3ZSIA

X-ray structure of p38alpha bound to vx-745
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
347
structure length
326
Chain Sequence
b'PTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLTRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOGEN-ACTIVATED PROTEIN KINASE 14
publication title X-ray structure of p38 alpha bound to TAK-715: comparison with three classic inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 106
structure length 326
sequence length 347
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2011-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3zsiA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3zsiA01
2X1NA 2W1EA 1GAGA 4ARKA 1W83A 3WF9A 3AC3A 4AG8A 3WOWA 3U6JA 4TW9A 2QNJA 5B2MA 1WBPA 3CJFA 3HMNA 2WD1A 2YDJA 3F7ZA 4L9IA 3R83A 3TZMA 3WIKA 3QTXA 4LGGA 4OTPA 4ANBA 2C5VA 2VN9A 1BYGA 1SNUA 1ZY4A 3IW7A 4G9CA 2VX1A 1OKYA 3OFMA 3LCTA 4DFYA 2WKMA 3L8XA 3WZJA 5HU9A 2IZRA 1RDQE 4IZAA 4A9YA 3E64A 3MB6A 3F5GA 5JFSA 4NJDA 3CEKA 4QP9A 2QG7A 2X2KA 4YC3A 2IZTA 2PVFA 4I1ZA 3KXXA 4GK4A 4IZ5A 4J97A 4OTWA 4O1PA 5BVEA 4DEIA 4AOTA 3HDNA 1Y6BA 3L8VA 5TT7A 3VBVA 3NAXA 4H3PA 4JBVA 1CTPE 3F2AA 5CLPA 4OTRA 3KXMA 5EHLA 4D0XA 3CQUA 5BX0A 4K8AA 3RJCA 1SVEA 4CFWA 1U54B 2J5EA 3IK3A 4JBPA 2WMBA 2OXXA 2AUHA 2W96B 3NYNA 2W7XA 3FUPA 4IFGA 3EH9A 5IZFA 3TIYA 4B0GA 2XJ1A 1Q61A 3GP0A 4FE2A 3FKOA 3NEWA 4ZS4A 2GDOA 1UU8A 2VTIA 5J9YA 3ELJA 4OTQA 4BICA 3MY0A 1SVGA 2ITNA 2A1AB 1KE8A 5FM3A 4EOQA 5CAUA 2ETRA 3DAJA 5GJFA 1W0XC 2WMUA 4JR7A 3MFRA 5AR8A 5C9CA 4OUCA 4M68A 1UNHA 3W55A 2C47A 4FSWA 2ZM3A 3RP9A 1Q97A 3Q04A 3WARA 2V55A 5KMMA 1YKRA 3PXQA 1YDRE 4GYIA 3RPVA 4JL9A 3KK8A 5GJGA 2VTTA 4FK3A 3FMHA 5FLFA 5LMBA 4GIIA 4HGTA 2PMOX 4JG6A 5I9YA 1ZMVA 4D5HA 3DPKA 4A9TA 4FSUA 1JBPE 4EK6A 4FEUA 2X9EA 1J91A 4U8ZA 5J1WA 5I9ZA 4QQTA 4GKIA 2HZ0A 4BDBA 3G9LX 1WFCA 3WILA 2JDOA 3NCGA 4FT3A 3R9DA 4PQNA 2ZV9A 4C59A 3R2BA 3MBLA 3QRUA 4ZTQA 4Q2AA 4BDDA 3FXWA 4EBVA 4ZJVA 3IW4A 5BVNA 3P4KA 4ALUA 4TYHB 4IAKA 4YZ9A 5H8BA 5CXHA 2X0GA 3AOXA 4FTTA 1J1BA 2JIVA 3UO6A 4E3CA 3FZRA 3G2FA 1OPLA 4R3PA 4A9RA 5E4HA 4XV2A 3ET7A 1O6YA 2VWXA 4S33A 4QMQA 5M4FA 2UW7A 2W99B 4OLIA 5DR9A 2C3LA 4DINA 3QRJA 4BCIA 4ZSEA 4JXFA 3AC5A 4F7JA 2Z02A 1XR1A 4IX5A 4AZTA 5CF4A 3ODZX 2GNJA 3LJ1A 1ZYCA 4UEUA 1ZYJA 4QNYA 2GHMA 4F09A 4UN0C 5BQ0A 3QZFA 4D9UA 5D7VA 3AMBA 3NW5A 2OZOA 4U9AA 4DEBA 1OZ1A 1Q24A 4IM3A 2W4OA 3IOKA 3ZO2A 1PHKA 5K9IA 1WMKA 4BI0A 4GL9A 3VIDA 4D2PA 5IUGA 3HMIA 3SG8A 5FUTA 3D83A 5IUIA 4NKAA 5L6PA 4FA2A 4O0WA 2R3KA 2BUJA 3GENA 2JKKA 3PY1A 4G3GA 5CEOA 5CF5A 2UVZA 3OUNB 5LVMA 4UMQA 3NRMA 4G34A 3MH3A 4IAFA 4G3EA 3A8XA 3QHWA 3NYVA 4XG7A 2CDZA 5CY3A 3Q3BA 5J7HA 3G9NA 3PSCA 4FT0A 4AXAA 5HLNA 2X39A 3FC1X 4QMZA 2IO6A 2X81A 3SOAA 4E4MA 1P4FA 3EFKA 3F9NA 4TYIA 2OJFE 3U9NA 2VO6A 2Y4IB 4MXZA 3DCVA 3OOMA 3UODA 2QOKA 4RJ7A 5TOZA 4W4XA 4YO4A 2JIUA 5CU6A 2QKRA 3W33A 3BWFA 4R78A 4O6LA 2XKEA 4BFMA 3MFSA 3LOKA 3JYAA 1H8FA 2XP2A 3O50A 4UWYA 5AUZA 2FB8A 4U80A 5EI8A 3UYSA 4YHJA 5IPJA 1XH4A 3R30A 5DT3A 3BHUA 2W9FB 3RPRA 3B2WA 5HVKA 4GEOA 3R1SA 4BWXA 4GUBA 3WE4A 3PUPA 3SXFA 1H0VA 5AUWA 4NWMA 4CYJA 5ICPA 3TV6A 4BYJA 2OI4X 3B2TA 3VBWA 2R3IA 4DEHA 3QKKA 3HNGA 2UZWE 2VTLA 2JDVA 5FP5A 3TTIA 5IQHA 4BGGA 3EQBA 4V01A 2C3KA 3PLAE 5LOHA 2NP8A 2Y7JA 2R9SA 1WZYA 1WAKA 4EOKA 1TKIA 3NIEA 5IQEA 1ZOEA 4GVAA 3M11A 3ZEPA 1GOLA 1OL6A 3HAMA 1FQ1B 1OUYA 4UALA 1XJDA 3CY3A 3LPBA 4Q9SA 1V1KA 2YDKA 5EW3A 4ASDA 4FOBA 4TNBA 4EOJA 3H3CA 3CP9A 3EOCA 3PPKA 1QPEA 4OAVB 2WHBA 2XS0A 4PNIA 4RJ3A 2CN8A 5EH0A 5HNGA 4B7TA 4AAAA 2IZUA 3UP7A 2WFYA 1H1RA 1DM2A 2UW4A 2YM5A 4ZZOA 4NUSA 1TVOA 2LAVA 3LFFA 2YISA 3BLRA 4KB8A 4TYJA 5AUYA 2XZSA 1CMKE 4XP3A 3VUKA 1JKTA 5FRIA 3ZBFA 3BE2A 1K3AA 4DEAA 4O0VA 3REPA 1XWSA 2NPQA 2QO9A 4KIKA 5TE0A 2UVXA 5J9LA 5EQEA 1H4LA 2WU6A 2ACXA 2ETMA 4IX3A 4AE9A 2GTNA 5DWRA 3PTGA 3A62A 4JT3A 3MB7A 3RMFA 3DQWA 3TJCA 3NW7A 1JSUA 1GY3A 3PXZA 4J8NA 5CAQA 5JKGA 4O7ZA 3GU6A 1YOJA 5AP6A 4CFNA 4FKPA 3OEFX 4UMUA 2QO7A 1OIRA 2IG7A 3ENHA 2PYWA 4RRVA 3D7ZA 3RHXA 3Q5IA 3GGFA 4RIXB 5AP4A 3DKCA 4FSZA 2CSNA 3DBDA 2HZNA 3G5DA 5JH6A 2XK9A 4KSQA 3U54A 5EM7A 3AG9A 4GKHA 1OECA 3GEQA 5D12A 4FKTA 5HQ0A 2X2LA 4C4JA 4F0IA 3BGQA 5DRDA 4CCUA 4D28A 4APCA 3D7TA 3AC8A 2YDIA 1HOWA 4HPUE 2XKDA 4L43A 4MCVA 2VUWA 3TV7A 3U4UA 4CT1A 5JGDA 5LXMA 3QYZA 3OCBA 4ZTSA 3VWAA 4JBOA 2CKOA 3MYGA 3FXZA 1EH4A 2VTRA 4JDJA 4HVSA 4H05A 3BHVA 3TL8A 2C1AA 1RE8A 3Q53A 4EK5A 5J95A 1KSWA 4AT3A 4HGEA 5ANJA 5IA5A 4FIFA 4GFMA 5AR2A 2PMNX 3EFJA 2RFNA 3IG7A 3AD4A 3AC1A 4F7SA 2PY3A 2GCDA 4QYGA 4F0GA 1ZZ2A 3GU4A 3NUAA 3BEAA 4ANOA 3H10A 3MH1A 5CT0A 3VW8A 4ITHA 5AR5A 3WE8A 4NU1A 4PPCA 2BDFA 3DBFA 4IACA 4PTCA 4N57A 3EQIA 4GYGA 3MDYA 1Z57A 4E1ZA 2VWIA 4ASXA 3QQHA 1CM8A 5CVGA 5HX6A 2XIZA 3ZSHA 2GPHA 5M53A 5L3AA 3TACA 3CQEA 4PPAA 2YCRA 4AW2A 3OD6X 4L8MA 4C34A 3R8MA 5FXSA 3QCSA 3ZFXA 1B6CB 3QFVA 5CAOA 1H1QA 4Z16A 1WVWA 2R3QA 5AP1A 5I9WA 3KGAA 4YTFA 3HDMA 1WBSA 1H25A 3P78A 3Q4ZA 2OF2A 1VYZA 4FTRA 4F9BA 5J7BA 5AUVA 4WD5A 3NDMA 2YIQA 3BYVA 3NIZA 4IVDA 3RM7A 4CD0A 3B8RA 4ZLYA 4GT4A 2OBJA 4G2FA 5EM6A 5HE1A 1YXUA 5CU2A 4JOAA 4FL2A 2WQMA 4J7BA 2EVAA 1A48A 1P4OA 2WU7A 2XJ0A 3EN5A 5DI1A 3V5JA 2PUNA 4GT3A 2E9UA 3TNWA 1WVYA 3FYKX 4EH5A 3FZOA 3UOHA 2A0CX 5F95A 2HW6A 4AZEA 4FKUA 2VRXA 3R6XA 4WG5A 4I93A 5J1VA 2V7OA 5CNNA 5EW9A 5C03A 1CDKA 3UJGA 3KB7A 5T6KA 4FTCA 4E6DA 4ANSA 4X3FB 2BRMA 1OI9A 2B55A 3HRBA 4XV3A 4BTMA 4DFUA 2JFLA 5CU4A 3PXRA 4A7CA 4QP4A 4PY1A 5KZ0A 3E7VA 5L2SA 4FNZA 3ALOA 2NO3A 4FTLA 3RNIA 2VTMA 4I6FA 3BLHA 3QXPA 2OIBA 4XS2A 4C3FA 3L8SA 3ZZWA 3MPAA 1JAMA 3DNDA 3HZTA 4P5ZA 4BDCA 5IEXA 1L3RE 3PVWA 2ITQA 4OBPA 4WSQA 5HCXA 4G6OA 4II5A 3DBCA 2A27A 2VO0A 3CGFA 4GIHA 4AT5A 3CQWA 4MVFA 5TO8A 3KN6A 3QTIA 4YTCA 4I6QA 4MD7E 4LL0A 5ETCA 5AV3A 4PMPA 1VR2A 2UZEA 5KBRA 5KHXA 4DEDA 3QXOA 2O0UA 1LPUA 4XP0A 4QRCA 4L44A 4LRMA 1E1XA 3D5XA 3AD6A 1A06A 2GSFA 3LCDA 3Q4UA 3F5UA 3FMNA 4IAAA 4NCTC 3ZRMA 2VTQA 2YIRA 2JEDA 3FYJX 4V05A 4CYIA 2PULA 4GCJA 1BI7A 4RPVA 5CVHA 4BIEA 4DH5A 3DJ5A 3D5WA 3MI9A 3I6WA 3DB8A 2RSVA 4DEGA 3BYSA 3DQXA 4QMOA 3RI1A 4C35A 4IVAA 4FG8A 1BMKA 2CCHA 4BDKA 3O7LB 5K4IA 4CRSA 4AT4A 2WMXA 2VNWA 2PVHA 3OP5A 3SRVA 2XKFA 4E7WA 3WF6A 4NKSA 4O7VA 2R3PA 4N6ZA 3BKBA 5CYIA 4RA4A 2P2HA 3EFLA 2VGPA 1ERKA 4FZAB 4M0YA 1R39A 4QP6A 2H96A 3U55A 3GUBA 2OJGA 3K3IA 2OGVA 3AXWA 4QMUA 2ONLC 1GZOA 4M7IA 2BMCA 4NEUA 2UW3A 2QOIA 3FWQA 2FSOX 4IWOA 4LL5A 4RIOA 5CASA 5CSXA 1IRKA 3PYYA 4PMMA 2BDWA 4LV5A 3UTOA 1OVEA 4DH8A 2W1HA 3QQUA 4B6LA 1UU7A 4KIPA 4OBQA 4ZTMA 4KWPA 3GCPA 1L8TA 3HMOA 1UNGA 4MD9E 2VNYA 5IQDA 5KMKA 1KE7A 3QQKA 4WBOA 4WSYA 4XNEA 2VWUA 3LM0A 3QA8A 4L42A 4XG4A 3WI6A 2B52A 3V8SA 2OKRA 3QX2A 1YXTA 4FL1A 1UU9A 3KU2A 2VAGA 2ZAZA 4ANMA 3EQFA 3DDQA 3LXKA 4JIAA 4MBJA 2WXVA 3HVCA 3EN9A 5JQ5A 2HXQA 4UMPA 2GS6A 4LV8A 4ACMA 3GOKA 2ZV8A 2C6DA 5BVKA 3IO7A 5KE0A 4BDFA 1Y91A 2REIA 4O81A 3I0QA 4WNPA 5EK7A 2J0JA 1XBCA 4B99A 1ZMUA 2UZUE 4BBFA 4I5CA 4BKJA 5AA9A 5BVDA 3N4VA 4DFZE 5HNBA 2Z7LA 3DXPA 4I20A 3FMLA 4DITA 4O1OA 2PZIA 2R2PA 4O86A 4E4LA 1T45A 3R2YA 1AGWA 3S3IA 4CLJA 1PJKA 3OXZA 4E6CA 4FKIA 4F65A 3AC2A 2PUIA 2RG6A 4ZTNA 5J5TA 4EC9A 4RJ4A 4NZWB 4RWLA 4GG5A 3FZSA 5CU0A 4FUXA 4XUFA 4CT2A 3PJ2A 4DLJA 3K5VA 3P0MA 4O7NA 3MVHA 4I4FA 1H1SA 3AMYA 1IA9A 4FKQA 4NTTA 3DLSA 2P3GX 4YSMA 3ZS5A 5M56A 2PPQA 2XNGA 1QL6A 3QLGA 4H3BA 1ZY5A 4FKSA 3S2PA 2ZM1A 4Y5QA 5LARA 3MWUA 5AJQA 5K0XA 3NVMB 2VX3A 1G5SA 4TWOA 3P23A 4D4YA 4Y85A 3E7OA 4ZSGA 4D2WA 4ACDA 4AZFA 4F99A 4RLKA 2XVDA 2ITTA 4IM0A 5BVWA 4C33A 4PDYA 2V22A 4AWIA 3ZZEA 3C4ZA 3AC4A 3DKFA 3FE3A 2FH9A 3C4WA 3HKOA 1H26A 3Q2JA 2QHMA 1GNGA 3Q4CA 4FNXA 5CT7A 3LXNA 5HLWA 2YM3A 4LMNA 3CJGA 2WTWA 4YHTA 3WF7A 5LMAA 3UG1A 1PMUA 4PMTA 3EN6A 3QWJA 4IWPA 3I1AA 2CJMA 4FK6A 1WBTA 4XCUA 3C0IA 4R1YA 4X7QA 3SKCA 4Z7HA 3UOJA 3D0EA 4HGLA 3TCPA 3PLSA 1K2PA 2HWPA 4WRGA 4DGLC 3NNVA 2OJ9A 2G15A 4X3FC 1H28A 4S31A 2ZYBA 2EB2A 2IJMA 2ZB0A 4BYIA 4HVIA 2X8DA 5C01A 2Z8CA 5FWKK 5I9XA 1Q5KA 5AR3A 4G31A 4N0SA 3R8ZA 5HG5A 2PSQA 4ITIA 3ATSA 1BX6A 4DF3A 4IAIA 5HHWA 5A4QA 3UNKA 4DTKA 1ZLTA 2R3OA 4FT5A 2BZHB 4FSTA 3LXPA 1YVJA 3G6HA 4ANLA 3QYWA 3T9TA 4NIFB 4DH1A 3E62A 5FXQA 3UMWA 3ZUUA 4O96A 4HW7A 4GFOA 2W4KA 4MQ1A 4R8QA 4MBIA 3ROCA 2X7FA 1OKZA 3DK6A 2HCKA 4LGDA 3F2NA 4PWNA 5EG3A 3SXRA 4F08A 4BWKA 2ZV7A 4F4PA 3ORZA 3EQRA 3KMMA 1OKVA 4HVHA 3HA6A 4L3JA 2ZDUA 3LLTA 5HIBA 1Q62A 3ZCLA 4MTAA 1BI8A 3DS6A 5C8NA 3TKIA 4ZZNA 3NR9A 2VTOA 3E63A 4KSPA 3SAYA 4YNOA 4ZK5A 3PIZA 4QQ5A 3RWQA 4I6BA 1PY5A 3C13A 4FTAA 3RALA 3ZMMA 4O82A 4QYYA 4QNAA 4U3ZA 4FV8A 4XOZA 3OXIA 1KV2A 2GNHA 3VS1A 3W32A 3BU6A 3KL8A 5IMEA 3U9CA 4APPA 4RG0A 1OL5A 4PNKA 4JDIA 2XRWA 4AGWA 5IEYA 3BV3A 3DV3A 4O0RA 4GH2A 4U3YA 4G6LA 4YC6A 3BI6A 4IX6A 5HTBA 4CNHA 3OXTA 4ZJJA 4DGMA 5HNIX 5M07A 4CRLA 4E6QA 3S00A 4FTJA 3DFAA 4L00A 5D10A 4D2TA 4RJ6A 2VTSA 2BZIB 4IC7A 2RGPA 2WQEA 4PP9A 4C57A 4FEWA 4LYNA 4AN2A 4L3PA 3NX8A 4E26A 2GHLA 4JAIA 4ZTRA 5I3RA 4NYEA 4WG4A 3GCQA 3RCDA 5AP5A 3VRZA 4EOLA 1H27A 3VAPA 3OEZA 4TY1A 4U41A 2FGIA 3I5ZA 3PVUA 3FL5A 3RZFA 3ENMA 2W5AA 3JY9A 3KCFA 2XKCA 2GS2A 2GU8A 2YERA 2HXLA 3OMVA 1Y6AA 4R6VA 4EOOA 3C4XA 4L46A 2UW6A 3DLZA 2YABA 2YZAA 4U79A 3W2PA 1TQMA 1SM2A 4ORKA 1VEBA 4C8BA 4FGRA 4RZVA 2W1CA 3DTWA 4JQ7A 4O7SA 4RVTA 2YZLA 1A9UA 3E8CA 4ACCA 2XYUA 4DFNA 4TWNA 3CTHA 3QF9A 4FICA 2C4GA 1UV5A 5AR7A 3I6UA 5L4QA 3ZUVA 2BHEA 3T3VA 1YRPA 2J2IB 3FLZA 3HV4A 3QUDA 1YHVA 4E5WA 2PE1A 5HE0A 3SC1A 2NNWB 4DCAA 2SRCA 3MIAA 4C62A 2R3LA 4FKLA 5D11A 4DC2A 3QCYA 5D9HA 2C1BA 3PVGA 4FTUA 4RIYA 2WMAA 3QQLA 5CEQA 3IW8A 3QC9A 2C68A 3PY3A 4UY9A 4B8MA 4J96A 4R77A 4F6WA 4TWCA 4MNEA 3HMMA 4EH9A 3ORMA 3OS3A 2WIHA 2UZNA 4FNYA 4RFZA 4DFLA 4RC3A 3OWKA 2QO2A 2QLQA 4X2GA 2WQNA 3VF9A 3KA0A 2VO7A 5CAPA 1V0OA 3FMKA 5FBOA 2C6TA 2PHKA 4PV0A 5JGBA 4BZOA 5IA1A 4FSNA 5GHVA 2XNEA 3UVRA 3ITZA 1PRYA 3R71A 2R3MA 1ATPE 1RW8A 2XNMA 2G9XA 4IVCA 4OTGA 2BVAA 4DT8A 2VWVA 4GK3A 4KNBA 4BBMA 2BDJA 3L9NA 4NSTA 4BCOA 4BDHA 1PMNA 4KAOA 4OTFA 4IDTA 3L9LA 4IW0A 3TIZA 3JR1A 1PMEA 5CF6A 2HY0A 5GZ9A 2XUUA 3EL8A 3OG7A 3VULA 4TTHB 2PUPA 2XIXA 2VTNA 4ZTHA 5J5SA 3SVVA 5EDRA 3DJ6A 3EB0A 4FL3A 4M13A 1O9UA 3R9RA 4OTIA 3ROYA 4DFXE 4QPAA 1NVSA 2WMTA 3MFUA 4ZOGA 5KX8A 4XV9A 2PVLA 3QRKA 4CTCA 5E8ZA 4HCVA 5FQDC 3P1AA 2OXDA 1UKIA 2X7GA 3HRFA 4QYHA 4HZRA 4UWBA 1G3NA 4RA5A 3MTLA 1DAWA 4Y46A 3PDTA 2FA2A 3GCSA 1T46A 2HIWA 3CLYA 3WZUA 3FV8A 4G5PA 4BIBA 3QAME 4I94A 1GIHA 4K18A 4AGUA 4DCEA 4EZ5A 1MRVA 3EYHA 3NAYA 1CSNA 2BHHA 2Q83A 2JITA 3VQHA 3C4FA 1GIJA 3R7YA 3TJDA 4C4FA 4USFA 4FTOA 3VUIA 3Q6WA 4ALVA 5CEIA 2C3IB 3F3UA 4FTNA 3RAHA 1MQBA 2CNVA 1V0PA 4AN3A 3PVBA 4EHZA 1Q3WA 2ITOA 2FSMX 3OZ6A 3W10A 3MIYA 3K54A 1E1VA 3GC7A 2PL0A 3R7EA 3EN4A 4U7ZA 5HORA 3ZC5A 3FQSA 2GS7A 5IU2A 2J90A 3DGKA 4D2VA 4DGNA 3P7AA 2Y9QA 4QYFA 2O2UA 2C0OA 3V5QA 2EXMA 3A4PA 2AYPA 3KF4A 3POZA 4K9YA 3QQFA 3RPSA 4BCFA 4BCKA 4O83A 4ZMFA 2ZDTA 1S9IA 4R7HA 5BMMA 2B4SB 4NL0A 3O71A 2P33A 3RBWA 4KRDA 3NS9A 2OO8X 3O17A 3LFEA 3CTJA 4EH7A 5IUHA 5AMNA 2J0KA 4HYUA 5DRBA 3SHEA 3VBXA 4CFXA 2C6KA 2WTCA 3FLNC 5JRQA 2C3JA 5HZNA 3BHHA 3QALE 2G1TA 4LG4A 3PPJA 4CZUA 3E5AA 3VO3A 3PRFA 3GQLA 3FI2A 3P79A 2EUFB 4ZAUA 4AGCA 4ZLZA 2WTIA 5K0KA 2VWWA 3V51A 5E8YA 3QTRA 3SXSA 4FKRA 5EKOA 2WTKB 4EOSA 4L53A 3OT3A 3VQUA 4YZDA 3EFWA 2PVKA 3T8OA 4EK4A 4IH8A 3A7GA 2QHNA 3R1QA 2YITA 3LFNA 1M14A 1XKKA 4ZZMA 1Q41A 5IEVA 4FV2A 3EIDA 2UW0A 3F3VA 2JC6A 2PZYA 4AX8A 5L6OA 3LHJA 2QVSE 2XNOA 4M8TA 3DKGA 2R3HA 3CXWA 1W98A 4H1JA 4C4IA 5JFWA 1J1CA 4F9AA 2GFSA 2YWPA 3CBLA 3OOGA 2JD5A 3WF8A 5EYDA 3ZYAA 2QKWB 4JJRA 5EYMA 4PL5A 4D1XA 1OMWA 4BY9E 3ZC6A 4TYEA 2HZIA 1W82A 4CG9A 4I5MA 4AN9A 2J51A 4UMTA 2H9VA 2R5TA 4UWCA 4JR3A 3LW0A 4I22A 4XG3A 5JZNA 4L6QA 4RZWA 5HD4A 1FOTA 3EHAA 1XH5A 3DOGA 5E1SA 5HTCA 3JS2A 4USDA 5EW8A 2YCSA 4F1OA 4IB3A 3NNUA 4O0SA 2B54A 4K1BA 4OTDA 4QP8A 3JXWA 5G1XA 3POOA 2E9VA 2PE0A 1Q8TA 1YXXA 4F0FA 3DFCB 3E92A 4X3JA 3U87A 3UOKA 3MY5A 4AOJA 3QRIA 4YPDA 4FI1A 2XNBA 4W4VA 3IQ7A 4IEBA 2I1MA 2VD5A 4G1WA 4U97A 1JPAA 1PXNA 4YLKA 5K5XA 4FF8A 3W8QA 3COKA 2BPMA 4TNDA 3BYUA 1BUHA 1FMOE 1OIQA 3RKBA 4M14A 2QU5A 1XH8A 1UWHA 1KUTA 5HX8A 3QQGA 2PK9A 2J6MA 3A7FA 2ZVAA 4QMMA 4XYFA 3IKAA 3Q60A 4E6AA 4E4NA 4OGRA 5KKRB 2JAMA 5AR4A 4KS8A 4RX8A 4BDEA 4C58A 3CIKA 4FIJA 2CKEA 3QKLA 4I3ZA 4ZJIA 3R9NA 3RHKA 3AT3A 4I21A 1VYWA 3HV6A 5KBQA 1UVRA 4IB1A 1M52A 4KRCA 3DA6A 2EU9A 3I81A 4QMVA 3UPZA 3SOCA 4EH8A 4ZLOA 3EQHA 3TUBA 4U44A 4TT7A 4EH2A 3ANQA 1H1WA 2Q0BA 1W84A 4O0UA 3K2LA 3UG2A 5B0XA 2PZ5A 4FR4A 2X7OA 1M7NA 3C0GA 3MA3A 3MVJA 1B38A 4KIKB 3W2SA 3C5IA 2YM8A 4I0TA 3TWJA 4YTHA 1PXOA 5TF9A 3I7CA 4MH7A 4CKIA 1ND4A 3ZLWA 5CEKA 5ETFA 3WYXA 2X9FA 3MH2A 3R0TA 1ZOHA 5LWNA 3I7BA 2W05A 5A54A 3C0HA 4IDVA 2YEXA 5HO7A 3NMUF 4O84A 5D7AA 3FQEA 2X4ZA 2WPAA 3ZLXA 4FKGA 4DH7A 4JAJA 4RVMA 4X2NA 3I5NA 2PVRA 3FZTA 3OWJA 3PWYA 3ORPA 4D4RA 3HP2A 3TUDA 3D7TB 4YBKA 1YI3A 3EWHA 3IS5A 2YM6A 2A19B 3DKOA 3VC4A 2UZVA 5DFPA 4YJOA 3UYTA 1DS5A 4YJRA 3FPQA 3PSBA 5I5ZA 4NCTA 4CXAA 3BCEA 5HKMA 3ZO3A 4ZSJA 3EQPA 3GC9A 3MFTA 5BUIA 3LCKA 4BCGA 4FZFB 4LUDA 4MXYA 5AADA 4C38A 3B8QA 4HYIA 4QTDA 4BI2A 4DT9A 3LM5A 3SGCA 3DZOA 4HVGA 4A4OA 3TZ8A 4WO5A 5HCYA 3VRYA 1XQZA 4BI1A 2PVYA 5DGZA 4D5KA 5M08A 4AS0A 4E93A 3ZLYA 3GC0A 4FEVA 3NYXA 2OK1A 5L2QA 3RGFA 3HEGA 2XBAA 5FG8A 5HG9A 5DPVA 4QMTA 3PIXA 3PFQA 5DVRA 4F1MA 5LMKC 5IKWA 3RNYA 5IQIA 5BVOA 4GRBA 1FMKA 3KCKA 3PZHA 3QLFA 3G6GA 1NA7A 3NZ0A 3RWPA 2F49A 4Y83A 2ONLA 3SW7A 1MRUA 2OJJA 2Q0NA 3PA3A 4RWIA 4O6EA 4EUTA 2EXCX 4JBQA 4YLLA 3WZEA 2BAJA 3COHA 3IPHA 3QQJA 4RWJA 4Y5HA 5EKNA 3KXNA 4ID7A 2WTKC 3O51A 2HELA 4FV5A 1UKHA 3ETAA 3IGGA 1ZMWA 4FTMA 4PTGA 2JDTA 5AAGA 4RIXA 3COIA 5IQFA 4QMPA 4ZP5A 3KC3A 1Y8GA 4F6UA 3WZKA 3R73A 2KTYA 1URWA 3BX5A 4MYGA 4LQMA 5ACBC 3UBDA 3FDNA 1J7LA 1KE5A 1OL7A 4CFFA 1RQQA 3MPTA 1PW2A 1FVRA 4CVAA 4ZY5A 2WTVA 4I0SA 4V0GA 3TNHA 2UVYA 1REJA 3LIJA 3FSFA 3BPRA 4FIEA 3LJ2A 4J52A 5HVYA 2I0YA 3EN7A 4DG0E 1PXPA 5HO6A 5M4IA 5IF1A 2XEZA 4HNIA 5GNKA 5M51A 5L8LA 2B1PA 2J0MB 2R64A 4JQEA 1GJOA 3RCJA 4JI9A 2QOQA 3D14A 4D9TA 3TNIA 4O0XA 2JIIA 1KE9A 4D58A 3PWDA 4PRJA 4BKZA 4ANQA 1XH6A 2X4FA 4JG8A 4FZ7A 4EORA 1YHSA 2E9OA 2YN8A 3FLQA 5DLSA 3VNTA 2WELA 4PL4A 3ZH8A 1R0PA 1J3HA 2Y4IC 2P55A 3R28A 2OWBA 4E20A 3Q96A 3R8LA 4EBWA 2W5BA 2EB3A 3SLSA 3FKLA 4FV6A 2CMWA 3TDVA 4R7BA 4P2KA 2QODA 5IA4A 4YJPA 3QCQA 3KF7A 4BCPA 5AAEA 4CQGA 3ZSIA 4N4SA 4EZ3A 2BRNA 2W1FA 1AD5A 3H9FA 3QUPA 1MRYA 4LGHA 1ZZLA 3ZO1A 2HYYA 4YNEA 3F5XA 4LI5A 4EZ7A 4JVGA 4G3FA 5E1EA 1ZYSA 1APME 4RJ5A 3IDBA 3TG1A 3ID6C 3FY2A 5F9EA 4EQCA 3BLQA 5H2UA 2IW8A 4XMOA 3VVHA 3M2WA 4NFMA 3MJ2A 3HUBA 1CKJA 3L1SA 4QMLA 1FBNA 2NRYA 2C6IA 3VUDA 4L45A 4MK0A 4G9RA 3HX4A 1JSTA 2OICA 4OW8A 5KMNA 3SRVB 2VO3A 5FDXA 4AFJA 2OU7A 3FPMA 4YHFA 5A4LA 3FY0A 4IWDA 2UZLA 3F61A 4OTHA 2HAKA 5E8UA 1OB3A 4C3RA 4X3FA 3R02A 3OT8A 4ITJA 4W4YA 1Q4LA 5KZIA 3QBNA 2HWOA 4HPTE 4J99A 3IGOA 2IW9A 5L2WA 3TUCA 1BL7A 4Z3VA 3UQCA 4ZY6A 1OUKA 3PPZA 4MXXA 1QPJA 4QMNA 4M69A 2YAKA 3FSKA 3L8PA 3LFDA 4M67A 2ITUA 4UMRA 4S32A 3VJOA 4FSRA 3EKKA 4Z55A 4U45A 4EH4A 4ERWA 2PVNA 2XM9A 5JGAA 3EZRA 3TV4A 2FYSA 2WEIA 4G17A 3PXFA 5C26A 5E8VA 3ZONA 5EHOA 2CLXA 2NRUA 2VWZA 5E7RA 1U4DA 1LEZA 2PZRA 3W2QA 4AZSA 4DBNA 1F3MC 4TRLA 1U59A 3RM6A 5B2LA 3V5WA 4PL3A 3CR0A 3EMGA 4I4EA 3OTVA 2J5FA 2QOCA 2Y8OA 3KULB 4RC4A 2I40A 4YP8A 1ZOGA 4MBLA 5LVLA 3OCGA 4PP7A 4QTBA 5BUJA 3I4BA 1SNXA 4YBJA 3GI3A 4EJNA 2QOBA 3MS9A 2CGXA 4RSSA 2PZPA 4X2JA 4A9SA 5EQPA 5ITAA 3U51A 2IWIA 3UC4A 2C6MA 4J95A 2R7IA 4CZTA 4ENYA 4H39A 1QCFA 3O8UA 3CPCA 4GK2A 5EFQA 2J50A 2XEYA 2JKMA 3LFBA 4BHNA 4DTBA 4WUAA 2OG8A 3E3BX 3R8VA 4EQUA 5IH4A 1LEWA 3PJ8A 3QZIA 3UVPA 4C7TA 3TM0A 4WIHA 4UXQA 3SQQA 2XK7A 3OW4A 4AA4A 4BVUA 3K5UA 4EQMA 1IAJA 1IASA 2XF0A 3MGYA 4YTIA 1QMZA 3I79A 2DQ7X 4CCBA 2GMXA 3HMPA 2WTDA 5HOAA 4YJSA 5DEWA 4L52A 2JKQA 4JDKA 5A46A 2VV9A 3KEXA 5CEMA 2VWBA 1RJBA 3FMJA 2X8IA 3VUMA 3QTWA 4D1SA 4UX9A 4DA5A 1H07A 4F70A 5CQWA 4V04A 3UE4A 2QLUA 2GNLA 4FSQA 4L7FA 2WB8A 2CPKE 3D5VA 2FVDA 4OT6A 5E92A 5C4KA 3EL7A 4IB0A 3BRBA 4WOVA 4FZDB 3G51A 5BMSA 3BYOA 2QOHA 4JRVA 4GU6A 5I9VA 4UBAA 2ITPA 3UDBA 2P0CA 3L9MA 1PYXA 1VJYA 4IZYA 3RK9A 3V04A 2VU3A 3TZ9A 3TXOA 2H8HA 4G3CA 4BCNA 3E87A 1YQJA 5DH3A 3WIGA 5ETIA 3A7JA 2E9PA 1I09A 2C5YA 5HIDA 4C37A 4RX5A 3CD8A 2OXYA 3NWWA 3QKMA 5HU3A 3GU8A 1ZYDA 1YW2A 3AGLA 5FTQA 3ZDIA 4X0MA 3R7OA 4AU8A 5IQBA 5HESA 1JLUE 5CTPA 1GIIA 3DDPA 4QP1A 4WNOA 1KOBA 2E2BA 2GNIA 4ONAA 4OAUC 3AGMA 2WMSA 4QMWA 5DE2A 4C4GA 2YJSA 3EQGA 4I92A 4S2ZA 2OIQA 5JMSA 1LR4A 2Y4PA 4CTBA 3LFCA 2A4LA 3OCSA 2JAVA 4O21A 5AAFA 2BFYA 4RJ8A 2JDSA 4C2WA 1R78A 4U40A 4QP3A 3W2CA 4C02A 3IECA 4FVPA 4MX9A 3JVSA 4R5SA 4WA9A 3QTUA 3Q9WA 1FPUA 2KULA 3TEIA 3WBLA 4ANNA 4YMJA 4BDAA 2RFEA 3QZHA 4AW1A 5TR6A 3VJNA 1HCLA 2J7TA 3NUXA 1IAHA 4EOPA 1YHWA 3BELA 3TT0A 3W18A 1GZKA 4X6RA 3I0OA 5CANA 4NM0A 4EKLA 3TKUA 5M57A 3S1HA 5D1JA 4J98A 4QYEA 5M55A 3TKHA 2DS1A 4IX4A 3DAEA 4TZRA 3FLSA 2VGOA 4IJ9A 2I0EA 3MVMA 5G6VA 4D55A 4I5PA 4K6ZA 3T9IA 1PMVA 4FIIA 1IA8A 3EKNA 3LFAA 4RFMA 4GMYA 1O6LA 3GBZA 2O5KA 3OY1A 4XBRA 5E8WA 1QPCA 5DT0A 1OIUA 3BBTB 5AUUA 4I41A 3DJ7A 4LFIA 4F9CA 3LE6A 2UW5A 3NUSA 3GT8A 4P4CA 1ZWSA 3UO4A 3BYMA 3ORLA 2Z7RA 4DFBA 1VZOA 5M06A 3RAWA 4KKHA 4CEGA 5AV0A 2O8YA 2ZJWA 2QOLA 4IB5A 2EWAA 2QC6A 4DG3E 3LMHA 1NVRA 3G33A 3OF0A 1REKA 4TKSA 4P5QA 5H8GA 4G16A 1GZNA 2YHVA 4Z9LA 3LLAA 3H30A 4RFYA 1PKDA 5CSHA 4CFMA 5CWZA 2JKOA 3KK9A 2H34A 4G6NA 4MNFA 4GS6A 3GC8A 5H8EA 3U6IA 3ERKA 3F6XA 4HYHA 2B9JA 5L2IA 3WF5A 3V5LA 2JBOA 2OH4A 4NIFA 4Q5HA 4UZHA 3FEGA 3UNZA 3F5PA 2YCQA 5E91A 4EC8A 4DBXA 4BZNA 2W1ZA 3V5PA 3ZHPC 2Z7SA 5CENA 1JWHA 5JSMA 3U4WA 3DK3A 4MXOA 1R3CA 3CSVA 3MSSA 2XA4A 2W5HA 4R3CA 4XBUA 4W9WA 4BBEA 4FVRA 3ATTA 4BF2A 2WNTA 5KMLA 2B9FA 2V62A 4IMYA 4QOXA 3IONA 4QO9A 5EQYA 4E8AA 3FI8A 2WTJA 5LWMA 1H1PA 5ACKA 2GQGA 3OWPA 4BDIA 3V3VA 3RPOA 3UP2A 2G01A 3LAUA 4DEEA 5HO8A 3SX9A 4RX7A 4U42A 4RWKA 5L6WL 3UNJA 2R3GA 2WAJA 4YJVA 4TN6A 4S34A 5EDPA 3TZ7A 3JPVA 4AOIA 2HW7A 3NLBA 4RIYB 3RK7A 4BTKA 1YWNA 2XM8A 1G8SA 2OFUA 4FV4A 3O8TA 2UW8A 4XRJA 3R9OA 4K2RA 4MNEB 3A8WA 3QGYA 5DT4A 2IPXA 3VS0A 2EXEA 4FNWA 4EH6A 2GQSA 5EYKA 2O3PA 3F69A 3V6RA 5M4UA 3UQFA 4EYMA 2B53A 2BZJA 2YM4A 1H24A 2J0IA 5GIOE 2W0JA 3P08A 2J0LA 1YI6A 2HY81 1P14A 5DA3A 2R3FA 4M12A 4XOYA 3WZDA 4YZBA 1W7HA 3PA5A 5AM6A 4GUEA 1PXJA 2I6LA 1JOWB 1AQ1A 3QTQA 1YXVA 4FKWA 4QTCA 3ZXZA 3QZGA 4WNKA 4GSBA 4ZIMA 3II5A 4QQCA 4WRSA 5I3OA 4RBLA 3GFEA 2G2IA 3BU3A 3FLWA 4EK3A 4RIWA 3PG1A 2FO0A 4L7SA 3BBWA 4HZSA 5BYZA 4XG8A 4BL1A 2C5NA 3N51A 2YWVA 1ZRZA 3F82A 3HRCA 2UV2A 3CE3A 3ODYX 5AP3A 3LFQA 5IDNA 1WBNA 4EHVA 1IG1A 3DAKA 3G0FA 1LUFA 3CGOA 4D4VA 4LMUA 3CTQA 4I23A 4BIDA 1JVPP 4KKGA 1Q3DA 3BIZA 3QGWA 4NTSA 2OZAA 4IHPA 4FKOA 3HP5A 4YGAA 1M17A 4UB7A 4YJNA 3GU7A 5DMZA 3D15A 4YUQA 4I0RA 4C2VA 1MQ4A 5FEQA 3C7QA 1WBWA 5ANEA 2ITWA 2JDRA 3OBJA 3MTFA 5FBNC 5KO1A 3UVQA 3HV7A 4ALWA 5K4JA 5JK3A 3BHYA 5TKDA 4R7IA 1URCA 3RPYA 4M66A 4L67A 4M97A 5AFVA 3ULIA 5HBJA 5HBEA 4A07A 3OCTA 4J71A 3UGCA 3LCOA 1CKIA 3FKNA 5DYJA 2WMVA 3EJ1A 1E9HA 3OUKA 3QX4A 3A4OX 2FSLX 2C6LA 1DI8A 4C61A 3QD2B 3RTPA 4WG3A 4XHKB 2BFXA 2C30A 2CHLA 2F7ZE 1Q8ZA 4BCQA 2AC5A 3GVUA 5F1ZA 3FHRA 4MF1A 4KIOA 3VUGA 3ORTA 4ZXTA 4GV1A 2BAKA 5CSVA 4AW5A 1TQPA 2BCJA 3O8PA 4DHFA 1JNKA 5I9UA 5AX9A 1FGIA 4CKRA 5A9UA 1S9JA 2F4JA 2R3RA 3AT2A 5CVFA 4O7TA 4BCJA 4ZSAA 3W2OA 2P4IA 5J79A 4K33A 4XG9A 1XO2B 3EQDA 4CSVA 3M42A 4LOOA 4DG2E 4GFGA 5IQGA 3DZQA 2GHGA 4FVQA 4DAWA 2Z7QA 1U54A 4I5HA 5HLPA 4IXPA 3A7HA 5CQUA 2WO6A 3BQRA 3VUTA 3ZM4A 1MUOA 2F2UA 3H0ZA 1SVHA 4R3RA 2XK6A 4JQ8A 3RINA 3OWLA 4GJ2A 3D2KA 4AA5A 2XK4A 4B4LA 5FEEA 1FGKA 4QT1A 5E8XA 4ERKA 5A4TA 3QC4A 5LCKA 5K5NA 2OH0E 3QA0A 1YOLA 2ZV2A 3NUYA 2RG5A 4EEVA 2ZOQA 4CMTA 2G2FA 4XLVA 2GTMA 1XH7A 2RIOA 4W8EA 5T3QA 4D2RA 3MJ1A 4O7WA 1OBGA 2BRGA 2ITYA 5DBXA 2BR1A 2VX0A 4FTIA 3FL4A 3DK7A 3F3ZA 5CSWA 4CLIA 5AX3A 5A6OA 5FXRA 3Q2MA 2RKUA 3VS6A 2A2AA 2ERZE 2XNPA 3UQGA 4PTEA 3FLYA 4UV0A 3UIMA 3IW5A 3MV5A 4AUAA 2UW9A 5IG1A 1OM1A 4BCMA 2F2CB 2PMIA 5HIEA 3VN9A 3KKVA 3ULZA 4FSYA 2BILB 4RMZA 1Q8WA 2C6EA 5BYLA 4FG7A 4X2FA 3R04A 4A4LA 2B9IA 3KFAA 4RGJA 3MY1A 4H36A 2Z60A 3VHEA 3UOLA 5JQ8A 2PU8A 1SYKA 3UMXA 3FAAA 5AV1A 5EM5A 5HCZA 3NCZA 4RQKA 4ZEGA 4BR3A 3Q9YA 3FHIA 4M84A 4NM5A 3ANRA 1KE6A 5LMKA 2XJ2A 3U8WA 3QWKA 3LQ3A 4ACHA 3QTSA 5AP2A 4FYOA 4P7EA 5DEYA 4IJPA 2IVSA 1MP8A 2PWLA 4FIGA 4TYHA 5DR2A 4L01A 4C3PA 4O7LA 2XH5A 3HV5A 4JX7A 5F4NA 2YLEA 4A9UA 3S0OA 5GIPE 3ZDUA 1JSVA 5IH5A 1Y8YA 3BU5A 1OL1A 4XRLA 2BALA 5KNJA 2YLFA 2WOTA 4ZSLA 5ANDA 3OW3A 4KBAA 3C1XA 5T68A 5ANOA 4I6HA 5IH6A 2IVUA 4KS7A 4EONA 5EI6A 4DE4A 1XBAA 3D5UA 2BKZA 3R1YA 3VF8A 3R9HA 2X6EA 1WVXA 4PDOA 2R4BA 2GNGA 2PTKA 2HENA 3ORKA 3PE2A 4FV1A 5JN2A 4EUUA 4NW6A 3PRIA 2WZJA 1YDSE 4WNMA 4BC6A 4FSMA 4QMSA 3BV2A 2PUUA 4O0TA 3UIUA 4MEDA 5FTOA 4C36A 3PZEA 4FEXA 3TN8A 3MVLA 4RVKA 4C4HA 2UUEA 2VZ6A 3KN5A 2ITVA 2YFXA 3RAKA 4FX3A 3TNQB 2ITXA 2XBJA 1DAYA 4BCHA 4XH6A 1OPJA 2WQBA 1CKPA 5HE3A 4FBXA 1NVQA 3D9VA 1WBOA 2OFVA 4HNFA 2OJIA 4LM5A 4N70A 3RZBA 4EHGA 4N6YA 4YJTA 1XH9A 4FOCA 5HVJA 1QPDA 3BE9A 3L9PA 2VWYA 4XLIA 3AT4A 4A4XA 1G8AA 1YXSA 4CG8A 3QHRA 1J7UA 5CI6A 4ACGA 3ZXTA 5LCJA 1M2PA 5HEZA 4U0IA 4DTAA 3V5TA 2YM7A 4QMXA 2F57A 3DNEA 3IDCA 2CGWA 2G2HA 3NYOA 5EYCA 4D0WA 2OLCA 3O0GA 3VS7A 1B39A 4GG7A 3OROA 5IDPA 5AIRA 3ZFYA 3C50A 4UZDA 2JBPA 3P5KA 3IDPA 4GT5A 4QPSA 4J53A 3OHTA 1U46A 2B0QA 4F9YA 2VTJA 3EYGA 2W1DA 5LVOA 2PVJA 3CC6A 4QTAA 5EI2A 4JX3A 4MKCA 2WMRA 3DB6A 2O63A 2UZDA 2WMWA 1J7IA 5E90A 3A2CA 3F2RA 3IW6A 1JQHA 5M44A 1DI9A 4LUEA 4F64A 3GXLA 1OKWA 4HJOA 5FD2A 4Q9ZA 3V8TA 5C8MA 5EOLA 4DN5A 3GFWA 1Q99A 5EM8A 2QU6A 1PXLA 3FBVA 3BEGA 3G90X 3NNXA 3Q9XA 2JFMA 1R1WA 4NM3A 1H08A 4IQ6A 3QRTA 5BYYA 4IBMA 4MWIA 1ZXEA 4PF4A 4X21A 2YACA 1YI4A 4OR5A 2QCSA 4M15A 3VS2A 3CY2A 2LGCA 3R1NA 2FUMA 3W16A 3P7BA 4BZDA 4J8MA 5AUTA 3VW6A 5CALA 5IQCA 3KRJA 3R7UA 3NGAA 4FV0A 2VTAA 5LJJA 1WCCA 3FI4A 2XIKA 3LMGA 2XRUA 3C4EA 2O64A 3CS9A 4JG7A 3UIXA 4CFVA 5DNRA 3GQIA 4IADA 4JNWA 5HICA 2UZTA 4XP2A 4EHEA 5C27A 4UYAA 3QTZA 4IE9A 5EOBA 4F7LA 2C0TA 1UA2A 2H6DA 4O38A 4RC2A 4M0ZA 4EYJA 3LMIA 3PXYA 2IZSA 5DIAA 2R0IA 4YPSA 2VTPA 5IISA 4UYNA 4KIQA 3Q4TA 3FXXA 2X6DA 3T3UA 3FMMA 3UPXA 2X8EA 4PDSA 3PA4A 4AACA 4V0GB 4NFNA 2YIWA 5FDPA 4AFEA 4U43A 5ANKA 5LVNA 3C5UA 1FVTA 4NW5A 2W1IA 3O96A 3FMEA 2WIPA 1ZAOA 4O22A 3VHKA 1FVVA 4BTFA 4Y73A 3KQ7A 3RK5A 5BNJA 3PXKA 4KUJA 3WYYA 3E88A 1JKLA 3N4TA 4D1ZA 5A14A 3KXZA 5HD7A 4AF3A 2WMQA 3DXNA 4FV7A 1BKXA 4TYGA 5CS6A 5AWMA 5F20A 2I7QA 4HCTA 2C6OA 2J4ZA 4YZMA 3DXQA 3BGPA 4CQEA 3ZSGA 3HECA 2BIYA 3PY0A 2F7XE 1LP4A 5FP6A 4F7NA 5GINE 5A6NA 3COMA 2DWBA 2PE2A 3ORNA 3UO5A 4MWHA 3MPMA 5L8JA 5GJDA 3G0EA 3GB2A 3O2MA 4FIHA 5EHYA 3UZTA 3KREA 4JRNA 4G3DA 4WUNA 2UZOA 5CZIA 4WHZA 2YIXA 5AP0A 4PMSA 5LQFA 1UNLA 2HZ4A 2Y6MA 4BRXA 4IWQA 1R0EA 3GCUA 3O23A 2CKQA 5AM7A 2CKPA 4YR8A 2PVMA 2W1GA 4GJ3A 4QQJA 2IVTA 3KVXA 3OY3A 1X8BA 2BRHA 3QU0A 4BN1A 2FSTX 5HG7A 4XX9A 1Q8YA 2ZM4A 1UWJA 4YC8A 4CV9A 4DGOA 2WGJA 2QR8A 4ENXA 4CFUA 4IM2A 3CCNA 5J9ZA 2C5XA 5E9EA 5HTIA 3ZLSA 4DLIA 2BTSA 4HVDA 3OVVA 1Z5MA 2RL5A 3OBGA 2W9ZB 2P2IA 4KA3A 2RF9A 3PJ1A 2ZB1A 5A4CA 2O65A 5KKRC 5L8KA 4FTQA 4AP7A 1KOAA 2CGVA 5AUXA 3UIBA 2RFSA 4E4XA 3QD3A 3R7GA 1H01A 2F9GA 4X2KA 4W4WA 4M69B 4KABA 3HAVA 4BHZA 4ZTLA 3QL8A 3DY7A 4BDJA 3R21A 2V0DA 3GU5A 1PXKA 3UC3A 4FKVA 3DTCA 4FUYA 2CLQA 2BIKB 4LOQA 1NXKA 3KMUA 4CMUA 4E73A 1U5QA 1XBBA 3P9JA 5KMOA 4Y95A 4BKYA 3R7IA 1M7QA 4UXLA 3MESA 3DBQA 3HLLA 5DOSA 3SV0A 5M09A 3O7LD 4FTKA 4FZ6A 1K9AA 3E93A 3NUPA 4LRKA 3F66A 3LVPA 4WBBB 5F94A 3W2RA 3HGKA 4RVLA 5CU3A 2XNNA 3IOPA 5JRSA 1BL6A 3FZ1A 3Q32A 5BPYA 3R8UA 4FT7A 1IEPA 4GW8A 3UZRA 2R3JA 2DUVA 1STCE 3P7CA 4YLJA 2AC3A 4YO6A 4EK8A 3OTUA 4U81A 3NNWA 2OF4A 3ACKA 3A99A 4CMOA 4EOMA 3FI3A 5BVFA 2XK3A 3ZBXA 5AIKA 3TNPC 4NM7A 4O2ZA 5AA8A 3C51A 3I60A 4E5AX 4F6SA 4YJUA 3R7VA 1JKKA 4WT6A 2GQRA 4Q5EA 3FC2A 4O7RA 2C0IA 2XCKA 1UU3A 3CKXA 4XV1A 3VS4A 4GU9A 4HGSA 3G15A 3KXHA 5J8IA 4CV8A 2IVVA 1YDTE 4PUZA 3N9XA 3C4CA 4FG9A 4R1VA 3HYHA 3NVKI 2BAQA 5KMIA 4D2SA 2WEVA 3R22A 3MH0A 1PXMA 4AQCA 2JGZA 3MN3A 4IANA 2BZKB 5H3QA 3THBA 3PSDA 2YCFA 3H9RA 5CZHA 5CEPA 4K0YA 1XHAA 1GZ8A 3ZU7A 2QOOA 5HE2A 4NH1A 5LVPA 3D2IA 1V0BA 1KWPA 3ZFMA 3DT1A 4EWQA 1YWRA 5IQAA 2YAAA 4P90A 4MHAA 3SD0A 4YURA 2W17A 3PG3A 3R8PA 3S95A 4A06A 4DH3A 3KRRA 2CNUA 3VBYA 1SZMA 3F7WA 3ZRLA 2XYNA 3EZVA 3PJ3A 3GCVA 2OW3A 4AZVA 5IA0A 3CKWA 4ZMEA 3H0YA 3PP0A 3VUHA 3ALNA 4AGDA 3NPCA 3D4QA 5D41A 4O7YA 4U5JA 4Y72A 5AV4A 3GNIB 4HCUA 3KULA 3AD5A 4X6QC 5JFVA 2IN6A 4MAOA 3H9OA 4YSJA 3P86A 4PPBA 3A60A 2QONA 2YA9A 4JS8A 3KVWA 4FT9A 5FGKA 1Z9XA 4YZCA 4F63A 3SW4A 3PP1A 2HK5A 2Z2WA 4RQVA 2I0VA 3ZO4A 3CD3A 3K3JA 1Y57A 1YOMA 2XK8A 4MXCA 3E3PA 1HCKA 4DYMA 4KKEA 3KXGA 5HI2A 4IAZA 1H0WA 3ZEWA 5HBHA 3ZRKA 4EOIA 2WQOA 3NSZA 5DR6A 1NW1A 4XG2A 2Y6OA 4BWPA 4KINA 2VTHA 3SA0A 3A7IA 5ANGA 3Q52A 4FGBA 3NUUA 5CAVA 3F3WA 5A4EA 3HA8A 2XCHA 1ZARA 4FYNA 4K11A 2GNFA 2RFDA 3VS3A 3N4UA 4O0YA 2W06A 2Y0AA 4U6RA 4AA0A 1OPKA 4S30A 3R63A 2XIRA 4H58A 3JVRA 1PF8A 4LRJA 2XB7A 4QD6A 5KHWA 4EI4A 3U6HA 4TPTA 1WBVA 1KV1A 5IMXA 4USEA 2ERKA 4R5YA 2CCIA 5C1QB 3QD4A 4BGQA 4CZYB 4CKJA 4C4EA 2GFCA 3S4QA 3HUCA 3AMAA 5B2KA 1PXIA 5AV2A 5B7VA 4NK9A 3SDJA 3BWJA 4AZWA 4F9WA 2WOUA 2ZMDA 3BZ3A 2OSCA 5HGIA 1PYEA 2ETKA 4EL9A 4LOPA 3GOPA 5JEBA 4B9DA 2PMLX 3LQ5A 5CF8A 3LFSA 4FC0A 1I44A 4FEQA 4HOKA 4BTJA 1BLXA 5E8SA 1M2RA 4H1MA 3KRXA 4E5BA 4ASEA 2BROA 1IR3A 1TQIA 2BTRA 2C5OA 3AQVA 3PJCA 4I24A 4Y8DA 5DG5A 5K3YA 4OT5A 4B8LA 4BGHA 4CGAA 5C4LA 2CGUA 4RX9A 5J87A 3F3TA 3MA6A 3ZUTA 4NT4A 4FODA 1JKSA 2IW6A 4L68A 1FINA 5EDQA 3QUEA 4JLCA 4BDGA 4QPMA 3R01A 4GVJA 1P2AA 4H3QA 2XIYA 4O91A 4AE6A 3A61A 1PKGA 3JUHA 4PDPA 2BRBA 5ANIA 5HG8A 1M2QA 4IZ7A 3W8LA 3ZM9A 2QR7A 4JIKA 4PX6A 5JZJA 2YJRA 3E8EA 4C0TA 4O2PA 5KMJA 3E8DA 3KY2A 3KRLA 2F7EE 4MQ2A 4YZNA 2OIDA 5C8KA 2R0UA 3TTJA 3C9WA 5DHJA 3QD0A 4YU2A 2B9HA 2C69A 4QP2A 5CX9A 3RVGA 4OBOA 3UZPA 4EH3A 4QTEA 4ASZA 5FEDA 3LQ8A 3VS5A 4IFCA 4TXCA 4DGGA 1W8CA 4W9XA 4EKKA 2JLDA 3FZPA 4FKJA 3W1FA 4TL0A 5CSPA 4D4SA 2QOFA 3NUNA 5H9BA 5JT2A 2X2MA 3HV3A 4MF0A 3TI1A 2QURA 5CNOA 5M4CA 1YWVA 1NT2A 3ACJA 4KBKA 3EQCA 3FQHA 3JY0A 4ZY4A 4HYSA 2UZBA 2BKKA 1OL2A 4ZS0A 3V01A 3BHTA 4MXAA 5GZAA 5I0BA 1F5QA 3BGZA 4EJ7A 4QMYA 2YIYA 4XG6A 3KRWA 1H00A 3ORXA 2E9NA 1Q8UA 3LZBA 4FV3A 4NJ3A 4WKQA 1SMHA 3MW1A 1NY3A 4MD8E 5AEPA 2QQ7A 2J9MA 2DYLA 3LCSA 3FJQE 2R3NA 3QCXA 3DU8A 4K77A 4YJQA 3R00A 3PE1A 5KUPA 4AW0A 5IA2A 5E8TA 5JFXA 5GZ8A 2B7AA 4O27B 3HL7A 3V8WA 4G5JA 5CXZA 4XEYA 4IAYA 4KBCA 2V7AA 5BUEA 3OC1A 4XJ0A 3PIYA 4F1TA 2QI8A 5AP7A 4FMQA 2V5QA 4KD1A 1O6KA 4IC8A 1U5RA 3LKMA 3VBTA 3F88A 5CI7A 2ITZA 3Q6UA 5FM2A 4RIWB 3RAIA 2QD9A 3ZTXA 2CN5A 4RLLA 4TWPA 3ZOSA 3TDWA 5ETAA 2ZMCA 2QG5A 3H4JA 1OBDA 1ZYLA 3D94A 3FMDA 4JDHA 4QP7A 2CNQA 3V6SA 3SG9A 4IVBA 5DN3A 5KCVA 5FTGA 1OIYA 3E8NA 3NW6A 3CPBA 2W4JA 4L3LA 2XMYA 3M1SA 4J1RA 2OZAB 4Z7GA 4IIRA 3ORIA 2I0HA 5IA3A 3LXLA 5I4NA 4EWHA 5L2TA 4RT7A 3KMWA 3BQCA 4M3QA 1F0QA 4W8DA 1OITA 1P5EA 2R7BA 3Q5ZA 1OGUA 3VBQA 3LJ0A 4FV9A 5A3XA 2HOGA 2ESMA 3DBEA 4BB4A 3Q9ZA
chains in the Genus database with same CATH superfamily
2X1NA 2W1EA 1GAGA 4ARKA 1W83A 3WF9A 3AC3A 4AG8A 3WOWA 3U6JA 4TW9A 2QNJA 5B2MA 1WBPA 3CJFA 3HMNA 2WD1A 2YDJA 3F7ZA 4L9IA 3R83A 3TZMA 3WIKA 3QTXA 4LGGA 4OTPA 4ANBA 2C5VA 2VN9A 1BYGA 1SNUA 1ZY4A 3IW7A 4G9CA 2VX1A 1OKYA 3OFMA 3LCTA 4DFYA 2WKMA 3L8XA 3WZJA 5HU9A 2IZRA 1RDQE 4IZAA 4A9YA 3E64A 3MB6A 3F5GA 5JFSA 4NJDA 3CEKA 4QP9A 2QG7A 2X2KA 4YC3A 2IZTA 2PVFA 4I1ZA 3KXXA 4GK4A 4IZ5A 4J97A 4OTWA 4O1PA 5BVEA 4DEIA 4AOTA 3HDNA 1Y6BA 3L8VA 5TT7A 3VBVA 3NAXA 4H3PA 4JBVA 1CTPE 3F2AA 5CLPA 4OTRA 3KXMA 5EHLA 4D0XA 3CQUA 5BX0A 4K8AA 3RJCA 1SVEA 4CFWA 1U54B 2J5EA 3IK3A 4JBPA 2WMBA 2OXXA 2AUHA 2W96B 3NYNA 2W7XA 3FUPA 4IFGA 3EH9A 5IZFA 3TIYA 4B0GA 2XJ1A 1Q61A 2XARA 3GP0A 4FE2A 3FKOA 3NEWA 4ZS4A 2GDOA 1UU8A 2VTIA 5J9YA 3ELJA 4OTQA 4BICA 3MY0A 2XANA 1SVGA 2ITNA 2A1AB 1KE8A 5FM3A 4EOQA 5CAUA 2ETRA 3DAJA 5GJFA 1W0XC 2WMUA 4DHIB 4JR7A 4F78A 3MFRA 5AR8A 5C9CA 4OUCA 4M68A 1UNHA 3W55A 2C47A 4FSWA 2ZM3A 3RP9A 1Q97A 2IEWA 3Q04A 3WARA 2V55A 5KMMA 1YKRA 3PXQA 1YDRE 4GYIA 3RPVA 4JL9A 3KK8A 5GJGA 2VTTA 4FK3A 3FMHA 5FLFA 5LMBA 4GIIA 4HGTA 2PMOX 4JG6A 5I9YA 1ZMVA 4D5HA 3DPKA 4A9TA 4FSUA 1JBPE 4EK6A 4FEUA 2AEGA 2X9EA 1J91A 4U8ZA 5J1WA 5I9ZA 4QQTA 4GKIA 2HZ0A 4BDBA 3G9LX 4O4DA 1WFCA 3WILA 2JDOA 3NCGA 4FT3A 3R9DA 4PQNA 2ZV9A 4C59A 3R2BA 3MBLA 3QRUA 4ZTQA 4Q2AA 4BDDA 3FXWA 4EBVA 4ZJVA 3IW4A 5BVNA 3P4KA 4ALUA 4TYHB 4IAKA 4YZ9A 5H8BA 5CXHA 2X0GA 3AOXA 4FTTA 1J1BA 2JIVA 3UO6A 4E3CA 3FZRA 3G2FA 1OPLA 4R3PA 4A9RA 5E4HA 4XV2A 3ET7A 1O6YA 2VWXA 4S33A 4QMQA 5M4FA 2UW7A 2W99B 1OGYA 4OLIA 5DR9A 2C3LA 4DINA 3QRJA 4BCIA 4ZSEA 4JXFA 3AC5A 4F7JA 2Z02A 1XR1A 4IX5A 4AZTA 5CF4A 3ODZX 2GNJA 3LJ1A 1ZYCA 4UEUA 1ZYJA 4QNYA 2GHMA 4F09A 4UN0C 5BQ0A 3QZFA 4D9UA 5D7VA 3AMBA 3NW5A 2OZOA 4U9AA 4DEBA 1OZ1A 1Q24A 4IM3A 2W4OA 3IOKA 3ZO2A 4QEBA 1PHKA 5K9IA 1WMKA 4BI0A 4GL9A 3VIDA 4D2PA 5IUGA 3HMIA 3SG8A 5FUTA 3D83A 5IUIA 4NKAA 5L6PA 4FA2A 4O0WA 2R3KA 2BUJA 3GENA 2JKKA 3PY1A 4G3GA 5CEOA 5CF5A 2UVZA 3OUNB 5LVMA 4UMQA 3NRMA 4G34A 3MH3A 4IAFA 4G3EA 3A8XA 3QHWA 3NYVA 4XG7A 2CDZA 5CY3A 3Q3BA 5J7HA 3TMOA 3G9NA 3PSCA 4FT0A 3W0QA 4AXAA 5HLNA 2X39A 3FC1X 4QMZA 2IO6A 2X81A 3SOAA 4E4MA 1P4FA 3EFKA 3F9NA 4TYIA 2OJFE 3U9NA 2VO6A 2Y4IB 4MXZA 3DCVA 3OOMA 3O5AA 3UODA 2QOKA 4RJ7A 5TOZA 4W4XA 4YO4A 2JIUA 5CU6A 2QKRA 3W33A 3BWFA 4R78A 4O6LA 2XKEA 4BFMA 3MFSA 3LOKA 3JYAA 1H8FA 2XP2A 3O50A 4UWYA 5AUZA 2FB8A 4U80A 5EI8A 3UYSA 4YHJA 5IPJA 1XH4A 3R30A 5DT3A 3BHUA 2W9FB 3RPRA 3B2WA 5HVKA 4GEOA 3R1SA 4BWXA 4GUBA 3WE4A 3PUPA 3SXFA 1H0VA 5AUWA 4NWMA 4CYJA 5ICPA 3TV6A 4BYJA 2OI4X 1TFFA 3B2TA 3VBWA 2R3IA 4DEHA 3QKKA 3HNGA 2UZWE 2VTLA 2JDVA 5FP5A 3TTIA 5IQHA 4BGGA 3EQBA 4V01A 2C3KA 3PLAE 5LOHA 2NP8A 2Y7JA 2R9SA 1WZYA 1WAKA 4EOKA 1TKIA 3NIEA 5IQEA 1ZOEA 4GVAA 3M11A 3ZEPA 1GOLA 1OL6A 3HAMA 1FQ1B 1OUYA 4UALA 1XJDA 3CY3A 3LPBA 4Q9SA 1V1KA 2YDKA 2X0OA 5EW3A 4ASDA 4FOBA 4TNBA 4EOJA 3H3CA 3CP9A 3EOCA 3PPKA 1QPEA 4OAVB 2WHBA 2XS0A 4PNIA 4RJ3A 2CN8A 5EH0A 5HNGA 4B7TA 4AAAA 2IZUA 3UP7A 2WFYA 1H1RA 1DM2A 2UW4A 2YM5A 4ZZOA 4NUSA 1TVOA 2LAVA 3LFFA 2YISA 3BLRA 4KB8A 4TYJA 5AUYA 2XZSA 1CMKE 4XP3A 3VUKA 1JKTA 5FRIA 3ZBFA 3BE2A 1K3AA 4DEAA 4O0VA 3REPA 1XWSA 2NPQA 2QO9A 4KIKA 5TE0A 2UVXA 5J9LA 5EQEA 1H4LA 2WU6A 2ACXA 2ETMA 4IX3A 4AE9A 2GTNA 5DWRA 3PTGA 3A62A 4JT3A 3MB7A 3RMFA 3DQWA 3TJCA 3NW7A 1JSUA 1GY3A 3PXZA 4J8NA 5CAQA 5JKGA 4O7ZA 3GU6A 1YOJA 2AQXA 5AP6A 4FKPA 3OEFX 4CFNA 2QO7A 1OIRA 4UMUA 2IG7A 3ENHA 2PYWA 4RRVA 3D7ZA 3RHXA 3Q5IA 3GGFA 4RIXB 5AP4A 3DKCA 4FSZA 2CSNA 3DBDA 2HZNA 3G5DA 5JH6A 2XK9A 4KSQA 3U54A 5EM7A 3AG9A 4GKHA 1OECA 3GEQA 5D12A 4FKTA 5HQ0A 2X2LA 4C4JA 4F0IA 3BGQA 5DRDA 4CCUA 4D28A 4APCA 3D7TA 3AC8A 2YDIA 1HOWA 4HPUE 2XKDA 4L43A 4MCVA 2VUWA 3TV7A 3U4UA 4CT1A 5JGDA 5LXMA 3QYZA 3OCBA 4ZTSA 3VWAA 4JBOA 2CKOA 3MYGA 3FXZA 1EH4A 2VTRA 4JDJA 4HVSA 4H05A 3BHVA 3TL8A 2C1AA 1RE8A 3Q53A 4EK5A 5J95A 1KSWA 4AT3A 4HGEA 5ANJA 5IA5A 4FIFA 4GFMA 5AR2A 2PMNX 3EFJA 2RFNA 3IG7A 3AD4A 3AC1A 4F7SA 2PY3A 2GCDA 4QYGA 4F0GA 1ZZ2A 3GU4A 3NUAA 3BEAA 4ANOA 3H10A 3MH1A 5CT0A 3VW8A 4ITHA 5AR5A 3WE8A 4NU1A 4PPCA 2BDFA 3DBFA 4IACA 4PTCA 4N57A 3EQIA 4GYGA 3MDYA 1Z57A 4E1ZA 2VWIA 4ASXA 3QQHA 1CM8A 5CVGA 5HX6A 2XIZA 3ZSHA 2GPHA 5M53A 5L3AA 3TACA 3CQEA 4PPAA 2YCRA 4AW2A 3OD6X 4L8MA 4C34A 3R8MA 5FXSA 3QCSA 3ZFXA 1B6CB 3QFVA 5CAOA 1H1QA 4Z16A 1WVWA 2R3QA 5AP1A 5I9WA 3KGAA 4YTFA 3HDMA 1WBSA 1H25A 3P78A 3Q4ZA 2OF2A 1VYZA 3BL7A 4FTRA 4F9BA 5J7BA 5AUVA 4WD5A 3NDMA 2YIQA 3BYVA 3NIZA 4IVDA 3RM7A 4CD0A 3B8RA 4ZLYA 4GT4A 2OBJA 4G2FA 5EM6A 5HE1A 1YXUA 5CU2A 4JOAA 4FL2A 2WQMA 4J7BA 2EVAA 1A48A 1P4OA 2WU7A 2XJ0A 3EN5A 5DI1A 3V5JA 2PUNA 4GT3A 2E9UA 3TNWA 1WVYA 3FYKX 4EH5A 3FZOA 3UOHA 2A0CX 5F95A 2HW6A 4AZEA 4FKUA 2VRXA 3R6XA 4WG5A 4I93A 5J1VA 2V7OA 5CNNA 5EW9A 5C03A 1CDKA 3UJGA 3KB7A 5T6KA 4FTCA 4E6DA 4ANSA 4X3FB 2BRMA 1OI9A 2B55A 3HRBA 4XV3A 4BTMA 4DFUA 2JFLA 5CU4A 3PXRA 4A7CA 4QP4A 4PY1A 5KZ0A 3E7VA 5L2SA 4FNZA 3ALOA 2NO3A 4FTLA 3RNIA 2VTMA 4I6FA 3BLHA 3QXPA 2OIBA 4XS2A 4C3FA 3L8SA 3ZZWA 3MPAA 1JAMA 3DNDA 3HZTA 4P5ZA 4BDCA 5IEXA 1L3RE 3PVWA 2ITQA 4OBPA 4WSQA 5HCXA 4G6OA 4II5A 3DBCA 2A27A 2VO0A 3CGFA 4GIHA 4AT5A 3CQWA 4MVFA 5TO8A 1W2FA 3KN6A 3QTIA 4YTCA 4I6QA 4MD7E 4LL0A 5ETCA 5AV3A 4PMPA 1VR2A 2UZEA 5KBRA 5KHXA 4DEDA 3QXOA 2O0UA 1LPUA 4XP0A 4QRCA 4L44A 4LRMA 1E1XA 3D5XA 3AD6A 1A06A 2GSFA 3LCDA 3Q4UA 3F5UA 3FMNA 4IAAA 4NCTC 3ZRMA 2VTQA 2YIRA 2JEDA 3FYJX 4V05A 4CYIA 2PULA 4GCJA 1BI7A 4RPVA 5CVHA 4BIEA 4DH5A 3DJ5A 3D5WA 3MI9A 3I6WA 3DB8A 2RSVA 4DEGA 3BYSA 3DQXA 4QMOA 3RI1A 4AXFA 4C35A 4IVAA 4FG8A 3AKLA 1BMKA 2CCHA 4BDKA 3O7LB 5K4IA 4CRSA 4AT4A 2WMXA 2VNWA 2PVHA 3OP5A 3SRVA 2XKFA 4E7WA 3WF6A 4NKSA 4O7VA 2R3PA 4N6ZA 3BKBA 5CYIA 4RA4A 2P2HA 3EFLA 2VGPA 1ERKA 4FZAB 4M0YA 1R39A 4QP6A 2H96A 3U55A 3GUBA 2OJGA 3K3IA 2OGVA 3AXWA 4QMUA 2ONLC 1GZOA 4M7IA 2BMCA 4NEUA 2UW3A 2QOIA 3FWQA 2FSOX 4IWOA 4LL5A 4RIOA 5CASA 5CSXA 1IRKA 3PYYA 4PMMA 2BDWA 4LV5A 3UTOA 1OVEA 4DH8A 2W1HA 3QQUA 4B6LA 1UU7A 4KIPA 4OBQA 4ZTMA 4KWPA 3GCPA 1L8TA 3HMOA 1UNGA 4MD9E 2VNYA 5IQDA 5KMKA 1KE7A 3QQKA 4WBOA 4WSYA 4XNEA 2VWUA 3LM0A 3QA8A 4L42A 4XG4A 3WI6A 2B52A 3V8SA 2OKRA 3QX2A 1G8JA 1YXTA 4FL1A 1UU9A 3KU2A 2VAGA 2ZAZA 4ANMA 3EQFA 3DDQA 3LXKA 4JIAA 4MBJA 2WXVA 3HVCA 3EN9A 5JQ5A 2HXQA 4O4BB 4UMPA 2GS6A 4LV8A 4ACMA 3GOKA 2ZV8A 2C6DA 5BVKA 3IO7A 5KE0A 4BDFA 1Y91A 2REIA 4O81A 3I0QA 4WNPA 5EK7A 2J0JA 1XBCA 4B99A 1ZMUA 2UZUE 4BBFA 4I5CA 4BKJA 5AA9A 5BVDA 3N4VA 4DFZE 5HNBA 2Z7LA 3DXPA 4I20A 2XAOA 3FMLA 4DITA 4O1OA 2PZIA 2R2PA 4O86A 4E4LA 1T45A 3R2YA 1AGWA 3S3IA 4CLJA 1PJKA 3OXZA 4E6CA 4FKIA 4F65A 3AC2A 2PUIA 2RG6A 4ZTNA 5J5TA 4EC9A 4RJ4A 4NZWB 4RWLA 4GG5A 3FZSA 5CU0A 4FUXA 4XUFA 4CT2A 3PJ2A 4DLJA 3K5VA 3P0MA 4O7NA 3MVHA 4I4FA 1H1SA 3AMYA 1IA9A 4FKQA 4NTTA 3DLSA 2P3GX 4YSMA 3ZS5A 5M56A 2PPQA 2XNGA 1QL6A 3QLGA 4H3BA 1ZY5A 4FKSA 3S2PA 2ZM1A 4Y5QA 5LARA 3MWUA 5AJQA 5K0XA 3W0SA 3NVMB 2VX3A 1G5SA 4TWOA 3P23A 4D4YA 4Y85A 3E7OA 4ZSGA 4D2WA 4ACDA 4AZFA 4F99A 4RLKA 2XVDA 2ITTA 4IM0A 5BVWA 4C33A 4PDYA 2V22A 4AWIA 3ZZEA 3C4ZA 3AC4A 3DKFA 3FE3A 2FH9A 3C4WA 3HKOA 1H26A 3Q2JA 2QHMA 1GNGA 4LDTA 3Q4CA 4FNXA 5CT7A 3LXNA 5HLWA 2YM3A 4LMNA 3TYKA 3CJGA 2WTWA 4YHTA 3WF7A 5LMAA 3UG1A 1PMUA 4PMTA 3EN6A 3QWJA 4IWPA 3I1AA 2CJMA 4FK6A 1WBTA 4XCUA 3C0IA 4R1YA 4X7QA 3SKCA 4Z7HA 3UOJA 3D0EA 4HGLA 3TCPA 3PLSA 1K2PA 2HWPA 4WRGA 4DGLC 3NNVA 2OJ9A 2G15A 4X3FC 1H28A 4S31A 2ZYBA 2EB2A 2IJMA 2ZB0A 4BYIA 4HVIA 2X8DA 5C01A 2Z8CA 5FWKK 5I9XA 1Q5KA 5AR3A 4QDEA 4G31A 4N0SA 3R8ZA 5HG5A 2PSQA 4ITIA 3ATSA 1BX6A 4DF3A 4IAIA 5HHWA 5A4QA 3UNKA 4DTKA 1ZLTA 2R3OA 4FT5A 2BZHB 4FSTA 3LXPA 1YVJA 3G6HA 4ANLA 3UDTA 3QYWA 3T9TA 4NIFB 4DH1A 3E62A 5FXQA 3UMWA 3ZUUA 3AKKA 4O96A 4HW7A 4GFOA 2W4KA 4MQ1A 3W0RA 4R8QA 4MBIA 3ROCA 2X7FA 3W0MA 1OKZA 3DK6A 2HCKA 4LGDA 3F2NA 4PWNA 5EG3A 3SXRA 4F08A 4BWKA 2ZV7A 4F4PA 3ORZA 3EQRA 3KMMA 1OKVA 4HVHA 3HA6A 4L3JA 2ZDUA 3LLTA 5HIBA 1Q62A 3ZCLA 4MTAA 1BI8A 3DS6A 5C8NA 3TKIA 4ZZNA 3NR9A 2VTOA 3E63A 4KSPA 1TZDA 4YNOA 4ZK5A 3PIZA 4QQ5A 3SAYA 3RWQA 4I6BA 1PY5A 3C13A 4FTAA 3RALA 3ZMMA 4O82A 4QYYA 4QNAA 4U3ZA 4FV8A 4XOZA 3OXIA 1KV2A 2GNHA 3VS1A 3W32A 3BU6A 3KL8A 5IMEA 3U9CA 4APPA 4RG0A 1OL5A 4PNKA 4JDIA 2XRWA 4AGWA 5IEYA 3BV3A 3DV3A 4O0RA 4GH2A 4U3YA 4G6LA 4YC6A 1G8KA 3BI6A 4IX6A 5HTBA 4CNHA 3OXTA 4ZJJA 4DGMA 5HNIX 5M07A 4CRLA 4E6QA 3S00A 4FTJA 3DFAA 4L00A 5D10A 4D2TA 4RJ6A 2VTSA 2BZIB 4IC7A 2RGPA 2WQEA 4PP9A 4C57A 4FEWA 4LYNA 4AN2A 4L3PA 3NX8A 4E26A 2GHLA 4JAIA 4ZTRA 5I3RA 4NYEA 4WG4A 3GCQA 3RCDA 5AP5A 3VRZA 4EOLA 1H27A 3VAPA 3OEZA 4TY1A 4U41A 2FGIA 3I5ZA 3PVUA 3FL5A 3RZFA 3ENMA 2W5AA 3JY9A 3KCFA 4BJJA 2XKCA 2GS2A 2GU8A 2YERA 2HXLA 3OMVA 1Y6AA 4R6VA 4EOOA 3C4XA 4L46A 2UW6A 3DLZA 2YABA 2YZAA 4U79A 3W2PA 1TQMA 1SM2A 4ORKA 1VEBA 4C8BA 4FGRA 4RZVA 2W1CA 3DTWA 4JQ7A 4O7SA 4RVTA 2YZLA 1A9UA 3E8CA 4ACCA 2XYUA 4DFNA 4TWNA 3CTHA 3QF9A 4FICA 2C4GA 1UV5A 5AR7A 3I6UA 5L4QA 3ZUVA 2BHEA 3T3VA 1YRPA 2J2IB 3FLZA 3HV4A 3QUDA 1YHVA 4E5WA 2PE1A 5HE0A 3SC1A 2NNWB 4DCAA 2SRCA 3MIAA 4C62A 2R3LA 4FKLA 5D11A 4DC2A 3QCYA 5D9HA 2C1BA 3PVGA 4FTUA 4RIYA 2WMAA 3QQLA 5CEQA 3IW8A 3QC9A 2C68A 3PY3A 4UY9A 4B8MA 4J96A 4R77A 4F6WA 4TWCA 4MNEA 3HMMA 4EH9A 3ORMA 3OS3A 2WIHA 2UZNA 4FNYA 4RFZA 4DFLA 4RC3A 3OWKA 2QO2A 2QLQA 4X2GA 2WQNA 3VF9A 3KA0A 2VO7A 5CAPA 1V0OA 3FMKA 5FBOA 2C6TA 2PHKA 4PV0A 5JGBA 4BZOA 5IA1A 4FSNA 5GHVA 3AKJA 2XNEA 3UVRA 3ITZA 1PRYA 3R71A 2R3MA 1ATPE 1RW8A 2XNMA 2G9XA 4IVCA 4OTGA 2BVAA 4DT8A 2VWVA 4GK3A 4KNBA 4BBMA 2BDJA 3L9NA 4NSTA 4BCOA 4BDHA 1PMNA 4KAOA 4OTFA 4IDTA 3L9LA 4IW0A 3TIZA 3JR1A 1PMEA 5CF6A 2HY0A 5GZ9A 2XUUA 3EL8A 3OG7A 3VULA 4TTHB 2PUPA 2XIXA 2VTNA 4ZTHA 5J5SA 1ST4A 3SVVA 5EDRA 3DJ6A 3EB0A 4FL3A 4M13A 1O9UA 3R9RA 4OTIA 3ROYA 4DFXE 4QPAA 1NVSA 2WMTA 3MFUA 4ZOGA 5KX8A 4XV9A 2PVLA 3QRKA 4CTCA 5E8ZA 4HCVA 5FQDC 3P1AA 2OXDA 1UKIA 2X7GA 3HRFA 4QYHA 4HZRA 4UWBA 1G3NA 4RA5A 3MTLA 1DAWA 4Y46A 3PDTA 2FA2A 3GCSA 1T46A 2HIWA 3CLYA 3WZUA 3FV8A 4G5PA 4BIBA 3QAME 4I94A 1GIHA 4K18A 4AGUA 4DCEA 4EZ5A 1MRVA 3KIOC 3EYHA 3NAYA 1CSNA 2BHHA 2Q83A 2JITA 3VQHA 3C4FA 1GIJA 3R7YA 3TJDA 4C4FA 4USFA 4FTOA 3VUIA 3Q6WA 4ALVA 5CEIA 2C3IB 3F3UA 4FTNA 3RAHA 1MQBA 2CNVA 1V0PA 4AN3A 3PVBA 4EHZA 1Q3WA 2ITOA 2FSMX 3OZ6A 3W10A 3MIYA 3K54A 1E1VA 3GC7A 2PL0A 3R7EA 3EN4A 4I6LA 4U7ZA 5HORA 3ZC5A 3FQSA 2GS7A 5IU2A 2J90A 3DGKA 4D2VA 4DGNA 3P7AA 2Y9QA 4QYFA 2O2UA 2C0OA 3V5QA 2EXMA 3A4PA 2AYPA 3KF4A 3POZA 4K9YA 3QQFA 3RPSA 4BCFA 4BCKA 4O83A 4ZMFA 2ZDTA 1S9IA 4R7HA 5BMMA 2B4SB 4NL0A 3O71A 2P33A 3RBWA 4KRDA 3NS9A 2OO8X 3O17A 3LFEA 3CTJA 4EH7A 5IUHA 5AMNA 2J0KA 4HYUA 5DRBA 3SHEA 3VBXA 4CFXA 2C6KA 2WTCA 3FLNC 5JRQA 2C3JA 5HZNA 3BHHA 3QALE 2G1TA 4LG4A 3PPJA 4CZUA 3E5AA 3VO3A 3PRFA 3GQLA 3FI2A 3P79A 2EUFB 4ZAUA 4AGCA 4ZLZA 2WTIA 5K0KA 2VWWA 3V51A 5E8YA 3QTRA 3SXSA 4FKRA 5EKOA 2WTKB 4EOSA 4L53A 3OT3A 3VQUA 4YZDA 3EFWA 2PVKA 3T8OA 4EK4A 4IH8A 3A7GA 2QHNA 3R1QA 2YITA 3LFNA 1M14A 1XKKA 4ZZMA 1Q41A 5IEVA 4FV2A 3EIDA 2UW0A 3F3VA 2JC6A 2PZYA 4AX8A 5L6OA 3LHJA 2QVSE 2XNOA 4M8TA 3DKGA 2R3HA 3CXWA 1W98A 4H1JA 4C4IA 5JFWA 1J1CA 4F9AA 2GFSA 2IF8A 2YWPA 3CBLA 4DHJA 3OOGA 2JD5A 3WF8A 5EYDA 3ZYAA 2QKWB 4JJRA 5EYMA 4PL5A 4D1XA 1OMWA 4BY9E 3ZC6A 4TYEA 2HZIA 1W82A 4CG9A 4I5MA 4AN9A 2J51A 4UMTA 2H9VA 2R5TA 4UWCA 4JR3A 3LW0A 4I22A 4XG3A 5JZNA 4L6QA 4RZWA 5HD4A 1FOTA 3EHAA 1XH5A 2X0PA 3DOGA 5E1SA 5HTCA 3JS2A 4USDA 5EW8A 2YCSA 4F1OA 4IB3A 3NNUA 4O0SA 2B54A 4K1BA 4OTDA 4QP8A 3JXWA 5G1XA 3POOA 2E9VA 2PE0A 1Q8TA 1YXXA 4F0FA 3DFCB 3E92A 4X3JA 3U87A 3UOKA 3MY5A 4AOJA 3QRIA 4YPDA 4FI1A 2XNBA 4W4VA 3IQ7A 4IEBA 2I1MA 2VD5A 2X0QA 4G1WA 1JPAA 1PXNA 4U97A 4YLKA 5K5XA 4FF8A 3W8QA 3UDZA 3COKA 2BPMA 4O4CA 4TNDA 3BYUA 1BUHA 1FMOE 1OIQA 3RKBA 4M14A 2QU5A 1XH8A 1UWHA 1KUTA 5HX8A 3QQGA 2PK9A 2J6MA 3A7FA 2ZVAA 4QMMA 4XYFA 3IKAA 3Q60A 4E6AA 4E4NA 4OGRA 5KKRB 2JAMA 5AR4A 4KS8A 4RX8A 4BDEA 4C58A 3CIKA 4FIJA 2CKEA 3QKLA 4I3ZA 4ZJIA 3R9NA 3RHKA 3AT3A 4I21A 1VYWA 3HV6A 5KBQA 1UVRA 4IB1A 1M52A 4KRCA 3DA6A 2EU9A 3I81A 4QMVA 3UPZA 3SOCA 4EH8A 4ZLOA 3EQHA 3TUBA 4U44A 4TT7A 4EH2A 3ANQA 1H1WA 2Q0BA 1W84A 4O0UA 3K2LA 3UG2A 5B0XA 2PZ5A 4FR4A 2X7OA 1M7NA 3C0GA 3MA3A 3MVJA 1B38A 4KIKB 3W2SA 3C5IA 2YM8A 4I0TA 3TWJA 4YTHA 1PXOA 5TF9A 3I7CA 4MH7A 4CKIA 1ND4A 3ZLWA 5CEKA 5ETFA 3WYXA 2X9FA 3MH2A 3R0TA 1ZOHA 5LWNA 3I7BA 2W05A 5A54A 3C0HA 4IDVA 2YEXA 5HO7A 3NMUF 4O84A 5D7AA 3FQEA 2X4ZA 2WPAA 3ZLXA 4FKGA 4DH7A 5BV3A 4JAJA 4RVMA 4X2NA 3I5NA 2PVRA 3FZTA 3OWJA 3PWYA 3ORPA 4D4RA 3HP2A 3TUDA 3D7TB 4YBKA 1YI3A 3EWHA 3IS5A 2YM6A 2A19B 3DKOA 3VC4A 2UZVA 5DFPA 4YJOA 3UYTA 1DS5A 4YJRA 3FPQA 3PSBA 5I5ZA 4NCTA 4CXAA 3BCEA 5HKMA 3ZO3A 4ZSJA 3EQPA 3GC9A 3MFTA 5BUIA 3LCKA 4BCGA 4FZFB 4LUDA 4MXYA 5AADA 4C38A 3B8QA 4HYIA 4QTDA 4BI2A 4DT9A 3LM5A 3SGCA 3DZOA 4HVGA 4A4OA 3TZ8A 4WO5A 5HCYA 3VRYA 1XQZA 4BI1A 2PVYA 5DGZA 4D5KA 5M08A 4AS0A 4E93A 3ZLYA 3GC0A 4FEVA 3NYXA 2OK1A 5L2QA 3VONA 3RGFA 3HEGA 2XBAA 5FG8A 5HG9A 5DPVA 4QMTA 3PIXA 3PFQA 5DVRA 4F1MA 5LMKC 5IKWA 3RNYA 5IQIA 5BVOA 4GRBA 1FMKA 3KCKA 3PZHA 3QLFA 3G6GA 1NA7A 3NZ0A 3RWPA 2F49A 4Y83A 2ONLA 3SW7A 1MRUA 2OJJA 2Q0NA 3PA3A 4RWIA 4O6EA 4EUTA 3BLAA 2EXCX 4JBQA 4YLLA 3WZEA 2BAJA 3COHA 3IPHA 3QQJA 4RWJA 4Y5HA 5EKNA 3KXNA 4ID7A 2WTKC 3O51A 2HELA 4FV5A 1UKHA 3ETAA 3IGGA 1ZMWA 4FTMA 4PTGA 2JDTA 5AAGA 4RIXA 3COIA 5IQFA 4QMPA 4ZP5A 3KC3A 1Y8GA 4F6UA 3WZKA 3R73A 2KTYA 1URWA 3BX5A 4MYGA 4LQMA 5ACBC 3UBDA 3FDNA 1J7LA 1KE5A 1OL7A 4CFFA 1RQQA 3MPTA 1PW2A 1FVRA 4CVAA 4ZY5A 2WTVA 4I0SA 4V0GA 3TNHA 2UVYA 1REJA 3LIJA 3FSFA 3BPRA 4FIEA 3LJ2A 4J52A 5HVYA 2I0YA 3EN7A 4DG0E 1PXPA 5HO6A 5M4IA 5IF1A 2XEZA 4HNIA 5GNKA 5M51A 5L8LA 2B1PA 2J0MB 2R64A 4JQEA 1GJOA 3RCJA 4JI9A 2QOQA 3D14A 4D9TA 3TNIA 4O0XA 2JIIA 1KE9A 4D58A 3PWDA 4PRJA 4BKZA 4ANQA 1XH6