 2Z2WA 4WUNA 5HCYA 5HVKA 3NYNA 2CNQA 2ZVAA 1BMKA 4I20A 4ZEGA 2E9VA 2OZAB 4CRLA 1HOWA 1ZZ2A 2VO3A 2XRWA 3MI9A 3SX9A 1BX6A 3VS1A 3DNEA 5DI1A 3DJ6A 4BCGA 4D0XA 1FBNA 2ZV8A 2VU3A 4ZOGA 4BYIA 5GIPE 4O7NA 1CM8A 3CKXA 3NLBA 1PXJA 3R2YA 3V3VA 4AXAA 4GU9A 3R83A 4BVUA 4WKQA 3W2PA 4J52A 2YN8A 4ORKA 1URWA 4MNEA 4S34A 3ZUTA 3NS9A 1XH8A 2EWAA 4JX7A 3HAMA 5M51A 4JG7A 5TR6A 4AQCA 3FDNA 4IVBA 4U44A 2A19B 4RC4A 3FEGA 4YSMA 4FVPA 4XG7A 5CEMA 2XEYA 1KOBA 4B0GA 3SOAA 3U9NA 4Y5HA 3SOCA 5JQ8A 2J5EA 4GMYA 1M2QA 3DBDA 5TOZA 2J0KA 4QYGA 4UN0C 4IACA 2W4JA 5AV0A 2PVMA 3OBGA 4BDFA 4ASZA 4YTFA 5IQFA 2PULA 3R8UA 3LCSA 2VO7A 3RWQA 2IVUA 3H0ZA 3NUYA 3U87A 2VNWA 2IVVA 3GU4A 4N4SA 4BWXA 3AOXA 3R6XA 2J90A 3VBXA 3ZO1A 4O0WA 3VNTA 4FKQA 1K9AA 2QOCA 3EYGA 5CU4A 2OJIA 3QYWA 3KEXA 4CFUA 3LFAA 4ZS0A 2HWOA 2P2HA 2I1MA 1R0EA 3JPVA 2IG7A 5HICA 3BGPA 3MWUA 4JR3A 2UZUE 1EH4A 3BZ3A 3DK3A 1RE8A 3JVRA 3EZVA 4G6OA 5EDRA 2QVSE 3RAWA 1OGUA 3V04A 1J7LA 1ZWSA 4V01A 4E4NA 1WVWA 3NUXA 1W84A 4JAIA 4OBQA 3ZO4A 3ZSGA 3I1AA 3ODZX 3OXZA 1APME 2VAGA 3EN4A 3EQCA 2UUEA 3LIJA 4DFZE 4EQCA 2WTKB 1UNGA 4A7CA 4FGRA 4PV0A 4D4SA 4CG8A 3KXMA 1SYKA 3K5UA 3QRKA 3C50A 4XUFA 1KV1A 2P2IA 4AZFA 1U54B 2HW7A 3EZRA 5GZ8A 3PVGA 4DFBA 3NVKI 3S4QA 3KL8A 3O0GA 4YPDA 3C4ZA 4DTBA 3O96A 3EQFA 3PG3A 4R77A 2BDWA 4L9IA 2R7IA 3W2CA 5L4QA 4V04A 4PL5A 4J1RA 4AN3A 4D9UA 1GIJA 5DPVA 4ZZNA 3R1SA 4O7ZA 3M11A 4L7SA 4KUJA 4WA9A 4M3QA 4ANLA 3LPBA 3TNHA 1M7NA 2XBAA 2FO0A 3WF7A 2Y6OA 1TKIA 4H3QA 3NMUF 1GIIA 3EQPA 3O7LD 4GSBA 3B8RA 3SD0A 4FSRA 2BFYA 3DBQA 4GG7A 2PWLA 2WB8A 3I0QA 3RAHA 4K33A 3BLHA 4LFIA 4TWCA 4MXOA 4QMWA 4WNOA 3P9JA 3BU3A 3HUBA 2C6OA 2WHBA 3OG7A 5FBNC 5IH4A 4M69B 3H4JA 3UNZA 3GGFA 3V5PA 4E26A 4TNBA 4GJ3A 3FQEA 4TXCA 4WUAA 1TQIA 3OUNB 4MNFA 2VTJA 4U3YA 4X0MA 4EORA 1LEZA 3QRUA 5CWZA 3AC8A 4QMZA 1SZMA 3PZHA 4FZDB 3WZUA 1YHSA 4PRJA 4FKVA 4QMMA 1WBOA 5AR2A 2HYYA 3D5WA 3W32A 3LLAA 3FL4A 5LCJA 4IM3A 2W1GA 4BB4A 4FEWA 5M55A 1OIYA 1XH9A 2VWBA 3E87A 3IPHA 2V22A 4ZSLA 5AUXA 3UJGA 3PY1A 3KC3A 4U8ZA 4O0RA 4TWNA 3WE8A 5EOBA 5F1ZA 3TZ9A 4C37A 2BILB 3KXGA 1FPUA 1R1WA 3QCXA 3ZSIA 5CT7A 3QHWA 3UOKA 3VJOA 4H05A 3AC5A 4AU8A 2R3OA 3UOHA 3PE2A 4QYYA 2I0EA 3DY7A 4CYJA 4F6UA 2PMLX 3R00A 1O6YA 4KIKB 4KABA 5C1QB 2PU8A 2VGOA 1JVPP 2YM3A 3F82A 2QODA 1CMKE 2ZV7A 4PMSA 5EYCA 5J7HA 3NYXA 2C5VA 3EN9A 3PA3A 2JBOA 2OZOA 4FTKA 4NM3A 4ACMA 1H08A 4QPAA 3H3CA 3VUGA 3CBLA 4A06A 4RIXA 3MB7A 2V7OA 4GK2A 4AZVA 5CS6A 3TXOA 4C61A 3S3IA 4FSTA 4BWKA 3R1YA 2XK9A 4I5CA 5FDXA 2QOIA 3VULA 3V8TA 2GHMA 5HTIA 3G15A 4DTKA 4UMUA 1IAHA 3BBWA 4J95A 4MNEB 3CPCA 1OL5A 5E8VA 1GZOA 3ORIA 4QPSA 3ZHPC 3NZ0A 2BAKA 4FKIA 5AUYA 5EYDA 1YOMA 3ENHA 3HGKA 4BRXA 4PP7A 5I9YA 1PKDA 4HCVA 2E9NA 4L67A 3SLSA 4EKLA 4B4LA 3TKHA 4ZJVA 4O81A 4PPCA 4ANNA 3C0IA 5EI6A 3ORTA 4FV2A 4J96A 5A3XA 4O82A 4M14A 3TDWA 3HV4A 1HCKA 2GDOA 3ZRKA 3DB6A 2PSQA 4ZZMA 3PSBA 2CGUA 5HIDA 1ZYCA 5CU6A 2XMYA 3DKFA 2EXEA 1QL6A 2EXMA 5HG7A 3BU6A 3D5UA 5BQ0A 5L6WL 3HV3A 3KKVA 4FV6A 4DH1A 5AUTA 4YZNA 1B39A 3COIA 4GKHA 3TDVA 2RFEA 3TI1A 3QZGA 5KUPA 4YP8A 4XRJA 3WARA 4GUEA 1YI3A 5BYYA 2BZKB 2CN5A 4RFZA 3I79A 4H36A 1FQ1B 4IX6A 2ACXA 3NRMA 3WF8A 4R3PA 1H0WA 3DLZA 3OEZA 3R04A 4WG4A 2W1HA 3Q9XA 5CNOA 2W1EA 3CLYA 2O64A 4CXAA 4BGHA 3L8VA 4TN6A 4M66A 3QZFA 1XH5A 3VRYA 2WELA 4Q9SA 1XR1A 4RIYA 4C4GA 4FSZA 5IQEA 5A6OA 2VWVA 3KCFA 5DT3A 4MD7E 5IKWA 5J9LA 2VO6A 3RALA 3UBDA 1ZMVA 3I60A 4DFNA 5LXMA 4YJVA 5FXQA 3QTSA 3UGCA 3O71A 3FAAA 5CI6A 3RGFA 3OXIA 3KRLA 1FINA 4D4RA 3QGWA 4MWIA 2R0IA 5HE3A 3V5WA 1AD5A 4M12A 3QKMA 2XB7A 4IMYA 5HD7A 4MH7A 5TF9A 3VUKA 5AUUA 1R78A 1PXMA 4UBAA 4AE6A 4DEIA 3E93A 3OY3A 3QRIA 4OTQA 3PIZA 2GHGA 3DAEA 3MY0A 1RQQA 4AZSA 4DH8A 4GYIA 3U4WA 3U6HA 5FRIA 3HZTA 4UALA 2F2CB 3RZBA 4GT3A 5EDQA 3PE1A 5IUHA 4RGJA 4OTRA 3KGAA 4C0TA 1P2AA 2BRNA 3RWPA 5TT7A 3PJ3A 4G3GA 5CSXA 4BI2A 5A4LA 5LMKC 5L2IA 2YISA 2OH0E 4QYFA 2VX0A 3DGKA 3VVHA 5JRQA 2OSCA 4QP1A 2X39A 2C5OA 2C6EA 2YAAA 5JSMA 3KULB 1OL7A 3V8WA 3MBLA 2XH5A 5HG8A 5B7VA 1L8TA 3ALOA 2IO6A 4NEUA 5KHXA 3TKUA 4EZ5A 3T9TA 4D2VA 5HCZA 3PXYA 4LOQA 1KE7A 3E7OA 3KA0A 4HZRA 4KBAA 4LGGA 3RP9A 3BYSA 4X2NA 3W33A 2EB2A 4LUEA 4AW2A 1YHWA 4AA5A 1G3NA 4FT9A 2UVYA 4IC8A 5AR8A 3LFSA 1H1RA 2YIWA 4ZK5A 4FG9A 4EH3A 2G2HA 5ETCA 4S33A 5CU0A 2XNEA 3LFNA 1ZYLA 2RIOA 3LQ8A 3F7ZA 2A0CX 2BVAA 4HPUE 1OECA 4EC9A 5LMBA 4RFYA 1OBGA 3FLSA 4BCNA 4DGGA 3VS6A 1YXVA 4D1SA 4L53A 4RSSA 1KUTA 4IW0A 3QQLA 2G1TA 3MA6A 5AP7A 4ASDA 2R3LA 2PVRA 3R8VA 2B53A 3LXKA 3R02A 4U79A 5AP4A 2XCKA 3U55A 3F2AA 5FXRA 4QP9A 3S00A 5I9XA 4AT3A 5DFPA 3DAKA 4DLIA 5HTCA 3K3JA 4O84A 3P4KA 3W8LA 1UWHA 3C51A 2XNGA 3RVGA 4UMPA 1KOAA 1YXSA 3C4EA 4R3RA 3GC0A 4F7SA 4G5JA 4RIXB 5M4IA 4QO9A 4EHGA 5IDNA 2C4GA 1BI7A 2ETKA 4MBLA 1H1PA 4G6NA 4EQUA 4KKHA 1JLUE 4ENXA 4NIFB 3GP0A 4MAOA 3NGAA 3CC6A 4I6HA 3ZO2A 3CIKA 4IZ5A 4F9BA 5I0BA 5C01A 3DKOA 1Q3DA 1M14A 3F3VA 5CY3A 4DEDA 1PJKA 3PRFA 4JBVA 3D15A 2BTSA 4UV0A 3UVRA 2V0DA 1DI8A 5AP1A 3NVMB 4ZTNA 3PXZA 4AS0A 1OMWA 4B9DA 4EZ7A 5AX9A 2PE2A 3PPJA 3ZRLA 3GCUA 5IA0A 4RVTA 5J87A 3Q32A 5B2KA 4L8MA 4RJ5A 3UC4A 3HDMA 4IVAA 5IMXA 4BCJA 3HUCA 2WU7A 5CVFA 5EYKA 3E3PA 2OG8A 3OUKA 3R7VA 4FGBA 5HE0A 3R9NA 5HBHA 4RWKA 1U4DA 2IZUA 3O8TA 2F7ZE 2O65A 1JKTA 2PVJA 4LI5A 5ITAA 3UMXA 3UQCA 5CI7A 4ID7A 5IMEA 3BBTB 3TV4A 3GBZA 2PZYA 3MH0A 2H6DA 4UXLA 3D7TB 1O6KA 3BELA 5A4CA 4K11A 3SQQA 3ENMA 3PPKA 5AX3A 3RI1A 3ANQA 4AGUA 3DDQA 4DH5A 4F0GA 4M7IA 2QONA 4HJOA 5E8SA 4A9YA 4C4JA 4FEXA 2BIYA 3R8LA 4WSYA 3VUIA 2BAQA 5AP0A 2B9HA 3A62A 1YW2A 3QRJA 4HGLA 3ZZWA 4O7LA 3NNXA 4IANA 2ITOA 5BVOA 1WBWA 5D7VA 4KBKA 4BGQA 4CD0A 4IXPA 4R3CA 3BYOA 4V0GA 2G15A 5K9IA 2OBJA 4J71A 4W4XA 3MFRA 4FV1A 5CVGA 2E9PA 2GTNA 3L9PA 2W4KA 4JI9A 4K18A 3CTHA 3D14A 4J99A 5CSHA 4EOOA 4DEHA 3KN5A 2JIVA 1AGWA 1Q8WA 2BHHA 4QMSA 3IW7A 3FMNA 3RPSA 1JBPE 3E62A 3COMA 1ZYSA 2NRUA 3ALNA 2YCFA 4H39A 4YO6A 2RFSA 4JL9A 2REIA 4HCUA 3GCQA 4BI0A 1A48A 3ROCA 2Q83A 2X2LA 4KS8A 3PWDA 3PTGA 4CEGA 4IAYA 2GCDA 4D58A 3BWJA 4DGLC 1QPEA 1QPDA 1PW2A 1YDTE 5BVWA 2UZDA 2I0YA 4NTSA 4IAAA 2C5NA 4DFYA 3OCBA 3NNWA 3QGYA 2JEDA 4Z7HA 4XJ0A 3QRTA 1Z57A 1KE5A 3QA8A 3R01A 3I6UA 1PXOA 4O7SA 4ONAA 2RL5A 4IHPA 4AX8A 3AD4A 5HE2A 4G1WA 4QP8A 4ENYA 4DCAA 2OFVA 2OH4A 3KU2A 4G2FA 3R9HA 3PZEA 4P4CA 4QQJA 1XKKA 4OTPA 3ZFMA 4I22A 5LVLA 2VNYA 5C4LA 5M07A 2R3JA 3QQFA 5CAQA 3LVPA 3FYKX 3HRFA 1OPLA 1FGIA 4OTGA 4F1TA 1JSVA 4D1XA 3Q9YA 4Q5HA 2QOQA 3HKOA 4AA0A 2CKEA 3LHJA 3QD3A 4OR5A 4YHFA 3QCSA 4DEBA 4F7NA 1YI4A 5GHVA 3PJ1A 3HV6A 3P5KA 5JT2A 3SW7A 2JDSA 4FSYA 4JDKA 4YNOA 2PVHA 2CDZA 4BIEA 3EQGA 3HX4A 3AC3A 4IFGA 5KE0A 3ZUUA 2Q0NA 3I7CA 5DWRA 1WVXA 3ULIA 4MX9A 4D5KA 4NH1A 3E64A 1P4FA 3FI2A 3PVWA 5CEQA 4FSWA 4J8NA 4LL5A 4YJRA 2W7XA 3UIMA 4D1ZA 5CQUA 3JS2A 2XNNA 3GXLA 4DINA 2ZM3A 2O63A 3A7GA 5A14A 3TKIA 1XJDA 1Y6AA 5M4UA 1Q8UA 3POZA 2GNHA 5EW8A 3O50A 4KA3A 4C57A 4FTMA 4BIBA 4YTCA 2A4LA 2BDJA 2W96B 3VN9A 2X1NA 4GFMA 4MYGA 5L6PA 1GNGA 2VTHA 4FIGA 5DR9A 5HTBA 2PVYA 3SXSA 4C38A 4MTAA 5AJQA 3ET7A 5HKMA 4K6ZA 3ZZEA 4HVGA 1K2PA 2YDIA 2JFLA 2J2IB 2ONLC 4FTOA 4GKIA 3G33A 4Z16A 2FGIA 3FJQE 3P7CA 4FZAB 4R78A 4G16A 5HD4A 1IAJA 2QQ7A 3CD3A 4U0IA 3UYSA 1ZZLA 4KS7A 2ZMDA 2JD5A 2QOKA 2YIXA 2G01A 4GK3A 3UIUA 4PTEA 5HO8A 4ZTLA 5IQBA 3Q2JA 2R3KA 3Q60A 3D5XA 5E8YA 4M68A 4U5JA 4U7ZA 3SXRA 2F9GA 2X8EA 4TNDA 4YC3A 3KF7A 3FXZA 5FTOA 3WIGA 5C03A 2IZRA 2BKZA 4MQ2A 2JAMA 3UC3A 5T68A 1MRUA 4A9SA 3E88A 3KK9A 1H0VA 4CLIA 1Q62A 5GIOE 3EMGA 3FLZA 5A46A 4KNBA 3A99A 4BWPA 2VTRA 3EIDA 4IBMA 3OW4A 4XBRA 3Q6WA 3RAIA 3SC1A 3QTIA 4LGHA 4XG6A 3N4UA 3W10A 2QR8A 4AACA 2HIWA 4BDDA 1QMZA 1NY3A 3WILA 4V0GB 2AUHA 4AT4A 3KN6A 3R7GA 5HO7A 2P0CA 3V6RA 3KQ7A 4RIWA 4FKSA 4QP3A 4FG8A 4USEA 5CZHA 2OIDA 3LFCA 3R9RA 4NKAA 4CMTA 4DA5A 3IW8A 4RWJA 1MRYA 5CU2A 4Y95A 4FIEA 4EI4A 4F7JA 5M53A 5J1WA 1CKPA 5HIEA 4I6QA 2J0MB 1BLXA 5HG9A 2X6DA 2YCSA 3LM0A 4MXXA 4R5YA 4WHZA 5HI2A 3NIZA 2O5KA 2J7TA 4GRBA 1CTPE 4P7EA 3CE3A 5E8UA 3OWPA 4EL9A 5H3QA 1KV2A 4AZWA 3JR1A 4EJNA 2XK3A 3WBLA 4J53A 3FZOA 4KD1A 4QMQA 3BLRA 4XNEA 2LAVA 5DGZA 4RC3A 1XWSA 4AW1A 2CN8A 3CQWA 4PMPA 5CAUA 3LE6A 5CXZA 1DM2A 2EU9A 3FWQA 1B6CB 1KE6A 2B52A 4M13A 5AP3A 3DXQA 2FA2A 4ZY5A 4QYEA 4I0TA 5F95A 3G0EA 3PXFA 2P33A 5J9YA 4BDEA 3HVCA 2VV9A 3QL8A 5CSWA 2Y4PA 3RJCA 3LCDA 3OWKA 3HNGA 4FSUA 2C6KA 3F3UA 3MFTA 3QAME 2XP2A 4Z55A 3NDMA 5LMKA 1FOTA 5BUIA 4FNXA 1JSUA 2ITXA 3PPZA 4LOOA 4DFLA 3SW4A 4AOJA 2RFNA 2F4JA 3ACKA 2UW7A 3AD5A 5EYMA 3T3UA 4D4VA 4EK4A 5JFWA 4FSQA 2IJMA 3WF6A 1OIQA 5HX8A 2QNJA 2EXCX 1YHVA 4N57A 1NT2A 3FHRA 3ACJA 4YLJA 5ETFA 5ACKA 3MTFA 4D2SA 3VS2A 3O8UA 2A27A 4GU6A 2EUFB 3OBJA 3IGGA 3F61A 4EHVA 3TN8A 4OLIA 1JSTA 2VGPA 4ITIA 2YCRA 2ZV2A 3LMHA 4YHJA 3F7WA 5AR4A 3VIDA 4EK3A 3PA5A 3HV7A 1ZOHA 4ZSEA 5C8NA 2BRGA 5K4JA 4FKTA 4XH6A 3NUUA 5M06A 3W18A 1W7HA 4KIQA 5L3AA 3SRVA 3RHKA 4JRVA 4FKJA 1X8BA 4ERWA 4BYJA 5I9WA 3PP1A 5DLSA 1JOWB 4QTEA 2CHLA 4KSQA 3QYZA 3KREA 2R0UA 5CAOA 4HVHA 5IA3A 1OM1A 4FE2A 3PP0A 4BR3A 1KSWA 2V55A 4TYGA 4QMTA 3ATSA 3GVUA 3KXXA 3FZSA 4JIKA 4FIFA 4YJSA 5CX9A 4I92A 3CXWA 1R3CA 3LLTA 3MIAA 4FKPA 2XK4A 4G9RA 4RX9A 3WF9A 5B2MA 4BN1A 1OI9A 4OAUC 5L8JA 1G8SA 4LYNA 3R1QA 1TQPA 4QOXA 5KKRC 1SM2A 2OXXA 1Q97A 3I0OA 1J91A 4UMTA 3RBWA 2R4BA 2B9IA 2YLEA 4F9AA 5CAPA 4A4LA 5C26A 5EDPA 4E5WA 5J95A 3SA0A 5LCKA 1YDRE 4IAIA 4I6BA 4RRVA 5JMSA 3EKNA 4W9WA 2W0JA 5IQIA 3ETAA 2FSOX 4UXQA 4EK5A 2Q0BA 3MFUA 3ZM9A 4NW6A 3FLYA 3RPRA 4F9WA 3MFSA 3QCYA 3C5IA 4RMZA 3RCDA 3IW5A 3IOKA 2OW3A 4XV1A 3JUHA 2UZTA 2JKQA 3D2KA 5HOAA 2R3MA 2YHVA 5D1JA 4O1OA 2C5XA 1XBAA 4IIRA 4ZP5A 4EK8A 2OGVA 4FTQA 4L42A 2PE0A 3TUCA 3ERKA 3IDBA 3QQHA 4YZDA 5D11A 4Q2AA 5AUWA 5L2SA 2WQNA 4QMNA 4ANMA 2G2FA 2ITUA 5IQAA 2ZB1A 3IQ7A 4OTIA 3A7JA 3T9IA 2RG5A 4M97A 4N6ZA 3ORLA 4YTIA 2QO9A 3GQLA 5C8MA 4G34A 4FTCA 4PMMA 4EONA 1Y8YA 2OXYA 4EOMA 3ORNA 4QP6A 4YZMA 3RCJA 3CQUA 2W1IA 4HNIA 1W8CA 1H25A 2VTAA 5ANOA 4E6DA 3H30A 1LPUA 4AZEA 5CF6A 3C4XA 3EQDA 2YM8A 2CCHA 3AXWA 2BCJA 5AA9A 2BDFA 2HOGA 3ELJA 4FK6A 5EK7A 1PKGA 2QKRA 4CSVA 2R3FA 2IPXA 4ZTQA 4WNMA 2ETMA 5FD2A 3ZFYA 5IEXA 4XBUA 3UMWA 3F5UA 3SHEA 5JFSA 3O17A 5IQDA 4YNEA 4L3JA 4HGTA 3Q04A 3N4TA 1ZYDA 3BGZA 3WZEA 2Z7LA 5JQ5A 1YWNA 4D2RA 3E8EA 3OOGA 4FUXA 2LGCA 5AAFA 3VQHA 4ZTMA 4L45A 1OL2A 5ETIA 4BTMA 1RJBA 4B8LA 4JG6A 2C30A 2W06A 4FC0A 2J0IA 4CYIA 3BIZA 3Q3BA 5FEEA 3LCOA 3R7YA 3FPQA 3MB6A 3QX2A 4MEDA 2XIZA 3UTOA 2XRUA 3G6HA 3UZRA 1PHKA 4PDSA 3PFQA 3DA6A 3PLAE 2E9UA 4IADA 3TNQB 3MH3A 5DT4A 4FOBA 3PG1A 5LQFA 3FZRA 4IX3A 4RIOA 3U6JA 1UU8A 5I4NA 4CKRA 4TZRA 5LWNA 3PJCA 2CLQA 3CPBA 4R7BA 3QKLA 4FKLA 3IO7A 3QUDA 1UV5A 5K5XA 4L7FA 4AAAA 2C68A 3EN5A 4BTJA 2YM7A 5K0KA 2IN6A 4NWMA 4AP7A 5EM8A 4U41A 4W9XA 5CF8A 4JIAA 5L8KA 3BYVA 4TPTA 5AIKA 4KIOA 2NP8A 4IX5A 2BRBA 5HE1A 1DS5A 4HVIA 2J9MA 5HLPA 2FYSA 3O7LB 3QD0A 2F7EE 5IZFA 3LM5A 4X3FA 3IK3A 4JJRA 2QO2A 3QQGA 5DBXA 4CMOA 3QTZA 2IVSA 3KXHA 4C8BA 3LMIA 3RM7A 2QCSA 2UW4A 3GFWA 1H07A 3IS5A 4C4EA 5B2LA 4EBWA 4IC7A 4TTHB 4GH2A 5EQPA 1GOLA 4YBJA 2BALA 4WG3A 5DVRA 3Q4ZA 1FMOE 5E91A 4Y85A 2WOUA 3C0HA 4GFGA 4BICA 5DE2A 2PVNA 4OUCA 3OEFX 2BKKA 2XVDA 4FT0A 4O6EA 5A4EA 5J5TA 1JAMA 4O6LA 3U4UA 4YJPA 3ZCLA 4F9CA 3KF4A 4QPMA 1CKJA 1WBVA 2OF2A 3D4QA 4RA5A 4RQKA 3HYHA 3AQVA 1Z5MA 4ERKA 3GOPA 4ZMFA 3TCPA 2ZDUA 1M7QA 3LW0A 3NAXA 5GJGA 1PF8A 2GPHA 4BDJA 3QTWA 4YZCA 1BL7A 4YHTA 4IZ7A 4GV1A 3FLNC 3GCSA 4XYFA 4XRLA 4E73A 2VWWA 3BQCA 4U97A 4RVMA 4JRNA 4X2KA 3KFAA 4FKUA 4PTGA 4ZTSA 3LQ3A 2OJJA 5IQHA 4ARKA 3Q9ZA 3HA8A 4RWLA 2UZWE 3RK9A 4UB7A 3R28A 4E4MA 2YFXA 1IASA 4JAJA 4PDPA 3Q4CA 2QG7A 5DN3A 2GMXA 2SRCA 3K2LA 4NYEA 2YIYA 4LRKA 4CTCA 5EW9A 5AUZA 3PIYA 4O96A 4CV9A 4FV7A 3GUBA 3GEQA 1ZLTA 2XM9A 4RPVA 2BRMA 3FSKA 2RKUA 2C0OA 3OTVA 4Y5QA 3UPXA 2WQBA 1M2PA 4QNYA 3V6SA 4TRLA 2UV2A 4CQGA 3THBA 4O7VA 4IZYA 4TY1A 4FK3A 5AFVA 2OLCA 4OTWA 4U43A 3POOA 3VHEA 2XZSA 5EHOA 4DG2E 4LRJA 2XYUA 4DEEA 4FL2A 5H8GA 2E9OA 1WZYA 5JK3A 2ZMCA 4IWPA 4AGWA 2BUJA 2WTWA 2I0VA 2RFDA 3MY5A 3ROYA 3PSDA 2XUUA 5FTQA 3DXPA 4NCTA 3FYJX 3DJ7A 4I94A 4MBIA 3PXKA 4WNKA 3QA0A 4XLVA 2ESMA 4NU1A 5J8IA 1DI9A 2WTKC 3FC1X 3R8ZA 4Y73A 4E20A 2R5TA 4FUYA 2W17A 4NFMA 1ATPE 4FV5A 3V8SA 1H4LA 5KBRA 4AF3A 2PVLA 2R3NA 2HAKA 4S31A 4A07A 2FSLX 4BZDA 3C0GA 3PRIA 5HBEA 2JDOA 2UW3A 3ATTA 4BDIA 3TJDA 1NVSA 1W83A 2XKDA 2H9VA 4PPBA 5CXHA 2ZYBA 2JKMA 4CZYB 5C27A 4BTKA 2P4IA 1UNLA 4DYMA 4RFMA 2CLXA 2BTRA 2VTIA 4HVDA 2ZV9A 5LMAA 3VWAA 2QU5A 1E1XA 3RK7A 3CEKA 4O21A 2XNMA 4FEUA 4RQVA 1T45A 3FKOA 2ERZE 4ZY6A 3TZ8A 4BCOA 4D2WA 4F4PA 4H58A 3U54A 2JDVA 4KINA 4S32A 3AC4A 3W55A 2J0LA 1E1VA 3FMMA
chains in the Genus database with same CATH superfamily
1ND4A 5GJFA 3NUAA 3A4OX 3FMLA 3WI6A 4KRDA 3QUPA 3K3IA 5BYZA 4ZLOA 5AAEA 3U9CA 3G9NA 4AGCA 2CGWA 3ZXTA 1H8FA 2PVFA 4L68A 4IB5A 5CSPA 4I23A 2GHLA 3R2BA 1MRVA 1WCCA 4YSJA 1IR3A 4Y46A 4NJ3A 3NUSA 3P79A 1OITA 4O0SA 2YIRA 5BMSA 2HXQA 3IW4A 1XH4A 5AIRA 3QWJA 4FIHA 3HMIA 2WQMA 4BCQA 5M08A 1R39A 2YJRA 1BUHA 3FY0A 5CEKA 2O2UA 3MESA 3MIYA 3W0PA 2UZBA 3UIBA 5ETAA 4X3FB 2QC6A 2VZ6A 3AD6A 5TKDA 2OJGA 2QR7A 5CAVA 3F5XA 5FDPA 4FNYA 4TWPA 2B1PA 2PHKA 5HO6A 5DYJA 1CSNA 4U9AA 3M2WA 3I5ZA 1GZ8A 4R1VA 2W9FB 5IUIA 3UE4A 5G6VA 2XIYA 2R9SA 1Q41A 4NZWB 1UKHA 5D9HA 4CGAA 4RX7A 1F0QA 4IAZA 2PPQA 2O8YA 3BCEA 2WEIA 3OTUA 4L52A 4QMVA 4CFWA 4TW9A 3C4CA 2V7AA 4EJ7A 3D0EA 4U45A 3FMHA 3TJCA 3V5TA 3NW6A 4QMPA 2X7GA 3DZOA 4UWCA 4DT9A 2IZSA 3NCGA 3W0NA 5M4CA 4BC6A 4EHEA 5LOHA 4JVGA 4ZLYA 3B8QA 3QQUA 4CCUA 3OT8A 2CMWA 2PMNX 4PY1A 1PMNA 1YWRA 2Y4IB 3ZRMA 3IONA 4LOPA 4TT7A 3HMOA 4QTCA 3P0MA 4AXDA 2DYLA 1KE9A 2ZOQA 4MK0A 4YGAA 2H8HA 5D10A 3VW6A 4D9TA 4EOQA 5BUEA 5CF4A 2X4FA 5FXSA 3F2NA 3FC2A 4KB8A 3BYUA 4IWOA 3R8MA 4E6QA 2XF0A 3BQRA 2X2MA 2X8DA 4PUZA 1SVGA 1GAGA 1JKKA 5ANKA 3A2CA 4E5AX 4TYEA 3EFJA 5IQGA 3OW3A 1YXXA 2RF9A 1XBBA 3AGMA 3FMEA 1Q3WA 3S95A 2JIUA 4EOIA 4GVJA 3JY0A 4Q5EA 2QOOA 4YC8A 1LUFA 4EZ3A 1ST0A 4KSPA 4E8AA 3IDCA 4M8TA 1Y6BA 3LFBA 3F66A 1OB3A 2Y8OA 4U6RA 4DN5A 3WZKA 1IA9A 2VWYA 3LQ5A 4G5PA 4NM7A 3T8OA 2Z7RA 4FICA 2C3KA 4PX6A 5AP2A 3D2IA 1VYZA 1P5EA 5KMOA 2CSNA 3CTJA 3NSZA 3IG7A 4BDHA 3FUPA 3P1AA 2W5BA 2Z60A 3BE2A 4UZDA 3GC9A 5CQWA 4UYAA 2DS1A 4LMNA 1QPJA 3IDPA 4GG5A 4AW5A 3TUDA 3E8NA 3WF5A 4Y8DA 4MD9E 1ZMUA 2WMXA 2VTMA 2WMQA 3UNJA 5C8KA 5IA1A 5FTGA 4RIYB 1IG1A 4NW5A 5D12A 1PXNA 2XIXA 4BHZA 4A4XA 2F57A 4DEAA 4ANQA 4AAYA 2QOHA 2GSFA 4BTFA 5JFVA 4WRSA 5DR2A 3R63A 2H96A 3IW6A 5DEWA 4FV9A 1I44A 4QP7A 5FEDA 3L9NA 2J0JA 3W2QA 3DNDA 2YCQA 3FE3A 4JQEA 5I3OA 5AEPA 5FG8A 4EYMA 4BBFA 4N6YA 4DEGA 1H24A 3OOMA 2OK1A 4MWHA 2C1BA 4RG0A 3TIZA 3NUNA 1PMUA 2C6MA 2YITA 2HELA 2VTTA 3MJ1A 3SDJA 4AZTA 2AC5A 4UY9A 3PFYA 4DG0E 3HP2A 4D28A 1OIUA 4CCBA 1IEPA 4OAVB 3GNIB 1YDSE 1WBSA 1TQMA 2WEVA 3GCVA 3OMVA 5HORA 3HMPA 4EH2A 1W2CA 2YACA 2GNJA 3DDPA 4C2VA 5KMJA 1UU9A 1UNHA 2FUMA 3F2RA 3K5VA 2BMCA 2G2IA 3Q53A 2X4ZA 1SVHA 4FTJA 1Y8GA 3GC8A 1ZYJA 4YC6A 3ZOSA 2VX3A 4P2KA 3QBNA 4CMUA 5EHLA 4CKJA 4C3RA 4O22A 3ZFXA 1ZOEA 4PL4A 4LG4A 1PXLA 4K0YA 3LFFA 3OP5A 4QNAA 2P3GX 4FR4A 4RLLA 5H8EA 4FNWA 4H3BA 5KMKA 2CCIA 4A9TA 3MN3A 5LVOA 4O7YA 4O0UA 2QU6A 4GVAA 2QG5A 4IQ6A 2C0TA 4NKSA 3P7AA 3IGOA 2NYAA 5KMNA 4OBOA 3C13A 1AQ1A 2HZNA 3E3BX 4U40A 1DAYA 2PUPA 3LJ2A 3NNVA 5E7RA 5BVDA 4WNPA 4E6AA 3UDBA 4HGEA 3U51A 1OKVA 3A7HA 5EI2A 5JGAA 4I4EA 4L44A 4JLCA 2GFCA 4CLJA 3WYXA 5J9ZA 3TMOA 5L8LA 4H3PA 5KZ0A 3QD4A 4XG9A 3RAKA 3H10A 4U80A 3TTIA 3PDTA 3ZXZA 4MKCA 3AT4A 3OVVA 5HNGA 3BWFA 4E4LA 1LR4A 3EN6A 2QLQA 3MVJA 4FI1A 4B8MA 2IW9A 3EWHA 3MVMA 4X3JA 3DXNA 4FTAA 3TEIA 4F9YA 2WMSA 4CG9A 2J50A 4BCMA 1JKLA 2VWUA 4HZSA 3R7UA 3VF9A 1H1QA 3QTUA 4EC8A 4FTIA 5EKOA 3PXRA 5A9UA 3DLSA 3E5AA 3ORKA 4F99A 2ITPA 3F6XA 4K8AA 3LAUA 3Q96A 3ORZA 4BJJA 5K3YA 5CENA 1BI8A 2GNIA 3GU5A 1WVYA 4FT7A 4YZBA 2XJ2A 4FYNA 2C6LA 3PXQA 4WBOA 4YJQA 4WSQA 5ICPA 4E3CA 2FVDA 2OZAA 3VS5A 1ZAOA 3FZPA 4DE4A 4DBXA 4XV3A 2FSTX 4I5MA 5HG5A 4EKKA 2JGZA 4YBKA 2B54A 4K77A 4IVCA 3WZJA 4OTFA 3LXPA 4GCJA 2XBJA 2WTIA 3EKKA 3QFVA 4TYJA 4EK6A 5IISA 4MF0A 3UG1A 4ZXTA 4GYGA 3VO3A 1OL6A 4LL0A 4QYHA 2X81A 4L43A 5FP5A 4BY9E 3P78A 2AQXA 4Y72A 5EHYA 3H9FA 5AR5A 3PLSA 4ANOA 2CPKE 3MPMA 3KMUA 4GW8A 3SXFA 3FKNA 4B99A 3HDNA 1O6LA 2ITQA 4Q9ZA 2JFMA 2WO6A 5I9UA 3U6IA 1BYGA 2CGVA 1OPKA 1PYXA 2F49A 3DFCB 3PWYA 2QURA 4IZAA 4KKEA 4C35A 3FY2A 4R6VA 2VTOA 2IWIA 1VYWA 2OWBA 4JDHA 3LXNA 2GFSA 4LMUA 3M42A 1DAWA 4TYIA 3UVPA 2EB3A 4FTRA 3KVWA 4AXCA 4CTBA 3GT8A 4UEUA 5KMLA 3TNWA 1F5QA 2BHEA 1OKWA 2BROA 2HWPA 3QTRA 4EH5A 3Q9WA 3ZC5A 2ITTA 4JBPA 3ORXA 5IA4A 4FX3A 4O0XA 4BCFA 3CY3A 4X2JA 2HW6A 3F3WA 3EH9A 4ANBA 2XS0A 3O8PA 4IWQA 3MH2A 5BVNA 4O7RA 4DTAA 5AM6A 5BPYA 1PXIA 3VJNA 4EUTA 4I5HA 4I93A 5EFQA 1NW1A 5ANEA 3BEGA 3ZSHA 2JLDA 5E90A 3LOKA 3H9OA 4FV8A 4EEVA 5E8TA 3ZLSA 3FLQA 1Q4LA 2BZJA 1H27A 2PE1A 2VWXA 1RDQE 3CP9A 4X6RA 3KXZA 3PY3A 4I21A 4BDKA 3QLFA 2DQ7X 3MDYA 4PF4A 4RJ6A 5H8BA 3M1SA 5LVMA 3SV0A 2HY81 3O23A 2HZ4A 3R9OA 3ZUVA 1TFFA 5IF1A 4F64A 4C34A 4O91A 3UP2A 4AFEA 3NWWA 3BRBA 5DR6A 5HIBA 1CKIA 2RG6A 2ZDTA 4ACGA 3TV7A 3AMBA 5CANA 4XLIA 3PVUA 2BPMA 4O27B 4RJ3A 1BKXA 2W4OA 5IA5A 2J6MA 2GNLA 2Z7QA 3VRZA 4QMYA 4BGGA 1MP8A 3ZMMA 1UKIA 4MF1A 3R73A 5ANGA 2X6EA 4BCKA 4IAKA 2PUUA 2J51A 2F7XE 3Q4UA 5DG5A 5AP5A 3OT3A 4ALUA 4FOCA 4GUBA 3IKAA 3LJ1A 3BHHA 3VF8A 3I7BA 4QMOA 4EOPA 5BMMA 3ZM4A 5FM3A 2VTNA 3FSFA 3R71A 3MA3A 3SKCA 4XOZA 4EUUA 2WQEA 4FEQA 1YOJA 4CFXA 2W99B 4O0VA 4PP9A 5DHJA 2JDRA 3RINA 4PNKA 4YTHA 5F4NA 5LVPA 2W1DA 1F3MC 2JITA 5GZ9A 3TNIA 1MUOA 4I5PA 4A9UA 3MV5A 4M69A 4CFMA 3SG8A 4O86A 1Q24A 2WXVA 5HVJA 3ZH8A 4OTHA 1YXTA 4FTUA 1XH6A 3BEAA 4HYUA 4BKJA 4UWBA 3MGYA 3OCGA 3R7EA 2WMVA 3FZTA 1J7IA 3CGFA 3N51A 1URCA 2C6TA 4CFVA 5A4TA 3ORPA 1XHAA 1GIHA 4CV8A 2QO7A 4I1ZA 4R7IA 1NXKA 4BFMA 4IM0A 2ITVA 3DS6A 5EW3A 4XCUA 3C1XA 4ASXA 4C58A 4DLJA 5HQ0A 5LWMA 5M56A 3F69A 3AGLA 2E2BA 2ZJWA 5FWKK 5CASA 1GZKA 1JQHA 3BV3A 4DAWA 2GTMA 4PPAA 2C6DA 4IJ9A 4KAOA 1H01A 4DDGA 2PZPA 3VUDA 3HMMA 4LV7A 2WMUA 3A4PA 5E8ZA 3UQFA 3EQIA 2PK9A 5AADA 4YLKA 3UP7A 2XK8A 5I9ZA 1OIRA 2YERA 3G90X 4FVQA 4GL9A 5AA8A 3F5GA 5JGDA 3TIYA 3BYMA 4HYIA 3C4WA 3O51A 3OCSA 3PJ2A 2ZB0A 5FBOA 5AR7A 4LV8A 1OPJA 4CZUA 1NVRA 2YAKA 2ERKA 1P4OA 3GU8A 3NPCA 4R5SA 3FMDA 1UU3A 3AMAA 4ALWA 2J5FA 4XEYA 4FJVA 4RBLA 3RPYA 3EQBA 3P7BA 4IDVA 4L3LA 4M15A 1VJYA 2R2PA 4WT6A 1YQJA 3G2FA 2R64A 4WOVA 4O0YA 4W8EA 3NCZA 5AV2A 2B0QA 2H34A 4FSNA 3VC4A 4AUAA 2EVAA 1W98A 4JDIA 4BIDA 2B4SB 1G8KA 3OF0A 4LM5A 2R3HA 1W82A 4EH4A 2X0GA 4IB1A 5BYLA 2Y0AA 2XNOA 4PWNA 2X7OA 3DCVA 5KNJA 4GFOA 5IUGA 2C47A 2W05A 4O1PA 4D4YA 3CCNA 3C9WA 3COHA 4NM5A 3MVLA 4FIIA 3NYVA 2OIQA 4QQ5A 3V5JA 3QXPA 3FI4A 3HL7A 4EOSA 3DK6A 2QD9A 2OXDA 3G51A 3OZ6A 4RA4A 5KCVA 2X0PA 4DG3E 1H26A 3R7IA 1WAKA 4RLKA 4DITA 3N9XA 3OXTA 3HECA 5FEQA 2VTPA 2CNUA 3OWJA 1ZXEA 2OFUA 3UO4A 4ZAUA 3S1HA 3RM6A 3QHRA 2WAJA 4RIWB 4FG7A 4QEBA 1JPAA 1YRPA 3AC2A 3DJ5A 3ZU7A 2GQSA 4ANSA 3FI8A 4DF3A 4O2ZA 1A9UA 4U3ZA 2YDKA 3VS3A 1L3RE 3DK7A 3QX4A 3MS9A 3ZLWA 5K0XA 4L6QA 4YJNA 1U5RA 5HESA 3WZDA 1PXKA 2XA4A 5ANJA 4B7TA 2IW8A 4OW8A 2XNPA 3CSVA 4LV5A 3QQJA 3H9RA 4FTLA 4OT5A 2VTLA 4DC2A 2CKPA 5JKGA 2HENA 3KVXA 4ZSJA 2NPQA 3DPKA 4II5A 3VW8A 1ST4A 4WIHA 1JNKA 5E9EA 4Z9LA 3EL8A 4USDA 3LKMA 2V5QA 2JAVA 3ZONA 3QC9A 4LRMA 5GNKA 1S9IA 1YKRA 4LDTA 3IECA 5EM5A 3EQHA 5B0XA 4YJOA 5ANIA 4I24A 5BUJA 3ZDUA 3UDZA 2BR1A 1VEBA 2C3IB 5H2UA 4AN2A 3MY1A 2YIQA 2WMRA 2YLFA 4QP4A 4X21A 1V0BA 4FKWA 3DBCA 4FZ7A 3CKWA 2PVKA 2FSMX 3BV2A 1PMVA 3BPRA 4C3PA 5E1EA 3ORMA 2PUNA 1KWPA 3DAJA 3PY0A 5KBQA 3RPVA 3I6WA 3FZ1A 3MPAA 1LEWA 2R3IA 1VR2A 2UZOA 4IX4A 3BHYA 4K9YA 4U81A 3QCQA 5BVKA 5HLNA 3DQXA 3GB2A 2P55A 2JC6A 2QOLA 4JBOA 4NM0A 3T3VA 3TUBA 2WIHA 5EI8A 4UX9A 5EH0A 2QHMA 3EFWA 5HHWA 1IA8A 2IVTA 3BE9A 4A9RA 4G3CA 4JNWA 2FH9A 3PVBA 1PYEA 4Y83A 3ZBXA 4AWIA 3KULA 5CYIA 4QQCA 5L2WA 3OROA 4I0RA 5BVEA 5AV1A 5HNBA 4N70A 4I4FA 3DTCA 2OJ9A 4XP0A 3EYHA 3MSSA 2VO0A 2YABA 3GOKA 5I9VA 4E6CA 4G3EA 4FKRA 1G8AA 4M0YA 5HGIA 5JRSA 4C36A 4F1MA 4X2FA 4XP3A 5T6KA 1T46A 4QMLA 3ZYAA 4NUSA 3SRVB 4EH6A 3R8PA 2PZRA 2ITWA 3KRJA 3E92A 3NEWA 2WMAA 3NYOA 4IJPA 1ZY5A 4N0SA 5K4IA 2R3QA 3PIXA 4P5ZA 4FTTA 2HZIA 3R21A 4UWYA 3RZFA 3VAPA 3WIKA 4NFNA 4PQNA 1K3AA 2HZ0A 4RVLA 2ZM4A 3GI3A 5FM2A 3VUMA 2JDTA 1J1CA 4QTAA 5CEPA 1YI6A 1A06A 2A98A 1WMKA 2OF4A 3E7VA 4FV3A 4MXCA 1CDKA 3FKLA 4X7QA 3W8QA 4EBVA 1P14A 4JS8A 1V1KA 4EH9A 2QOFA 2ETRA 4M67A 3CS9A 3LJ0A 3I4BA 3IOPA 4G3FA 5EQEA 2C1AA 3I81A 2PZIA 4RWIA 2UZNA 5KZIA 4G6LA 4DGMA 4CFFA 5TE0A 2JBPA 3FV8A 2ONLA 4KWPA 4YO4A 2UVZA 2BRHA 4AA4A 3CJGA 3FXXA 4NIFA 3K54A 4C7TA 3TTJA 5EM7A 4QD6A 4IB0A 3P08A 1MQ4A 3KRXA 1U46A 3FMKA 4FRFA 2PL0A 5GZAA 4FEVA 1GJOA 4E4XA 4ZJJA 3LFQA 4JG8A 5BVFA 3GQIA 1JKSA 3JVSA 5FQDC 4E5BA 4YMJA 4XP2A 3Q5IA 3TG1A 5JGBA 1ERKA 3VBTA 3UO6A 2I6LA 3UNKA 5FUTA 4BF2A 2UZVA 4FT5A 2C69A 2BZIB 4AXFA 5L6OA 2XAMA 1BL6A 3Q52A 4IE9A 2XEZA 2WFYA 2BFXA 4D55A 2XK6A 4O4CA 4GIHA 5BV3A 2W9ZB 1XO2B 2C6IA 1VZOA 2YM6A 3NR9A 3NW7A 4ZTHA 3SAYA 3SG9A 2C3JA 3FI3A 3LCKA 3II5A 3L9LA 5J7BA 3TT0A 3FMJA 2VN9A 4FODA 4AOIA 5M4FA 3UOJA 5EOLA 3A7FA 4FA2A 3D7TA 5KO1A 5AV4A 5CT0A 2WGJA 3A8XA 4MXZA 3UIXA 4O2PA 1U59A 2YM5A 4KKGA 1ZMWA 3QKKA 4W4VA 2UVXA 2R3PA 1OKZA 4C4FA 5JFXA 3R22A 4NL0A 4HYSA 2CKOA 1MQBA 4Z3VA 4F6SA 4WG5A 5HEZA 3REPA 1W0XC 4P5QA 3W2SA 3VBVA 4MUQA 5F20A 4TL0A 3UZPA 2O3PA 2ITYA 3DB8A 2RGPA 5BX0A 2CNVA 5CEIA 2NRYA 3L9MA 4O38A 2GQGA 1Q5KA 4EYJA 4PMTA 1Q8YA 3TNPC 2WD1A 3TZMA 4JR7A 4O4DA 3ZLYA 4R8QA 3TYKA 4JMQA 1H1SA 5GJDA 4IWDA 4F7LA 3ZLXA 4IVDA 3R0TA 3KXNA 4FL3A 4OT6A 4YPSA 4I6FA 5G1XA 2C3LA 3MJ2A 3RNIA 1WFCA 3U8WA 3DFAA 2GQRA 3VUTA 1OVEA 2W1CA 2WMTA 4IEBA 4W8DA 3TM0A 2YEXA 4FNZA 4R7HA 4YR8A 3JXWA 1OBDA 4E7WA 4CQEA 3ANRA 3R1NA 3D5VA 2XNBA 3FLWA 2VRXA 4WO5A 4C4IA 3H0YA 3GU6A 4P90A 4XG4A 2W1ZA 3G9LX 4QQTA 2I40A 2XKFA 3SVVA 3OWLA 5I3RA 4ZZOA 2GNGA 5DT0A 5E4HA 3PSCA 5A54A 5HU3A 4LUDA 1ZY4A 2RSVA 5KX8A 1PRYA 1XBCA 4CKIA 4FL1A 5FP6A 4RZVA 2XJ0A 4F65A 2V62A 4G17A 3RTPA 3ZEPA 1Y57A 3MPTA 4QMUA 2HCKA 1NA7A 3QZIA 4HGSA 5E8XA 3EJ1A 1RW8A 2YJSA 2GS6A 2VTQA 3V5QA 1H28A 1M52A 3MVHA 5J1VA 4FYOA 2XYNA 4QMXA 2PUIA 5CF5A 3JY9A 4PDYA 5LJJA 4JDJA 4RT7A 3L8PA 2PMOX 2B9FA 2WTVA 3ULZA 4BBMA 1SMHA 3AG9A 4BCPA 2UW5A 5KHWA 5AV3A 2AEGA 1QCFA 4FZ6A 3EQRA 3RNYA 2OICA 2X7FA 5IH5A 5F94A 4MVFA 4RX8A 2UZEA 5I5ZA 4FBXA 5JEBA 3VBQA 3W1FA 1W2DA 1WBPA 3ID6C 4UZHA 1OUKA 1Z9XA 4WD5A 2PYWA 4BZNA 4DHJA 2AYPA 4OBPA 3VS0A 3W16A 2Y6MA 4CFNA 4NSTA 4J8MA 1TVOA 3CQEA 4RVKA 3DBFA 3C4FA 2WTCA 4RZWA 3TWJA 1FVRA 3ZBFA 4DBNA 3D9VA 3FQHA 3BHUA 3NW5A 4KIPA 4W4WA 3A7IA 3BGQA 2GU8A 3CGOA 4FZFB 5DIAA 1H00A 1YOLA 3B2TA 4XOYA 3FXWA 3HRCA 3P86A 3LCTA 2WOTA 4X2GA 4AOTA 3UODA 3QTQA 1PXPA 1SNXA 1XQZA 2IW6A 4LQMA 4ASEA 2GNFA 4C33A 2XIKA 1Q61A 4JQ8A 4RJ8A 5C9CA 4BHNA 5HCXA 3GC7A 3E8DA 2QHNA 4EH7A 5IA2A 5GINE 2DWBA 5DOSA 4F70A 3VBYA 4XHKB 4MD8E 4RJ7A 3EN7A 3W2OA 2A2AA 3EFKA 2XM8A 2YA9A 4MBJA 4QTDA 3CD8A 3D7ZA 3HLLA 2QLUA 4L46A 2JKOA 4IB3A 5T3QA 4YUQA 4NTTA 3PYYA 1YVJA 3GCPA 4TYHA 5E8WA 2W1FA 4G3DA 3NAYA 4IDTA 4QTBA 4FT3A 3VQUA 4RC2A 2PTKA 3KK8A 4ITHA 4ACCA 1R0PA 4QT1A 2BIKB 2AC3A 3AKJA 3MW1A 3V51A 3QC4A 4BDBA 4EWQA 4YJUA 2X9FA 4RJ4A 3QZHA 5HBJA 5EKNA 2XKEA 3F3ZA 4DFXE 3BI6A 1NVQA 2G9XA 3UYTA 4JXFA 3S0OA 4F6WA 4C59A 5AUVA 4JOAA 3A61A 3HAVA 5C4KA 2OKRA 3ITZA 1M2RA 5LARA 5IDPA 4GT4A 4IFCA 2UW8A 3NFGB 2CKQA 3BKBA 4FV4A 4MCVA 4DGNA 2VX1A 2WIPA 3HEGA 4C62A 1V0OA 2ITNA 2UW0A 4EOJA 3ML1A 5EQYA 4S30A 3L1SA 5AR3A 4Z7GA 5D7AA 3D83A 3EOCA 5AAGA 3PJ8A 3Q4TA 3P5JC 2R3RA 5M57A 2IZTA 3B2WA 3G5DA 3VS4A 4ALVA 2YDJA 2FB8A 2R3GA 4BZOA 2OU7A 4GIIA 3ZO3A 2ITZA 3OC1A 3NX8A 4L00A 4FKOA 4F63A 2NO3A 3OS3A 4ZIMA 4EHZA 1UWJA 4MXYA 3HMNA 4CZTA 5HU9A 3F88A 5HVYA 3UO5A 4BDAA 1LP4A 3MTLA 4FVRA 2Z8CA 4AN9A 4BI1A 4HPTE 3NNUA 2VUWA 2B55A 5EG3A 5CTPA 4CNHA 3KIOC 2NNWB 2O0UA 1Y91A 4GK4A 4O4EA 2UZLA 3R7OA 4APPA 2JIIA 5CU3A 3QWKA 3PA4A 4XG3A 4ZSAA 2PMIA 3UVQA 4IM2A 4FMQA 3V01A 2QOBA 5BNJA 5DMZA 3COKA 3UQGA 4BCHA 3QTXA 5HNIX 5IEVA 4KRCA 5K5NA 4GEOA 1KE8A 4DFUA 4XG8A 1V0PA 2OIBA 3W2RA 3I5NA 3RKBA 4K2RA 1H1WA 1J3HA 4TWOA 4QP2A 5HLWA 1O9UA 2XCHA 4XS2A 4FSMA 4AT5A 3VUHA 3OY1A 4NT4A 4R1YA 4YZ9A 4PNIA 1REKA 3QLGA 4ACDA 3MH1A 3TACA 4ZJIA 4OGRA 3CY2A 4C3FA 3A8WA 3LZBA 5M44A 5H9BA 1ZARA 4FTNA 1GZNA 3DOGA 4I0SA 2HY0A 4O7WA 3BHTA 4X3FC 4MQ1A 5CLPA 4BDCA 1UU7A 4XG2A 5FGKA 1ZOGA 3G6GA 2I0HA 4GJ2A 4F1OA 4JX3A 5ANDA 1REJA 3WOWA 2PY3A 3NUPA 3ZTXA 4E93A 2W5HA 4E1ZA 4F08A 4B6LA 4ZS4A 5CVHA 2XJ1A 5HZNA 5CEOA 1Q8ZA 4BCIA 5M09A 4BDGA 2OJFE 1FVTA 4FV0A 4EWHA 4O83A 3AT3A 2XIRA 5ACBC 3Q6UA 3BHVA 3PUPA 3QXOA 4NJDA 3FHIA 3AMYA 5AM7A 3TZ7A 4D2TA 3SGCA 4JQ7A 4IAFA 1M17A 2CJMA 2VWZA 1OZ1A 2W5AA 4D5HA 4L3PA 3QD2B 2IEWA 3RK5A 4PTCA 1UVRA 5F9EA 3DV3A 5JN2A 4LGDA 2R7BA 3KRWA 1SNUA 2Y4IC 3UZTA 1B38A 2Y7JA 5IQCA 2Z02A 2PZ5A 2B9JA 2QI8A 2Z7SA 4ZSGA 2Y9QA 5KKRB 3FQSA 2I7QA 3O2MA 2ZM1A 3FL5A 5JZJA 1WBTA 4YU2A 3DU8A 4HYHA 4JBQA 5JH6A 5IH6A 3QQKA 2YZLA 2WTDA 3QU0A 3N4VA 1IRKA 3TV6A 3P23A 3AC1A 4K1BA 4F0IA 4FF8A 5L2TA 2C0IA 2WKMA 2WZJA 5DNRA 2VD5A 3VS7A 4D2PA 1J7UA 4XV2A 2X0OA 4NK9A 3KY2A 2WNTA 2VWIA 4ZTRA 4AW0A 1XH7A 3KMMA 1FMKA 4TYHB 4GS6A 4AG8A 2YZAA 1YXUA 3Q5ZA 4O7TA 4APCA 5EM6A 4EOLA 2WTJA 3DTWA 4USFA 4WRGA 1W2FA 1HCLA 2A1AB 5IU2A 4I41A 5J79A 3GENA 4V05A 3HV5A 4HCTA 4HW7A 3C5UA 3L8SA 3UG2A 1SVEA 1UA2A 4BL1A 2CGXA 1E9HA 3R30A 3RPOA 4CVAA 1I09A 4FKGA 4M0ZA 4C4HA 2OO8X 3A60A 3NIEA 2XKCA 4GT5A 3QALE 3KB7A 5DA3A 4ZMEA 3LFDA 2C5YA 4YJTA 4HNFA 3RHXA 3EFLA 2YWVA 3AT2A 4NCTC 4YLLA 2WU6A 1QPCA 2BAJA 3AKLA 4C02A 2OI4X 1U5QA 3CJFA 5DRDA 3DQWA 3EL7A 2DUVA 2UW6A 2X2KA 4PDOA 4X6QC 4XMOA 2J4ZA 2HK5A 4DGOA 4G9CA 5IPJA 2F2UA 4WBBB 3BU5A 3F3TA 4O0TA 3HA6A 3FPMA 4AE9A 5IEYA 2HXLA 2WPAA 1U54A 5A4QA 4J97A 3RMFA 4MHAA 5DH3A 4AGDA 4MXAA 1OL1A 3MYGA 5E92A 4D0WA 3VBWA 1GY3A 2KULA 3E63A 4QRCA 4BBEA 4EQMA 3TL8A 1ZRZA 3ZDIA 4H1JA 5D41A 5E1SA 4ITJA 2GS2A 4S2ZA 3LXLA 4M84A 5DEYA 4U42A 4DH7A 4F09A 5TO8A 3ZEWA 5AMNA 2WQOA 3C7QA 5JZNA 4UMQA 2YM4A 2X9EA 4AFJA 5A6NA 3ODYX 2QKWB 4JT3A 4KBCA 3BLQA 4XV9A 3E8CA 3WE4A 4A4OA 5IG1A 3QUEA 4HVSA 3OD6X 5DRBA 3UOLA 4I3ZA 3L8XA 1J1BA 1OUYA 3DKGA 2VTSA 3DT1A 3KRRA 4ACHA 1Q99A 3BL7A 3R9DA 4BKZA 5KMMA 5LVNA 4OTDA 4CT2A 4DHFA 4ZY4A 4J7BA 5FLFA 2X8IA 1STCE 4PL3A 5CNNA 5HX6A 3GFEA 1JWHA 3LFEA 4ZLZA 4W4YA 2BZHB 3HP5A 4YURA 1PY5A 4CRSA 3D94A 2ZAZA 3OHTA 4EH8A 4DT8A 3KMWA 2ZFYA