1XBAA

Crystal structure of apo syk tyrosine kinase domain
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
274
structure length
266
Chain Sequence
VYLDRKLLTLEDKELGSGNFGTVKKGYYQMVVKTVAVKILPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Tyrosine-protein kinase SYK
publication title A novel mode of Gleevec binding is revealed by the structure of spleen tyrosine kinase.
pubmed doi rcsb
source organism Homo sapiens
total genus 85
structure length 266
sequence length 274
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2004-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1xbaA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1xbaA01
2BRGA 3N4VA 5CT0A 3W2RA 4PMSA 2RFNA 2XBJA 5EYKA 4TL0A 1YI4A 2ITYA 2R3HA 3BQCA 2OWBA 3EYHA 3R9OA 3V5WA 3VS7A 4Z3VA 5BUJA 5L6OA 4FIEA 1UU7A 2IWIA 4S34A 4M7IA 2CCHA 4DFZE 4FYOA 2VWUA 2X4FA 4WOVA 5HNGA 4DINA 4I0TA 5C26A 5DBXA 4C62A 4P4CA 3DXQA 2GU8A 4QMVA 5EK7A 3PP1A 4ACDA 4RJ8A 2ITTA 2P55A 2R3KA 2YIQA 4ZTSA 2HOGA 4M0YA 2B7AA 3VBQA 5KE0A 3ROCA 3V6RA 2F7EE 3QTZA 3R2BA 4FF8A 4NM3A 4YZCA 3TACA 2P33A 3ACKA 4AZEA 3PXZA 4FIHA 4YHFA 5TT7A 4Y5HA 1M7QA 3TV4A 3I4BA 3AC3A 4F7SA 4FKWA 3V5JA 5DPVA 5E8TA 1OIRA 3E8EA 2RIOA 1LR4A 4EZ5A 3QRIA 2VTPA 1XH7A 3ZC6A 4YC6A 2ONLA 5D41A 3GFEA 1OB3A 5BPYA 3EH9A 5AUXA 2ZB0A 3ORIA 2ETMA 2C47A 3R01A 4O7RA 2R3GA 4RWLA 1CM8A 5HE1A 3B8QA 4QQJA 1E1XA 3QCSA 3FE3A 5CSXA 4MTAA 3ZRLA 2VWVA 3PPZA 4R8QA 3AOXA 2Z7RA 4AAAA 1IAJA 4IFCA 3ZCLA 3VS3A 4BCMA 3C4EA 3CY2A 2OJGA 3KXZA 5AEPA 4XCUA 5C4LA 1B38A 4KWPA 1FMOE 4YZMA 3KL8A 3ZLSA 4DYMA 2WOUA 4EHZA 3DB8A 4MWHA 4PUZA 3SV0A 4F63A 4KB8A 4D4SA 3TNHA 3IW8A 2W7XA 3V5PA 2B0QA 3R7IA 5GZ8A 2WMQA 4USFA 2REIA 3LLAA 3RKBA 5CEMA 4A4LA 4IANA 1Q4LA 5KMOA 1H28A 3S95A 2C6OA 2BRBA 4AG8A 3QX4A 4TYJA 1M52A 4BFMA 5AJQA 3QGWA 2X7FA 2XIXA 2XNBA 2JDOA 4F65A 3AMBA 1VYZA 5CLPA 4FZ6A 4RX5A 5FDPA 1KWPA 3E87A 4ZS4A 1XR1A 4G6OA 2YEXA 4AGWA 3EQFA 4L9IA 4GIHA 5JGBA 5DT4A 3FZ1A 3HZTA 1DAWA 1JOWB 4V0GB 2PVKA 5ANEA 5CENA 3E8CA 4D2RA 4B9DA 5LVLA 5GIOE 4YZDA 3TEIA 2VO3A 1UNHA 2CGXA 3QCXA 4WG4A 3DK6A 4A4XA 4OAUC 2GCDA 3Q9XA 4YJVA 4RIWB 3ZLXA 3D15A 2VWYA 4FT0A 2J7TA 2WMUA 5KZIA 2YITA 3HP2A 4CD0A 1O6KA 3TIYA 5HG7A 3P5KA 2LAVA 1ZOGA 3R1NA 3SXSA 1YXTA 4DGMA 2I1MA 4DH7A 3WYYA 5DH3A 5AA9A 5K5XA 2FUMA 5I9YA 4DG2E 4PNKA 2XA4A 4ASZA 1JQHA 4ZK5A 4LQMA 2F7ZE 4FV5A 3UGCA 3AG9A 5J7BA 5AP6A 4KUJA 3K3IA 4TWOA 3D14A 3LXLA 1W83A 5A54A 5IA3A 1Q24A 4FTCA 5M07A 3TWJA 1HCLA 2EXCX 3KVXA 4Q9SA 4XG8A 3RCJA 2YM6A 3OP5A 5D11A 3QUEA 3KXHA 4BZOA 5KX8A 4E7WA 3W55A 4M66A 4HGLA 4QMTA 1YXUA 2FSOX 1JAMA 5BVNA 5LWNA 2XB7A 4P5ZA 3KCFA 3P79A 2R3LA 4RVLA 5ANJA 4IW0A 4W9XA 3HDNA 4PL3A 5IA5A 2HCKA 3OY3A 2WGJA 5C27A 4BKJA 4L01A 4DFBA 4QMPA 3R04A 4KSQA 3P23A 4J71A 5B0XA 4IM0A 4L68A 4EBWA 3SVVA 3F7WA 4IADA 4AS0A 5D7VA 1BMKA 4G6NA 4NFNA 3TIZA 3ZO1A 5L3AA 3OCSA 3RMFA 4C36A 4G5PA 2J9MA 2YABA 3PSBA 1OMWA 2WMWA 3IPHA 4UMRA 4TYHB 2PPQA 4WA9A 2WTKB 5J87A 3R8UA 4PMMA 2C69A 3NNXA 3QC9A 2R3OA 4W4WA 4FYNA 2IZTA 3RM7A 3ZFMA 1B6CB 4UXLA 4ZEGA 5GNKA 1Q8TA 2ZAZA 5T3QA 2QHNA 4F6UA 3E5AA 3H10A 4CVAA 5AR2A 5AM6A 4GT3A 3RTPA 4EQCA 2IO6A 2F4JA 3TG1A 2PE0A 4IZYA 2R3JA 4DFNA 4EWQA 1H1PA 2X2KA 3E8DA 4L44A 1Y6AA 2DS1A 4IJPA 3RBWA 4AW1A 3A62A 3DQWA 4QMLA 5BYZA 4RQKA 3PUPA 3VJNA 2C6LA 2VN9A 3P4KA 3MVJA 4IX6A 3TNPC 3NWWA 5L4QA 3ANRA 3HUBA 1F0QA 3QXPA 3QTQA 2WTDA 2W1GA 2OIBA 3UG2A 3FY2A 2IVVA 4FTIA 5E1EA 2V55A 3NR9A 3BKBA 4AA5A 4XP3A 5B2MA 4R1YA 4RGJA 3UP2A 3NMUF 5HE0A 3WF6A 3QZIA 4UBAA 3PXKA 4EYMA 4GYGA 3SOCA 2R3PA 2ZV9A 2VWXA 4QRCA 3I79A 4W4YA 4C4HA 4A9RA 3Q60A 4ENXA 1TVOA 5HLPA 4TXCA 1CDKA 4QP7A 3DZOA 4GVJA 4E26A 1REJA 2VGPA 3V8TA 2VZ6A 3E3BX 3WILA 3E88A 4APCA 4FKSA 4DT8A 2PZIA 2X6EA 3WE4A 2P2HA 3AC1A 4MD7E 4BVUA 2BRHA 4A4OA 2X39A 3BHTA 4UWCA 1W82A 4M13A 5LWMA 2OF4A 4XYFA 2GDOA 3FAAA 1UNLA 2G1TA 4I3ZA 3VQHA 4FTMA 4YZNA 4D28A 3HGKA 3PJCA 3MH2A 4CT2A 5LQFA 2XCHA 3AD4A 4F08A 2YAKA 3DOGA 3I6UA 4AZSA 1WAKA 2WNTA 3FY0A 3EWHA 2QG7A 4U81A 3FPMA 2WTKC 4F9CA 4FT5A 4XV3A 2Q83A 3FEGA 5H3QA 5EM5A 2ZM1A 4FTOA 2WO6A 3CQUA 3HRFA 1YVJA 4E8AA 3ITZA 2R3QA 2XKCA 3UJGA 4ANSA 5KMIA 3R7UA 4PPCA 4AGCA 2E9OA 3FI2A 3EHAA 1G5SA 3FBVA 3LCKA 4I24A 3A7FA 3S3IA 1OBDA 3EFKA 3DTWA 3QRJA 4NCTA 5KCVA 1WVXA 2O8YA 1YDRE 3FPQA 3UOKA 1YHSA 1OITA 4IBMA 4OGRA 5EI8A 5IDNA 3B8RA 3OXTA 4YZBA 3TUCA 1R0EA 4J53A 5J9ZA 4FEWA 4YBKA 2UZUE 4AE6A 4EBVA 5EH0A 4EH2A 5JMSA 3Q9YA 1KSWA 4FG9A 2DUVA 4O6EA 3NCGA 4X6QC 2CHLA 4FV2A 2YJRA 3Q4TA 5JK3A 2R9SA 4YTIA 3NUXA 4EHVA 4HNIA 2OH0E 4PTGA 5A46A 3H3CA 3PA3A 3UO4A 3HRBA 3R7VA 2JEDA 2J0IA 4WBOA 4OTDA 4DG0E 2X9FA 4N6ZA 3OXZA 3ZSHA 3VF9A 5HESA 3LM5A 1XWSA 3FSFA 1G3NA 2HENA 4OTQA 2A4LA 3VRYA 3V51A 4AFJA 5K3YA 4YTFA 5JSMA 4PWNA 5CTPA 2R3IA 3HA6A 1XBAA 3V01A 4ALVA 4HPTE 3SXFA 4F9YA 5HU3A 4C8BA 3RM6A 2OXXA 4IVAA 4PRJA 2VWBA 4FVQA 4PTCA 3VS4A 3UE4A 4KIOA 2IVSA 3NCZA 2G2FA 2O0UA 3R00A 3ZSIA 4EH9A 4O7TA 4U80A 1P4OA 3GFWA 3IS5A 4BDCA 3F6XA 3NW5A 2UUEA 4W8DA 4BWXA 3OF0A 5EFQA 3VC4A 4UV0A 1V1KA 5E91A 2VTAA 2W99B 5CX9A 4OTWA 1ND4A 4UY9A 4ANMA 3VS5A 1OIUA 2UZVA 3CBLA 4PL4A 5J8IA 3W2CA 5IQIA 3UZRA 4RBLA 2QC6A 4DEAA 1JPAA 4EK6A 3CPCA 3FKOA 4OTFA 4AW2A 3COIA 3HV4A 4QD6A 3QRUA 3GENA 3UO5A 3O2MA 2OI4X 2C1BA 2SRCA 1GZKA 2WB8A 2YIXA 3HX4A 4AT5A 1PHKA 4MXAA 3VO3A 1Q61A 4EJNA 3MY1A 1IG1A 5DWRA 4AT3A 4ZJIA 1ZYSA 2Y9QA 4MEDA 4WRGA 5EM8A 5HVJA 3WI6A 3WZEA 4ASXA 5H9BA 3GU7A 5BVEA 3EMGA 3MH3A 3V5TA 2BMCA 5HNIX 4XG7A 1ZOEA 5L2TA 1JKLA 2YIRA 2AYPA 3RAKA 2XK8A 4FKTA 3PZHA 3HV3A 5JFWA 1YHVA 2PL0A 2R5TA 2YM3A 2GS6A 4Z16A 3NSZA 5AV2A 2UVYA 3LJ0A 4AUAA 3KA0A 3W2QA 4FKVA 3LFCA 4HGSA 4HYIA 2C5NA 4IAYA 3ZFXA 5BVOA 2QOBA 3PRIA 4FKLA 1WVWA 4FMQA 4NW5A 4O83A 4OTGA 3LJ1A 1PXKA 1ZMUA 3IW6A 5FD2A 3RWQA 3OG7A 3R1YA 3HAVA 3ZUUA 1W8CA 3Q2JA 4ITIA 4HJOA 1KE9A 1Q97A 4LG4A 4AU8A 4E1ZA 1FQ1B 4K0YA 5IA0A 4EK8A 5HO8A 4C59A 2J50A 1OPKA 2WTCA 5IQDA 4ALWA 3JVSA 3BE9A 4IWOA 1YDSE 5JQ8A 3UNJA 2JGZA 3W2OA 3R1QA 3VS6A 2P0CA 4IVDA 1WZYA 5IG1A 2QODA 4MXCA 3OWJA 2QLQA 4CZYB 4P2KA 4R3PA 5AUYA 4DEDA 2QI8A 3QRKA 4X7QA 3PRFA 2PE1A 2WEIA 4JI9A 5E92A 5AR3A 4CXAA 2BZKB 3U54A 5C9CA 4FKJA 4WUNA 5LCKA 4QTCA 2WQBA 3NNVA 4D1XA 4PQNA 3I1AA 4FTJA 4IACA 3CIKA 5JEBA 1ZMWA 2ZJWA 2GS2A 3BQRA 3ERKA 3F5UA 4K6ZA 4BIBA 2FGIA 5M4FA 2QNJA 2IG7A 1GOLA 2VTIA 3PPKA 4C3FA 2PY3A 3CC6A 2DWBA 2WAJA 2Y6OA 4QQ5A 2EWAA 2C3KA 3ZSGA 4D55A 4LL5A 4EWHA 5CASA 3QZFA 1S9JA 3C0HA 2RFSA 4UYAA 3ZO4A 4H3PA 2BTSA 3BGPA 3F5GA 3WARA 3T8OA 2HXLA 4DEEA 4W8EA 4CEGA 3GC7A 4ZZNA 2YCRA 3PJ3A 3GI3A 2R7IA 4ANLA 5CXHA 2I6LA 4NK9A 3PVUA 4TW9A 3TZMA 5ICPA 1JVPP 2QO2A 3GUBA 4OT6A 1M17A 2IVTA 3MJ2A 3NAYA 5HVKA 2XNOA 3P0MA 3PIZA 3PWYA 3PE1A 3OWKA 3ORXA 5CSHA 5KMJA 2IW6A 4DEGA 5K4JA 4X2FA 4BYJA 3U87A 4FODA 5CF4A 5BQ0A 4BDHA 4E3CA 4C2VA 1J1BA 4FT7A 2OBJA 3R21A 3D9VA 5C03A 4ZTNA 2HZ4A 4JBPA 4QTAA 5LARA 3CLYA 4ZY5A 3QLGA 3QZGA 4GFGA 4Y83A 4FSQA 4IXPA 4YBJA 4ZS0A 1QPDA 5A4TA 3FLWA 3I5NA 4EUUA 5IQAA 3RNIA 3QBNA 2GNFA 4IQ6A 2X2MA 4G5JA 3DTCA 3ZC5A 5GJGA 1WMKA 2G01A 3TKIA 2EB3A 4A7CA 3DU8A 3ZEWA 5EQYA 1WVYA 4O0VA 4FG8A 5AUTA 4L00A 3B2TA 3MVLA 3CQWA 4N57A 5CQWA 1QMZA 3LOKA 5F94A 3TZ8A 2YZAA 5TR6A 3FXWA 3OUNB 3WOWA 2VX0A 4RFMA 4XRLA 3ZONA 4B99A 4G17A 4C2WA 3FMHA 3QALE 2E2BA 4BKYA 5BMSA 2VO6A 3E8NA 2W0JA 4RX9A 4ACCA 4ANBA 5CWZA 4JBVA 4EOKA 3D2IA 3VUGA 3EYGA 3ZDUA 4NEUA 4TNDA 1H1QA 4FZFB 2YM4A 2XBAA 4YJNA 3PY0A 3CR0A 2CMWA 2GHMA 2PHKA 4D5KA 4E73A 2ITXA 3KRWA 5HZNA 2UZWE 3DK7A 2UW7A 1ATPE 4M67A 3TJCA 2OJFE 2YM7A 3OWLA 1DAYA 5IQFA 4IMYA 4RT7A 1GAGA 3KF4A 1O6YA 3QYWA 4EK3A 4G3CA 4ZXTA 1A48A 5JN2A 5A3XA 5A4CA 2XM8A 4RJ6A 3GEQA 4XG3A 4Y8DA 5AADA 3IW5A 1JSTA 2PU8A 3RWPA 2XNEA 1J7LA 2WMSA 4O84A 3VBXA 3VUDA 2W05A 4CRSA 5IQBA 4ZTMA 1ZYLA 3A8WA 3EZVA 2G2HA 3COMA 5JKGA 1OIQA 3MTLA 3GCVA 1LEZA 3TJDA 4O1OA 2ITWA 5D10A 2CPKE 3K54A 4F9BA 4QTEA 2YAAA 3KRRA 4CKRA 3C5IA 1ZYCA 3VHKA 2PE2A 5HVYA 4FSTA 2GFCA 4O0WA 5AUVA 3R63A 2HWPA 3LQ3A 3ROYA 2QOQA 4DH8A 4FTLA 3EKNA 3BZ3A 4ZY6A 4GMYA 4YC8A 3DNDA 4HVSA 4Y72A 4D4YA 3WIKA 2X8DA 4KBCA 3U9CA 3QYZA 3GCSA 5H8BA 3W10A 4MHAA 4XG2A 3IDPA 5IH6A 5EDPA 4JAJA 3EQCA 5JFSA 4NM7A 5J1WA 4QMQA 1IA9A 3VN9A 2Y4IB 2FVDA 2VX1A 5DMZA 5KMNA 2BROA 5E1SA 3FLYA 3PJ1A 4XBUA 2C5XA 2JC6A 1WFCA 4QYFA 4JNWA 3HMIA 3ANQA 2PVFA 2VTQA 3VS1A 3Q6UA 3ALNA 2VTTA 4F99A 4O82A 3QWJA 3IDBA 3HUCA 4ACMA 2XNPA 5D9HA 2J0LA 2Y0AA 2X7OA 2Y8OA 4RSSA 3QQUA 2O2UA 4RVTA 1Y8GA 2VO0A 1KE6A 3Q2MA 4FL3A 4XJ0A 1Z5MA 2R3RA 2VTRA 5AIKA 3RINA 2CKQA 4CYIA 3G5DA 4CTCA 4EH7A 2OK1A 3QQFA 3AGLA 1UNGA 2V7OA 3D94A 3ODYX 4FV0A 2W1FA 3SW7A 4FT9A 5EYDA 1URWA 4CLJA 5E8UA 2W5HA 1U46A 3O8TA 3EFJA 4FVPA 4H3QA 4DA5A 2QG5A 4PF4A 3NS9A 3O8PA 4LGGA 3JY0A 4QP6A 3IONA 4GU9A 5BVKA 5BVFA 5GHVA 3QQJA 2NNWB 3ATSA 2PUIA 4IIRA 1DM2A 3LQ8A 3Q9ZA 3V3VA 4G16A 2CNUA 3E7VA 1YWVA 3FDNA 3Q4ZA 5KBQA 4WD5A 4EOIA 2ZVAA 3LFEA 2WHBA 4MX9A 5AP7A 4ZMFA 3V6SA 4QP9A 3ZHPC 5IUGA 2BCJA 1URCA 2QVSE 2Z8CA 4FV6A 4IWPA 3VBTA 3PG3A 3R8LA 5AV3A 4OTHA 2VX3A 5CVGA 5M4CA 4O0XA 5KZ0A 5HNBA 5ANGA 2J5EA 3TT0A 4BTFA 4LI5A 3CD8A 1NVQA 4NCTC 3NNUA 3C1XA 4OT5A 4E5WA 4C38A 2WIHA 1UU3A 2C6IA 2EXMA 3FQSA 3RPYA 3M1SA 3UOLA 3R9RA 4A9TA 3NYXA 1PXJA 1REKA 3DBQA 4IZAA 4J96A 3SC1A 4S2ZA 4A07A 4C37A 3HMMA 2BAQA 5L8JA 4BY9E 3BYOA 2WFYA 2NPQA 4KD1A 4O22A 4LUEA 2R3NA 3VWAA 2Y4IC 3BX5A 3KN5A 2OH4A 3PLSA 4GT5A 4KINA 4LGHA 5EDRA 5IH5A 3GGFA 3ZM4A 3LKMA 4RA4A 1FVTA 2UZDA 1PW2A 5CEIA 4BCHA 3NUYA 4RJ5A 3QQLA 5FP6A 3NAXA 4BI1A 3OOGA 4YJPA 1OPJA 4EH3A 4UMUA 2QOLA 4J98A 4CFNA 4TYGA 3MFUA 4N70A 2HAKA 3OEZA 4R3RA 2NRUA 4JG7A 3ALOA 3ZEPA 1XH8A 4I94A 1PMEA 2WMXA 2VUWA 2UW4A 4L67A 5HI2A 4U40A 1H4LA 3UOHA 1NVSA 5AAEA 2UW3A 2WXVA 3ORLA 1GJOA 3MFSA 1DS5A 5BVWA 2BDWA 1Q5KA 4MNEA 1TQIA 4JIAA 2HZ0A 3IK3A 5F95A 4DHFA 2C68A 2OF2A 1OL2A 4FV4A 4I20A 4BGQA 2CNVA 2QONA 4YJOA 4F0IA 4CLIA 4IAKA 2W5AA 2WQMA 3P86A 2GPHA 4L46A 2V7AA 2PMLX 3N4UA 3BYMA 2Y7JA 5A4LA 2BFYA 3QZHA 4IB1A 3BGQA 4K1BA 2Y6MA 5LMKA 4MXXA 1XBCA 3ORNA 4B8MA 3C4XA 2VWZA 4WHZA 3RHXA 2HW6A 3NW7A 4GVAA 3KXNA 4JR7A 5AIRA 4BDBA 5KHXA 3QCQA 5IMXA 3OT8A 1UA2A 2WEVA 5IQHA 1H26A 1YXVA 4DBXA 1U54A 4XNEA 3SDJA 4D0XA 4FSNA 2OO8X 4OLIA 3LFAA 5FM2A 4E6CA 5CXZA 3OVVA 3ZH8A 3D5VA 3QQGA 5T68A 3I7BA 4RC2A 1YDTE 1Q62A 4I0RA 4Z55A 1NXKA 4KKHA 5HO6A 2QO9A 2QOKA 3C4CA 3FQEA 3KCKA 4E93A 4I6HA 3PIYA 4K33A 4R7BA 4MD9E 2WMRA 4S32A 4L3LA 5JH6A 2YFXA 4FUXA 1H1WA 1OECA 3L8XA 3FI4A 3OXIA 2J0JA 4F1OA 4EZ3A 3JYAA 3IOPA 3P7CA 5JQ5A 2W4KA 3M42A 2VTOA 3TCPA 2CKOA 1XO2B 2A27A 3VJOA 2XK4A 3Q52A 2C3LA 3FV8A 3UC4A 4DH5A 4RWKA 5LVOA 4JDJA 3THBA 2GNLA 2DQ7X 2QR7A 2BZHB 3Q32A 4D2VA 3EKKA 2WTJA 5I3OA 3UNKA 1Z9XA 2JKOA 1YHWA 1ZYDA 4AQCA 4GL9A 4JIKA 5AP5A 2ITZA 4ALUA 1GY3A 3BLQA 5FXQA 3R30A 2C3IB 1YOJA 2I0EA 5LJJA 4MXOA 3L9MA 2CGUA 1SNXA 4GV1A 3ZUTA 3O23A 3DB6A 5E8WA 1PKGA 4G3FA 4FKUA 1K9AA 3R02A 3VW8A 2VRXA 4NL0A 4KIQA 2FO0A 3E93A 4NTTA 4U43A 4AN3A 5M53A 3C9WA 3EB0A 1M7NA 4RG0A 4C34A 2R4BA 1OZ1A 2C4GA 2XF0A 3GU5A 2PVMA 2XUUA 4L52A 2YLEA 1MQBA 2GTNA 4QNAA 2GQRA 2CSNA 5GJFA 3CS9A 4C35A 2YCFA 2ESMA 3LZBA 1S9IA 3ZO2A 5DN3A 4C4GA 2CGWA 1H0VA 4LOPA 4PMTA 4ZOGA 3DPKA 1PMVA 2BHEA 1Q3WA 1RQQA 2H6DA 4NM0A 1J3HA 2FYSA 4ERWA 5AV1A 1Q8ZA 4ASEA 5M06A 1WBWA 3P08A 2I40A 4WG3A 4FV7A 4AX8A 4ZTQA 5FLFA 5DRDA 2R7BA 4L8MA 4J99A 5ANIA 3UDBA 2JLDA 1TQMA 1Q41A 5HTBA 4YJUA 4FKPA 1Y57A 3OC1A 4JQ7A 4XEYA 5KBRA 3V8SA 4GK4A 5HIEA 2QOHA 4FOBA 3QTSA 4LL0A 4IWDA 4CZTA 4RA5A 1L8TA 3CJGA 1K3AA 3FI3A 4O2PA 3UTOA 3UZTA 3A7HA 3AC4A 4MXYA 4DFYA 3C0IA 4XOZA 3MIAA 4Y95A 4XS2A 2PUUA 2CN5A 2PZ5A 5AX3A 2O63A 3H4JA 3RCDA 2W1CA 3RGFA 4EONA 4BKZA 4JOAA 3A61A 4B6LA 5EG3A 5EW3A 5KMKA 2Z02A 4CQEA 4NJDA 3QUPA 2Y4PA 4RWIA 4ANQA 4I92A 5CANA 4DEIA 5CZHA 5I3RA 5L6WL 3QTWA 1TQPA 3ORZA 4GG5A 3COKA 1IEPA 4UALA 4K8AA 5J1VA 1OI9A 2JFLA 2Q0BA 1XJDA 2W4OA 3QTRA 2HW7A 2B1PA 5E8ZA 3JPVA 4BZDA 5FXRA 4EI4A 1BX6A 1ZARA 2JDRA 4FL1A 2W1EA 3UQFA 2VWWA 2OJJA 4HVIA 4G2FA 2F9GA 5CU4A 1XBBA 2ITPA 2UW6A 4ARKA 3MPMA 2J90A 3TKUA 5I9VA 2PYWA 1U5QA 3D5UA 2CNQA 2OSCA 1U5RA 5HG8A 4BR3A 1OBGA 3Q4CA 4NZWB 3V8WA 3VS0A 4EH4A 4XRJA 2ZM4A 3WBLA 5EKOA 4ORKA 3R73A 2B55A 4W4VA 1PXPA 5E8YA 3IOKA 4BHZA 3DBDA 1NY3A 3EZRA 4FK6A 4AGDA 4A9UA 2XKDA 4YHTA 5M4UA 1PXOA 2VWIA 2X2LA 3IO7A 4I5HA 2JKMA 4L42A 1ZOHA 2EB2A 2QO7A 3MPAA 4O0YA 3PDTA 4XP2A 2YDIA 4UN0C 4ZSGA 3PXFA 3QQHA 3A4PA 4TZRA 3UIXA 3HRCA 1FVRA 2UZTA 2NRYA 3H0YA 3Q9WA 4U41A 2OGVA 2BPMA 3N9XA 1PRYA 3O7LB 3DQXA 3PE2A 4OBOA 1UU9A 2JBOA 3A7GA 4ITHA 3POZA 4FTTA 3C5UA 2VTLA 3PJ2A 2R0IA 3CD3A 1J7IA 3OW4A 3TM0A 4BDEA 4I4EA 4CMUA 3NUAA 4KNBA 3F3ZA 4CFMA 1JKTA 2YCSA 2YACA 4KSPA 3D83A 3L8SA 5EKNA 4EOOA 5HG9A 4RX7A 4TYEA 4MQ1A 5M56A 2VU3A 4YR8A 3K5VA 5AUUA 5I9XA 2PSQA 4FIGA 3FMKA 4IVBA 3WF5A 5DEWA 3W8LA 4O81A 3KULB 4ZSJA 3LAUA 4APPA 4TPTA 3JUHA 5L2IA 5CU2A 3ZM9A 3FSKA 3NUPA 3QAME 4MKCA 2GFSA 1FGIA 5IA2A 1Y91A 2ITVA 3VAPA 3R9NA 3KFAA 3FC2A 4FC0A 5FTQA 3TNWA 1JSUA 3GU8A 3SA0A 4ANNA 3DKOA 5DT3A 2FSMX 5JZJA 1FOTA 4U8ZA 5ACKA 4U6RA 4O7NA 4D0WA 4CV9A 5AA8A 1SZMA 4EH5A 4UEUA 1NA7A 3K5UA 5TE0A 1ZRZA 4EHGA 4KRDA 4DTBA 4Q5EA 3KMWA 3BIZA 4X2JA 4X2NA 5IQCA 3VIDA 3AMYA 3ZBFA 4MNEB 1PXNA 4AZWA 1I44A 3KXMA 4RJ4A 5D7AA 1YI3A 1YOMA 4O2ZA 4L3JA 3EN5A 2QD9A 3GOPA 3R22A 4AZVA 4E4XA 4EEVA 3F7ZA 4LYNA 3R8ZA 2UZLA 2LGCA 2VTHA 3LMGA 3ORMA 4XV2A 3SW4A 4WBBB 3ZFYA 5KKRB 1IAHA 3AT4A 4KAOA 3C0GA 2X4ZA 3ZYAA 3M2WA 4HVGA 3AD6A 4P90A 4GKIA 2XRWA 4PP9A 2YM8A 3AGMA 2VTSA 5TOZA 3C51A 4NUSA 2OXYA 4BYIA 3ODZX 4PTEA 5EM7A 5JFVA 5DYJA 4PP7A 1NT2A 3OT3A 3PXQA 5C4KA 4G9CA 4TYIA 4QTBA 5HE2A 4BTJA 5F9EA 3S4QA 4X3FA 1PMNA 3JS2A 3PVWA 4IDTA 4H36A 4NW6A 5EW8A 4BL1A 4C02A 1U54B 1HCKA 1OUYA 4IB5A 4M15A 2V62A 5D1JA 3AC8A 3FJQE 2PMIA 3I0OA 4M69A 1H00A 1PJKA 1GIJA 5CAVA 4BCNA 5DG5A 4HCUA 3O71A 1APME 3MN3A 5EI2A 2C0IA 4BCGA 2PVJA 1YI6A 3LCSA 2Z7LA 3C4ZA 1PMUA 3ELJA 3FKLA 4B7TA 4BCKA 4CMOA 3W8QA 5JGDA 5IQGA 3QRTA 2XIZA 4UYNA 5LMAA 4HGEA 4FKIA 5H8EA 3SQQA 1A06A 4ZJVA 3G0FA 4K11A 4RWJA 5IH4A 4EK4A 2WTWA 5AR5A 3VBWA 3H9OA 3QQKA 5CS6A 1W98A 1OL5A 5IEVA 4JG8A 3EL8A 3EN6A 3F5XA 3HEGA 4GT4A 4WSYA 4V05A 5HBEA 3RP9A 4YJSA 4OBPA 4Y73A 4D2PA 3U4WA 4ZZMA 3QTIA 2B9IA 3QWKA 4KIKA 2JKKA 3LE6A 3SRVA 4O91A 4A9YA 5HHWA 3DXPA 4FICA 5AFVA 4OR5A 3LFDA 2P2IA 2JBPA 2UVXA 4F64A 5IISA 2EUFB 3HA8A 2C5VA 5FUTA 3F2NA 4GG7A 4PV0A 3F2RA 4K9YA 4O7ZA 3OY1A 1QCFA 3PSDA 3KK9A 3ORKA 2P4IA 3IW7A 2JD5A 4HYUA 3IKAA 3QLFA 2XYUA 3AT3A 4CMTA 2OFVA 3P9JA 1T46A 2G2IA 5LMKC 3QGYA 4K18A 3LCTA 3PTGA 4AN2A 1KE5A 4ONAA 4G1WA 3RPOA 5BNJA 2B52A 3BYUA 3I5ZA 5HD7A 5BYLA 5CEOA 4BF2A 3OS3A 4GKHA 2RFEA 2WZJA 2XEYA 2IJMA 3L8VA 4U0IA 4L7SA 3DDQA 4RVMA 4WNKA 5LMBA 3QTXA 1GZNA 5A4QA 5J9YA 2I0VA 1ZWSA 3CKWA 5EI6A 4LOOA 3R1SA 3KN6A 2WU7A 4PX6A 5D12A 3VUIA 3PWDA 4TRLA 2OLCA 2R3MA 3MDYA 5T6KA 1CMKE 5J79A 3NYVA 3C4WA 4UMTA 3LPBA 3LVPA 4I21A 1Y6BA 4ZIMA 5J5TA 2VO7A 4X2GA 3KRLA 2PVRA 3Q96A 4R78A 4LRMA 4H39A 4FTQA 4OTPA 2ONLC 2BRNA 4X6RA 4JS8A 4EJ7A 3TUBA 5FEEA 1LUFA 3G6GA 2W9FB 4FNZA 4C33A 3IGOA 4Z7HA 2C0TA 4FSRA 3WYXA 3KREA 3T3VA 4QMMA 4JRVA 2OZAB 3PJ8A 4QP8A 4CCUA 3BBWA 4GEOA 3ULZA 2ITOA 4B4LA 3GC8A 1ZZLA 2XCKA 4WSQA 1J1CA 3FI8A 1GZOA 4RMZA 3KK8A 5TO8A 3D7TA 3Q6WA 4ACGA 3S2PA 3TZ9A 2QU5A 3GB2A 2AC3A 3DFCB 3AD5A 4X3JA 5M57A 3UQCA 4FUYA 3MI9A 4O96A 2XRUA 5HKMA 3NW6A 4TTHB 3FL4A 3LHJA 3PXYA 2A0CX 5M4IA 2ITUA 2F49A 5E8VA 3ZMMA 4XUFA 2HY0A 2QR8A 2YDKA 4KA3A 1IASA 4QP2A 5L2QA 3T9TA 2VNYA 4AW0A 4E6DA 4HOKA 1H08A 5CAOA 1E1VA 2BILB 2PTKA 3FZTA 4FV9A 4R5YA 1H24A 1X8BA 4FX3A 4BBMA 2J6MA 4IAAA 2PZYA 4AW5A 5K0KA 4FNWA 4UX9A 1OKZA 1ZZ2A 4DGOA 1H27A 2QHMA 3UMXA 3VQUA 4IE9A 3LM0A 2WQNA 4BDAA 3A2CA 3OMVA 4CYJA 5CALA 4O0TA 4ZZOA 4CFWA 2RGPA 3HNGA 4BHNA 1JBPE 4E6AA 4R1VA 3R0TA 5LVMA 2XM9A 4AOTA 1BL6A 1RDQE 3GNIB 3LFSA 3QU0A 3FZRA 4QYEA 4RQVA 4YZ9A 5CQUA 5FDXA 4O7YA 2PVNA 2HYYA 4C57A 5DEYA 5IA1A 3KVWA 3GT8A 4PL5A 3OTVA 3RHKA 4JBOA 3GCUA 5C1QB 1ZAOA 3MW1A 3N51A 4HZSA 2CCIA 2VTMA 5H2UA 3PZEA 1TKIA 3NDMA 4IVCA 3K3JA 4QMYA 3QD2B 4FIJA 2UW5A 3QXOA 2UZOA 4AE9A 3PLAE 4O38A 3L9LA 4EOLA 5FEDA 2O3PA 2VTJA 3MYGA 4JR3A 4ENYA 1LPUA 4FOCA 1WCCA 2UVZA 3BCEA 3QKMA 3UODA 3ZS5A 5HLWA 1YW2A 4CG9A 2ZYBA 3OFMA 3Q53A 4EC8A 5F4NA 3L1SA 2RKUA 3MFTA 2OU7A 4DN5A 4DLIA 1XH6A 3BGZA 3O50A 4FEXA 4NH1A 5I9UA 4EL9A 2PZRA 4E4LA 3C50A 2WOTA 3EQDA 3HMOA 4NIFA 4AA0A 1R1WA 4UZHA 3RALA 3KC3A 3KEXA 2V5QA 2ITQA 3U51A 4UB7A 3HYHA 3TKHA 1RE8A 2YIYA 4ERKA 4LFIA 2UZBA 3DV3A 3QHRA 1YRPA 4BDKA 4F1TA 3HV5A 1SMHA 1SVHA 3EQGA 2ETKA 2PMOX 3NYNA 4DC2A 5DA3A 5FEQA 4RIYA 2Z2WA 2GHGA 3AC5A 2W1HA 4DFUA 5ETIA 2XNGA 4YNOA 4D2TA 1IRKA 4O0UA 5ANKA 4F9WA 3AC2A 1ERKA 4I4FA 1FBNA 3P7AA 4G31A 3U8WA 3UIMA 2WQEA 3F69A 3TV7A 1UU8A 2KULA 3R9HA 4EOJA 2VD5A 3COHA 5ANOA 1BKXA 4MK0A 5IQEA 2W1IA 3EQBA 4FI1A 5F1ZA 4FGRA 3CGFA 4JX3A 2C6EA 1IR3A 2F2CB 3OCGA 2I0HA 3VBYA 1FPUA 5IEYA 3ZXZA 2I0YA 4BGGA 4AZFA 4U3YA 4PY1A 5CVHA 4WNOA 4F0FA 4FT3A 3P78A 2JIVA 3MH0A 3NLBA 2BKKA 5KMLA 2VV9A 2XNNA 1Z57A 3NVKI 1ZXEA 4IZ5A 3LFFA 4EK5A 2QOCA 3C7QA 3D4QA 3E62A 2WTVA 3QKLA 5FRIA 4FZAB 1VZOA 3HKOA 5EOBA 4BI2A 3CGOA 4DTAA 2YCQA 3G90X 3LW0A 2NO3A 4MH7A 1ZY4A 5CY3A 4XG4A 3MGYA 5FBOA 3H0ZA 3VUKA 3KB7A 3U4UA 4ZY4A 4O0RA 3CKXA 5HCZA 3QD3A 4PPBA 2YZLA 5E8XA 4JXFA 4L6QA 2BIKB 3AMAA 4QMSA 3OUKA 3H30A 2UW8A 3MA3A 5M51A 1YWNA 2C5YA 4WNPA 2B9JA 3WF7A 2WU6A 3R6XA 5HQ0A 3TNIA 4CV8A 4X3FB 4M97A 3U55A 4RRVA 5HX8A 4J52A 4FEUA 4GJ3A 5EHLA 2YHVA 1J7UA 3FMDA 3UIUA 2J51A 5GZAA 3MA6A 4TY1A 4FSWA 4HYHA 4M69B 4HGTA 3E64A 3WIGA 5AMNA 2IVUA 4R7HA 4S33A 4NYEA 3EL7A 5LVPA 5TF9A 3BU3A 3IDCA 2RSVA 3FL5A 3GU4A 3MV5A 3R2YA 4FR4A 4W4XA 5FTOA 5HE3A 1JKSA 4QYGA 5LOHA 4F6SA 3SG9A 3TTJA 4JBQA 4N0SA 4RLLA 4QOXA 4FG7A 3R8VA 3DAKA 3S1HA 5FG8A 1T45A 1P14A 4B8LA 2JDTA 1KOBA 3A4OX 3FMNA 2PUPA 1W0XC 3BHHA 4IX3A 4FSMA 4CCBA 3BEGA 4IB0A 3VF8A 2EXEA 4RC4A 3SAYA 1CSNA 5FQDC 3MESA 5LVNA 4KIKB 4KKGA 3SRVB 4EH6A 4JL9A 3WF8A 5HTCA 2DYLA 3FHRA 3KULA 4FA2A 2BFXA 2FSTX 4DEHA 5FM3A 4BI0A 4KIPA 1WBNA 3DBCA 4MBJA 3HMPA 3NZ0A 4RIXA 2GNGA 3H9FA 4YJRA 1BYGA 3O8UA 4EOQA 4IDVA 1H07A 5DFPA 5K0XA 4TNBA 4QP1A 4ZTHA 4I1ZA 4V04A 4G3GA 4Q5HA 3AT2A 4QQCA 2W96B 2O65A 4KS7A 5EHYA 4OUCA 2XIKA 3QA8A 1OKYA 4ID7A 2UZNA 4M12A 4FTKA 2JAMA 4B0GA 2J5FA 3CXWA 2XS0A 4MXZA 5CI7A 4L53A 2JIIA 3S0OA 2GNJA 1P5EA 2WIPA 4FNYA 5A6NA 4X3FC 3BRBA 5DRBA 4BWKA 2GQSA 2XIYA 5GINE 2XK7A 1SVGA 3NUSA 4OTRA 4TT7A 4O7WA 4EORA 4XBRA 4EZ7A 1QL6A 2Z60A 4IX4A 3RZFA 4HVDA 3DBFA 4ZLYA 4ZLOA 4A06A 5AP4A 1UVRA 2XKEA 4X0MA 1E9HA 2C30A 1OUKA 1EH4A 1H0WA 3B2WA 3QCYA 3FXZA 3TI1A 4BIEA 3LXNA 3VS2A 4JQ8A 4BGHA 4DITA 4DH3A 5HO7A 1YKRA 4U97A 4YLJA 4X2KA 3NNWA 4Q9ZA 4QMUA 3IQ7A 4FV3A 1U4DA 4PPAA 4WG5A 5F20A 3IGGA 4I5MA 4YNEA 3DLZA 3F2AA 2BIYA 5J9LA 1BI7A 3R71A 4CTBA 3CY3A 3P1AA 4DGLC 5C01A 3R8PA 2CLXA 3ZLYA 2G15A 2B4SB 3BHVA 4YJQA 4U42A 3KQ7A 3D7TB 1CKJA 2W9ZB 3GP0A 3A7IA 3EN4A 2ZOQA 3CTQA 5DT0A 4EUTA 2PULA 5IA4A 4J8MA 1YXSA 3HP5A 4OAVB 4IFGA 2GQGA 2C6TA 5IUHA 1PF8A 1XQZA 4YURA 5A14A 2XK6A 4FSUA 1FGKA 4A9SA 2XK3A 4O86A 4PDYA 3HL7A 5HTIA 1Q8UA 2X8IA 3PY1A 3GCPA 4NFMA 4FZ7A 5CZIA 3MY0A 1KV2A 2ETRA 2IW8A 5EOLA 3Q5IA 4R3CA 3TTIA 3EOCA 5I4NA 2PZPA 5AP0A 4FKOA 3SKCA 2FB8A 5DHJA 4GJ2A 5CSWA 4FTNA 1WBVA 3OW3A 2XP2A 3R9DA 3MWUA 4M14A 4NTSA 3MVMA 5E7RA 2H8HA 4O7VA 2BALA 3CTHA 4R6VA 5EYCA 4MCVA 3BU5A 3BBTB 3HV7A 3TZ7A 3H9RA 2X81A 4WO5A 2G9XA 4FGBA 4BCJA 2W1DA 2BZIB 4MNFA 2QU6A 5EDQA 1J91A 4ASDA 4AXAA 4JDIA 5AAGA 4Y5QA 2OZOA 1XH9A 2ZM3A 3KMMA 4LRKA 4YUQA 2XK9A 3UYSA 2E9PA 3GC9A 3SLSA 5AX9A 4JX7A 3DT1A 4LV8A 1FINA 2YA9A 4MQ2A 4U44A 1WBSA 3SHEA 2R0UA 5CT7A 5AUZA 3FC1X 2J0KA 3R28A 2F7XE 2BAKA 4J95A 4QMZA 4C3PA 1UKIA 3HV6A 4DEBA 4DG3E 5AP1A 3EQHA 1GNGA 1UWHA 3VUHA 4UMQA 5CU6A 1UV5A 3PY3A 3BHUA 4Y85A 4NIFB 4JRNA 4KBAA 3UVQA 3DDPA 3HVCA 5L8KA 2GS7A 1KUTA 3ZOSA 3ZU7A 5FTGA 3QD0A 4FV8A 3EQRA 4G34A 4C4JA 3FQHA 2CLQA 4BRXA 3UMWA 1AQ1A 1JSVA 5IEXA 3T9IA 4ZSLA 3EN7A 4NSTA 2WMTA 3GBZA 4RIYB 5BYYA 4OW8A 3KXXA 4D2SA 5HU9A 1XKKA 5AP2A 3A60A 3IECA 2YWVA 3BHYA 2YIWA 3QC4A 4K77A 5FP5A 4D4VA 1XH4A 3TNQB 3UO6A 1R39A 2OZAA 3DNEA 3V5QA 4CFUA 4Z7GA 3W32A 4CT1A 3O0GA 4HZRA 1QPJA 5C8MA 1MRVA 4RJ3A 4F4PA 2XEZA 4FV1A 2YERA 1KOAA 2PVLA 3GCQA 4EOSA 3TUDA 2HXQA 3F5PA 5KO1A 4J1RA 4QYHA 4EKLA 3O7LD 2QURA 2CDZA 4JJRA 4BTKA 4CZUA 2B53A 3U6JA 1XHAA 3TN8A 3KMUA 2UW0A 2QOOA 2A2AA 1M14A 2AUHA 2NP8A 3HECA 3NIZA 5DVRA 2XH5A 4FTAA 5CSVA 5HCYA 3S00A 3EQIA 5DIAA 3DJ5A 4GUBA 4HCTA 3E3PA 3LCOA 4C4EA 4Y46A 4FEVA 2W17A 4NJ3A 3RAIA 3CCNA 4KABA 4FNXA 4XLIA 4QP4A 3DAJA 2JITA 4CFVA 2JDSA 4BBEA 2QLUA 4WIHA 4CQGA 1PYXA 4D4RA 4TWCA 4E5BA 2OFUA 3Q5ZA 4QYYA 3I0QA 4W9WA 4AOJA 5KMMA 3ZBXA 3NVMB 3SXRA 4GFOA 4QMOA 3FLZA 4O27B 4FKQA 3RJCA 5IKWA 2E9NA 3CP9A 3V04A 4MAOA 5HLNA 3U9NA 5AWMA 5CAQA 3F3WA 4LM5A 1M2QA 4JQEA 4QPSA 4C3RA 3UC3A 2JAVA 4BTMA 4EOPA 1CKPA 4ZTRA 3W18A 3UPZA 2WMAA 1VJYA 2ZMCA 4GCJA 1HOWA 2BDFA 3U6HA 3LJ2A 5IU2A 3I7CA 3ENHA 2J2IB 1RJBA 3C13A 3PVBA 4FSZA 4KBKA 3EJ1A 4L45A 1L3RE 3RK7A 5M08A 4F1MA 3RPRA 2FA2A 3NGAA 5BX0A 2OW3A 4S30A 3EIDA 5CU0A 3LXKA 1WBPA 4FSYA 4YO6A 3REPA 4D9TA 3IG7A 3RAWA 4IAZA 1MRYA 2X1NA 3BU6A 1GIHA 3KF7A 2PWLA 4AGUA 4C58A 5L8LA 2JKQA 4F7NA 4ZLZA 3BI6A 4F7JA 4DH1A 5B7VA 3W16A 5B2KA 4C61A 1BUHA 5IZFA 5J7HA 4BCPA 5CSPA 4R5SA 5AM7A 3FHIA 4M0ZA 4QMXA 5ETFA 4I23A 4PNIA 1M2RA 3OBJA 4U79A 5A6OA 3ZRMA 5I9WA 4FEQA 4FBXA 5CI6A 5M55A 5AUWA 4AWIA 4CGAA 5JFXA 4MD8E 4RVKA 4AOIA 4GS6A 1OKVA 4MF1A 4CKIA 4NKAA 3OCTA 3MTFA 3PA4A 4ZTLA 5ANDA 3TXOA 4RIXB 4D2WA 1YOLA 1PXMA 4ITJA 4M3QA 3DJ7A 3OWPA 5DGZA 5HOAA 4BB4A 4DGNA 4L7FA 4I0SA 4V01A 3A8XA 3WZDA 5DR9A 3PVGA 3UVRA 4I6QA 4DFLA 1Q8YA 3CQEA 2X6DA 3R7GA 5BUEA 4FKRA 3FMEA 2XJ0A 4J97A 1Q3DA 3FXXA 4DT9A 1I09A 1YQJA 3MSSA 2RG5A 4E4NA 1PXLA 1NVRA 5CNNA 1SNUA 2PK9A 5ETCA 5KUPA 3CPBA 2H96A 3D2KA 2GMXA 3QX2A 4GRBA 2WMBA 1Y8YA 4I93A 3RVGA 2HIWA 3D5WA 4F9AA 3UPXA 5TKDA 3VUTA 1AGWA 2XJ1A 4BCQA 4IAFA 3WZKA 4ZAUA 5KNJA 4IC7A 2UW9A 3OHTA 5J5SA 4LOQA 3G9LX 4IAIA 4XX9A 2HK5A 4GK3A 1O6LA 5GZ9A 3F61A 4C4FA 5I0BA 5CAUA 3NIEA 3O17A 4BIDA 4F6WA 4I6BA 3SD0A 4KRCA 5AR8A 4CNHA 3BELA 4XV1A 3R7EA 3R83A 3G51A 3NYOA 4YP8A 1WBTA 1ZY5A 2QKRA 2QOFA 3BLHA 2XVDA 3UQGA 4LUDA 3GQLA 4C0TA 1W7HA 1LP4A 4ZMEA 3R7OA 1K2PA 3OTUA 4F7LA 5AP3A 4EQUA 3NUNA 3KKVA 5GIPE 3ID6C 3CEKA 2GNHA 3GC0A 3SOAA 1RW8A 3OZ6A 5DR2A 4F09A 5HBJA 5DE2A 4GYIA 2PVYA 2BHHA 1VYWA 3BYSA 2ZMDA 3DJ6A 2QQ7A 2XIRA 4FL2A 1YXXA 2A19B 4D1ZA 2C3JA 1JNKA 1Q8WA 4UWYA 3MY5A 3NEWA 4DGGA 5BVDA 4LGDA 4IB3A 1KE8A 4U7ZA 4C4IA 3DZQA 4NM5A 3Q04A 2BRMA 5GJDA 4MF0A 4H3BA 4HYSA 5BMMA 5K9IA 3UZPA 3MVHA 1Q99A 3BV3A 4NKSA 3F9NA 4AP7A 4JAIA 2B9FA 2XZSA 5L2SA 3DGKA 3II5A 2QOIA 1H01A 1LEWA 3EFLA 4IX5A 4HCVA 1STCE 3G2FA 1R3CA 4BDIA 1SYKA 4BCIA 4DF3A 4LMUA 3VRZA 3MB6A 4WKQA 1PY5A 4AFEA 2C6DA 4P5QA 4RFYA 1AD5A 4QO9A 3C4FA 3R8MA 4BN1A 3DXNA 4PDSA 5JZNA 5JT2A 5HD4A 5I5ZA 3HAMA 3DS6A 3GVUA 3I6WA 3LFQA 5A4EA 3BV2A 5AR7A 2GNIA 2BR1A 3DKFA 3RZBA 3WZUA 3RPSA 3P7BA 4EH8A 5DR6A 3ACJA 5CNOA 4XG6A 4IJ9A 5KKRC 4G9RA 3BPRA 4E4MA 2RF9A 1OGUA 2VAGA 4KS8A 4H1JA 3WE8A 4H05A 2YISA 1YWRA 3MB7A 4D58A 3ATTA 2C1AA 2C6MA 4JG6A 3K2LA 4YPDA 2PUNA 2H34A 3KU2A 4I5PA 3MBLA 3E92A 3UIBA 4Q2AA 2WQOA 3BWFA 3OEFX 4UZDA 3LMIA 2OIQA 3PIXA 5EHOA 4IM2A 2W4JA 4UWBA 3NX8A 1OL6A 2CJMA 3DKGA 3ET7A 5HIDA 3M11A 4DE4A 3Q3BA 2BVAA 3HLLA 4YGAA 3ZUVA 4BC6A 5CEPA 3WF9A 5DOSA 4RX8A 4IHPA 4AA4A 3DBEA 5CF5A 1A9UA 3ZZEA 1OL1A 4JLCA 4GFMA 3VNTA 4DTKA 3IW4A 3UOJA 3O51A 4GK2A 4CG8A 3F66A 4GUEA 3NPCA 4GH2A 1PYEA 4UXQA 4YTCA 2XNMA 4O1PA 2ACXA 3FMMA 1VEBA 2BUJA 1QPCA 3PFQA 2YJSA 3BLRA 4NU1A 5EQPA 1G8AA 3I81A 5C8KA 5IPJA 1ZMVA 4ACHA 4RJ7A 4P7EA 4O7LA 5I9ZA 1WBOA 3MPTA 2A1AB 3HDMA 3MS9A 5DNRA 3ORTA 4JDHA 4MWIA 4MBLA 3ORPA 4QPMA 5LXMA 2X8EA 4ZSEA 3U6IA 1U59A 4RLKA 5JRSA 3OROA 1R78A 4BWPA 4EKKA 1O9UA 4N4SA 5FBNC 4S31A 4R77A 3KRJA 3KY2A 3ZRKA 2Z7QA 1F3MC 3D0EA 4XH6A 4AZTA 4GIIA 4L3PA 4WNMA 4YTHA 4K2RA 4D5HA 3SX9A 4YSMA 5M09A 3JXWA 4IH8A 3SGCA 4DFXE 1JKKA 5CF8A 2HZIA 4WUAA 3OOMA 2P3GX 3ENMA 5AR4A 2YM5A 4WT6A 1ZYJA 4FIFA 4TWPA 4QP3A 4MYGA 3PYYA 4GU6A 3QL8A 3W1FA 3PA5A 1MUOA 4LV5A 3FUPA 2F57A 4YLLA 4BCOA 2IZSA 4CRLA 3W2SA 5KHWA 3G6HA 4DCAA 3G0EA 5L2WA 3ZXTA 3DLSA 3UNZA 3FZPA 2OKRA 3OCBA 4LMNA 4U9AA 4O21A 4ZJJA 2Z7SA 5J95A 3DA6A 4C7TA 3SG8A 2HZNA 4TWNA 4GW8A 5FGKA 3DY7A 3FYKX 5HIBA 4PMPA 4G3EA 4U5JA 4AF3A 4KKEA 2XMYA 4XHKB 1BI8A 2WELA 3UP7A 4YMJA 4USEA 3LXPA 3MIYA 3E63A 3ZTXA 2IPXA 5HGIA 1UKHA 5EW9A 2FSLX 2HELA 2W1ZA 2PMNX 3FWQA 1CKIA 3GXLA 2J4ZA 4FIIA 5HORA 4IWQA 2B9HA 2R3FA 2JFMA 3BE2A 3BYVA 5G1XA 5HG5A 2IZRA 4M8TA 3QFVA 3R7YA 4BDDA 3RAHA 4QNYA 4ZSAA 1CTPE 2H9VA 3TDWA 4RIOA 3DFAA 2YLFA 3JY9A 5E4HA 1M2PA 3BWJA 3OD6X 4E20A 4FTUA 3VBVA 2ZDTA 4ZP5A 5AAFA 4DAWA 4YU2A 5CAPA 2V22A 4BDGA 1V0PA 4G6LA 4BDFA 1PKDA 3CSVA 4HPUE 2O64A 2EVAA 1ZLTA 3F3TA 4NWMA 1B39A 4XOYA 2X0GA 2WTIA 2KTYA 1QPEA 2CKEA 3FMJA 2YN8A 3QTUA 5CF6A 2WMVA 3ETAA 3QF9A 3VHEA 3LFBA 3F3UA 4CFFA 2GSFA 4F70A 1KV1A 2X7GA 2V0DA 2E9VA 3QD4A 2C0OA 3RNYA 3FKNA 1R0PA 5ETAA 1DI8A 3DAEA 5L6PA 2GTMA 3PG1A 1XH5A 2HY81 3FLQA 4BZNA 5E9EA 4UMPA 3RPVA 5JRQA 2WKMA 1SM2A 4E6QA 4V0GA 3LLTA 3QKKA 3G9NA 4IZ7A 4X21A 5FXSA 4XV9A 3A99A 3W2PA 4MBIA 2JIUA 2R2PA 4RIWA 3FLNC 4TKSA 4YJTA 4O0SA 4R7IA 1F5QA 4EQMA 5K4IA 5ITAA 3AQVA 4JT3A 2BDJA 4FK3A 3JR1A 4XP0A 2IN6A 4I41A 4EOMA 4ANOA 1P2AA 4GSBA 4OBQA 1KE7A 2R64A 1H8FA 2ZB1A 3FLSA 4M68A 2J0MB 4XLVA 4AACA 5IMEA 3FYJX 4O6LA 4D9UA 2CN8A 3NRMA 3L9PA 2ZV7A 1DI9A 2BTRA 4OTIA 4EC9A 4I22A 3Q4UA 4G3DA 4N6YA 4USDA 2JDVA 3UG1A 3F88A 4NT4A 1UWJA 2VNWA 4Z9LA 2E9UA 3KRXA 3WZJA 3LFNA 4BBFA 2BZJA 4D1SA 3G33A 5JGAA 4II5A 4IM3A 4FZDB 5EM6A 4RZWA 2OJ9A 1MQ4A 4JDKA 3AXWA 3F82A 2VGOA 4FTRA 1MP8A 2UV2A 3VUMA 2X9EA 5B2LA 1P4FA 3GOKA 3LQ5A 2FH9A 2XYNA 2QCSA 3O96A 3V5LA 2C6KA 4U3ZA 2ERKA 4RZVA 3TL8A 1BLXA 3EN9A 3HMNA 3PXRA 4EHEA 4JVGA 2ITNA 2OIDA 2IZUA 3FZSA 4TYHA 4YPSA 1V0OA 4J8NA 1IA8A 1GIIA 2RG6A 3VVHA 3T3UA 2EU9A 5EYMA 3I60A 3POOA 4MVFA 5IUIA 3E7OA 3CJFA 5C8NA 4RFZA 3TDVA 5M44A 4M84A 3D7ZA 3DKCA 3FMLA 3QUDA 4YHJA 3FZOA 4RC3A 2W5BA 5CEQA 3W33A 1NW1A 2C5OA 5FWKK 3RK9A 3LIJA 1JWHA 2HWOA 2OICA 3QHWA 4LRJA 3OBGA 5CEKA 3ULIA 1W84A 2RL5A 1VR2A 2IW9A 4HW7A 3RI1A 5HX6A 4PDPA 4YSJA 4HNFA 1GZ8A 2PVHA 5DLSA 2OG8A 2XKFA 3ZDIA 5H8GA 4HVHA 5AV0A 4DCEA 1H25A 2OJIA 5DI1A 4BCFA 5AV4A 3PP0A 3ZO3A 5HCXA 3GQIA 4F0GA 4O7SA 5BUIA 4J7BA 1FVVA 3QA0A 5K5NA 4U45A 2WD1A 3PSCA 2ZV8A 3ZLWA 2GHLA 4IC8A 3GU6A 5A9UA 2W06A 4EYJA 5HEZA 4H58A 5CU3A 3UVPA 4IEBA 5IDPA 3L8PA 2UZEA 3UBDA 2Q0NA 2F2UA 2ZV2A 3D5XA 4CKJA 3BEAA 4YC3A 3DCVA 3G15A 3LCDA 3N4TA 1G8SA 4L43A 1BL7A 3VW6A 4XMOA 4BDJA 1OM1A 4CSVA 5IF1A 2QKWB 5E8SA 1SVEA 3EFWA 1FMKA 3F3VA 3KXGA 3NUUA 4XG9A 3L9NA 4WRSA 5CYIA 2AC5A 4AN9A 1H1SA 4BICA 4TN6A 4I6FA 5EQEA 1OVEA 4CFXA 5LCJA 5CVFA 3LMHA 3UYTA 2O5KA 4PDOA 2WPAA 3A7JA 1H1RA 5ACBC 4QPAA 4AT4A 4E5AX 2CKPA 3PPJA 2I7QA 4DLJA 5G6VA 4QMNA 2ERZE 2B54A 3CTJA 1MRUA 3CE3A 1OPLA 4RPVA 5HBHA 2CGVA 3ZZWA 4DBNA 4FVRA 3JVRA 3MFRA 3TV6A 1OL7A 4YO4A 2ZDUA 4H1MA 2VTNA 2XJ2A 5E90A 3DK3A 4QTDA 3MJ1A 2YDJA 3RK5A 4QQTA 3KGAA 4QMWA 2OXDA 4YLKA 3VULA 1V0BA 3EQPA 1PXIA 5HICA 2YWPA 2BKZA 4FE2A 1OIYA 1OKWA 2BAJA 1JLUE 3MH1A 4QT1A 4FKGA 4I5CA 2RFDA
chains in the Genus database with same CATH superfamily
2BRGA 3N4VA 5CT0A 3W2RA 4PMSA 2RFNA 2XBJA 5EYKA 4TL0A 1YI4A 2ITYA 2R3HA 3BQCA 2OWBA 3EYHA 3R9OA 3V5WA 3VS7A 4Z3VA 5BUJA 5L6OA 4FIEA 1UU7A 2IWIA 4S34A 4M7IA 2CCHA 4DFZE 4FYOA 2VWUA 2X4FA 4WOVA 5HNGA 4DINA 4I0TA 5C26A 5DBXA 4C62A 4P4CA 3DXQA 2GU8A 4QMVA 5EK7A 3PP1A 4ACDA 4RJ8A 2ITTA 2P55A 2R3KA 2YIQA 4ZTSA 2HOGA 4M0YA 2B7AA 3VBQA 5KE0A 3ROCA 3V6RA 2F7EE 3QTZA 3R2BA 4FF8A 4NM3A 4YZCA 3TACA 2P33A 3ACKA 4AZEA 3PXZA 4FIHA 4YHFA 5TT7A 4Y5HA 1M7QA 3TV4A 3I4BA 3AC3A 4F7SA 4FKWA 3V5JA 4BJJB 5DPVA 5E8TA 1OIRA 3E8EA 2RIOA 1LR4A 4EZ5A 3QRIA 2VTPA 1XH7A 3ZC6A 4YC6A 1G8JA 2ONLA 5D41A 3GFEA 1OB3A 5BPYA 3EH9A 5AUXA 1TFFA 2ZB0A 3ORIA 2ETMA 2C47A 3R01A 4O7RA 2R3GA 4RWLA 1CM8A 5HE1A 3B8QA 4QQJA 1E1XA 3QCSA 3FE3A 5CSXA 4MTAA 3ZRLA 2VWVA 3PPZA 4R8QA 3AOXA 2Z7RA 4AAAA 1IAJA 4IFCA 3ZCLA 3VS3A 4BCMA 3C4EA 3CY2A 2OJGA 3KXZA 5AEPA 4XCUA 5C4LA 1B38A 4KWPA 1FMOE 4YZMA 3KL8A 3ZLSA 4DYMA 2WOUA 4EHZA 3W0QA 3DB8A 4MWHA 4PUZA 3SV0A 4F63A 4KB8A 4D4SA 3TNHA 3IW8A 2W7XA 3V5PA 2B0QA 3R7IA 5GZ8A 2WMQA 4USFA 2REIA 3LLAA 3RKBA 5CEMA 4A4LA 4IANA 1Q4LA 5KMOA 1H28A 3S95A 2C6OA 2BRBA 4AG8A 3QX4A 4TYJA 1M52A 4BFMA 5AJQA 3QGWA 2X7FA 2XIXA 2XNBA 2JDOA 4F65A 3AMBA 1VYZA 5CLPA 4FZ6A 4RX5A 5FDPA 1KWPA 3E87A 4ZS4A 1XR1A 4G6OA 2YEXA 4AGWA 3EQFA 4L9IA 2AEGA 4GIHA 5JGBA 5DT4A 3FZ1A 3HZTA 1DAWA 1JOWB 4V0GB 2PVKA 5ANEA 5CENA 3E8CA 4D2RA 4B9DA 5LVLA 5GIOE 4YZDA 3TEIA 2VO3A 1UNHA 2CGXA 3QCXA 4WG4A 3DK6A 4A4XA 4OAUC 2GCDA 3Q9XA 4YJVA 4RIWB 3ZLXA 3D15A 2VWYA 4FT0A 2J7TA 2WMUA 5KZIA 2YITA 3HP2A 4CD0A 1O6KA 3TIYA 2IF8A 3P5KA 5HG7A 1ZOGA 3R1NA 2LAVA 1YXTA 3SXSA 4DGMA 2I1MA 4DH7A 3WYYA 5DH3A 5AA9A 5K5XA 2FUMA 5I9YA 4DG2E 4PNKA 2XA4A 4ASZA 1JQHA 4ZK5A 4LQMA 2F7ZE 4FV5A 3UGCA 3AG9A 5J7BA 5AP6A 4KUJA 3K3IA 4TWOA 3D14A 3LXLA 1W83A 5A54A 5IA3A 1Q24A 4FTCA 5M07A 3TWJA 1HCLA 2EXCX 3KVXA 4Q9SA 4XG8A 3RCJA 2YM6A 3OP5A 5D11A 3QUEA 3KXHA 4BZOA 5KX8A 4E7WA 3W55A 4M66A 4HGLA 4QMTA 1YXUA 2FSOX 1JAMA 5BVNA 5LWNA 2XB7A 4P5ZA 3KCFA 3P79A 2R3LA 4RVLA 5ANJA 4IW0A 4W9XA 3HDNA 4PL3A 5IA5A 2HCKA 3OY3A 2WGJA 5C27A 4BKJA 4L01A 4DFBA 4QMPA 3R04A 4KSQA 3P23A 4J71A 5B0XA 4IM0A 4L68A 4EBWA 3SVVA 3F7WA 4IADA 4AS0A 5D7VA 1BMKA 4G6NA 4NFNA 3TIZA 3ZO1A 5L3AA 3OCSA 3RMFA 4C36A 4G5PA 2J9MA 2YABA 3PSBA 1OMWA 2WMWA 3IPHA 4UMRA 4TYHB 2PPQA 4WA9A 2WTKB 5J87A 3R8UA 4PMMA 2C69A 3NNXA 3QC9A 3W0PA 2R3OA 4W4WA 4FYNA 2IZTA 3RM7A 3ZFMA 1B6CB 4UXLA 4ZEGA 5GNKA 1Q8TA 2ZAZA 5T3QA 2QHNA 4F6UA 3E5AA 3H10A 4CVAA 5AR2A 5AM6A 4GT3A 3RTPA 4EQCA 2IO6A 4AAYA 2F4JA 3TG1A 2PE0A 4IZYA 2R3JA 4DFNA 4EWQA 1H1PA 2X2KA 3E8DA 4L44A 1Y6AA 2DS1A 4IJPA 3RBWA 4AW1A 3A62A 3DQWA 4QMLA 5BYZA 4RQKA 3PUPA 3VJNA 2C6LA 2VN9A 3P4KA 3MVJA 4IX6A 3TNPC 3NWWA 5L4QA 3ANRA 3HUBA 1F0QA 3QXPA 3QTQA 2WTDA 2W1GA 2OIBA 3UG2A 3FY2A 3UDTA 2IVVA 4FTIA 4F78A 5E1EA 2V55A 3NR9A 3BKBA 4AA5A 4XP3A 5B2MA 4R1YA 4RGJA 3UP2A 3NMUF 5HE0A 3WF6A 3QZIA 4UBAA 3PXKA 4EYMA 4GYGA 3SOCA 2R3PA 2ZV9A 2VWXA 4QRCA 3I79A 4W4YA 4C4HA 4A9RA 3Q60A 4ENXA 1TVOA 5HLPA 4TXCA 1CDKA 4QP7A 3DZOA 4GVJA 4E26A 1REJA 2VGPA 3V8TA 2VZ6A 3E3BX 3WILA 3E88A 4APCA 4FKSA 4DT8A 2PZIA 2X6EA 3WE4A 2P2HA 3AC1A 4MD7E 4BVUA 2BRHA 4A4OA 2X39A 1VLRA 3BHTA 4UWCA 1W82A 4M13A 5LWMA 2OF4A 4XYFA 2GDOA 3FAAA 1UNLA 2G1TA 4I3ZA 3VQHA 4FTMA 4YZNA 4D28A 3HGKA 3PJCA 3MH2A 4CT2A 5LQFA 2XCHA 3AD4A 4F08A 2YAKA 3DOGA 3I6UA 4AZSA 1WAKA 2WNTA 3FY0A 3EWHA 2QG7A 4U81A 3FPMA 2WTKC 4F9CA 4FT5A 4XV3A 2Q83A 3FEGA 5H3QA 5EM5A 2ZM1A 4FTOA 2WO6A 3CQUA 3HRFA 1YVJA 4E8AA 3ITZA 2R3QA 2XKCA 3UJGA 4ANSA 5KMIA 3R7UA 4PPCA 4AGCA 2E9OA 3FI2A 3EHAA 1G5SA 3FBVA 3LCKA 4I24A 3A7FA 3S3IA 1OBDA 2XANA 3EFKA 3DTWA 3QRJA 4NCTA 5KCVA 1WVXA 4I6LA 2O8YA 1YDRE 3FPQA 3UOKA 1YHSA 1OITA 4IBMA 4OGRA 5EI8A 5IDNA 3B8RA 3OXTA 4YZBA 3TUCA 1R0EA 4J53A 5J9ZA 4FEWA 4YBKA 2UZUE 4AE6A 4EBVA 5EH0A 4EH2A 5JMSA 3Q9YA 1KSWA 4FG9A 2DUVA 4O6EA 3NCGA 4X6QC 2CHLA 4FV2A 2YJRA 3Q4TA 5JK3A 2R9SA 4YTIA 3NUXA 4EHVA 4HNIA 2OH0E 4PTGA 5A46A 3H3CA 3PA3A 3UO4A 3HRBA 3R7VA 2JEDA 2J0IA 4WBOA 4OTDA 4DG0E 2X9FA 4N6ZA 3OXZA 3ZSHA 3VF9A 5HESA 3LM5A 1XWSA 3FSFA 1G3NA 2HENA 4OTQA 2A4LA 3VRYA 3V51A 4AFJA 5K3YA 4YTFA 5JSMA 4PWNA 5CTPA 2R3IA 3HA6A 1XBAA 3V01A 4ALVA 4HPTE 3SXFA 4F9YA 5HU3A 4C8BA 3RM6A 2OXXA 4IVAA 4PRJA 2VWBA 4FVQA 4PTCA 3VS4A 3UE4A 4KIOA 2IVSA 3NCZA 2G2FA 2O0UA 3R00A 3ZSIA 4EH9A 4O7TA 4U80A 1P4OA 3GFWA 3IS5A 4BDCA 3F6XA 3NW5A 2UUEA 4W8DA 4BWXA 3OF0A 5EFQA 3VC4A 4UV0A 1V1KA 5E91A 2VTAA 2W99B 5CX9A 4OTWA 1ND4A 4UY9A 4ANMA 3VS5A 1OIUA 2UZVA 3CBLA 4PL4A 5J8IA 3W2CA 5IQIA 3UZRA 4RBLA 2QC6A 4DEAA 1JPAA 4EK6A 4O4BB 3CPCA 3FKOA 4OTFA 4AW2A 3COIA 3HV4A 4QD6A 3QRUA 3GENA 3UO5A 3O2MA 2OI4X 2C1BA 2SRCA 1GZKA 2WB8A 2YIXA 3HX4A 4AT5A 1PHKA 4MXAA 3VO3A 1Q61A 4EJNA 3MY1A 1IG1A 5DWRA 4AT3A 4ZJIA 1ZYSA 2Y9QA 4MEDA 4WRGA 5EM8A 5HVJA 3WI6A 3WZEA 4ASXA 5H9BA 3GU7A 5BVEA 3EMGA 3MH3A 3V5TA 2BMCA 5HNIX 4XG7A 1ZOEA 5L2TA 1JKLA 2YIRA 2AYPA 3RAKA 2XK8A 4FKTA 3PZHA 3HV3A 5JFWA 1YHVA 2PL0A 2R5TA 2YM3A 2GS6A 4Z16A 3NSZA 5AV2A 2UVYA 3LJ0A 4AUAA 3KA0A 3W2QA 4FKVA 3LFCA 4HGSA 4HYIA 2C5NA 4IAYA 3ZFXA 5BVOA 2QOBA 3PRIA 4FKLA 1WVWA 4FMQA 4NW5A 4O83A 4OTGA 3LJ1A 1PXKA 1ZMUA 3IW6A 5FD2A 3RWQA 3OG7A 3R1YA 3HAVA 3ZUUA 1W8CA 3Q2JA 4ITIA 2ZFYA 4HJOA 1KE9A 1Q97A 4LG4A 4AU8A 4E1ZA 1FQ1B 4K0YA 5IA0A 4EK8A 5HO8A 4C59A 2J50A 1OPKA 2WTCA 5IQDA 4ALWA 3JVSA 3BE9A 4IWOA 1YDSE 5JQ8A 3UNJA 1OGYA 2JGZA 3W2OA 3R1QA 3VS6A 2P0CA 4IVDA 1WZYA 5IG1A 2QODA 4MXCA 3OWJA 2QLQA 4CZYB 4P2KA 4R3PA 5AUYA 4DEDA 2QI8A 3QRKA 4X7QA 3PRFA 2PE1A 2WEIA 4JI9A 5E92A 5AR3A 4CXAA 2BZKB 3U54A 5C9CA 4FKJA 4WUNA 5LCKA 4QTCA 2WQBA 3NNVA 4D1XA 4PQNA 3I1AA 4FTJA 4IACA 3CIKA 5JEBA 1ZMWA 2ZJWA 2GS2A 3BQRA 3ERKA 3F5UA 4K6ZA 4BIBA 2FGIA 5M4FA 2QNJA 2IG7A 1GOLA 2VTIA 3PPKA 4C3FA 2PY3A 3CC6A 2DWBA 2WAJA 2Y6OA 4QQ5A 2EWAA 2C3KA 3ZSGA 4D55A 4LL5A 4EWHA 5CASA 3QZFA 1S9JA 3C0HA 2RFSA 4UYAA 3ZO4A 4H3PA 2BTSA 3BGPA 3F5GA 3WARA 3T8OA 2HXLA 4DEEA 4W8EA 4CEGA 3GC7A 4ZZNA 2YCRA 3PJ3A 3GI3A 2R7IA 4QDEA 4ANLA 5CXHA 2I6LA 4NK9A 3PVUA 4TW9A 3TZMA 5ICPA 1JVPP 2QO2A 3GUBA 4BJJA 4OT6A 1M17A 2IVTA 3MJ2A 3NAYA 5HVKA 2XNOA 3P0MA 3PIZA 3PWYA 3PE1A 3OWKA 3ORXA 5CSHA 5KMJA 2IW6A 4DEGA 5K4JA 4X2FA 4BYJA 3U87A 4FODA 5CF4A 5BQ0A 4BDHA 4E3CA 4C2VA 1J1BA 4FT7A 2OBJA 3R21A 3D9VA 5C03A 4ZTNA 2HZ4A 4JBPA 4QTAA 5LARA 3CLYA 4ZY5A 3QLGA 3QZGA 4GFGA 4Y83A 4FSQA 4IXPA 4YBJA 4ZS0A 1QPDA 5A4TA 3FLWA 3I5NA 4EUUA 5IQAA 3RNIA 3QBNA 2GNFA 4IQ6A 2X2MA 4G5JA 3DTCA 3ZC5A 5GJGA 1WMKA 2G01A 3TKIA 2EB3A 4A7CA 3DU8A 3ZEWA 5EQYA 1WVYA 4O0VA 4FG8A 5AUTA 4L00A 3B2TA 3MVLA 3CQWA 4N57A 5CQWA 1QMZA 3LOKA 5F94A 3TZ8A 2YZAA 5TR6A 3FXWA 3OUNB 3WOWA 2VX0A 4RFMA 4XRLA 3ZONA 4B99A 4G17A 4C2WA 3FMHA 3QALE 2E2BA 4BKYA 5BMSA 2VO6A 3E8NA 2W0JA 4RX9A 4ACCA 4ANBA 5CWZA 4JBVA 4EOKA 3D2IA 3VUGA 3EYGA 3ZDUA 4NEUA 4TNDA 1H1QA 4FZFB 2YM4A 2XBAA 4YJNA 3PY0A 3CR0A 2CMWA 2GHMA 2PHKA 4D5KA 4E73A 4DDGA 2ITXA 3KRWA 5HZNA 2UZWE 3DK7A 2UW7A 1ATPE 4M67A 3TJCA 2OJFE 2YM7A 3OWLA 1DAYA 5IQFA 4IMYA 4RT7A 1GAGA 3KF4A 1O6YA 3QYWA 4EK3A 4G3CA 4ZXTA 1A48A 5JN2A 5A3XA 5A4CA 2XM8A 4RJ6A 3GEQA 4XG3A 4Y8DA 5AADA 3IW5A 1JSTA 2PU8A 3RWPA 2XNEA 1J7LA 2WMSA 4O84A 3VBXA 3VUDA 2W05A 4CRSA 5IQBA 4ZTMA 1ZYLA 3A8WA 3EZVA 2G2HA 3COMA 5JKGA 1OIQA 3MTLA 3GCVA 1LEZA 3TJDA 4O1OA 2ITWA 5D10A 2CPKE 3K54A 4F9BA 4QTEA 2YAAA 3KRRA 1TZDA 4CKRA 3C5IA 1ZYCA 3VHKA 2PE2A 5HVYA 4FSTA 2GFCA 4O0WA 5AUVA 3R63A 2HWPA 3LQ3A 3ROYA 2QOQA 4DH8A 4FTLA 3EKNA 3BZ3A 4ZY6A 4GMYA 4YC8A 3DNDA 4HVSA 4Y72A 4D4YA 3WIKA 2X8DA 4KBCA 3U9CA 3QYZA 3GCSA 5H8BA 3W10A 4MHAA 4XG2A 3IDPA 5IH6A 5EDPA 4JAJA 3EQCA 5JFSA 4NM7A 5J1WA 4QMQA 1IA9A 3VN9A 2Y4IB 2FVDA 2VX1A 5DMZA 5KMNA 2BROA 5E1SA 3FLYA 3PJ1A 4XBUA 2C5XA 2JC6A 1WFCA 4QYFA 4JNWA 1XMMA 3HMIA 3ANQA 2PVFA 2VTQA 3VS1A 3Q6UA 3ALNA 2VTTA 3KIOC 4F99A 4O82A 3QWJA 3IDBA 3HUCA 4ACMA 2XNPA 5D9HA 2J0LA 2Y0AA 2X7OA 2Y8OA 4RSSA 3QQUA 2O2UA 4RVTA 1Y8GA 2VO0A 1KE6A 3Q2MA 4FL3A 4XJ0A 1Z5MA 2R3RA 2VTRA 5AIKA 3RINA 2CKQA 4CYIA 3G5DA 4CTCA 4EH7A 2OK1A 3QQFA 3AGLA 1UNGA 2V7OA 3D94A 3ODYX 4FV0A 2W1FA 3SW7A 4FT9A 5EYDA 1URWA 4CLJA 5E8UA 2W5HA 1U46A 3O8TA 3EFJA 4FVPA 4H3QA 4DA5A 2QG5A 4PF4A 3NS9A 3O8PA 4LGGA 3JY0A 4QP6A 3IONA 4GU9A 5BVKA 5BVFA 5GHVA 3QQJA 2NNWB 3ATSA 2PUIA 4IIRA 1DM2A 3LQ8A 3Q9ZA 3V3VA 4G16A 2CNUA 3E7VA 3VONA 1YWVA 3FDNA 3Q4ZA 5KBQA 4WD5A 4EOIA 2ZVAA 3LFEA 2WHBA 4MX9A 5AP7A 4ZMFA 3V6SA 4QP9A 3ZHPC 5IUGA 2BCJA 1URCA 2QVSE 2Z8CA 4FV6A 4IWPA 3VBTA 3PG3A 3R8LA 5AV3A 4OTHA 3UDZA 2VX3A 5CVGA 5M4CA 4O0XA 5KZ0A 5HNBA 5ANGA 2J5EA 3TT0A 4BTFA 4LI5A 3CD8A 1NVQA 4NCTC 3NNUA 3C1XA 4OT5A 4E5WA 4C38A 2WIHA 1UU3A 2C6IA 2EXMA 3FQSA 3RPYA 3M1SA 3UOLA 3R9RA 4A9TA 3NYXA 1PXJA 1REKA 3DBQA 4IZAA 4J96A 3SC1A 4S2ZA 4A07A 4C37A 3HMMA 2BAQA 5L8JA 4BY9E 3BYOA 2WFYA 2NPQA 4KD1A 4O22A 4LUEA 2R3NA 3VWAA 2Y4IC 3BX5A 3KN5A 2OH4A 3PLSA 4GT5A 4KINA 4LGHA 5EDRA 5IH5A 3GGFA 3ZM4A 3LKMA 4DHZA 4RA4A 1FVTA 2UZDA 1PW2A 5CEIA 4BCHA 3NUYA 4RJ5A 3QQLA 5FP6A 3NAXA 4BI1A 3OOGA 4YJPA 1OPJA 4EH3A 4UMUA 2QOLA 4J98A 4CFNA 4TYGA 3MFUA 4N70A 2HAKA 3OEZA 4R3RA 2NRUA 4JG7A 3ALOA 3ZEPA 1XH8A 4I94A 1PMEA 2WMXA 2VUWA 2UW4A 4L67A 5HI2A 4U40A 1H4LA 3UOHA 1NVSA 5AAEA 2UW3A 2WXVA 3ORLA 1GJOA 3MFSA 1DS5A 5BVWA 2BDWA 1Q5KA 4MNEA 1TQIA 4JIAA 2HZ0A 3IK3A 5F95A 4DHFA 2C68A 2OF2A 1OL2A 4FV4A 4I20A 4BGQA 2CNVA 2QONA 4YJOA 4F0IA 4CLIA 4IAKA 2W5AA 2WQMA 3P86A 2GPHA 4L46A 2V7AA 2PMLX 3N4UA 3BYMA 2Y7JA 5A4LA 2BFYA 3QZHA 4IB1A 3BGQA 4K1BA 2Y6MA 5LMKA 3TYKA 4MXXA 1XBCA 3ORNA 4B8MA 3C4XA 2VWZA 4WHZA 3RHXA 2HW6A 3NW7A 4GVAA 3KXNA 4JR7A 5AIRA 4BDBA 5KHXA 3QCQA 5IMXA 3OT8A 1UA2A 2WEVA 5IQHA 1H26A 1YXVA 4DBXA 1U54A 4XNEA 3SDJA 4D0XA 4FSNA 2OO8X 4OLIA 3LFAA 5FM2A 4E6CA 5CXZA 3OVVA 3ZH8A 3D5VA 3QQGA 5T68A 3I7BA 3TMOA 4AQKA 4RC2A 1YDTE 1Q62A 4I0RA 4Z55A 1NXKA 4KKHA 5HO6A 2QO9A 2QOKA 3C4CA 3FQEA 3KCKA 4E93A 4I6HA 3PIYA 4K33A 4R7BA 4MD9E 2WMRA 4S32A 4L3LA 5JH6A 2YFXA 4FUXA 1H1WA 1OECA 3L8XA 3FI4A 3OXIA 2J0JA 4F1OA 4EZ3A 3JYAA 3IOPA 3P7CA 5JQ5A 2W4KA 3M42A 2VTOA 3TCPA 2CKOA 1XO2B 2A27A 3VJOA 2XK4A 3Q52A 2C3LA 3FV8A 3UC4A 4DH5A 2AQXA 4RWKA 5LVOA 4JDJA 3THBA 2GNLA 2DQ7X 2QR7A 2BZHB 3Q32A 4D2VA 3EKKA 2WTJA 5I3OA 3UNKA 1Z9XA 2JKOA 1YHWA 1ZYDA 4AQCA 4GL9A 4JIKA 5AP5A 2ITZA 4ALUA 1GY3A 3BLQA 5FXQA 3R30A 2C3IB 1YOJA 2I0EA 5LJJA 4MXOA 3L9MA 2CGUA 1SNXA 4GV1A 3ZUTA 3O23A 3DB6A 5E8WA 1PKGA 4G3FA 4FKUA 1K9AA 3R02A 4AXDA 3VW8A 2VRXA 4NL0A 4KIQA 2FO0A 3E93A 4NTTA 4U43A 4AN3A 5M53A 3C9WA 3EB0A 1M7NA 4RG0A 4C34A 2R4BA 1OZ1A 2C4GA 2XF0A 3GU5A 2PVMA 2XUUA 4L52A 2YLEA 1MQBA 2GTNA 4QNAA 2GQRA 2CSNA 5GJFA 3CS9A 4C35A 2YCFA 2ESMA 3LZBA 1S9IA 3ZO2A 5DN3A 4C4GA 2CGWA 1H0VA 4LOPA 4PMTA 4ZOGA 3DPKA 1PMVA 2BHEA 1Q3WA 1RQQA 2H6DA 4NM0A 1J3HA 2FYSA 4ERWA 5AV1A 1Q8ZA 4ASEA 5M06A 1WBWA 3P08A 2I40A 4WG3A 4FV7A 4AX8A 4ZTQA 3PFYA 5FLFA 5DRDA 2R7BA 4L8MA 4J99A 5ANIA 3UDBA 2JLDA 1TQMA 2XAMA 1Q41A 5HTBA 4YJUA 4FKPA 1Y57A 3OC1A 4JQ7A 4XEYA 5KBRA 3V8SA 4GK4A 5HIEA 2QOHA 4FOBA 3QTSA 4LL0A 4IWDA 4CZTA 4RA5A 1L8TA 3CJGA 1K3AA 3FI3A 4O2PA 3UTOA 3UZTA 3A7HA 3AC4A 4MXYA 4DFYA 3C0IA 4XOZA 3MIAA 4Y95A 4XS2A 2PUUA 2CN5A 2PZ5A 5AX3A 2O63A 3H4JA 3RCDA 2W1CA 3RGFA 4EONA 4BKZA 4JOAA 3A61A 4B6LA 5EG3A 5EW3A 5KMKA 2Z02A 4CQEA 4NJDA 3QUPA 2Y4PA 4RWIA 4ANQA 4I92A 5CANA 4DEIA 5CZHA 5I3RA 5L6WL 3QTWA 1TQPA 3ORZA 4GG5A 3COKA 1IEPA 4UALA 4K8AA 5J1VA 1OI9A 2JFLA 2Q0BA 1XJDA 2W4OA 3QTRA 2HW7A 2B1PA 5E8ZA 3JPVA 4BZDA 5FXRA 3O5AA 4EI4A 1BX6A 1ZARA 2JDRA 4FL1A 2W1EA 3UQFA 2VWWA 2OJJA 4HVIA 4G2FA 2F9GA 5CU4A 1XBBA 2ITPA 2UW6A 4ARKA 3MPMA 2J90A 3TKUA 5I9VA 2PYWA 1U5QA 3D5UA 2CNQA 2OSCA 1U5RA 5HG8A 4BR3A 2XALA 1OBGA 3Q4CA 4NZWB 3V8WA 3VS0A 4EH4A 4XRJA 2ZM4A 3WBLA 5EKOA 4ORKA 3R73A 2B55A 4W4VA 1PXPA 5E8YA 3IOKA 4BHZA 3DBDA 1NY3A 3EZRA 4FK6A 4AGDA 4A9UA 2XKDA 4YHTA 5M4UA 1PXOA 2VWIA 2X2LA 3IO7A 4I5HA 2JKMA 4L42A 1ZOHA 2EB2A 2QO7A 3MPAA 4O0YA 3PDTA 4XP2A 2YDIA 4UN0C 4ZSGA 3PXFA 3QQHA 3A4PA 4TZRA 3UIXA 3HRCA 1FVRA 2UZTA 2NRYA 3H0YA 3Q9WA 4U41A 2OGVA 2BPMA 3N9XA 1PRYA 3O7LB 3DQXA 3PE2A 4OBOA 1UU9A 2JBOA 3A7GA 4ITHA 3POZA 4FTTA 5BV3A 3C5UA 2VTLA 3PJ2A 2R0IA 3CD3A 1J7IA 3OW4A 3TM0A 4BDEA 4I4EA 4CMUA 3NUAA 4KNBA 3F3ZA 4CFMA 1JKTA 2YCSA 2YACA 4KSPA 3D83A 3L8SA 5EKNA 4EOOA 5HG9A 4RX7A 4TYEA 4MQ1A 5M56A 2VU3A 4YR8A 3K5VA 5AUUA 5I9XA 2PSQA 4FIGA 3FMKA 4IVBA 3WF5A 5DEWA 3W8LA 4O81A 3KULB 4ZSJA 3LAUA 4APPA 4TPTA 3JUHA 5L2IA 5CU2A 3ZM9A 3FSKA 3NUPA 3QAME 4MKCA 2GFSA 1FGIA 4O4CA 5IA2A 1Y91A 2ITVA 3VAPA 3R9NA 3KFAA 3FC2A 4FC0A 5FTQA 3TNWA 1JSUA 3GU8A 3SA0A 4ANNA 3DKOA 5DT3A 2FSMX 5JZJA 1FOTA 4U8ZA 5ACKA 4U6RA 4O7NA 4D0WA 4CV9A 5AA8A 1SZMA 4EH5A 4UEUA 1NA7A 3K5UA 5TE0A 1ZRZA 4EHGA 4KRDA 4DTBA 4Q5EA 3KMWA 3BIZA 4X2JA 4X2NA 5IQCA 3VIDA 3AMYA 3ZBFA 4MNEB 1PXNA 4AZWA 1I44A 3KXMA 4RJ4A 5D7AA 1YI3A 1YOMA 4O2ZA 4L3JA 3EN5A 2QD9A 3GOPA 3R22A 4AZVA 4E4XA 4EEVA 3F7ZA 4LYNA 4FJVA 3R8ZA 2UZLA 2LGCA 2VTHA 3LMGA 3ORMA 4XV2A 3SW4A 4WBBB 3ZFYA 5KKRB 1IAHA 3AT4A 4KAOA 3C0GA 2X4ZA 3ZYAA 3M2WA 4HVGA 3AD6A 4P90A 4GKIA 2XRWA 4PP9A 2YM8A 3AGMA 2VTSA 5TOZA 3C51A 4NUSA 2OXYA 4BYIA 3ODZX 4PTEA 5EM7A 5JFVA 5DYJA 4PP7A 1NT2A 3OT3A 3PXQA 5C4KA 4G9CA 4TYIA 4QTBA 5HE2A 4BTJA 5F9EA 3S4QA 4X3FA 1PMNA 3JS2A 3PVWA 4IDTA 4H36A 4NW6A 5EW8A 4BL1A 4C02A 1U54B 1HCKA 1OUYA 4IB5A 4M15A 2V62A 5D1JA 3AC8A 3FJQE 2PMIA 3I0OA 4M69A 1H00A 1PJKA 1GIJA 5CAVA 3NFGB 4BCNA 5DG5A 4HCUA 3O71A 1APME 3MN3A 4AXFA 5EI2A 2C0IA 4BCGA 2PVJA 1YI6A 3LCSA 2Z7LA 3C4ZA 1PMUA 3ELJA 3FKLA 4B7TA 4BCKA 4CMOA 3W8QA 5JGDA 5IQGA 3QRTA 2XIZA 4UYNA 5LMAA 4HGEA 4FKIA 5H8EA 3SQQA 1A06A 4ZJVA 3G0FA 4K11A 4RWJA 5IH4A 4EK4A 2WTWA 5AR5A 3VBWA 3H9OA 3QQKA 5CS6A 1W98A 1OL5A 5IEVA 4JG8A 3EL8A 3EN6A 3F5XA 3HEGA 4GT4A 4WSYA 4V05A 5HBEA 3RP9A 4YJSA 4OBPA 4Y73A 4D2PA 3U4WA 4ZZMA 3QTIA 2B9IA 3QWKA 4KIKA 2JKKA 3LE6A 3SRVA 4O91A 4A9YA 5HHWA 3DXPA 4FICA 5AFVA 4OR5A 3LFDA 2P2IA 2JBPA 2UVXA 4F64A 5IISA <