1XBAA

Crystal structure of apo syk tyrosine kinase domain
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
274
structure length
266
Chain Sequence
VYLDRKLLTLEDKELGSGNFGTVKKGYYQMVVKTVAVKILPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase SYK
publication title A novel mode of Gleevec binding is revealed by the structure of spleen tyrosine kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 85
structure length 266
sequence length 274
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2004-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1xbaA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1xbaA01
2OKRA 2WB8A 2UW6A 3FHRA 2PZRA 2YCQA 1SYKA 3A4OX 3C0GA 3FL4A 2B9JA 4M13A 3VF8A 4AFJA 3EL8A 3R1QA 4LV5A 3PPKA 4IAFA 2YJSA 4IX3A 3KGAA 3UOLA 2C3JA 5HQ0A 3O8PA 3R6XA 4FT9A 2QO9A 3EN7A 2UUEA 4U80A 2QD9A 4U44A 2E9PA 3ZRMA 4BDJA 4EOPA 4BDEA 2YM4A 2ZV7A 4QMYA 3CJGA 4ANOA 4EOKA 3SHEA 1XKKA 4BBEA 4E6AA 2VNWA 1PXIA 2PK9A 1WVWA 3F7ZA 4FT5A 4RFYA 5CZHA 1KE9A 3B8QA 4D2TA 2OJJA 2W4OA 4HGSA 4MYGA 4FKSA 3S2PA 4WSYA 3UNZA 4QMPA 2QLUA 2VZ6A 5DEWA 5F95A 1FOTA 3IDBA 2C30A 3ERKA 3HKOA 2RL5A 3POZA 5FM3A 3R7VA 5HOAA 3BHVA 5FTGA 1UKHA 2HZ4A 3QQJA 5K3YA 4BCNA 3AD4A 3ZUTA 3PZEA 5CNOA 4WNMA 3OVVA 5HG8A 4OLIA 3TZ8A 4XV9A 4EQUA 2CNUA 1URCA 2XNGA 3Q6UA 3OS3A 3PXYA 4LOPA 3T9IA 3ZCLA 3FC2A 4EHZA 4F7SA 4WO5A 4BIDA 3IW7A 1JOWB 4EK8A 4UN0C 2W1CA 4NKSA 4CQGA 2ZV8A 1YDRE 2WXVA 4RVLA 3EYGA 4GH2A 3DV3A 4TWOA 1GIJA 3SKCA 3LJ0A 5J9ZA 4DFBA 1OBGA 2XYNA 1Z5MA 4G3FA 3Q9XA 4F1OA 2F49A 5DH3A 5L2TA 3WF6A 3LFSA 1OUKA 4E7WA 4FKIA 3DKGA 5IEYA 2CGWA 2JITA 3F6XA 3PVWA 3WARA 1TKIA 1YXXA 3HP5A 4RIXA 3TZMA 4RIOA 2RKUA 4BZNA 1IAHA 3VVHA 4TYGA 2IZRA 3VBTA 1CDKA 2C1AA 2QURA 4CD0A 5DBXA 5CF5A 2DS1A 4FG7A 1VJYA 2X9EA 3JVRA 4EHVA 1URWA 3PDTA 3F9NA 2QOOA 4EOMA 3VQHA 3A61A 3JVSA 1LEWA 1M2RA 3BYOA 5HE1A 2F57A 3FL5A 1Q8ZA 5ANOA 4TYJA 5AR5A 1PYXA 2UW5A 3FDNA 3FQEA 3VW8A 4AN9A 2WMSA 3VRZA 2WQOA 4KKHA 2A27A 3GXLA 4D4VA 4ID7A 4S32A 5I9XA 2Z60A 2ITUA 4GUBA 4EHEA 5FWKK 5B7VA 4RLKA 1Q5KA 5J8IA 4FKPA 5LVOA 3QQFA 2DWBA 5HCXA 4F9YA 2BKKA 3VS7A 2X4FA 3CC6A 3IDPA 5E8VA 3FLWA 4LRMA 3QWJA 5FDPA 4CYIA 4E5WA 2A2AA 1ZYJA 4MBJA 5T6KA 4A9TA 4ZSAA 4BCFA 3LKMA 2FSOX 4Y72A 4FSUA 1YKRA 1UWHA 4I3ZA 4Q2AA 3U9CA 3CQWA 4IJPA 3R2YA 1H07A 2C47A 5HIEA 4E3CA 2OFVA 1V0OA 2VU3A 5HO6A 3FKNA 3QKKA 3V8TA 3BEGA 2ITQA 2QHNA 3A62A 4O1PA 3TI1A 4D2WA 3VHKA 5HVKA 2O3PA 3ULZA 2BTSA 1ZLTA 3HDNA 4ZS4A 2Q0NA 3DPKA 4C4HA 3BBTB 3QGWA 4ZEGA 3ORTA 5HZNA 1Z57A 4O7ZA 1PKDA 1CKJA 4DEDA 1ERKA 1Q99A 3AOXA 2JIUA 1YXSA 3D5VA 2PVHA 5JQ5A 4FTOA 4FYNA 2UZLA 4JXFA 3EZRA 3WYYA 4DFZE 4RSSA 5IA2A 3DKFA 4F09A 3I6WA 3ZO1A 4DGGA 1YHVA 1DAWA 2WPAA 3C4WA 1LP4A 3FXXA 3O2MA 3MIAA 4WIHA 4DT9A 3QXPA 4U42A 1UU7A 2FSTX 3RK9A 2ZDTA 3NYVA 4FOBA 4PL3A 5AUUA 4FV3A 2QR7A 4GG7A 2PUPA 2Z8CA 3AD5A 2G01A 3ITZA 3ROYA 2WIPA 2YM6A 3POOA 5K4JA 5KUPA 3EQPA 4CSVA 2J7TA 5CVGA 4BVUA 3IGOA 4QP2A 3E8NA 4LL5A 3D2KA 4U79A 3MS9A 5CQWA 2GS2A 2IN6A 5E8YA 3DGKA 4I93A 3W55A 5J1VA 3BV3A 3GQLA 2R0UA 2X7OA 4YPDA 3O71A 3KB7A 4RJ7A 3W10A 2OGVA 4TRLA 3WF8A 3OEFX 4FKOA 3I79A 4DAWA 1JWHA 1OIUA 3PIXA 2OJFE 3FLQA 3ATTA 4QMWA 2OH4A 2RGPA 2XNEA 4Y95A 3KXHA 5L2WA 2ETMA 3QZHA 1G5SA 3H9FA 3GEQA 4O38A 2HK5A 2XK8A 4PDPA 3UO4A 1I09A 5H8EA 4W4WA 5FQDC 4MD8E 3WZKA 3E8EA 4N4SA 4ZJVA 3DNEA 1JSTA 4D58A 3U8WA 3BRBA 1W7HA 4L3LA 4X2KA 5AR7A 4W4YA 4OAUC 1WBOA 3LCOA 2GTNA 4FODA 5A4QA 4G5JA 3DT1A 4AZVA 4RJ6A 4A06A 4MD9E 1H1RA 4LV8A 4BCGA 3QGYA 2IJMA 2C3KA 3R7YA 3PSCA 3CTQA 1HCLA 4KSQA 5HIBA 3GGFA 4CMOA 1PXNA 1FMKA 4Q9ZA 5EHOA 3IK3A 4F65A 5J9YA 4EORA 3LJ2A 3Q4CA 3LMIA 3DK6A 4KUJA 4RC2A 4I5HA 3DKCA 4UYAA 1YDTE 3WE4A 5EI8A 1O6YA 4H1JA 4WHZA 3FV8A 3IW4A 4PX6A 4RA4A 4YLKA 3F69A 3LCDA 3FY0A 2OZOA 4GYIA 2WEVA 4L6QA 2ITOA 2EXEA 2X6DA 4XBRA 4R7IA 2CN8A 3NUSA 4L3PA 2Z7RA 3VHEA 4XP0A 2VO0A 1R39A 4GKHA 2Z2WA 3PJ1A 5C8KA 4PDYA 2E9NA 1NVSA 4QQ5A 3W2PA 4G2FA 2BFYA 2BUJA 4GV1A 3WYXA 5KMIA 3HZTA 4FL1A 4YNEA 3WF7A 3MDYA 4DCEA 3TV7A 5JN2A 4RA5A 4IC8A 3GCSA 4GJ3A 4EUTA 4QYGA 3VC4A 4MQ1A 3AC3A 4JI9A 3CR0A 3NW7A 4BTFA 4UY9A 3OWPA 2YM5A 2I0VA 3S3IA 3WOWA 3ZSHA 4GL9A 1J1BA 4QMTA 3DJ7A 1OPKA 4IZ5A 2XBAA 3V01A 4C61A 4AG8A 2QI8A 2J51A 3LJ1A 2HAKA 2CNQA 2UZDA 1CM8A 5IUHA 3PJCA 2XIKA 2F4JA 1FGIA 2JBPA 3NWWA 4II5A 3D7ZA 4JBQA 4FSZA 4XV1A 5AAFA 3E8DA 4B99A 1OZ1A 4RX9A 5KMJA 5C8MA 3RZBA 4EUUA 4AF3A 3WIKA 3THBA 5L3AA 4EOIA 2OK1A 5DE2A 4R1YA 2RFNA 3SVVA 2J9MA 5A4CA 1WMKA 3KULA 3LXLA 1IA9A 3UOHA 5AR8A 4HPUE 2GU8A 5KZ0A 3NUPA 2YN8A 4C4EA 2LGCA 3ZMMA 4M0ZA 4M66A 2YIXA 3PVGA 5KE0A 4AZEA 4XG3A 3EN6A 3DCVA 4M14A 4NFNA 3VBXA 4KBKA 4L52A 4F99A 3RNIA 2V7OA 3EL7A 4DG3E 5CU3A 4ZJIA 2WU6A 2P4IA 2A19B 4APCA 4YO4A 3PLAE 4YBKA 3PJ2A 1MRYA 2O2UA 3U87A 4EH8A 3L1SA 2YCSA 2XK9A 4BWPA 4HYUA 3LMHA 5EDPA 4BF2A 3A7HA 3NS9A 1SVEA 4IEBA 4BBFA 2WMUA 4CGAA 3VBYA 1UU3A 1BX6A 4NJ3A 2B55A 4QMUA 4XOZA 5TT7A 1W8CA 2VTMA 2X6EA 5CF4A 3DTWA 3P9JA 4JLCA 4XHKB 1PXJA 1TVOA 5EHLA 4BKZA 1QPDA 4FUXA 4NUSA 2UVXA 1WVXA 3C4FA 5D10A 1GIHA 5AP3A 5HG9A 3RPVA 4R77A 1Q24A 3V6RA 4ARKA 2PMLX 4ZTSA 1WBVA 2XEZA 3KRLA 3DFAA 3MWUA 4NCTA 5J87A 4C3PA 2CKOA 3N4TA 2YLEA 4JR7A 4CCUA 5DOSA 2GNFA 1CMKE 2XK6A 3ZZEA 3ENMA 2FO0A 4ANNA 4FIIA 3UGCA 4R8QA 4EYMA 5BMMA 4TWCA 5BYYA 1GNGA 4MF1A 5IU2A 3UE4A 1NXKA 4LOOA 1KUTA 4WA9A 4YZBA 5BVFA 4WT6A 5LWMA 4PDSA 2GHLA 3CQEA 3GU7A 2ZM4A 3P5KA 4QYHA 5CXZA 4DLIA 4FZDB 3VS5A 3NNUA 3N9XA 3O51A 5C9CA 4IX4A 2Z7LA 4PPCA 3QX2A 1BI7A 1Q8UA 5FM2A 4QNYA 1OKWA 3MPMA 4FTKA 4DFUA 3A4PA 3QCSA 4BGGA 5HG5A 4U9AA 3CXWA 3UP7A 4BDGA 5BYLA 1MP8A 5CYIA 4ZTMA 4MHAA 3EQDA 3FZSA 3GI3A 4UWYA 2Y4IC 3Q3BA 2JDSA 3EQBA 4KS7A 2ZOQA 4GK3A 4QMSA 5EOLA 4A9UA 2PZPA 2V0DA 5LCKA 3FZ1A 2PZIA 4AN2A 4I6BA 5IH4A 5FG8A 4FIFA 1G8SA 3GC9A 1XH8A 3AQVA 1YHSA 4LGGA 1Q62A 4NM5A 3W2CA 1PMVA 4FTQA 4YTFA 5D12A 3RCDA 3W1FA 1DAYA 4UMRA 1HOWA 4X2JA 4W4VA 4ZTHA 2QO7A 4MTAA 2IW8A 3KMMA 3TIYA 5IEXA 4RQKA 1SNXA 4L01A 4ZSEA 5GNKA 4J71A 2WZJA 5CAQA 2UW9A 5AJQA 3HRBA 4XS2A 2BFXA 4GVJA 1OITA 2ZVAA 3VBVA 5IDPA 3ZO3A 5JH6A 4IJ9A 5GJFA 3DBFA 2YDJA 3H0ZA 2RG5A 3ZBXA 2VN9A 5L8KA 4UMPA 5M09A 4X6RA 3VULA 3CE3A 4GMYA 1KV2A 4FTRA 4CZTA 5ANJA 3COKA 1BYGA 4EZ3A 4I94A 2BZIB 4O7SA 3E8CA 1OKVA 5BUEA 1XO2B 2GNGA 4NJDA 3I0OA 1R78A 3LM0A 3R21A 4DE4A 4G3EA 2R3PA 3SQQA 4F6WA 4NKAA 4PMTA 3NZ0A 4I0TA 4YZDA 3C13A 4RG0A 5JFVA 2QG7A 1VYZA 3G6HA 3ORIA 2JKKA 2XZSA 3QTSA 2XK4A 3BLRA 3EQGA 3QZFA 3MH2A 4V04A 4EK4A 4XRLA 3R83A 3AC5A 5E4HA 2Y6MA 1JKLA 4MKCA 1T45A 3F3UA 4X3FB 3EIDA 5BX0A 1ZY5A 4HVHA 4LUEA 4ZTLA 2VNYA 5L6WL 3PG3A 4IM3A 2PE1A 1PY5A 3R1NA 4ZAUA 3MB7A 4JG8A 3UO5A 2J5EA 5IMEA 5JZJA 3ODYX 4AA0A 3KU2A 2W5AA 3OTUA 3LFQA 4O1OA 2EWAA 2W4KA 2WMAA 3NUYA 2BAJA 4FIJA 4UB7A 3QL8A 5CEOA 4V05A 2EUFB 5DR2A 3SG9A 3W8QA 3QU0A 3EN5A 4O91A 2WMBA 2GSFA 3KK8A 3KXNA 3QLFA 4JJRA 4JQEA 3OXTA 4E73A 3TL8A 1GOLA 4O22A 4EQMA 1YXTA 5J5TA 3MH0A 3KCKA 3VUMA 3R2BA 3BYUA 3Q32A 5AAGA 4YPSA 3R9NA 3ORNA 4UALA 3ROCA 3AMAA 5DG5A 1K3AA 5AUWA 5LXMA 4E1ZA 1PMUA 4L42A 1FQ1B 3E5AA 1J3HA 4RRVA 4OT5A 1OMWA 3U6JA 3FYJX 4RX8A 4QYFA 4O0TA 3COHA 3SA0A 3M11A 4KABA 5C03A 4NSTA 3QQUA 4D2PA 3ORMA 4GFOA 4JDHA 3FZOA 5HX8A 4EH5A 3GBZA 4LMUA 1REKA 4NU1A 2ITNA 3HV5A 1NA7A 3EQRA 5HO8A 3QRUA 3R71A 5ICPA 5KCVA 4I24A 4D4YA 3FEGA 4ZTNA 3LAUA 4CQEA 3EKKA 2P55A 4IQ6A 4XYFA 1Y8GA 2P3GX 4WKQA 5AWMA 1E1VA 2UZVA 3RTPA 5DNRA 3UC4A 4B8LA 3HAVA 3IOPA 1CKIA 2UVZA 3UNKA 4KIQA 5DI1A 4TY1A 3VJNA 3Q9WA 3SW7A 4IB3A 3MVMA 4I4FA 5K4IA 3QC4A 3BU5A 4YSJA 3RINA 4OBQA 4OTHA 3GP0A 4O7RA 3FLNC 4BZDA 2YIWA 4JQ8A 5ANKA 4FIGA 4BICA 4ZLZA 4FNZA 2ZMDA 4XJ0A 3ODZX 4C4FA 3NW6A 5IDNA 3GCVA 4O7TA 1REJA 4JDKA 4D0WA 4DFLA 3T3VA 4TL0A 2PTKA 1YOMA 3P0MA 4PMSA 3QX4A 3G9LX 3FMNA 2HZIA 1Y8YA 4K9YA 4IVDA 2OXXA 1XH4A 1ZARA 2OF4A 3TEIA 4E4NA 2C0IA 2E9UA 2X2MA 4JG6A 4EOQA 5KBQA 3HAMA 3QTWA 5FP5A 4J1RA 2AC5A 5ETCA 3OWLA 4L7SA 1PXKA 5GJGA 1BLXA 4O7VA 5DR9A 2W06A 3AGLA 3BGZA 3PA3A 4CFUA 3DBCA 3FBVA 3OW3A 5CAPA 4AE6A 5KNJA 5ANEA 4EH4A 5CX9A 3A8WA 4JVGA 2PY3A 2QU5A 2PVKA 3E92A 2C6EA 3DLZA 1FPUA 4XG4A 3ZLYA 2Y0AA 3QKMA 1FVRA 4G6NA 4EQCA 5HTBA 1OKZA 3FXWA 2PWLA 3TNWA 3UVRA 2XRUA 3HDMA 4XV3A 4P4CA 5BVWA 4AACA 4K6ZA 4C57A 4CT1A 5AUTA 2X8EA 2B9IA 3DKOA 4XH6A 2XNNA 5L6PA 2XNOA 4QMLA 2ZJWA 2EB3A 1MQ4A 2VTLA 3U6HA 5CENA 5IA4A 3MFTA 3OY1A 3NYNA 4ZIMA 5AR2A 4WUAA 3OWKA 3LFBA 1Y91A 3FSFA 5IQCA 3LMGA 3PG1A 4IX6A 2WTJA 5BNJA 4OTGA 4F1TA 3TUDA 3L8VA 2C5OA 2VWXA 4LG4A 3WZUA 4FA2A 3V5JA 2QOHA 4AT4A 1R0EA 3MH3A 4FMQA 4Z9LA 4DYMA 2C0OA 3C4XA 4XG8A 4ACMA 3E64A 4XV2A 3G15A 4ZZMA 5C27A 3B8RA 1YDSE 4KINA 2QKRA 4E20A 2NRYA 3R1SA 2QOBA 3UG2A 1PHKA 4O0WA 2WGJA 3RI1A 3C4EA 4UMUA 3SC1A 4D28A 3TACA 5IKWA 3OW4A 1EH4A 2BRGA 2PE2A 3TUBA 4DCAA 3DJ5A 2R7BA 1ZWSA 2PSQA 2IZUA 4ERWA 3ORPA 2QR8A 3KRXA 4HCTA 5HE3A 4HOKA 2XKCA 4AW5A 4BDHA 4ORKA 4IE9A 3OCBA 4AOTA 2WIHA 2O0UA 3P7BA 4C33A 4UBAA 3R1YA 3DU8A 3KL8A 5D11A 4F0IA 4ANBA 3Q60A 5GHVA 5IQFA 4R5YA 4BDCA 3ID6C 5CF8A 1U5QA 1KE6A 4FTMA 4RMZA 4U40A 1YRPA 4GFGA 5AIRA 3ATSA 3ZSIA 4PL5A 4KD1A 2ZM3A 3QCQA 4X3JA 2WMRA 4XRJA 2HELA 2ERKA 1PW2A 2QU6A 2XF0A 4CMTA 2ONLC 5AA9A 3F82A 2X1NA 3C0IA 3OXZA 4AGCA 4EK6A 1Q61A 3FKOA 2WD1A 3OOGA 3PXFA 2VGOA 5ETAA 5LMKC 4WNOA 5EQYA 2IG7A 3MN3A 3GUBA 2X8DA 3KVXA 3FI8A 3I7CA 4K77A 1BL6A 1OL7A 3K5VA 2CGVA 3EYHA 3FJQE 3G0FA 4IIRA 5JGDA 2I0YA 3R7EA 4KIKB 2WHBA 4IM2A 3AC4A 4AOIA 3TXOA 4NM0A 4CCBA 3OY3A 4EOJA 3ORKA 4TYIA 3IKAA 3UOKA 3TNQB 4YP8A 2R3HA 3FLYA 3JUHA 4ALUA 3H9OA 2VTPA 4DEBA 4YJVA 4AZWA 2F7XE 4L3JA 3WZEA 3HRCA 4QP3A 3RK5A 2EXCX 3ZOSA 3S4QA 2BZKB 2C6KA 4Q5EA 4RWKA 3GQIA 4O0RA 3RAIA 3EOCA 3IO7A 1QL6A 2CMWA 4DLJA 2E2BA 5HIDA 4CNHA 3DDQA 5KZIA 3UIMA 2W9FB 3TTJA 4NZWB 3VIDA 4C62A 1KWPA 3VAPA 4BTKA 3ZTXA 3IDCA 3FPMA 4AZFA 4RPVA 2VTRA 4KKGA 4RVTA 4FVPA 2XMYA 3R01A 4MK0A 5D7AA 4YTHA 5CEQA 4I0RA 2UZBA 4P2KA 3VBQA 2ZM1A 3OCGA 4FVRA 2JFMA 4FL2A 2G2IA 2XKEA 4GT4A 3COIA 2PVYA 1QPEA 4NW6A 4BCMA 3A7FA 2B52A 4YC8A 4LM5A 5I3OA 1H8FA 3V8SA 5CWZA 4IB5A 3EHAA 1PXPA 4EH3A 1QMZA 4AOJA 3Q2MA 2I0EA 2PULA 2JEDA 3ZFMA 3ET7A 3OUNB 2JKQA 2VUWA 3FC1X 5FRIA 5FEQA 1BUHA 5M4FA 4EHGA 3W33A 5JMSA 3ORZA 4IB0A 4XG2A 2H34A 5ACKA 4PTCA 3TJCA 3DS6A 3O8UA 3U51A 4DH1A 3FZRA 1YWRA 3R0TA 4H36A 4LMNA 1VEBA 5FBOA 5EW9A 3K3IA 5KMOA 1WZYA 4BWXA 2R9SA 4KWPA 4FV8A 4JRVA 4G3DA 3DA6A 3BWFA 5C4KA 5LCJA 1E9HA 2W4JA 1A06A 2G2FA 2GNJA 2HW7A 3CEKA 4NIFB 4ONAA 4X3FA 2XEYA 4S33A 3ZYAA 1J1CA 4D1ZA 3EQCA 5H9BA 4QTCA 3SW4A 1WBSA 2WTDA 4QMVA 5CS6A 3NPCA 5KHXA 2CGXA 4RFMA 3R7UA 4CG8A 2R3MA 5A3XA 4D1XA 4ZLOA 1XHAA 2JC6A 3RWQA 3A8XA 1GY3A 3OROA 5CLPA 1PF8A 2ESMA 4S34A 5C26A 3C4CA 1JKKA 4CV9A 2X2LA 3MIYA 3NSZA 3K2LA 3BQRA 3UMWA 2JBOA 2EU9A 2ACXA 4I23A 4D0XA 1ZY4A 4H05A 4A4OA 4PPAA 3QQKA 4GW8A 3NGAA 3ZU7A 2C5YA 4YSMA 3BBWA 3FHIA 3KMWA 1H0WA 1OBDA 1SVHA 2PE0A 3VRYA 3RPRA 4ZSLA 5G6VA 4AGWA 2R3LA 3IG7A 4UZHA 4C02A 4D5KA 5GZ8A 3UPXA 2J0IA 4Q5HA 5FTQA 5AV4A 2XS0A 4LGHA 1ZMVA 4FI1A 4FV6A 1GZ8A 3PP0A 5KHWA 1M2QA 4FE2A 3FE3A 3CP9A 3PZHA 3KXZA 4QRCA 4U5JA 3PWDA 4F7NA 3KVWA 3QQGA 4IWPA 4WNKA 3L8SA 2C68A 4UMTA 1H01A 1PYEA 2CSNA 3S0OA 1H26A 3NNWA 4YTCA 5LMAA 2H6DA 5LMKA 1OPJA 3F5XA 3LFAA 5GZ9A 3CBLA 3ZUVA 1HCKA 2VTSA 2Z7QA 3HX4A 3V5WA 4J7BA 3KQ7A 4FKUA 4XNEA 3Q04A 4EONA 3CCNA 5B2MA 3AT2A 1DI8A 4WG3A 5M56A 2OSCA 4L46A 4D2SA 3L8PA 2QO2A 4W8EA 3HVCA 1H4LA 3DBQA 4G31A 2O65A 1TQMA 4J8MA 4L7FA 5DT3A 4BC6A 4FGBA 3F5GA 5HO7A 5I0BA 3V5LA 3NCGA 2UZWE 3UG1A 3ORXA 4J99A 4AFEA 4AW0A 3QHRA 2WEIA 4I6HA 5CEIA 3MVHA 2OLCA 1Z9XA 5HLNA 3SOCA 4FTCA 4MXOA 2Z7SA 3FMMA 1OI9A 4IHPA 3JXWA 5KBRA 2OJ9A 3H3CA 4IVCA 4EEVA 3TUCA 4ALWA 4DGNA 4X2GA 3RWPA 3OC1A 2YHVA 5I9UA 3OBJA 4YHTA 3TNIA 4RGJA 2R3GA 3FY2A 3RAHA 3VUHA 4EZ7A 2BZHB 3U9NA 4GKIA 2YDIA 2YM7A 2YFXA 3VJOA 4U6RA 1A48A 3R9RA 2UZTA 4O81A 2Q83A 1ND4A 1QCFA 2Y6OA 4RJ8A 3DQXA 3DK7A 3VN9A 3QAME 3RKBA 2VO7A 2VWIA 2QOCA 2HYYA 3RAKA 4FNWA 4CZUA 4C8BA 1F3MC 1MQBA 2UW4A 4UXQA 4AQCA 4YUQA 4FZAB 4H58A 2VTHA 4KIOA 2B4SB 1QPCA 4NM3A 1KE7A 3QLGA 2CKQA 2X2KA 3D15A 3PFQA 3QQLA 4OTPA 4JIKA 1OL5A 2PHKA 3NAXA 4L00A 4FTLA 3FMDA 4Q9SA 5I3RA 3ANQA 4O84A 3F66A 3LM5A 5FEEA 3SDJA 5IA0A 4L68A 2VTQA 1YXUA 4YZNA 3KA0A 3HYHA 5CEMA 5B2KA 4FV0A 4R78A 3FQHA 3FI2A 4E4MA 3O0GA 2XM9A 1APME 1DS5A 2Y4IB 3F88A 3EH9A 4UWCA 4XG7A 5M08A 4DTKA 5M4IA 4N6YA 3CS9A 1Q4LA 3FMKA 2QOFA 3GOPA 4JOAA 4LUDA 5CU0A 2XIRA 2X9FA 3EJ1A 3HV4A 4JX3A 4Z16A 5D41A 3Q4UA 4GK2A 1O9UA 3UIXA 4BCKA 4HVDA 5AAEA 5M51A 4FYOA 2RG6A 1CKPA 5CU4A 4DG2E 4GIHA 1SM2A 4ZS0A 4F7LA 5K0XA 2C3IB 5EHYA 2XNPA 4P7EA 1JSVA 4YJSA 1OECA 5HE0A 5EG3A 4OAVB 2R3FA 3NMUF 1Y6AA 4E6QA 4ENYA 4D2VA 1GJOA 2C5VA 4F70A 4NW5A 3GC8A 4BKJA 2QKWB 4DH8A 2QOLA 4F63A 5DFPA 5CSHA 3WI6A 2B1PA 2BKZA 4J95A 4ZSGA 2Y9QA 1UU9A 3ACKA 3W2OA 2REIA 5CAUA 4CKRA 5IQGA 5DVRA 2A1AB 2ZDUA 1XJDA 3L9LA 3QUDA 2YZLA 1IA8A 2PMIA 2O63A 1V0BA 2NO3A 4ENXA 2HENA 4MH7A 4QMNA 4QP1A 2WMQA 5M55A 3DDPA 3Q4ZA 5GJDA 3UQFA 2GTMA 4C38A 4U3YA 4FV7A 4TKSA 4Y73A 4FTNA 4GVAA 5JFXA 3EQFA 3IW8A 4U81A 2C6LA 4GU6A 1UNHA 4DEHA 4FEVA 4R3CA 4R3RA 3KF4A 3UP2A 4D9UA 5FTOA 4YO6A 3OTVA 1CSNA 5CVFA 2QLQA 4QD6A 3P86A 2YDKA 3EN4A 3BYMA 5L8LA 5IZFA 3KFAA 3S1HA 4XLIA 4MAOA 4H3BA 3NIZA 3Q53A 2HXQA 4GSBA 4ITJA 3W18A 5AM6A 1W98A 4FZ7A 4O6LA 2R0IA 2W5BA 5JFSA 4TN6A 4ACCA 4AW1A 2PZ5A 3MY1A 4IAIA 5T68A 5KMLA 5K0KA 5AX3A 4DGMA 3DBEA 3Q6WA 4HGTA 4KIKA 3DAJA 2R3OA 3FI4A 5HX6A 3LCTA 3CTJA 4HZRA 5L2SA 2CKPA 4PTGA 3H30A 3LOKA 4BB4A 3SG8A 1S9IA 5CU6A 5IA3A 3LLAA 3ALNA 2XP2A 4N0SA 4L45A 4FTTA 4OT6A 3ZO2A 3ZXZA 4HGEA 4XEYA 4DHFA 3FMJA 4XMOA 2WAJA 2NPQA 4WBOA 5IA1A 1J7LA 2VTOA 2I0HA 4ZMFA 4EL9A 1JNKA 2YITA 2PVJA 4PDOA 4QMQA 2GQSA 1M14A 1FGKA 2ETKA 4FNXA 2UW0A 4Y5QA 2VTIA 3EFWA 3QYZA 4BCJA 3C1XA 5K5NA 5EI6A 5BVEA 3ZSGA 4DEIA 4U0IA 5AX9A 1YOJA 1ZXEA 2X7GA 3PXZA 4N57A 3A7IA 4Y46A 4BRXA 4GG5A 4YZMA 5CY3A 2IVSA 3I5NA 2OFUA 3Q9ZA 1XBCA 2V7AA 3FMEA 3CD8A 3AXWA 4CFNA 3NUXA 5LVPA 3VUIA 4XOYA 3LFCA 4RVMA 3TM0A 2BRHA 4BWKA 4C4IA 4U97A 4WBBB 5CAVA 3U54A 4PP7A 3SX9A 3PY1A 4ASZA 2H9VA 2UW8A 3DAKA 2OXDA 3G2FA 4GJ2A 2QCSA 3OXIA 1BMKA 4H3QA 4TWPA 4JDIA 1JBPE 1MUOA 4FTAA 4QP7A 5EW3A 2CNVA 1FMOE 3RPOA 4EJ7A 1G3NA 4CTCA 3ENHA 3R9DA 2XJ0A 3QYWA 5CEPA 4KIPA 1H25A 2NP8A 5HD7A 1GZOA 1WVYA 3DNDA 1K2PA 3VF9A 4F0GA 4AAAA 5CI6A 4AN3A 2V62A 4DEEA 2JLDA 2XYUA 4C3RA 3QC9A 2PZYA 2A4LA 5A4LA 3I6UA 3OD6X 4JRNA 4MXXA 2CJMA 5DLSA 4Z55A 4NFMA 4E4LA 4CV8A 3BKBA 4YURA 3BYSA 3MVLA 4KBAA 2BRNA 3TZ7A 4FSQA 3S95A 4MXCA 3QTQA 2FSLX 4GYGA 5HNBA 1OL2A 5BYZA 3OUKA 4MEDA 4FKRA 4UX9A 3KRRA 2OH0E 3SXFA 4DC2A 2W9ZB 3DXNA 4NIFA 3A7JA 5CSXA 4EKLA 3MTLA 4FKJA 4EWQA 5C4LA 3R00A 3PYYA 5TF9A 3O7LD 4FT7A 4C2WA 3U6IA 2B9FA 1ZMWA 1J7IA 1H0VA 1OB3A 2FYSA 3KY2A 4IWDA 3U4WA 4GS6A 4IFGA 3HMMA 3WE8A 2Z02A 4MBIA 1PXLA 1B38A 1XH9A 2WU7A 4ZY5A 3RNYA 5JSMA 4EOOA 3DK3A 5AP7A 4RIWB 5FBNC 5A6NA 2HXLA 4HYSA 1U5RA 3V3VA 4HVSA 3E3BX 2F2UA 4M68A 1PRYA 4C59A 4O82A 4U8ZA 2YZAA 5HVJA 2FUMA 4BCPA 5ANGA 4AT3A 3PPJA 3PRFA 1Q3WA 1XH6A 3A2CA 4BIBA 2YABA 5LMBA 5FXSA 2VTJA 3HV6A 5EYMA 2XBJA 2ZV9A 3OP5A 3FYKX 5EDRA 1R1WA 4S2ZA 4BGQA 2JDOA 5EK7A 4F6SA 3HRFA 5HKMA 1ZZ2A 4K8AA 1SZMA 2BDFA 3ALOA 5EFQA 3GT8A 3MYGA 2GFCA 3DZOA 3FZPA 2XJ2A 5FXQA 2W1IA 3TKHA 4FKLA 5TR6A 1U59A 2W7XA 5D9HA 2G9XA 4XX9A 3LQ3A 2QG5A 3ZLXA 3UC3A 3GU6A 4YR8A 3E93A 5DPVA 4QMOA 3UYSA 4DH3A 3QALE 5E92A 2C6IA 2WNTA 4BDIA 4IBMA 4NH1A 3A60A 4FSWA 5LOHA 2PVMA 2WTVA 3BLQA 1M7QA 4HVIA 5IQDA 1Q41A 2WTCA 4HYIA 1P5EA 4LFIA 5HBHA 2PVNA 4BTJA 3H4JA 2VX1A 3PLSA 5JK3A 4QPAA 1IAJA 4FGRA 2PVLA 2C69A 3VWAA 5HORA 3C51A 3CKXA 3GNIB 4UYNA 1YI3A 1YVJA 3IECA 5J95A 4O83A 3RHKA 3EQHA 4K11A 3P79A 3QTUA 4YZCA 4BDBA 3JS2A 4XUFA 2F7EE 1AGWA 1CTPE 4O7NA 4R5SA 1PXOA 2IVTA 3NCZA 4O0XA 2BZJA 2V55A 3C7QA 2PUNA 2CPKE 2R5TA 5E1EA 3SOAA 4CKJA 4XP3A 4DEAA 4HVGA 3Q4TA 4EWHA 4GIIA 2XVDA 3G33A 3PJ3A 4QPSA 4BCIA 5IEVA 3C5IA 2HCKA 4BDFA 3PIYA 4UV0A 3CTHA 3E7OA 4UXLA 1R3CA 4ZOGA 5DT4A 4KS8A 3T3UA 5HI2A 4TWNA 2OBJA 1FBNA 3TNHA 2WMTA 4TYHA 4YLLA 5TE0A 3II5A 2JDVA 5AR4A 2IWIA 2RSVA 2PMNX 4RIYB 5JGBA 3I1AA 5HLWA 2CHLA 5AV0A 2Y8OA 4YBJA 1WCCA 4ZXTA 2R7IA 3LCKA 2X0GA 1IRKA 5HNIX 2BHEA 4O7WA 3LXPA 2VX3A 3OWJA 5A14A 3BWJA 4YC3A 4A7CA 3MPTA 2YIYA 5DA3A 3KRJA 3DZQA 4WOVA 3ZH8A 4FC0A 4DA5A 3BHUA 4PV0A 4ERKA 5HCYA 3PXQA 3QF9A 2WO6A 4TZRA 3BE9A 3BGPA 3TKUA 2WQBA 4IWQA 3DLSA 4YJPA 4MWHA 4AXAA 4PNKA 4F7JA 2XA4A 3ZRKA 3VUTA 4YNOA 4C0TA 4F9AA 5EQPA 4F0FA 4FVQA 1OKYA 2BDWA 2XB7A 3RALA 3KK9A 1WBPA 2OIBA 4TT7A 2CN5A 5TKDA 5DEYA 3WF9A 3IW6A 4BFMA 3E7VA 4DTBA 2W17A 2QONA 3NRMA 2VWBA 3WIGA 1NVQA 4R3PA 5F20A 4QMMA 3BI6A 3HV7A 2CCIA 3GC7A 4E8AA 3AGMA 2JKOA 4U41A 4DGLC 4IAZA 5HD4A 2XIXA 4MNEA 2BAKA 4JQ7A 5CSVA 3W8LA 1YI4A 1AD5A 5E8UA 1F0QA 3ACJA 1GIIA 1Y57A 3C0HA 3F5UA 2VAGA 4PF4A 2BIYA 2C5XA 2XNMA 3DXQA 2PVFA 1B6CB 3QD3A 4W9XA 4B4LA 3GU8A 3HMNA 1W82A 2WKMA 3G6GA 4MXYA 4MD7E 2YERA 2UZEA 3HEGA 3ZM4A 5HBJA 1O6KA 3BV2A 3EMGA 5EQEA 1B39A 3DQWA 5GINE 4M69B 3D5WA 1YWVA 3LE6A 5LVLA 3R8LA 4L53A 4WUNA 3O17A 1XBAA 3Q9YA 4FIHA 4GRBA 5CT7A 4F1MA 4DN5A 5EYKA 2BTRA 2ETRA 4CTBA 5CI7A 4W4XA 2E9VA 5M4UA 2J0JA 3D83A 3UPZA 4EBWA 2JFLA 4FICA 4F4PA 3GB2A 3ZONA 4F64A 2QHMA 2C6TA 4FG9A 5L2IA 2H8HA 4EOSA 3I60A 1J7UA 4JBOA 4M8TA 1OM1A 4CFVA 4ZY4A 3DJ6A 4NT4A 3WBLA 4RJ4A 4L9IA 4W9WA 4ZK5A 3FUPA 2WOTA 1I44A 3HGKA 1LEZA 4G3GA 3F3ZA 5HLPA 4YTIA 2BRMA 3RM6A 4G3CA 5FUTA 4O2ZA 2HWPA 1SNUA 2GQRA 1NT2A 2GHMA 2OW3A 2XRWA 4O21A 3D9VA 3EKNA 3DOGA 4YU2A 5IQAA 3R8UA 4FEXA 4G1WA 1OL6A 4EH2A 1Q3DA 3CY2A 2G2HA 1TQIA 4BCOA 3PP1A 4AE9A 2FSMX 3IQ7A 4YMJA 4CFXA 4X2NA 3M2WA 2VWZA 3L9MA 4OBOA 3OCTA 3RM7A 1OIRA 4JNWA 1YW2A 4QQTA 3UO6A 1OUYA 4K18A 1XR1A 2ITTA 2UW3A 4FZ6A 4AA5A 4C2VA 2OWBA 3H10A 3O8TA 4PQNA 3V51A 3FQSA 5LVNA 4G9CA 2J2IB 4HZSA 4E4XA 2XKDA 4GCJA 4O96A 4XG9A 4USFA 5JQ8A 3EFKA 3BE2A 2ERZE 4O6EA 4RVKA 4C36A 2GS6A 3EWHA 4BI1A 2YISA 4CT2A 4FEQA 3TV6A 3MV5A 4YJOA 3QFVA 3EFJA 3FKLA 3QTRA 5DR6A 5LJJA 5GIPE 1OIYA 1YOLA 4XCUA 3UVQA 2XCKA 4A9YA 1UKIA 2J50A 2XKFA 2I1MA 1KE8A 4F6UA 3GVUA 5AV3A 5HESA 4BI2A 3DFCB 1ZOGA 4ITHA 1OGUA 4OTIA 3MA3A 4FX3A 2X4ZA 4OTFA 3QWKA 2JD5A 5BVKA 3NIEA 3VS6A 3WZJA 2KTYA 4QNAA 3WF5A 5KKRC 4CFWA 1H28A 5AUZA 3ZO4A 5AP6A 3QD0A 3TG1A 1H00A 3BHHA 4EKKA 5HHWA 4M15A 5CASA 3QCYA 5L4QA 5LARA 3D7TB 1IASA 2VX0A 4JIAA 1P2AA 3HLLA 4CXAA 3C5UA 2BPMA 2WTIA 3BPRA 3F7WA 2FGIA 3KC3A 2BRBA 3MPAA 4QOXA 2PMOX 3R8MA 4FV2A 4V0GB 3ETAA 3ZUUA 4AWIA 5G1XA 4BZOA 4QMZA 4E6CA 4OGRA 5ETFA 2IO6A 4NTSA 3REPA 3IPHA 4RX7A 3MJ1A 3PE2A 1XH7A 2OI4X 3QCXA 2XIYA 1K9AA 4KRCA 4DF3A 4I1ZA 5DRBA 3VS2A 3SV0A 3P7AA 4FIEA 3CPBA 4MQ2A 4L67A 5AP5A 3VUGA 4DFXE 3RJCA 5M57A 4A4XA 4FSYA 3MBLA 4IWOA 2NRUA 3LW0A 1NY3A 1U46A 3H0YA 3W16A 4O2PA 5IH5A 3D94A 4JX7A 3MJ2A 4QYYA 5HBEA 3I0QA 4PNIA 3ZLWA 3O50A 4USEA 2ITYA 4QTBA 4FF8A 1ZYDA 3DAEA 2ZMCA 3ORLA 3RGFA 1KSWA 4IDTA 4CEGA 2XK7A 4IZAA 4L44A 5DT0A 4XBUA 2WQMA 4BGHA 4I6QA 5E8XA 3C9WA 4ZTRA 3LIJA 3L9PA 4LQMA 4MX9A 1U54A 4IVBA 3TNPC 5HEZA 4RIWA 5FLFA 3Q5ZA 1P4FA 2GNHA 4QTEA 2R3KA 1XQZA 3R63A 5KMMA 5GIOE 3R8VA 2ITWA 4WG4A 3OF0A 3KCFA 1H1SA 4W8DA 4G5PA 2A0CX 4JL9A 2ZB1A 4O0VA 5CEKA 4A9SA 4YGAA 2C6DA 4BCHA 3E87A 5JKGA 5IQIA 2CCHA 5E90A 2ITZA 4IB1A 4M97A 4P5ZA 3N4VA 4K1BA 4HCVA 4AZTA 4DITA 2C3LA 3NW5A 2X8IA 3PY3A 3R02A 2R3IA 2J4ZA 2IVUA 3GCQA 3BU3A 2OF2A 5AMNA 5DWRA 1UNLA 3KRWA 5CT0A 3F61A 3VUDA 5F9EA 2PVRA 5AUXA 1YXVA 3QRKA 3R28A 2OZAB 3UVPA 3HV3A 4XP2A 2QNJA 5ETIA 4QP6A 1ZOHA 1Q8TA 5AP1A 3UTOA 2C5NA 4K2RA 4FK3A 2LAVA 3UZRA 1ZAOA 2XK3A 4HYHA 2XM8A 3BHTA 3QTZA 5DN3A 3KKVA 3BEAA 4BL1A 2QVSE 3RHXA 1ZYCA 1P4OA 4J96A 3GCUA 3LXNA 3AMYA 4U7ZA 2PU8A 5H8GA 3QA0A 2HY81 3WILA 1FINA 3SLSA 3F5PA 5EYDA 4X6QC 1V1KA 5HCZA 1AQ1A 3NEWA 3P78A 4J97A 3MH1A 3PE1A 2OO8X 3QXOA 5JRSA 3DBDA 4H1MA 4I22A 1SVGA 4QP4A 4ASXA 4EC8A 5BQ0A 1BI8A 1PXMA 5CVHA 2P33A 5CNNA 4ASEA 1KV1A 3E62A 4AX8A 4C4JA 2VWWA 2VV9A 3CQUA 4FT3A 3MFSA 4AGUA 3GU5A 4S30A 3TCPA 2J0KA 3AC2A 1H1WA 2VWYA 4G9RA 4Z7HA 5LQFA 4D4RA 5KX8A 4IADA 2KULA 3UIBA 2ONLA 2I6LA 1OPLA 4O7LA 2B9HA 3W2QA 5K9IA 2XNBA 3M1SA 3MVJA 4PUZA 3TV4A 3TIZA 2J6MA 3MTFA 3E88A 4C4GA 4RIYA 1M7NA 5IQBA 3TJDA 3L9NA 3E63A 4IVAA 4C58A 4U43A 2HZ0A 3RP9A 4ITIA 4YJTA 3PJ8A 3HA8A 3UYTA 3ULIA 5D7VA 2IW9A 3VUKA 4EI4A 4RC3A 2GMXA 2ZV2A 3KF7A 3QQHA 4UZDA 4I41A 4GFMA 4Z3VA 4G16A 3CY3A 4N70A 3R8ZA 5GZAA 4PPBA 4LL0A 4Z7GA 3QRJA 2IZTA 4KKEA 1JKTA 3MSSA 4YC6A 4YJUA 4IX5A 1LR4A 1ZYLA 5CSWA 3ZEWA 4FEUA 5A6OA 4EK3A 4J98A 2QOKA 4MCVA 3PPZA 4KA3A 4R7HA 3FSKA 3AC1A 2HZNA 3SXSA 1O6LA 2SRCA 3LQ8A 4TW9A 4BDAA 3Q2JA 4TPTA 5DGZA 5H3QA 5KO1A 3MY0A 3VQUA 2PPQA 4FTUA 3O23A 3GC0A 2VWUA 2JGZA 4LRKA 4ZY6A 4DH5A 4TYHB 4I21A 3R7GA 4ZJJA 3VW6A 3DB8A 3FWQA 1UWJA 1WBWA 4RBLA 3FZTA 3HMIA 3OFMA 3ZFYA 4RZVA 3UBDA 5IF1A 3BELA 2JDRA 4AGDA 4M69A 4GK4A 4FTIA 1PKGA 3N4UA 3QD2B 1R0PA 3B2TA 3NR9A 1Q97A 4J52A 3FLZA 4EH9A 5M07A 1JVPP 2EXMA 4YJQA 4AP7A 3D14A 5AM7A 5HU9A 5M44A 5I9ZA 3I81A 3UJGA 3QA8A 4O0UA 4P90A 4UMQA 5EOBA 4AU8A 5LWNA 2VGPA 3ZRLA 4AZSA 4NCTC 1WFCA 2G15A 3COMA 3DB6A 4L8MA 5CSPA 1ZYSA 1XH5A 2B53A 2W1GA 1JSUA 2RF9A 4M12A 4NK9A 4CLJA 5IQHA 4ACHA 2X81A 5ANIA 3VS3A 4CFMA 3CKWA 4MNEB 4Y5HA 3UIUA 2VO3A 4MBLA 3M42A 1M52A 2YACA 2WTKB 5E8SA 1UVRA 2UZOA 1ZZLA 3NUUA 4D1SA 4BI0A 4HJOA 4OTQA 2J0MB 3CD3A 3N51A 4YZ9A 5E8TA 4FEWA 1PMNA 2QOQA 4IXPA 5F94A 5TO8A 1VYWA 1RJBA 2G1TA 5DMZA 3F2NA 3FI3A 3JY9A 2V5QA 4IAYA 3NYOA 2O8YA 4KBCA 3O96A 4I20A 4WSQA 4F08A 4FZFB 3D5XA 4HNIA 4HNFA 1DM2A 2JKMA 5BUJA 2JAVA 2QOIA 3A99A 4QTAA 5HU3A 2WFYA 3U4UA 3OHTA 3UZPA 4IZ7A 5BVDA 1A9UA 2JDTA 2X39A 4JBVA 4FSTA 4BR3A 3UDBA 3R22A 3Q5IA 3TN8A 3EB0A 4NTTA 3E3PA 3ZXTA 5DRDA 3UQGA 3HL7A 2YWVA 1IEPA 4OW8A 4I6FA 4OR5A 4ANQA 3RAWA 4JS8A 5ITAA 3PXRA 1KOAA 5C01A 4TTHB 4D55A 5AFVA 2OXYA 4IM0A 4FUYA 5AR3A 3TT0A 5A4TA 3CGFA 3IONA 3NX8A 4FKTA 5I4NA 1NW1A 2F2CB 3HUCA 5HG7A 5DHJA 4A07A 4ZZNA 5KMKA 5LVMA 5AP0A 5IUGA 3S00A 4O86A 4WRGA 4UWBA 4EZ5A 4FKGA 1JPAA 5IPJA 3LVPA 5D1JA 4DT8A 3MI9A 3JY0A 3V5PA 3OG7A 5B2LA 4M3QA 4EJNA 2QQ7A 3HNGA 2O5KA 2GNLA 4YJRA 3NNVA 4X2FA 3HUBA 5JRQA 3D7TA 5CTPA 4I0SA 3LFDA 4N6ZA 4EH7A 5HTCA 4R6VA 4DBNA 3D2IA 2F7ZE 3I4BA 5FD2A 3ZZWA 5AA8A 4PMPA 4ZMEA 1DI9A 4QP8A 3FLSA 4AS0A 2DUVA 5A54A 3JR1A 4V0GA 4NWMA 2CGUA 4DH7A 5FXRA 5J7BA 2B0QA 3QHWA 4CG9A 5M53A 1LUFA 2H96A 3AMBA 4M67A 3KN5A 4O7YA 3QUPA 4GEOA 2C4GA 2FA2A 4NM7A 1PJKA 1V0PA 5BVNA 4IC7A 4GT3A 2YAKA 3UQCA 4FR4A 3HP2A 1IR3A 2VTNA 2WMXA 3LFNA 3OBGA 3QKLA 4YLJA 3SD0A 5BVOA 4RJ5A 5J7HA 2YA9A 3QRTA 3F3VA 3MGYA 5EM6A 2Y7JA 5AUYA 2OIQA 3ZFXA 4ZLYA 1H08A 2C6OA 4Y85A 4EBVA 3F3TA 4QO9A 3SRVB 2YM8A 3BCEA 5E1SA 2CLXA 5H2UA 5JEBA 5FEDA 1L3RE 1H1QA 2WMWA 3W2RA 4FKWA 5HICA 4CZYB 4JBPA 3PVBA 3CLYA 4OTDA 4QQJA 2VWVA 5HGIA 4F9CA 1J91A 3LQ5A 4OTWA 4FSNA 5M06A 4CVAA 5AV2A 2YIQA 4ANLA 3VS1A 2W1ZA 1JAMA 3FAAA 4KB8A 4CMUA 2VTTA 5JT2A 3R9HA 1TQPA 3P23A 3OEZA 3GOKA 3PSBA 2HOGA 3BGQA 3K54A 4WNPA 5E7RA 4HPTE 2WQEA 3ANRA 4C37A 1W84A 3LHJA 4FKQA 1WAKA 2AYPA 1XWSA 4DGOA 4R1VA 2W05A 2BHHA 5FP6A 4I4EA 3P08A 3R73A 4FT0A 1ZOEA 2P2IA 4FV1A 2V22A 3K3JA 2UZUE 1KOBA 4IACA 3ZBFA 4E93A 4G6OA 4DFYA 4X7QA 2YM3A 2JIVA 4HW7A 2R2PA 1X8BA 1M17A 3ZEPA 2BILB 2WMVA 4HGLA 4X0MA 4RX5A 5J9LA 4M84A 4PP9A 5EM7A 4B9DA 1ZMUA 3O7LB 2C0TA 2DYLA 3HMOA 4O0SA 3G5DA 3NVMB 2OZAA 2RFEA 4TNDA 5IA5A 2FH9A 4ACGA 4KNBA 5L6OA 3R7IA 3OT3A 4OUCA 2WTKC 3ZDUA 3NVKI 5BPYA 1H27A 1VZOA 4YHJA 3RCJA 5IMXA 2GCDA 2IVVA 4D4SA 4FSRA 4BYJA 3OCSA 1SMHA 4G34A 2GQGA 3I7BA 3OMVA 4BN1A 4CFFA 1U54B 2GFSA 4IDVA 1LPUA 5AP4A 5HVYA 4CKIA 3W32A 3V04A 5CXHA 5CZIA 4KSPA 4O0YA 2PUIA 3EQIA 4FL3A 4EK5A 2PUUA 4P5QA 5HNGA 1E1XA 4JG7A 3BQCA 4S31A 1H24A 3V6SA 2X7FA 4RFZA 3B2WA 5J5SA 2JIIA 4KAOA 2HW6A 3SAYA 2OICA 2R4BA 4GU9A 4BYIA 3UODA 5C1QB 2BVAA 5E8ZA 4R7BA 2JAMA 3RBWA 4F9BA 5FGKA 4AA4A 4FSMA 2R64A 4YJNA 1UU8A 4FTJA 1OIQA 4E6DA 5JZNA 4BTMA 1FVVA 2OJGA 4RWLA 4QMXA 4C34A 2W1HA 4LI5A 5EM8A 3V5TA 5CQUA 4QTDA 4JAIA 2PYWA 2R3QA 2XIZA 5AEPA 4ZSJA 3BYVA 4ASDA 3F3WA 4AW2A 3PVUA 5HE2A 1F5QA 4U3ZA 5T3QA 5K5XA 3FMHA 2UV2A 3AT4A 3QUEA 3LCSA 1Y6BA 1RE8A 3JYAA 3UMXA 4C3FA 4TNBA 3VS4A 2OU7A 2HY0A 3CIKA 5CU2A 4B6LA 4PWNA 4EC9A 5IG1A 4RIXB 3BU6A 5EM5A 2XUUA 5L2QA 4RC4A 2FVDA 4FKVA 3VNTA 5AV1A 1RW8A 3FMLA 4BDKA 1YQJA 2AUHA 4H3PA 4PL4A 2ITPA 4QP9A 4MNFA 2W1EA 1H1PA 4DTAA 2BCJA 3BX5A 1YHWA 3TDWA 3BZ3A 2UVYA 3D0EA 2FB8A 3A7GA 3NUAA 2W1DA 3AG9A 2NNWB 4NEUA 3FPQA 3TKIA 2J90A 2IZSA 4MXZA 4TYEA 3VS0A 1FVTA 4BKYA 2YJRA 4A9RA 4UEUA 2J0LA 5BMSA 5A4EA 4FV5A 3AD6A 3PWYA 4O27B 2WELA 2UZNA 3CJFA 3R8PA 5TOZA 2W5HA 4HCUA 4ZTQA 3D4QA 3V5QA 5KKRB 3PUPA 3NLBA 1T46A 2PL0A 1WBNA 2J5FA 3KXGA 4D5HA 1W0XC 3TWJA 4E5AX 1JQHA 4Y83A 4IANA 2AC3A 4FG8A 2ITXA 3ZDIA 3P1AA 3QTXA 3F2RA 3D5UA 3P7CA 1OVEA 3NAYA 3NYXA 5J1WA 1STCE 2VD5A 4X21A 3JPVA 4NL0A 2YCRA 4IW0A 2XCHA 1P14A 5DYJA 5IH6A 4XG6A 5EYCA 3AC8A 2RFDA 3BIZA 3EZVA 4I5MA 3LZBA 3LPBA 2ITVA 3R04A 3ZS5A 4ALVA 4BCQA 1Q8WA 2W99B 3W2SA 3UZTA 3IS5A 4H39A 4TXCA 4BHNA 1OL1A 3NDMA 3PXKA 3CPCA 4GUEA 5CAOA 3HA6A 5ACBC 4AT5A 2ZAZA 5A46A 2YEXA 3WZDA 4JDJA 3LLTA 4EH6A 4BY9E 4FV9A 5E8WA 3G51A 3CSVA 1ATPE 3C50A 2I40A 4RWJA 3RZFA 2I7QA 2RFSA 5EH0A 5CALA 4D9TA 4USDA 4J8NA 4APPA 4M7IA 4D2RA 3K5UA 2IW6A 1G8AA 4U45A 3G9NA 2CLQA 2HIWA 3TTIA 3GFWA 2BIKB 5IUIA 5IQEA 3LFEA 5C8NA 5I9YA 3IW5A 3GU4A 1PMEA 4LGDA 4EOLA 4J53A 3KMUA 4WG5A 4BIEA 3BLHA 1YI6A 1Q8YA 3PA4A 5IISA 1IG1A 5EI2A 1L8TA 4ANSA 3SGCA 1XBBA 2GPHA 2W0JA 1JLUE 5CANA 2YAAA 3PY0A 2Q0BA 3QZGA 5EW8A 4ZZOA 3TZ9A 2C1BA 3CGOA 5KMNA 4WD5A 2UW7A 3ELJA 1VR2A 2BAQA 3U55A 2WTWA 4CLIA 4RZWA 3MFRA 2EB2A 3MY5A 2R3NA 3OZ6A 3EN9A 2EVAA 3AT3A 4JR3A 5JGAA 4OTRA 2WQNA 2QODA 4RT7A 4PTEA 3VO3A 4C35A 2W1FA 5I9VA 4IZYA 5AIKA 1U4DA 4MVFA 5F1ZA 5I5ZA 1UV5A 4E26A 4IH8A 3C4ZA 2YLFA 3MFUA 4K0YA 3I5ZA 4V01A 4IMYA 1MRUA 2OIDA 5FDXA 3P4KA 2R3RA 4DBXA 5EKNA 2VO6A 2R3JA 3IOKA 5B0XA 4QT1A 2RIOA 2GS7A 4FOCA 2YCFA 2F9GA 4CYJA 3HMPA 2GNIA 3BHYA 3PRIA 1GAGA 3QD4A 4Y8DA 4BBMA 4EYJA 3DXPA 3NUNA 5I9WA 2WOUA 3L8XA 4IFCA 3QBNA 1MRVA 2P2HA 4E5BA 4G6LA 3LXKA 4QPMA 4FV4A 3GCPA 3QRIA 2BROA 4I5CA 4PY1A 4CRLA 2W96B 1YWNA 4AUAA 3EFLA 3F2AA 3PSDA 4I92A 4MF0A 5J79A 3MW1A 4OBPA 1NVRA 3DY7A 2ZYBA 4DEGA 3Q52A 2YIRA 4FBXA 4LYNA 4MWIA 3RPSA 3T9TA 4M0YA 4ANMA 2IPXA 3MESA 3ZM9A 3ZC6A 3MA6A 4IAAA 2BDJA 2CKEA 4DG0E 4FNYA 4C7TA 1WBTA 4BDDA 3PA5A 4DFNA 4LRJA 3R9OA 2ZB0A 1UNGA 3NNXA 4X3FC 1M2PA 4MXAA 2B54A 3LFFA 4FK6A 5CF6A 2YWPA 4ZP5A 2Y4PA 3KN6A 4JAJA 4RWIA 1W83A 3GFEA 3ZC5A 2GDOA 1QPJA 3UNJA 3UOJA 2VRXA 3R7OA 3Q96A 1ZRZA 3QTIA 1GZKA 4PMMA 3T8OA 2C6MA 2XH5A 5E91A 4JT3A 4YHFA 3KREA 4RJ3A 3MB6A 3SRVA 2BR1A 3R30A 4B0GA 2O64A 3G0EA 3RMFA 2GHGA 3IGGA 3KXXA 3HECA 5AP2A 3PTGA 1JKSA 4B8MA 4PRJA 3OOMA 3H9RA 3V8WA 4DINA 4L43A 3ZHPC 5HTIA 4XLVA 5H8BA 3KXMA 4ACDA 3RK7A 4A4LA 4CRSA 5EKOA 3QZIA 2QC6A 4GT5A 3SXRA 5BUIA 4RLLA 5E9EA 3VBWA 3TDVA 5ANDA 3KEXA 4LOQA 4K33A 3ZLSA 2BMCA 5F4NA 4BHZA 5DIAA 2OG8A 3DTCA 1KE5A 2OJIA 2P0CA 2E9OA 3OT8A 5EDQA 2VTAA 2B7AA 5JFWA 4QYEA 5AADA 3RVGA 1RQQA 1UA2A 1S9JA 1BKXA 3RPYA 4I5PA 1RDQE 2DQ7X 2XJ1A 1GZNA 2CDZA 3G90X 3KULB 4KRDA 4RQVA 5AUVA 4NYEA 4IAKA 3GENA 1BL7A 4WRSA 5M4CA 3PIZA 4F9WA 4G17A 5L8JA 5A9UA 4B7TA 2HWOA 4QQCA 2BALA 3FXZA
chains in the Genus database with same CATH superfamily
2OKRA 2WB8A 2UW6A 3FHRA 2PZRA 2YCQA 1SYKA 3A4OX 3C0GA 3FL4A 2B9JA 4M13A 3VF8A 4AFJA 3EL8A 3R1QA 4LV5A 3PPKA 4IAFA 2YJSA 4IX3A 3KGAA 3UOLA 2C3JA 5HQ0A 3O8PA 3R6XA 4FT9A 2QO9A 3EN7A 2UUEA 4U80A 2QD9A 4U44A 2E9PA 3ZRMA 4BDJA 4EOPA 4BDEA 2YM4A 2ZV7A 4QMYA 3CJGA 4ANOA 4EOKA 3SHEA 1XKKA 4BBEA 4E6AA 2VNWA 1PXIA 2PK9A 1WVWA 3F7ZA 4FT5A 4RFYA 5CZHA 1KE9A 3B8QA 4D2TA 2OJJA 2W4OA 4HGSA 4MYGA 4FKSA 3S2PA 4WSYA 3UNZA 4QMPA 2QLUA 2VZ6A 5DEWA 5F95A 1FOTA 3IDBA 2C30A 3ERKA 3HKOA 2RL5A 3POZA 5FM3A 3R7VA 5HOAA 3BHVA 5FTGA 1UKHA 2HZ4A 3QQJA 5K3YA 4BCNA 3AD4A 3ZUTA 3PZEA 5CNOA 4WNMA 3OVVA 5HG8A 4OLIA 3TZ8A 4XV9A 4EQUA 2CNUA 1URCA 2XNGA 3Q6UA 3OS3A 3PXYA 4LOPA 3T9IA 3ZCLA 3FC2A 4EHZA 4F7SA 4WO5A 4BIDA 3IW7A 1JOWB 4EK8A 4UN0C 2W1CA 4NKSA 4CQGA 2ZV8A 1YDRE 2WXVA 4RVLA 3EYGA 4GH2A 3DV3A 4TWOA 1GIJA 3SKCA 3LJ0A 5J9ZA 4DFBA 1OBGA 2XYNA 1Z5MA 4G3FA 3Q9XA 4F1OA 2F49A 5DH3A 5L2TA 3WF6A 3LFSA 1OUKA 4E7WA 4FKIA 3DKGA 5IEYA 2CGWA 2JITA 3F6XA 3PVWA 3WARA 1TKIA 1YXXA 3HP5A 4RIXA 3TZMA 4RIOA 2RKUA 4BZNA 1IAHA 3VVHA 4TYGA 2IZRA 3VBTA 1CDKA 2C1AA 2QURA 4CD0A 1XMLA 5DBXA 5CF5A 2DS1A 4FG7A 1VJYA 2X9EA 3JVRA 4EHVA 1URWA 3PDTA 3F9NA 2QOOA 4EOMA 3VQHA 3A61A 3JVSA 1LEWA 1M2RA 3BYOA 5HE1A 2F57A 3FL5A 2ZFYA 1Q8ZA 5ANOA 4TYJA 5AR5A 1PYXA 2UW5A 3FDNA 3FQEA 3VW8A 4AN9A 2WMSA 3VRZA 2WQOA 4KKHA 2A27A 3GXLA 4D4VA 4ID7A 4S32A 5I9XA 2Z60A 2ITUA 4GUBA 4EHEA 5FWKK 5B7VA 4RLKA 1Q5KA 5J8IA 4FKPA 5LVOA 1G8JA 3QQFA 2DWBA 5HCXA 4F9YA 2BKKA 3VS7A 2X4FA 3CC6A 3IDPA 5E8VA 3FLWA 4LRMA 3QWJA 5FDPA 4CYIA 4E5WA 2A2AA 1ZYJA 4MBJA 5T6KA 4A9TA 4ZSAA 4BCFA 3LKMA 2FSOX 4Y72A 4FSUA 1YKRA 1UWHA 4I3ZA 4Q2AA 3U9CA 3CQWA 4IJPA 3R2YA 1H07A 2C47A 5HIEA 4E3CA 2OFVA 1V0OA 2VU3A 3W0MA 5HO6A 3FKNA 3QKKA 3V8TA 3BEGA 2ITQA 2QHNA 3A62A 4O1PA 3TI1A 4D2WA 3VHKA 5HVKA 2O3PA 3ULZA 2BTSA 1ZLTA 3HDNA 4ZS4A 2Q0NA 3DPKA 4C4HA 3BBTB 3QGWA 4ZEGA 3ORTA 5HZNA 1Z57A 4O7ZA 1PKDA 1CKJA 4DEDA 1ERKA 1Q99A 3AOXA 2JIUA 1YXSA 3D5VA 2PVHA 5JQ5A 4FTOA 4FYNA 2UZLA 4JXFA 3EZRA 3WYYA 4DFZE 4RSSA 5IA2A 3DKFA 4F09A 3I6WA 3ZO1A 4DGGA 1YHVA 1DAWA 2WPAA 3C4WA 1LP4A 3FXXA 3O2MA 3MIAA 4WIHA 4DT9A 3QXPA 4U42A 1UU7A 2FSTX 3RK9A 2ZDTA 3NYVA 4FOBA 4PL3A 5AUUA 4FV3A 2QR7A 4GG7A 2PUPA 2Z8CA 3AD5A 2G01A 3ITZA 3ROYA 2WIPA 2YM6A 3POOA 5K4JA 5KUPA 3EQPA 4CSVA 2J7TA 5CVGA 4BVUA 3IGOA 4QP2A 3E8NA 4LL5A 3D2KA 4U79A 3MS9A 5CQWA 2GS2A 2IN6A 5E8YA 3DGKA 4I93A 4DHJA 3W55A 5J1VA 3BV3A 3GQLA 2R0UA 2X7OA 4YPDA 3O71A 3KB7A 4RJ7A 3W10A 2OGVA 4TRLA 3WF8A 3OEFX 4FKOA 3I79A 4DAWA 1JWHA 1OIUA 3PIXA 2OJFE 3FLQA 3ATTA 4QMWA 2OH4A 2RGPA 2XNEA 4Y95A 3KXHA 5L2WA 2ETMA 3QZHA 1G5SA 4AQKA 3H9FA 3GEQA 4O38A 2HK5A 2XK8A 4PDPA 3UO4A 1I09A 5H8EA 4W4WA 5FQDC 4MD8E 2XAMA 3WZKA 3E8EA 4N4SA 4ZJVA 3DNEA 1JSTA 4D58A 3W0RA 3U8WA 3BRBA 1W7HA 4L3LA 4X2KA 5AR7A 4W4YA 4OAUC 1WBOA 3LCOA 2GTNA 4FODA 5A4QA 2XALA 4G5JA 3DT1A 4AZVA 4RJ6A 4A06A 4MD9E 1H1RA 4LV8A 4LV7A 4BCGA 3QGYA 2IJMA 2C3KA 3R7YA 3PSCA 3CTQA 1HCLA 4KSQA 5HIBA 3GGFA 4CMOA 1PXNA 1FMKA 4Q9ZA 5EHOA 3IK3A 4F65A 5J9YA 4EORA 3LJ2A 3Q4CA 3LMIA 3DK6A 2AEGA 4KUJA 4RC2A 4I5HA 3DKCA 4UYAA 1YDTE 3WE4A 5EI8A 1O6YA 4H1JA 4WHZA 3FV8A 3IW4A 4PX6A 4RA4A 4YLKA 3F69A 3LCDA 3FY0A 2OZOA 4GYIA 2WEVA 4L6QA 2ITOA 2EXEA 2X6DA 4XBRA 4R7IA 2CN8A 3NUSA 4L3PA 2Z7RA 3VHEA 4XP0A 2VO0A 1R39A 4GKHA 2Z2WA 3PJ1A 3W0OA 5C8KA 4PDYA 2E9NA 1NVSA 4QQ5A 3W2PA 4G2FA 2BFYA 2BUJA 4GV1A 3WYXA 5KMIA 3HZTA 4FL1A 4YNEA 3WF7A 3MDYA 4DCEA 3TV7A 5JN2A 4RA5A 4IC8A 3GCSA 4GJ3A 4EUTA 4QYGA 3VC4A 4MQ1A 3AC3A 4JI9A 3CR0A 3NW7A 4BTFA 4UY9A 3OWPA 2YM5A 2I0VA 3S3IA 3WOWA 3ZSHA 4GL9A 1J1BA 4QMTA 3DJ7A 1OPKA 4IZ5A 2XBAA 3V01A 4C61A 4AG8A 2QI8A 2J51A 3LJ1A 2XARA 2HAKA 2CNQA 2UZDA 1CM8A 5IUHA 3PJCA 2XIKA 2F4JA 1FGIA 2JBPA 3NWWA 4II5A 3D7ZA 4JBQA 4FSZA 4XV1A 5AAFA 3E8DA 4B99A 1OZ1A 4RX9A 5KMJA 5C8MA 3RZBA 4EUUA 4AF3A 3WIKA 3THBA 5L3AA 4EOIA 2OK1A 5DE2A 4R1YA 2RFNA 3SVVA 2J9MA 5A4CA 1WMKA 3KULA 3LXLA 1IA9A 3UOHA 3UDSA 5AR8A 4HPUE 2GU8A 5KZ0A 3NUPA 2YN8A 4C4EA 2LGCA 3ZMMA 4M0ZA 4M66A 2YIXA 3PVGA 5KE0A 4AZEA 4XG3A 3EN6A 3DCVA 4M14A 4NFNA 3VBXA 4KBKA 4L52A 4F99A 3RNIA 2V7OA 3EL7A 4DG3E 5CU3A 4ZJIA 2WU6A 2P4IA 2A19B 4APCA 4YO4A 3PLAE 4YBKA 3PJ2A 1MRYA 2O2UA 3U87A 4EH8A 3L1SA 2YCSA 2XK9A 4BWPA 4HYUA 3LMHA 5EDPA 4BF2A 4AXEA 3A7HA 3NS9A 1SVEA 4IEBA 4BBFA 2WMUA 4CGAA 3VBYA 1UU3A 1BX6A 4NJ3A 2B55A 4QMUA 4XOZA 5TT7A 1W8CA 2VTMA 2X6EA 5CF4A 3DTWA 3P9JA 4JLCA 4XHKB 1PXJA 1TVOA 5EHLA 4BKZA 1W2FA 1QPDA 4FUXA 4NUSA 2UVXA 1WVXA 3C4FA 5D10A 1GIHA 5AP3A 5HG9A 3RPVA 4R77A 1Q24A 3V6RA 4ARKA 2PMLX 4ZTSA 1WBVA 2XEZA 3KRLA 3DFAA 3MWUA 4NCTA 5J87A 4C3PA 2CKOA 3N4TA 2YLEA 4JR7A 4CCUA 3W0NA 5DOSA 2GNFA 1CMKE 2XK6A 3ZZEA 3ENMA 2FO0A 4ANNA 4FIIA 3UGCA 4R8QA 4EYMA 5BMMA 4TWCA 5BYYA 1GNGA 4MF1A 5IU2A 3UE4A 1NXKA 4LOOA 1KUTA 4WA9A 4YZBA 5BVFA 4WT6A 5LWMA 4PDSA 2GHLA 3CQEA 3GU7A 2ZM4A 3P5KA 4QYHA 5CXZA 4DLIA 4FZDB 3VS5A 3NNUA 3N9XA 3O51A 5C9CA 4IX4A 2Z7LA 4PPCA 3QX2A 1BI7A 1Q8UA 5FM2A 4QNYA 1OKWA 3MPMA 4FTKA 4DFUA 3A4PA 3QCSA 4BGGA 5HG5A 4U9AA 3CXWA 3UP7A 4BDGA 5BYLA 1MP8A 5CYIA 4ZTMA 4MHAA 3EQDA 3FZSA 3GI3A 4UWYA 2Y4IC 3Q3BA 2JDSA 3EQBA 4KS7A 2ZOQA 4GK3A 4QMSA 5EOLA 4A9UA 2PZPA 2V0DA 5LCKA 3FZ1A 2PZIA 4AN2A 4I6BA 5IH4A 5FG8A 4FIFA 1G8SA 3GC9A 1XH8A 3AQVA 1YHSA 4LGGA 1Q62A 4NM5A 3W2CA 1PMVA 4FTQA 4YTFA 5D12A 3RCDA 3W1FA 1DAYA 4UMRA 1HOWA 4X2JA 4W4VA 4ZTHA 2QO7A 4MTAA 2IW8A 3KMMA 3TIYA 5IEXA 4RQKA 1SNXA 4L01A 4ZSEA 5GNKA 4J71A 2WZJA 5CAQA 2UW9A 5AJQA 3HRBA 4XS2A 4BJJB 2BFXA 4GVJA 1OITA 2ZVAA 3VBVA 5IDPA 3ZO3A 5JH6A 4IJ9A 5GJFA 3DBFA 2YDJA 3H0ZA 2RG5A 3ZBXA 2VN9A 5L8KA 4UMPA 1ST4A 5M09A 4X6RA 3VULA 3CE3A 4GMYA 1KV2A 4FTRA 4CZTA 5ANJA 3COKA 1BYGA 4EZ3A 4I94A 2BZIB 4O7SA 3E8CA 1OKVA 5BUEA 1XO2B 2GNGA 4NJDA 3I0OA 1R78A 3LM0A 3R21A 4DE4A 4G3EA 2R3PA 3SQQA 4F6WA 4NKAA 4PMTA 4QEBA 3NZ0A 4I0TA 4YZDA 3C13A 4RG0A 5JFVA 2QG7A 1VYZA 3G6HA 3ORIA 2JKKA 2XZSA 3QTSA 2XK4A 3BLRA 3EQGA 3QZFA 2X0PA 3MH2A 4V04A 4XRLA 3R83A 3AC5A 5E4HA 2Y6MA 1JKLA 4MKCA 1T45A 3F3UA 4X3FB 3EIDA 5BX0A 1ZY5A 4HVHA 4LUEA 4ZTLA 2VNYA 5L6WL 3PG3A 4IM3A 2PE1A 1PY5A 3R1NA 4ZAUA 3MB7A 4JG8A 3UO5A 2J5EA 5IMEA 5JZJA 3ODYX 4AA0A 3KU2A 2W5AA 3OTUA 3LFQA 4O4DA 2EWAA 2W4KA 2WMAA 3NUYA 2BAJA 4FIJA 4UB7A 3QL8A 5CEOA 4V05A 2EUFB 5DR2A 3SG9A 3W8QA 3QU0A 3EN5A 4O91A 2WMBA 2GSFA 3KK8A 3KXNA 3QLFA 3UDTA 4JJRA 4JQEA 3OXTA 4E73A 3TL8A 1GOLA 4O22A 4EQMA 1YXTA 5J5TA 3MH0A 3KCKA 3VUMA 3R2BA 3BYUA 3Q32A 5AAGA 4YPSA 3R9NA 3ORNA 4UALA 3ROCA 3AMAA 5DG5A 1K3AA 5AUWA 5LXMA 4E1ZA 1PMUA 4L42A 1FQ1B 3E5AA 1J3HA 4RRVA 4OT5A 1OMWA 3U6JA 3FYJX 4RX8A 4QYFA 4O0TA 3COHA 3SA0A 3M11A 4KABA 5C03A 4NSTA 3QQUA 4D2PA 3ORMA 4GFOA 4JDHA 3FZOA 5HX8A 4EH5A 3GBZA 4LMUA 1REKA 4NU1A 2ITNA 3HV5A 1NA7A 3EQRA 5HO8A 3QRUA 1ST0A 3R71A 5ICPA 5KCVA 4I24A 4D4YA 3FEGA 4ZTNA 3LAUA 4CQEA 3EKKA 2P55A 4IQ6A 4XYFA 1Y8GA 2P3GX 2AQXA 4WKQA 1E1VA 2UZVA 5AWMA 5DNRA 3RTPA 3UC4A 4B8LA 3IOPA 1CKIA 2UVZA 3HAVA 3UNKA 4KIQA 5DI1A 4TY1A 3VJNA 3Q9WA 3SW7A 4IB3A 3MVMA 4I4FA 5K4IA 3QC4A 3BU5A 4YSJA 3RINA 4OBQA 4OTHA 3GP0A 4O7RA 3FLNC 4BZDA 2YIWA 4JQ8A 5ANKA 4FIGA 4BICA 4ZLZA 4FNZA 2ZMDA 4XJ0A 3ODZX 4C4FA 3NW6A 5IDNA 3GCVA 4O7TA 1REJA 4JDKA 4D0WA 4DFLA 3T3VA 4TL0A 2PTKA 1YOMA 3P0MA 4PMSA 3QX4A 3G9LX 3FMNA 2HZIA 1Y8YA 4K9YA 4IVDA 2OXXA 1XH4A 1ZARA 2OF4A 3TEIA 4E4NA 2C0IA 2E9UA 2X2MA 4JG6A 4EOQA 5KBQA 3HAMA 3QTWA 5FP5A 4J1RA 2AC5A 5ETCA 3OWLA 4L7SA 1PXKA 5GJGA 1BLXA 4O7VA 5DR9A 2W06A 3AGLA 3BGZA 3PA3A 4CFUA 3DBCA 3FBVA 3OW3A 5CAPA 4AE6A 5KNJA 5ANEA 4EH4A 5CX9A 3A8WA 4JVGA 2PY3A 2QU5A 2PVKA 3E92A 2C6EA 3DLZA 1FPUA 4XG4A 3ZLYA 2Y0AA 3QKMA 1FVRA 4G6NA 4EQCA 5HTBA 1OKZA 3FXWA 2PWLA 3TNWA 3UVRA 2XRUA 3HDMA 4XV3A 4P4CA 5BVWA 4AACA 4K6ZA 4C57A 4CT1A 5AUTA 2X8EA 2B9IA 3DKOA 4XH6A 2XNNA 5L6PA 2XNOA 4QMLA 2ZJWA 2EB3A 1MQ4A 2VTLA 3U6HA 5CENA 5IA4A 3MFTA 3OY1A 3NYNA 4ZIMA 5AR2A 4WUAA 3OWKA 3LFBA 1Y91A 3FSFA 5IQCA 3LMGA 3PG1A 4IX6A 2WTJA 5BNJA 4OTGA 4F1TA 3TUDA 3L8VA 2X0QA 2C5OA 2VWXA 4LG4A 3WZUA 4FA2A 3V5JA 2QOHA 4AT4A 1R0EA 3MH3A 4FMQA 4Z9LA 4DYMA 2C0OA 3C4XA 4XG8A 4ACMA 3E64A 4XV2A 3G15A 4ZZMA 5C27A 3B8RA 1YDSE 4KINA 2QKRA 4E20A 2NRYA 3R1SA 2QOBA 3UG2A 1PHKA 4O0WA 2WGJA 3RI1A 3C4EA 4UMUA 3SC1A 4D28A 3TACA 5IKWA 3OW4A 1EH4A 2BRGA 2PE2A 3TUBA 4DCAA 3DJ5A 2R7BA 1ZWSA 2PSQA 2IZUA 4ERWA 3ORPA 2QR8A 3KRXA 4HCTA 5HE3A 4HOKA 2XKCA 4AW5A 4BDHA 4ORKA 4IE9A 3OCBA 4AOTA 2WIHA 2O0UA 3P7BA 4C33A 4UBAA 3R1YA 3DU8A 3KL8A 5D11A 4F0IA 4ANBA 3Q60A 5GHVA 5IQFA 4R5YA 4BDCA 3ID6C 5CF8A 1U5QA 1KE6A 4FTMA 4RMZA 4U40A 1YRPA 4GFGA 5AIRA 3ATSA 4O4EA 3ZSIA 4PL5A 4KD1A 2ZM3A 3QCQA 4X3JA 2WMRA 4XRJA 2HELA 2ERKA 1PW2A 2QU6A 2XF0A 4CMTA 2ONLC 5AA9A 3F82A 2X1NA 3C0IA 3OXZA 4AGCA 4EK6A 1Q61A 3FKOA 2WD1A 3OOGA 3PXFA 2VGOA 5ETAA 5LMKC 4WNOA 5EQYA 2IG7A 3MN3A 3GUBA 2X8DA 3KVXA 3FI8A 3I7CA 4K77A 1BL6A 1OL7A 3K5VA 2CGVA 3EYHA 3FJQE 3G0FA 4IIRA 5JGDA 2I0YA 3R7EA 4KIKB 2WHBA 4IM2A 3AC4A 4AOIA 3TXOA 4NM0A 4CCBA 3OY3A 4EOJA 3ORKA 4TYIA 3IKAA 3UOKA 3TNQB 4YP8A 2R3HA 3FLYA 3JUHA 4ALUA 3H9OA 2VTPA 4DEBA 4YJVA 4AZWA 2F7XE 4L3JA 3WZEA 3HRCA 4QP3A 3RK5A 2EXCX 3ZOSA 3S4QA 2BZKB 2C6KA 4Q5EA 4RWKA 3GQIA 4O0RA 3RAIA 3EOCA 3IO7A 1QL6A 2CMWA 4DLJA 2E2BA 5HIDA 4CNHA 3DDQA 5KZIA 3UIMA 2W9FB 3TTJA 4NZWB 3VIDA 4C62A 1KWPA 3VAPA 4BTKA 3ZTXA 3IDCA 3FPMA 4AZFA 4RPVA 2VTRA 4KKGA 4RVTA 4FVPA 2XMYA 3R01A 4MK0A 5D7AA 4YTHA 5CEQA 3W0SA 4I0RA 2UZBA 4P2KA 3VBQA 2ZM1A 3OCGA 4FVRA 2JFMA 4FL2A 2G2IA 2XKEA 4GT4A 2XANA 3COIA 2PVYA 1QPEA 4NW6A 4BCMA 3A7FA 4BJJA 2B52A 4YC8A 4LM5A 5I3OA 1H8FA 3V8SA 5CWZA 4IB5A 3EHAA 1PXPA 4EH3A 1QMZA 4AOJA 3Q2MA 2I0EA 2PULA 2JEDA 3ZFMA 3ET7A 3OUNB 2JKQA 2VUWA 3FC1X 5FRIA 5FEQA 1BUHA 5M4FA 4EHGA 3W33A 5JMSA 3ORZA 4IB0A 4XG2A 2H34A 5ACKA 4PTCA 3TJCA 3DS6A 3O8UA 3U51A 4DH1A 3FZRA 1YWRA 3R0TA 4H36A 4LMNA 1VEBA 5FBOA 5EW9A 3K3IA 5KMOA 1WZYA 4BWXA 2R9SA 4KWPA 4LDTA 4FV8A 4JRVA 4G3DA 3DA6A 3BWFA 5C4KA 5LCJA 1E9HA 2W4JA 1A06A 2G2FA 2GNJA 2HW7A 3CEKA 4NIFB 4ONAA 4X3FA 2XEYA 4S33A 3ZYAA 1J1CA 4D1ZA 3EQCA 5H9BA 4QTCA 3SW4A 1WBSA 2WTDA 4QMVA 5CS6A 3NPCA 5KHXA 2CGXA 4RFMA 3R7UA 4DHZA 4CG8A 2R3MA 5A3XA 4D1XA 4ZLOA 1XHAA 2JC6A 3RWQA 3A8XA 1GY3A 3OROA 5CLPA 1PF8A 2ESMA 4S34A 5C26A 3C4CA 1JKKA 4AXDA 4CV9A 2X2LA 3MIYA 3NSZA 3K2LA 3BQRA 3UMWA 2JBOA 2EU9A 2ACXA 4I23A 4D0XA 1ZY4A 4H05A 4A4OA 4PPAA 3QQKA 4GW8A 3NGAA 3ZU7A 2C5YA 4YSMA 3BBWA 3FHIA 3KMWA 1H0WA 1OBDA 1SVHA 2PE0A 3VRYA 1W2CA 4ZSLA 5G6VA 3RPRA 4AGWA 2R3LA 3IG7A 4UZHA 4C02A 4D5KA 5GZ8A 3UPXA 2J0IA 4Q5HA 5FTQA 5AV4A 2XS0A 4DDGA 4LGHA 1ZMVA 4FI1A 4FV6A 1GZ8A 3PP0A 5KHWA 1M2QA 4FE2A 3FE3A 3CP9A 3PZHA 3KXZA 4QRCA 4U5JA 3PWDA 4F7NA 4FRFA 3KVWA 3QQGA 4IWPA 4WNKA 3L8SA 2C68A 4UMTA 1H01A 1PYEA 2CSNA 3S0OA 1H26A 3NNWA 4YTCA 5LMAA 2H6DA 5LMKA 1OPJA 3F5XA 3LFAA 5GZ9A 3CBLA 3ZUVA 1HCKA 2VTSA 2Z7QA 3HX4A 3V5WA 4J7BA 3KQ7A 4FKUA 4MUQA 4XNEA 3Q04A 4EONA 3CCNA 5B2MA 3AT2A 1DI8A 4WG3A 5M56A 2OSCA 4L46A 4D2SA 3L8PA 2QO2A 4W8EA 3HVCA 1H4LA 3DBQA 4G31A 2O65A 1TQMA 4J8MA 4L7FA 5DT3A 4BC6A 4FGBA 3F5GA 5HO7A 5I0BA 3V5LA 3NCGA 2UZWE 3UG1A 3ORXA 4J99A 4AFEA 4AW0A 3QHRA 2WEIA 4I6HA 5CEIA 3MVHA 2OLCA 1Z9XA 5HLNA 3SOCA 4FTCA 4MXOA 2Z7SA 3FMMA 1OI9A 4IHPA 3JXWA 5KBRA 1W2DA 2OJ9A 3H3CA 4IVCA 3AKLA 4EEVA 3TUCA 4ALWA 4DGNA 4X2GA 3RWPA 3OC1A 2YHVA 5I9UA 3OBJA 4YHTA 3TNIA 4RGJA 2R3GA 3FY2A 3RAHA 3VUHA 4EZ7A 2BZHB 3U9NA 4GKIA 2YDIA 2YM7A 2YFXA 3VJOA 4U6RA 1A48A 3R9RA 2UZTA 4O81A 2Q83A 1ND4A 1QCFA 2Y6OA 4RJ8A 3DQXA 3DK7A 3VN9A 3QAME 3RKBA 2VO7A 2VWIA 2QOCA 2HYYA 3RAKA 4FNWA 4CZUA 4C8BA 1F3MC 1MQBA 2UW4A 4UXQA 4AQCA 4YUQA 4FZAB 4H58A 2VTHA 4KIOA 2B4SB 1QPCA 4NM3A 1KE7A 3QLGA 2CKQA 2X2KA 3D15A 1G8KA 3PFQA 3QQLA 4OTPA 4JIKA 1OL5A 2PHKA 3NAXA 4L00A 4FTLA 3FMDA 4Q9SA 5I3RA 3ANQA 4O84A 3F66A 3LM5A 5FEEA 3SDJA 5IA0A 4L68A 2VTQA 1YXUA 4YZNA 3VONA 3KA0A 3HYHA 5CEMA 5B2KA 4FV0A 4R78A 3FQHA 3FI2A 4E4MA 3O0GA 2XM9A 1APME 1DS5A 2Y4IB 3F88A 3EH9A 4UWCA 4XG7A 5M08A 4DTKA 5M4IA 4N6YA 3CS9A 1Q4LA 3FMKA 2QOFA 3GOPA 4JOAA 4LUDA 5CU0A 2XIRA 2X9FA 3EJ1A 3HV4A 4JX3A 4Z16A 5D41A 3Q4UA 4GK2A 1O9UA 3UIXA 4BCKA 4HVDA 5AAEA 5M51A 4FYOA 2RG6A 1CKPA 5CU4A 4DG2E 4GIHA 1SM2A 4ZS0A 4F7LA 5K0XA 2C3IB 5EHYA 2XNPA 4P7EA 1JSVA 4YJSA 1OECA 5HE0A 5EG3A 4OAVB 2R3FA 3NMUF 1Y6AA 4E6QA 4ENYA 4D2VA 1GJOA 2C5VA 4F70A 4NW5A 3GC8A 4BKJA 2QKWB 4DH8A 2QOLA 4F63A 5DFPA 5CSHA 3WI6A 2B1PA 2BKZA 4J95A 4ZSGA 2Y9QA 1UU9A 3ACKA 3W2OA 2REIA 5CAUA 4CKRA 5IQGA 5DVRA 2A1AB 2ZDUA 1XJDA 3L9LA 3QUDA 2YZLA 1IA8A 2PMIA 2O63A 1V0BA 2NO3A 4ENXA 4F78A 2HENA 4MH7A 4QMNA 4QP1A 2WMQA 5M55A 3DDPA 3Q4ZA 5GJDA 3UQFA 2GTMA 4C38A 4U3YA 4FV7A 4TKSA 4Y73A 4FTNA 4GVAA 5JFXA 3EQFA 3IW8A 4U81A 2C6LA 4GU6A 1UNHA 4DEHA 4FEVA 4R3CA 4R3RA 3KF4A 3UP2A 4D9UA 5FTOA 4YO6A 3OTVA 1CSNA 5CVFA 2QLQA 4QD6A 3P86A 2YDKA 3EN4A 3BYMA 5L8LA 5IZFA 3KFAA 3S1HA 4XLIA 4MAOA 4H3BA 3NIZA 3Q53A 2HXQA 4GSBA 4ITJA 3W18A 5AM6A 1W98A 4FZ7A 4O6LA 2R0IA 2W5BA 5JFSA 4TN6A 4ACCA 4AW1A 2PZ5A 3MY1A 4IAIA 5T68A 5KMLA 5K0KA 5AX3A 4DGMA 3DBEA 3Q6WA 4HGTA 3O5AA 4KIKA 3DAJA 2R3OA 3FI4A 5HX6A 3LCTA 3CTJA 4HZRA 5L2SA 2CKPA 4PTGA 3H30A 3LOKA 4BB4A 3SG8A 1S9IA 5CU6A 5IA3A 3LLAA 3ALNA 2XP2A 4N0SA 4L45A 4FTTA 4OT6A 3ZO2A 3ZXZA 4HGEA 4XEYA 4DHFA 3FMJA 4O1OA 4XMOA 2WAJA 2NPQA 4WBOA 5IA1A 1J7LA 2VTOA 2I0HA 4ZMFA 4EL9A 1JNKA 2YITA 2PVJA 4PDOA 4QMQA 2GQSA 1M14A 1FGKA 2ETKA 4FNXA 2UW0A 4Y5QA 2VTIA 3EFWA 3QYZA 4BCJA 3C1XA 5K5NA 5EI6A 3W0PA 5BVEA 3ZSGA 4DEIA 4U0IA 5AX9A 1YOJA 1ZXEA 2X7GA 3PXZA 4N57A 3A7IA 4Y46A 4BRXA 4GG5A 4YZMA 5CY3A 2IVSA 3I5NA 2OFUA 3Q9ZA 1XBCA 2V7AA 3FMEA 3CD8A 3AXWA 4CFNA 3NUXA 5LVPA 3VUIA 4XOYA 3LFCA 4RVMA 3TM0A 2BRHA 4AXFA 4BWKA 4C4IA 4U97A 4WBBB 5CAVA 3U54A 4PP7A 3SX9A 3PY1A 4ASZA 2H9VA 2UW8A 3DAKA 2OXDA 3G2FA 4GJ2A 2QCSA 3OXIA 1BMKA 4H3QA 4TWPA 4JDIA 1JBPE 1MUOA 4FTAA 4QP7A 5EW3A 2CNVA 1FMOE 3RPOA 4EJ7A 1G3NA 4CTCA 3ENHA 3R9DA 2XJ0A 3QYWA 5CEPA 4EK4A 4KIPA 1H25A