1XBAA

Crystal structure of apo syk tyrosine kinase domain
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
274
structure length
266
Chain Sequence
VYLDRKLLTLEDKELGSGNFGTVKKGYYQMVVKTVAVKILPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase SYK
publication title A novel mode of Gleevec binding is revealed by the structure of spleen tyrosine kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 85
structure length 266
sequence length 274
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2004-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1xbaA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1xbaA01
2Y7JA 3QXOA 4D1XA 2PVLA 4QP7A 2OW3A 3ELJA 2JBOA 4H1MA 3P7BA 2IVTA 3IDBA 5EG3A 3LIJA 3ZLXA 3VHKA 1UWHA 3TZ7A 1REJA 4OGRA 4O0RA 4ZZNA 2BHEA 3GXLA 5CAVA 4EOLA 4CCBA 1SNUA 4EOQA 4QP6A 5BMSA 1W83A 2W1CA 5ACBC 3OG7A 2FSOX 1YI6A 3SVVA 2EXEA 4MQ2A 2BIKB 4KINA 4PMMA 3F2NA 3F66A 3ZM4A 2VWWA 4X6QC 4X6RA 1DI8A 1S9JA 1ZY5A 1CKJA 5K9IA 4K0YA 1F0QA 2QVSE 2Y4PA 2WHBA 2ZDUA 3EQCA 1BX6A 4KKGA 3EYHA 4YHTA 3MJ1A 3LFBA 4GL9A 3N4TA 3WIGA 3HKOA 4YUQA 3R0TA 1H24A 3L8PA 2VRXA 4MAOA 4GT4A 3BQCA 4M67A 4YBJA 3TZ9A 1PXKA 3CPBA 2BZHB 3OY1A 3UIBA 3M42A 4M0ZA 4AZTA 3OY3A 3LFFA 4OBQA 1VZOA 3VJNA 4QMNA 3S95A 5AP0A 1J7IA 2UVZA 1PKGA 3ZHPC 1ZRZA 1UNHA 3SGCA 4E6CA 4M66A 3V5TA 2X2KA 4JDJA 2FSTX 2YA9A 4AW2A 4KSQA 2YWPA 5CNNA 5AUXA 1GIHA 2JIUA 4IB1A 3PZHA 1OL1A 3RI1A 4JRVA 2XYNA 5CEQA 4AZWA 3ZDIA 3Q3BA 5D10A 3FXXA 3D5VA 3QTZA 1H1PA 2VZ6A 3ENHA 3DAKA 3R1SA 1L8TA 1UU9A 1HCLA 2CDZA 3F88A 1TKIA 2WTDA 2DUVA 5EHOA 2RF9A 5CU6A 1CTPE 2J90A 5BUJA 5HNBA 4DGNA 1ZMWA 4NKSA 5HHWA 2JKQA 3OWJA 4AE9A 4M12A 4A9RA 3TM0A 3QRIA 3TG1A 5IA5A 5K3YA 4CCUA 4E5AX 4CYIA 1ZXEA 2WOTA 3QCXA 1JSTA 5A14A 3ZCLA 3VBXA 4X2FA 4MXAA 5K0XA 4WG3A 5ANOA 2UW9A 1QCFA 3G6HA 5KMMA 2IZSA 2RFDA 2UVYA 4FSRA 3TV6A 5E7RA 2CGVA 1B6CB 3CD8A 3LFEA 3R8UA 3AC3A 1PMEA 5EQPA 4H58A 4CFMA 5JZNA 3ERKA 2C6KA 4KKEA 3FZ1A 2QC6A 2X7FA 4RSSA 4NH1A 1ZYSA 4EH5A 2OU7A 5A9UA 1GIIA 3G9LX 5FRIA 3LVPA 4WKQA 3WBLA 5L6WL 1DAWA 4O0SA 3VQUA 4EHEA 1U4DA 2WTKC 4Z3VA 5A54A 2ZB0A 4FODA 5KNJA 4GW8A 3SV0A 3R7UA 3BHUA 5I9UA 4EONA 1BKXA 4DGMA 3BYMA 4D4SA 1XKKA 3IDCA 3Q4CA 4X3JA 4ALUA 4K1BA 4FEQA 1QMZA 4ASEA 5L2IA 3OS3A 5JGAA 4JIAA 2XB7A 3UQGA 5FDXA 3ORTA 1B38A 1P2AA 4I24A 3CQUA 1ZOHA 4BCOA 4EOOA 5DBXA 5AX9A 4LRKA 3TXOA 2J51A 5BUIA 5CANA 3L8VA 4L67A 3TKUA 3PLAE 1Q8YA 4FTRA 4TWNA 3ZSHA 4RRVA 4NM5A 2WB8A 4UWYA 3F2AA 3WF5A 4BI0A 3EQDA 3HYHA 3HMPA 3ZUVA 2C0OA 2R3LA 1OITA 2YM4A 3IG7A 2IZTA 3UZPA 3RHKA 3NX8A 4WOVA 2CNVA 1I44A 3C13A 1V0BA 4UN0C 1YDRE 2X7GA 4Y8DA 1ZARA 3BQRA 3COHA 4BRXA 3TTJA 2X6DA 4ZMFA 5T68A 2UZUE 4EOMA 2BRHA 3PP1A 5C8KA 5DRDA 5DEYA 2WMAA 2X2LA 3FMNA 3RINA 4EYJA 3QGYA 4RFMA 4HYSA 2WU7A 5DGZA 3LCDA 5HOAA 5JFVA 4FTIA 4J98A 3ORZA 2WEVA 3VUKA 4XHKB 2Y4IC 2WNTA 4OLIA 5CSXA 4AZVA 3ZMMA 3K3IA 5HLNA 5IQGA 1SYKA 3OT3A 5G1XA 4DEIA 4PMPA 3G51A 3KXMA 3M1SA 3W2RA 1H25A 1YVJA 2GHGA 5FBOA 3FY2A 3UPZA 3DA6A 1FPUA 2BDWA 4F0IA 4YC6A 1R3CA 3I0QA 4Y83A 1JPAA 2BRMA 4HOKA 4JT3A 5CT0A 4FV1A 5IF1A 3U55A 1RE8A 3BLHA 3KMUA 4FNWA 4S31A 4FX3A 4Y95A 3P86A 4LFIA 4CT1A 4FIGA 4APCA 3P7AA 3NUPA 3UOLA 1ND4A 4FKQA 5CF5A 3BE2A 1OMWA 3DLZA 4OUCA 2X7OA 2XVDA 2WTWA 4C2VA 4ZJJA 2YIWA 2P4IA 3MTFA 2W96B 4BGHA 4CSVA 4C4GA 3O71A 3UVQA 4YMJA 5A6NA 3L1SA 5D7VA 4NJDA 2BAKA 5T3QA 3TWJA 5CXZA 5DI1A 3PE1A 4UEUA 4LOQA 5HVYA 1OPKA 4QQ5A 4MNEB 1M2PA 2R3QA 1LEWA 1PW2A 2JBPA 2LGCA 3FV8A 4FUYA 4R7HA 3FMLA 4HNFA 4Q5EA 4CKIA 4CT2A 4EH9A 1PYEA 1W98A 3KREA 1M7NA 1YDTE 4YU2A 4QMYA 4OTDA 4B9DA 4BN1A 2PE2A 2UUEA 2YIYA 1TQMA 3AC1A 5KHXA 2G9XA 2XZSA 3CKWA 5AMNA 3LCOA 4BCJA 4QPSA 4GKIA 3MYGA 1WVWA 5IQIA 3UG1A 3NUXA 3S0OA 1P4FA 4YZCA 4FKIA 1PF8A 2PVNA 4FG7A 4BHNA 3W2SA 4ZXTA 4HNIA 3RJCA 4QMXA 4RX7A 3KGAA 4J96A 5CT7A 4KD1A 4HVIA 3LPBA 1GZOA 3LQ5A 5DE2A 4AU8A 4C58A 4IQ6A 4AWIA 2ITYA 3CE3A 3ZLYA 1FGKA 3LM5A 4V05A 5GIPE 4FKPA 5AV1A 1KOAA 1UKHA 3A8XA 4MXOA 5AP5A 1OL6A 2XK6A 3UYTA 4ZLYA 4G3GA 4IB3A 3QCSA 1BUHA 4JS8A 5DR6A 5GZ8A 3FHRA 5CASA 1ZOGA 2JD5A 4EOJA 3PWYA 5EH0A 4PL3A 1QPEA 3WYXA 3Q96A 5LMKC 3OWLA 3Q9WA 2ITUA 3TNQB 3U9CA 3QTRA 4D0WA 4WG5A 4HZRA 5EQYA 3FSFA 1XQZA 3PIZA 4NT4A 5CEPA 4D2TA 3W55A 4G6OA 4DFYA 3EJ1A 4FYOA 1J7UA 3JR1A 3DKOA 3U9NA 5M06A 4XRLA 3RCJA 3ZOSA 1JOWB 1NY3A 2C3JA 1R0PA 2IJMA 3NUYA 4LV5A 3BI6A 3NUNA 3P0MA 4WSQA 5HTBA 2PE1A 1OKVA 1J3HA 4B99A 2VX3A 4RQKA 4E6DA 4RQVA 2X9FA 3WZEA 4BI1A 3JPVA 5JRQA 4CG9A 4YJVA 3I0OA 3F3ZA 4MD7E 3SAYA 3LXLA 2J0KA 4TT7A 4AUAA 2Z7LA 3H4JA 2F7ZE 3W8QA 3O0GA 2XMYA 4S33A 2G2FA 1J91A 2P0CA 3MFSA 4FGBA 4AZFA 3C4EA 5I9XA 3ACJA 3BEAA 5F9EA 2C0IA 2XEYA 5M55A 3RK5A 2YIRA 1JBPE 1ZZLA 4TPTA 3U87A 4R5YA 4B8MA 4MYGA 5D1JA 1Y6BA 2PMIA 2R3FA 3JY9A 4M3QA 1GAGA 5CENA 3AT2A 3EQFA 2C5VA 2VWZA 3NR9A 3B8RA 2PK9A 3D15A 1XH8A 2VTIA 2YCSA 2A0CX 4U45A 4X2NA 3OXZA 5DOSA 4WHZA 4DT8A 4RX5A 5GINE 2FSMX 4FKSA 4KIOA 3FDNA 3KMWA 3VO3A 3W10A 4O2PA 5AR7A 4C4EA 5HIDA 5IMEA 1NT2A 2CN5A 3LJ1A 3ORXA 5IDNA 3DTWA 4AA4A 4I5CA 2DS1A 1OECA 2J2IB 4G2FA 4DEAA 3R21A 3ORMA 2QOCA 5HORA 3LAUA 3PXKA 5CSPA 4WRGA 2FB8A 2G01A 4ZJVA 4V04A 4I92A 5EOBA 3QC9A 3DNDA 2R3JA 2YACA 4AFEA 4U40A 3CTQA 1CKPA 1V0OA 1OKZA 2JDSA 2ONLC 4EWHA 3DKGA 3W33A 2A2AA 2QOOA 4U79A 1DM2A 4ITIA 4BVUA 4DH7A 2VWVA 2I6LA 2QR7A 3MH0A 4C57A 4FIJA 1KE7A 3OXTA 5DT0A 4MBJA 3PY0A 3UPXA 4FV0A 4J99A 2HY81 4WNOA 5HU3A 4CFNA 4L68A 1E9HA 5AP1A 4FIEA 1Q41A 1Q3WA 3GC8A 3PVBA 4JDKA 3F3UA 4FKJA 2HY0A 4IC8A 5LJJA 2YITA 3VAPA 3LJ0A 3RVGA 2EUFB 3I6WA 3QTQA 1X8BA 2FO0A 3GNIB 3N51A 4FTOA 5EW8A 5KUPA 4MD8E 4WA9A 4EWQA 4E20A 2FA2A 4F7JA 3L9NA 3TDVA 5AV0A 2X1NA 3BGZA 4FR4A 4U6RA 2JFMA 2ZVAA 3QQUA 3LQ3A 3QX4A 2OJIA 5L8JA 4O7SA 2C68A 2PYWA 4YPDA 1J1BA 2HIWA 2P2HA 2XKFA 3PJ1A 1Q61A 4PV0A 5CVFA 3W16A 4QMQA 1R1WA 5JGDA 1BI7A 4OTGA 3CD3A 2OXYA 3V5LA 3CP9A 5D12A 4TN6A 4E8AA 5BVWA 2PZPA 4IM2A 4YJUA 3DFCB 4WIHA 2EWAA 3QA8A 4YNOA 5EHLA 5B7VA 5EI6A 3RPYA 2AC3A 4QO9A 4UWCA 3ZO2A 3DBCA 3NAXA 1IASA 2XM9A 3V51A 2XH5A 2ZV8A 2OBJA 1BMKA 1CDKA 4BCPA 4CFVA 4BDKA 4EKLA 4H05A 1KV2A 5T6KA 5CI7A 1VYWA 4APPA 4FC0A 4YJOA 2XYUA 2OF4A 3SC1A 4ZTRA 2QHNA 4M15A 4IFCA 4WRSA 3IGGA 2IZUA 3ETAA 3JYAA 4BIBA 4R7IA 4FTQA 1YXVA 5BVDA 5HVJA 4HCUA 1UU3A 3A60A 3DKFA 2O5KA 1CSNA 2B54A 1REKA 3FC2A 3TJDA 4LOOA 2J0JA 2X2MA 4NK9A 3RALA 4D58A 5L2QA 2Q83A 3LFDA 4D0XA 3V6RA 5D41A 3ODYX 3OUNB 2WAJA 3PSDA 5CSVA 2PMNX 4FK3A 4JI9A 5CVGA 5GNKA 4A9YA 4AW1A 3QXPA 4UYNA 3OT8A 4BKJA 2JIIA 3I7CA 5K0KA 4KNBA 3EQBA 5HX8A 4A9TA 1IR3A 3F7ZA 3G90X 4IM0A 3WZUA 3BE9A 1SVHA 1DAYA 3R1QA 4AA0A 3E8NA 3LCTA 4U0IA 3R8PA 3AC5A 4O6EA 4IE9A 2AUHA 4F1OA 3DB8A 3IOKA 4JR3A 4G6LA 3E3BX 5E9EA 2ZMCA 4TNBA 5LOHA 2H6DA 4C59A 2XNOA 2HCKA 5GZAA 4M84A 5TO8A 3OCTA 4FIFA 5KKRB 3F9NA 3HX4A 5E8UA 5ANJA 3MY0A 4BCIA 4DTBA 1XBBA 3FMHA 4O1OA 3IS5A 4PMSA 4X3FB 4MKCA 3BWFA 4F63A 5FTGA 1YHSA 2RFSA 2YERA 3GFEA 4ZZOA 1W84A 4LL5A 3COIA 2WTJA 4GV1A 3S1HA 2UV2A 3Q2JA 4FKUA 3FLZA 2QOLA 4LMUA 3R9NA 3E7OA 3KN6A 4M14A 4D5HA 5AV4A 2GNJA 3CGFA 2DQ7X 2WQMA 2Z60A 3KXZA 5KBQA 2FH9A 2VO0A 4AF3A 2GS6A 4AGDA 2Y6OA 3GU4A 3PVWA 3O51A 3R1NA 2R5TA 3TIZA 3WF7A 5B2MA 4ZMEA 2CLXA 2ETRA 3T9IA 4N0SA 5I9YA 4JDHA 3W32A 3OCSA 3QKMA 4XP0A 4S30A 3JVRA 3DTCA 3UE4A 2WMVA 3R9RA 2JDVA 4K8AA 4GKHA 3PVGA 4OBOA 1WBPA 4IIRA 2HZ4A 3BPRA 4FTUA 2WMUA 2ZOQA 1IAHA 1L3RE 3OEZA 4X21A 4HVGA 3KC3A 4JDIA 4XUFA 4KRDA 2O63A 2B52A 4JG7A 3IW4A 2C47A 3ZO4A 3DV3A 4JBQA 1Q8ZA 2C6MA 2Z2WA 1KSWA 4D2PA 2C1BA 3JVSA 4FV3A 4QTDA 4I94A 1GJOA 3DZOA 1H26A 4HGLA 3ITZA 4QYHA 5CU4A 3RPSA 2GS7A 3VUTA 4V0GA 3R7YA 1MRVA 2XKEA 4FV4A 5HKMA 3RAIA 1T45A 3UODA 3DNEA 5H8BA 4FG9A 3ZSIA 5FQDC 3WI6A 2VTPA 1O6YA 1QPCA 2VWIA 1ZYLA 3DJ5A 4YLJA 2ITWA 3DT1A 3FLQA 4NYEA 4X3FA 2F4JA 4IWQA 4ZS0A 2R3HA 4RGJA 4BIEA 5EYDA 3G2FA 3ZUUA 4AW5A 4XX9A 4O86A 3QBNA 3HDNA 3LJ2A 3CR0A 3V5JA 1HOWA 4LUDA 3DOGA 1CMKE 4NM7A 3RMFA 3RPRA 3BX5A 4O21A 4FTMA 1AD5A 4I1ZA 3VUMA 2R3MA 4KBAA 4BCGA 5IEYA 5LVPA 3VS3A 3ZEWA 4NL0A 5A4CA 5L6PA 1URCA 2ZM3A 5CTPA 4KIKA 5HE0A 4QMPA 5AUVA 3KB7A 4D2RA 2ITXA 2C0TA 3GB2A 4KAOA 4EUTA 3CLYA 4FNXA 3DB6A 3EN9A 3L9PA 4E4XA 4KBCA 4MWIA 1ZAOA 4F6UA 4UMUA 3SW7A 2JC6A 4KB8A 2HK5A 3HV4A 2DWBA 4GFGA 5M08A 4ACCA 2A1AB 1V1KA 4GH2A 3A7HA 2W17A 3MIYA 3E7VA 3QRUA 4R5SA 2HELA 2Z8CA 4ZTLA 3VS1A 3IW8A 4FIHA 1PXPA 1FVVA 3F69A 4U81A 5J79A 5HO8A 1VYZA 3FZOA 1ZYDA 4E73A 4CMTA 3EMGA 5EI2A 4G17A 5M4UA 2XNEA 1EH4A 5I3OA 3VN9A 2OI4X 2REIA 4RA5A 4BDAA 5L6OA 3C4FA 2XRUA 1U5RA 2BDJA 3TCPA 4HPTE 4FT9A 3K5VA 4R6VA 5I9WA 2I40A 4FL2A 4P5ZA 2CCHA 5H8GA 4FT0A 2C6DA 2IO6A 4UZHA 4TXCA 4BBMA 4J97A 3NWWA 4BCMA 4BDEA 2OK1A 4O0TA 3DAEA 4AACA 4C7TA 4FIIA 4BCFA 4I22A 1GZ8A 2VO3A 4FEXA 2PHKA 4UB7A 5KZIA 4Y72A 2X8EA 4ZY5A 5IPJA 5ETIA 4KBKA 1ERKA 3ZBXA 4BTJA 4O82A 4JX7A 4S32A 4AN9A 4XP3A 4XG9A 4FI1A 4OTHA 5HEZA 3DJ7A 4P7EA 2A4LA 4ID7A 4LI5A 4MXZA 5EDQA 3QAME 4YJTA 5LXMA 2XCHA 5FGKA 4OTQA 2R64A 1KE6A 3ROYA 3ZFMA 3HGKA 4AGCA 4Q2AA 2XRWA 3EN5A 3FLWA 4ITJA 3EQHA 4YJNA 4XG3A 2WU6A 2GNLA 4JJRA 5E8WA 1H0VA 3PXQA 5FEQA 3V8SA 5IG1A 1H28A 3AQVA 4FT7A 4PDOA 2UZWE 3GVUA 4D28A 4EC8A 1BL6A 2BALA 3F3WA 4DG3E 2R3KA 4ZS4A 1OIQA 2R3GA 4QMSA 3PLSA 5EHYA 4DFZE 3LXKA 1IAJA 2CPKE 4F4PA 4EQUA 2VD5A 4QMZA 2YIXA 4RVKA 3FI3A 1CKIA 2VTOA 2V22A 4IC7A 4NW6A 4EH2A 3GCQA 2YLEA 2PZRA 3CY2A 2UW4A 4XV2A 5LVLA 5HG7A 4IWOA 4ZJIA 1GZNA 5L8LA 3RAKA 3EN6A 1H0WA 5M4CA 4FYNA 4BBFA 2W1IA 3RWQA 3H3CA 1KE8A 3MFUA 4ZP5A 3VJOA 3UQCA 3UC3A 3DPKA 4ANSA 3VF9A 2QI8A 5DT3A 2AC5A 5BYYA 5DMZA 4CG8A 4L52A 3HEGA 4FKLA 3D7TB 4K9YA 3LHJA 4ZTHA 4HJOA 1H1RA 4IVCA 5EM6A 5IUGA 4LGGA 3KULB 2UZOA 3MDYA 4F9CA 4GRBA 4I6HA 2VWUA 1OPJA 3HV6A 4FMQA 3WOWA 2A19B 1OVEA 2WOUA 3MS9A 3L8SA 4LYNA 1Z57A 3D83A 4CFFA 4R78A 2PTKA 4ERWA 3PRFA 2UW6A 4FTJA 2GCDA 4M69B 3F3TA 4RT7A 1OL7A 5CU3A 2OH0E 4L8MA 4G5JA 3KXHA 4IHPA 3FUPA 5CYIA 3QD4A 3NEWA 4C2WA 1H8FA 3QLFA 4IDTA 2ITPA 5FWKK 3TUCA 4QP2A 2EB2A 5L2SA 5DT4A 4EBVA 1JKKA 2Z7SA 4BI2A 3D9VA 2C6IA 3ALOA 3RNIA 4FV8A 3K2LA 3I5NA 3GU7A 4W4YA 2BZJA 4L3LA 3Q60A 4KUJA 4TWOA 2W7XA 4J7BA 4R7BA 3PIYA 1B39A 3FY0A 4ASZA 4DG0E 3DGKA 3R8MA 4KABA 4GIIA 4I0SA 5LWNA 2GQSA 3CKXA 4U7ZA 1WBWA 4F0GA 4F08A 4EZ3A 1JSVA 4E93A 4FK6A 3CJFA 5IQCA 3PPJA 1I09A 4GYGA 3BYVA 2GNHA 4IM3A 3VS7A 4DGLC 4ASDA 4BZDA 3EOCA 1APME 4BWKA 4EHZA 4NM3A 3QZHA 1WBSA 2SRCA 3GGFA 2JEDA 3GP0A 2R2PA 4N4SA 4LOPA 3KXNA 4XOYA 2JAMA 5A4QA 5FUTA 4CZYB 3PG3A 5AIRA 3RCDA 4JLCA 1OBDA 4PPAA 2OJGA 2ZV7A 2YM5A 4G3CA 3O8UA 2FVDA 4XS2A 3A4PA 3ORIA 4RWKA 2XA4A 1YW2A 2XIZA 4KWPA 3S2PA 4RVMA 5DVRA 4FSZA 1H4LA 3PJ8A 4YJQA 3QKLA 3QWKA 4ZY4A 4RBLA 2QOKA 4EK6A 4PL5A 2OIQA 2Y9QA 4RJ8A 3FI8A 5IMXA 2PSQA 4EOIA 4U3ZA 1XWSA 3JY0A 5HIBA 1OGUA 3NIEA 1GNGA 3D5UA 3ET7A 3FSKA 4FZAB 4QTCA 5EW3A 5CF6A 3N4VA 3KQ7A 2YAKA 4FSUA 5J7HA 2YHVA 1BYGA 3BCEA 2VNWA 2KTYA 4QRCA 4ASXA 4DAWA 4FUXA 3SKCA 4ZSGA 1GZKA 3UDBA 5GIOE 3QCYA 4GMYA 3U4UA 3RTPA 1O6LA 2PWLA 3AC8A 4TYJA 5L2WA 3BLRA 1XO2B 3KK9A 4H1JA 4UXQA 5AP7A 3VHEA 4DGOA 3U6JA 4IANA 1MQBA 4WUAA 5IUHA 4PP9A 3O7LD 4C3RA 4FF8A 2GFCA 3G6GA 3UNJA 1JKLA 3R83A 2Q0BA 2WMXA 1U59A 1Q8UA 4IADA 5H2UA 3OFMA 5E8SA 3UZRA 3WZKA 2VU3A 1P14A 2VTTA 2YAAA 5CALA 3RBWA 2YZAA 3W2OA 4OR5A 4DFBA 4P2KA 1V0PA 1PMUA 2V7OA 1Q97A 3C0IA 4QNYA 4RJ5A 4DFLA 2GQGA 5KMKA 1KOBA 1U5QA 3POZA 3OWPA 4L00A 2GPHA 4F7SA 4QP3A 4R3CA 3THBA 2XBAA 5IH4A 4H39A 4C4IA 4ORKA 2X4FA 3E8CA 5TF9A 3Q4TA 4PWNA 4TYHB 4Y5QA 2C5YA 5EYKA 3ENMA 3FHIA 3C4ZA 3I4BA 4FKOA 3UG2A 3ACKA 4A4OA 4GU6A 4RZVA 4W8EA 4UMPA 3M2WA 3UO6A 5HVKA 4X7QA 4R77A 5HTIA 1G5SA 3ZBFA 2PVKA 4IAAA 1PXNA 4II5A 3KRJA 2QO9A 3CC6A 4WNMA 3PRIA 5B2LA 4PTEA 1YKRA 2ZDTA 3ZXTA 3A61A 3D4QA 3LMGA 4D4YA 4BR3A 3MH2A 2VTJA 3N4UA 3GC7A 1JQHA 4I3ZA 4I5HA 4LQMA 2YDJA 3ANQA 3I7BA 4E1ZA 1OIRA 2I0EA 2QR8A 4FTAA 2PVYA 2V5QA 3NW7A 3V8TA 4ZAUA 3CSVA 3L8XA 4D55A 3NMUF 4CMOA 4EKKA 2BTRA 1YHVA 1JLUE 1WMKA 4BIDA 4YJSA 5DH3A 4BDJA 4DEEA 3QD2B 5AFVA 3F6XA 2BHHA 3HUBA 5CXHA 3EN4A 2IVVA 3F5GA 5HE3A 5CEIA 1OIUA 3DAJA 1J7LA 4G9RA 1P4OA 2WTCA 2J4ZA 3C50A 3OOGA 4EEVA 2IVUA 3WARA 2HZNA 3HV5A 3NLBA 4HYUA 5DWRA 4O7WA 1YXTA 4LRJA 4GK3A 4RJ3A 3EIDA 2NPQA 2VTMA 4MF0A 1YI4A 3P4KA 4AT5A 5DG5A 1K2PA 5FLFA 5J1WA 3HECA 4EK5A 4YTFA 2WMRA 3DU8A 1UWJA 3UZTA 2WMQA 2XNGA 4C38A 3FPQA 4XLVA 4N6ZA 2CLQA 3SLSA 5FTQA 5JFWA 4TNDA 2YZLA 3CBLA 3MTLA 2CGUA 4RG0A 3MA3A 5H9BA 4I5PA 2QHMA 5M51A 3ZU7A 5J1VA 4JR7A 1LPUA 2Z7QA 2XIKA 2PVRA 4U42A 3CTJA 5JFSA 3MW1A 5E4HA 3RPVA 3IQ7A 4LG4A 4BWXA 3K54A 4M7IA 5ITAA 3V5WA 3FMMA 4FKTA 4CFXA 3FQHA 1TVOA 2ZV2A 2EXCX 4ITHA 4IVAA 4O0WA 4FSYA 2QO7A 3DXQA 2WKMA 4DBXA 3G0FA 4O7ZA 2CKQA 3RAHA 2R3RA 4ANQA 4F7LA 1Z9XA 4G3EA 5K5XA 4MNFA 3NYVA 5E8VA 1TQIA 3VQHA 4YJPA 2E9PA 1PXLA 5CS6A 4D9TA 3L9LA 2YM7A 4JG6A 3FYKX 4IB5A 3MVLA 3BHTA 3IOPA 4YLKA 3O7LB 4BCKA 1WVXA 3PPZA 3PSCA 5E8XA 1VEBA 3SDJA 4CV9A 4D4RA 4NIFB 4IAIA 2RGPA 5AIKA 4OAVB 3EFJA 1OKWA 4E5WA 2EVAA 2V0DA 4K77A 4RJ6A 3UNKA 5DIAA 5BVEA 3BHVA 5J87A 4FGRA 4F9WA 3MA6A 4OTFA 4I93A 2WEIA 3TV7A 5CAUA 3NZ0A 3BU5A 2WELA 1PXJA 4MNEA 4NU1A 1Q99A 5BX0A 4DE4A 2PVJA 3ZONA 3CQEA 4C62A 2BKZA 2JKOA 5EDPA 5L3AA 3BEGA 1H1QA 5EQEA 4DEBA 4FG8A 1JSUA 4B0GA 5DYJA 3HP5A 1ZOEA 1OUKA 3BU3A 4FKVA 4I6QA 4IEBA 4ACDA 3UQFA 4IJ9A 4QTEA 3PXFA 4ZLOA 5KKRC 3HLLA 2RSVA 3MB6A 4FSNA 3FL5A 3RGFA 4D5KA 5BVOA 5A4TA 1QPDA 3H9OA 4JRNA 5EKNA 2IN6A 4NSTA 4OBPA 3FLSA 3DXNA 3KFAA 3ODZX 4GK4A 4QQCA 2HZ0A 2PVFA 3FXZA 3SD0A 5HBJA 4D2VA 2QQ7A 3MGYA 4X3FC 3WF6A 5IQEA 2YIQA 2ZAZA 3F61A 4WNPA 4XG2A 3PZEA 2GHMA 3BYOA 3KCFA 4HCTA 4W4VA 4GJ2A 5EKOA 1OL5A 3TJCA 2F9GA 3OVVA 4B4LA 4A7CA 2XK4A 5LWMA 3OUKA 2BVAA 5J5SA 5IH5A 5BYZA 1XH6A 3V04A 1XH4A 4CNHA 4ZY6A 3UIMA 5DFPA 3S00A 3SOCA 5DR2A 3EFWA 2XKDA 4CQEA 2W4OA 3UC4A 3R1YA 4BDDA 2XNNA 2CHLA 3AMYA 3FAAA 3O8PA 2WQNA 3V6SA 2YJRA 4BZOA 2OZOA 3RZBA 2YJSA 3FQEA 3QTWA 5TKDA 1IA8A 3UO5A 2OKRA 3RZFA 5ANEA 5HD7A 5KMLA 4PF4A 4CGAA 5CSHA 5I3RA 5JN2A 3HMMA 4TKSA 3UOHA 4BY9E 3EKKA 4Y46A 4FEUA 2R9SA 4XCUA 3PP0A 4L42A 4C35A 1NW1A 2YEXA 3PUPA 3VWAA 3R2BA 5GHVA 3VRZA 5KCVA 1LP4A 4IZAA 1VJYA 1KE9A 2FSLX 2UZVA 1H07A 1ZYJA 2B1PA 3FMDA 3G0EA 3JS2A 5C03A 3OBGA 2QU6A 4GU9A 4BDCA 1SNXA 4E4LA 2UZTA 3LOKA 3VF8A 4TWCA 4GG7A 2B53A 2QURA 4DFNA 1KE5A 4ZSAA 2Y4IB 3LCSA 1XR1A 1U54B 4IX4A 2GTMA 2R4BA 4I6FA 3ZC5A 4K18A 3OD6X 4BTFA 3A7FA 3UO4A 3HMNA 3VS6A 4FL1A 4TYEA 2WQBA 5HG9A 3IKAA 2PY3A 2R0IA 4EBWA 3REPA 3D2IA 2RKUA 1ZWSA 3O2MA 5HO7A 4EOKA 3TUBA 3I60A 3NNXA 4TW9A 3C5UA 4IH8A 5CAQA 5KMJA 4CEGA 5H8EA 3UP7A 3V5PA 3C1XA 1WAKA 2ETMA 4DFXE 4E5BA 5AA9A 3HV3A 3UJGA 3D7ZA 3H10A 4QP9A 3KXXA 4GVJA 2H34A 2OJJA 4F09A 1FGIA 3U51A 4DCAA 1GIJA 5C9CA 3F7WA 3LLTA 3TEIA 2C6LA 4GS6A 2Y0AA 1SM2A 2B9IA 3KVWA 3NCGA 3Q5IA 3RK9A 4FV7A 5KMNA 1SVGA 2W9FB 3RK7A 5HBHA 5HX6A 2E9UA 3D0EA 4FV2A 3E8EA 3IGOA 4FTLA 4PRJA 4IW0A 1H1SA 3FLYA 2QNJA 3F5UA 4O27B 4JXFA 4BCNA 4NEUA 3BU6A 4UALA 2GDOA 3ZZEA 3MPAA 4IAKA 3BZ3A 4ACHA 4ANLA 4DN5A 4EUUA 3KY2A 2O3PA 4ZSLA 2R3NA 2VO7A 3AXWA 2VX0A 4DF3A 1Q62A 4ZOGA 4MK0A 5AX3A 3OHTA 4QPMA 4RPVA 5AAFA 1PXMA 4QMMA 5ETFA 3GQLA 3UTOA 4BTKA 5AUZA 4IX6A 2W4JA 4IWDA 4AA5A 2P2IA 4OTPA 1OBGA 2ZMDA 1XHAA 3IONA 3VS0A 5E91A 4RC2A 4ZTSA 3EQIA 4AQCA 5C26A 5IDPA 4RVLA 5KX8A 4AP7A 3O17A 3FXWA 5FM3A 2Y8OA 2YDIA 3PIXA 4EQMA 4E7WA 3SG8A 3PA3A 2BROA 3SA0A 3KRXA 4FSWA 4UX9A 2VTRA 3TN8A 4EOSA 4RIYB 1F5QA 4FSQA 2C6EA 4U5JA 1QPJA 4L9IA 3W8LA 3ZDUA 4AOIA 5F4NA 4CTBA 4DH5A 5IA4A 5IA1A 3QYWA 5KMOA 3DCVA 5DRBA 4NZWB 2XIRA 2EU9A 5HESA 5A46A 3TI1A 2F49A 3H30A 4LGDA 3UMXA 3NNWA 4DH8A 4NM0A 4E4NA 2YM8A 3EL7A 5KO1A 4XMOA 3C4WA 3FI4A 5CF4A 3HUCA 5AAGA 2GNFA 4XG4A 2VTHA 1O9UA 4OTIA 2R7BA 2R0UA 2QCSA 4F99A 1Y8GA 2OXDA 5ACKA 3EQRA 4HGSA 2WMWA 3DJ6A 4AN3A 3MJ2A 5LARA 4C61A 1PY5A 4D1SA 2I7QA 1Q8TA 2XNPA 3C4XA 4DG2E 3NVKI 3KU2A 2YABA 3Q04A 4MXXA 1UNLA 5ANGA 4ZLZA 3QCQA 2IW8A 4DEDA 1Q8WA 2OGVA 3FQSA 4E6QA 5AM6A 1PXIA 1FMOE 4XV9A 3RPOA 1OL2A 1ZYCA 1H01A 3B2WA 3B8QA 2Q0NA 2XK8A 5GZ9A 5D7AA 1XH5A 4TRLA 2QOBA 2IWIA 3E92A 5HU9A 4RA4A 3BHYA 4M97A 2O8YA 5M57A 2PUUA 4CMUA 3NUAA 3I1AA 4BDIA 4ENYA 4C33A 5LCJA 3R63A 2BRBA 1OKYA 3HDMA 4QMUA 2B4SB 5B0XA 3KKVA 5JRSA 3ZO1A 3EKNA 3C7QA 3VUGA 3VC4A 4U97A 5DLSA 3COKA 4QTBA 3SRVB 5FTOA 3HRBA 3NUSA 3DBDA 3COMA 1Y91A 3OROA 1OZ1A 1E1VA 4G16A 5BNJA 2Z02A 3HZTA 3QHWA 5FD2A 4EJNA 2OZAB 2CNQA 4RIXB 4NW5A 4M8TA 2XUUA 5DHJA 2VTSA 2C30A 2PZIA 5LQFA 2VWXA 4C4JA 1R39A 2JGZA 4ZZMA 3GCSA 4I21A 2ITTA 4LL0A 2UW8A 3KL8A 2WGJA 3UIUA 2XJ0A 4BKYA 4BWPA 4F6SA 1A9UA 5JMSA 2J50A 2BCJA 3MFTA 3OF0A 4L3JA 4QYEA 2X0GA 1YQJA 5HQ0A 4G31A 3EFLA 3I79A 4QD6A 5I5ZA 2YDKA 3AD4A 3EWHA 5HD4A 3GQIA 3WILA 2OIBA 2QO2A 3I81A 3EQGA 4KS8A 2IW9A 5C4LA 2WIHA 3A4OX 3EN7A 3IW6A 5CQUA 5E1EA 4PDYA 4G9CA 2ZV9A 3HMOA 4AZEA 4C4FA 2GQRA 4YP8A 3BV2A 5FEDA 1NVQA 2J0MB 4FVRA 4AW0A 5C01A 1Q4LA 1OM1A 3FMJA 3ZRKA 4Z55A 3AC2A 4L43A 4DHFA 4C3FA 4L45A 5HCXA 4RWIA 3LFNA 3DKCA 4QMTA 3BWJA 4CXAA 2E9OA 2IG7A 3ATTA 1J1CA 2BUJA 1WBOA 1UNGA 4Q9ZA 4O7YA 5CAPA 1PMNA 2C69A 4YTHA 2WMSA 3JUHA 3QD3A 1F3MC 2QOIA 3MH3A 5HLPA 3R28A 4NUSA 2DYLA 2GNIA 3CJGA 3EL8A 4AT3A 1XJDA 4I4FA 5LMAA 2C4GA 2CGXA 4E3CA 3AT4A 5CI6A 2X4ZA 4YJRA 2VTQA 4R8QA 3NUUA 4DYMA 4O0YA 3OOMA 4BL1A 4FSTA 4FEWA 5AP2A 3WZDA 2GS2A 3OW3A 5CY3A 4ARKA 3R7IA 5AA8A 2HOGA 4BCHA 5JKGA 4MD9E 2C5XA 5HCYA 5IQHA 2NP8A 4GEOA 1MRUA 4NFMA 4QMVA 4C0TA 4E26A 2ZYBA 3WE8A 3IK3A 4EHVA 5HE2A 3CGOA 4HYIA 3DFAA 3LW0A 3EB0A 4FTTA 3GC9A 3RKBA 3P79A 3LFQA 5H3QA 1YRPA 2W5AA 3I5ZA 4FOCA 3HA6A 3D5XA 3K3JA 3CPCA 4J52A 3NSZA 4L7SA 5D9HA 5FXQA 5AAEA 3EFKA 3DBQA 1FVRA 4Z7GA 4MVFA 4QP8A 2O64A 2ZM1A 3T3UA 3V3VA 4EC9A 5TOZA 3SX9A 3TNPC 2C6OA 5KE0A 3RAWA 4B8LA 1SMHA 5HZNA 1H1WA 2FGIA 4IAZA 1ZLTA 5HIEA 4IWPA 2VTLA 3GU8A 4IAYA 3QU0A 4N70A 5CLPA 3VUHA 4ZIMA 2J5EA 3A62A 4FZ6A 2A27A 1XH9A 4X2KA 3QKKA 2CMWA 4YSMA 4BDGA 4HYHA 3ZO3A 2VGOA 3DLSA 5E92A 4O7NA 5I9VA 5AJQA 3LLAA 3O96A 4AOJA 3PXZA 4IACA 4UBAA 2QLQA 4EK3A 3SG9A 3A7GA 5HO6A 2W1ZA 4EI4A 5AR5A 4EK4A 1DS5A 2WMTA 5BPYA 3IW7A 4PQNA 5IKWA 3E63A 1FINA 3QYZA 5F94A 3OZ6A 4RVTA 3E64A 4IBMA 1UU8A 2YM6A 3LE6A 5IEVA 5HNIX 4ZK5A 4XG8A 1MUOA 2JITA 2VGPA 5HGIA 2PU8A 3VBVA 4CD0A 3QX2A 3R8VA 2UW5A 4EK8A 5EFQA 5EM8A 2PPQA 3E62A 2I0HA 4JBOA 4OTWA 5M09A 3NVMB 4O2ZA 3AGLA 3R7OA 3VBTA 4DLJA 4F9YA 4UMTA 3IW5A 4OW8A 3E3PA 2OO8X 4NCTA 5EM7A 4ANBA 4N57A 1BLXA 1UU7A 2HWOA 4FV5A 2W1HA 4MCVA 4P5QA 4JX3A 4TWPA 4CTCA 5LVOA 3UOJA 3FWQA 3KMMA 4Q5HA 5CAOA 4LGHA 4JNWA 3A7IA 2W4KA 3GI3A 3P08A 4PL4A 4PX6A 2ETKA 3H9FA 5J9ZA 1YOMA 4YC8A 4AAAA 3U6HA 3NNVA 2XNBA 4ZTNA 3UMWA 2ITQA 3TACA 1IEPA 3TT0A 4FTCA 4W8DA 3MIAA 5AR4A 3FZTA 3C4CA 5HI2A 4AZSA 4WUNA 4FZ7A 3KN5A 4GJ3A 3VRYA 2HW6A 3RNYA 4E4MA 4O91A 1NXKA 3QQGA 2UZDA 3W2PA 4XLIA 1FOTA 4QYFA 4DH1A 3AGMA 2X8IA 4FV6A 2R3PA 3CTHA 4M13A 4F64A 3ZXZA 4FE2A 1PYXA 3E93A 4MF1A 2WMBA 1KUTA 2ZM4A 4FZFB 4I41A 3WIKA 2VN9A 2QOFA 5CZIA 3EH9A 3QL8A 4I0RA 4GT5A 2BAQA 4BF2A 3KXGA 5E8YA 4R3RA 4Y73A 3O23A 3QQJA 4UMRA 5AUUA 3F82A 3PFQA 3FLNC 2F57A 3OTUA 4RFZA 5DN3A 4FVQA 3R2YA 4JBVA 4ZTQA 2XF0A 3QZFA 4QMLA 3ZFYA 1YOJA 4RMZA 4EYMA 2RIOA 5F1ZA 3QUEA 5CSWA 4YSJA 3ULIA 3EYGA 1E1XA 2WO6A 1UVRA 2YN8A 3AMAA 4S2ZA 4Y85A 4A9UA 2QKRA 2PVHA 4HGEA 2X8DA 2QONA 1IG1A 4QMOA 4EH4A 4W4XA 3NCZA 3UNZA 3R6XA 3IO7A 3PY1A 4HGTA 4AE6A 3PJCA 2W06A 3QD0A 3VBQA 4EORA 5ANIA 3PDTA 2BDFA 1Y6AA 4J53A 5FP6A 2OJFE 3BLQA 4BTMA 1NA7A 4XG6A 5FP5A 1QL6A 3GU5A 4WD5A 4D2SA 2QD9A 4MXYA 3P5KA 4O84A 3A7JA 3A2CA 3QA0A 4H3BA 2JFLA 2R7IA 3D7TA 4I0TA 2G15A 2C6TA 2F7XE 2C3LA 3KULA 3BYSA 4WT6A 4ONAA 5B2KA 3R22A 3GCUA 1WVYA 4PNKA 2Y6MA 4NWMA 4H3PA 4R1VA 1ZMUA 4M69A 2G2IA 4UMQA 4C37A 2XS0A 3GC0A 3GFWA 3Q9YA 3NPCA 2YISA 3QZGA 4H3QA 3SW4A 4JQEA 4QP1A 3GCVA 2J9MA 4YHJA 1CM8A 4KKHA 1RDQE 1OUYA 2QG7A 4AS0A 3ORNA 5A4EA 1JKSA 5AM7A 5JT2A 1WBTA 3A8WA 4YTCA 3MI9A 5DNRA 2RG6A 4ZSEA 1URWA 5CEKA 3VW6A 2YCFA 5AR3A 3U8WA 4NFNA 4Z7HA 3TKIA 3PXYA 4IXPA 4OT5A 3R7EA 4J71A 3QTUA 5C8NA 2BR1A 4YTIA 2OFUA 2UW7A 5KBRA 4IVDA 2O2UA 3MVMA 1LUFA 4Q9SA 2CKOA 4UY9A 3TZ8A 3P7CA 2QU5A 4YZDA 3DQXA 3KRWA 2J7TA 4BDHA 3C0HA 4F1TA 4ZEGA 3BHHA 3PPKA 5IA2A 4DFUA 5M44A 4M0YA 1M52A 3FKLA 5EYMA 3V01A 2RFEA 3ZSGA 5EOLA 2ERZE 4JBPA 4FNYA 4DTAA 2RL5A 5AUTA 5JGBA 2JIVA 3Q6UA 2W99B 2F2CB 5TE0A 3PG1A 4G3DA 3S3IA 3Q53A 2BPMA 2EB3A 2E9VA 4IJPA 4TL0A 5BYLA 2WQEA 4RX8A 5ETAA 1R78A 3ZFXA 4BC6A 3PTGA 5J9YA 2HZIA 2V62A 3CXWA 3K5UA 4XRJA 3AG9A 5DA3A 5AV3A 4YLLA 2XEZA 4XG7A 4D1ZA 2VX1A 2YCRA 4O7TA 4V01A 4CV8A 3VS5A 4HW7A 3DK6A 3LMHA 3MPTA 3Q4UA 4TYGA 1LEZA 1JKTA 4U41A 5F20A 2XK3A 3FI2A 4O0XA 3UOKA 4CVAA 4EH3A 1BI8A 4Y5HA 3ZS5A 4U3YA 4U44A 3SXSA 2HAKA 3RWPA 2OIDA 4X0MA 4BZNA 3GT8A 2OICA 2LAVA 3GENA 4BHZA 2IPXA 3R00A 3OP5A 3D5WA 2W05A 3QUPA 5EYCA 5AADA 5HG5A 3FZSA 4KSPA 2OJ9A 4FEVA 5HNGA 1O6KA 4M68A 3QGWA 3DBEA 3UIXA 2WTIA 1JAMA 5GJDA 4IZYA 5EDRA 4MWHA 3QRJA 4CFUA 3MVJA 4BYIA 2AYPA 3O8TA 5E90A 3MFRA 1OPLA 4U8ZA 3HMIA 2PMLX 4KIPA 2PE0A 1M2RA 1PJKA 4N6YA 5CX9A 3HAMA 1WBVA 4FTKA 2B55A 2I1MA 2QOQA 4G34A 4TTHB 4TYHA 1PHKA 4EZ5A 1W82A 3OEFX 4X2GA 4B6LA 4BCQA 4O0UA 2NRYA 3JXWA 3KF4A 2H8HA 4NTSA 3R71A 5GJFA 4CQGA 3PSBA 2C5NA 4MHAA 1RW8A 4JIKA 3HA8A 4RIWB 4QYYA 4XV1A 4A4LA 2XM8A 3LXNA 2ITZA 3LXPA 4LM5A 2CNUA 4CRSA 4PTGA 5CWZA 2G1TA 3AD6A 4FTNA 3FMEA 3DK3A 2IW6A 3Q2MA 3FBVA 4R1YA 4O7RA 2UZEA 2NO3A 4PY1A 3D14A 4U80A 3Q32A 1YDSE 3TNHA 3VNTA 2XJ2A 4DEHA 4FA2A 3EHAA 2FYSA 5IQBA 3EZRA 3GOPA 5JFXA 3DS6A 3G5DA 3R30A 3VULA 4EL9A 1WZYA 2I0YA 4C36A 1FBNA 4QYGA 3GOKA 4RJ7A 3FPMA 5IH6A 2J0LA 4AFJA 3IDPA 3SQQA 4CZTA 4G1WA 4JAIA 5AR2A 3TZMA 1MRYA 4BGQA 2BILB 4B7TA 3TNIA 4EH7A 5D11A 1K9AA 3AOXA 5C27A 4DINA 3R02A 3UVRA 2VWYA 1YWNA 4F70A 3HRFA 4TYIA 3QTXA 4H36A 5JSMA 3CY3A 2OSCA 2IZRA 4PPBA 4DGGA 5CU0A 3T3VA 4AG8A 2W1DA 5LMBA 5LVMA 4PPCA 3VUDA 2WD1A 1G3NA 4W4WA 4YR8A 4C34A 2I0VA 4YZBA 5IUIA 2V7AA 4AN2A 4F9BA 3R8LA 4ANNA 4GCJA 4IDVA 2NRUA 5EI8A 3FZRA 5J95A 4RZWA 2JDRA 3S4QA 4DITA 5K4JA 2O0UA 1M14A 4RWJA 4DH3A 4CZUA 2CSNA 4EH8A 2WPAA 5JQ8A 3UP2A 3C0GA 2QLUA 3BV3A 4JQ8A 3ZLSA 4YNEA 3F3VA 2OLCA 3CEKA 2WTKB 2RG5A 4HCVA 4ENXA 2VUWA 2XK9A 2KULA 2P3GX 4XEYA 1Q24A 3QUDA 3VBWA 4IVBA 4RJ4A 1YXUA 4PP7A 5LCKA 3MVHA 4UYAA 4YZMA 3Q4ZA 4RIWA 4JOAA 5IU2A 5HTCA 1WFCA 4GT3A 4QTAA 1OIYA 2F2UA 3P23A 1M7QA 3DDQA 3WZJA 1MP8A 2QKWB 2RFNA 2UW3A 3GBZA 4YGAA 5BUEA 4MBLA 2E2BA 4QQJA 3BBTB 2ERKA 4KIQA 2ESMA 3ROCA 3HL7A 5BVNA 4O7LA 3M11A 3P1AA 2OWBA 3GEQA 4NIFA 4RLLA 4DEGA 4F7NA 4CKJA 3TV4A 5CEOA 5M53A 3F5XA 2E9NA 3R73A 1RJBA 3G9NA 4DC2A 4F6WA 4FBXA 1Q3DA 4RC4A 5HE1A 1YXXA 4PTCA 2ITOA 3VS2A 1G8SA 4OT6A 2B0QA 2C3IB 5E8TA 1G8AA 5J8IA 1KV1A 3WYYA 1HCKA 3TUDA 1K3AA 4QNAA 1YHWA 2BAJA 3GCPA 2EXMA 2XKCA 3QRKA 4RX9A 5ANDA 3HP2A 4FV9A 5TT7A 5HLWA 5CNOA 3W1FA 2YWVA 2Z7RA 4A07A 3LFCA 4BDFA 2WZJA 1ZZ2A 1NVRA 3T9TA 3KCKA 3LM0A 4QQTA 5LVNA 3VIDA 3FKOA 3G15A 4YZNA 1M2QA 2PVMA 2W9ZB 3MWUA 4ALVA 1M17A 2OFVA 4RC3A 2BRNA 2O65A 3OW4A 3ORPA 5HBEA 3ID6C 4UV0A 1XBCA 4HVDA 1JNKA 3QZIA 3V5QA 3MV5A 2XP2A 2WQOA 3LFAA 3CS9A 4G5PA 4JG8A 1TQPA 4XH6A 5I4NA 2X6EA 4KRCA 3H0ZA 4MTAA 2XIXA 4EZ7A 1FVTA 4UWBA 4YO4A 3ATSA 4EHGA 3DY7A 1H08A 3ORKA 5CF8A 4YURA 5J5TA 3CIKA 3R04A 4G6NA 4W9XA 3Q9ZA 3QTSA 3PA4A 3RHXA 5IQAA 1XH7A 5C8MA 3MB7A 4BGGA 5ETCA 3KEXA 3QALE 4XNEA 5J7BA 2X39A 4GVAA 4ANOA 5KHWA 3R7VA 4YC3A 5AUYA 1AQ1A 2W5BA 5IISA 2WXVA 2J0IA 3W2QA 4A4XA 4F65A 4Z16A 4PMTA 3TTIA 4BBEA 3C5IA 4WBOA 2VTNA 5BQ0A 4CYJA 4FSMA 5G6VA 2PZ5A 5KZ0A 2XK7A 2NNWB 1LR4A 3VS4A 2XBJA 3LZBA 1RQQA 4DLIA 5A4LA 2CGWA 4J8MA 5CEMA 2W5HA 4PUZA 1VR2A 3IPHA 4LV8A 1YI3A 3ULZA 1Y57A 3BKBA 4WNKA 2UZBA 3BGPA 5IEXA 1H00A 4FNZA 4O38A 4O22A 3I6UA 5M07A 3OC1A 4I6BA 4BFMA 4BKZA 3PE2A 3QC4A 3BRBA 4XJ0A 4FZDB 2JKKA 3EQPA 4USDA 4ZSJA 4NCTC 3ZTXA 4NTTA 2XJ1A 2GSFA 5FDPA 3LKMA 4O7VA 4L7FA 2QODA 4RIOA 4AT4A 4QMWA 3Q6WA 1NVSA 3QLGA 1U54A 5A3XA 3KVXA 2BFXA 3NW5A 1SVEA 4YPSA 5IA3A 4JQ7A 3D2KA 5DR9A 2GFSA 4GUBA 4BYJA 3AD5A 4UXLA 2B9FA 2HENA 4I4EA 5HICA 3II5A 2C3KA 5ANKA 5AP6A 4F9AA 4MQ1A 3BIZA 4OAUC 3U6IA 4DA5A 4Z9LA 3ZEPA 3QQKA 5EK7A 2R3IA 4HVSA 3U54A 4QPAA 3MPMA 4J1RA 4BDBA 2OH4A 5DPVA 1WBNA 3OCGA 4C4HA 3SHEA 1FMKA 5AR8A 3KRLA 5JQ5A 4KA3A 5AV2A 4O0VA 5BVKA 2PUIA 1AGWA 2GTNA 3BELA 1IRKA 2W1EA 3ZRMA 1WCCA 2C5OA 5L8KA 5M4IA 3SXFA 2C1AA 1XBAA 4TY1A 1UKIA 1OI9A 3QQFA 3UVPA 1UV5A 2W1FA 3P78A 4W9WA 4D2WA 3UYSA 3DZQA 1H27A 3NS9A 3QWJA 2CCIA 3FYJX 4P90A 3R7GA 3MBLA 3FZPA 4ACMA 5JZJA 5IQFA 2JDTA 2UW0A 3POOA 4K33A 4V0GB 3W18A 4EH6A 4AGWA 2UVXA 4HZSA 5FBNC 4JVGA 3SOAA 3IECA 4WG4A 3ZC6A 4GFMA 4L53A 3NNUA 3PY3A 4XV3A 5AWMA 2GMXA 2BRGA 2ITNA 3AT3A 3FEGA 1P5EA 4FKWA 3TDWA 4K6ZA 3PJ3A 4XP2A 5K4IA 3QFVA 2R3OA 2QG5A 4ACGA 1Y8YA 4GYIA 4PDPA 3KK8A 3U4WA 1IA9A 3PA5A 5L2TA 3R8ZA 4DBNA 3RM7A 1T46A 5BVFA 4FL3A 3WF9A 1MQ4A 3E87A 3WF8A 1PKDA 1A48A 2QOHA 5F95A 4GK2A 3WE4A 4I20A 4C3PA 2PUNA 3ZZWA 3MN3A 4O83A 5M4FA 1YWVA 2XCKA 5FXRA 3R9DA 4O6LA 4XOZA 4RIYA 4GIHA 4WBBB 5IQDA 4O96A 5IA0A 3R9HA 3BGQA 4KIKB 1KWPA 3ZRLA 5LMKA 4S34A 4HVHA 5FXSA 3HAVA 2VAGA 3EZVA 2WIPA 4IX3A 3DDPA 4O1PA 2G2HA 4OTRA 1GY3A 5FG8A 4EJ7A 5K5NA 3Q5ZA 4IX5A 4G3FA 1PRYA 3LQ8A 4XBRA 4L44A 2JKMA 2HWPA 2B9JA 3NYXA 2BZIB 2B9HA 2GU8A 4U9AA 5EW9A 5HCZA 5JH6A 3OXIA 4HPUE 4IAFA 3LMIA 2OXXA 4GFOA 4J8NA 1SZMA 2VWBA 4FVPA 2F7EE 4KS7A 2BZKB 3BBWA 3HVCA 4C02A 1GOLA 1R0EA 2YM3A 3W2CA 4EOPA 5AEPA 2WFYA 2CJMA 4K11A 4L01A 2VO6A 5C1QB 2ZJWA 3NRMA 4NJ3A 1OB3A 4AXAA 4RLKA 4O81A 5FEEA 3V8WA 5M56A 3CCNA 4IZ7A 2X81A 3P9JA 3E88A 5JK3A 3F2RA 4XBUA 3ZYAA 2YLFA 1W8CA 3NIZA 3NAYA 3N9XA 3VVHA 2OG8A 4GUEA 4FT5A 3H0YA 4PNIA 2BIYA 3VUIA 4I23A 1PMVA 4E6AA 5ICPA 3DXPA 3FC1X 2VTAA 4DT9A 4JAJA 4A9SA 5EM5A 4IFGA 3MY5A 3VBYA 5CVHA 4FKGA 2HXQA 2BKKA 4K2RA 3OWKA 4CRLA 3FL4A 4X2JA 2YCQA 3DK7A 4DCEA 5DEWA 2PULA 1U46A 4ALWA 2XIYA 5FM2A 5J9LA 3E5AA 3HNGA 3GU6A 3MSSA 3PXRA 5HG8A 5I9ZA 3QRTA 4MEDA 5IZFA 3SRVA 1DI9A 1ZY4A 3F5PA 3KRRA 5AUWA 3FJQE 4CKRA 4USFA 2CN8A 1YXSA 3PWDA 4CLIA 2UZLA 4TZRA 2P33A 2YFXA 3ORLA 4YO6A 4A06A 2CKPA 3Q9XA 5AP4A 2HW7A 2CKEA 1W7HA 2OZAA 3AMBA 4RIXA 5AP3A 4CLJA 3HRCA 5TR6A 5JEBA 3QQHA 4PDSA 3ZM9A 2ZB1A 2J6MA 1YOLA 1ZMVA 3QF9A 3RP9A 1STCE 2OF2A 3PJ2A 3UBDA 4C8BA 1PXOA 4GG5A 4ZTMA 4AX8A 4BICA 5CZHA 3HV7A 4F1MA 3MESA 4L3PA 3DQWA 3LFSA 3ALNA 2ONLA 3C51A 3NYNA 2VV9A 4RWLA 3L9MA 3OBJA 2ITVA 2J5FA 2B7AA 2XNMA 3NDMA 4UZDA 3R9OA 3T8OA 4QT1A 5I0BA 3H9RA 2HYYA 2PL0A 4XYFA 3SXRA 5E1SA 2JDOA 4DTKA 4EQCA 5A6OA 3LCKA 2PZYA 1BL7A 1S9IA 3DBFA 3Q52A 3QQLA 1UA2A 4MX9A 3OMVA 4U43A 4IZ5A 4WSYA 2HXLA 5GJGA 3RM6A 4ANMA 5L4QA 2X9EA 1ATPE 2BFYA 3QHRA 2WTVA 1Q5KA 3TIYA 4MXCA 2UZNA 3NYOA 1W0XC 3D94A 4D4VA 4FOBA 5CU2A 2JLDA 3UGCA 2H96A 4JL9A 4R3PA 5E8ZA 3NW6A 3PYYA 4MBIA 4AGUA 3R01A 3FE3A 4USEA 3OCBA 3AC4A 5CQWA 4MH7A 3TNWA 3TL8A 4CFWA 3CQWA 1JVPP 2IVSA 5BMMA 5KMIA 5C4KA 4QP4A 3PVUA 3BYUA 3QTIA 4FKRA 4IMYA 2PMOX 4QOXA 2BTSA 3O50A 4P4CA 3ANRA 4LUEA 1YWRA 4L6QA 2P55A 3E8DA 2ACXA 3GUBA 3NGAA 4NKAA 4FICA 4RFYA 3TKHA 1FQ1B 4GSBA 2GNGA 3B2TA 2VNYA 3FMKA 4YBKA 3VW8A 3ZUTA 4AOTA 2GHLA 3OTVA 4LMNA 4ERKA 3ZH8A 2JAVA 3A99A 4BB4A 4YHFA 3FKNA 2V55A 1A06A 2H9VA 4WO5A 3ZLWA 4LRMA 4FT3A 4J95A 3KF7A 2PUPA 1Z5MA 4F0FA 3G33A 3KA0A 3MY1A 4YZ9A 4D9UA 4I5MA 2W1GA 1JWHA 2BMCA 4IB0A 3C9WA 4L46A 2W0JA 2FUMA 3MH1A
chains in the Genus database with same CATH superfamily
2Y7JA 3QXOA 4D1XA 2PVLA 4QP7A 2OW3A 3ELJA 2JBOA 4H1MA 3P7BA 2IVTA 3IDBA 5EG3A 3LIJA 3ZLXA 3VHKA 1UWHA 3TZ7A 1REJA 4OGRA 4O0RA 4ZZNA 2BHEA 3GXLA 5CAVA 4EOLA 4CCBA 1SNUA 4EOQA 4QP6A 5BMSA 1W83A 2W1CA 5ACBC 3OG7A 2FSOX 1YI6A 3SVVA 2EXEA 4MQ2A 2BIKB 4KINA 4PMMA 3F2NA 3F66A 3ZM4A 2VWWA 4X6QC 4X6RA 1DI8A 1S9JA 1ZY5A 1CKJA 5K9IA 4K0YA 1F0QA 2QVSE 2Y4PA 2WHBA 2ZDUA 3EQCA 1BX6A 4KKGA 3EYHA 4YHTA 3MJ1A 3LFBA 4GL9A 3N4TA 3WIGA 3HKOA 4YUQA 3R0TA 1H24A 3L8PA 2VRXA 4MAOA 4GT4A 3BQCA 4M67A 4YBJA 3TZ9A 1PXKA 3CPBA 2BZHB 3OY1A 3UIBA 3M42A 4M0ZA 4AZTA 3OY3A 3LFFA 4OBQA 3KIOC 1VZOA 3VJNA 4QMNA 3S95A 5AP0A 1J7IA 2UVZA 1PKGA 3ZHPC 1ZRZA 1UNHA 3SGCA 4E6CA 4M66A 3V5TA 2X2KA 4JDJA 2FSTX 2YA9A 4AW2A 4KSQA 2YWPA 5CNNA 5AUXA 1GIHA 2JIUA 4IB1A 3PZHA 1OL1A 3RI1A 4JRVA 2XYNA 5CEQA 4AZWA 3ZDIA 3Q3BA 5D10A 3FXXA 3D5VA 3QTZA 1H1PA 2VZ6A 3ENHA 3DAKA 3R1SA 1L8TA 1UU9A 1HCLA 2CDZA 3F88A 1TKIA 2WTDA 2DUVA 5EHOA 2RF9A 5CU6A 1CTPE 2J90A 5BUJA 5HNBA 4DGNA 1ZMWA 4NKSA 5HHWA 2JKQA 3OWJA 4AE9A 4M12A 4A9RA 3TM0A 3QRIA 3TG1A 5IA5A 5K3YA 4CCUA 4E5AX 4CYIA 1ZXEA 2WOTA 3QCXA 1JSTA 5A14A 3ZCLA 3VBXA 4X2FA 4MXAA 5K0XA 4WG3A 5ANOA 2UW9A 1QCFA 3G6HA 5KMMA 2IZSA 2RFDA 2UVYA 4FSRA 3TV6A 5E7RA 2CGVA 1B6CB 3CD8A 3LFEA 3R8UA 3AC3A 1PMEA 5EQPA 4H58A 4CFMA 5JZNA 3ERKA 2C6KA 4KKEA 3FZ1A 2QC6A 2X7FA 4RSSA 4NH1A 1ZYSA 4EH5A 2OU7A 5A9UA 1GIIA 3G9LX 5FRIA 3LVPA 4WKQA 3WBLA 5L6WL 1DAWA 4O0SA 3VQUA 4EHEA 1U4DA 2WTKC 4Z3VA 5A54A 2ZB0A 4FODA 5KNJA 4GW8A 3SV0A 3R7UA 3BHUA 5I9UA 4EONA 1BKXA 4DGMA 3BYMA 4D4SA 1XKKA 3IDCA 3Q4CA 4X3JA 4ALUA 4K1BA 4FEQA 1QMZA 4ASEA 5L2IA 3OS3A 5JGAA 4JIAA 2XB7A 3UQGA 5FDXA 3ORTA 1B38A 1P2AA 2XALA 4I24A 3CQUA 1ZOHA 4BCOA 4EOOA 5DBXA 5AX9A 4LRKA 3TXOA 2J51A 5BUIA 5CANA 3L8VA 4L67A 3TKUA 3PLAE 1Q8YA 4FTRA 4TWNA 3ZSHA 4RRVA 4NM5A 2WB8A 4UWYA 3F2AA 3WF5A 4BI0A 3EQDA 3HYHA 3HMPA 3ZUVA 2C0OA 2R3LA 1OITA 2YM4A 3IG7A 2IZTA 4O4EA 3RHKA 3NX8A 4WOVA 2CNVA 1I44A 3C13A 1V0BA 4UN0C 1YDRE 2XANA 2X7GA 4Y8DA 1ZARA 3BQRA 3COHA 4BRXA 3TTJA 2X6DA 4ZMFA 5T68A 2UZUE 4EOMA 2BRHA 3PP1A 5C8KA 5DRDA 5DEYA 2WMAA 2X2LA 3FMNA 3RINA 4EYJA 3QGYA 4RFMA 4HYSA 2WU7A 5DGZA 3LCDA 5HOAA 5JFVA 4FTIA 4J98A 3ORZA 2WEVA 3VUKA 4XHKB 2Y4IC 2WNTA 4OLIA 5CSXA 4AZVA 3ZMMA 3K3IA 5HLNA 5IQGA 1SYKA 3OT3A 5G1XA 4DEIA 4PMPA 3G51A 3KXMA 3M1SA 3W2RA 1H25A 1YVJA 2GHGA 5FBOA 3FY2A 3UPZA 3DA6A 1FPUA 2BDWA 4F0IA 4YC6A 1R3CA 3I0QA 4Y83A 1JPAA 2BRMA 4HOKA 4JT3A 5CT0A 4FV1A 5IF1A 3U55A 1RE8A 3BLHA 3KMUA 4FNWA 4S31A 4FX3A 4Y95A 3P86A 4LFIA 4CT1A 4FIGA 4APCA 3P7AA 3NUPA 3UOLA 1ND4A 4FKQA 5CF5A 3BE2A 1OMWA 3DLZA 4OUCA 2X7OA 2XVDA 2WTWA 4LV7A 4C2VA 4ZJJA 2YIWA 2P4IA 3MTFA 2W96B 4BGHA 4CSVA 4C4GA 3O71A 3UVQA 4YMJA 5A6NA 3L1SA 5D7VA 4NJDA 2BAKA 5T3QA 3TWJA 5CXZA 5DI1A 3PE1A 4UEUA 4LOQA 5HVYA 1OPKA 4QQ5A 4MNEB 1M2PA 2R3QA 1LEWA 1PW2A 2JBPA 2LGCA 3FV8A 4FUYA 4R7HA 3FMLA 4HNFA 4Q5EA 4CKIA 4CT2A 4EH9A 1PYEA 1W98A 3KREA 1M7NA 1YDTE 4YU2A 4QMYA 4OTDA 4B9DA 4BN1A 2PE2A 2UUEA 2YIYA 1TQMA 3AC1A 5KHXA 2G9XA 2XZSA 3CKWA 5AMNA 3LCOA 4BCJA 4QPSA 4GKIA 3MYGA 1WVWA 5IQIA 3UG1A 3NUXA 3S0OA 1P4FA 4YZCA 4FKIA 1PF8A 2PVNA 4FG7A 4BHNA 3W2SA 4ZXTA 4HNIA 3RJCA 4QMXA 4RX7A 3KGAA 4J96A 5CT7A 4KD1A 4HVIA 3LPBA 1GZOA 3LQ5A 5DE2A 4AU8A 4C58A 4IQ6A 4AWIA 2ITYA 3CE3A 3ZLYA 1FGKA 3LM5A 4V05A 5GIPE 4FKPA 5AV1A 1KOAA 1UKHA 3A8XA 4MXOA 5AP5A 1OL6A 2XK6A 3UYTA 4ZLYA 4G3GA 4IB3A 3QCSA 1BUHA 4JS8A 5DR6A 5GZ8A 3FHRA 5CASA 1ZOGA 2JD5A 4EOJA 3PWYA 5EH0A 4PL3A 1QPEA 3WYXA 3Q96A 5LMKC 3OWLA 3Q9WA 2ITUA 3TNQB 3U9CA 3QTRA 4D0WA 4WG5A 4HZRA 5EQYA 3FSFA 1XQZA 3PIZA 4NT4A 5CEPA 4D2TA 3W55A 4G6OA 4DFYA 3EJ1A 4FYOA 1J7UA 3JR1A 3DKOA 3U9NA 3O5AA 5M06A 4XRLA 3RCJA 3ZOSA 1JOWB 1NY3A 2C3JA 1R0PA 2IJMA 3NUYA 4LV5A 3BI6A 3NUNA 3P0MA 4WSQA 5HTBA 2PE1A 1OKVA 1J3HA 3AKJA 4DHIB 4B99A 2VX3A 4RQKA 4E6DA 4RQVA 4DDGA 2X9FA 3WZEA 4BI1A 3JPVA 5JRQA 4CG9A 4YJVA 3I0OA 3F3ZA 4MD7E 3SAYA 3LXLA 3NFFB 2J0KA 4TT7A 4AUAA 2Z7LA 3H4JA 2F7ZE 3W8QA 3O0GA 2XMYA 4S33A 3TMOA 3TYKA 2G2FA 1J91A 2P0CA 3MFSA 4FGBA 4AZFA 3C4EA 5I9XA 3ACJA 3BEAA 5F9EA 2C0IA 2XEYA 5M55A 3RK5A 2YIRA 1JBPE 1ZZLA 4TPTA 3U87A 4R5YA 4B8MA 4MYGA 5D1JA 1Y6BA 2PMIA 2R3FA 3JY9A 4M3QA 1GAGA 5CENA 3AT2A 3EQFA 2C5VA 2VWZA 3NR9A 3B8RA 2PK9A 3D15A 1XH8A 2VTIA 2YCSA 2A0CX 4U45A 4X2NA 3OXZA 5DOSA 4WHZA 4DT8A 4RX5A 5GINE 2FSMX 4FKSA 4KIOA 3FDNA 3KMWA 3VO3A 3W10A 4O2PA 5AR7A 4C4EA 5HIDA 5IMEA 1NT2A 2X0PA 2CN5A 3LJ1A 3ORXA 5IDNA 3DTWA 4AA4A 4I5CA 2DS1A 1OECA 2J2IB 4G2FA 4DEAA 3R21A 3ORMA 2QOCA 5HORA 3LAUA 3PXKA 5CSPA 4WRGA 2FB8A 2G01A 4ZJVA 4V04A 4I92A 5EOBA 3QC9A 3DNDA 2R3JA 2YACA 4AFEA 4U40A 3CTQA 1CKPA 1V0OA 1OKZA 2JDSA 2ONLC 4EWHA 3DKGA 3W33A 2A2AA 2QOOA 4U79A 1ST4A 1DM2A 4ITIA 4BVUA 4DH7A 2VWVA 2I6LA 2QR7A 3MH0A 4C57A 4FIJA 1KE7A 3OXTA 5DT0A 4MBJA 3PY0A 3UPXA 4FV0A 4J99A 2HY81 4WNOA 5HU3A 4CFNA 4L68A 1E9HA 5AP1A 4FIEA 1Q41A 1Q3WA 3GC8A 3PVBA 4JDKA 3F3UA 4FKJA 2HY0A 4IC8A 5LJJA 2YITA 3VAPA 3LJ0A 3RVGA 2EUFB 3I6WA 3QTQA 1X8BA 2FO0A 3GNIB 3N51A 4FTOA 5EW8A 5KUPA 4MD8E 4WA9A 4EWQA 4E20A 2FA2A 4F7JA 3L9NA 3TDVA 5AV0A 2X1NA 3BGZA 4FR4A 4U6RA 2JFMA 2ZVAA 3QQUA 3LQ3A 3QX4A 2OJIA 5L8JA 4O7SA 2C68A 2PYWA 4YPDA 1J1BA 2HIWA 2P2HA 2XKFA 3PJ1A 1Q61A 4PV0A 5CVFA 3W16A 4QMQA 1R1WA 5JGDA 1BI7A 4OTGA 3CD3A 2OXYA 3V5LA 3CP9A 5D12A 4TN6A 4E8AA 5BVWA 2PZPA 4IM2A 4YJUA 3DFCB 4WIHA 2EWAA 3QA8A 4YNOA 5EHLA 5B7VA 5EI6A 3RPYA 2AC3A 4QO9A 4UWCA 3ZO2A 3DBCA 3NAXA 1IASA 2XM9A 3V51A 2XH5A 2ZV8A 2OBJA 1BMKA 1CDKA 4BCPA 4CFVA 4BDKA 4EKLA 4H05A 1KV2A 5T6KA 5CI7A 1VYWA 4APPA 4FC0A 4YJOA 2XYUA 2OF4A 3SC1A 4ZTRA 2QHNA 4M15A 4IFCA 4WRSA 3IGGA 2IZUA 3ETAA 3JYAA 4BIBA 4R7IA 4FTQA 1YXVA 5BVDA 5HVJA 4HCUA 1UU3A 3A60A 3DKFA 2O5KA 1CSNA 2B54A 1REKA 3FC2A 3TJDA 4LOOA 2J0JA 2X2MA 4NK9A 3RALA 4D58A 5L2QA 2Q83A 3LFDA 4D0XA 4AQKA 3V6RA 5D41A 3ODYX 3OUNB 2WAJA 3PSDA 5CSVA 2PMNX 4FK3A 4JI9A 5CVGA 5GNKA 4A9YA 4AW1A 3QXPA 1W2FA 4UYNA 3OT8A 4BKJA 2JIIA 3I7CA 5K0KA 4KNBA 3EQBA 5HX8A 4A9TA 1IR3A 3F7ZA 3G90X 4IM0A 3WZUA 3BE9A 1SVHA 1DAYA 3R1QA 4AA0A 3E8NA 3LCTA 4U0IA 3R8PA 3AC5A 4O6EA 4IE9A 2AUHA 4F1OA 3DB8A 3IOKA 4JR3A 4G6LA 3E3BX 5E9EA 2ZMCA 4TNBA 5LOHA 2H6DA 4C59A 2XNOA 2HCKA 5GZAA 4M84A 5TO8A 3OCTA 4FIFA 5KKRB 3F9NA 3HX4A 5E8UA 5ANJA 3MY0A 4BCIA 4DTBA 1XBBA 3FMHA 4O1OA 3IS5A 4PMSA 4X3FB 4MKCA 3BWFA 4F63A 5FTGA 1YHSA 2RFSA 2YERA 3GFEA 4ZZOA 1W84A 4LL5A 3COIA 2WTJA 4GV1A 3S1HA 2UV2A 3Q2JA 4FKUA 3FLZA 2QOLA 4LMUA 3R9NA 3E7OA 3KN6A 4M14A 4D5HA 5AV4A 2GNJA 3CGFA 2DQ7X 2WQMA 2Z60A 3KXZA 5KBQA 2FH9A 2VO0A 4AF3A 2GS6A 4AGDA 2Y6OA 3GU4A 3PVWA 3O51A 3R1NA 2R5TA 3TIZA 3WF7A 5B2MA 4ZMEA 2CLXA 2ETRA 3T9IA 4N0SA 5I9YA 4JDHA 3W32A 3OCSA 3QKMA 4XP0A 4S30A 3JVRA 3DTCA 3UE4A 2WMVA 3R9RA 2JDVA 4K8AA 4GKHA 3PVGA 4OBOA 1WBPA 4IIRA 2HZ4A 3BPRA 4FTUA 2WMUA 2ZOQA 1IAHA 1L3RE 3OEZA 4X21A 4HVGA 3KC3A 4JDIA 4XUFA 4KRDA 2O63A 2B52A 4JG7A 3IW4A 2C47A 3ZO4A 3DV3A 4JBQA 1Q8ZA 2C6MA 2Z2WA 1KSWA 4D2PA 2C1BA 3JVSA 4FV3A 4QTDA 4I94A 1GJOA 3DZOA 1H26A 4HGLA 3ITZA 4QYHA 5CU4A 3RPSA 2GS7A 3VUTA 4V0GA 3R7YA 1MRVA 2XKEA 4FV4A 5HKMA 3RAIA 1T45A 3UODA 3DNEA 5H8BA 4FG9A 3ZSIA 5FQDC 3WI6A 2VTPA 4QDEA 1O6YA 1QPCA 2VWIA 1ZYLA 3DJ5A 4YLJA 2ITWA 3DT1A 3FLQA 4NYEA 4X3FA 2F4JA 4IWQA 4ZS0A 2R3HA 4RGJA 4BIEA 5EYDA 3G2FA 3ZUUA 4AW5A 4XX9A 4O86A 3QBNA 3HDNA 3LJ2A 3CR0A 3V5JA 1HOWA 4LUDA 3DOGA 1CMKE 4NM7A 3RMFA 3RPRA 3BX5A 4O21A 4FTMA 1AD5A 4I1ZA 3VUMA 2R3MA 4KBAA 4BCGA 5IEYA 5LVPA 3VS3A 3ZEWA 4NL0A 5A4CA 5L6PA 1URCA 2ZM3A 5CTPA 4KIKA 5HE0A 4QMPA 5AUVA 3KB7A 4D2RA 2ITXA 2C0TA 3GB2A 4KAOA 4EUTA 2X0OA 3CLYA 4FNXA 3DB6A 3EN9A 3L9PA 4E4XA 4KBCA 4O4FA 4MWIA 3W0QA 1ZAOA 4F6UA 4UMUA 3SW7A 2JC6A 4KB8A 2HK5A 3HV4A 2DWBA 4GFGA 3VONA 5M08A 4ACCA 2A1AB 1V1KA 4GH2A 3A7HA 2W17A 3MIYA 3E7VA 3QRUA 4R5SA 2HELA 2Z8CA 4ZTLA 3VS1A 3IW8A 4FIHA 1PXPA 1FVVA 3F69A 4U81A 5J79A 5HO8A 1VYZA 3FZOA 1ZYDA 4E73A 4CMTA 3EMGA 5EI2A 4G17A 5M4UA 2XNEA 1EH4A 5I3OA 3VN9A 2OI4X 2REIA 4AXCA 4RA5A 4BDAA 5L6OA 3C4FA 2XRUA 1U5RA 2BDJA 3TCPA 4HPTE 4FT9A 3K5VA 4R6VA 5I9WA 2I40A 4FL2A 4P5ZA 2CCHA 5H8GA 4FT0A 2C6DA 2IO6A 4UZHA 4TXCA 4BBMA 4J97A 3NWWA 4BCMA 4BDEA 2OK1A 4O0TA 3DAEA 4AACA 4C7TA 4FIIA 4BCFA 4I22A 1GZ8A 2VO3A 4FEXA 2PHKA 4UB7A 5KZIA 4Y72A 2X8EA 4ZY5A 5IPJA 5ETIA 4KBKA 1ERKA 3ZBXA 4BTJA 4O82A 4JX7A 4S32A 4AN9A 4XP3A 4XG9A 4FI1A 1W2DA 4OTHA 5HEZA 3DJ7A 4P7EA 2A4LA 4ID7A 4LI5A 4MXZA 5EDQA 3QAME 4YJTA 5LXMA 2XCHA 5FGKA 4OTQA 2R64A 1KE6A 3ROYA 3ZFMA 3HGKA 4AGCA 4Q2AA 2XRWA 3EN5A 3FLWA 4ITJA 3EQHA 4YJNA 2AQXA 4XG3A 2WU6A 2GNLA 4JJRA 5E8WA 1H0VA 3PXQA 5FEQA 3V8SA 5IG1A 1H28A 3AQVA 4FT7A 4PDOA 2UZWE 3GVUA 4D28A 4EC8A 1BL6A 1ST0A 2BALA 3F3WA 4DG3E 2R3KA 4ZS4A 1OIQA 2R3GA 4QMSA 3PLSA 5EHYA 4DFZE 3LXKA 1IAJA 2CPKE 4F4PA 4EQUA 2VD5A 4QMZA 2YIXA 4RVKA 3FI3A 1CKIA 2VTOA 2V22A 4IC7A 4NW6A 4EH2A 3GCQA 2YLEA 2PZRA 3CY2A 2UW4A 4XV2A 5LVLA 5HG7A 4IWOA 1TZDA 4ZJIA 1GZNA 5L8LA 3RAKA 2A98A 3EN6A 1H0WA 5M4CA 4FYNA 4BBFA 2W1IA 3RWQA 3H3CA 1KE8A 3MFUA 4ZP5A 3VJOA 3UQCA 3UC3A 3DPKA 4ANSA 3VF9A 2QI8A 5DT3A 2AC5A 5BYYA 5DMZA 4CG8A 4L52A 3HEGA 4FKLA 3D7TB 4K9YA 3LHJA 4ZTHA 4HJOA 1H1RA 4IVCA 5EM6A 5IUGA 4LGGA 3KULB 2UZOA 2X0QA 3MDYA 4F9CA 4GRBA 4I6HA 2VWUA 1OPJA 3HV6A 4FMQA 3WOWA 2A19B 1OVEA 2WOUA 3MS9A 3L8SA 4LYNA 1Z57A 3D83A 4CFFA 4R78A 2PTKA 4ERWA 3PRFA 2UW6A 4FTJA 3W0NA 2GCDA 4M69B 3F3TA 4RT7A 1OL7A 5CU3A 2OH0E 4L8MA 4G5JA 3KXHA 4IHPA 3FUPA 5CYIA 3QD4A 3NEWA 4C2WA 1H8FA 3QLFA 4IDTA 2ITPA 5FWKK 3TUCA 4QP2A 2EB2A 5L2SA 5DT4A 4EBVA 1JKKA 2Z7SA 4BI2A 3D9VA 2C6IA 3ALOA 3RNIA 4FV8A 3K2LA 3I5NA 3GU7A 4W4YA 2BZJA 4L3LA 3Q60A 4KUJA 4TWOA 2W7XA 4J7BA 4R7BA 3PIYA 1B39A 3FY0A 4ASZA 4DG0E 3DGKA 3R8MA 4KABA 4GIIA 4I0SA 5LWNA 2GQSA 3CKXA 4U7ZA 1WBWA 4F0GA 4F08A 4EZ3A 1JSVA 4E93A 4FK6A 3CJFA 5IQCA 3PPJA 1I09A 4GYGA 3BYVA 2GNHA 4IM3A 3VS7A 4DGLC 4ASDA 4BZDA 3EOCA 1APME 4BWKA 4EHZA 4NM3A 3BL9A 3QZHA 1WBSA 2SRCA 3GGFA 2JEDA 3GP0A 2R2PA 4N4SA 4LOPA 3KXNA 4XOYA 2JAMA 5A4QA 5FUTA 4CZYB 3PG3A 5AIRA 3RCDA 4JLCA 1OBDA 4PPAA 2OJGA 2ZV7A 2YM5A 4G3CA 3O8UA 2FVDA 4XS2A 3A4PA 3ORIA 4RWKA 2XA4A 1YW2A 2XIZA 4KWPA 3S2PA 4RVMA 5DVRA 4FSZA 1H4LA 3PJ8A 4YJQA 3QKLA 3QWKA 4ZY4A 4RBLA 2QOKA 4EK6A 4PL5A 2OIQA 2Y9QA 4RJ8A 3FI8A 5IMXA 2PSQA 4EOIA 4U3ZA 1XWSA 3JY0A 5HIBA 1OGUA 3NIEA 1GNGA 3D5UA 3ET7A 3FSKA 4FZAB 4QTCA 5EW3A 5CF6A 3N4VA 3KQ7A 2YAKA 4FSUA 5J7HA 2YHVA 1BYGA 3BCEA 2VNWA 2KTYA 4QRCA 4ASXA 4DAWA 4FUXA 3SKCA 4ZSGA 1GZKA 3UDBA 5GIOE 3QCYA 4GMYA 3U4UA 3RTPA 1O6LA 2PWLA 3AC8A 4TYJA 5L2WA 3BLRA 1XO2B 3KK9A 4H1JA 4UXQA 5AP7A 3VHEA 4DGOA 3U6JA 4IANA 1MQBA 4WUAA 5IUHA 4PP9A 3O7LD 4C3RA 4FF8A 2GFCA 3G6GA 3UNJA 1JKLA 4MUQA 3R83A 2Q0BA 2WMXA 1U59A 1Q8UA 4IADA 5H2UA 3OFMA 5E8SA 3UZRA 3WZKA 2VU3A 1P14A 2VTTA 2YAAA 5CALA 3RBWA 1XMLA 4DHJA 2YZAA 3W2OA 4OR5A 4DFBA 4P2KA 1V0PA 1PMUA 2V7OA 1Q97A 3C0IA 4QNYA 4RJ5A 4DFLA 2GQGA 5KMKA 1KOBA 1U5QA 3POZA 3OWPA 4L00A 2GPHA 4F7SA 2AEGA 4QP3A 4R3CA 3THBA 2XBAA 5IH4A 4H39A 4C4IA 4ORKA 2X4FA 3E8CA 5TF9A 3Q4TA 4PWNA 4TYHB 4Y5QA 2C5YA 5EYKA 3ENMA 3FHIA 3C4ZA 3I4BA 4FKOA 3UG2A 3ACKA 4A4OA 4GU6A 4RZVA 4W8EA 4UMPA 3M2WA 3UO6A 5HVKA 4X7QA 4R77A 5HTIA 1G5SA 3ZBFA 2PVKA 4IAAA 1PXNA 4II5A 3KRJA 2QO9A 3CC6A 4WNMA 3PRIA 5B2LA 4PTEA 1YKRA 2ZDTA 3ZXTA 4QEBA 3PUFC 3A61A 3D4QA 3LMGA 4D4YA 4BR3A 3MH2A 2VTJA 3N4UA 3GC7A 1JQHA 4I3ZA 4I5HA 4LQMA 2YDJA 3ANQA 3I7BA 4E1ZA 1OIRA 4BJJB 2I0EA 2QR8A 4FTAA 2PVYA 2V5QA 3NW7A 3V8TA 4ZAUA 3CSVA 3L8XA 4D55A 3NMUF 4CMOA 4EKKA 2BTRA 1YHVA 1JLUE 1WMKA 4BIDA 4YJSA 5DH3A 4BDJA 4DEEA 3QD2B 5AFVA 3F6XA 2BHHA 3HUBA 5CXHA 3EN4A 2IVVA 3F5GA 5HE3A 5CEIA 1OIUA 3DAJA 1J7LA 4G9RA 1P4OA 2WTCA 2J4ZA 3C50A 3OOGA 4EEVA 2IVUA 3WARA 2HZNA 3HV5A 3NLBA 4HYUA 5DWRA 4O7WA 1YXTA 4LRJA 4GK3A 4RJ3A 3EIDA 2NPQA 2VTMA 4MF0A 1VLRA 1YI4A 3P4KA 4AT5A 5DG5A 1K2PA 5FLFA 5J1WA 3HECA 4EK5A 4YTFA 2WMRA 3DU8A 1UWJA 3UZTA 2WMQA 2XNGA 4C38A 3FPQA 4XLVA 4N6ZA 2CLQA 3SLSA 5FTQA 5JFWA 4DDIA 4TNDA 2YZLA 3CBLA 3MTLA 2CGUA 4RG0A 3MA3A 5H9BA 4I5PA 2QHMA 5M51A 3ZU7A 5J1VA 4JR7A 1LPUA 2Z7QA 2XIKA 2PVRA 4U42A 3CTJA 5JFSA 3MW1A 5E4HA 3RPVA 3IQ7A 4LG4A 4BWXA 3K54A 4M7IA 5ITAA 3V5WA 3FMMA 4FKTA 4CFXA 3FQHA 1TVOA 2ZV2A 2EXCX 4ITHA 4IVAA 4O0WA 4FSYA 2QO7A 3DXQA 2WKMA 4DBXA 3G0FA 4O7ZA 2CKQA 3RAHA 2R3RA 4ANQA 4F7LA 1Z9XA 4G3EA 5K5XA 4MNFA 3NYVA 5E8VA 1TQIA 3VQHA 4YJPA 2E9PA 1PXLA 5CS6A 4D9TA 3L9LA 2YM7A 4JG6A 3FYKX 4IB5A 3MVLA 3BHTA 3IOPA 4YLKA 3O7LB 4BCKA 1WVXA 3PPZA 3PSCA 5E8XA 1VEBA 3SDJA 4CV9A 4D4RA 4NIFB 4IAIA 2RGPA 5AIKA 4OAVB 4AAYA 3EFJA 1OKWA 4E5WA 2EVAA 2V0DA 4K77A 4RJ6A 3UNKA 5DIAA 5BVEA 3BHVA 5J87A 4FGRA 4F9WA 3MA6A 4OTFA 4I93A 2WEIA 3TV7A 5CAUA 3NZ0A 3BU5A 2WELA 1PXJA 4MNEA 4NU1A 1Q99A 5BX0A 4DE4A 2PVJA 3ZONA 3CQEA 4C62A 2BKZA 2JKOA 5EDPA 5L3AA 3BEGA 1H1QA 5EQEA 4DEBA 4FG8A 1JSUA 4B0GA 5DYJA 3HP5A 1ZOEA 1OUKA 3BU3A 4FKVA 4I6QA 4IEBA 4ACDA 3UQFA 4IJ9A 4QTEA 4JMQA 3PXFA 4ZLOA 4AXFA 5KKRC 3HLLA 2RSVA 3MB6A 4FSNA 3FL5A 3RGFA 4D5KA 5BVOA 5A4TA 1QPDA 3H9OA 4JRNA 5EKNA 2IN6A 4NSTA 4OBPA 3FLSA 3DXNA 3KFAA 3ODZX 4GK4A 4QQCA 2HZ0A 2PVFA 3FXZA 3SD0A 5HBJA 4D2VA 2QQ7A 3MGYA 4X3FC 3WF6A 5IQEA 2YIQA 2ZAZA 3F61A 4WNPA 4XG2A 3PZEA 2GHMA 3BYOA 3KCFA 4HCTA 4W4VA 4GJ2A 5EKOA 1OL5A 3TJCA 2F9GA 3OVVA 4B4LA 4A7CA 2XK4A 5LWMA 3OUKA 2BVAA 5J5SA 5IH5A 5BYZA 1XH6A 3V04A 1XH4A 4CNHA 4ZY6A 3UIMA 5DFPA 3S00A 3SOCA 5DR2A 3EFWA 2XKDA 4CQEA 2W4OA 3UC4A 3R1YA 4BDDA 2XNNA 2CHLA 3AMYA 3FAAA 3O8PA 2WQNA 3V6SA 2YJRA 4BZOA 2OZOA 3RZBA 2YJSA 3FQEA 3QTWA 5TKDA 1IA8A 3UO5A 2OKRA 3RZFA 5ANEA 5HD7A 5KMLA 4PF4A 4CGAA 5CSHA 5I3RA 5JN2A 3HMMA 4TKSA 3UOHA 4BY9E 3EKKA 4Y46A 4FEUA 2R9SA 4XCUA 3PP0A 4L42A 4C35A 1NW1A 2YEXA 3PUPA 3VWAA 3R2BA 5GHVA 3NFGB 3VRZA 5KCVA 1LP4A 4IZAA 1VJYA 1KE9A 2FSLX 2UZVA 1H07A 1ZYJA 2B1PA 3FMDA 3G0EA 3JS2A 5C03A 3OBGA 2QU6A 4GU9A 4BDCA 1SNXA 4E4LA 2UZTA 3LOKA 3VF8A 4TWCA 4GG7A 2B53A 2QURA 4DFNA 1KE5A 4ZSAA 2Y4IB 3LCSA 1XR1A