3ZSIA

X-ray structure of p38alpha bound to vx-745
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
347
structure length
326
Chain Sequence
PTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLTRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MITOGEN-ACTIVATED PROTEIN KINASE 14
publication title X-ray structure of p38 alpha bound to TAK-715: comparison with three classic inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 106
structure length 326
sequence length 347
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2011-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3zsiA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3zsiA01
2J5FA 3ORMA 3CD3A 3RPYA 5FM2A 2XF0A 4G6OA 3F3TA 4D58A 2IZUA 3ZBXA 4D2VA 3HLLA 4IX4A 4C4GA 4CT2A 3BBTB 3WIGA 2B7AA 2G2FA 3EL8A 3WZUA 5A4EA 4W9XA 4M0YA 3H4JA 4RFZA 3VHEA 4IW0A 3UIUA 4UB7A 3TACA 5JT2A 1GZKA 3AD4A 3A2CA 4PP9A 3S2PA 1VJYA 2C5NA 5D7AA 5HIBA 5C8MA 2OF2A 2PUUA 3UOJA 3T9TA 3RM6A 4YZNA 4ZOGA 4FIFA 3TZMA 5HVJA 2GHMA 3UG2A 5AX9A 4GT3A 1HOWA 4BY9E 3NVKI 4NTTA 1GZ8A 4BF2A 5CWZA 4LUDA 4O0XA 2HWOA 3SOAA 3E88A 4D0XA 4LRMA 4MX9A 2QVSE 3FXZA 4C4JA 3LKMA 5FTGA 1ZZLA 4FNYA 4WSYA 2BIKB 1PRYA 5JGAA 3GNIB 3TUCA 4ZY4A 2E9UA 4RJ8A 4U44A 3I5NA 4G2FA 4W8DA 3VQUA 4JG8A 5T68A 4DEGA 3HMIA 4AZSA 3EQCA 3PG3A 3QTQA 5IQGA 3BGPA 2YHVA 4FZDB 4JDHA 5FDXA 3AMYA 2QR8A 4PTCA 2RFEA 2BALA 3KB7A 3QUPA 4BCFA 4GKIA 2C3IB 3LLTA 2YAAA 1WMKA 3BPRA 4K0YA 4LMNA 4DT9A 3FYJX 4GFOA 4CZYB 4GUBA 3UOKA 4I6QA 1QPCA 2PE0A 4GW8A 3CTJA 4N6YA 4M97A 4L52A 4APPA 4F65A 4IZYA 4RFMA 4S34A 2CDZA 3D83A 3FLWA 5AMNA 3SW7A 4N4SA 4ZSAA 3F7ZA 4RQVA 5KHXA 1CM8A 5HCXA 1W98A 4ASZA 5FXSA 3ZO2A 2H34A 5IEVA 2OXXA 1JOWB 1RW8A 3EN6A 3P79A 5CTPA 4QTEA 2PVFA 5D1JA 1T46A 5ANGA 4JR7A 1IR3A 4RA4A 3W2RA 3DNEA 3EQGA 4QP2A 4YZ9A 1OL2A 3AC2A 3FDNA 2XUUA 4FV0A 4I5HA 4ZZOA 1GOLA 3DY7A 3DAJA 4K9YA 4YJUA 4IWDA 1V1KA 3IW4A 3P78A 4C2WA 4LOQA 4L3JA 2XK3A 2R5TA 1PKDA 4QMLA 4DLIA 2C3KA 2W4OA 4FKLA 5FQDC 3MY1A 3BYOA 3PPJA 4GIIA 5LVNA 3I6UA 5IQHA 3S95A 4WG3A 2OLCA 1ZMVA 2A27A 4F64A 1KE7A 4YJNA 5CANA 1YDSE 2GCDA 2J90A 3MIYA 4M67A 4EOPA 5HIEA 1H1WA 1OPJA 2XK7A 3EMGA 3QBNA 4ZSJA 4EH7A 3QWKA 4CTBA 3QZIA 2VTIA 4IX5A 4RX8A 4YLLA 4EL9A 3UC3A 3BQRA 4QYGA 4CFNA 4D2WA 3IOKA 2OI4X 4L45A 4AN3A 3R7VA 2EVAA 2QONA 3LQ3A 4O7NA 1H1PA 1M2PA 4RZWA 3KULB 2YM7A 4FTOA 5EH0A 4B6LA 3T9IA 2ONLA 3QKKA 2WAJA 2VTTA 1G8AA 2O63A 3BGQA 4H3PA 4JG7A 3LFFA 4KBKA 1SM2A 5TOZA 1JNKA 2BRNA 3SV0A 4JRVA 4QYHA 5IH4A 3FL5A 3G2FA 2JIVA 4DEBA 4ASXA 4F9WA 3Q4ZA 2XBJA 4K1BA 3PXZA 1SNUA 3ZC6A 4RWJA 5L2TA 4NYEA 3RALA 5M08A 3L1SA 3D9VA 1OPKA 3LCTA 4FKJA 3R22A 4XG8A 3WE4A 3QUEA 4C38A 4NTSA 3KMMA 2CLQA 3SD0A 5L2IA 4FSUA 2UZOA 2QOFA 3FKNA 4DH7A 2WD1A 4FOCA 4N57A 2I40A 2JC6A 1LUFA 2ZV8A 1L3RE 3N9XA 4B0GA 5CEPA 2P4IA 4EOOA 4FSNA 3VS2A 4IAYA 2YERA 3ZSHA 5JMSA 2W4KA 5GIOE 3R1SA 3BU3A 5I9UA 5GZAA 2UV2A 4ZP5A 3FPQA 4BN1A 4O0TA 2C6IA 4RWIA 3LW0A 4B9DA 2YFXA 4HGLA 3AC3A 2BZKB 2Z8CA 1UNGA 1UNHA 1PJKA 4GFMA 3C5IA 1YHSA 5DEYA 2Y6MA 2YACA 5E4HA 3PA3A 3QA8A 2ZAZA 4L3PA 4RJ5A 3LXNA 2RL5A 3ZUUA 3UZTA 2OIQA 3GCQA 3EH9A 2WQEA 4DCEA 5C27A 3ZO4A 4HPTE 4BCJA 3VUHA 4U42A 3LFDA 4IJ9A 4PPCA 3TNIA 2OZAB 5CAVA 1E1XA 2VTRA 4ANBA 3CJFA 3QZHA 2VX0A 4RIYA 3MW1A 5HTIA 4O7YA 3FZSA 4MQ2A 2NPQA 3DXQA 3PVWA 3Q4TA 3KA0A 4G3DA 3C0GA 5L8LA 2HZIA 4XG7A 3VBYA 2VTSA 2G2HA 2JKOA 2IWIA 2GNJA 4JR3A 3A7HA 5AAGA 1YWRA 3OCBA 4C36A 4E8AA 1YHWA 2R7BA 1PXLA 4ANNA 4D28A 2HYYA 4E6CA 3EYGA 4ALWA 3QTIA 2CJMA 3L9PA 3PJ2A 5AJQA 4CCBA 1OI9A 4OLIA 4BKYA 4ENXA 5CAUA 3M11A 4GT4A 4BVUA 2XK6A 4R7IA 3M42A 2ZDTA 3QZGA 1S9JA 2XK8A 1XWSA 4FGBA 3PWDA 2OU7A 4WUAA 2PUNA 4QPAA 1YOLA 4APCA 3BU6A 1FVTA 3ZRLA 3UOLA 2BDWA 3C4XA 4YHJA 5EYCA 2VWUA 3TTJA 4DN5A 4JIKA 4PQNA 4OTIA 2XKEA 5HTCA 3DTCA 3WYXA 3CD8A 3FI4A 5I4NA 1AQ1A 2WTVA 4GS6A 3R8MA 4DEAA 1LEWA 5BVEA 3R1NA 3ZUVA 4DF3A 3QTWA 3QX2A 1H8FA 3O8PA 4RC2A 3EB0A 2QOHA 3FC1X 4PPAA 5CYIA 3REPA 4E93A 3FE3A 3GCVA 4PTGA 4C02A 4CZUA 1FGKA 3ZUTA 5BYYA 2BVAA 2WHBA 2HY0A 5CSVA 4D1ZA 1ZMWA 3II5A 3ULIA 2XIXA 4BTFA 1FQ1B 4TYGA 1UWJA 3DDQA 3U9CA 5KZ0A 4EK4A 3MDYA 5DRDA 1REKA 5I9ZA 1MRUA 3ZFYA 3ZO3A 2QO2A 2QCSA 3P86A 3UZPA 4ZJIA 4BBFA 3PZHA 2ITYA 3BEGA 5HO8A 5AUTA 2I0EA 5HE0A 2XKDA 4FV8A 2WMVA 5IU2A 4O38A 2OIBA 1ZYDA 1QPDA 5HU9A 3QD0A 4F99A 2VV9A 1PW2A 5L2QA 4O84A 3G90X 4NSTA 3ATSA 5IG1A 3L8SA 5C1QB 4D1SA 4OAVB 3SG9A 1JSVA 3V5QA 1AGWA 5F20A 4YTCA 1H01A 4RLLA 4OTFA 4R6VA 1B38A 1CSNA 4DINA 1AD5A 2IVVA 3IW8A 4G16A 4F0IA 4H1MA 2YM5A 2YDIA 3E7VA 4RIWB 5BVNA 3VQHA 3DKOA 4ID7A 3DK6A 4QP8A 5E8YA 3OWKA 4DA5A 4X2NA 1ZYLA 4KKEA 3R04A 1BKXA 4TYHB 2OJJA 3F3VA 4K33A 1ZOEA 2XP2A 2HK5A 2ITUA 3WF6A 5CU2A 4HJOA 5CALA 2QURA 3WE8A 3BKBA 5BNJA 3CR0A 2XNNA 4EH6A 5EQEA 2OIDA 3E3PA 2WQBA 3NIEA 3LHJA 4FBXA 2I7QA 2VD5A 1OIQA 5E90A 4CYIA 5DE2A 5CEIA 2R9SA 2HCKA 4GV1A 4ZSEA 4HZSA 2X8IA 3LLAA 5M4IA 4AA0A 2JKMA 5AP3A 3C4EA 3ATTA 3WBLA 4XP3A 4TNBA 4UWCA 2QC6A 1NVQA 4FUYA 5JEBA 1QPJA 2C68A 4EOSA 1U54B 3UQCA 4EORA 3VW8A 5CQUA 1KV2A 4D4VA 3VUGA 5KKRC 5CSWA 4BCQA 2C1AA 2QHMA 2XA4A 3EQFA 4QP4A 5HE3A 4HPUE 2I0HA 3SXFA 3TV4A 5IQDA 3CPBA 5BVFA 4UZDA 4Y5QA 3U54A 3C4FA 1JKLA 3CTQA 3CS9A 3NUNA 3QC9A 4DEHA 2WOTA 5M4FA 4NM3A 3EYHA 5HNBA 4YJPA 5I3RA 2BRGA 2CGWA 3T3UA 3PDTA 5D12A 2XNGA 3AC1A 2WMSA 4FTQA 4FTKA 4ACDA 3LFNA 4G31A 5DPVA 5IQIA 3BE9A 3MB7A 1YXVA 4NKAA 4NZWB 2J0KA 5F9EA 1L8TA 2YZLA 2UW6A 3FSFA 5J5SA 3LCDA 2YZAA 3OWJA 2PZPA 4J71A 2OBJA 4KBAA 3W8LA 3KULA 4FC0A 2UZNA 4U8ZA 4M66A 3NUAA 1OKYA 3P7AA 4KBCA 4HVDA 2JBOA 3EQBA 4LV5A 2W1DA 3QYZA 3ZCLA 2HELA 5HCYA 3O2MA 2FSMX 3FZRA 4W9WA 4J8NA 3PLSA 5EI6A 3HRBA 4EOKA 4JQ8A 2ZMDA 3QTXA 1LR4A 4FV5A 4KS8A 4R3CA 4UWBA 4UYAA 1Y57A 3KREA 1YDTE 1OECA 4DGOA 3LJ2A 4E5BA 4EWQA 4C7TA 2O64A 4EH8A 4FEVA 1WBTA 2EUFB 1BUHA 3C1XA 2GNIA 1YWNA 3A4PA 3LFBA 3MI9A 3D7TA 3KN6A 4F7SA 4NM7A 4ZMEA 4ZZMA 4FIJA 3OWPA 1XBBA 4RX9A 1SVEA 4BKZA 4CSVA 4CKRA 2C6EA 4IWOA 2ZOQA 3POZA 2GU8A 4W4WA 4MQ1A 4YGAA 2IG7A 3AC4A 4I6FA 5I9WA 3MVHA 5HCZA 4CFMA 4FKTA 5DRBA 4MKCA 3R63A 4OT6A 1ZXEA 3HRFA 2XM9A 3TV6A 2JAMA 3UC4A 4F08A 3PUPA 1BYGA 1WBOA 2E2BA 2Z02A 4HZRA 5A4CA 3G9NA 2JGZA 5I9XA 2GTNA 3ITZA 2RFSA 3DK7A 3F82A 3KXGA 4I41A 2DWBA 4XLVA 5F1ZA 4E26A 3D2KA 1GY3A 3EN9A 3C4CA 4FK6A 5ETAA 3E62A 3QKMA 3UYSA 2BUJA 4BHNA 5EKNA 5CF6A 3HP5A 5D11A 1ZOHA 2OZAA 1VYWA 5CT0A 4C37A 1ZYSA 3NW7A 4UV0A 1H25A 3W2OA 3ZRMA 3VRZA 4KIPA 1CTPE 4KKHA 3DBDA 2CN5A 5AV2A 2WMXA 5C9CA 2BDJA 3BHTA 5HLPA 1H24A 1HCLA 5CS6A 5IA0A 3LPBA 4M69B 5E9EA 4WIHA 1Q97A 2R3MA 3I0QA 5CI6A 5AR4A 2C6LA 5J1VA 2B0QA 2O3PA 2C47A 1Q3DA 3R9RA 5KZIA 3EZRA 4AFJA 4FTJA 3QQUA 4EBVA 4RX5A 4NEUA 3TIZA 3PWYA 5FD2A 4O7LA 4DFZE 4KIOA 3OT3A 4FZ7A 2Y9QA 1KUTA 4MNFA 4AE9A 4FKSA 1F3MC 1OKWA 4G9RA 5TF9A 4X6RA 4YC8A 3DA6A 1P4FA 3HAMA 3E63A 3KY2A 4GK4A 1ZRZA 1OIUA 3FZOA 2VWWA 5HG9A 3LOKA 4PWNA 5IMEA 4AOJA 3N4VA 2JIUA 3F61A 4MD8E 2OO8X 4AZFA 1PF8A 5A6NA 5DMZA 1FMOE 4C34A 3UYTA 4EOIA 3FLZA 4U45A 5LWMA 1GNGA 3UNZA 2VX1A 3KXZA 3OY3A 2PL0A 4I23A 1O6LA 4KIQA 1UU8A 4C4EA 3G6GA 4IMYA 3A62A 3ORPA 4D1XA 4EKLA 4QYEA 4IB0A 1J91A 4MEDA 3ID6C 2XRUA 4O27B 4I5MA 4FODA 4BGQA 4QTAA 2YM8A 1YI3A 4JRNA 1K9AA 3DQXA 4BTJA 3GU8A 4JXFA 4RQKA 5CEOA 3QQJA 1QPEA 4FNXA 3S00A 2VWBA 5I5ZA 4FVQA 5M56A 1DAWA 2A2AA 5HX8A 3NMUF 3CQEA 4D5HA 2CKPA 3MH3A 4WOVA 2YN8A 2F9GA 3GCUA 2VO3A 3V5WA 4YSMA 1U59A 4P90A 3DKFA 4CLIA 1R0EA 5CU4A 3QCXA 5EI8A 3O96A 4YZCA 4TWCA 1ERKA 4KINA 4J7BA 5FGKA 5C8NA 3F5XA 4G1WA 3EQIA 4M7IA 4RVMA 2H8HA 5A9UA 2ITWA 1H4LA 2WMRA 3D15A 3KGAA 4PDSA 4PDPA 4S30A 4DH8A 4YURA 4ZTMA 4IAZA 3O8TA 5CSXA 5BQ0A 2QG7A 4RIWA 3C50A 4X3FB 2O8YA 3O71A 4YZMA 4CVAA 4E6AA 2GSFA 3HDNA 4ITHA 4RC4A 3CXWA 5KNJA 4JQ7A 5EOLA 5BX0A 4TYHA 4ZZNA 4ACMA 3FI3A 5LOHA 5J7BA 5EM8A 2C6DA 5FEQA 2UW4A 4JX3A 3OS3A 2XH5A 4DG2E 3KL8A 5CXHA 4GVJA 2WU6A 4BDGA 3DDPA 3KKVA 2R3KA 4JX7A 4FSRA 4WG5A 3GU4A 4C33A 4ZJVA 5HBJA 3QCYA 4EYJA 3H9OA 3RK7A 3C7QA 4BCKA 3RHKA 4UZHA 5HBEA 3B8RA 4KD1A 3CKXA 3T8OA 3DT1A 3KVWA 3OCSA 4IACA 1W83A 2BZJA 2OXDA 2VZ6A 4XUFA 5FBNC 5AV3A 2CMWA 2QLQA 2VO7A 3NYXA 4LOPA 1JAMA 4MBLA 1RJBA 5F4NA 5KBQA 3R1QA 4BI0A 3GVUA 2VTPA 4HVGA 1APME 1XH8A 5BPYA 3IGGA 3SG8A 3KF7A 3KXXA 2VTMA 1JVPP 4W4VA 4YHFA 4RJ4A 4JL9A 3R2BA 4RSSA 3CSVA 4C3RA 4ZLOA 2WTKB 4I0SA 2EWAA 2X9EA 5DT0A 3UO4A 4Y72A 4XV2A 2YA9A 5L8KA 1O9UA 2GQGA 3LJ1A 2C6OA 2R3IA 2ZV2A 2B4SB 4O7ZA 2GS7A 4IX6A 5BYLA 4FZFB 3UVPA 4E6QA 3UVQA 1M7NA 3A8XA 1UNLA 2PMOX 3OCGA 3NW6A 2J0IA 1OITA 4KABA 1OZ1A 4MAOA 4ZTLA 4MF0A 2WMTA 3CGFA 2CNVA 3PXKA 4L6QA 3NEWA 2GQSA 5AWMA 2ITXA 3RPOA 1H0VA 2E9PA 2J7TA 4I0RA 2DS1A 4ZLYA 2J51A 4EHZA 3FJQE 4QQTA 2GS2A 1SVGA 3DAKA 4QNYA 3VNTA 1KV1A 4AW2A 2G15A 4O7SA 3A7GA 5EHOA 3OY1A 4QOXA 4QTDA 2IVSA 3MVMA 3KF4A 4PL5A 4U40A 4ALUA 4E5AX 2CSNA 2IVTA 3R9HA 4BYJA 4C35A 2ONLC 4L44A 3DOGA 4HYIA 2UZVA 3F2NA 1F5QA 3NPCA 3R02A 2V7OA 4OTRA 2F7EE 3HYHA 5C4KA 2F7ZE 2YLFA 3F5GA 3MYGA 2FO0A 3A7IA 2YAKA 3P7BA 3FI2A 2JD5A 3QX4A 4WD5A 4D2PA 2UZLA 1J7LA 2CCIA 5AAEA 1YOJA 2WKMA 4GKHA 4WA9A 3ZU7A 5KMOA 2V62A 3CGOA 3R2YA 4RRVA 4DBXA 3E8EA 4FZ6A 2NRUA 5M09A 4O0RA 5JSMA 2JKKA 2P55A 4YU2A 5H8GA 5KO1A 4AXAA 3ZLSA 4FTMA 3HNGA 3BELA 5HBHA 2FA2A 4H1JA 3QCSA 3NWWA 3UQFA 2BIYA 2QKWB 2XVDA 3F66A 3PVGA 3VUDA 3VUKA 4C4FA 3AMAA 2UW3A 4ACHA 4IVBA 3S0OA 5BMSA 2J2IB 1JWHA 1WVWA 4F6SA 3MH1A 4K8AA 5HG7A 5BVOA 4V01A 5CNOA 3UOHA 4KRCA 5ACBC 2R3OA 2XKFA 4ONAA 4OBQA 5CSPA 3GBZA 2XNEA 2WOUA 3DV3A 3TG1A 3DNDA 1PMNA 3E93A 4G3GA 4BCNA 4BCIA 2FB8A 1QCFA 3NLBA 4RLKA 2I0YA 4E20A 2IPXA 4K11A 3UQGA 3WZEA 4A7CA 4FA2A 2Y6OA 4E6DA 2PVKA 1KOBA 3BHVA 4FX3A 4DG3E 2IN6A 3NX8A 3V5TA 4F6WA 3AG9A 3VS7A 4M69A 3LFCA 4IVAA 4CXAA 1ZARA 2XK9A 3DBQA 4H36A 3TZ8A 4DFLA 3SGCA 2BZIB 1O6KA 1A9UA 4PMSA 2PMNX 4ZXTA 1XH4A 2PE1A 5IEYA 2W1CA 4PMPA 3TKIA 3SVVA 3O7LB 5FUTA 3OXIA 3QTZA 4L68A 2QOBA 3NYVA 3DBFA 2PY3A 2WMBA 4BHZA 2Z7QA 3UZRA 3R71A 3HUBA 3WILA 3DK3A 3OROA 3LXLA 4AT4A 3V8TA 5HQ0A 4ASEA 3ROYA 2FVDA 3Q9YA 5HU3A 2BCJA 3Q9ZA 4FKQA 5HNIX 1Q4LA 3AT2A 3P0MA 2C0TA 3I6WA 3FZPA 4WRGA 2CHLA 2O5KA 5TR6A 2W06A 4MF1A 3SQQA 4CV9A 2DUVA 5J87A 3C9WA 3P7CA 4G3CA 3SA0A 3F7WA 1J3HA 1LP4A 4PNKA 5AV4A 4P4CA 4O6LA 4BL1A 3COIA 3JYAA 5F94A 2ERKA 2UZBA 4FIHA 5HGIA 4IAIA 3ZMMA 1PHKA 1ZMUA 3ACJA 3C0IA 4F0FA 1UKIA 4WBOA 5HLNA 3OEFX 3K5UA 4Y5HA 4CMTA 5A4LA 2IW9A 3C4ZA 4GSBA 4YP8A 3VS4A 1W8CA 3ORKA 4FMQA 4EOMA 2ZM3A 4CGAA 1KE6A 1Q8YA 2G1TA 4E73A 4JBVA 3QXOA 3RHXA 4ZTHA 5A6OA 2WIPA 2ZMCA 4CMOA 1IAHA 3MIAA 4MYGA 2YIQA 2R0IA 4YNOA 3WIKA 3EQDA 3ZLYA 3ZH8A 3B2WA 4C62A 4ZLZA 1GIIA 5C8KA 3QD4A 4EWHA 3QAME 1JBPE 4IANA 3RNIA 3E87A 4MWHA 2W4JA 2ITNA 1KE5A 3QQFA 4XJ0A 2AC3A 4OTGA 2UW0A 4ARKA 3R21A 3CQWA 4TYJA 2C30A 3R9OA 3LCSA 3FQHA 3V3VA 4BTKA 3ODZX 4RJ6A 4FKPA 4B4LA 3Q4CA 3BYUA 4X3JA 1A48A 3W2SA 4HVSA 4IVCA 1JKSA 5JFXA 3QC4A 3UPZA 3COHA 4IADA 3EL7A 1Q99A 4OUCA 5G6VA 5ACKA 4X3FA 5CI7A 3QRTA 3CCNA 5EW3A 1GZOA 1G3NA 1WZYA 2EXCX 1FVVA 1SMHA 2Y7JA 3EHAA 3BBWA 3NNVA 5DG5A 3RGFA 2QOCA 3PJ8A 4UXQA 4AACA 1VEBA 5J9ZA 4JDIA 3VJNA 2GPHA 2PMIA 3G6HA 3HEGA 3DKCA 4A9YA 3KK9A 5J5TA 4FG8A 3A7JA 3PA5A 1YXTA 4D55A 1OL1A 2V5QA 5AM7A 2CCHA 4Y8DA 4IAFA 3CY3A 4MWIA 2V55A 3EZVA 3PIXA 5GZ9A 2F2CB 4FZAB 2PTKA 3OBGA 4WHZA 3PXFA 1OL7A 4XLIA 4CV8A 4HCUA 4F7JA 4BIDA 1IEPA 4R1VA 2OK1A 3MWUA 4G6NA 4XG9A 3AMBA 5FG8A 2OF4A 3EKKA 4GK3A 2XYUA 5JRQA 3UO5A 4Z3VA 2PULA 4FEQA 4ANSA 3LVPA 1A06A 4UYNA 5E8VA 5JFVA 3ZYAA 4AW1A 4QQ5A 2P2HA 4UWYA 5LVLA 3RJCA 5EHYA 4AN2A 4FKUA 4DFNA 3D5XA 5KMKA 4WO5A 4YTHA 5B0XA 5CF4A 4FG9A 4IWPA 4YC3A 3OF0A 3DFAA 3SDJA 1W84A 2W17A 4B8MA 5JQ5A 3KXNA 4PTEA 2W1IA 4J52A 3D14A 3MS9A 1YQJA 3BHUA 3NCGA 2VTQA 4NIFB 5L6PA 1UU9A 2R3QA 2XYNA 2OWBA 3VF9A 1Q8WA 3OOMA 4IZ7A 4AW0A 2C5OA 2IW8A 3MFSA 4C59A 3CJGA 3GU6A 2ACXA 4MXXA 3Q2JA 3IW6A 3Q5IA 4I4EA 2PZIA 5I0BA 5CQWA 2QD9A 4RVTA 5DBXA 3IOPA 4BR3A 4ORKA 2YIXA 3QRKA 4Y46A 4R5SA 1RE8A 1Q62A 3QD2B 3N4TA 5DN3A 2J5EA 3HL7A 4OTQA 3P5KA 1ZY4A 4DH3A 2QR7A 5AP6A 4YLJA 3HV6A 4EQMA 4M13A 3AGMA 4JDKA 2F4JA 4D2SA 5A46A 4YMJA 4FTNA 4FEWA 5JRSA 2X7GA 4L46A 4QYFA 4F1OA 2QU6A 2WTJA 4ZY5A 5LCJA 2HW6A 5TKDA 4IHPA 3R83A 4CKIA 3CTHA 5IQCA 1NVSA 4AG8A 4DEIA 5L6WL 4NUSA 4DFBA 4BWXA 4WNMA 2W5BA 2BTSA 4ZJJA 4IB1A 3W33A 2WQMA 2YISA 5AA8A 4PV0A 5CENA 3CP9A 4AE6A 4Z7GA 1V0BA 5JK3A 4LFIA 4FR4A 2R3JA 3A61A 4FNWA 5AUUA 3KFAA 3WYYA 3OOGA 2XMYA 5LWNA 4IEBA 4F6UA 5HG8A 5BUIA 2XB7A 3V04A 2QOQA 4QP1A 4II5A 3BHYA 3GU5A 4MK0A 1TQMA 3KQ7A 3P4KA 1PMUA 2JEDA 4N0SA 4RA5A 1JLUE 4ZY6A 4X2GA 2O65A 4I3ZA 5AEPA 2YIYA 4KKGA 4L7SA 5AIKA 3HMOA 3VS5A 4EH2A 1YKRA 3VS3A 2XJ1A 2Y0AA 2ETRA 5C4LA 4G3EA 2XNBA 3PY1A 1FINA 3B2TA 3NUSA 4YPSA 1FMKA 3R7UA 5K4JA 5GIPE 3FUPA 4RWKA 5DOSA 4EOLA 2B52A 3U9NA 3LFSA 2XCKA 4CCUA 3EQPA 3NVMB 4CG9A 3I81A 1Q3WA 4K6ZA 3GOKA 5AM6A 3S4QA 3OW4A 3UBDA 3C5UA 5E8UA 4DC2A 3V5PA 4YO6A 1U4DA 4HW7A 3R0TA 5JZNA 1Q61A 1Y91A 3PJ1A 3PRFA 4V05A 4TWPA 1VYZA 2XS0A 4HYUA 4FK3A 5E92A 4V04A 5DA3A 5M53A 5HLWA 4KNBA 3UGCA 4FV6A 3LCOA 3ORZA 1XJDA 4NM0A 2WTIA 3C0HA 2CKOA 4FEUA 4JI9A 3TUDA 3R00A 4YJOA 5CX9A 4XRJA 3LAUA 4A07A 5A54A 3ZEPA 4FOBA 4BC6A 1BLXA 3NGAA 3MBLA 4ALVA 4MHAA 3OUNB 5LVMA 4O82A 1I44A 3VUTA 3JY9A 3W32A 3HUCA 3W2PA 4EI4A 3QGYA 4TL0A 3QKLA 4BTMA 4YBKA 3ZSGA 4FT9A 5LVPA 2O2UA 3E8NA 4K77A 3TKHA 4U0IA 4EUUA 3GT8A 3G15A 1URWA 4FKVA 2VNYA 4EK6A 4P5ZA 3PVUA 2UZWE 2BRBA 3AQVA 4PUZA 4YSJA 3SAYA 1IG1A 4TYEA 4U80A 5AR8A 3ZLXA 2YCRA 5H2UA 4ZAUA 2BPMA 5EOBA 1CKJA 3I0OA 5ETCA 3PA4A 4UBAA 2OG8A 3ETAA 4AQCA 2NP8A 3Q2MA 3QFVA 3BRBA 2VUWA 1YXUA 4UMTA 1IAJA 3HAVA 3OXZA 2JLDA 2XM8A 3KRRA 4FTRA 1PMEA 4LGHA 4TXCA 4EKKA 4OAUC 4PL3A 3FMKA 1DM2A 4BDDA 3QHWA 3BWFA 5J7HA 4NW5A 1J7UA 4F0GA 3BLQA 4M12A 3RKBA 3VULA 4BWKA 3ZS5A 3E64A 3ALNA 4GG7A 4GVAA 3SHEA 3ANQA 3ZM4A 2BRHA 4F63A 4G17A 4IAAA 5CU3A 3WZJA 5DNRA 3I7CA 5AP1A 3TNQB 4N6ZA 3BE2A 5AUVA 4J8MA 3TJDA 4FL3A 2ZM4A 4JAIA 3LZBA 3UG1A 2ESMA 3NUUA 4CEGA 4FV3A 3PVBA 3FZ1A 2P33A 2R64A 5EKOA 3QTRA 4F9CA 5FP5A 3FXXA 1B6CB 4PPBA 2BMCA 1Z57A 2WPAA 4QTCA 1BI7A 4ZK5A 3GENA 4IDVA 4U3YA 4IVDA 4BCGA 4EH3A 2BHEA 4QRCA 4JLCA 5IDPA 4LL5A 3C51A 2O0UA 3WZKA 3MA6A 3TT0A 2LGCA 1MP8A 4YZDA 3RZBA 5ANIA 4QMXA 2RF9A 3P1AA 4KWPA 3AD5A 5HD4A 5E1SA 2WXVA 1GIHA 3EIDA 1FBNA 3FL4A 4PL4A 5DYJA 3OXTA 1UU3A 1ATPE 3E8CA 1P5EA 4AGUA 4ANLA 2PVNA 3AT3A 3FY2A 2J0LA 5LCKA 1KOAA 5LVOA 2IJMA 4NT4A 5GHVA 4IJPA 2X1NA 3HKOA 1V0PA 2YDKA 4IBMA 3FMMA 4WSQA 4ZTSA 2JDOA 3TWJA 5ANJA 4NU1A 3VBXA 3W18A 3W1FA 5L2SA 4O83A 2RFNA 3EOCA 1PXPA 2ZM1A 3G33A 4YUQA 2ITQA 3POOA 2PVMA 2QLUA 4GG5A 2C6MA 2X2KA 3IK3A 3O7LD 4YZBA 1PYEA 3R8ZA 4CRSA 3UPXA 3QUDA 5CF5A 4WNKA 4X2FA 4HNFA 4O81A 5DIAA 2Y4IB 1E9HA 5D10A 3Q6UA 4WG4A 2VTHA 3KRLA 4XV9A 3FMJA 3HMPA 2QO7A 3AGLA 5CXZA 3MGYA 4I5PA 4Y95A 1T45A 2A1AB 5HE2A 1ZYCA 4AZWA 3QLGA 3COKA 4AU8A 1PKGA 4EH9A 4FV4A 3I79A 4FV7A 4R7HA 5EDPA 3MESA 5EM7A 4AZTA 4AGWA 3PJCA 1TKIA 2B53A 3DFCB 4WT6A 4X21A 4U7ZA 3V51A 3FY0A 1Y6BA 2E9NA 5DEWA 1H00A 1TQPA 4XYFA 3LXPA 5L2WA 2B54A 4XX9A 4UMPA 4QPSA 4I22A 4FKIA 1M14A 5EG3A 4NW6A 3CBLA 3UIXA 5FWKK 1OL6A 2G9XA 4TYIA 2W05A 4ACGA 5EYMA 2BZHB 4XOZA 3WF7A 2NNWB 4OTPA 3A99A 3HDMA 3FEGA 5GJFA 2VTNA 1OGUA 5LXMA 4QNAA 4D4RA 4WUNA 4AOTA 2V0DA 3KVXA 5ITAA 2GNHA 2HXLA 3EWHA 3V6SA 3F2RA 2VWZA 3MJ2A 3NIZA 4FE2A 3V5LA 1DI9A 4RJ7A 4USEA 4CTCA 2ZYBA 4BDHA 2RKUA 2R3RA 3QL8A 4JDJA 4Q5HA 3MFUA 3U51A 4FKWA 4DYMA 4O7VA 3LFEA 4EJ7A 4JS8A 4JOAA 5KHWA 2EXEA 2QQ7A 4AZVA 3NUXA 5C01A 4EJNA 3AOXA 2QOKA 2XK4A 3FLSA 3NUYA 3RBWA 2JAVA 5AP4A 4F7LA 5FP6A 4XP2A 5HO6A 3O50A 3VUMA 3PIZA 2P0CA 2IZRA 3MTFA 2HWPA 3PTGA 2VGOA 3FZTA 3HZTA 4NFNA 3SX9A 2HW7A 2J50A 2UVYA 2BTRA 2X6EA 3GC9A 3WI6A 3K3IA 3OG7A 4NCTA 5JGBA 5ANDA 5GINE 4FV9A 3VWAA 4C0TA 4EH5A 4O0WA 4CRLA 4QTBA 2W1HA 3RPVA 4YC6A 3LMIA 3LMGA 3OUKA 1KWPA 1Z5MA 3QYWA 2JKQA 4FF8A 4G5PA 4I24A 4U3ZA 1WBWA 2VAGA 2WELA 5BMMA 5BVDA 4O7TA 3FLQA 5M57A 3FYKX 4FKRA 1H28A 4YBJA 1QMZA 3DLSA 2OKRA 3R1YA 2BILB 5CVHA 2Q0NA 2GNLA 5DT3A 3PY0A 4Q5EA 4TNDA 3ZO1A 5D7VA 1Q8ZA 3OEZA 1Q8UA 4QP6A 5H3QA 2HZNA 2HXQA 4GUEA 4KRDA 2CNUA 4ERKA 2GMXA 1JPAA 5EQPA 5EHLA 3F3UA 4XV1A 4KA3A 5BUEA 2J0JA 2R3NA 2CN8A 3R9NA 1XO2B 2NRYA 2PZYA 2YM3A 4O1OA 5J8IA 4D5KA 3QD3A 2WQOA 3QHRA 4L53A 4FIGA 3OW3A 2VTJA 4JBPA 3WARA 4A06A 5B2KA 1PXNA 2OJFE 3BHHA 3AXWA 3NSZA 4M0ZA 4HGEA 4MD9E 4A4LA 4BDEA 4LRJA 3ZDUA 1DI8A 2YCQA 2YEXA 3F88A 4H58A 5DFPA 3LM5A 3W2QA 5JKGA 3MH0A 3DLZA 1DAYA 3CEKA 5IQBA 5KMNA 4C58A 3QRJA 3PLAE 5B7VA 4O22A 1R78A 1XQZA 2BAQA 2ZB1A 2Q0BA 1RDQE 2R3LA 5DR9A 4FVPA 5I3OA 3ULZA 3PJ3A 1OBGA 3VAPA 4QYYA 5DVRA 4ZSGA 4I0TA 5CVFA 4E4XA 1P2AA 3LM0A 4QD6A 4ANQA 1OKVA 2X4FA 5EDRA 1OIRA 3NAXA 4AT5A 4CFUA 4RZVA 2KTYA 2F57A 2QODA 5KMLA 4IM2A 4C4HA 1JQHA 3OWLA 4AP7A 1CKIA 3W55A 5DWRA 3WZDA 2YLEA 5H8BA 3QQGA 3E5AA 1H26A 4YJQA 3UJGA 5LMKA 4FTIA 4U97A 1R1WA 4J96A 2WMUA 5EK7A 4JG6A 1U54A 3K2LA 3VIDA 3LMHA 2YDJA 4JBOA 4LMUA 2F49A 3H0YA 4AA5A 4EK3A 3DZOA 3TNHA 2ZJWA 4PX6A 5HESA 3DAEA 4BB4A 4CLJA 2RG5A 3NR9A 4AZEA 2YM6A 5CAOA 2YCSA 4GYGA 3HGKA 4LL0A 3E3BX 5JGDA 4AFEA 3U6IA 3LE6A 4C3FA 2XEZA 5EM6A 3UP2A 4GEOA 3EQRA 5AX3A 2W5AA 2C6KA 1WBPA 3EFKA 3RM7A 3TDWA 1IA8A 3L8PA 2XIRA 4BCPA 3GQIA 2KULA 5HX6A 4H05A 1K3AA 4UEUA 3OBJA 5AV1A 5K5NA 4EOJA 3G0FA 4WNPA 5E91A 2ZDUA 4U41A 2QOIA 2JBPA 3HX4A 4KSQA 4G34A 4W4YA 3IO7A 4J98A 1ND4A 3TM0A 3FKLA 3L8VA 4PP7A 2B1PA 4DHFA 2C0IA 3G9LX 4O2PA 3SW4A 5HO7A 2VO0A 3BYMA 5FXQA 4WBBB 3FMNA 1UA2A 4AGCA 3QLFA 1UV5A 4LQMA 5CAPA 5CF8A 5I9VA 2UVXA 3R6XA 2VRXA 1JSUA 2NO3A 3QZFA 3BYSA 4EQCA 3JR1A 2BRMA 3VS0A 1U46A 3TTIA 3TZ9A 2WO6A 4FYNA 2A0CX 4RX7A 3VUIA 4IAKA 4TW9A 3GGFA 3CKWA 2JFLA 3RINA 2FH9A 1TQIA 3RK9A 4AOIA 4XG2A 3AD6A 3VF8A 5AFVA 2VWYA 2VN9A 4X3FC 2BFXA 2PK9A 3BLHA 4ERWA 1IASA 3UMWA 3P9JA 4M84A 2X8DA 2Q83A 1WBVA 4RMZA 4DCAA 4BFMA 3ZZWA 4UXLA 3ZOSA 2VWXA 3QF9A 3ENHA 4R7BA 5M07A 4R1YA 1Q24A 4MNEB 1FGIA 3I5ZA 4FSTA 2VWIA 2E9VA 3GFWA 4RIXB 4Z9LA 4GU6A 5G1XA 2JIIA 3PRIA 1XKKA 1ZYJA 3DZQA 4FTCA 4ITJA 5AAFA 4ASDA 4BDBA 2YCFA 3BZ3A 4O0YA 4HVHA 4O0VA 3H30A 2UZTA 5HNGA 2UZUE 3DCVA 2FYSA 1ZAOA 4FTLA 5HICA 3RPRA 3UP7A 3BLRA 3WF8A 4GFGA 2WTCA 4XBUA 2W0JA 3HV5A 2B9HA 5HG5A 3R7EA 5CT7A 5ANOA 2GFCA 3UVRA 4PDOA 3GXLA 4ZTQA 3MTLA 4XCUA 4C61A 3O17A 1Y8YA 2W1ZA 2REIA 3G51A 3MVLA 4O91A 3LFAA 5FTQA 5H8EA 4CMUA 3U4UA 4DGNA 4F9YA 5KCVA 2BKZA 4HGSA 3IECA 4J1RA 5KBRA 4FT5A 2WTKC 4QQJA 5LARA 3R8PA 3U87A 3RCJA 2YWVA 2X6DA 2J6MA 5M44A 2GFSA 1BL7A 4FTAA 3V8SA 3G5DA 2VWVA 4NL0A 4R78A 4NJ3A 3ZXZA 2RIOA 4BBEA 4ACCA 2QOLA 3OP5A 3OFMA 2PUPA 5A4QA 4XG6A 2X8EA 3DJ6A 5FDPA 3O23A 3EKNA 4B7TA 4GT5A 5BVWA 3THBA 3HV4A 3TDVA 3FBVA 4Z16A 2AUHA 1JKTA 4IFGA 4ITIA 3SLSA 5JN2A 4FUXA 2J4ZA 3VS6A 2C5VA 3L9NA 4MXYA 4ZMFA 5E8SA 4CQEA 2BDFA 4R8QA 5J95A 3ZRKA 1OMWA 2UW5A 4DLJA 5F95A 3F69A 4G3FA 4LUEA 4EEVA 2Y4PA 4UN0C 4NKSA 3ZBFA 4DFYA 4DEEA 5KX8A 4Z55A 1ZLTA 4U79A 5A4TA 4HNIA 5M4CA 2FSLX 5AADA 2PSQA 3R8LA 2PVRA 4OR5A 5K0KA 2GNGA 4LI5A 5A14A 2YM4A 1NT2A 1EH4A 4CZTA 2C1BA 5L3AA 2OFVA 3K3JA 3ZHPC 4F9BA 1KE8A 2PU8A 3W16A 3V5JA 4XG4A 4E1ZA 2GQRA 2H96A 3VBWA 5HEZA 3FV8A 4TY1A 3MPMA 4XHKB 5HVKA 3QALE 1NVRA 3EN5A 3GFEA 3PE2A 4N70A 2PE2A 3AT4A 2CGXA 3BWJA 4JVGA 4QMTA 5K5XA 4IM0A 3D5VA 1J7IA 4LM5A 2X0GA 5E8XA 3FXWA 2YABA 3F3WA 4EONA 4LRKA 4A4OA 4QQCA 4BDFA 1YXXA 3IGOA 2GHGA 3RNYA 2W99B 2WIHA 1Q8TA 2E9OA 3PYYA 5A3XA 3CQUA 1GAGA 5HKMA 4RG0A 4BWPA 3IDCA 2PZ5A 1NW1A 2ITTA 4X2KA 2PVHA 1YWVA 3MFTA 1LPUA 3VW6A 5LJJA 5TO8A 2OGVA 3QGWA 5IKWA 4FSYA 3TN8A 3R28A 4PMMA 4XMOA 3UIBA 3V8WA 4Z7HA 4EQUA 1H0WA 2C6TA 4XS2A 4E7WA 3R30A 3VJOA 2XBAA 3H3CA 2J0MB 2W5HA 3NNXA 4R77A 1OL5A 2WEVA 2I0VA 4DGMA 3Q60A 1MQBA 5FTOA 4QP7A 4Y73A 4ZS4A 3NS9A 1CKPA 2LAVA 3TL8A 4ZSLA 3KC3A 5IA4A 4L01A 3DJ7A 3JPVA 2HOGA 3JXWA 4CG8A 3QTUA 1PXIA 3OZ6A 3RPSA 2CPKE 4Q2AA 4QMVA 4IE9A 2F7XE 2X9FA 4D4SA 2ZB0A 2PVYA 4O6EA 4FI1A 1X8BA 3NZ0A 3Q04A 4RGJA 3BEAA 5BVKA 4F4PA 3WF5A 4L3LA 4X2JA 3SC1A 4NH1A 4EOQA 4A9RA 2P2IA 3V01A 4CFVA 2JDRA 2YJSA 5AUWA 4AAAA 1OM1A 4ANOA 4UMRA 4EC9A 5IDNA 3HA8A 3LJ0A 4JQEA 5T3QA 2W9FB 1NA7A 3PPZA 4MBJA 2H6DA 3FHRA 3HP2A 4D0WA 3MY0A 2WTDA 3H10A 1SYKA 3SRVB 1WVXA 3ZXTA 4ZTNA 4KS7A 1P14A 1UU7A 2QNJA 3JUHA 4FL1A 4J95A 4DFXE 3CC6A 4UMQA 1W82A 2ERZE 5DHJA 5J9YA 3AC8A 3IW5A 1YXSA 3EFLA 3EJ1A 4FSMA 4IH8A 3KXHA 4YR8A 4R3PA 4C57A 1R39A 2HIWA 5K4IA 4OW8A 2GS6A 4PY1A 4I1ZA 4ZTRA 2UZDA 5IUIA 3SOCA 3RAIA 3RZFA 3F2AA 2PHKA 1YVJA 3S3IA 2HY81 3VVHA 4IIRA 2X4ZA 1NXKA 4CQGA 4V0GB 3ACKA 4OTDA 3BIZA 3B8QA 3M2WA 3P08A 3VN9A 1PXKA 2ITVA 5JFWA 2XEYA 4MVFA 3RVGA 3Q6WA 1Y8GA 4X6QC 2OJ9A 3D4QA 4XH6A 1SNXA 3KMWA 3D7TB 3G0EA 5HE1A 4D4YA 2JDVA 5GZ8A 3HMNA 5EW8A 4WKQA 2C3JA 3ORTA 3IDBA 3FC2A 1H1RA 3I1AA 3EFJA 4HCVA 4E3CA 3GI3A 2HZ4A 3C4WA 3Q32A 3IG7A 3Q96A 4RPVA 4NFMA 4O21A 3EQHA 5DR2A 4FIIA 1JSTA 4GCJA 2VTAA 4XOYA 4BDJA 5HTBA 4B99A 1KE9A 3QWJA 5CNNA 5HOAA 3F9NA 5E1EA 2EU9A 4Y85A 4KSPA 4P7EA 3PSBA 1BI8A 5EW9A 3OCTA 3OTUA 2OXYA 3JVRA 4EZ7A 3CPCA 3TZ7A 4AX8A 3KXMA 4M14A 3DTWA 3V6RA 4U5JA 3FQSA 4O1PA 1NY3A 3PE1A 4GH2A 5HORA 4YJSA 4DG0E 5ETIA 3F5UA 1H07A 1YRPA 3FSKA 4OTHA 4XG3A 3ZEWA 1YDRE 3ELJA 4RBLA 1WCCA 3D5UA 3F5PA 3GUBA 4A9SA 4CD0A 3DXNA 3NUPA 4O86A 3MSSA 5TE0A 1DS5A 1M52A 3GU7A 5AP7A 4TRLA 4BDKA 2B9JA 5GJDA 4HYHA 4A9TA 3MVJA 4EBWA 3HVCA 5ETFA 3N51A 1OB3A 4EZ5A 4QMSA 3D7ZA 4D2TA 3R8UA 1REJA 3LFQA 4GMYA 3S1HA 3QQKA 5KE0A 1M2RA 3ORIA 1PXOA 1BX6A 3FLNC 3U55A 4MNEA 2CKEA 4DAWA 2CNQA 5IEXA 4RIXA 2HAKA 2WTWA 4BI1A 2CLXA 4TT7A 2BAJA 4WRSA 4BI2A 3TV7A 4IZ5A 4LGGA 5BUJA 4CFWA 3TNPC 2R3FA 5B2LA 4AF3A 3NAYA 4AA4A 1H08A 3IKAA 5TT7A 5KMJA 4G9CA 4IXPA 3COMA 2WGJA 1CMKE 2XJ2A 3ALOA 3OD6X 3GC0A 3W8QA 1E1VA 2HENA 2P3GX 1JKKA 4IZAA 5E8ZA 3UNKA 2PWLA 3NNUA 5HD7A 1OPLA 5KKRB 3QRUA 3CY2A 4GIHA 4J99A 4EH4A 2XCHA 4IB5A 1XH6A 1O6YA 4D9UA 3KRWA 3O8UA 4FV2A 2IZTA 3ORXA 3PSCA 3D0EA 5AP5A 4IB3A 5KMIA 5FBOA 4I20A 1GIJA 4QPMA 4XNEA 3TNWA 1K2PA 3BGZA 3BX5A 3JS2A 1RQQA 5CASA 3NYNA 3IW7A 3U6JA 2WMWA 1HCKA 2UW7A 2GNFA 1PMVA 1WBSA 3U4WA 4CFXA 3FMLA 3TKUA 4U9AA 4YHTA 2C0OA 3ZLWA 5IUHA 3Q52A 5AR3A 3DB8A 4GJ3A 3KN5A 5IA2A 3ZFMA 1QL6A 4TKSA 5AR5A 2QKRA 5DT4A 3EFWA 2XIYA 4C2VA 2XNMA 2X2MA 4TN6A 3UODA 1UWHA 2PPQA 4FKGA 5E7RA 3RAWA 1OUKA 4QP9A 3GOPA 3NW5A 2C4GA 3Q9WA 4FT0A 2R2PA 4CT1A 2X2LA 2BROA 2XNPA 3MB6A 5I9YA 3BV3A 3DJ5A 4I4FA 3GCPA 2XNOA 2PYWA 3R8VA 5IA5A 2J9MA 3W2CA 4L42A 5CZHA 4FSQA 2GTMA 2ZV9A 4MXZA 3RP9A 5CAQA 5CSHA 3NYOA 3OMVA 4FIEA 4F9AA 2XIZA 5KMMA 4O0UA 4YJRA 5EM5A 3D2IA 2OZOA 2XIKA 3ENMA 5HVYA 4BIBA 2RGPA 3ORNA 3KEXA 3F3ZA 2QU5A 3SKCA 3H9RA 1J1CA 4EUTA 1WFCA 4FYOA 3NDMA 2UUEA 4YO4A 3R73A 1ZWSA 4F09A 4BGHA 1OIYA 4B8LA 2I1MA 4XV3A 5DLSA 3MPTA 4QT1A 2IZSA 3M1SA 3PZEA 4NCTC 3A7FA 3FWQA 2JITA 2UVZA 3PP1A 3Q9XA 4L00A 4F1MA 3RWPA 3ERKA 4BCHA 1LEZA 3I7BA 4QMUA 3DXPA 3IS5A 4J53A 2GHLA 3BYVA 1H1SA 2X39A 3OHTA 3UO6A 4Q9SA 3A4OX 4QMMA 1YHVA 2FSOX 5AUXA 5ICPA 3CE3A 4ENYA 4HVIA 4DH1A 1H27A 3PG1A 5AP0A 4KIKB 5AUYA 5IH6A 2WMAA 5JQ8A 4D2RA 3VS1A 5FM3A 4BZNA 5CU0A 4RJ3A 4O96A 4CKJA 3QTSA 1Q41A 4TWNA 2EXMA 4IFCA 3HV7A 3RAHA 5DI1A 3VO3A 3DGKA 4YNEA 3MJ1A 2Z7SA 2ITPA 3H9FA 5JZJA 4GK2A 4CYJA 4YLKA 4FTTA 1IRKA 4LV8A 4AWIA 3LXKA 4KB8A 4BGGA 4FT7A 1XH7A 5LQFA 2DYLA 2SRCA 2ETKA 4XBRA 4XEYA 2GDOA 3PXRA 4IC7A 2QHNA 2B55A 4HOKA 4P2KA 4HGTA 1WBNA 3DBCA 5J1WA 4O7RA 2QO9A 3PPKA 1XH9A 2QG5A 3DU8A 3SRVA 4K2RA 2UW9A 4PRJA 3ZFXA 2BR1A 2WQNA 2ITZA 5CU6A 4MH7A 2VNWA 4WNOA 4XRLA 4IWQA 4Q9ZA 2BKKA 4RC3A 4E4MA 5IQFA 3A60A 2JDSA 2WFYA 2XKCA 3O51A 3FHIA 5CY3A 2PVJA 3QU0A 4QO9A 5M06A 1SZMA 4OT5A 5DGZA 2VTOA 3NNWA 3QRIA 3RI1A 3TIYA 3TXOA 2C69A 2R4BA 3WOWA 4FVRA 5HZNA 5LMBA 1M2QA 3I4BA 4L8MA 5GNKA 3L9MA 3UNJA 4K18A 4X0MA 5HI2A 4TWOA 4QMWA 4DTBA 1U5RA 4V0GA 5LMKC 3DKGA 1XHAA 1ZOGA 4JJRA 3PXQA 1PYXA 3ET7A 4KUJA 3ANRA 3PY3A 3GEQA 4EHVA 5IUGA 2OW3A 3FMHA 3BU5A 3VHKA 4IM3A 4QP3A 4BDIA 3ZM9A 4I6BA 2QI8A 1OVEA 5CEQA 4O7WA 2CGVA 2RFDA 2UW8A 4NIFA 4RVLA 1XR1A 2A4LA 3VC4A 4AN9A 2W7XA 3PXYA 3ZONA 3SXRA 3MA3A 4I6HA 4QMNA 3E8DA 4I5CA 4U81A 1B39A 4E4NA 3KK8A 3ZDIA 3FPMA 4FV1A 2BHHA 1XH5A 5IMXA 2X7OA 2X7FA 3DS6A 1YI6A 4I21A 3F6XA 5AIRA 3ZC5A 3R7OA 5AA9A 5T6KA 3W10A 4I94A 5JFSA 3VBTA 1PY5A 3D94A 4EK8A 4GL9A 4MXAA 4YJTA 4NJDA 5D41A 4EHGA 4EK5A 5H9BA 4FTUA 4BCOA 3RAKA 3ODYX 3N4UA 3BQCA 4IQ6A 4P5QA 3KCFA 2FSTX 3ORLA 4KAOA 2YIWA 4QMQA 5IISA 2OJGA 5ANEA 4DFUA 3RWQA 3PSDA 4BDAA 4O0SA 4H3BA 3GQLA 5K0XA 5GJGA 4YTFA 5EI2A 3K54A 5IF1A 1I09A 4F1TA 1MRYA 4QMYA 4MXOA 4RFYA 4DGGA 4FEXA 3QCQA 4OBPA 3ZTXA 4MBIA 2R3HA 1TVOA 3MY5A 4R5YA 4AS0A 3R01A 1GZNA 3GP0A 4FG7A 2IW6A 3R7IA 1W0XC 4LOOA 3Q5ZA 4XP0A 3MPAA 3UIMA 3LQ8A 4I92A 4FICA 1PXJA 4X7QA 2WMQA 4UX9A 5C26A 4DE4A 3VBVA 5M4UA 5B2MA 3JY0A 4AW5A 4JIAA 3TUBA 2VU3A 4E5WA 5LMAA 3L9LA 4L43A 4PNIA 4RWLA 4HCTA 2RG6A 4C4IA 4L9IA 4S31A 4DGLC 4ZEGA 2JFMA 3SXSA 3VRYA 3HV3A 1IA9A 4QMOA 3R7GA 4RVKA 4PDYA 3I60A 2AC5A 3FAAA 3ZSIA 5L6OA 1VZOA 3L8XA 4G6LA 4YTIA 2PUIA 2YWPA 3NCZA 3MN3A 3DBEA 4YJVA 3QXPA 3IONA 2WEIA 3JVSA 1WAKA 5IA1A 1OKZA 1PXMA 2Y4IC 5IQAA 3MFRA 1FVRA 4AUAA 5IH5A 2UZEA 3PIYA 5L4QA 3CIKA 4FSZA 3LCKA 3P23A 5L8JA 3TJCA 3HA6A 3E92A 3OC1A 4QMPA 4EYMA 2C5XA 3KMUA 4R3RA 5DR6A 4AT3A 4BBMA 3U6HA 4FNZA 4M3QA 2IO6A 4M68A 4UALA 4CNHA 5K9IA 3FMDA 4GJ2A 4OTWA 2C5YA 3DPKA 1M7QA 4OBOA 4YPDA 1P4OA 3FQEA 3KU2A 3PP0A 4S33A 4F70A 3OVVA 1OBDA 1V0OA 1J1BA 1Q5KA 2Z60A 3A8WA 3WF9A 4MD7E 3HMMA 2B9IA 4LGDA 1WVYA 3OT8A 2XRWA 4M8TA 1Y6AA 3DB6A 1URCA 2YJRA 2ZVAA 4U43A 3T3VA 3R7YA 1KSWA 5AR7A 5D9HA 5AV0A 4F7NA 2V7AA 4IC8A 5J79A 2OFUA 1UKHA 4J97A 5DH3A 3O0GA 1S9IA 2I6LA 4IDTA 4A4XA 1G8SA 2PZRA 5FEEA 2BAKA 2PVLA 2FUMA 1ZY5A 4NWMA 4D9TA 4OGRA 5EDQA 3QA0A 3DQWA 2EB2A 1YOMA 5EQYA 3GC8A 5AUZA 1G5SA 1BMKA 3C13A 3MV5A 2R3GA 1OUYA 4U6RA 3GCSA 4A9UA 3H0ZA 3QQHA 2VGPA 3KCKA 3NRMA 4GU9A 4RIOA 2ETMA 2WB8A 2W96B 2WNTA 2Y8OA 3E7OA 4IX3A 5C03A 3CLYA 5EYDA 3TEIA 4BZOA 4W4XA 1BL6A 1XBCA 2ZV7A 4ZS0A 5FEDA 4C8BA 4DEDA 4EZ3A 2QOOA 3FI8A 5KUPA 2XJ0A 3LIJA 3U8WA 2C3LA 4DT8A 5AR2A 4EHEA 1FOTA 3RTPA 1MUOA 4MXCA 3D5WA 1Z9XA 2DQ7X 2RSVA 2W1EA 2VX3A 2R3PA 4I93A 3FKOA 1UVRA 5CZIA 5FLFA 5BYZA 1MRVA 3ZZEA 4UMUA 4BRXA 4FKOA 4DTKA 4TTHB 3MH2A 2W1FA 4USDA 3UTOA 5M51A 5EYKA 1XBAA 3IPHA 2R0UA 4FT3A 4S2ZA 3RK5A 1YI4A 3EN7A 5FXRA 1R3CA 4BIEA 4LG4A 1CDKA 4BICA 4S32A 2B9FA 3LQ5A 5ANKA 4H3QA 2IVUA 4ZIMA 4BDCA 1H1QA 1FPUA 2F2UA 1GJOA 3FMEA 4JAJA 4DBNA 3KRXA 5HIDA 2V22A 2W1GA 4KIKA 3UDBA 5CEKA 2HZ0A 2H9VA 3GC7A 3BI6A 4NM5A 4PF4A 5M55A 3AC5A 3KRJA 3ROCA 3UE4A 4JBQA 4NK9A 1F0QA 5IPJA 4G5JA 2WZJA 4PMTA 5J9LA 3Q3BA 2FGIA 2PMLX 2YITA 4FL2A 4DH5A 1ZZ2A 4AGDA 4BYIA 3VBQA 4JNWA 4RIYB 4RT7A 2OSCA 3RMFA 2AYPA 3TI1A 4UY9A 4BZDA 4FSWA 1VR2A 2OICA 3FLYA 4GRBA 3BCEA 5JH6A 2XZSA 5IQEA 2OJIA 1SVHA 2Z7RA 4BKJA 4LYNA 2VO6A 4DITA 3IDPA 2VTLA 5CEMA 1U5QA 4USFA 3HECA 3PFQA 5E8WA 4BCMA 2ITOA 3Q4UA 4EC8A 2OH4A 4JT3A 4W8EA 3Q53A 4FGRA 4L7FA 3TCPA 5HHWA 4DTAA 4C3PA 1STCE 2Z2WA 2A19B 1W7HA 5E8TA 4ANMA 2BFYA 2R7IA 5CVGA 2CKQA 4E4LA 4O2ZA 3R9DA 2CGUA 5CLPA 5AP2A 2EB3A 4GYIA 2W9ZB 3K5VA 1MQ4A 4QMZA 3GB2A 4MTAA 3HRCA 5FRIA 4H39A 3OTVA 3RCDA 5IA3A 1R0PA 2OH0E 4M15A 5EFQA 3UMXA 2JDTA 4Y83A 2G2IA 1M17A 4CFFA 2YIRA 3BV2A 3IQ7A 2WU7A 4MCVA 4TZRA 5K3YA 3QQLA 4L67A 1YW2A 4TPTA 2Z7LA 5IZFA 3EN4A 2G01A 4HYSA 2X81A
chains in the Genus database with same CATH superfamily
2J5FA 3ORMA 3CD3A 3RPYA 5FM2A 2XF0A 4G6OA 3F3TA 4D58A 2IZUA 3ZBXA 4D2VA 3HLLA 4IX4A 2XANA 4C4GA 4CT2A 3BBTB 3WIGA 2B7AA 2G2FA 3EL8A 3WZUA 5A4EA 4W9XA 4M0YA 3H4JA 4RFZA 3VHEA 4IW0A 3UIUA 4UB7A 3TACA 5JT2A 1GZKA 3AD4A 3A2CA 4PP9A 3S2PA 1VJYA 2C5NA 5D7AA 5HIBA 5C8MA 2OF2A 2PUUA 3UOJA 3T9TA 3RM6A 4YZNA 4ZOGA 4FIFA 3TZMA 5HVJA 2GHMA 3UG2A 5AX9A 1XMMA 4GT3A 1HOWA 4BY9E 3NVKI 4NTTA 1GZ8A 4BF2A 5CWZA 4LUDA 4O0XA 2HWOA 3SOAA 3E88A 4D0XA 4LRMA 4MX9A 2QVSE 3FXZA 4C4JA 3LKMA 5FTGA 1ZZLA 4FNYA 4WSYA 3O5AA 2BIKB 1PRYA 5JGAA 3GNIB 3TUCA 4ZY4A 2E9UA 4RJ8A 4U44A 3I5NA 4G2FA 4W8DA 3VQUA 4JG8A 5T68A 4DEGA 3HMIA 4AZSA 3EQCA 3PG3A 3QTQA 5IQGA 3BGPA 2YHVA 4FZDB 4JDHA 5FDXA 3AMYA 2QR8A 4PTCA 2RFEA 2BALA 3KB7A 3QUPA 4BCFA 4GKIA 2C3IB 3LLTA 2YAAA 1WMKA 3BPRA 4K0YA 4LMNA 4DT9A 3FYJX 4GFOA 4CZYB 4GUBA 3UOKA 4I6QA 1QPCA 2PE0A 4GW8A 3CTJA 4N6YA 4M97A 4L52A 4APPA 4F65A 4IZYA 4RFMA 4S34A 2CDZA 3D83A 3FLWA 5AMNA 3SW7A 4N4SA 4ZSAA 3F7ZA 4RQVA 5KHXA 1CM8A 5HCXA 1W98A 4ASZA 5FXSA 3ZO2A 2H34A 5IEVA 2OXXA 1JOWB 1RW8A 3EN6A 3P79A 4O4EA 5CTPA 4QTEA 2PVFA 5D1JA 1T46A 5ANGA 4JR7A 1IR3A 4RA4A 3W2RA 3DNEA 3EQGA 4QP2A 4YZ9A 1OL2A 3AC2A 3FDNA 2XUUA 4FV0A 4I5HA 4ZZOA 1GOLA 3DY7A 3DAJA 4K9YA 4YJUA 4IWDA 1V1KA 3IW4A 3P78A 4C2WA 4LOQA 4L3JA 2XK3A 2R5TA 1PKDA 4QMLA 4DLIA 2C3KA 2W4OA 4FKLA 5FQDC 3MY1A 3BYOA 3PPJA 4GIIA 5LVNA 3I6UA 5IQHA 3S95A 4WG3A 2OLCA 1ZMVA 2A27A 4F64A 1KE7A 4YJNA 5CANA 1YDSE 2GCDA 2J90A 3MIYA 4M67A 4EOPA 5HIEA 1H1WA 1OPJA 2XK7A 3EMGA 2AQXA 3QBNA 4ZSJA 4EH7A 3QWKA 4CTBA 3QZIA 2VTIA 4IX5A 4RX8A 4YLLA 4EL9A 3UC3A 3BQRA 4QYGA 4CFNA 4D2WA 3IOKA 2OI4X 4L45A 4AN3A 3R7VA 2EVAA 2QONA 3LQ3A 4O7NA 1H1PA 1M2PA 4RZWA 3KULB 2YM7A 4FTOA 5EH0A 4B6LA 3T9IA 2ONLA 3QKKA 2WAJA 2VTTA 1G8AA 2O63A 3BGQA 4H3PA 4JG7A 3LFFA 4KBKA 1SM2A 5TOZA 1JNKA 2BRNA 3SV0A 4JRVA 4QYHA 5IH4A 3FL5A 3G2FA 2JIVA 4DEBA 4ASXA 4F9WA 3Q4ZA 2XBJA 4K1BA 3PXZA 1SNUA 3ZC6A 4RWJA 5L2TA 4NYEA 3RALA 5M08A 3L1SA 3D9VA 1OPKA 3LCTA 4FKJA 3R22A 4XG8A 3WE4A 3QUEA 4C38A 4NTSA 3KMMA 2CLQA 3SD0A 5L2IA 4FSUA 2UZOA 2QOFA 3FKNA 4DH7A 2WD1A 4FOCA 4N57A 2I40A 2JC6A 1LUFA 2ZV8A 1L3RE 3N9XA 4B0GA 5CEPA 2P4IA 4EOOA 4FSNA 3VS2A 4IAYA 2YERA 3ZSHA 5JMSA 2W4KA 5GIOE 3R1SA 3BU3A 5I9UA 5GZAA 2UV2A 4ZP5A 3FPQA 4BN1A 4O0TA 2C6IA 4RWIA 3LW0A 4B9DA 2YFXA 4HGLA 3AC3A 4AAYA 2BZKB 2Z8CA 1UNGA 1UNHA 1PJKA 4GFMA 3C5IA 1YHSA 5DEYA 2Y6MA 2YACA 5E4HA 3PA3A 5BV3A 3QA8A 2ZAZA 4L3PA 4RJ5A 3LXNA 2RL5A 3ZUUA 3UZTA 2OIQA 3GCQA 3EH9A 3W0PA 2WQEA 4DCEA 5C27A 3ZO4A 4HPTE 4BCJA 3VUHA 4U42A 3LFDA 4IJ9A 4PPCA 3TNIA 2OZAB 5CAVA 1E1XA 2VTRA 4ANBA 3CJFA 3QZHA 2VX0A 4RIYA 3MW1A 5HTIA 4O7YA 3FZSA 4MQ2A 2NPQA 3DXQA 3PVWA 3Q4TA 3KA0A 4G3DA 3C0GA 5L8LA 2HZIA 4XG7A 3VBYA 2VTSA 2G2HA 2JKOA 2IWIA 2GNJA 4JR3A 3A7HA 5AAGA 1YWRA 3OCBA 4C36A 4E8AA 1YHWA 2R7BA 1PXLA 4ANNA 4D28A 2HYYA 4E6CA 3EYGA 4ALWA 3QTIA 2CJMA 3L9PA 3PJ2A 5AJQA 4CCBA 1OI9A 4OLIA 4BKYA 4ENXA 5CAUA 4BJJA 3M11A 4GT4A 4BVUA 2XK6A 4R7IA 3M42A 2ZDTA 3QZGA 1S9JA 2XK8A 1XWSA 4FGBA 3PWDA 2OU7A 4WUAA 2PUNA 4QPAA 1YOLA 4APCA 3BU6A 1FVTA 3ZRLA 3UOLA 2BDWA 3C4XA 4YHJA 5EYCA 2VWUA 3TTJA 4DN5A 4JIKA 4PQNA 4OTIA 2XKEA 5HTCA 3DTCA 3WYXA 3CD8A 3FI4A 5I4NA 1AQ1A 2WTVA 4GS6A 3R8MA 4DEAA 1LEWA 1TZDA 5BVEA 3R1NA 3ZUVA 4DF3A 3QTWA 3QX2A 1H8FA 3O8PA 4RC2A 3EB0A 2QOHA 3FC1X 4PPAA 5CYIA 3REPA 4E93A 3FE3A 3GCVA 4PTGA 4C02A 4CZUA 1FGKA 3ZUTA 5BYYA 2BVAA 2WHBA 2HY0A 5CSVA 4D1ZA 1ZMWA 3II5A 3ULIA 2XIXA 4BTFA 1FQ1B 4TYGA 1UWJA 3DDQA 3U9CA 5KZ0A 4EK4A 3MDYA 5DRDA 1REKA 5I9ZA 1MRUA 3ZFYA 3ZO3A 2QO2A 2QCSA 3P86A 3UZPA 4ZJIA 4BBFA 3PZHA 2ITYA 3BEGA 5HO8A 5AUTA 2I0EA 5HE0A 2XKDA 4FV8A 2WMVA 5IU2A 4O38A 2OIBA 1ZYDA 1QPDA 5HU9A 3QD0A 4F99A 2VV9A 1PW2A 5L2QA 2ZFYA 4O84A 3G90X 4NSTA 3ATSA 5IG1A 3L8SA 5C1QB 4D1SA 4OAVB 3SG9A 1JSVA 3V5QA 1AGWA 5F20A 4YTCA 1H01A 4RLLA 4OTFA 4R6VA 1B38A 1CSNA 4DINA 1AD5A 2IVVA 2AEGA 3IW8A 4G16A 4F0IA 4H1MA 2YM5A 2YDIA 3E7VA 4RIWB 5BVNA 3VQHA 3DKOA 4ID7A 3DK6A 4QP8A 5E8YA 3OWKA 4DA5A 4X2NA 1ZYLA 4KKEA 3R04A 1BKXA 4TYHB 2OJJA 3F3VA 4K33A 1ZOEA 2XP2A 2HK5A 2ITUA 3WF6A 5CU2A 4HJOA 5CALA 4O4CA 2QURA 3WE8A 3BKBA 5BNJA 3CR0A 2XNNA 4EH6A 5EQEA 2OIDA 3E3PA 2WQBA 3NIEA 3LHJA 4FBXA 2I7QA 2VD5A 1OIQA 5E90A 4CYIA 5DE2A 5CEIA 2R9SA 2HCKA 4GV1A 4ZSEA 4HZSA 2X8IA 1G8JA 3LLAA 5M4IA 4AA0A 2JKMA 5AP3A 3C4EA 4I6LA 3ATTA 3WBLA 4XP3A 4TNBA 4UWCA 2QC6A 3W0OA 1NVQA 4FUYA 5JEBA 1QPJA 2C68A 4EOSA 1U54B 3UQCA 4EORA 3VW8A 5CQUA 1KV2A 4D4VA 3VUGA 5KKRC 5CSWA 4BCQA 2C1AA 2QHMA 2XA4A 3EQFA 4QP4A 5HE3A 4HPUE 2I0HA 3SXFA 3TV4A 5IQDA 3CPBA 5BVFA 4UZDA 4Y5QA 3U54A 3C4FA 1JKLA 3CTQA 3CS9A 3NUNA 3QC9A 4DEHA 2WOTA 5M4FA 4NM3A 3EYHA 5HNBA 4YJPA 5I3RA 2BRGA 2CGWA 3T3UA 3PDTA 5D12A 2XNGA 3AC1A 2WMSA 4FTQA 4FTKA 4ACDA 3LFNA 4G31A 5DPVA 5IQIA 3BE9A 3MB7A 1YXVA 4NKAA 4NZWB 2J0KA 5F9EA 1L8TA 2YZLA 2UW6A 3FSFA 5J5SA 3LCDA 2YZAA 3OWJA 2PZPA 4J71A 2OBJA 4KBAA 3W8LA 3KULA 4FC0A 2UZNA 4U8ZA 4M66A 3NUAA 1OKYA 3P7AA 4KBCA 4HVDA 2JBOA 3EQBA 4LV5A 2W1DA 3QYZA 3ZCLA 2HELA 5HCYA 3O2MA 2FSMX 3FZRA 4W9WA 4J8NA 3PLSA 5EI6A 3HRBA 4EOKA 4JQ8A 2ZMDA 3QTXA 1LR4A 4FV5A 4KS8A 4R3CA 4UWBA 4UYAA 1Y57A 3KREA 1YDTE 1OECA 4DGOA 3LJ2A 4E5BA 4EWQA 4C7TA 2O64A 4EH8A 4FEVA 1WBTA 2EUFB 1BUHA 3C1XA 2GNIA 1YWNA 3A4PA 3LFBA 3MI9A 3D7TA 3KN6A 4F7SA 4NM7A 4ZMEA 4ZZMA 4FIJA 3OWPA 4AXCA 1XBBA 4RX9A 1SVEA 4BKZA 4CSVA 4CKRA 2C6EA 4IWOA 2ZOQA 3POZA 2GU8A 4W4WA 4MQ1A 4YGAA 2IG7A 3AC4A 4I6FA 5I9WA 3MVHA 5HCZA 4CFMA 4FKTA 5DRBA 4MKCA 3R63A 4OT6A 1ZXEA 3HRFA 2XM9A 3TV6A 2JAMA 3UC4A 4F08A 3PUPA 1BYGA 1WBOA 2E2BA 2Z02A 4HZRA 5A4CA 3G9NA 2JGZA 5I9XA 2GTNA 3ITZA 2RFSA 3DK7A 3F82A 3KXGA 4I41A 2DWBA 4XLVA 5F1ZA 4E26A 3D2KA 1GY3A 3EN9A 3C4CA 4FK6A 5ETAA 3E62A 3QKMA 3UYSA 2BUJA 4BHNA 5EKNA 5CF6A 3HP5A 5D11A 1ZOHA 2OZAA 1VYWA 5CT0A 4C37A 1ZYSA 3NW7A 4UV0A 1H25A 3W2OA 3ZRMA 3VRZA 2A98A 4KIPA 1CTPE 4KKHA 3DBDA 2CN5A 5AV2A 2WMXA 5C9CA 2BDJA 3BHTA 5HLPA 3KIOC 1H24A 1HCLA 5CS6A 5IA0A 3LPBA 4M69B 5E9EA 4WIHA 1Q97A 2R3MA 3I0QA 5CI6A 5AR4A 2C6LA 5J1VA 2B0QA 2O3PA 2C47A 1Q3DA 3R9RA 5KZIA 3EZRA 4AFJA 4FTJA 3QQUA 4EBVA 4RX5A 4NEUA 3TIZA 3PWYA 5FD2A 4O7LA 4DFZE 4KIOA 3OT3A 4FZ7A 2Y9QA 1KUTA 4MNFA 4AE9A 4FKSA 1F3MC 1OKWA 4G9RA 5TF9A 4X6RA 4YC8A 3DA6A 1P4FA 3HAMA 3E63A 3KY2A 4GK4A 1ZRZA 1OIUA 3FZOA 2VWWA 5HG9A 3LOKA 4PWNA 5IMEA 4AOJA 3N4VA 2JIUA 3F61A 4MD8E 2OO8X 4AZFA 1PF8A 5A6NA 5DMZA 1FMOE 4C34A 3UYTA 4EOIA 3FLZA 4U45A 5LWMA 1GNGA 3UNZA 2VX1A 3KXZA 3OY3A 2PL0A 4I23A 1O6LA 4KIQA 1UU8A 4C4EA 3G6GA 4IMYA 3A62A 3ORPA 4D1XA 4EKLA 4QYEA 4IB0A 4QDVA 1J91A 4MEDA 3ID6C 2XRUA 4O27B 4I5MA 4FODA 4BGQA 4QTAA 2YM8A 1YI3A 4JRNA 1K9AA 3DQXA 4BTJA 3GU8A 4JXFA 4RQKA 5CEOA 3QQJA 1QPEA 4FNXA 3S00A 2VWBA 5I5ZA 4FVQA 5M56A 1DAWA 2A2AA 5HX8A 3NMUF 3CQEA 4D5HA 2CKPA 3MH3A 4WOVA 2YN8A 2F9GA 4AXEA 2X0OA 3GCUA 2VO3A 3V5WA 4YSMA 1U59A 4P90A 3DKFA 3W0RA 4CLIA 1R0EA 5CU4A 3QCXA 5EI8A 3O96A 4YZCA 4TWCA 1ERKA 4KINA 4J7BA 5FGKA 5C8NA 3BL7A 3F5XA 4G1WA 3EQIA 4M7IA 4RVMA 2H8HA 5A9UA 2ITWA 1H4LA 2WMRA 3D15A 3KGAA 4PDSA 4PDPA 4S30A 4DH8A 4YURA 4ZTMA 4IAZA 3O8TA 5CSXA 5BQ0A 2QG7A 4RIWA 3C50A 4X3FB 2O8YA 3O71A 4YZMA 4CVAA 4E6AA 2GSFA 3HDNA 4ITHA 4RC4A 3CXWA 5KNJA 4JQ7A 5EOLA 5BX0A 4TYHA 4ZZNA 4ACMA 3FI3A 5LOHA 5J7BA 5EM8A 2C6DA 5FEQA 2UW4A 4JX3A 3OS3A 2XH5A 4DG2E 3KL8A 5CXHA 4GVJA 2WU6A 4BDGA 3DDPA 3KKVA 2R3KA 4JX7A 4FSRA 4WG5A 3GU4A 4C33A 4ZJVA 5HBJA 3QCYA 4EYJA 3H9OA 3RK7A 3C7QA 4BCKA 3RHKA 4UZHA 5HBEA 3B8RA 4KD1A 3CKXA 3T8OA 3DT1A 3KVWA 3OCSA 4IACA 1W83A 2BZJA 2OXDA 2VZ6A 4XUFA 5FBNC 5AV3A 2CMWA 2QLQA 2VO7A 3NYXA 4LOPA 1JAMA 4MBLA 1RJBA 5F4NA 5KBQA 3R1QA 4BI0A 3GVUA 2VTPA 4HVGA 1APME 1XH8A 5BPYA 3IGGA 3SG8A 3KF7A 3KXXA 2VTMA 1JVPP 4W4VA 4YHFA 4RJ4A 4JL9A 3R2BA 4RSSA 3CSVA 4C3RA 4QDEA 4ZLOA 2WTKB 4I0SA 2EWAA 2X9EA 5DT0A 3UO4A 4Y72A 4XV2A 2YA9A 5L8KA 1O9UA 2GQGA 3LJ1A 2C6OA 2R3IA 2ZV2A 2B4SB 4O7ZA 2GS7A 4IX6A 5BYLA 4FZFB 3UVPA 4E6QA 3UVQA 1M7NA 3A8XA 1UNLA 2PMOX 3OCGA 3NW6A 2J0IA 1OITA 4KABA 1OZ1A 4MAOA 4ZTLA 4MF0A 2WMTA 3CGFA 2CNVA 3PXKA 4L6QA 3NEWA 2GQSA 5AWMA 2ITXA 3RPOA 1H0VA 2E9PA 2J7TA 4I0RA 2DS1A 4ZLYA 2J51A 4FJVA 4EHZA 3FJQE 4QQTA 2GS2A 1SVGA 3DAKA 4QNYA 3VNTA 1KV1A 4AW2A 2G15A 4O7SA 3A7GA 5EHOA 3OY1A 4QOXA 4QTDA 2IVSA 3MVMA 3KF4A 4PL5A 4U40A 4ALUA 4E5AX 2CSNA 2IVTA 3R9HA 4BYJA 4C35A 2ONLC 4L44A 3DOGA 4HYIA 2UZVA 3F2NA 1F5QA 3NPCA 3R02A 2V7OA 4OTRA 2F7EE 3HYHA 5C4KA 2F7ZE 2YLFA 3F5GA 3MYGA 2FO0A 3A7IA 2YAKA 3P7BA 3FI2A 2JD5A 3QX4A 4WD5A 4D2PA 2UZLA 1J7LA 2CCIA 5AAEA 1YOJA 2WKMA 4GKHA 4WA9A 3ZU7A 5KMOA 2V62A 3CGOA 3R2YA 4RRVA 4DBXA 3E8EA 4FZ6A 2NRUA 5M09A 4O0RA 5JSMA 2JKKA 2P55A 4YU2A 5H8GA 5KO1A 4AXAA 3ZLSA 4FTMA 3HNGA 3BELA 5HBHA 2FA2A 4H1JA 1G8KA 3QCSA 3NWWA 3UQFA 2BIYA 2QKWB 2XVDA 3F66A 3PVGA 3VUDA 3VUKA 4C4FA 3AMAA 2UW3A 4ACHA 4IVBA 3S0OA 5BMSA 2J2IB 1JWHA 1WVWA 4F6SA 3MH1A 4K8AA 5HG7A 5BVOA 4V01A 5CNOA 3UOHA 4KRCA 5ACBC 2R3OA 2XKFA 4ONAA 4OBQA 5CSPA 3GBZA 2XNEA 2WOUA 3DV3A 3TG1A 3DNDA 1PMNA 3E93A 4G3GA 4BCNA 3TMOA 4BCIA 2FB8A 1QCFA 3NLBA 4RLKA 2I0YA 4E20A 2IPXA 4K11A 4O4BB 3UQGA 3WZEA 4A7CA 4FA2A 2Y6OA 4E6DA 2PVKA 1KOBA 3BHVA 4FX3A 4DG3E 2IN6A 3NX8A 3V5TA 4F6WA 3AG9A 3VS7A 4M69A 3LFCA 4IVAA 4CXAA 1ZARA 2XK9A 3DBQA 4H36A 3TZ8A 4DFLA 3SGCA 2BZIB 4BJJB 1O6KA 1A9UA 4PMSA 2PMNX 4ZXTA 1XH4A 2PE1A 4LV7A 5IEYA 2W1CA 4PMPA 3TKIA 3SVVA 3O7LB 5FUTA 3OXIA 3QTZA 4L68A 2QOBA 3NYVA 3DBFA 2PY3A 2WMBA 4BHZA 2Z7QA 3UZRA 3R71A 3HUBA 3WILA 3DK3A 3OROA 3LXLA 4AT4A 3V8TA 5HQ0A 4ASEA 3ROYA 2FVDA 3Q9YA 5HU3A 2BCJA 3Q9ZA 4FKQA 5HNIX 1Q4LA 3AT2A 3P0MA 2C0TA 3I6WA 3FZPA 4WRGA 2CHLA 2O5KA 5TR6A 2W06A 4MF1A 3SQQA 4CV9A 2DUVA 5J87A 3C9WA 3P7CA 4G3CA 3SA0A 3F7WA 1J3HA 1LP4A 4PNKA 5AV4A 4P4CA 4O6LA 4BL1A 3COIA 3JYAA 5F94A 2ERKA 2UZBA 4FIHA 5HGIA 4IAIA 3ZMMA 1PHKA 1ZMUA 3ACJA 3C0IA 4F0FA 1UKIA 4WBOA 5HLNA 3OEFX 3K5UA 4Y5HA 4CMTA 5A4LA 2IW9A 3C4ZA 4GSBA 4YP8A 3VS4A 1W8CA 3ORKA 4FMQA 4EOMA 2ZM3A 4CGAA 1KE6A 1Q8YA 2G1TA 4LDTA 4E73A 4JBVA 3QXOA 3RHXA 4ZTHA 5A6OA 2WIPA 2ZMCA 4CMOA 1IAHA 3MIAA 4MYGA 2YIQA 2R0IA 4YNOA 3WIKA 3EQDA 3ZLYA 3ZH8A 3B2WA 4C62A 4ZLZA 1GIIA 5C8KA 3QD4A 4EWHA 3QAME 1JBPE 4IANA 3RNIA 3E87A 4MWHA 2W4JA 2ITNA 1KE5A 3QQFA 4XJ0A 2AC3A 4OTGA 2UW0A 4ARKA 3R21A 3CQWA 4TYJA 2C30A 3R9OA 3LCSA 3FQHA 3V3VA 4BTKA 3ODZX 4RJ6A 4FKPA 4B4LA 3Q4CA 3BYUA 4X3JA 1A48A 3W2SA 4HVSA 4IVCA 1JKSA 5JFXA 3QC4A 3UPZA 3COHA 4IADA 3EL7A 1Q99A 4OUCA 5G6VA 5ACKA 4X3FA 5CI7A 3QRTA 3CCNA 5EW3A 1GZOA 1G3NA 1WZYA 2EXCX 1FVVA 1SMHA 2Y7JA 3EHAA 3BBWA 3NNVA 5DG5A 3RGFA 2QOCA 3PJ8A 4UXQA 4AACA 1VEBA 5J9ZA 2X0PA 4JDIA 3VJNA 2GPHA 2PMIA 3G6HA 3HEGA 3DKCA 4A9YA 3KK9A 5J5TA 4FG8A 3A7JA 3PA5A 1YXTA 4D55A 1OL1A 2V5QA 5AM7A 2CCHA 4Y8DA 4IAFA 3CY3A 4MWIA 2V55A 3EZVA 3PIXA 5GZ9A 2F2CB 4FZAB 2PTKA 3OBGA 4WHZA 3PXFA 1OL7A 4XLIA 4CV8A 4HCUA 4F7JA 4BIDA 1IEPA 4R1VA 4DHIB 2OK1A 3MWUA 4G6NA 4XG9A 3AMBA 5FG8A 2OF4A 3EKKA 4GK3A 2XYUA 5JRQA 3UO5A 4Z3VA 2PULA 4FEQA 4ANSA 3LVPA 1A06A 4UYNA 5E8VA 5JFVA 3ZYAA 4AW1A 4QQ5A 2P2HA 4UWYA 5LVLA 3RJCA 5EHYA 4AN2A 4FKUA 4DFNA 3D5XA 5KMKA 4WO5A 4YTHA 5B0XA 5CF4A 4FG9A 4IWPA 4YC3A 3OF0A 3DFAA 3SDJA 1W84A 2W17A 4B8MA 5JQ5A 3KXNA 4PTEA 2W1IA 4J52A 3D14A 3MS9A 1YQJA 3BHUA 3NCGA 2VTQA 4NIFB 5L6PA 1UU9A 2R3QA 2XYNA 2OWBA 3VF9A 1Q8WA 3OOMA 4IZ7A 4AW0A 2C5OA 2IW8A 3MFSA 4C59A 3CJGA 3GU6A 2ACXA 4MXXA 3Q2JA 3IW6A 3Q5IA 4I4EA 2PZIA 5I0BA 5CQWA 2QD9A 4RVTA 5DBXA 3IOPA 4AXFA 4ORKA 4BR3A 2YIXA 3QRKA 4Y46A 4R5SA 1RE8A 1Q62A 3QD2B 3N4TA 5DN3A 2J5EA 3HL7A 2IF8A 4OTQA 3P5KA 1ZY4A 4DH3A 2QR7A 5AP6A 4YLJA 3HV6A 4EQMA 4M13A 3AGMA 4JDKA 2F4JA 4D2SA 5A46A 4YMJA 4FTNA 4FEWA 5JRSA 2X7GA 4L46A 4QYFA 4F1OA 2QU6A 2WTJA 4ZY5A 5LCJA 2HW6A 5TKDA 4IHPA 3R83A 4CKIA 3CTHA 5IQCA 1NVSA 4AG8A 4DEIA 5L6WL 4NUSA 4DFBA 4BWXA 4WNMA 2W5BA 2BTSA 4ZJJA 4IB1A 3W33A 2WQMA 2YISA 5AA8A 4PV0A 5CENA 3CP9A 4AE6A 4Z7GA 1V0BA 5JK3A 4LFIA 4FR4A 2R3JA 3A61A 4FNWA 5AUUA 3KFAA 3WYYA 3OOGA 2XMYA 5LWNA 4IEBA 4F6UA 5HG8A 5BUIA 2XB7A 3V04A 2QOQA 4QP1A 4II5A 3BHYA 3GU5A 4MK0A 1TQMA 3KQ7A 3P4KA 1PMUA 2JEDA 4N0SA 4RA5A 1JLUE 4ZY6A 4X2GA 2O65A 4I3ZA 5AEPA 2YIYA 4KKGA 4L7SA 5AIKA 3HMOA 3VS5A 4EH2A 1YKRA 3VS3A 2XJ1A 2Y0AA 2ETRA 5C4LA 4G3EA 2XNBA 3PY1A 1FINA 3B2TA 3NUSA 4YPSA 1FMKA 3R7UA 5K4JA 5GIPE 3FUPA 4RWKA 5DOSA 4EOLA 2B52A 3U9NA 3LFSA 2XCKA 4CCUA 3EQPA 3NVMB 4CG9A 3I81A 1Q3WA 4K6ZA 3GOKA 5AM6A 3S4QA 3OW4A 3UBDA 3C5UA 5E8UA 4DC2A 3V5PA 4YO6A 1U4DA 4HW7A 3R0TA 5JZNA 2XALA 1Q61A 1Y91A 3PJ1A 3PRFA 4V05A 4TWPA 1VYZA 2XS0A 4HYUA 4FK3A 5E92A 4V04A 5DA3A 5M53A 5HLWA 4KNBA 3UGCA 4FV6A 3LCOA 3ORZA 1XJDA 4NM0A 2WTIA 3C0HA 2CKOA 4FEUA 4JI9A 3TUDA 3R00A 4YJOA 5CX9A 4XRJA 3LAUA 4A07A 5A54A 3ZEPA 4FOBA 4BC6A 1BLXA 3NGAA 3MBLA 4ALVA 4MHAA 3OUNB 5LVMA 4O82A 1I44A 3VUTA 3JY9A 3W32A 3HUCA 3W2PA 4EI4A 3QGYA 4TL0A 3QKLA 4BTMA 4F78A 4YBKA 3ZSGA 4FT9A 5LVPA 2O2UA 3E8NA 4K77A 3TKHA 4U0IA 4EUUA 3GT8A 3G15A 1URWA 4FKVA 2VNYA 4EK6A 4P5ZA 3PVUA 2UZWE 2BRBA 3AQVA 4PUZA 4YSJA 3SAYA 1IG1A 4TYEA 4U80A 5AR8A 3ZLXA 2YCRA 5H2UA 4ZAUA 2BPMA 5EOBA 1CKJA 3I0OA 5ETCA 3PA4A 4UBAA 2OG8A 3ETAA 4AQCA 2NP8A 3Q2MA 3QFVA 3BRBA 3UDZA 2VUWA 1YXUA 4UMTA 1IAJA 3HAVA 3OXZA 2JLDA 2XM8A 3KRRA 4FTRA 1PMEA 4LGHA 4TXCA 4EKKA 4OAUC 4PL3A 3FMKA 1DM2A 4BDDA 3QHWA 3BWFA 5J7HA 4NW5A 1J7UA 4F0GA 3BLQA 4M12A 3RKBA 3VULA 4BWKA 3ZS5A 3E64A 3ALNA 4GG7A 4GVAA 3SHEA 3ANQA 3ZM4A 2BRHA 4F63A 4G17A 4IAAA 4MUQA 5CU3A 3WZJA 5DNRA 3I7CA 5AP1A 3TNQB 4N6ZA 3BE2A 2XAOA 3PUFC 5AUVA 4J8MA 3TJDA 4FL3A 2ZM4A 4JAIA 3LZBA 3UG1A 2ESMA 3NUUA 4CEGA 4FV3A 3PVBA 3FZ1A 2P33A 2R64A 5EKOA 3QTRA 4F9CA 5FP5A 3FXXA 1B6CB 4PPBA 2BMCA 1Z57A 2WPAA 4QTCA 1BI7A 4ZK5A 3GENA 4IDVA 4U3YA 4IVDA 4BCGA 4EH3A 2BHEA 4QRCA 4JLCA 5IDPA 4LL5A 3C51A 2O0UA 3WZKA 3MA6A 3TT0A 2LGCA 1MP8A 4YZDA 3RZBA 5ANIA 4QMXA 2RF9A 3P1AA 4KWPA 3A