3ZSIA

X-ray structure of p38alpha bound to vx-745
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
347
structure length
326
Chain Sequence
PTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLTRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of p38 alpha bound to TAK-715: comparison with three classic inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords MITOGEN-ACTIVATED PROTEIN KINASE 14
total genus 106
structure length 326
sequence length 347
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2011-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3zsiA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3zsiA01
5E8SA 1UA2A 2HOGA 3UQFA 1FPUA 2XUUA 2V7OA 4D5HA 3AMAA 2X4FA 5EFQA 2VUWA 3CTJA 4O0WA 4QP9A 3S0OA 5IH5A 1ZOGA 2A2AA 1J1BA 5AP2A 3CBLA 4BDJA 4O0YA 2PTKA 1SZMA 2ITZA 4XCUA 2WZJA 3PJ1A 3P7CA 5B2MA 3S1HA 4EOKA 3BU6A 3Q96A 1BX6A 2YDIA 5E8ZA 3AT3A 1M2RA 4G3GA 3FLYA 5AP6A 1OBGA 4E6QA 3UZPA 4C2VA 5JKGA 3A62A 2I0YA 3PFQA 4I1ZA 4X3FC 3ZZWA 4Y46A 3QRIA 3BU3A 4R78A 4N70A 1NA7A 1LEZA 4GYGA 5AIKA 5IEXA 1H08A 4GIIA 4XEYA 3VNTA 3TJDA 3UVPA 1YRPA 3HV6A 3FZRA 4RIXA 1ZMUA 3Q9XA 2C5NA 5AJQA 4EK5A 3IGOA 4G3FA 2WEVA 3QGWA 4YGAA 2P33A 1PW2A 3ATTA 1ZYCA 2UZDA 3C0IA 4O22A 3HZTA 3TJCA 4ASXA 5CI7A 4CRLA 4D2TA 4KINA 3M1SA 2OFVA 2XNEA 3R73A 4O1PA 4N0SA 4QP4A 3H0YA 3RI1A 4JBQA 4RWLA 3DZOA 3HMOA 5EHLA 1RJBA 2ZMCA 3KF4A 5A4LA 1J7IA 1YWNA 4DITA 4DTAA 3FWQA 3H9FA 4D2VA 4QMXA 3K5VA 4ASEA 4P90A 4HVGA 2YCQA 4AE6A 1WVXA 4DEGA 1Z9XA 1OPLA 5C4KA 3HLLA 2X39A 4AF3A 2JKMA 4UYNA 3EYHA 5AR4A 3QLGA 3ZO1A 4EHGA 4M12A 1M17A 2ERKA 4KRDA 3MFUA 4IWDA 3EYGA 5IMXA 3R71A 3BGZA 5IA4A 2QKRA 4I3ZA 3D15A 5IQIA 2BRNA 1OITA 4CNHA 1R39A 4YO4A 1Z5MA 4L3JA 3R8VA 3L9PA 5HU3A 4JR7A 2EU9A 3VQHA 3D0EA 5FRIA 3ZRMA 1QPEA 3ZLXA 3MPAA 2CKQA 1LP4A 1HCLA 1J1CA 3A8WA 3MH0A 4J98A 2QOHA 5L6WL 3MB6A 4IB5A 4PRJA 1JLUE 5FXSA 1M7QA 3UVRA 4L45A 4MXCA 5E9EA 4QTAA 3OVVA 4FKIA 2OZAA 4P5ZA 3Q9ZA 3QQKA 4AA5A 1XBBA 2XNBA 4TRLA 5DG5A 2RFDA 4P4CA 1SNXA 5AWMA 2X6EA 4RJ5A 1PY5A 1G8AA 3EHAA 4FSNA 3WF7A 2FA2A 2YDKA 3UDBA 1PXOA 1ZY5A 3HMPA 3AD6A 3FXWA 4CCUA 2C1BA 2OLCA 2W1ZA 3PVUA 3AG9A 2VWUA 3E7OA 5K3YA 5IA5A 4RC4A 3UC4A 1W82A 4AAAA 1UU7A 3QKLA 5FM2A 4GKHA 3VBXA 2QOIA 2J5FA 2XNPA 2O8YA 3KXGA 4JBOA 3VUDA 2I6LA 3NDMA 1CTPE 4IAIA 4MHAA 4L46A 3R6XA 2W17A 2B0QA 1GY3A 3GCPA 4UMQA 4HVDA 1JPAA 3LCOA 3W2CA 2J0IA 4FV0A 5CSHA 3FKLA 4XV3A 4F4PA 4X7QA 4Y83A 1Q8UA 2C3IB 5HORA 3TM0A 4PL5A 1QPDA 5JZNA 1OIRA 4IX4A 5HE3A 2PPQA 5FP6A 4F7SA 2YWPA 5L2TA 2WIPA 5H8BA 3W32A 3ZLYA 4ZTMA 3KC3A 2QR7A 3D7ZA 3VS4A 3RZBA 5ANKA 2WOTA 3SOAA 3QXPA 4YP8A 5AV4A 3O8TA 4ZSAA 4RA4A 5EM5A 5A6NA 3P79A 3O96A 4AXAA 3DQWA 2B9JA 2XRUA 4F08A 5A9UA 3CY3A 4WSQA 3CPCA 5ANDA 5HBHA 3FI8A 4EH4A 3PJCA 4GJ2A 4AW1A 1KV1A 4DLIA 4AOTA 2ESMA 4GYIA 4CVAA 4X2GA 2OH4A 1Y8YA 1WZYA 3TNIA 3DKCA 2EB2A 2NP8A 4GT4A 5HE0A 2R3QA 2WAJA 2W1GA 4TPTA 3SRVA 3QZIA 3CCNA 5I9ZA 5H9BA 4IB3A 4Z7HA 3NW7A 3Q04A 3GVUA 1W98A 4IMYA 3SW4A 2VTOA 5IUHA 5AUZA 2VGOA 4BVUA 4I4FA 4WA9A 4CFXA 3PRFA 3QTUA 4L3LA 2IVUA 2CLQA 4ZP5A 4JG6A 3VBQA 4BC6A 3EL7A 3ZM9A 5HVYA 1GZOA 1S9IA 2AC5A 3QKKA 1SYKA 1OKVA 2GNLA 3L9MA 3MS9A 4U41A 3AD4A 2WTKB 4PPCA 5EM8A 4O7SA 3LLTA 4EH5A 5KCVA 2PE0A 3UVQA 3W8QA 3QD3A 2BRMA 4FV6A 4EK8A 3P86A 1H24A 5KE0A 5BMSA 2XYNA 2WD1A 2IVVA 4IDTA 2OK1A 3LM5A 4IW0A 3GQIA 4PDYA 1XO2B 2JDTA 3FLNC 3OOGA 4ALVA 4FSWA 5KMMA 3C5UA 2O2UA 3P4KA 3QFVA 2RKUA 1OM1A 2XK4A 3O8UA 4V0GA 2X4ZA 4ZEGA 4QTEA 2ONLC 3QCXA 3P7AA 1GOLA 2B52A 3VULA 4KSQA 3UP7A 3ORPA 4MBLA 3V5WA 3OW4A 3QQJA 4PMTA 2BAQA 2JITA 1H25A 4UN0C 2XNOA 3BV2A 3COIA 3O71A 3U4UA 2OXXA 3POZA 4HVIA 4DEDA 1Y8GA 4QMPA 3IKAA 4R5SA 3PVWA 2O65A 4I6QA 3RNYA 3U9CA 5IQHA 1DS5A 2FSOX 4YJPA 2BDWA 3HRFA 2C3LA 3Q6UA 2YM4A 3N51A 3PE1A 1FVTA 3QU0A 2QHNA 3LMHA 3RALA 1O6LA 3PPKA 1H1QA 2J51A 2YFXA 3PRIA 4FNYA 4LGHA 4Y8DA 3JR1A 5IQGA 4YJQA 3T9IA 4LMNA 1A9UA 3NR9A 3QGYA 4E6DA 4EUTA 4DGGA 5DR2A 4MD9E 4BKYA 4DC2A 2BCJA 4R5YA 4I0RA 3U87A 4QYFA 5BUJA 4FMQA 4RBLA 3FBVA 4PNIA 2IW8A 2RL5A 2UZWE 2WMSA 5DI1A 3UOLA 4KBKA 3PIYA 2GNGA 3IOKA 4CMTA 3SG8A 3WOWA 4CXAA 3CTQA 3VO3A 3MIAA 3PJ2A 3ANRA 3LCSA 3TZMA 5KMOA 4YJOA 3HAMA 4JOAA 1HOWA 2XKCA 4ERKA 3EN4A 1P2AA 2YIRA 4IZAA 3KVXA 4NJ3A 5JQ8A 2UVXA 3JUHA 4MD7E 4WRGA 5BYYA 4F7NA 3VBYA 1G8SA 3CGOA 4I5PA 4JLCA 4D2PA 1PXKA 2WTWA 3KULB 2UW9A 3QTIA 4O0TA 5AX9A 3CP9A 4TW9A 1H4LA 3GU4A 4ZTQA 2ERZE 2WGJA 5ANEA 1QMZA 4EL9A 4RJ8A 3MWUA 4GK4A 3VAPA 4TWOA 2WTVA 2VWIA 5CXHA 4D28A 5HG5A 1YWVA 3KGAA 4Z9LA 2BRHA 2YZAA 2BHHA 3OTVA 4YR8A 5CEOA 4XBUA 1H0WA 4BN1A 4C0TA 4F65A 4LOQA 3UBDA 3UQGA 4J52A 3UG1A 2W06A 4G34A 1YXUA 2E2BA 4IANA 4JXFA 4JBVA 2GS6A 3BLQA 2UV2A 1VYZA 1UWHA 2B7AA 2WELA 4OT5A 3R1SA 4WNMA 3LAUA 2PZ5A 1Q3WA 3ZSHA 4FGBA 2C6TA 3KMUA 4FF8A 4U43A 2XIRA 3QHWA 4YZMA 5D12A 3RPVA 4A4OA 4DFZE 1R0PA 2GQRA 1PXLA 4CQGA 3MPMA 3R1NA 3R00A 4YZNA 4FTIA 3R0TA 2C30A 4FV3A 3OZ6A 3F7ZA 3QUPA 3R8UA 3NRMA 4F0FA 5H8EA 4FTTA 4R8QA 5HU9A 3SW7A 3HYHA 3TG1A 4M84A 4CKRA 3P9JA 4Y72A 4C7TA 4I20A 3EFKA 4HNFA 4XG7A 5CT0A 5AUUA 4L42A 3S2PA 5EYMA 3UNZA 3HMIA 4O38A 4R3CA 5KZ0A 5HO6A 4LGDA 3CGFA 3LFBA 3R2BA 3VJNA 4NT4A 4IWPA 3RGFA 5B7VA 4GMYA 4CG9A 3MH3A 4J53A 4ZZNA 3R30A 1ZYJA 3PA3A 4QMTA 3A7HA 3OEFX 4D55A 5LXMA 5IQDA 3L8VA 2YLEA 2QI8A 3A8XA 3R2YA 4HZSA 1MRVA 4O86A 4NW6A 3ZC6A 4D9TA 1CMKE 3D7TB 4EOSA 2ZOQA 3GQLA 3ZCLA 1ZRZA 2HAKA 5HD4A 1UNLA 4BYIA 3U54A 4AT4A 2GNJA 2JEDA 5FTOA 4IADA 3QX4A 2XKDA 4TN6A 2QCSA 5KBRA 1F0QA 3QKMA 1NY3A 2ITNA 2R3KA 4QOXA 3SOCA 3QC4A 4C38A 2ITTA 4IDVA 5IPJA 1YXVA 3WBLA 5KMKA 4IB1A 5CEIA 3EZVA 3GI3A 5EW3A 1W0XC 4BCPA 4FSRA 3O7LD 3FXZA 5HGIA 3MFSA 2W7XA 4DCAA 5EDPA 1GZKA 5E8VA 4OT6A 2PZYA 3RZFA 1OUKA 4JS8A 4W4WA 2FGIA 3ZDUA 4TT7A 4BDCA 4HW7A 5IEVA 4FZFB 2OKRA 4BKJA 2H9VA 2JBPA 1U59A 4S30A 3ZDIA 4G5JA 3D5WA 4FSTA 4LI5A 1PRYA 4IVDA 3VF9A 1IR3A 4XRLA 4BCHA 4U97A 4HYSA 2PVJA 1WBTA 4ALWA 1GIIA 2XEZA 2O63A 1ERKA 4ERWA 5CYIA 5KMNA 3EOCA 4BDIA 3G6HA 4FBXA 2OJIA 4CKJA 4BI1A 4FX3A 3WI6A 1Q3DA 2OSCA 4EQCA 4O2ZA 3GFWA 2OBJA 3IW6A 4O91A 4ZAUA 3RPSA 1FINA 4U8ZA 4AQCA 3ALNA 4FIEA 1QL6A 2BAKA 4HGLA 4KWPA 4U7ZA 5HKMA 4M13A 4HNIA 4LG4A 3TNWA 1H01A 2B53A 1JKLA 2HYYA 4EHVA 4BHNA 4D5KA 2WTKC 3FHRA 1XH8A 3C13A 4ZMEA 3TEIA 2JLDA 5CEPA 4FG7A 5EH0A 3NUUA 1SM2A 4ZZMA 5C01A 4XV1A 5EG3A 3C4FA 3UZTA 5LWNA 3T3UA 2RG5A 2XIKA 5EKOA 3V8WA 5BNJA 4RIYB 4H58A 3NUXA 3ZO3A 4CKIA 2W9ZB 4ANNA 3F3UA 4XV9A 3IONA 2PHKA 5GJFA 1W84A 4RT7A 3PLAE 3Q4CA 4CD0A 4QO9A 2C6DA 3MVMA 4JBPA 5HICA 3C4ZA 3C9WA 4WT6A 4ZK5A 3DBDA 4F6UA 3SD0A 2H96A 4FE2A 1KE5A 4ANOA 1YHSA 3UGCA 4YUQA 3F3TA 2WMBA 2HW7A 2XB7A 4OAUC 4GVAA 4LYNA 4FEVA 2OZOA 3GBZA 3VHEA 4WUAA 4DEHA 3W18A 3E8EA 3H4JA 4KBAA 4TWPA 4D1ZA 4DA5A 2C0OA 1PHKA 4HCUA 3CQWA 3NIZA 4MWIA 4OTWA 4WG3A 5DLSA 4EZ5A 5KHWA 4RFZA 3TV6A 3GCVA 5K4IA 3MW1A 4UMTA 5EDQA 2UZBA 4UBAA 4I24A 4JIKA 3SV0A 4KIKB 4D1XA 3VUGA 3OCTA 2VTIA 4G3CA 4DG0E 2JIUA 4DAWA 3WF6A 4JQ7A 3DU8A 4DH1A 2W1FA 4FVRA 5HCZA 4S31A 5CNNA 2A0CX 4L01A 4J96A 3NX8A 4YZBA 4EORA 3PXQA 2CKEA 2VTPA 2R3MA 3MFTA 1SNUA 3BX5A 2GNHA 5LJJA 2VTNA 3JVRA 3HAVA 4RZWA 1YDRE 1J3HA 1I44A 3F3WA 4GFMA 2W05A 3HUBA 5DIAA 3GCSA 3PVGA 5J8IA 1OPKA 5AR8A 4EQUA 1GZNA 2R5TA 4MKCA 1ATPE 4IB0A 5M53A 4BR3A 5DT0A 4OR5A 2HCKA 5AR7A 4I5HA 5AUXA 5IQCA 3H10A 4TWNA 3T9TA 4D9UA 3IW7A 3VS6A 5F9EA 4IAKA 4EOIA 4ZTLA 1XBAA 4U81A 5FQDC 3NUAA 3FHIA 2VTLA 5BVKA 3FMJA 4D0XA 5CVHA 3R8PA 4H36A 2FVDA 5CAVA 2VX0A 4K77A 5EM7A 2HZIA 2CJMA 2JBOA 3HP5A 2CGXA 5KMLA 3EQFA 1WVYA 3ZU7A 5CAPA 2WMRA 4R1VA 1FGKA 4L9IA 4MAOA 4FKQA 4CQEA 4E8AA 2IG7A 2UUEA 3EN9A 4CFMA 4OTFA 3UO4A 4MXAA 4OTRA 3ZC5A 1ZMWA 2VTHA 2NRYA 3W2QA 3ZLWA 3DK7A 4CV9A 1OL7A 4BRXA 3II5A 4C3RA 2YCSA 4O7ZA 3PTGA 1JQHA 2Z7LA 4FNWA 4U3YA 3EQRA 2UW3A 3OF0A 4GEOA 3TDWA 4AA4A 4ANBA 5K9IA 3FV8A 3R9DA 4EOOA 1MQBA 4A06A 4IHPA 4F7JA 5IISA 4GS6A 4KKEA 3BV3A 4C2WA 3E64A 3OFMA 5CU6A 5H3QA 4B6LA 4ENYA 5A54A 5KUPA 4J95A 2PY3A 3QTSA 4GG5A 3O0GA 3I60A 4FKOA 3KN5A 3EKNA 3COMA 3NNVA 3RVGA 5LQFA 3AC8A 3HMMA 1WVWA 3ORZA 3KRXA 4MBIA 4M3QA 5EM6A 4E73A 2ZV9A 3ODZX 4EQMA 4EKLA 4YSJA 4OTDA 3L1SA 3VS7A 3AC3A 3CIKA 3I5NA 2FSMX 4BDEA 3F7WA 3HV5A 5E8YA 5KHXA 4PMPA 3U6JA 1XH5A 2W5HA 3LXKA 4IAFA 4E93A 4HVSA 5A3XA 4DH7A 5HESA 3LQ8A 3BKBA 5DFPA 1PXIA 1Q8WA 4C34A 3T8OA 5CU0A 4YZCA 3BCEA 3VIDA 4BCJA 2X8IA 4YC6A 4C4GA 2DUVA 1OUYA 3C7QA 1MQ4A 3IPHA 4G3DA 1SVHA 3ZZEA 3DY7A 4IJ9A 4CEGA 3C4CA 3LHJA 3PZEA 3TZ9A 4IH8A 4AFJA 4O83A 2OJ9A 3KXMA 3C50A 1R1WA 3IGGA 5IF1A 3NLBA 3A7JA 5HEZA 3BGQA 3SQQA 4NM7A 4IACA 3COHA 3JVSA 3V01A 4AX8A 4BBFA 3O23A 1Q4LA 5AM7A 2PUPA 4GW8A 5CF5A 3QL8A 1JAMA 5AUWA 2PULA 4FT0A 3RWPA 2CKPA 4IM3A 1U54B 5F94A 5FDPA 2WQMA 1YHVA 1CSNA 2BFXA 3ALOA 3GP0A 3OROA 3QTZA 2IW6A 2FYSA 4FTKA 4XP3A 5C26A 3HECA 3Q9YA 5LMKC 3AC2A 5E4HA 4KSPA 3F9NA 5HNGA 4CYIA 2O64A 3UC3A 2ACXA 2R3FA 3KCKA 1UNGA 2VNWA 5A4TA 4QP6A 3UOJA 1GAGA 3R9NA 2OJJA 3W2SA 2PSQA 4BKZA 3PG3A 4HPTE 3H9OA 3MH1A 3P0MA 2EB3A 4GJ3A 1QPJA 4EKKA 3G9LX 4K18A 2YERA 4IZ7A 1B6CB 4KKGA 3DOGA 4QMZA 2DYLA 1JKTA 3ORNA 4CCBA 4TYGA 3EMGA 4R3PA 4YNEA 3V5TA 3LFDA 4QQTA 2GNIA 2XF0A 4RJ7A 5AX3A 3NAYA 2YM7A 2XJ0A 4GK2A 4F9AA 4Z3VA 3KXHA 4NH1A 3R7OA 3C5IA 4FC0A 2VWBA 1O6YA 3W33A 3HGKA 4X6RA 3F82A 2VX1A 3FLQA 2YIYA 3EFWA 4I0SA 4IC8A 2E9NA 4O2PA 3MB7A 1TVOA 3B2TA 1M2PA 5CEQA 4OTQA 4JDJA 4CRSA 4O7RA 2X0GA 2JIVA 1PMEA 3A99A 2QU5A 3E8DA 4W9XA 4NIFB 2CKOA 3QQUA 5BVOA 4CTCA 5BPYA 4M66A 4PTGA 5ANJA 1OMWA 1MP8A 1Q62A 2EXCX 3AMYA 3FLWA 5HVJA 5DA3A 4C58A 4FT3A 5JT2A 3FMEA 1WFCA 4NTSA 4E5AX 2IWIA 4O96A 4P2KA 2P2HA 4ANSA 3UPZA 4F99A 3LCTA 3TKIA 4YJUA 5GIPE 3QQHA 4BGQA 2VO3A 3TCPA 4O7VA 3TI1A 5F1ZA 4J97A 1YXTA 4YTIA 4AN3A 4O7YA 4IVCA 4K11A 4QMYA 3VS1A 4R3RA 3V5QA 3CD3A 1Q97A 2VTTA 3OHTA 3LCDA 4FSMA 4AZWA 4NU1A 4FKGA 3IOPA 3OS3A 3UJGA 3VBVA 4BCQA 3RM7A 1Q5KA 5BVNA 5I9UA 3MVLA 2KTYA 1QCFA 4IWOA 4JDKA 4K8AA 5ETFA 3V51A 2P2IA 4E1ZA 2X8EA 1BYGA 1TKIA 2OFUA 3MV5A 4FZ7A 2GPHA 4MWHA 4LMUA 4XV2A 4EONA 3IDPA 4FR4A 2BZHB 4BTKA 2PVLA 3QCSA 5LVLA 3ORKA 3P7BA 4IFCA 5LCKA 2I0VA 2R7BA 5DWRA 2W96B 3FMKA 5LVNA 3B8RA 4LV8A 5HZNA 3OC1A 2BTRA 3QWJA 4UWBA 3ZSIA 3AGMA 4FTOA 4IC7A 1R3CA 1GIHA 3KXNA 5HCXA 3MDYA 3Q5ZA 3UIBA 4FTQA 4D1SA 5C8KA 2OIBA 4FT9A 4ID7A 3W2PA 1MRYA 2QLQA 4NUSA 4WHZA 1B39A 2BFYA 4EH6A 3C0HA 2XJ1A 3KXZA 3TV4A 4BCNA 3KRWA 4A9YA 4ONAA 5FBOA 3Q2JA 2UZLA 1CKPA 3TV7A 4LRMA 1XQZA 2VWWA 4MXOA 5M4FA 5DRDA 4ORKA 4GU9A 4DT9A 2C6MA 3G90X 4EOPA 3WE8A 4YTFA 4QTBA 4OAVB 3TZ7A 2R3GA 4QMNA 5HD7A 3AC4A 4DH5A 3HDMA 5ICPA 2GFCA 4PV0A 2I0HA 4BCIA 3FY2A 3I1AA 4KNBA 3LM0A 4DFLA 5C8NA 5L8LA 2GS2A 2PUIA 2B1PA 2IO6A 3Q5IA 5JRQA 3DXQA 4KUJA 4I93A 3LQ5A 3UO6A 4RQVA 2ITPA 1H07A 4O27B 3ZOSA 2CHLA 4XP2A 2ZMDA 3VBWA 1OKWA 2BROA 2C6EA 4FTLA 2BIYA 3DZQA 4AZSA 3QRKA 3HRBA 2JC6A 4PUZA 4WOVA 4R77A 3COKA 3TN8A 4DE4A 1IG1A 4AOJA 2JKKA 3KU2A 4X3FA 4A4XA 4I21A 2EUFB 4GUEA 2OWBA 2OXDA 5E8UA 4QNAA 2W99B 4E26A 1TQIA 4FIIA 3RWQA 3RBWA 3TACA 4ZJJA 3O2MA 3S4QA 5L8JA 3F5UA 2EXMA 4MXXA 1WBOA 4RX7A 4IIRA 4U42A 2UZTA 5ETCA 3RNIA 3SKCA 2ITQA 3LXLA 2JAMA 3NAXA 4QPMA 5H2UA 4M7IA 4IM0A 4DH3A 2GS7A 2E9UA 4DF3A 2VO0A 1DI8A 2VWVA 5AV0A 4F9YA 5J7HA 3Q4UA 4PDSA 3D83A 1WCCA 4TNBA 3NUNA 1WMKA 3R8LA 3CTHA 3MPTA 5CX9A 3RM6A 5IA1A 1OECA 2WQOA 3D2IA 5EKNA 4B4LA 3DKOA 3ROCA 4FKWA 4QP3A 4C61A 4RWKA 3DJ5A 5L4QA 1PXPA 2X9EA 1PMVA 5EW8A 3IS5A 4PL4A 3OOMA 2G2IA 2HXLA 4M68A 1K9AA 2Y4IB 3HV7A 2J4ZA 3RPYA 2Q0BA 4AT5A 4NZWB 5DEYA 4OTPA 4GSBA 3DDPA 4AOIA 2P3GX 2YCFA 1IEPA 3MYGA 4FVPA 2GHGA 2YJSA 5EI2A 4E4LA 4TXCA 4L43A 5IMEA 4F9CA 5IQAA 5F4NA 5FWKK 2DS1A 5AP0A 2VWYA 1UKIA 2XRWA 3ET7A 3BI6A 3FPMA 1REKA 4J8MA 5HO8A 5TT7A 4BTFA 5AR5A 1BMKA 3C4XA 4ITIA 4DYMA 4EK4A 1ZZLA 4FL2A 2JFMA 4YLKA 1YQJA 3GXLA 1Q99A 4BTMA 2IW9A 3QQFA 3TTJA 3QA8A 1A48A 3IO7A 4ACDA 4DFBA 3WF8A 3HKOA 3OWPA 2J0LA 4TTHB 4F1OA 1L3RE 3OT8A 4OTHA 3SC1A 2QOBA 1HCKA 5FD2A 5ANIA 4RFMA 4JT3A 3QLFA 3WZUA 5L2WA 4C4HA 2R7IA 5E8XA 1WBWA 2C6LA 3KKVA 4OLIA 2VN9A 5LOHA 5CY3A 2VGPA 3DLZA 2OF2A 5HG8A 4N6YA 4V0GB 3DK3A 3OXIA 4G6NA 2GHLA 3Q6WA 5BVDA 5F20A 5TKDA 2UZOA 2GQSA 5A6OA 2NNWB 1H1RA 3RINA 3ORXA 3Q3BA 3AQVA 2HZ0A 4BCMA 3NNWA 3SA0A 3M42A 4WBOA 1UU8A 2F7EE 2YJRA 3LJ0A 3F5GA 4FKLA 2J0KA 4XG4A 2JD5A 1JSTA 4M15A 3PY1A 1XHAA 4XJ0A 4FV2A 4AW5A 3FQEA 5GJGA 3VUHA 4O82A 2WNTA 1YDTE 4YBKA 1ZY4A 2QONA 3TWJA 3PZHA 5FUTA 3DV3A 1PJKA 4BZOA 2J0JA 2VTAA 5D1JA 4ZTRA 2VNYA 4E4MA 5CF4A 2Y9QA 4FSZA 3AC5A 3QRTA 4V04A 2ZVAA 5AP3A 5HLWA 3PG1A 4HGTA 4NFMA 3QA0A 4DINA 2WTDA 4ZTSA 5GJDA 4AZFA 2G2HA 4YPSA 4H39A 5B0XA 1DM2A 3UE4A 4E6CA 1Y91A 2YISA 2OJFE 4FYNA 3TIYA 4CLJA 4EOJA 3IG7A 1EH4A 1OIYA 2P55A 3UYSA 1SMHA 3F66A 2O3PA 2PK9A 5KZIA 2J7TA 5L2SA 1AD5A 3MSSA 2HXQA 4MNEB 5HBJA 4J8NA 4A9RA 4NM5A 2XK9A 4CFFA 2EWAA 1LEWA 2W1CA 4G31A 1ND4A 1STCE 2VWZA 3VN9A 4ASZA 3P78A 4ZS4A 3LVPA 2WMWA 1PXNA 4QMUA 2C1AA 5EOLA 2HY0A 4DEIA 4FIFA 1T46A 4CFNA 3L9NA 3QTQA 4X2JA 5EYCA 4TY1A 4GL9A 4TYHA 3O8PA 1BUHA 1OZ1A 2VTRA 4KA3A 3KREA 1L8TA 4USDA 5L6PA 1CKIA 3U4WA 4ZJIA 1OPJA 3AXWA 1UNHA 3QXOA 4Y5QA 3W10A 4C37A 4YPDA 3BE2A 1PXJA 2WOUA 3PP1A 5AUVA 2DWBA 2Y7JA 3LCKA 2VTSA 4Q5HA 4G5PA 2XIYA 3GU5A 2J5EA 5EW9A 4LUEA 3ZFMA 4FTMA 4X3JA 3D5VA 1REJA 5DHJA 5TE0A 3OG7A 2LGCA 5CU2A 5AAFA 3BWFA 4ASDA 4S34A 4QYGA 3G0FA 3LFAA 4HPUE 5EI6A 4F6WA 1YOJA 3FEGA 3OCSA 3ORIA 2QO2A 3GC9A 2PMIA 4ITHA 3W16A 3ORTA 5IQEA 3BYOA 1UWJA 3JPVA 3HNGA 3R1QA 4ZXTA 2OXYA 1H0VA 3LFEA 4FK6A 1CKJA 4YLLA 4EJ7A 4KB8A 5KBQA 4NKSA 4E7WA 1Q41A 4JX3A 1J91A 3U6HA 3ORMA 3DB6A 4XS2A 5AEPA 3NUSA 2ITWA 4FUXA 2YACA 4W8EA 4EWHA 1ZARA 4XG9A 4BCOA 4ANQA 4OBPA 3SHEA 2ZM3A 1GZ8A 2YIWA 4E5BA 3MY5A 2B55A 4DFUA 3QC9A 3LPBA 4GRBA 2JDOA 3RPOA 2XBAA 3LW0A 4M8TA 4JX7A 5FGKA 3A7IA 4FG9A 4LL0A 1JNKA 4LGGA 4UZDA 5AADA 3CKXA 3GNIB 3E3BX 5CSVA 3F5PA 5IG1A 4R7IA 3E87A 4AFEA 3CLYA 2QODA 3LXPA 4RA5A 1YI6A 3DAEA 3AT4A 4JI9A 5HOAA 5TF9A 2CGVA 3F6XA 5A4EA 3NYNA 5KMJA 2Y6MA 5HLNA 5J1VA 5FG8A 3HEGA 3M2WA 4BB4A 2XM9A 4YTHA 4A9SA 2X2KA 4BDFA 1W8CA 1KE9A 2BUJA 3ENMA 4IX3A 4TZRA 2XK6A 2Z2WA 2Z7SA 4QMOA 3EJ1A 4Y85A 3WIKA 4R1YA 3FXXA 3P1AA 4F9BA 1GJOA 4Q9SA 4BGGA 5AA8A 2PZRA 4TYJA 1B38A 2GHMA 4U0IA 2R3LA 2RF9A 2F7ZE 2QKWB 3DTCA 3EH9A 3K3IA 4PDOA 4CLIA 2C0TA 3M11A 5HI2A 3P23A 3UODA 3B2WA 4BY9E 3KF7A 4I94A 4H1JA 4AUAA 3FSKA 2F57A 4XLVA 4O7TA 4AZTA 5E8WA 1LPUA 2Q0NA 2X7GA 2YIQA 2CN8A 4HOKA 4UY9A 4GV1A 4FSUA 3QTXA 3BRBA 4QYHA 4MEDA 4BGHA 3MJ2A 1GIJA 4F63A 3K54A 2VZ6A 4G9RA 1NVQA 4IEBA 5EHYA 2YLFA 4DG2E 2ETKA 3WZJA 2AC3A 4CT2A 4HCTA 3DNDA 2BRGA 4YMJA 1Z57A 3JYAA 2HW6A 2QOOA 3RCDA 5DT3A 4BDAA 1OKZA 2WQNA 3BELA 3OT3A 4R7HA 4RIXB 3LMIA 5GHVA 5J87A 4CMUA 5HNIX 3I0QA 3Q52A 4CSVA 2HWOA 5FDXA 2YEXA 2CCIA 3Q4ZA 3FMLA 4I4EA 4S2ZA 4BCKA 4F1TA 3VHKA 5M08A 3WZEA 4RVLA 3NNUA 4UX9A 3VS0A 4FOCA 3KL8A 4YURA 4YC8A 3CS9A 4PTEA 4QTDA 2WB8A 3BPRA 4FZAB 3VWAA 2XK3A 2PUUA 4WNOA 3BWJA 1VYWA 3BBWA 3IW4A 3QBNA 4RGJA 4XH6A 3HX4A 4YJSA 3EQCA 3HUCA 2FSTX 5AV2A 2YM6A 3L8PA 1OL5A 1VEBA 2BR1A 3DXNA 1U5RA 3S3IA 1FMKA 2I40A 3D5XA 3NSZA 4M97A 3SGCA 3QAME 4JAJA 1CDKA 4RZVA 4ANLA 2C5VA 3DBQA 4YO6A 4ZTNA 5GZAA 1H26A 4U80A 5ITAA 2BILB 5I9VA 4UXQA 2OU7A 3FQHA 2QLUA 3DQXA 4M67A 3UOKA 3QRJA 4IQ6A 1JSUA 5DVRA 5JGBA 2SRCA 4QRCA 4EI4A 4K9YA 5DRBA 1AQ1A 1E1XA 3OUKA 1JKSA 2P0CA 4C36A 4FUYA 4NTTA 3EFJA 4MD8E 1AGWA 2ITXA 2FB8A 3KRJA 3I0OA 3V6RA 3DBFA 3NW5A 3N4TA 1KOAA 3AD5A 5CEKA 5CQUA 1XBCA 5DN3A 3ZBXA 3HRCA 1F5QA 3CPBA 2GTNA 4XX9A 4EH3A 1I09A 1RDQE 3C0GA 5CF6A 5IEYA 2QG7A 5HNBA 4FEWA 2V62A 5I9WA 3WYYA 4BBMA 3KXXA 1KE6A 1E1VA 2OW3A 2IVTA 3BU5A 4AACA 3DBCA 3D5UA 2F9GA 4FTAA 5G1XA 3R7UA 3TZ8A 4MQ2A 5BX0A 4BICA 1FVRA 3ZO4A 3W2OA 4YHJA 4G1WA 5HE1A 1APME 3BHVA 2YN8A 3PSCA 4UMRA 2OO8X 4BHZA 4O6LA 4WD5A 3QCQA 5AFVA 2WPAA 4O0VA 5A4CA 4OTIA 3ZEWA 5B2KA 3LFSA 2ETMA 5HBEA 4RX9A 4KRCA 2R3OA 5CANA 2QU6A 4IX6A 4YHTA 4EZ7A 3CC6A 4MXZA 4KS7A 2YIXA 4RFYA 2PE1A 3UIMA 2Z7RA 5LVMA 2R3IA 4UYAA 3PWYA 5JEBA 4FEUA 3VQUA 5E1EA 3OWJA 4X6QC 4F64A 4F09A 2VTMA 2YAKA 5CSWA 2B9IA 2VU3A 3G51A 1X8BA 1NXKA 3VRYA 3PPJA 3A2CA 3HA6A 3OWLA 3FZTA 4C4JA 4XRJA 1J7UA 4WKQA 4QPSA 4PPAA 5DH3A 4E4XA 4PP7A 4EOMA 5DYJA 3ZONA 2WTCA 3QALE 4FOBA 4JRNA 5HIDA 3EN7A 1WBPA 4BIEA 1QPCA 4DFNA 3MIYA 3KK9A 3PJ3A 4FG8A 5I3RA 4XOYA 5BYZA 1K2PA 2IZSA 4JRVA 3MA6A 4B9DA 5HCYA 5DR9A 2X81A 3GUBA 4X2KA 2ZM4A 3GEQA 2RGPA 2R64A 4RJ4A 1FVVA 2V7AA 3FI4A 3FKOA 4HVHA 5A4QA 3F3VA 4NKAA 4IX5A 4FZDB 4UXLA 2R9SA 4NL0A 4HCVA 4FKUA 4G2FA 2LAVA 3GU7A 5JFSA 5JN2A 4MF0A 5J95A 2WXVA 4G3EA 4WIHA 5FLFA 3UIUA 3WE4A 2E9PA 5K0XA 3VVHA 3MESA 1V0BA 5CWZA 4A9UA 4JG7A 3SLSA 1P5EA 5L8KA 3PXYA 3UMWA 2XVDA 3LJ1A 5D41A 1ZYSA 4FNXA 2OH0E 4MTAA 5ETIA 5CS6A 3VS2A 4FA2A 3FZPA 3L9LA 3CQEA 3NCZA 2W4JA 2JDSA 3NEWA 3NGAA 4FV8A 4RIYA 3UTOA 3VF8A 4QP7A 5GIOE 3U8WA 4FIJA 3D2KA 3KRRA 3OBJA 5H8GA 3R7EA 2F4JA 5CTPA 2QO7A 4GU6A 3F2RA 2WMQA 2Y8OA 3FMDA 3KULA 4YZ9A 3TDVA 2GMXA 4FKVA 4Y95A 3OCBA 5DBXA 2BPMA 3ZBFA 3D7TA 4ZS0A 4D4YA 5I9XA 1IAHA 1R78A 2W5AA 2O0UA 5CAQA 4I41A 4U3ZA 4RIWA 1ZYLA 3RAIA 4IM2A 5CNOA 3FZOA 4ITJA 2QQ7A 3LJ2A 3A4OX 4KIPA 4GFOA 4GIHA 1H1PA 3MGYA 3ITZA 4E20A 3CD8A 1G3NA 5LMAA 2QG5A 5KO1A 2P4IA 3LKMA 4M69A 1PF8A 3QYZA 1PMNA 1OIUA 3GFEA 4GK3A 5I3OA 4QQJA 2OIDA 3OP5A 4WO5A 3R83A 4RX8A 3MI9A 3VUTA 4K1BA 5M57A 1P14A 2WFYA 2C6IA 3BE9A 4IVAA 4ZSEA 3V8TA 3MVJA 3QQLA 5DMZA 5ACKA 4U44A 4CYJA 4RJ3A 3LMGA 4DN5A 3GC7A 1JVPP 3NS9A 5E8TA 5KNJA 1BL7A 3CJGA 3AMBA 3BQCA 4H05A 2C5XA 5J9YA 2EVAA 4YLJA 3FLZA 3V5PA 5CT7A 4FIHA 4AG8A 2C3KA 4F0GA 5LMKA 4BDKA 5HX8A 1BLXA 4KS8A 4F0IA 1DAYA 4I0TA 1XH6A 1Q24A 2ONLA 4RVTA 2DQ7X 3EQIA 4RG0A 2WMUA 5EYKA 5E1SA 3F61A 3O50A 4LFIA 4J99A 1JBPE 3DKFA 5F95A 5CLPA 4FKPA 4X0MA 3QZFA 4FTJA 4V05A 1XWSA 5HG9A 2A27A 4U9AA 2PYWA 1ZWSA 2YITA 4DGMA 1PKDA 1PXMA 3QTWA 1KE7A 4D4RA 4XG6A 1OB3A 2PZPA 3PIZA 4ZZOA 2CDZA 4QD6A 4A07A 2JAVA 3UO5A 3OXTA 3GGFA 2W1HA 2X6DA 3R63A 3E88A 3BGPA 3MY0A 5TOZA 3BEGA 2O5KA 5EK7A 1YWRA 5KKRB 3PIXA 4WG4A 4DTKA 2R2PA 3DTWA 2PVRA 3R02A 3GOKA 5J5TA 4L8MA 2XJ2A 2R3NA 3E93A 3FMNA 3V6SA 4ZLOA 3DK6A 1XH4A 3QZHA 4L68A 5M44A 3KB7A 4YHFA 3OBGA 2PZIA 4G17A 3CXWA 3VRZA 4BDGA 1PKGA 2FUMA 4BF2A 1Y6BA 2BALA 2REIA 4WNPA 3KCFA 4DBNA 4JQ8A 5LWMA 3P5KA 4IZ5A 4ZJVA 5CSPA 4EHZA 5T3QA 3I81A 4AGUA 4H3PA 2RSVA 2J90A 4QPAA 2AUHA 4YJVA 2GTMA 3TNQB 2H8HA 1JKKA 2WTJA 3ID6C 2IZTA 3W55A 4MVFA 3QX2A 3UIXA 1V0PA 1VZOA 3E7VA 3HMNA 4V01A 3TL8A 4IZYA 1IAJA 3UOHA 2YAAA 4QMQA 3FI3A 2Y4IC 4MX9A 4DBXA 4OW8A 2Y0AA 4CV8A 3CEKA 2PVFA 4RC2A 4FSYA 2F2UA 2ITYA 4NM3A 4B99A 4EBWA 3DA6A 4G16A 3TKHA 5IDNA 1DAWA 1H1WA 2B4SB 3FE3A 5KX8A 5FXRA 3ZXZA 1NW1A 2YA9A 4OBQA 4PMSA 4Q5EA 5L3AA 3R9OA 1WAKA 5M09A 2X1NA 3OY3A 3GENA 3PXRA 3EWHA 4FL3A 4DFYA 3FI2A 4L6QA 4C62A 3NVMB 3I7BA 4O7WA 2ZJWA 4AWIA 4JDIA 1YI4A 5J7BA 3ELJA 3ODYX 3RTPA 1ZZ2A 4FKJA 5K0KA 5AM6A 3RP9A 3NYVA 5L2QA 3ROYA 4KKHA 2R0UA 3UMXA 3R01A 4IAZA 3G15A 3ORLA 5D11A 5CZIA 4ZOGA 3VJOA 4QP8A 3LQ3A 4QMLA 5FTGA 3OY1A 3U9NA 2HENA 1WBVA 2UZUE 3G6GA 3ZO2A 2C3JA 1XH7A 4FK3A 2ZYBA 3IK3A 3BZ3A 4XYFA 3WILA 4CZTA 3UNKA 2FSLX 2BRBA 3WYXA 5JMSA 4XBRA 3RMFA 4QP1A 4UWCA 3EN5A 2OJGA 3D9VA 5HG7A 3DPKA 1T45A 4IWQA 2W5BA 3G0EA 2YM5A 2QR8A 4UMPA 2VTJA 3C1XA 3PXKA 5EHOA 3SDJA 3AC1A 3D14A 5C8MA 4ZMFA 3QD2B 4XP0A 2X2LA 5CF8A 5EQPA 2J9MA 4EBVA 3GCUA 3U6IA 2QOFA 1VR2A 3VUIA 2BAJA 4RVMA 2ITOA 4IFGA 2PWLA 3FMHA 5HTBA 2OG8A 2W1EA 4AT3A 4PL3A 4RMZA 4XG3A 3TNHA 2ZB1A 2JKOA 5ACBC 4C35A 3F88A 3ZSGA 4AP7A 3A7GA 3PXZA 2GFSA 3HP2A 3R7VA 2WU6A 3DCVA 1U4DA 2W4OA 4R6VA 3G2FA 2XZSA 3QUDA 3C51A 3UPXA 3HDNA 3AT2A 2OI4X 3Q32A 5DGZA 2VD5A 4FODA 1ZOHA 2PVNA 2G15A 2UW4A 1BL6A 3RK7A 4QQCA 4BI0A 4Z55A 1E9HA 3G9NA 4U5JA 3ZEPA 3RAHA 2I7QA 2H6DA 3PP0A 5K5NA 2PE2A 3RK9A 4DGNA 4GT3A 3OUNB 5J5SA 4QQ5A 4HZRA 4ENXA 4O84A 4HYIA 4N4SA 1F3MC 3SRVB 4IBMA 4I6BA 4K0YA 2CNUA 2Y6OA 4FZ6A 5AP5A 5I5ZA 2CMWA 2XK7A 3HL7A 3JXWA 3F5XA 1YXXA 1FGIA 2XKEA 4PDPA 3IQ7A 4C33A 4MCVA 1NVRA 2YCRA 4M69B 5T6KA 1PYEA 5ANGA 4PP9A 1V1KA 3RHXA 3PE2A 3VS3A 3KMMA 4IXPA 3RK5A 3UYTA 4BYJA 2ZAZA 4MK0A 4RIWB 2FO0A 4M0YA 4EHEA 4EUUA 2H34A 2VRXA 1JOWB 2B9FA 4JIAA 4ZSLA 5KMIA 2UZVA 4FVQA 4HJOA 2C4GA 3IDCA 4EWQA 2UW6A 1KE8A 3NCGA 3DJ7A 4WSYA 4YNOA 3DS6A 3BHYA 4JG8A 4X21A 2WO6A 3TUBA 5JGAA 4DLJA 3NMUF 3FPQA 4EK6A 2PVYA 3L8SA 4IAAA 3R9HA 3DNEA 3VBTA 3FLSA 4L53A 2WU7A 3R28A 2W1DA 4QNYA 4EH2A 3CJFA 3S95A 4ACCA 3ZXTA 5DPVA 3SAYA 3WF9A 4QMSA 4PNKA 1U5QA 3D4QA 4ZLZA 1FBNA 3OD6X 4J71A 2YZLA 1MRUA 3E92A 3ULZA 3GC0A 3MFRA 4U79A 3THBA 5A46A 3KQ7A 5KKRC 3RCJA 3NZ0A 2RIOA 5C4LA 3BQRA 1P4FA 2F7XE 3GU6A 3NYXA 4O7LA 3N4UA 3N9XA 3DJ6A 3RAKA 5C9CA 4APCA 4U45A 4B8LA 2X9FA 2PL0A 2R3RA 2CCHA 2F49A 5BUEA 3JY9A 5CVFA 4JAIA 2C0IA 4RVKA 3PY3A 2GDOA 4GVJA 3V8SA 5HE2A 4PTCA 3VW8A 2ZV7A 4WNKA 3ZHPC 3IW5A 4NIFA 1YVJA 2ETRA 1BI7A 5JFVA 2VWXA 3R21A 4RC3A 4O7NA 3LFFA 3EB0A 3PSBA 5E90A 2R3HA 4FSQA 2VAGA 3E8CA 3Q60A 2XMYA 4BWPA 5IA2A 2UW5A 4PY1A 3B8QA 4Y5HA 1ZLTA 2YM3A 2C6KA 3BHTA 4ZY5A 3FZ1A 4PF4A 5K4JA 2BMCA 2F2CB 4L67A 2XM8A 4MQ1A 4YJTA 3EN6A 2XNGA 5BMMA 2WEIA 4ACGA 1OL2A 5J79A 4RWIA 5JGDA 5AUYA 5EDRA 4FIGA 3CR0A 3ACKA 2UW0A 2RFSA 3E8NA 1Q8YA 3PA4A 4EC8A 3QD0A 3W2RA 3ZFXA 3AOXA 5BVWA 4CFUA 2G9XA 3LFQA 3TXOA 4C4IA 4F70A 5DOSA 5BVFA 4APPA 4QYEA 2A19B 2BKZA 4GG7A 3QCYA 1UVRA 2QOKA 3KN6A 3BLHA 4KAOA 3V04A 4I92A 4C8BA 3OMVA 5CEMA 3PDTA 5CENA 2PUNA 3FKNA 4OGRA 4TYEA 3VC4A 5D10A 2BVAA 2X7FA 3GOPA 2JIIA 5EQEA 3FC2A 5JK3A 3R1YA 4E3CA 4D2RA 4K6ZA 5CAUA 1YI3A 2XP2A 3N4VA 3RAWA 2KULA 3ZRKA 5HTIA 4MH7A 4X3FB 4A9TA 1DI9A 4FEXA 3SG9A 3ZMMA 4DCEA 4BBEA 2ZV2A 4B7TA 3BLRA 4USFA 3IDBA 5J1WA 5DR6A 3DT1A 5IU2A 4LRKA 4MF1A 2BTSA 5J9ZA 3NWWA 2QNJA 2XNNA 5E91A 4BL1A 1FOTA 2I0EA 2W1IA 4FT5A 5M55A 3VUKA 4DFXE 3RHKA 4DGOA 3TIZA 4UV0A 2XIXA 5GZ9A 1WBNA 2CGUA 3GCQA 4GH2A 2B9HA 5FBNC 3WZDA 4EJNA 3ULIA 4FV5A 2BKKA 1TQPA 3I4BA 1URCA 4NWMA 1J7LA 5ANOA 2OGVA 4Z7GA 4UB7A 3K2LA 3BHUA 3Q9WA 5IQBA 3EFLA 5JQ5A 1GNGA 4ZLYA 2QHMA 3FQSA 5JZJA 2PVMA 2WMAA 3NNXA 4WBBB 4FTUA 4GCJA 4TNDA 4GUBA 4AGDA 3SXRA 5CASA 5M07A 3ZUUA 5CU4A 1XKKA 3DGKA 1ZOEA 2AYPA 4LQMA 3TTIA 5HVKA 4O1OA 4YBJA 3GU8A 5D7VA 4ZY6A 3UQCA 3C4WA 3ATSA 3EL8A 4FV4A 1FQ1B 1XR1A 2UVYA 4RLKA 4BZNA 1SVGA 4FYOA 4NYEA 2WMXA 1JSVA 4WRSA 5AV1A 3W8LA 4LV5A 4QP2A 5AP4A 5FXQA 1Y57A 4PQNA 4CZYB 1A06A 4C02A 3ZLSA 4FKRA 1ZAOA 4O21A 2BDJA 2IJMA 3KA0A 3MH2A 3QZGA 4XMOA 3F2NA 2HIWA 3DLSA 5AR2A 4BDHA 4DHFA 1OKYA 4O6EA 3TKUA 4NW5A 3BEAA 3U51A 5FTQA 4E5WA 4IVBA 4UZHA 2VTQA 1H8FA 5L2IA 4D4VA 1BKXA 5M06A 4L44A 3FDNA 4L7FA 1ZMVA 4XOZA 3G33A 3C4EA 5IUGA 2XEYA 3CQUA 2W4KA 5IZFA 3KFAA 4CMOA 2OZAB 1NVSA 1KSWA 3OCGA 4JVGA 3R8ZA 4DGLC 2XCKA 5G6VA 1M7NA 3ZH8A 5HX6A 3MJ1A 4O0XA 4E4NA 1UV5A 1W83A 3PA5A 5IUIA 4EC9A 3LXNA 3KEXA 2A1AB 4DEEA 3FL4A 3H3CA 3ZYAA 2X2MA 4DT8A 2FH9A 2IZUA 2QURA 4LOOA 4D2SA 3NYOA 2ITUA 4X2FA 3OTUA 1YDSE 3LE6A 1S9JA 3A7FA 3V5JA 2QOLA 2B54A 3ZUVA 4AZVA 4C59A 1WBSA 4GT5A 2UZNA 3PXFA 4AW0A 3ZS5A 3EIDA 2E9VA 4C3PA 1OIQA 4I22A 4I6FA 5IQFA 1M14A 2QOCA 4RPVA 3SXFA 1IA9A 3T3VA 4F6SA 1H1SA 2HZNA 2J0MB 4PPBA 4BI2A 4BZDA 5HTCA 2J6MA 2BDFA 4RQKA 3UG2A 2X8DA 3V3VA 1KWPA 2HELA 5HHWA 5CXZA 3PSDA 4RIOA 2VX3A 5AA9A 2YM8A 5T68A 1LR4A 3QYWA 1UU3A 4L52A 3TUCA 3DB8A 3HV4A 2Z8CA 4TYIA 3BYMA 2RG6A 3F2AA 4AE9A 4EEVA 1Y6AA 5I9YA 3EQPA 4FTNA 4W4YA 4W4XA 3CSVA 3FL5A 4FTCA 5AP1A 3FAAA 4X2NA 1SVEA 3MTFA 4D0WA 4L7SA 5FM3A 4FV1A 3H0ZA 3DDQA 4KD1A 1H27A 3O17A 4BCFA 1Q61A 4O0UA 5DE2A 3FSFA 3D94A 2RFNA 3BYUA 2JDRA 5AMNA 4LRJA 4I6HA 2HY81 4W9WA 2R3JA 4UMUA 1YHWA 3QUEA 3FUPA 4IAYA 3QRUA 5L6OA 1KUTA 3K5UA 5CALA 2Q83A 1PMUA 5LARA 1MUOA 2E9OA 1YOLA 2WMTA 2XIZA 2BHEA 3I6WA 5HLPA 4FGRA 2UW8A 5CI6A 2OF4A 3MBLA 1UKHA 3MY1A 4NCTA 2WQBA 3MA3A 5BVEA 3SXSA 4EH8A 3PWDA 2NO3A 5M4CA 4EOLA 3TT0A 3HVCA 1YKRA 3FY0A 4JDHA 1M2QA 4ANMA 5LCJA 4FKSA 2NPQA 2Z02A 2V22A 4JJRA 2PVHA 2R4BA 3WF5A 4DG3E 1V0OA 2OICA 4A4LA 3E5AA 3HV3A 2UW7A 3RJCA 3F3ZA 1OGUA 4RSSA 2JFLA 4MXYA 4OUCA 2WIHA 4A7CA 2GU8A 4W4VA 5EI8A 5C1QB 2JGZA 3DKGA 3FJQE 3QD4A 5LVOA 5IDPA 3NPCA 5CZHA 3QWKA 2V0DA 5JSMA 1P4OA 4LOPA 3QTRA 1LUFA 3NVKI 1IA8A 4FEQA 2IVSA 3DXPA 4ZIMA 3VS5A 1JWHA 5EQYA 3O7LB 5C27A 3QF9A 1IASA 2ZB0A 2VO6A 4ZSGA 4F1MA 4IE9A 2HZ4A 5AUTA 3FMMA 3TNPC 5M4UA 2IN6A 2XNMA 2CNQA 2GQGA 4RJ6A 4JL9A 4HYHA 3REPA 4NM0A 4NCTC 5AR3A 1Q8ZA 2QVSE 3CE3A 4BDBA 5ETAA 2C6OA 4P5QA 1RE8A 3ANQA 4KIOA 4NFNA 5DNRA 5LVPA 1FMOE 3R22A 5JFWA 4HYUA 3SVVA 2V5QA 1BI8A 3Q2MA 3R8MA 3PPZA 4ALUA 5A14A 3VW6A 2WMVA 3QHRA 5M56A 2IZRA 5HIBA 2XS0A 4AN2A 3WZKA 3ZFYA 4PX6A 4QT1A 5D7AA 4C57A 2YDJA 3FYKX 4KBCA 5HQ0A 4OTGA 4ZTHA 3UZRA 3K3JA 3V5LA 4QTCA 4TYHB 4AU8A 4O81A 2G2FA 3EZRA 1W7HA 2WQEA 4P7EA 2ZV8A 2BIKB 5CSXA 4AA0A 4TL0A 4DEBA 3H9RA 4YC3A 4G6LA 4I5CA 4R7BA 1OL6A 3BIZA 3SX9A 5DT4A 5J9LA 4MYGA 4EYJA 5GINE 4EH9A 3ENHA 3O51A 4BIDA 4D2WA 3EQHA 2CGWA 5CVGA 4FV7A 1PYXA 2C5OA 3ZM4A 4HGSA 4S32A 4O0SA 4XLIA 3R7IA 3OW3A 1YW2A 4NEUA 4IJPA 2HK5A 2A4LA 5BQ0A 2X7OA 2BZKB 3LOKA 5LMBA 2GSFA 4PMMA 4F9WA 5IA3A 3EQGA 2G01A 5EYDA 1YXSA 4C3FA 3L8XA 4NK9A 4QMWA 5I0BA 4TWCA 5GZ8A 5IH6A 5BUIA 4MNFA 5IH4A 4CFWA 2BZJA 3BBTB 4QMVA 4YJNA 2C68A 4AN9A 2VO7A 5DEWA 4K2RA 5C03A 1Q8TA 4JR3A 2NRUA 3EQBA 1VJYA 4Y73A 2C69A 3QQGA 3U55A 5B2LA 5BYLA 2CPKE 3FC1X 3KMWA 3Q4TA 4FL1A 3KK8A 4H3QA 4AS0A 2CLXA 4USEA 3R9RA 4FICA 3R04A 5AP7A 1CM8A 2XKFA 2CNVA 3DFAA 4N6ZA 4FTRA 3OWKA 4U6RA 3VUMA 4B0GA 3LFNA 1M52A 1U54A 3H30A 4EH7A 5AAGA 1G5SA 2QC6A 3PVBA 4KIKA 3IW8A 4CT1A 4RRVA 3R7GA 4XG8A 4K33A 2XA4A 3TUDA 4Q2AA 4NJDA 2EXEA 4AGWA 2PVKA 4WUNA 5FEQA 4YJRA 2YHVA 2Y4PA 2QD9A 4CZUA 3CKWA 3E63A 3PJ8A 4E6AA 3BYSA 4U40A 3ZRLA 4C4EA 3A61A 4ACHA 1H00A 3WIGA 4AZEA 4I23A 5JFXA 2CSNA 2I1MA 4KIQA 4UEUA 3WARA 3P08A 5TR6A 3I79A 4D58A 1OBDA 1YOMA 3CY2A 3F69A 4BWXA 4BWKA 2XK8A 3R7YA 4BCGA 3LLAA 1H28A 4N57A 4FI1A 3AGLA 4L00A 5D9HA 4DEAA 2XYUA 3MVHA 3OXZA 5CU3A 3KVWA 4FKTA 2C5YA 3FYJX 3I6UA 1NT2A 2XCHA 5AIRA 2BZIB 3HA8A 5JRSA 3PYYA 2Z60A 4L3PA 3I7CA 4YU2A 1O9UA 5E92A 4J1RA 1XH9A 4G9CA 3NW6A 4RLLA 3GT8A 3W1FA 3POOA 4WG5A 3IECA 4XHKB 2IPXA 3ERKA 5IA0A 4LM5A 4ZY4A 4M0ZA 2ITVA 3NIEA 3I5ZA 5IKWA 2YABA 4RWJA 2PMLX 5FEEA 5TO8A 5HO7A 1R0EA 3ZTXA 2PMNX 1KV2A 5EOBA 4ACMA 2ZM1A 4G6OA 1IRKA 3JS2A 4GFGA 5GNKA 4FT7A 4ARKA 1UU9A 4DH8A 3BYVA 3EQDA 3GC8A 3PLSA 4J7BA 3FZSA 1TQMA 3A60A 2XBJA 4C4FA 4BTJA 2R0IA 5FEDA 4EOQA 4CG8A 1RQQA 3RPRA 3E62A 5FP5A 4S33A 3UNJA 2VV9A 2QOQA 2JKQA 5M4IA 2J50A 4YTCA 5E7RA 5I4NA 4Q9ZA 3G5DA 3KY2A 1URWA 5AV3A 3EKKA 1OL1A 3GB2A 3DAKA 4PWNA 2V55A 4YSMA 4D4SA 4EK3A 5HIEA 4XUFA 5CQWA 4FV9A 4CFVA 4O0RA 1ZYDA 4HGEA 4Z16A 1O6KA 5M51A 4NSTA 2CN5A 5K5XA 3ACJA 4LL5A 1K3AA 3UP2A 4M14A 5CAOA 4GKIA 2WKMA 4XG2A 3LFCA 4MBJA 3S00A 2Z7QA 3NUYA 2QO9A 3MN3A 4QMMA 2UZEA 4KABA 2GCDA 3Q53A 2PMOX 4CTBA 4RX5A 2WTIA 4OBOA 3JY0A 2GNFA 2W9FB 3NUPA 4EZ3A 2WHBA 2W0JA 5AAEA 4FNZA 4H3BA 2HWPA 4F7LA 2ZDTA 4W8DA 4YZDA 4EYMA 3ZUTA 3E3PA 2J2IB 4I5MA 5JH6A 4AGCA 4QYYA 2C47A 1U46A 3LZBA 4DTBA 4JNWA 3KRLA 4JQEA 3BHHA 4XNEA 3A4PA 3DAJA 4LUDA 2PU8A 3PUPA 2OIQA 4ZSJA 2RFEA 3DFCB 2R3PA 4UALA 4CGAA 3OEZA 2G1TA 4II5A 4UWYA 4MNEA 4BDDA 2XH5A 1OVEA 3DBEA 1OI9A 1RW8A 3RKBA 2UVZA 4AW2A 1ZXEA 3ETAA 1KOBA 3MTLA 3PY0A 3LIJA 4TKSA 4BIBA 4B8MA 2ZDUA 4BFMA 2JDVA 1XJDA 2YWVA 4H1MA
chains in the Genus database with same CATH superfamily
5E8SA 1UA2A 2HOGA 3UQFA 1FPUA 2XAMA 2XUUA 2V7OA 4D5HA 3AMAA 2X4FA 5EFQA 2VUWA 3CTJA 4O0WA 4QP9A 3S0OA 5IH5A 1ZOGA 2A2AA 1J1BA 5AP2A 3CBLA 4BDJA 4O0YA 2PTKA 1SZMA 2ITZA 4XCUA 2WZJA 3PJ1A 3P7CA 5B2MA 3S1HA 4EOKA 3BU6A 3Q96A 1BX6A 2YDIA 5E8ZA 3AT3A 1M2RA 4G3GA 3FLYA 5AP6A 1OBGA 4E6QA 3UZPA 4C2VA 5JKGA 3A62A 2I0YA 3PFQA 4I1ZA 4X3FC 3ZZWA 4Y46A 3QRIA 3BU3A 4DHIB 4R78A 4N70A 1NA7A 1LEZA 4GYGA 5AIKA 5IEXA 1H08A 4GIIA 4XEYA 3VNTA 3TJDA 3UVPA 1YRPA 3HV6A 3FZRA 4RIXA 1ZMUA 3Q9XA 2C5NA 5AJQA 4EK5A 3IGOA 4G3FA 2WEVA 3QGWA 4YGAA 2P33A 1PW2A 3ATTA 1ZYCA 2UZDA 3C0IA 4O22A 3HZTA 3TJCA 4ASXA 5CI7A 4CRLA 4D2TA 4KINA 3M1SA 2OFVA 2XNEA 3R73A 4O1PA 4N0SA 4QP4A 3H0YA 3RI1A 4JBQA 4RWLA 3DZOA 3HMOA 5EHLA 1RJBA 2ZMCA 3KF4A 5A4LA 1J7IA 1YWNA 4DITA 4DTAA 3FWQA 3H9FA 4D2VA 4QMXA 3K5VA 4ASEA 4DHZA 4P90A 4HVGA 2YCQA 4AE6A 1WVXA 4DEGA 1Z9XA 1OPLA 5C4KA 3HLLA 2X39A 4AF3A 2JKMA 4UYNA 3EYHA 5AR4A 3QLGA 3ZO1A 4EHGA 4M12A 1M17A 2ERKA 4KRDA 3MFUA 4IWDA 3EYGA 5IMXA 3R71A 3BGZA 5IA4A 2QKRA 4I3ZA 3D15A 5IQIA 2BRNA 1OITA 4CNHA 1R39A 4YO4A 1Z5MA 4L3JA 3R8VA 3L9PA 5HU3A 4JR7A 2EU9A 3VQHA 3D0EA 5FRIA 3ZRMA 1QPEA 3ZLXA 3MPAA 2CKQA 1LP4A 1HCLA 1J1CA 3A8WA 3MH0A 4J98A 2QOHA 5L6WL 3MB6A 4IB5A 4PRJA 1JLUE 5FXSA 1M7QA 3UVRA 4L45A 4MXCA 5E9EA 4QTAA 3OVVA 4FKIA 2OZAA 4P5ZA 3Q9ZA 3QQKA 4AA5A 1XBBA 2XNBA 4TRLA 5DG5A 2RFDA 4P4CA 1SNXA 5AWMA 2X6EA 4RJ5A 1PY5A 1G8AA 3EHAA 4FSNA 3WF7A 2FA2A 2YDKA 3UDBA 1PXOA 1ZY5A 3HMPA 3AD6A 3FXWA 4CCUA 2C1BA 2OLCA 2W1ZA 1ST0A 3PVUA 3AG9A 2VWUA 3E7OA 5K3YA 5IA5A 4RC4A 3UC4A 1W82A 4AAAA 1UU7A 3QKLA 5FM2A 4GKHA 3VBXA 2QOIA 2J5FA 2XNPA 2O8YA 2IEWA 3KXGA 4JBOA 3VUDA 2I6LA 3NDMA 1CTPE 4IAIA 4MHAA 4L46A 3R6XA 2W17A 2B0QA 1GY3A 3GCPA 4UMQA 4HVDA 1JPAA 3LCOA 3W2CA 2J0IA 4FV0A 5CSHA 3FKLA 4XV3A 4F4PA 4X7QA 4Y83A 1Q8UA 2C3IB 5HORA 3TM0A 4PL5A 1QPDA 5JZNA 1OIRA 4IX4A 5HE3A 2PPQA 5FP6A 4F7SA 2YWPA 5L2TA 2WIPA 5H8BA 3W32A 3ZLYA 4ZTMA 3KC3A 2QR7A 3D7ZA 3VS4A 3RZBA 5ANKA 2WOTA 3SOAA 3QXPA 4YP8A 5AV4A 3O8TA 4ZSAA 4RA4A 5EM5A 5A6NA 3P79A 3O96A 4AXAA 3DQWA 2B9JA 2XRUA 4F08A 5A9UA 3CY3A 4WSQA 3CPCA 5ANDA 5HBHA 3FI8A 4EH4A 3PJCA 4GJ2A 4AW1A 1KV1A 4DLIA 4AOTA 2ESMA 4GYIA 4CVAA 4X2GA 2OH4A 1Y8YA 1WZYA 3TNIA 3DKCA 2EB2A 2NP8A 4GT4A 5HE0A 2R3QA 2WAJA 2W1GA 4TPTA 3SRVA 3QZIA 3CCNA 5I9ZA 5H9BA 4IB3A 4Z7HA 3NW7A 3Q04A 3GVUA 1W98A 4IMYA 3SW4A 2VTOA 5IUHA 5AUZA 2VGOA 4BVUA 3AKLA 4I4FA 4WA9A 4CFXA 3PRFA 3QTUA 4L3LA 2IVUA 2CLQA 4ZP5A 4JG6A 3VBQA 4BC6A 3EL7A 3ZM9A 5HVYA 1GZOA 1S9IA 2AC5A 3QKKA 1SYKA 1OKVA 2GNLA 3L9MA 3MS9A 4U41A 3AD4A 2WTKB 4PPCA 5EM8A 4LV7A 3LLTA 4EH5A 5KCVA 2PE0A 3UVQA 3W8QA 3QD3A 2BRMA 4FV6A 4EK8A 3P86A 1H24A 5KE0A 5BMSA 2XYNA 2WD1A 2IVVA 4IDTA 2OK1A 3LM5A 4IW0A 3GQIA 4PDYA 1XO2B 2JDTA 3FLNC 3OOGA 4ALVA 4FSWA 5KMMA 3C5UA 2O2UA 3P4KA 3QFVA 2RKUA 1OM1A 2XK4A 3O8UA 4V0GA 2X4ZA 4ZEGA 4QTEA 2ONLC 3QCXA 3P7AA 1GOLA 2B52A 3VULA 4KSQA 3UP7A 3ORPA 4MBLA 3V5WA 3OW4A 3QQJA 4PMTA 2BAQA 2JITA 1H25A 4UN0C 2XNOA 3BV2A 3COIA 3O71A 3U4UA 2OXXA 3POZA 4HVIA 4O4BB 4DEDA 1Y8GA 4QMPA 3IKAA 4R5SA 3PVWA 2O65A 4I6QA 3RNYA 3U9CA 5IQHA 1DS5A 2FSOX 4YJPA 2BDWA 3HRFA 2C3LA 3Q6UA 2YM4A 3N51A 3PE1A 1FVTA 3QU0A 2QHNA 3LMHA 3RALA 1O6LA 3PPKA 1H1QA 2J51A 2YFXA 3PRIA 4FNYA 4LGHA 4Y8DA 3JR1A 5IQGA 4YJQA 3T9IA 4LMNA 1A9UA 3NR9A 3QGYA 4E6DA 4EUTA 4DGGA 5DR2A 4MD9E 4BKYA 4DC2A 2BCJA 4R5YA 4I0RA 3U87A 4QYFA 5BUJA 4FMQA 4RBLA 3FBVA 4PNIA 2IW8A 2RL5A 2UZWE 2WMSA 5DI1A 3UOLA 4KBKA 3PIYA 2GNGA 3IOKA 4CMTA 3SG8A 3WOWA 4CXAA 3CTQA 3TYKA 3VO3A 3MIAA 3PJ2A 3ANRA 3LCSA 3TZMA 5KMOA 4YJOA 3HAMA 4JOAA 1HOWA 2XKCA 4ERKA 3EN4A 1P2AA 2YIRA 4IZAA 3KVXA 4NJ3A 5JQ8A 2UVXA 3JUHA 4MD7E 4WRGA 5BYYA 4F7NA 3VBYA 1G8SA 4DDIA 3CGOA 4I5PA 4JLCA 4D2PA 1PXKA 3NFFB 2WTWA 3KULB 2UW9A 3QTIA 4O0TA 5AX9A 3CP9A 4TW9A 1H4LA 3GU4A 4ZTQA 2ERZE 2WGJA 5ANEA 1QMZA 4EL9A 4RJ8A 3MWUA 4GK4A 3VAPA 4TWOA 2WTVA 2VWIA 5CXHA 4D28A 5HG5A 1YWVA 3KGAA 4Z9LA 2BRHA 2YZAA 2BHHA 3OTVA 4YR8A 5CEOA 4XBUA 1H0WA 4BN1A 4C0TA 2NYAA 4F65A 4LOQA 3UBDA 3UQGA 4J52A 3UG1A 2W06A 4G34A 1YXUA 2E2BA 4IANA 4JXFA 4JBVA 2GS6A 3BLQA 2UV2A 1VYZA 1UWHA 2B7AA 2WELA 4OT5A 3R1SA 4WNMA 3LAUA 2PZ5A 1Q3WA 3ZSHA 4FGBA 2C6TA 3KMUA 4FF8A 4U43A 2XIRA 3QHWA 4YZMA 5D12A 3RPVA 4A4OA 4DFZE 1R0PA 2GQRA 1PXLA 4CQGA 3MPMA 3R1NA 3R00A 4YZNA 4FTIA 3R0TA 2C30A 4FV3A 3OZ6A 3F7ZA 3QUPA 3R8UA 3NRMA 4F0FA 5H8EA 4FTTA 4R8QA 5HU9A 3SW7A 3HYHA 3TG1A 4M84A 4CKRA 3P9JA 4Y72A 4C7TA 4I20A 3EFKA 4HNFA 4XG7A 5CT0A 5AUUA 4L42A 3S2PA 5EYMA 3UNZA 3HMIA 4O38A 4R3CA 5KZ0A 5HO6A 4LGDA 3CGFA 3LFBA 3R2BA 3VJNA 4NT4A 4IWPA 3RGFA 5B7VA 4GMYA 5BV3A 3MH3A 4J53A 4CG9A 4ZZNA 3R30A 1ZYJA 3PA3A 4QMTA 3A7HA 3OEFX 4D55A 5LXMA 5IQDA 3L8VA 2YLEA 2QI8A 3A8XA 3R2YA 4HZSA 1MRVA 4O86A 4NW6A 3ZC6A 4D9TA 1CMKE 3D7TB 4EOSA 2ZOQA 3GQLA 3ZCLA 1ZRZA 2HAKA 5HD4A 1UNLA 4BYIA 3U54A 4AT4A 2GNJA 2JEDA 5FTOA 4IADA 3QX4A 2XKDA 4TN6A 2QCSA 5KBRA 1F0QA 3QKMA 1NY3A 2ITNA 2R3KA 4QOXA 3SOCA 3QC4A 4C38A 2ITTA 4IDVA 5IPJA 1YXVA 3WBLA 5KMKA 4IB1A 5CEIA 3EZVA 3GI3A 5EW3A 1W0XC 4BCPA 4FSRA 3O7LD 3FXZA 5HGIA 3MFSA 2W7XA 4DCAA 5EDPA 1GZKA 5E8VA 4OT6A 2PZYA 3BL9A 3RZFA 1OUKA 4JS8A 4W4WA 2FGIA 3ZDUA 4TT7A 4BDCA 4HW7A 5IEVA 4FZFB 2OKRA 4BKJA 2H9VA 2JBPA 1U59A 4S30A 3ZDIA 4G5JA 3D5WA 4FSTA 4LI5A 1PRYA 4IVDA 3VF9A 1IR3A 4XRLA 4BCHA 4U97A 4HYSA 2PVJA 1WBTA 4ALWA 1GIIA 2XEZA 2O63A 1ERKA 4ERWA 5CYIA 5KMNA 3EOCA 4BDIA 3G6HA 4FBXA 2OJIA 3KIOC 4CKJA 4BI1A 4FX3A 3WI6A 1Q3DA 2OSCA 4EQCA 4O2ZA 3GFWA 2OBJA 3IW6A 4O91A 4ZAUA 3RPSA 1FINA 4U8ZA 4AQCA 3ALNA 4FIEA 1QL6A 2BAKA 4HGLA 4KWPA 4U7ZA 5HKMA 4M13A 4HNIA 4LG4A 2ZFYA 3TNWA 1H01A 2B53A 1XMLA 1JKLA 2HYYA 4EHVA 4BHNA 4D5KA 2WTKC 3FHRA 1XH8A 3C13A 4ZMEA 3TEIA 2JLDA 5CEPA 4FG7A 5EH0A 3NUUA 1SM2A 4ZZMA 5C01A 4XV1A 5EG3A 3C4FA 3UZTA 5LWNA 3T3UA 2RG5A 2XIKA 5EKOA 3V8WA 5BNJA 4RIYB 4H58A 3NUXA 3ZO3A 4CKIA 2W9ZB 4ANNA 3F3UA 4XV9A 3IONA 2PHKA 5GJFA 1W84A 4RT7A 3PLAE 3Q4CA 4CD0A 4QO9A 2C6DA 3MVMA 4JBPA 5HICA 3C4ZA 3C9WA 4WT6A 4ZK5A 3DBDA 4F6UA 3SD0A 2H96A 4FE2A 1KE5A 4ANOA 1YHSA 3UGCA 4YUQA 3F3TA 2WMBA 2HW7A 2XB7A 4OAUC 4GVAA 4LYNA 4FEVA 2OZOA 3GBZA 3VHEA 4WUAA 4DEHA 3W18A 3E8EA 3H4JA 4KBAA 4TWPA 4D1ZA 4O4FA 4DA5A 2C0OA 1PHKA 4HCUA 3CQWA 3NIZA 4MWIA 4OTWA 4WG3A 5DLSA 4EZ5A 5KHWA 4RFZA 4O7SA 3TV6A 3GCVA 5K4IA 3MW1A 4UMTA 5EDQA 2UZBA 4UBAA 4I24A 4JIKA 3SV0A 4KIKB 4D1XA 3VUGA 3OCTA 2VTIA 4G3CA 4DG0E 2JIUA 4DAWA 3WF6A 4JQ7A 3DU8A 4DH1A 2W1FA 4FVRA 5HCZA 4S31A 5CNNA 2A0CX 4L01A 4J96A 3NX8A 4YZBA 4EORA 3PXQA 2CKEA 2VTPA 2R3MA 3MFTA 1SNUA 3BX5A 2GNHA 5LJJA 2VTNA 3JVRA 3HAVA 4RZWA 1YDRE 1J3HA 1I44A 3F3WA 1OGYA 4GFMA 2W05A 3HUBA 5DIAA 3GCSA 3PVGA 5J8IA 1OPKA 5AR8A 4EQUA 1GZNA 2R5TA 4MKCA 1ATPE 4IB0A 5M53A 4BR3A 5DT0A 4OR5A 2HCKA 5AR7A 4I5HA 5AUXA 5IQCA 3H10A 4TWNA 3T9TA 1XMMA 4D9UA 3IW7A 3VS6A 5F9EA 4IAKA 4EOIA 4ZTLA 1XBAA 4U81A 5FQDC 3NUAA 3FHIA 2VTLA 5BVKA 3FMJA 4D0XA 5CVHA 3R8PA 4H36A 2FVDA 5CAVA 2VX0A 4K77A 5EM7A 2HZIA 2CJMA 2JBOA 4F78A 3HP5A 2CGXA 5KMLA 3EQFA 1WVYA 3ZU7A 5CAPA 2WMRA 4R1VA 1FGKA 4L9IA 4MAOA 4FKQA 4CQEA 4E8AA 2IG7A 2UUEA 3EN9A 4CFMA 4OTFA 3UO4A 2XAOA 4MXAA 4OTRA 3ZC5A 1ZMWA 2VTHA 2NRYA 3W2QA 3ZLWA 3DK7A 4CV9A 1OL7A 4BRXA 3II5A 4C3RA 2YCSA 4O7ZA 3PTGA 1JQHA 2Z7LA 4FNWA 4U3YA 3EQRA 2UW3A 3OF0A 4GEOA 3TDWA 4AA4A 4ANBA 5K9IA 3FV8A 4MUQA 3R9DA 4EOOA 1MQBA 4A06A 4IHPA 4F7JA 5IISA 4GS6A 4KKEA 3BV3A 4C2WA 3E64A 3OFMA 5CU6A 5H3QA 4B6LA 4ENYA 5A54A 5KUPA 4J95A 2PY3A 3QTSA 3BL7A 4GG5A 3O0GA 3I60A 4FKOA 3KN5A 3EKNA 3COMA 3NNVA 3RVGA 5LQFA 3AC8A 3HMMA 1WVWA 3ORZA 3KRXA 4MBIA 4M3QA 5EM6A 4E73A 2ZV9A 4AXCA 3ODZX 4EQMA 4EKLA 4YSJA 4OTDA 3L1SA 3VS7A 3AC3A 3CIKA 3I5NA 2FSMX 4BDEA 3F7WA 3W0OA 3HV5A 5E8YA 5KHXA 4PMPA 3U6JA 1XH5A 2W5HA 3LXKA 4IAFA 4E93A 4HVSA 5A3XA 4DH7A 5HESA 3LQ8A 3BKBA 5DFPA 1PXIA 1Q8WA 4C34A 3T8OA 5CU0A 4YZCA 3BCEA 3VIDA 4BCJA 2X8IA 4YC6A 4C4GA 2DUVA 1OUYA 3C7QA 1MQ4A 3IPHA 4G3DA 1SVHA 3ZZEA 3DY7A 4IJ9A 4CEGA 3C4CA 3LHJA 3PZEA 3TZ9A 4IH8A 4AFJA 4O83A 2OJ9A 3KXMA 3C50A 1R1WA 3IGGA 5IF1A 3NLBA 3A7JA 5HEZA 3BGQA 3SQQA 4NM7A 4IACA 3COHA 3JVSA 3V01A 4AX8A 4BBFA 3O23A 1Q4LA 5AM7A 2PUPA 4GW8A 5CF5A 3QL8A 1JAMA 5AUWA 2PULA 4FT0A 3RWPA 2CKPA 4IM3A 1U54B 5F94A 5FDPA 2WQMA 1YHVA 1CSNA 2BFXA 3ALOA 3GP0A 3OROA 3QTZA 2IW6A 2FYSA 4FTKA 4XP3A 5C26A 3HECA 3Q9YA 5LMKC 3AC2A 5E4HA 4KSPA 1TFFA 4AAYA 3F9NA 5HNGA 4CYIA 2O64A 3UC3A 2ACXA 2R3FA 3KCKA 1UNGA 2VNWA 5A4TA 4QP6A 3UOJA 1GAGA 3R9NA 2OJJA 3W2SA 2PSQA 4BKZA 3PG3A 4HPTE 3H9OA 3MH1A 3P0MA 2EB3A 4GJ3A 1QPJA 4EKKA 3G9LX 4K18A 2YERA 4IZ7A 1B6CB 4KKGA 3DOGA 4QMZA 2DYLA 1JKTA 3ORNA 4CCBA 4TYGA 3EMGA 4R3PA 4YNEA 3V5TA 3LFDA 4QQTA 2GNIA 2XF0A 4RJ7A 5AX3A 3NAYA 2YM7A 2XJ0A 4GK2A 4F9AA 4Z3VA 3KXHA 4NH1A 3R7OA 3C5IA 4FC0A 2VWBA 1O6YA 3W33A 3HGKA 4X6RA 3F82A 2VX1A 3FLQA 2YIYA 3EFWA 4I0SA 4IC8A 2E9NA 4O2PA 3MB7A 1TVOA 3B2TA 1M2PA 5CEQA 4OTQA 4JDJA 4CRSA 4O7RA 3UDSA 2X0GA 2JIVA 1PMEA 3A99A 2QU5A 3E8DA 4W9XA 4NIFB 2CKOA 3QQUA 5BVOA 4CTCA 5BPYA 4M66A 4PTGA 5ANJA 1OMWA 1MP8A 1Q62A 1TZDA 2EXCX 3AMYA 3FLWA 5DA3A 5HVJA 4FT3A 4C58A 3FMEA 5JT2A 1WFCA 4NTSA 4E5AX 2IWIA 4O96A 4P2KA 2P2HA 4ANSA 3UPZA 4F99A 3LCTA 3TKIA 4YJUA 5GIPE 3QQHA 4BGQA 3W0QA 2VO3A 3TCPA 4O7VA 3TI1A 5F1ZA 4J97A 1YXTA 4YTIA 4AN3A 4O7YA 4IVCA 4K11A 4QMYA 3VS1A 4R3RA 3V5QA 3CD3A 1Q97A 2VTTA 3OHTA 3LCDA 4FSMA 4AZWA 4NU1A 4FKGA 3IOPA 3OS3A 3UJGA 3VBVA 4BCQA 3RM7A 1Q5KA 5BVNA 5I9UA 3MVLA 2KTYA 1QCFA 4IWOA 4JDKA 4K8AA 5ETFA 3V51A 2P2IA 4E1ZA 2X8EA 1BYGA 1TKIA 2OFUA 3MV5A 4FZ7A 2GPHA 4MWHA 4LMUA 4XV2A 4EONA 3IDPA 4FR4A 2BZHB 4BTKA 2PVLA 3QCSA 5LVLA 3ORKA 3P7BA 4IFCA 5LCKA 2I0VA 2R7BA 5DWRA 2W96B 3FMKA 5LVNA 3B8RA 4LV8A 5HZNA 3OC1A 2BTRA 3QWJA 4UWBA 3ZSIA 3AGMA 4FTOA 4IC7A 1R3CA 1GIHA 3KXNA 5HCXA 3MDYA 3Q5ZA 3UIBA 4FTQA 4D1SA 5C8KA 2OIBA 4FT9A 4ID7A 3W2PA 1MRYA 2QLQA 4NUSA 4WHZA 1B39A 2BFYA 4EH6A 3C0HA 2XJ1A 3KXZA 3TV4A 4BCNA 3KRWA 4A9YA 4ONAA 5FBOA 3Q2JA 2UZLA 1CKPA 3TV7A 4LRMA 1XQZA 2VWWA 4MXOA 5M4FA 5DRDA 4ORKA 4GU9A 4DT9A 2C6MA 3G90X 4EOPA 3WE8A 4YTFA 4QTBA 4OAVB 3TZ7A 2R3GA 4QMNA 5HD7A 3AC4A 4DH5A 3HDMA 5ICPA 2GFCA 4PV0A 2I0HA 4BCIA 3FY2A 3I1AA 4KNBA 3LM0A 4DFLA 5C8NA 5L8LA 2GS2A 2PUIA 2B1PA 2IO6A 3Q5IA 5JRQA 3DXQA 4KUJA 4I93A 3LQ5A 3UO6A 4RQVA 2ITPA 1H07A 4O27B 3ZOSA 2CHLA 4XP2A 2ZMDA 3VBWA 1OKWA 2BROA 2C6EA 4FTLA 2BIYA 3DZQA 4AZSA 3QRKA 3HRBA 2JC6A 4PUZA 4WOVA 4R77A 3COKA 3TN8A 4DE4A 1IG1A 4AOJA 2JKKA 3KU2A 4X3FA 4A4XA 4I21A 2EUFB 4GUEA 2OWBA 2OXDA 5E8UA 4QNAA 2W99B 4E26A 1TQIA 4FIIA 3RWQA 3RBWA 3TACA 4ZJJA 3O2MA 3S4QA 5L8JA 3F5UA 2EXMA 4MXXA 1WBOA 4RX7A 4IIRA 4U42A 2UZTA 5ETCA 3RNIA 4DDGA 3SKCA 2ITQA 3LXLA 2JAMA 3NAXA 4QPMA 5H2UA 4M7IA 4IM0A 4DH3A 2GS7A 2E9UA 4DF3A 2VO0A 1DI8A 2VWVA 5AV0A 4F9YA 5J7HA 4BJJA 3Q4UA 4PDSA 3D83A 1WCCA 4TNBA 3NUNA 1WMKA 3R8LA 3CTHA 3MPTA 5CX9A 3RM6A 5IA1A 1OECA 2WQOA 3D2IA 5EKNA 4B4LA 3DKOA 3ROCA 4FKWA 4QP3A 4C61A 4RWKA 3DJ5A 5L4QA 1PXPA 2X9EA 1PMVA 5EW8A 3IS5A 4PL4A 3OOMA 4O4DA 2G2IA 2HXLA 4M68A 1K9AA 2Y4IB 3HV7A 2J4ZA 3RPYA 2Q0BA 4AT5A 4NZWB 5DEYA 4OTPA 4GSBA 3DDPA 4AOIA 2P3GX 2YCFA 1IEPA 3MYGA 4FVPA 2GHGA 2YJSA 5EI2A 4E4LA 4TXCA 4L43A 5IMEA 4F9CA 5IQAA 5F4NA 5FWKK 2DS1A 5AP0A 2VWYA 1UKIA 2XRWA 3ET7A 3BI6A 3FPMA 1REKA 4J8MA 5HO8A 5TT7A 4BTFA 5AR5A 1BMKA 3C4XA 4ITIA 4DYMA 4EK4A 1ZZLA 4FL2A 3AKJA 2JFMA 4YLKA 1YQJA 3GXLA 1Q99A 4BTMA 2IW9A 3QQFA 3TTJA 3QA8A 1A48A 3IO7A 4ACDA 3W0PA 4DFBA 3WF8A 3HKOA 3OWPA 2J0LA 4TTHB 4F1OA 1L3RE 3OT8A 4OTHA 3SC1A 2QOBA 1HCKA 5FD2A 5ANIA 4RFMA 4JT3A 3QLFA 3WZUA 5L2WA 4C4HA 2R7IA 5E8XA 1WBWA 2C6LA 3KKVA 4OLIA 2VN9A 5LOHA 5CY3A 2VGPA 3DLZA 4AXFA 2OF2A 5HG8A 4N6YA 4V0GB 3DK3A 3OXIA 4G6NA 2GHLA 3Q6WA 5BVDA 5F20A 5TKDA 2UZOA 2GQSA 5A6OA 2NNWB 1H1RA 3RINA 3ORXA 3Q3BA 3AQVA 2HZ0A 4BCMA 3NNWA 3SA0A 3M42A 4WBOA 1UU8A 2F7EE 2YJRA 3LJ0A 3F5GA 4FKLA 2J0KA 4XG4A 2JD5A 1JSTA 4M15A 3PY1A 1XHAA 4XJ0A 4FV2A 4AW5A 3FQEA 5GJGA 3VUHA 4O82A 2WNTA 1YDTE 4YBKA 1ZY4A 2A98A 2QONA 3TWJA 3PZHA 4I6LA 5FUTA 3DV3A 1PJKA 4BZOA 2J0JA 2VTAA 5D1JA 4ZTRA 2VNYA 4E4MA 5CF4A 2Y9QA 4FSZA 3AC5A 3QRTA 4V04A 2ZVAA 5AP3A 5HLWA 2XARA 3PG1A 4HGTA 4NFMA 3QA0A 4DINA 2WTDA 4ZTSA 5GJDA 4AZFA 2G2HA 4YPSA 4H39A 5B0XA 1DM2A 3UE4A 4E6CA 1Y91A 2YISA 2OJFE 4FYNA 3TIYA 4CLJA 4EOJA 3IG7A 1EH4A 1OIYA 2P55A 3UYSA 1SMHA 3F66A 2O3PA 2PK9A 5KZIA 2J7TA 5L2SA 1AD5A 3MSSA 2HXQA 4MNEB 4O4CA 5HBJA 4J8NA 4A9RA 4NM5A 2XK9A 3PFYA 4CFFA 2EWAA 1LEWA 2W1CA 4G31A 1G8KA 1ND4A 1STCE 2VWZA 3VN9A 4ASZA 3P78A 4ZS4A 3LVPA 2WMWA 1PXNA 4QMUA 2AEGA 2C1AA 5EOLA 2HY0A 4DEIA 4FIFA 1T46A 4CFNA 3L9NA 3QTQA 4X2JA 5EYCA 4TY1A 4GL9A 4TYHA 3O8PA 1BUHA 1OZ1A 2VTRA 4KA3A 3KREA 1L8TA 4USDA 5L6PA 1CKIA 3U4WA 4ZJIA 1OPJA 3AXWA 1UNHA 3QXOA 4Y5QA 3W10A 4C37A 4YPDA 3BE2A 1PXJA 2WOUA 3PP1A 5AUVA 2DWBA 2Y7JA 3LCKA 2VTSA 4Q5HA 4G5PA 2XIYA 3GU5A 2J5EA 5EW9A 4LUEA 3ZFMA 4FTMA 4X3JA 3D5VA 1REJA 5DHJA 5TE0A 3OG7A 2LGCA 5CU2A 5AAFA 3BWFA 4ASDA 4S34A 4QYGA 3G0FA 3LFAA 4HPUE 5EI6A 4F6WA 1YOJA 3FEGA 3OCSA 3ORIA 2QO2A 3GC9A 2PMIA 4ITHA 3W16A 3ORTA 5IQEA 3BYOA 1UWJA 3JPVA 3HNGA 3R1QA 4ZXTA 2OXYA 1H0VA 3LFEA 4FK6A 1CKJA 4YLLA 4EJ7A 4KB8A 5KBQA 4NKSA 3W0MA 4E7WA 1Q41A 4JX3A 1J91A 3U6HA 3ORMA 3DB6A 4XS2A 5AEPA 3NUSA 2ITWA 4FUXA 2YACA 4W8EA 4EWHA 1ZARA 4XG9A 4BCOA 4ANQA 4OBPA 3SHEA 2ZM3A 1GZ8A 3UDZA 2YIWA 4E5BA 3MY5A 2B55A 4DFUA 3QC9A 3LPBA 4GRBA 2JDOA 3RPOA 2XBAA 3LW0A 4M8TA 4JX7A 5FGKA 3A7IA 4FG9A 4LL0A 1JNKA 4LGGA 4UZDA 5AADA 3CKXA 3GNIB 3E3BX 5CSVA 3F5PA 5IG1A 4R7IA 3E87A 4AFEA 3CLYA 2QODA 3LXPA 4RA5A 1YI6A 3DAEA 3AT4A 4JI9A 5HOAA 5TF9A 2CGVA 3F6XA 5A4EA 3NYNA 5KMJA 2Y6MA 5HLNA 5J1VA 5FG8A 3HEGA 3M2WA 4BB4A 2XM9A 4YTHA 4A9SA 3W0RA 2X2KA 4BDFA 1W8CA 1KE9A 2BUJA 3ENMA 4IX3A 4TZRA 2XK6A 2Z2WA 2Z7SA 4QMOA 3EJ1A 4Y85A 3WIKA 4R1YA 3FXXA 3P1AA 4F9BA 1GJOA 4Q9SA 4BGGA 5AA8A 2PZRA 4TYJA