4ANNA

Crystal structure staphylococcus aureus essb cytoplasmic fragment
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
176
structure length
176
Chain Sequence
LDMREIPKSSIKPEHFHLMYLLEQHSPYFIDAELTELRDSFQIHYDINDNHTPFDNIKSFTKNEKLRYLLNIKNLEEVNRTRYTFVLAPDELFFTRDGLPIAKTRGLQNVVDPLPVSEAEFLTRYKALVICAFNEKQSFDALVEGNLELHKGTPFETKVIEAATLDLLTAFLDEQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization of Staphylococcus Aureus Essb, an Integral Membrane Component of the Type Vii Secretion System: Atomic Resolution Crystal Structure of the Cytoplasmic Segment.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus nctc 8325
molecule tags Membrane protein
molecule keywords ESSB
total genus 54
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2012-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4annA00
2XJ1A 2Z7QA 3WILA 5CI7A 3O2MA 4I41A 2R3MA 3BYMA 3I79A 3UIBA 2VX1A 3S0OA 5HEZA 3BHYA 5GJDA 4YZCA 3NZ0A 3O17A 3RCJA 4KNBA 5EM7A 2XNPA 4R1VA 5CVFA 4A4OA 5EDPA 3GOKA 2FB8A 5CZIA 4UWYA 4G9CA 3LVPA 4E1ZA 4TNBA 4ZSEA 5FP6A 5DLSA 2DUVA 3TI1A 3KKVA 5KMKA 3TUBA 4U0IA 5IH4A 5B7VA 2Z8CA 1IASA 3OT8A 5FM3A 5K0XA 3FV8A 4YZBA 5BVWA 4ENYA 1GZ8A 1P14A 5E90A 5HD7A 1VEBA 3GCQA 2PVFA 3NPCA 4YJVA 4BBFA 2WOUA 5L3AA 3PJ2A 3ITZA 3SC1A 4DFNA 3PP1A 1PMNA 2XBAA 3AC4A 2WQMA 3V5LA 3BE2A 5C01A 5K0KA 3SQQA 3C7QA 2YEXA 3H10A 5CXZA 3CKXA 2EXCX 1REKA 2WPAA 3RZFA 4EHGA 4JDJA 1Z5MA 4FKJA 4ZZNA 4RJ8A 1Q3WA 1SVEA 4FKPA 4FSWA 2VWXA 5AWMA 2X2KA 3MTLA 4I3ZA 4YJSA 3TUDA 3PXQA 5CAQA 3UOJA 3FPQA 4BDIA 5EHYA 3DDQA 4C36A 4KWPA 2PZ5A 1JKLA 2XS0A 2YM7A 3H4JA 5HICA 3B8RA 5CSPA 4GSBA 4ZJIA 2CN5A 5AP6A 4L52A 3PXYA 5BPYA 3OCTA 5IDPA 1BX6A 4D58A 3PPJA 1MQ4A 4QMLA 4FK6A 2EXMA 2O63A 3OROA 5IUIA 4IJ9A 3FZSA 4IB0A 2XF0A 2YA9A 4FSZA 1OECA 4HOKA 3OT3A 4FYOA 4GJ3A 4AOIA 4IVDA 3GOPA 2W5BA 3DKGA 3POZA 4TN6A 1PKDA 3PRFA 1FMKA 4APCA 4ANOA 5ICPA 4FG8A 4FKGA 5LMAA 1IG1A 4YUQA 5CAUA 3S1HA 3DNEA 2NO3A 3UGCA 1VYWA 4C2WA 4EWHA 4RX7A 4WG3A 3KCKA 4MH7A 3TNPC 5M56A 2GNGA 4EOSA 3D7TB 3VRYA 4FT0A 1JLUE 2QVSE 3LAUA 3PIZA 4HYHA 5CSVA 3VWAA 1VR2A 3ZUVA 5HX6A 5FDXA 1H01A 2PVRA 3F3ZA 2YIYA 2J4ZA 3GP0A 4RWKA 1QPEA 2PVMA 4UZDA 4ACDA 1KV1A 1Q8YA 4XP0A 3TNQB 4DEGA 3FLQA 5C03A 5CEQA 1W8CA 4LG4A 3DKFA 5HTCA 5IZFA 4W4XA 5KMJA 4LL5A 3I7CA 5E8ZA 2XK3A 1NXKA 2UVYA 3DXNA 1CSNA 3P0MA 4TYEA 4HYIA 4S2ZA 1OITA 4YJQA 3UP2A 4F1OA 3MVMA 2JDSA 3MH3A 4KB8A 1YXUA 3FWQA 3PWYA 4LOQA 4L43A 5LOHA 3NS9A 3PJ3A 2OF4A 4MVFA 4RT7A 4O6LA 4FNYA 4CMUA 5K4JA 2JD5A 3EH9A 4ZOGA 2R3IA 4ZY6A 1Q41A 4KA3A 3ZRMA 2XNNA 4IH8A 3PXFA 2XIZA 4DN5A 2PHKA 2J90A 2VZ6A 4IB3A 4RZVA 4U40A 4KBAA 3TZ9A 4BIDA 3FZPA 2GNFA 1GAGA 2OIBA 4GVJA 3P5KA 3WE8A 4DGLC 4FSYA 5AX3A 4RPVA 5TF9A 3OG7A 3P9JA 3KXXA 4RIWB 2QOHA 2XM8A 2ZAZA 1WBVA 4FV0A 3QQLA 4CFXA 2OKRA 3C4FA 3RK7A 3OCBA 5KCVA 4IZ5A 5EI6A 3PZHA 2ZMCA 4XG7A 3IPHA 5EM8A 4E4LA 4EH8A 2XZSA 3D5WA 3F5XA 3P86A 4F6UA 5JMSA 1OPKA 3EN9A 3KXHA 5EOLA 4J7BA 4YC6A 4FIHA 4UMTA 4LUDA 4RX5A 5IMEA 5LMKA 3EQRA 3CLYA 1UU7A 3SW4A 5CAOA 3H9FA 2YDKA 3E93A 5HNBA 3DT1A 4QPMA 5C26A 3QQKA 4LGDA 5FDPA 5GJGA 4LFIA 3G9LX 4OTRA 3JY0A 2RKUA 1QCFA 2G2FA 4F99A 3QTIA 4QP4A 5IEXA 3DBEA 4QMUA 2F7EE 4QNYA 5AV0A 2XNEA 4QO9A 3CEKA 3W16A 2ITXA 3HEGA 2HK5A 2PMLX 4PNIA 2OI4X 1YI4A 5CNNA 3PY1A 2W4KA 2ITZA 4YNEA 3PLSA 4QTAA 4WSYA 4QQJA 3JPVA 2IW6A 5TR6A 2RFDA 1WVYA 4Y5QA 2ACXA 1ZOHA 3D5VA 1W84A 2G2IA 2XCKA 3V01A 1NY3A 3LMGA 4YC3A 3AC1A 4FZ7A 3EKKA 3ALNA 3MS9A 4O0TA 4S32A 3PVGA 3E3BX 2BRMA 3FZTA 5I9YA 5LVOA 5EI8A 3OTVA 2B54A 4MXAA 2JBPA 2GHGA 5E1SA 5IA5A 1NVSA 3PPZA 4BI1A 4CFWA 2XJ0A 2YDJA 4FG9A 2EWAA 3LFFA 3R22A 1UWJA 3OBGA 4YSMA 5BUJA 5I9ZA 3ZC5A 4JVGA 5AV4A 4EOPA 5DG5A 4XS2A 4HVGA 4OTDA 4BTMA 4QP6A 2VTAA 4ALVA 4D4RA 1T45A 5EYKA 3PJCA 4KIPA 3W2OA 4F9YA 3TEIA 3R8MA 4D55A 4RJ7A 3F2NA 4M69B 4BCHA 4EZ7A 4ZTLA 3UVQA 4CT2A 5BMSA 5CF5A 3TWJA 4MD9E 1OUKA 4CFMA 4WG5A 3KULA 5HLNA 1YXXA 4TL0A 4YTHA 2GNJA 1TQMA 3EQIA 4PTCA 1BI8A 4I94A 4UMPA 3HV4A 4IAZA 4J99A 3CD3A 5M4FA 1RE8A 3PVBA 4KS8A 5LVMA 5C8NA 4OAUC 2VX0A 2CGVA 3OUNB 4D4YA 1XH8A 4RJ6A 5FEDA 1BL7A 3AOXA 4RVLA 4U43A 3HDNA 4ZTHA 3UG2A 5EG3A 3MPTA 3UPZA 3PZEA 4IX3A 3FXZA 3WZKA 3QD4A 1XJDA 4E4XA 3QAME 4IAIA 4KINA 1GIJA 3UOKA 1ZYDA 1ZOGA 2JDVA 3PE2A 5D1JA 5ANIA 4ZZOA 5HG8A 3GB2A 2A2AA 3IOPA 5BYYA 4QP7A 3C51A 2OICA 4GYIA 2RG5A 4RA4A 3V5TA 3TNHA 2Z7LA 2LGCA 2WMSA 4IVAA 4N6ZA 2YM8A 2BZKB 3FAAA 3FL4A 2XK7A 4BDJA 1U5QA 2OBJA 4FVRA 5IMXA 3UIXA 3MJ2A 4C4FA 4YJOA 4CQGA 1I09A 1JOWB 3E3PA 3VO3A 4BTFA 4BN1A 3KXGA 3PVUA 3R2YA 3UIMA 3VAPA 2WMRA 4ITHA 4YJTA 2R5TA 4HVDA 3NUYA 2IVTA 4KSPA 3FLZA 4K8AA 4FTAA 4D4SA 5EOBA 5JKGA 3VBYA 4I4EA 3DBFA 5AA9A 5KMNA 4BDEA 1BUHA 5J8IA 4IWPA 4CV9A 2GS2A 4UMUA 4KAOA 2I6LA 3QCSA 3MVLA 3NYVA 4KRDA 3MSSA 3WF9A 4ZIMA 4O0SA 4EUUA 4FKQA 2OFVA 2VWWA 2WAJA 2ITTA 5EW3A 2IVVA 2WMVA 1WBSA 4E4NA 1P4FA 2OK1A 2DQ7X 5CU6A 3T8OA 3LXNA 5DGZA 5M53A 2X7FA 5M51A 3IW7A 4FV4A 2R3FA 3BZ3A 2HENA 3GNIB 4C35A 4CT1A 2DWBA 3RKBA 4EH2A 3QWJA 4HYUA 3EOCA 2UW7A 5D11A 4OTGA 4B0GA 5KMOA 1H0VA 2ZMDA 3BV3A 4USFA 1ZZLA 2XRWA 1REJA 2V7AA 5CSHA 2C6IA 2YLFA 3ZEWA 2HXLA 3AC2A 4CKJA 3LXKA 4QP8A 4EOKA 2BFXA 4O22A 4QNAA 3BCEA 3IOKA 4MXYA 2GFCA 2WQBA 3PYYA 4EK5A 4MBIA 3W18A 5HO7A 3S00A 3FPMA 2AC5A 4PPBA 4ZTSA 2HYYA 2ZVAA 4NM3A 4ZSJA 3QUPA 2OXDA 1U5RA 4TWCA 4Z7GA 3K5UA 2F2CB 3BYVA 4J8NA 3ZONA 4F7SA 5H9BA 4YJUA 3MH1A 4QD6A 1V0OA 5CAPA 4PUZA 2C6MA 4J1RA 4TW9A 2CPKE 3ENMA 1OI9A 3LJ1A 2UZTA 3R9NA 4MBLA 2QKRA 1VZOA 3UZTA 2R3HA 1BL6A 4AZVA 3FMLA 4C2VA 4GUEA 1PMEA 3U87A 5L6PA 2Y6MA 1JKKA 3GCSA 2VTRA 3DNDA 4OBQA 2XKFA 3IW5A 3QL8A 5DH3A 5E92A 4M3QA 3R83A 4DFZE 2WMWA 3T9TA 3CIKA 3HRBA 3VJNA 3ZFYA 2PK9A 4IZ7A 2B53A 2F49A 3R8ZA 1HCLA 2PZPA 1OL5A 3KMWA 5JZJA 4PWNA 4YHTA 4BDBA 4CZUA 4I92A 3TIYA 4P2KA 3FSKA 2QQ7A 1H25A 2WNTA 4TKSA 3L8XA 3OOGA 4NM0A 4W4WA 4CTBA 3ORZA 4R3RA 3SLSA 4V05A 3CGOA 2UZDA 2CDZA 1J91A 4IM0A 2BRHA 2UW6A 4MYGA 1YDSE 4XG2A 5JRSA 4DH1A 2VWYA 4ACGA 3BIZA 2Y4PA 2C6TA 3IW8A 3OWPA 3R8LA 1M7QA 3QKKA 1EH4A 1LR4A 1Q8UA 3FZ1A 3LPBA 3MTFA 4FL3A 4K11A 1AGWA 4EKLA 4BKJA 1J1CA 1MUOA 4FV6A 1XH4A 5JGBA 2OJGA 4F9CA 5HO6A 4FT9A 2CCHA 4FYNA 4ITJA 3NW5A 3TCPA 5HU3A 2WTVA 1OPJA 3PXRA 2JKMA 3VBQA 3UJGA 4MCVA 2QOBA 3I1AA 4F7LA 3NYOA 3P7BA 1KOBA 1PXMA 3FHRA 3FI3A 4EC8A 3NDMA 4G2FA 4Z9LA 1Y57A 3DB6A 3QD0A 3DQXA 1JKSA 3QQGA 3F3UA 3HV3A 4QTBA 4WNPA 3C4EA 3FKNA 2C6EA 3OS3A 2W1CA 3KXMA 3BBWA 4PY1A 4D1ZA 2SRCA 3R6XA 3EMGA 4X3JA 4XX9A 4YO6A 3F3TA 4G6LA 1GY3A 4YTIA 5A4LA 2C6OA 4GFOA 5LWNA 3BHUA 3KVWA 4YPDA 3HYHA 5J1WA 4IFGA 4MXCA 4FKSA 3EN6A 2PZYA 4I5HA 3RHXA 3OWLA 4IX4A 5LQFA 4IADA 3E5AA 1FINA 5IA1A 5HNGA 1H8FA 5M4IA 5KUPA 4PL3A 2I0HA 3TV7A 3QYWA 4U45A 1DS5A 1NA7A 2W4JA 4AN2A 4XG9A 3QC9A 5CANA 1FVTA 2FSTX 1JVPP 2WMUA 3DLSA 2PMNX 5AIKA 4QMQA 3RNIA 2HY81 5FP5A 2WU7A 4RX9A 2F7ZE 4U6RA 4KD1A 5IU2A 1UU9A 3ZYAA 1YVJA 4PDOA 3HLLA 3R8UA 5EK7A 3I81A 3P7CA 4IIRA 3IECA 3ODYX 4FTUA 3KK8A 4XG3A 5EM5A 5FGKA 4JR7A 5HOAA 2QKWB 4B7TA 2XNOA 4KKHA 3PG1A 3TIZA 3H9RA 3F88A 3BLRA 3S3IA 4C58A 4FTMA 1FGIA 1IA8A 2H96A 2YACA 4J96A 4FT3A 3ANQA 3FQHA 4FT7A 5AUZA 1MRUA 4E5BA 5BMMA 4GMYA 4K9YA 2W4OA 5CYIA 5HCYA 2OG8A 2WTKC 4M8TA 4LOOA 2WTKB 4ZLYA 3HV5A 2WTIA 4HGTA 4JI9A 4W9XA 4Y95A 3F9NA 3WZJA 4EOJA 4YGAA 2WMTA 1WBNA 2J7TA 3C4ZA 2OXYA 2CGXA 4IJPA 5DT0A 4HPTE 5AJQA 4D2TA 2FUMA 4R5SA 4WOVA 2OH4A 4DGOA 4EH6A 4BI0A 5D7VA 4DG0E 4ZSLA 1XH9A 4I6HA 3O0GA 1F3MC 4A06A 1P2AA 3D7ZA 4C4GA 2ZYBA 1I44A 4M97A 1H4LA 3BEGA 4AE6A 3KGAA 3RK9A 4R5YA 3MGYA 2XK4A 3C0IA 3GFWA 2GDOA 2HZ0A 4HCTA 4CD0A 4W9WA 3U8WA 5IA0A 2BUJA 2W96B 4FMQA 5IDNA 4HVSA 5ANKA 2RFNA 2VAGA 3R02A 4BGGA 3SOCA 5ANJA 5AAFA 2CGUA 2G01A 3QFVA 5EDRA 4QPSA 4Y5HA 3RPRA 5BVDA 5AR5A 4GIHA 3LE6A 3KEXA 4ANMA 3HMMA 1RJBA 2P0CA 3D0EA 2XKDA 1UNGA 2XYNA 3FY2A 4LGGA 3FKLA 2C30A 4AA4A 3PWDA 5AV3A 4BKYA 3ACJA 2XIXA 3VS4A 4YO4A 3GC0A 4FTRA 5B2KA 4AP7A 3PSBA 4G3DA 3ORLA 2XH5A 4ONAA 4BCIA 3QZHA 4XV3A 3RP9A 3QRKA 4EH4A 3ZDIA 3O8PA 1ZY4A 3WI6A 2QONA 2UW8A 2WU6A 4FUXA 4NT4A 4L3LA 4L45A 2I0EA 4TYHB 4A9SA 4EOMA 3QRJA 5A9UA 4YP8A 4L44A 4U42A 4QTEA 3EYHA 5JQ8A 4WRGA 3KRLA 4OLIA 1PXPA 4ZAUA 4C3FA 5BVOA 4I6FA 4JAJA 4GV1A 4BBEA 2HY0A 2R0IA 1GIIA 3C50A 3PIXA 1HOWA 4AG8A 3A4OX 4R3PA 4ZS0A 2W9FB 3NIZA 4UY9A 4XLIA 5ETAA 3BWFA 3ZBFA 3VUMA 1PKGA 2GNHA 2LAVA 3OF0A 4BYIA 2OJ9A 2J0KA 3WARA 4MQ2A 5CTPA 4FR4A 2Y8OA 3LLTA 5FQDC 4FIGA 3U4WA 3VVHA 4MF0A 2XNMA 4NFNA 4M7IA 4CLJA 5L6OA 3JVRA 2QR8A 3NYXA 1PYEA 2JEDA 3EFWA 3KMUA 4KBCA 3VBTA 5DI1A 3LXLA 2PVNA 4FIEA 4NTTA 3VUDA 2AC3A 5AUUA 3L9PA 4HYSA 2G9XA 4YHFA 3GC7A 5DMZA 4IMYA 5DE2A 2J0LA 4I4FA 2UW5A 4V0GA 4RWLA 4MF1A 3CC6A 2QLQA 4ZZMA 1S9IA 2BAJA 4FSQA 5J1VA 5EYCA 2GHLA 3FZRA 5FWKK 5HTBA 3F66A 2WEVA 3FQEA 4ASXA 2BZHB 3G51A 3MVHA 4RX8A 5CU4A 5CNOA 4M67A 2O5KA 2WQNA 4FKIA 4KIKB 3DTCA 3UODA 4UWBA 1PF8A 3FI2A 4JX7A 4BB4A 5F94A 2UW0A 1IR3A 2H9VA 5F1ZA 2Y6OA 4QMOA 4CYJA 4WNMA 3MPMA 4ZTRA 5TT7A 2JIVA 4DAWA 2KTYA 4BDFA 1QMZA 4ERWA 5KBRA 3BGPA 4JQ7A 4TYIA 3V51A 3FBVA 3GBZA 4AFEA 5D41A 3KN6A 4ASDA 2G15A 3CGFA 4W8EA 2JC6A 4E5AX 5HO8A 2QO9A 4IC7A 4O0VA 5GJFA 4E4MA 4FEQA 4HZSA 3O8UA 5HE0A 3A4PA 3MN3A 3HKOA 4FUYA 1VYZA 3FXXA 3O23A 3RM6A 1WBTA 2J6MA 4HVIA 5CF4A 2X2LA 3R30A 4FKVA 3FLNC 3G0EA 1YOJA 3H3CA 3NUPA 4CZYB 4PMSA 3UVRA 3BHTA 5GHVA 4C4JA 4OTWA 3B2TA 1KWPA 2I0YA 3EIDA 2C0TA 3IDCA 2C3JA 3NNXA 3ORXA 5J7BA 2KULA 4TPTA 3T3UA 4JXFA 4O21A 3R7YA 4AA0A 4L46A 1H28A 5AM7A 3TV6A 1Q8WA 4C3PA 4XBUA 1XH7A 2C6LA 1GZKA 3FMJA 1BI7A 4RGJA 4DEDA 3QTXA 5KHWA 4FL1A 4L42A 5BUIA 2YJRA 4C8BA 4F63A 1S9JA 4C4IA 3OD6X 4MQ1A 4GT5A 2QURA 2R64A 3W55A 2BFYA 5JSMA 4P7EA 2CHLA 4Q9ZA 3RINA 3NNVA 3V5JA 4GT4A 4I22A 4BKZA 3BRBA 5IH5A 4FZFB 4D1SA 2QD9A 5C8KA 2GTNA 3M1SA 1CMKE 4M13A 3TT0A 5LARA 3KA0A 3OY1A 4LRKA 4S30A 5AAEA 4EQUA 2ITPA 3FI4A 3VNTA 1U4DA 2X9FA 4O27B 4G3FA 4E26A 1JPAA 3QCQA 3U6IA 4AZSA 1WCCA 5CEOA 4YJPA 3A7JA 3EZVA 4PPCA 4EH5A 3NAXA 3R7VA 4FTJA 3ZFXA 3F61A 4PPAA 2CJMA 3QU0A 3V04A 2ITYA 3QTWA 2PWLA 4OTIA 3P4KA 1LUFA 1G5SA 3FSFA 2QU5A 2BZIB 5DRDA 3ZLYA 3BE9A 3TG1A 1OB3A 4RIOA 4RLKA 3ZSGA 5FM2A 3QX4A 4JG8A 5BYZA 2FO0A 3NNWA 4BIBA 1ZYSA 3EJ1A 1OGUA 3H30A 3W33A 4ARKA 3I7BA 2HAKA 2WB8A 5I9WA 3GQIA 4AS0A 5AP0A 4Z55A 4ZTMA 3DFCB 4Y83A 3GXLA 4KBKA 2RG6A 1OL6A 1ZZ2A 5E8TA 1WZYA 3W2RA 4AXAA 3OC1A 1SMHA 4G6NA 4A9UA 2QHNA 4PMTA 3TN8A 5CQWA 4L3PA 4ZXTA 4RFMA 1F5QA 4UEUA 3UC4A 4BFMA 5KMLA 4NM5A 1UA2A 3ORKA 4DTKA 4BDCA 3AD4A 3F3VA 3R00A 2XIYA 4DFXE 4K33A 2UW4A 2JFLA 3BYSA 4RIXB 5C1QB 3DPKA 3O51A 1KE8A 5L8KA 1UKIA 3D94A 3C4WA 5HG7A 3DAKA 2X9EA 4R1YA 3R7UA 2YIXA 4KS7A 1V1KA 1ZARA 4QOXA 2XK8A 1SNUA 4CEGA 3OXIA 1YXVA 4FV3A 3CCNA 1ATPE 2I40A 5DEYA 2J5EA 2BMCA 2Z7RA 3I6WA 3OMVA 5HCXA 4F0GA 5I0BA 5I9VA 2IZSA 4LOPA 1B6CB 4XMOA 4JQEA 3FMDA 5AIRA 2W1DA 2UZVA 2QCSA 2UW9A 2VTPA 1ZAOA 4X0MA 2WOTA 2VTOA 4O0XA 4JNWA 1O6YA 1R0EA 3KU2A 2WIHA 2VU3A 3GT8A 2GSFA 3I0OA 4ZJJA 5T3QA 4Z3VA 3QD3A 3A7GA 1DM2A 2FH9A 4FOCA 2R7IA 2WTWA 3TV4A 3W10A 4N0SA 3V8SA 4RVMA 3NEWA 2UZUE 5FXSA 1MRVA 2Y4IB 4WUNA 5IA4A 3FMMA 3RCDA 5D9HA 1AQ1A 4OBOA 1SZMA 3DBCA 3QYZA 2C6KA 2WXVA 4IC8A 2YN8A 4E8AA 4YSJA 4AT5A 4CTCA 1KV2A 5CENA 3V5PA 5AEPA 4L7SA 2UVZA 3OEFX 3B8QA 2Z60A 3VHEA 5A4TA 5CU2A 3RGFA 1FVRA 2RIOA 1YW2A 4LV8A 3CS9A 4FZAB 4BHNA 3QKMA 4D2SA 3PA4A 5AR4A 3ERKA 3GGFA 3PRIA 3SXSA 2X4ZA 2ETRA 4EOLA 2O65A 4EYMA 2B9IA 5CU0A 4E93A 5M55A 5EW9A 4LMNA 4ASZA 4UMQA 3IW6A 2E9UA 3E7OA 2XIRA 4JIAA 5JFVA 1MRYA 4G6OA 4RZWA 5AM6A 3QUEA 3G5DA 2BR1A 2YERA 2B9HA 4IX5A 4GK4A 1MP8A 4I0SA 4WSQA 4NCTA 2XUUA 3AD5A 4H39A 3EKNA 4IFCA 2YHVA 3LCTA 4LI5A 4DINA 4F09A 3EQFA 3FLSA 4C57A 3NUUA 2ZM4A 1W7HA 3LFEA 4BCQA 5I9UA 5C8MA 1AD5A 3V5WA 4AW2A 4X3FA 4O96A 4F6WA 2BDJA 4EZ5A 5J5TA 3VS1A 3AXWA 4QQCA 4TWOA 4FSUA 4II5A 5EYDA 2VTQA 4C59A 3HRCA 4BCPA 2BDFA 1M14A 2ITWA 4IAFA 4RC4A 1NVQA 4TY1A 4X2JA 3TACA 2YCRA 3GCUA 5CS6A 1P4OA 4U3YA 3AQVA 1TVOA 4K6ZA 2EUFB 3BELA 4H1MA 3R04A 4XJ0A 4WIHA 3DY7A 3WE4A 3PUPA 2VTSA 3JVSA 4NZWB 1OKYA 3OHTA 3CQEA 4PL5A 4G31A 3RMFA 4CSVA 4U3ZA 4GG7A 1OIYA 4QP3A 5IUHA 4BZOA 3C1XA 3ZXTA 2ERZE 3F69A 3POOA 3GU5A 1B38A 3QTQA 5DT3A 3A99A 3LCDA 5JFXA 4UX9A 4IAAA 1W83A 3VS7A 4Z16A 3AD6A 2XEYA 5EYMA 2AUHA 3BQRA 3W32A 4HPUE 4ZY5A 4AUAA 2NRUA 3U6HA 5E8XA 2BZJA 3ZSIA 3ZLSA 2ITOA 5A4CA 1BKXA 2ZV7A 3EQHA 3MB7A 4MEDA 4FI1A 2XCHA 3GCVA 2HIWA 4UXLA 4QMNA 5A4QA 5I5ZA 4JS8A 4EK6A 4ZLZA 4EL9A 3NSZA 1ZWSA 2ONLC 5J7HA 3ALOA 2ITNA 4WBBB 2X8EA 3DJ5A 1STCE 4V04A 2PZIA 3HA8A 4RWJA 3ET7A 2OGVA 3P78A 2W17A 5ANGA 4JAIA 4FTNA 5E1EA 4L3JA 3KQ7A 4JDHA 3GU6A 2X4FA 3OWJA 3CTQA 2X1NA 1H1RA 2NP8A 5HBHA 3PG3A 2VTLA 4BF2A 3EYGA 1RQQA 4P90A 4TXCA 3UO5A 4C02A 4PX6A 4AGDA 3F3WA 3OWKA 1Q97A 2QOQA 3A8WA 3VIDA 3PVWA 3P79A 3Q9YA 4QMZA 3EWHA 2NPQA 4QYFA 4XHKB 5DPVA 4DCEA 4LRMA 4Q2AA 2W1FA 1VJYA 4IW0A 1Q24A 2C5VA 4U41A 3WYXA 3C9WA 3DTWA 2W1ZA 2WTJA 3Q04A 4ANSA 4F08A 3DGKA 3EQDA 3SVVA 2VTNA 2G1TA 5J9ZA 4DGMA 2ITVA 2R3JA 3S4QA 5H8GA 3AMAA 3RALA 4IZYA 2WIPA 3DK6A 5T68A 5D7AA 1HCKA 2X0GA 3KRRA 3UYTA 4EOIA 5A4EA 5HIEA 4G5PA 1ZYLA 2PUUA 5H8EA 4JLCA 3QXOA 4QTDA 5L8JA 3HZTA 2W05A 4DH7A 5FBOA 2YZAA 3CJFA 4OTPA 1Q62A 4AU8A 1SNXA 3GU8A 3VF9A 2BIYA 4BYJA 3BBTB 3BYOA 4NIFA 2I1MA 3ORIA 4BHZA 3AMBA 1M2RA 3MBLA 2R3RA 4PF4A 3WBLA 3UO4A 3MVJA 4EK3A 2YLEA 4L01A 1M17A 4D2WA 3HP5A 4NSTA 2C1BA 4IM3A 3VBXA 4B9DA 4IVCA 4XG6A 3HRFA 4A9TA 4RVTA 2YIQA 3L8PA 4PRJA 3LM5A 3ZO2A 2CCIA 2ZDUA 3MB6A 3IW4A 5B0XA 4ANNA 2P33A 3UPXA 2WQEA 2VN9A 3AT4A 5CLPA 5LMBA 1UNLA 5DT4A 3O50A 3FXWA 2BALA 3CR0A 2B9JA 1TQIA 4UV0A 4AT3A 3SV0A 4D0XA 4D9TA 3QHWA 1H1PA 2RL5A 2YWPA 3I0QA 2CLQA 3A8XA 4K18A 2PVHA 2A0CX 2WQOA 5A6OA 4X6QC 5JRQA 4AE9A 3SD0A 1J3HA 4D0WA 3BGQA 2GS7A 2YFXA 1APME 3H9OA 3R2BA 3B2WA 5AUYA 2ZV9A 4UWCA 4NJ3A 1KSWA 5GZ9A 5CT7A 4FF8A 3S95A 2BPMA 2ITQA 4PNKA 3DJ7A 4M84A 3UNKA 2R4BA 3RJCA 3E62A 3AC8A 1T46A 2VTHA 4QMPA 5AMNA 3SHEA 3OOMA 3KCFA 1JNKA 3L8VA 5EH0A 2XA4A 2W06A 4OAVB 1TKIA 3REPA 4GRBA 5GZAA 3QALE 1CKPA 4EYJA 5L2SA 1WBPA 4FIJA 3D2KA 4QYGA 5JGDA 1XO2B 4UYNA 3LFDA 3BEAA 5CXHA 1SVGA 2YM6A 2J0MB 4X3FB 3TJCA 2QOFA 4I20A 3Q32A 3ZO4A 2QI8A 2GPHA 3LFCA 4KIKA 4ZY4A 3UTOA 3EL8A 4WG4A 4FNXA 1R3CA 2YM4A 3OZ6A 4HCVA 5L2TA 3LJ0A 3E63A 3ZU7A 2GU8A 2PVKA 5K4IA 2BTSA 2WD1A 3VW6A 4FV8A 1PXNA 4X2FA 4JT3A 2GNLA 2PE1A 4FL2A 3S2PA 4BTKA 3IGOA 5HU9A 4P5ZA 1SYKA 4NU1A 3W2QA 2PVYA 4IHPA 4AGWA 3D15A 3DBDA 3GCPA 3BHHA 4QP2A 3VF8A 4ANLA 4LQMA 2PMIA 1GNGA 4F7NA 1UVRA 1V0BA 2EU9A 3HL7A 1KE7A 2BIKB 2E2BA 1WVWA 2OZAB 3LJ2A 3MFSA 4N6YA 4NTSA 3QRUA 3SKCA 1QPJA 5I4NA 3DBQA 2F9GA 1UU3A 5KZIA 4RJ5A 3R8PA 4WNKA 3R9HA 3UYSA 3VJOA 3CP9A 4CRLA 3WIKA 3KB7A 1Y6AA 4ANQA 4FA2A 5IG1A 4FC0A 2HZNA 4XLVA 4IB1A 5HI2A 3NUXA 4RQKA 4RA5A 4RG0A 4IVBA 3COHA 4J52A 4EH3A 5L2IA 3ORTA 3WZEA 4FV5A 3FC2A 4BRXA 4PV0A 3ZC6A 3KC3A 3UNJA 1YI6A 3OFMA 4QQTA 3T3VA 1FGKA 3O7LD 4FV2A 3P7AA 2XK9A 2OJJA 4BBMA 3ELJA 4HCUA 5EM6A 4QMXA 1P5EA 1UWHA 4QMTA 3SOAA 3SXRA 3U9CA 2QOLA 2VO0A 4R8QA 4WO5A 3W8QA 1J1BA 3D4QA 4R7IA 3VS0A 4RJ3A 2WMBA 4YR8A 3G6HA 4YZ9A 1M52A 2XB7A 4ASEA 1H1WA 4I1ZA 1XBAA 3NR9A 4WBOA 3IQ7A 1OZ1A 5T6KA 4DEHA 1B39A 4O6EA 2VRXA 4XG4A 3G33A 5TOZA 3FE3A 5ANEA 4JBPA 3JXWA 2P2IA 4U5JA 4CV8A 4G17A 3VS3A 3QZGA 2B55A 3QTUA 4MNEA 3E92A 1XQZA 2HW6A 5D12A 5HIDA 3ZZEA 4C34A 2R3NA 3EB0A 3MA3A 4IEBA 4RBLA 4B99A 3ZEPA 4DEEA 5JFSA 3ZUTA 2E9OA 1RW8A 4F0FA 2UZLA 3MH0A 4TYHA 3GI3A 2VX3A 3NW6A 1GZNA 2OXXA 2XM9A 5DVRA 4YTFA 5JH6A 2RSVA 3QTZA 5ACKA 4YURA 2VO7A 3RWPA 2H8HA 4RFYA 4LGHA 4MXOA 2X8DA 3ZMMA 1URCA 2C68A 5HCZA 3A7FA 3FLYA 2ZM1A 3UG1A 3MY0A 4DGGA 3ORMA 4CNHA 4FNWA 4CYIA 3K2LA 3OXZA 3C4XA 4FTIA 3R9OA 1OVEA 1CDKA 4I5CA 3IONA 3PP0A 3HDMA 2Y0AA 4EQMA 2ZV8A 5AV1A 5KO1A 3FUPA 3OTUA 3FZOA 2X7OA 3KXZA 5M4UA 3ORPA 5J5SA 4XP3A 4EI4A 4D28A 2E9VA 2UZEA 3HX4A 3VUIA 4AA5A 4EK8A 4I6QA 3R8VA 2J9MA 3E8CA 2YCFA 2QO7A 2QU6A 2ONLA 3G2FA 3LCKA 1R39A 4G1WA 4MHAA 2OWBA 4PP9A 3CY2A 4TWPA 4X21A 3SW7A 2BAKA 5LVNA 2IW9A 4Y72A 1ZLTA 2PZRA 3SRVA 4Y8DA 4FBXA 4BVUA 1U54B 1W0XC 4QYYA 5ETIA 4IXPA 1WBWA 2R3LA 3IO7A 4M0ZA 4OT6A 3V3VA 3V8WA 2XEZA 4N4SA 4CVAA 1H1QA 4GU6A 3CQWA 3LOKA 5JN2A 4YJRA 2C4GA 5FXRA 1U46A 2PMOX 3Q2MA 4XH6A 1JSTA 2IN6A 2B7AA 4JX3A 4WHZA 4HGSA 2OJIA 2JKOA 4LYNA 4QRCA 5AV2A 2OF2A 4H36A 2UV2A 2X6EA 4BCGA 4E73A 3VS5A 4O0RA 4AW1A 3DKOA 3G9NA 4S33A 4B8MA 4BDGA 2REIA 5GNKA 2RGPA 3QRIA 3K3IA 3M2WA 5AADA 1OMWA 1NVRA 3QA8A 3F6XA 3FKOA 5IPJA 3Q5IA 2R3PA 1FMOE 2WMXA 4DEIA 4I0TA 3OW3A 2W1EA 5C27A 4S34A 1URWA 2C5YA 4AACA 3IS5A 3R63A 4FSRA 4BI2A 5EKNA 3A7HA 1A06A 1LEZA 2EB2A 3LFSA 4H1JA 3Q4ZA 5CZHA 2WTCA 3NAYA 2WMQA 4EJNA 3THBA 4C62A 3E7VA 5JGAA 3VQHA 3ANRA 1DI9A 3I60A 4AN9A 5KKRC 4U80A 4BZNA 4CXAA 4C61A 4ANBA 2XRUA 5CVHA 1YHVA 2IWIA 4F4PA 4XOZA 4S31A 5C9CA 4B4LA 2J2IB 3QLFA 3HNGA 3DLZA 2XMYA 5CALA 3ZCLA 2O3PA 3MFUA 3OXTA 4IZAA 4MKCA 2FSMX 5AR2A 3KF7A 3VBVA 4JBVA 2C5NA 3ORNA 1XR1A 4IX6A 4OBPA 3D9VA 4L9IA 5D10A 4UYAA 1OM1A 3VW8A 5JFWA 3EFLA 4IANA 5HVKA 3K54A 4U9AA 3LCSA 3QGWA 4XRJA 5DRBA 3RAKA 2YITA 4FTOA 5K3YA 3BHVA 1UV5A 4TYGA 3RM7A 4PL4A 3GFEA 3BKBA 2O64A 1H1SA 2UZBA 4FVQA 5FTOA 4C4EA 1M2QA 5HE1A 4JOAA 3V6SA 4BCJA 3Q6UA 5JK3A 3C13A 4QMYA 4NKAA 2ERKA 3UC3A 2YAAA 3ZO3A 3CQUA 4M66A 1E1VA 3AC5A 1GZOA 4G16A 5BUEA 4AQCA 5J79A 4NUSA 3JUHA 4DG3E 1Q61A 2J50A 5CEMA 3PXZA 4GIIA 5E8YA 3VHKA 3HMNA 3ZRLA 3PXKA 4YLKA 4C3RA 2ZB0A 4JG7A 3Q4TA 5IA2A 4WT6A 1R0PA 2HOGA 4USEA 2FGIA 4FZ6A 4O38A 2XIKA 2C0OA 4J71A 1E9HA 2VWUA 4FSTA 3F5UA 3V8TA 5G1XA 4HNIA 4F70A 1Q3DA 2BKZA 4XNEA 3R7EA 5FBNC 4DEAA 5AP4A 2BRGA 4QMVA 2ESMA 2OO8X 4NM7A 2O8YA 3CY3A 4HW7A 1XHAA 3NW7A 4QP9A 4TT7A 4X2KA 3TTIA 5BVKA 4XP2A 4GEOA 1QPCA 4I21A 3EN4A 2VWIA 3DCVA 3UBDA 4GK3A 3Q3BA 2E9NA 1OIQA 2ITUA 4G9RA 4GL9A 5E8SA 2GTMA 1OPLA 1FOTA 4F7JA 5DR6A 3N51A 1YDRE 2BHHA 2BVAA 4Y46A 3QRTA 5BVNA 4FT5A 3UQCA 3HP2A 3DJ6A 3ZRKA 4ZTNA 2R7BA 3VQUA 4HJOA 4ID7A 4XUFA 1KE9A 4CKIA 1ZMWA 2P2HA 3SA0A 2JFMA 2PY3A 5JEBA 2A1AB 3EQBA 4L6QA 4X2GA 4FTTA 4IWQA 3UVPA 1Z9XA 3QCXA 1KE5A 2UUEA 4U7ZA 1K2PA 5AP5A 4EZ3A 3TUCA 2YJSA 2FSLX 5F20A 2VNWA 2X81A 3PY3A 1PY5A 3QA0A 3F5GA 1F0QA 2GMXA 3FYKX 4L67A 3U51A 2X7GA 4F64A 4FIIA 5TE0A 4C33A 2DYLA 5ANDA 4UN0C 1UKHA 4W4VA 3LFNA 4LL0A 4YBJA 2A4LA 5E8UA 3GC9A 3W1FA 4A07A 5CF8A 4AFJA 1OKZA 2QR7A 2V22A 3MV5A 3OCGA 4EC9A 4F0IA 2VUWA 3R28A 3DZOA 4AZEA 2B4SB 4RSSA 5J95A 2YM3A 3EFKA 2C3KA 2C3LA 4GT3A 5HVYA 2VTIA 3FQSA 3PA5A 3U4UA 3VUKA 2PTKA 4CZTA 5KE0A 5HZNA 4LV5A 2VTJA 2YDIA 5AP7A 1O6LA 3RNYA 4RC3A 5G6VA 3EQPA 5HORA 4GJ2A 2Z2WA 2F7XE 4O1OA 2A27A 4JL9A 2XBJA 5HVJA 4A9RA 1XH6A 2W9ZB 2P3GX 3TKIA 4NH1A 4YMJA 5LCKA 3Q4UA 3WF5A 5HNIX 5HLPA 2CLXA 1L3RE 5H2UA 4XYFA 2R3QA 4EHEA 3NCGA 3CKWA 2WZJA 4K1BA 3W2PA 2JAMA 5EDQA 1CKJA 3L9LA 3R0TA 3A2CA 3JY9A 4D2PA 3CXWA 3II5A 1OIRA 1LP4A 3ZXZA 4MD8E 5DR2A 5A54A 2XJ2A 5HKMA 4CCBA 1M2PA 1GOLA 5CVGA 3RBWA 4PTGA 2UZWE 4XV2A 3KRJA 2GNIA 1YXSA 4FSNA 4HZRA 1UU8A 4AOJA 4BCKA 2JIIA 2VO6A 2R2PA 3GVUA 4E6CA 5E8WA 3Q96A 2FSOX 2Y7JA 4EBWA 4KSQA 2IJMA 3M42A 3ZBXA 5I9XA 5A46A 4GK2A 2RFEA 2J51A 3QWKA 2XKEA 3UE4A 4YZNA 2QODA 4PTEA 4BGQA 4DLIA 4LRJA 4DH5A 1O6KA 1XBBA 5HGIA 1H27A 2QLUA 2VO3A 4O91A 1Q5KA 5DIAA 4MTAA 3RTPA 3KVXA 4H3PA 3CTJA 4BDHA 5ACBC 2VD5A 3TXOA 4AX8A 1WBOA 1TQPA 3OY3A 5CQUA 5AUWA 3DB8A 2JDTA 4WNOA 4MXZA 5CSXA 3DFAA 2W99B 3UOHA 4A7CA 4EK4A 1YOMA 4RQVA 2C6DA 4USDA 3WZUA 3PSDA 4KKGA 5HE2A 4I5PA 3D5UA 4N70A 5L6WL 5KMMA 1YXTA 3E8NA 2HWOA 4KABA 2XK6A 4YZMA 3U9NA 5DN3A 4L53A 3GENA 5FTQA 2GCDA 3EQGA 2AYPA 3PTGA 5JZNA 5BQ0A 3MW1A 3O96A 5GZ8A 5TKDA 4CFNA 4JQ8A 5KZ0A 4ERKA 4MD7E 4DLJA 4R6VA 5AR8A 3QQJA 5AUXA 4KIQA 4Y85A 2PE0A 4GFMA 4U8ZA 4G3CA 4ZJVA 4Z7HA 4AAAA 4ALUA 4CFUA 3TZ8A 4TRLA 4CFVA 5DOSA 3WF8A 2W1GA 3P23A 3ROCA 4D2RA 2BILB 3FYJX 1DAYA 3PE1A 4TWNA 3HUBA 5HD4A 3DS6A 2P55A 1FVVA 3LCOA 5CEIA 3VUHA 4CFFA 1KE6A 4HNFA 4NW6A 1YKRA 1JKTA 3WIGA 3QXPA 1ERKA 1V0PA 5J9LA 3GU7A 5AP3A 3MPAA 4C7TA 3AG9A 4ACCA 4UZHA 5HBJA 4AZWA 4J97A 5J9YA 2JDRA 3BPRA 3KK9A 3TZMA 3QKLA 1JAMA 1YWRA 2JKQA 4ZK5A 4EOQA 4WRSA 4EH9A 3LZBA 5I3OA 5JQ5A 4XRLA 4AGCA 4GYGA 2OW3A 4OGRA 5EHLA 2QOOA 3A7IA 4IB5A 4PQNA 2XNGA 4OTQA 4QYHA 3Q53A 3TZ7A 3O71A 1ZOEA 3FMEA 4CCUA 3WF7A 1SM2A 4NW5A 2IVUA 3R9DA 4GH2A 5EFQA 2YISA 4OT5A 4WKQA 1ZRZA 5AX9A 1PXLA 3O7LB 3ZLWA 4ITIA 5J87A 3IK3A 4JR3A 3NYNA 4AWIA 5LMKC 3G0FA 3UDBA 4FKOA 1BLXA 5IEVA 4OW8A 3LXPA 3C0HA 1OL2A 3DA6A 3KRXA 3N9XA 2QOCA 2G2HA 3BU6A 3QCYA 3QTRA 3NUNA 4BDAA 4ZLOA 3MY5A 4MNEB 2GHMA 4FZDB 4TYJA 5F95A 2R3OA 4XV1A 5H3QA 5IUGA 1UNHA 3CTHA 4A4LA 5LVPA 5DWRA 4C4HA 4FTCA 2QHMA 3GU4A 3FMNA 3QC4A 1OUYA 5KKRB 3D2IA 3U6JA 2VV9A 4IE9A 2HZIA 3UO6A 4GS6A 5CASA 4UXQA 3ACKA 3BLHA 2QNJA 3R21A 3SDJA 4W8DA 4NCTC 4XEYA 3WZDA 3EFJA 3NGAA 1ZYCA 3EZRA 2W5AA 2YIRA 3KF4A 4OR5A 5AP2A 3KN5A 1W82A 3QQFA 2HWPA 3MFTA 3HV7A 4EORA 4GUBA 4XCUA 1ZMUA 4G3EA 3I4BA 5B2MA 4KIOA 2DS1A 2F57A 4FX3A 2WTDA 1DAWA 1XKKA 3CD8A 4R7HA 5DA3A 2JKKA 3AC3A 3I5ZA 1JSUA 1Q8ZA 4EUTA 3Q9XA 2EB3A 3Q9ZA 5FEQA 1CTPE 4XBRA 2V5QA 2WHBA 4PDSA 3NCZA 3FMHA 4MWHA 2X8IA 4EONA 3AT2A 5KHXA 4AF3A 4K77A 2OIQA 3ZDUA 5I3RA 3LM0A 1WFCA 2PL0A 2QO2A 5L2QA 2W1IA 3GQLA 2EXEA 3ZSHA 1YHSA 2ZJWA 3QD2B 4FTKA 2VGOA 5L4QA 4G34A 4E3CA 2O0UA 1GJOA 1JWHA 3P08A 5K5NA 5M4CA 2J0JA 4IQ6A 1H07A 3TNWA 4JG6A 1Z57A 1YI3A 3NWWA 2CGWA 4EHZA 4ALWA 2C5OA 5EHOA 1ZMVA 3MFRA 4V01A 5LXMA 4MWIA 4FV1A 4QMWA 4ACHA 3FY0A 2VTTA 3BLQA 3VUGA 4FNZA 3DOGA 4BCMA 1H26A 3E8EA 3IGGA 4DITA 3QHRA 1KOAA 1M7NA 2BTRA 2HXQA 3V6RA 3HVCA 4RWIA 3FJQE 3R1NA 3VUTA 3BV2A 3DU8A 3ROYA 5BX0A 1PXJA 2GS6A 3FL5A 2BAQA 4J53A 1BYGA 2R3GA 3Q60A 5HQ0A 3VS2A 4QT1A 2YCSA 5B2LA 5LWMA 5DFPA 3RHKA 1W98A 3L9MA 4APPA 1QL6A 2VTMA 4IACA 4J98A 3W8LA 5DNRA 2EVAA 1IEPA 2V62A 3SAYA 3UZPA 4G3GA 3BYUA 3R1QA 5L2WA 1PJKA 3G6GA 4MX9A 5K5XA 3KULB 5HX8A 4YC8A 4D4VA 2YABA 4L8MA 2YAKA 2C5XA 4R3CA 4IDTA 4FV9A 5E8VA 2QG5A 3QQUA 2RFSA 3VS6A 2WEIA 4E6DA 5JT2A 4JDIA 3VC4A 3R1SA 4YPSA 3RI1A 3IDPA 1PYXA 3C5UA 5AR3A 3R1YA 3GEQA 4EKKA 2OFUA 3EQCA 3HMPA 5KNJA 3HMOA 5HG5A 4P5QA 3QLGA 2R3KA 1R78A 1H08A 3G90X 3OBJA 4D9UA 4F6SA 4P4CA 2BHEA 3OCSA 4FOBA 2J0IA 1ZXEA 3QUDA 4IAYA 4BZDA 5KMIA 3HMIA 3PJ1A 5HLWA 3D7TA 3COKA 2VWBA 4F9WA 4Q5EA 4ZSAA 3D5XA 3LQ5A 3QBNA 3FC1X 4AT4A 5DEWA 2X39A 5DBXA 5KX8A 2Y9QA 4U97A 3FMKA 1Q4LA 4GG5A 3EHAA 1CM8A 3K3JA 1WAKA 3MDYA 4M14A 4MK0A 4A9YA 4RRVA 2IVSA 2JAVA 3MH2A 3UP7A 1CKIA 4FG7A 1Y8YA 2GFSA 3CPCA 4YJNA 4D5KA 2WO6A 3ZZWA 4YBKA 4YZDA 4JBQA 5ANOA 3TKUA 2ETKA 4EWQA 4G5JA 3E64A 5ITAA 1LEWA 3MI9A 3ZLXA 4ACMA 5FD2A 4DBNA 2CMWA 4ZP5A 4FIFA 1IRKA 4GU9A 3TNIA 1PW2A 1H00A 5ETCA 3MIYA 1OKWA 1XH5A 4NJDA 2BRNA 2J5FA 3NUSA 3QZFA 4K0YA 3RWQA 5A6NA 3DKCA 4PMPA 3UNZA 4B8LA 2HW7A 2GQGA 4TNDA 5FG8A 3C0GA 4X2NA 3RZBA 5K9IA 3PPKA 3PIYA 3WF6A 3OVVA 3C4CA 3QTSA 2X2MA 4I0RA 4RJ4A 1FQ1B 4JBOA 5CY3A 2WMAA 5AR7A 2A19B 2JLDA 3MWUA 3OEZA 3Q4CA 4BWXA 3FLWA 3TKHA 2UW3A 2V55A 3PA3A 3R01A 4X7QA 3R7OA 3RPSA 4E6QA 5CEPA 5IA3A 5FLFA 3KFAA 4X3FC 5IKWA 1Y91A 3ODZX 1PXOA 3KMMA 4FICA 2V7OA 3QZIA 3L1SA 3O8TA 1OKVA 4IDVA 4H3QA 3TJDA 3KY2A 4FGBA 4D5HA 3F82A 3AGMA 4QPAA 1DI8A 4HGEA 3QGYA 4DFLA 5E91A 5F9EA 1Q8TA 3IG7A 3GC8A 4FSMA 5TO8A 5CAVA 4O2PA 2BDWA 5BVEA 4F1MA 4JJRA 2C47A 3SXFA 3UMWA 4RVKA 5IISA 3QQHA 5F4NA 1YHWA 4CQEA 4PP7A 4NWMA 2B52A 1U54A 5CI6A 5CSWA 2VWVA 3ZO1A 4GW8A 2UZOA 5ETFA 1K9AA 3Q6WA 4JDKA 4FTQA 3LFAA 4L00A 4UMRA 4Y73A 2CSNA 4NIFB 4X6RA 4NFMA 3ZFMA 2UVXA 3RAIA 4BC6A 5BNJA 5M57A 2WELA 2B1PA 3RPVA 4E7WA 3MA6A 2ZDTA 3DAJA 3RAWA 5HHWA 1FPUA 4DH8A 2PVJA 1OL1A 4QMSA 3MY1A 4YLLA 4BCFA 3MIAA 2V0DA 4YNOA 4KRCA 3T9IA 4LMUA 1JBPE 4O0UA 3VULA 4E20A 4FKWA 3ULZA 3VN9A 3F7WA 1QPDA 3ZS5A 5CF6A 2CKEA 4ZEGA 3TTJA 4RIYB 1YQJA 2QOKA 4M68A 1GIHA 4DEBA 3JS2A 4EHVA 2CN8A 4M69A 3ETAA 4GVAA 4OUCA 3E87A 3FDNA 4V0GB 2W5HA 5CWZA 2ZM3A 1U59A 3AMYA 1Y6BA 4M15A 2PE2A 4MXXA 3E88A 2FVDA 3R71A 3VBWA 4UALA 2BRBA 5LVLA 3RVGA 3WOWA 5FEEA 4BCOA 3BQCA 2IZRA 4EH7A 4F1TA 3NX8A 1XBCA 4YTCA 3MJ1A 2OJFE 4MNFA 3COIA 4QYEA 3UQGA 4U79A 1YWVA 4O0YA 1YDTE 3I6UA 2NRYA 4I6BA 5HBEA 3L9NA 3EL7A 2ETMA 3RPOA 4AZFA 4JRNA 4GFGA 3P1AA 3ZTXA 3K5VA 4J95A 5AP1A 1H24A 4FKTA 1K3AA 5IF1A 3KXNA 4EEVA 4AW5A 3BGZA 3M11A 4PMMA 5AAGA 1WVXA 3ZOSA 1PMVA 4C38A 5DHJA 4RMZA 3BU5A 3CE3A 4ZSGA 5E7RA 2E9PA 4FVPA 4AOTA 5IH6A 4MBJA 4DFYA 4F9AA 4C37A 1PMUA 3E8DA 2UZNA 4IBMA 4U81A 5CU3A 4BIEA 2XVDA 3HUCA 4WD5A 3H0ZA 4DHFA 3PSCA 3LW0A 1RDQE 3NRMA 3HECA 5EW8A 1SVHA 2ZV2A 2C3IB 2QOIA 4BDKA 3F7ZA 2C1AA 2JITA 3OW4A 4QTCA 4DC2A 4DGNA 2WKMA 4LM5A 2RF9A 3BWJA 2WGJA 3Q9WA 3R73A 3PFQA 2OZOA 2WFYA 3EN5A 3HGKA 3RAHA 4CRSA 3GUBA 4F9BA 4XG8A 2Q0NA 4J8MA 3LQ8A 3A62A 4CKRA 3AT3A 4D1XA 1G3NA 4QQ5A 2YIWA 3KRWA 4WUAA 4Q9SA 2B9FA 4DG2E 5AA8A 1JSVA 4M0YA 5EKOA 2OH0E 3H0YA 2F4JA 2OZAA 3D83A 3A60A 4IWDA 4I5MA 5HE3A 1OIUA 2OIDA 2Q0BA 3NNUA 4AZTA 3ZH8A 4F65A 3F2AA 4JIKA 2PSQA 2BROA 5DR9A 3W2CA 5CEKA 4U44A 2W1HA 4OTFA 1ZY5A 4BICA 1MQBA 3DDPA 4YHJA 3AGLA 4NKSA 2PVLA 4FKUA 5A14A 5HIBA 2XNBA 3A61A 4FODA 4L7FA 3DAEA 3HA6A 1Y8GA 5LJJA 4YLJA 4E5WA 2JBOA 4IAKA 2R9SA 4BWKA 4BCNA 3IKAA 2H6DA 4ZTQA 4LUEA 3WYYA 3CPBA 3BX5A 5A3XA 3RK5A 5M44A 4HGLA 3BI6A 4EBVA 4C0TA 3ENHA 3EN7A 3Q52A 3ZM4A 2W7XA 3PY0A 1WMKA 2VWZA 4I93A 2VNYA 3NLBA 5L8LA 5CT0A 4CMTA 5AUVA 4Q5HA 1PXKA 1A9UA 4EQCA 4K2RA 3V5QA 3CBLA 2BCJA 1R1WA 5KBQA 3TL8A 2IZTA 3UIUA 2Z7SA 3F5PA 3UOLA 4EOOA 4FKRA 2OSCA 4QP1A 2FA2A 4BWPA 1PXIA 2I0VA 3R7GA 4GCJA 4FTLA 3OP5A 3DK7A 1Q99A 3D14A 4IM2A 4O2ZA 2C0IA 2XKCA 3I5NA 1YRPA 4NK9A 5LCJA 5CX9A 4AW0A 2W0JA 3QF9A 3DK3A 5IEYA 4UBAA 2IO6A 1ZYJA 2OU7A 3FHIA 2YM5A 3JYAA 2F2UA 4I24A 4AN3A 1OL7A 2H34A 4XV9A 4A4XA 4RIXA 1XWSA 2JGZA 5HESA 3R7IA 1BMKA 4BL1A 4RIWA 4RFZA 3Q5ZA 3OUKA 3LIJA 4D2VA 2IZUA 3IDBA 4WA9A 4TZRA 2IW8A 4BDDA 4B6LA 4DYMA 1YOLA 3KL8A 4H58A 5HG9A 3W2SA 2XYUA 2ZB1A 4XOYA 4IWOA 3LFBA 1YWNA 1JQHA 2HELA 3DZQA 4E6AA 4BTJA 5HTIA 1E1XA 2R0UA 2VGPA 4W4YA 4JRVA 2HCKA 4O1PA 3SX9A 4RC2A 3CJGA 2JIUA 3L8SA 3VRZA 3DQWA 4UB7A 4CLIA 5BVFA 3LHJA 5EI2A 4CMOA 2YCQA 3LFQA 4I23A 4FKLA 2HZ4A 4TTHB 1O9UA 4NEUA 2X6DA 3RPYA 4DH3A 4YU2A 3UQFA 4FK3A 1LPUA 2XP2A 3BU3A 3DV3A 4MAOA 1X8BA 3ZHPC 5FXQA 4ENXA 2ZOQA 3QX2A 2FYSA 4AGUA 4HVHA 4OTHA 3UMXA 4O0WA 4PDPA 3COMA 3NIEA 4QMMA 4RIYA 4M12A 3ZUUA 2JDOA 2O2UA 4KKEA 4L68A 5H8BA 2Y4IC 3HV6A 3MYGA 4FV7A 1H0WA 3SRVB 2P4IA 4H3BA 2QC6A 2C69A 4RLLA 4BGHA 3PJ8A 5FRIA 5AUTA 1PHKA 3ULIA
chains in the Genus database with same CATH superfamily
2XJ1A 2Z7QA 3WILA 5CI7A 3O2MA 4I41A 2R3MA 3BYMA 3I79A 3UIBA 2VX1A 3S0OA 5HEZA 3BHYA 5GJDA 4YZCA 3NZ0A 3O17A 3RCJA 4KNBA 5EM7A 2XNPA 4R1VA 5CVFA 4A4OA 5EDPA 3GOKA 2FB8A 5CZIA 4UWYA 4G9CA 3LVPA 4E1ZA 4TNBA 4ZSEA 5FP6A 5DLSA 2DUVA 3TI1A 3KKVA 5KMKA 3TUBA 4U0IA 5IH4A 5B7VA 2Z8CA 1IASA 3OT8A 5FM3A 5K0XA 3FV8A 4YZBA 5BVWA 4ENYA 1GZ8A 1P14A 5E90A 5HD7A 1VEBA 3GCQA 2PVFA 3NPCA 4YJVA 4BBFA 2WOUA 5L3AA 3PJ2A 3ITZA 3SC1A 4DFNA 3PP1A 1PMNA 2XBAA 3AC4A 2WQMA 3V5LA 3BE2A 5C01A 5K0KA 3SQQA 3C7QA 2YEXA 3H10A 5CXZA 3CKXA 2EXCX 1REKA 2WPAA 3RZFA 4EHGA 4JDJA 1Z5MA 4FKJA 4ZZNA 4RJ8A 1Q3WA 1SVEA 4FKPA 4FSWA 2VWXA 5AWMA 2X2KA 3MTLA 4I3ZA 4YJSA 3TUDA 3PXQA 5CAQA 3UOJA 3FPQA 4BDIA 5EHYA 3DDQA 4C36A 4KWPA 2PZ5A 1JKLA 2XS0A 2YM7A 3H4JA 5HICA 3B8RA 5CSPA 4GSBA 2AQXA 2CN5A 4ZJIA 5AP6A 4L52A 3PXYA 5BPYA 3OCTA 5IDPA 1BX6A 4D58A 3PPJA 1MQ4A 4QMLA 4FK6A 2EXMA 2O63A 3OROA 5IUIA 4IJ9A 3FZSA 4IB0A 2XF0A 2YA9A 4FSZA 1OECA 4HOKA 3OT3A 4FYOA 4GJ3A 4AOIA 4IVDA 3GOPA 2W5BA 3DKGA 3POZA 4TN6A 1PKDA 3PRFA 1FMKA 4APCA 4ANOA 5ICPA 4FG8A 4FKGA 5LMAA 1IG1A 4YUQA 5CAUA 3S1HA 3DNEA 2NO3A 3UGCA 1VYWA 4C2WA 4EWHA 4RX7A 4WG3A 3KCKA 4MH7A 3TNPC 5M56A 2GNGA 4EOSA 3D7TB 3VRYA 4FT0A 1JLUE 2QVSE 3LAUA 3PIZA 4HYHA 5CSVA 3VWAA 1VR2A 3ZUVA 5HX6A 5FDXA 1H01A 2PVRA 3F3ZA 2YIYA 2J4ZA 3GP0A 4RWKA 1QPEA 2PVMA 4UZDA 4ACDA 1KV1A 1Q8YA 4XP0A 3TNQB 4DEGA 3FLQA 5C03A 5CEQA 1W8CA 4LG4A 3DKFA 5HTCA 5IZFA 4W4XA 5KMJA 4LL5A 3I7CA 5E8ZA 2XK3A 1NXKA 2UVYA 3DXNA 1CSNA 3P0MA 4TYEA 4HYIA 4S2ZA 1OITA 4YJQA 3UP2A 4F1OA 3MVMA 2JDSA 3MH3A 4KB8A 1YXUA 3FWQA 3PWYA 4LOQA 4L43A 5LOHA 3NS9A 3PJ3A 2OF4A 4MVFA 4RT7A 4O4DA 4FNYA 4O6LA 4CMUA 2JD5A 3EH9A 4ZOGA 5K4JA 2R3IA 4ZY6A 1Q41A 4KA3A 3ZRMA 2XNNA 4IH8A 3PXFA 2XIZA 4DN5A 2PHKA 2J90A 2VZ6A 4IB3A 4RZVA 4U40A 4KBAA 3TZ9A 4BIDA 3FZPA 2GNFA 1GAGA 2OIBA 4GVJA 3P5KA 3WE8A 4DGLC 4FSYA 5AX3A 4RPVA 5TF9A 3OG7A 3P9JA 3KXXA 4RIWB 2QOHA 2XM8A 2ZAZA 1WBVA 4FV0A 3QQLA 4CFXA 2OKRA 3C4FA 3RK7A 3OCBA 5KCVA 4IZ5A 5EI6A 4O4CA 3PZHA 2ZMCA 4XG7A 3IPHA 5EM8A 4E4LA 4EH8A 2XZSA 3D5WA 3F5XA 3P86A 4F6UA 5JMSA 1OPKA 3EN9A 3KXHA 5EOLA 4J7BA 4YC6A 4FIHA 4UMTA 4LUDA 4RX5A 5IMEA 5LMKA 3EQRA 3CLYA 1UU7A 3SW4A 5CAOA 3H9FA 2YDKA 3E93A 5HNBA 3DT1A 4QPMA 5C26A 3QQKA 4LGDA 5FDPA 5GJGA 4LFIA 3G9LX 4OTRA 3JY0A 2RKUA 1QCFA 2G2FA 4F99A 3QTIA 4QP4A 5IEXA 3DBEA 4QMUA 2F7EE 4QNYA 5AV0A 2XNEA 4QO9A 3CEKA 3W16A 2ITXA 3HEGA 2HK5A 2PMLX 4PNIA 2OI4X 1YI4A 5CNNA 3PY1A 2W4KA 2ITZA 4YNEA 3PLSA 4QTAA 4WSYA 4QQJA 3JPVA 2IW6A 5TR6A 2RFDA 1WVYA 2X0OA 4Y5QA 2ACXA 1ZOHA 3D5VA 1W84A 2G2IA 2XCKA 3V01A 1NY3A 3LMGA 4YC3A 3AC1A 4FZ7A 3EKKA 3ALNA 3MS9A 4O0TA 4S32A 3PVGA 3E3BX 2BRMA 3FZTA 5I9YA 5LVOA 5EI8A 3OTVA 2B54A 4MXAA 2JBPA 2GHGA 5E1SA 5IA5A 1NVSA 3PPZA 4BI1A 4CFWA 2XJ0A 2YDJA 4FG9A 2EWAA 3LFFA 3R22A 1UWJA 3OBGA 4YSMA 5BUJA 5I9ZA 3ZC5A 4JVGA 5AV4A 4EOPA 5DG5A 4XS2A 4HVGA 4OTDA 4BTMA 1W2DA 2VTAA 4QP6A 4ALVA 4D4RA 1T45A 5EYKA 3PJCA 4KIPA 3W2OA 4F9YA 3TEIA 3R8MA 4D55A 4RJ7A 3F2NA 4M69B 4BCHA 4EZ7A 4ZTLA 3UVQA 4CT2A 5BMSA 5CF5A 3TWJA 4MD9E 1OUKA 4CFMA 4WG5A 3KULA 5HLNA 2A98A 1YXXA 4TL0A 4YTHA 2GNJA 1TQMA 3EQIA 4PTCA 1BI8A 4I94A 4UMPA 3HV4A 4IAZA 4J99A 3CD3A 5M4FA 1RE8A 3PVBA 4KS8A 5LVMA 5C8NA 4OAUC 2VX0A 2CGVA 3OUNB 4D4YA 1XH8A 4RJ6A 5FEDA 1BL7A 3AOXA 4RVLA 4U43A 3HDNA 4ZTHA 3UG2A 5EG3A 3MPTA 3UPZA 3PZEA 4IX3A 3FXZA 3WZKA 3QD4A 1XJDA 4E4XA 3QAME 4IAIA 4KINA 1GIJA 3UOKA 1ZYDA 1ZOGA 2JDVA 3PE2A 5D1JA 5ANIA 4ZZOA 5HG8A 3GB2A 2A2AA 3IOPA 5BYYA 4QP7A 3C51A 2OICA 4GYIA 2RG5A 4RA4A 3V5TA 3TNHA 2Z7LA 2LGCA 2WMSA 4IVAA 4N6ZA 2YM8A 2BZKB 3FAAA 3FL4A 2XK7A 4BDJA 1U5QA 2OBJA 4FVRA 5IMXA 3UIXA 3MJ2A 4C4FA 4YJOA 4CQGA 1I09A 1JOWB 3E3PA 3VO3A 4BTFA 4BN1A 3KXGA 3PVUA 3R2YA 3UIMA 3VAPA 2WMRA 4ITHA 4YJTA 2R5TA 4HVDA 3NUYA 2IVTA 4KSPA 3FLZA 4K8AA 4FTAA 4D4SA 5EOBA 5JKGA 3VBYA 4I4EA 3DBFA 5AA9A 5KMNA 4BDEA 1BUHA 5J8IA 4IWPA 4CV9A 2GS2A 4UMUA 4KAOA 2I6LA 3QCSA 3MVLA 3NYVA 4KRDA 3MSSA 3WF9A 4ZIMA 4O0SA 4EUUA 4FKQA 2OFVA 2VWWA 2WAJA 2ITTA 5EW3A 2IVVA 2WMVA 1WBSA 4E4NA 1P4FA 2OK1A 2DQ7X 5CU6A 3T8OA 3LXNA 5DGZA 5M53A 2X7FA 5M51A 3IW7A 4FV4A 2R3FA 3BZ3A 2HENA 3GNIB 4C35A 4CT1A 2DWBA 3RKBA 4EH2A 3QWJA 4HYUA 3EOCA 2UW7A 5D11A 4OTGA 4B0GA 5KMOA 1H0VA 2ZMDA 3BV3A 4USFA 1ZZLA 2XRWA 1REJA 2V7AA 5CSHA 2C6IA 2YLFA 3ZEWA 2HXLA 3AC2A 4CKJA 3LXKA 4QP8A 4EOKA 2BFXA 4O22A 4QNAA 3BCEA 3IOKA 4MXYA 2GFCA 2WQBA 3PYYA 4EK5A 4MBIA 3W18A 5HO7A 3S00A 3FPMA 2AC5A 4PPBA 4ZTSA 2HYYA 2ZVAA 4NM3A 4ZSJA 3QUPA 2OXDA 1U5RA 4TWCA 4Z7GA 3K5UA 2F2CB 3BYVA 4J8NA 3ZONA 4F7SA 5H9BA 4YJUA 3MH1A 4QD6A 1V0OA 5CAPA 4PUZA 2C6MA 4J1RA 4TW9A 2CPKE 3ENMA 1OI9A 3LJ1A 2UZTA 3R9NA 4MBLA 2QKRA 1VZOA 3UZTA 2R3HA 1BL6A 4AZVA 3FMLA 4C2VA 4GUEA 1PMEA 3U87A 5L6PA 2Y6MA 1JKKA 3GCSA 2VTRA 3DNDA 4OBQA 2XKFA 3IW5A 3QL8A 5DH3A 5E92A 4M3QA 3R83A 4DFZE 2WMWA 3T9TA 3CIKA 3HRBA 3VJNA 3ZFYA 2PK9A 4IZ7A 2B53A 2F49A 3R8ZA 1HCLA 2PZPA 1OL5A 3KMWA 5JZJA 4PWNA 4YHTA 4BDBA 4CZUA 4I92A 3TIYA 4P2KA 3FSKA 2QQ7A 1H25A 2WNTA 4TKSA 3L8XA 3OOGA 4NM0A 4W4WA 4CTBA 3ORZA 4R3RA 3SLSA 4V05A 3CGOA 2UZDA 2CDZA 1J91A 4IM0A 2BRHA 2UW6A 4MYGA 1YDSE 4XG2A 5JRSA 4DH1A 2VWYA 4ACGA 3BIZA 2Y4PA 2C6TA 3IW8A 3OWPA 3R8LA 1M7QA 3QKKA 1EH4A 1LR4A 1Q8UA 3FZ1A 3LPBA 3MTFA 4FL3A 4K11A 1AGWA 4EKLA 4BKJA 1J1CA 1MUOA 4FV6A 1XH4A 5JGBA 2OJGA 4F9CA 5HO6A 4FT9A 2CCHA 4FYNA 4ITJA 3NW5A 3TCPA 5HU3A 2WTVA 1OPJA 3PXRA 2JKMA 3VBQA 3UJGA 4MCVA 2QOBA 3I1AA 4F7LA 3NYOA 3P7BA 1KOBA 1PXMA 3FHRA 3FI3A 4EC8A 3NDMA 4G2FA 4Z9LA 1Y57A 3DB6A 3QD0A 3DQXA 1JKSA 3QQGA 3F3UA 3HV3A 4QTBA 4WNPA 3C4EA 3FKNA 2C6EA 3OS3A 2W1CA 3KXMA 3BBWA 4PY1A 4D1ZA 2SRCA 3R6XA 3EMGA 4X3JA 4XX9A 4YO6A 3F3TA 4G6LA 1GY3A 4YTIA 5A4LA 2C6OA 4GFOA 5LWNA 3BHUA 3KVWA 4YPDA 3HYHA 5J1WA 4IFGA 4MXCA 4FKSA 3EN6A 2PZYA 4I5HA 3RHXA 3OWLA 4IX4A 5LQFA 4IADA 3E5AA 1FINA 5IA1A 5HNGA 1H8FA 5M4IA 5KUPA 4PL3A 2I0HA 3TV7A 3QYWA 4U45A 1DS5A 1NA7A 2W4JA 4AN2A 4XG9A 3QC9A 5CANA 1FVTA 2FSTX 1JVPP 2WMUA 3DLSA 2PMNX 5AIKA 4QMQA 3RNIA 1W2CA 2HY81 2WU7A 5FP5A 4RX9A 2F7ZE 4U6RA 4KD1A 5IU2A 1UU9A 3ZYAA 1YVJA 4PDOA 3HLLA 3R8UA 5EK7A 3I81A 3P7CA 4IIRA 3IECA 3ODYX 4FTUA 3KK8A 4XG3A 5EM5A 5FGKA 4JR7A 5HOAA 2QKWB 4B7TA 2XNOA 4KKHA 3PG1A 3TIZA 3H9RA 3F88A 3BLRA 3S3IA 4C58A 4FTMA 1FGIA 1IA8A 2H96A 2YACA 4J96A 4FT3A 3ANQA 3FQHA 4FT7A 5AUZA 1MRUA 4E5BA 5BMMA 4GMYA 4K9YA 2W4OA 5CYIA 5HCYA 2OG8A 2WTKC 4M8TA 4LOOA 2WTKB 4ZLYA 3HV5A 2WTIA 4HGTA 4JI9A 4W9XA 4Y95A 3F9NA 3WZJA 4EOJA 4YGAA 2WMTA 1WBNA 2J7TA 3C4ZA 2OXYA 2CGXA 4IJPA 5DT0A 4HPTE 5AJQA 4D2TA 2FUMA 4R5SA 4WOVA 2OH4A 4DGOA 4EH6A 4BI0A 5D7VA 4DG0E 4ZSLA 1XH9A 4I6HA 3O0GA 1F3MC 4A06A 1P2AA 3D7ZA 4C4GA 2ZYBA 1I44A 4M97A 1H4LA 3BEGA 4AE6A 3KGAA 3RK9A 4R5YA 3MGYA 2XK4A 3C0IA 3GFWA 2GDOA 2HZ0A 4HCTA 4CD0A 4W9WA 3U8WA 5IA0A 2BUJA 2W96B 4FMQA 5IDNA 4HVSA 5ANKA 2RFNA 2VAGA 3R02A 4BGGA 3SOCA 5ANJA 5AAFA 2CGUA 2G01A 3QFVA 5EDRA 4QPSA 4Y5HA 3RPRA 5BVDA 5AR5A 4GIHA 3LE6A 3KEXA 4ANMA 3HMMA 1RJBA 2P0CA 3D0EA 2XKDA 1UNGA 2XYNA 3FY2A 4LGGA 3FKLA 2C30A 4AA4A 3PWDA 5AV3A 4BKYA 3ACJA 2XIXA 3VS4A 4YO4A 3GC0A 4FTRA 5B2KA 4AP7A 3PSBA 4G3DA 3ORLA 2XH5A 4ONAA 4BCIA 3QZHA 4XV3A 3RP9A 3QRKA 4EH4A 3ZDIA 3O8PA 1ZY4A 3WI6A 2QONA 2UW8A 2WU6A 4FUXA 4NT4A 4L3LA 4L45A 2I0EA 4TYHB 4A9SA 4EOMA 3QRJA 5A9UA 4YP8A 4L44A 4U42A 4QTEA 3EYHA 5JQ8A 4WRGA 3KRLA 4OLIA 1PXPA 4ZAUA 4C3FA 5BVOA 4I6FA 4JAJA 4GV1A 4BBEA 2HY0A 2R0IA 1GIIA 3C50A 3PIXA 1HOWA 4AG8A 3A4OX 4R3PA 4ZS0A 2W9FB 3NIZA 4UY9A 4XLIA 5ETAA 3BWFA 3ZBFA 3VUMA 1PKGA 2GNHA 2LAVA 3OF0A 4BYIA 2OJ9A 2J0KA 3WARA 4MQ2A 5CTPA 4FR4A 2Y8OA 3LLTA 5FQDC 4FIGA 3U4WA 3VVHA 4MF0A 2XNMA 4NFNA 4M7IA 4CLJA 5L6OA 3JVRA 2QR8A 3NYXA 1PYEA 2JEDA 3EFWA 3KMUA 4KBCA 3VBTA 5DI1A 3LXLA 2PVNA 4FIEA 4NTTA 3VUDA 2AC3A 5AUUA 3L9PA 4HYSA 2G9XA 4YHFA 3GC7A 5DMZA 4IMYA 5DE2A 2J0LA 4I4FA 2UW5A 4V0GA 4RWLA 4MF1A 3CC6A 2QLQA 4ZZMA 1S9IA 2BAJA 4FSQA 5J1VA 5EYCA 2GHLA 3FZRA 5FWKK 5HTBA 3F66A 2WEVA 3FQEA 4ASXA 2BZHB 3G51A 3MVHA 4RX8A 5CU4A 5CNOA 4M67A 2O5KA 2WQNA 4FKIA 4KIKB 3DTCA 3UODA 4UWBA 1PF8A 3FI2A 4JX7A 4BB4A 5F94A 2UW0A 1IR3A 2H9VA 5F1ZA 2Y6OA 4QMOA 4CYJA 4WNMA 3MPMA 4ZTRA 5TT7A 2JIVA 4DAWA 2KTYA 4BDFA 1QMZA 4ERWA 5KBRA 3BGPA 4JQ7A 4TYIA 3V51A 3FBVA 3GBZA 4AFEA 5D41A 3KN6A 4ASDA 2G15A 3CGFA 4W8EA 2JC6A 4E5AX 5HO8A 2QO9A 4IC7A 4O0VA 5GJFA 4E4MA 4FEQA 4HZSA 3O8UA 5HE0A 3A4PA 3MN3A 3HKOA 4FUYA 1VYZA 3FXXA 3O23A 3RM6A 1WBTA 2J6MA 4HVIA 5CF4A 2X2LA 3R30A 4FKVA 3FLNC 3G0EA 1YOJA 3H3CA 3NUPA 4CZYB 4PMSA 3UVRA 3BHTA 5GHVA 4C4JA 4OTWA 3B2TA 1KWPA 2I0YA 3EIDA 2C0TA 3IDCA 2C3JA 3NNXA 3ORXA 5J7BA 2KULA 4TPTA 3T3UA 4JXFA 4O21A 3R7YA 4AA0A 4L46A 1H28A 5AM7A 3TV6A 1Q8WA 4C3PA 4XBUA 1XH7A 2C6LA 1GZKA 3FMJA 1BI7A 4RGJA 4DEDA 3QTXA 5KHWA 4FL1A 4L42A 5BUIA 2YJRA 4C8BA 4F63A 1S9JA 4C4IA 3OD6X 4MQ1A 4GT5A 2QURA 2R64A 3W55A 2BFYA 5JSMA 4P7EA 2CHLA 4Q9ZA 3RINA 3NNVA 3V5JA 4GT4A 4I22A 4BKZA 3BRBA 5IH5A 4FZFB 4D1SA 2QD9A 5C8KA 2GTNA 3M1SA 1CMKE 4M13A 3TT0A 5LARA 3KA0A 3OY1A 4LRKA 4O4BB 4S30A 5AAEA 4EQUA 2ITPA 3FI4A 3VNTA 1U4DA 2X9FA 4O27B 4G3FA 4E26A 1JPAA 3QCQA 3U6IA 4AZSA 1WCCA 5CEOA 4YJPA 3A7JA 3EZVA 4PPCA 4EH5A 3NAXA 3R7VA 4FTJA 3ZFXA 3F61A 4PPAA 2CJMA 3QU0A 3V04A 2ITYA 3QTWA 2PWLA 4OTIA 3P4KA 1LUFA 1G5SA 3FSFA 2QU5A 2BZIB 5DRDA 3ZLYA 3BE9A 3TG1A 1OB3A 4RIOA 4RLKA 3ZSGA 5FM2A 3QX4A 4JG8A 5BYZA 2FO0A 3NNWA 4BIBA 1ZYSA 3EJ1A 1OGUA 3H30A 3W33A 4ARKA 3I7BA 2HAKA 2WB8A 5I9WA 3GQIA 4AS0A 5AP0A 4Z55A 4ZTMA 3DFCB 4Y83A 3GXLA 4KBKA 2RG6A 1OL6A 1ZZ2A 5E8TA 1WZYA 3W2RA 4AXAA 3OC1A 1SMHA 4G6NA 4A9UA 2QHNA 4PMTA 3TN8A 5CQWA 4L3PA 4ZXTA 4RFMA 1F5QA 4UEUA 3UC4A 4BFMA 5KMLA 4NM5A 1UA2A 3ORKA 4DTKA 4BDCA 3AD4A 3F3VA 3R00A 2XIYA 4DFXE 4K33A 2UW4A 2JFLA 3BYSA 4RIXB 5C1QB 3DPKA 3O51A 1KE8A 5L8KA 1UKIA 3D94A 3C4WA 5HG7A 3DAKA 2X9EA 4R1YA 3R7UA 2YIXA 4KS7A 1V1KA 1ZARA 4QOXA 2XK8A 1SNUA 4CEGA 3OXIA 1YXVA 4FV3A 3CCNA 1ATPE 2I40A 5DEYA 2J5EA 2BMCA 2Z7RA 3I6WA 3OMVA 5HCXA 4F0GA 5I0BA 5I9VA 2IZSA 4LOPA 1B6CB 4XMOA 4JQEA 3FMDA 5AIRA 2W1DA 2UZVA 2QCSA 2UW9A 2VTPA 1ZAOA 4X0MA 2WOTA 2VTOA 4O0XA 4JNWA 1O6YA 1R0EA 3KU2A 2WIHA 2VU3A 3GT8A 2GSFA 3I0OA 4ZJJA 5T3QA 4Z3VA 3QD3A 3A7GA 1DM2A 2FH9A 4FOCA 2R7IA 2WTWA 3TV4A 3W10A 4N0SA 3V8SA 4RVMA 3NEWA 2UZUE 5FXSA 1MRVA 2Y4IB 4WUNA 5IA4A 3FMMA 3RCDA 5D9HA 1AQ1A 4OBOA 1SZMA 3DBCA 3QYZA 2C6KA 2WXVA 4IC8A 2YN8A 4E8AA 4YSJA 4AT5A 4CTCA 1KV2A 5CENA 3V5PA 5AEPA 4L7SA 2UVZA 3OEFX 3B8QA 2Z60A 3VHEA 5A4TA 5CU2A 3RGFA 1FVRA 2RIOA 1YW2A 4LV8A 3CS9A 4FZAB 4BHNA 3QKMA 4D2SA 3PA4A 5AR4A 3ERKA 3GGFA 3PRIA 3SXSA 2X4ZA 2ETRA 2IF8A 4EOLA 2O65A 4EYMA 2B9IA 5CU0A 4E93A 5M55A 5EW9A 4LMNA 4ASZA 4UMQA 3IW6A 2E9UA 3E7OA 2XIRA 4JIAA 5JFVA 1MRYA 4G6OA 4RZWA 5AM6A 3QUEA 3G5DA 2BR1A 2YERA 2B9HA 4IX5A 4GK4A 1MP8A 4I0SA 4WSQA 4NCTA 2XUUA 3AD5A 4H39A 3EKNA 4IFCA 2YHVA 3LCTA 4LI5A 4DINA 4F09A 3EQFA 3FLSA 4C57A 3NUUA 2ZM4A 1W7HA 3LFEA 4BCQA 5I9UA 5C8MA 1AD5A 3V5WA 4AW2A 4X3FA 4O96A 4F6WA 2BDJA 4EZ5A 5J5TA 3VS1A 3AXWA 4QQCA 4TWOA 4FSUA 4II5A 5EYDA 2VTQA 4C59A 3HRCA 4BCPA 2BDFA 1M14A 2ITWA 4IAFA 4RC4A 1NVQA 4TY1A 4X2JA 3TACA 2YCRA 3GCUA 5CS6A 1P4OA 4U3YA 3AQVA 1TVOA 4K6ZA 2EUFB 3BELA 4H1MA 3R04A 4XJ0A 4WIHA 3DY7A 3WE4A 3PUPA 2VTSA 3JVSA 4NZWB 1OKYA 3OHTA 3CQEA 4PL5A 4G31A 3RMFA 4CSVA 4U3ZA 4GG7A 1OIYA 4QP3A 5IUHA 4BZOA 3C1XA 3ZXTA 2ERZE 3F69A 3POOA 3GU5A 1B38A 3QTQA 5DT3A 3A99A 3LCDA 5JFXA 4UX9A 4IAAA 1W83A 3VS7A 4Z16A 3AD6A 2XEYA 5EYMA 2AUHA 3BQRA 3W32A 4HPUE 4ZY5A 4AUAA 2NRUA 3U6HA 5E8XA 2BZJA 3ZSIA 3ZLSA 2ITOA 5A4CA 1BKXA 2ZV7A 3EQHA 3MB7A 4MEDA 4FI1A 2XCHA 3GCVA 2HIWA 4UXLA 4QMNA 5A4QA 5I5ZA 4JS8A 4EK6A 4ZLZA 4EL9A 3NSZA 1ZWSA 2ONLC 5J7HA 3ALOA 2ITNA 4WBBB 2X8EA 3DJ5A 1STCE 4V04A 2PZIA 3HA8A 4RWJA 3ET7A 2OGVA 3P78A 2W17A 5ANGA 4JAIA 4FTNA 5E1EA 4L3JA 3KQ7A 4JDHA 3GU6A 2X4FA 3OWJA 3CTQA 2X1NA 1H1RA 2NP8A 5HBHA 3PG3A 2VTLA 4BF2A 3EYGA 1RQQA 4P90A 4TXCA 3UO5A 4C02A 4PX6A 4AGDA 3F3WA 3OWKA 1Q97A 2QOQA 3A8WA 3VIDA 3PVWA 3P79A 3Q9YA 4QMZA 3EWHA 2NPQA 4QYFA 4XHKB 5DPVA 4DCEA 4LRMA 4Q2AA 2W1FA 1VJYA 4IW0A 1Q24A 2C5VA 4U41A 3WYXA 3C9WA 3DTWA 2W1ZA 2WTJA 3Q04A 4ANSA 4F08A 3DGKA 3EQDA 3SVVA 2VTNA 2G1TA 5J9ZA 4DGMA 2ITVA 2R3JA 3S4QA 5H8GA 3AMAA 3RALA 4IZYA 2WIPA 3DK6A 5T68A 5D7AA 1HCKA 2X0GA 3KRRA 3UYTA 4EOIA 5A4EA 5HIEA 4G5PA 1ZYLA 2PUUA 5H8EA 4JLCA 3QXOA 4QTDA 5L8JA 3HZTA 2W05A 4DH7A 5FBOA 2YZAA 3CJFA 4OTPA 1Q62A 4AU8A 1SNXA 3GU8A 3VF9A 2BIYA 4BYJA 3BBTB 3BYOA 4NIFA 2I1MA 3ORIA 4BHZA 3AMBA 1M2RA 3MBLA 2R3RA 4PF4A 3WBLA 3UO4A 3MVJA 4EK3A 2YLEA 4L01A 1M17A 4D2WA 3HP5A 4NSTA 2C1BA 4IM3A 3VBXA 4B9DA 4IVCA 4XG6A 3HRFA 4A9TA 4RVTA 2YIQA 3L8PA 4PRJA 3LM5A 3ZO2A 2CCIA 2ZDUA 3MB6A 3IW4A 5B0XA 4ANNA 2P33A 3UPXA 2WQEA 2VN9A 3AT4A 5CLPA 5LMBA 1UNLA 5DT4A 3O50A 3FXWA 2BALA 3CR0A 2B9JA 1TQIA 4UV0A 4AT3A 3SV0A 4D0XA 4D9TA 3QHWA 1H1PA 2RL5A 2YWPA 3I0QA 2CLQA 3A8XA 4K18A 2PVHA 2A0CX 2WQOA 5A6OA 4X6QC 5JRQA 4AE9A 3SD0A 1J3HA 4D0WA 3BGQA 2GS7A 2YFXA 1APME 3H9OA 3R2BA 3B2WA 5AUYA 2ZV9A 4UWCA 4NJ3A 1KSWA 5GZ9A 5CT7A 4FF8A 3S95A 2BPMA 2ITQA 4PNKA 3DJ7A 4M84A 3UNKA 2R4BA 4FRFA 3RJCA 3E62A 3AC8A 1T46A 2VTHA 4QMPA 5AMNA 3SHEA 3OOMA 3KCFA 1JNKA 3L8VA 5EH0A 2XA4A 2W06A 4OAVB 1TKIA 3REPA 4GRBA 5GZAA 3QALE 1CKPA 4EYJA 5L2SA 1WBPA 4FIJA 3D2KA 4QYGA 5JGDA 1XO2B 4UYNA 3LFDA 3BEAA 5CXHA 1SVGA 2YM6A 2J0MB 4X3FB 3TJCA 2QOFA 4I20A 3Q32A 3ZO4A 2QI8A 2GPHA 3LFCA 4KIKA 4ZY4A 3UTOA 3EL8A 4WG4A 4FNXA 1R3CA 2YM4A 3OZ6A 4HCVA 5L2TA 3LJ0A 3E63A 3ZU7A 2GU8A 2PVKA 5K4IA 2BTSA 2WD1A 3VW6A 4FV8A 1PXNA 4X2FA 4JT3A 2GNLA 2PE1A 4FL2A 3S2PA 4BTKA 3IGOA 5HU9A 4P5ZA 1SYKA 4NU1A 3W2QA 2PVYA 4IHPA 4AGWA 3D15A 3DBDA 3GCPA 3BHHA 4QP2A 3VF8A 4ANLA 4LQMA 2PMIA 1GNGA 4F7NA 1UVRA 1V0BA 2EU9A 3HL7A 1KE7A 2BIKB 2E2BA 1WVWA 2OZAB 3LJ2A 3MFSA 4N6YA 4NTSA 3QRUA 3SKCA 1QPJA 5I4NA 3DBQA 2F9GA 1UU3A 5KZIA 4RJ5A 3R8PA 4WNKA 3R9HA 3UYSA 3VJOA 3CP9A 4CRLA 3WIKA 3KB7A 1Y6AA 4ANQA 4FA2A 5IG1A 4FC0A 2X0PA 2HZNA 4XLVA 4IB1A 5HI2A 3NUXA 4RQKA 4RA5A 4RG0A 4IVBA 3COHA 4J52A 4EH3A 5L2IA 3ORTA 3WZEA 4FV5A 3FC2A 4BRXA 4PV0A 3ZC6A 3KC3A 3UNJA 1YI6A 3OFMA 4QQTA 3T3VA 1FGKA 3O7LD 4FV2A 3P7AA 2XK9A 2OJJA 4BBMA 3ELJA 4HCUA 5EM6A 4QMXA 1P5EA 1UWHA 4QMTA 3SOAA 3SXRA 3U9CA 2QOLA 2VO0A 4R8QA 4WO5A 3W8QA 1J1BA 3D4QA 4R7IA 3VS0A 4RJ3A 2WMBA 4YR8A 3G6HA 4YZ9A 1M52A 2XB7A 4ASEA 1H1WA 4I1ZA 1XBAA 3NR9A 4WBOA 3IQ7A 1OZ1A 5T6KA 4DEHA 1B39A 4O6EA 2VRXA 4XG4A 3G33A 5TOZA 3FE3A 5ANEA 4JBPA 3JXWA 2P2IA 4U5JA 4CV8A 4G17A 3VS3A 3QZGA 2B55A 3QTUA 4MNEA 3E92A 1XQZA 2HW6A 5D12A 5HIDA 3ZZEA 4C34A 2R3NA 3EB0A 3MA3A 4IEBA 4RBLA 4B99A 3ZEPA 4DEEA 5JFSA 3ZUTA 2E9OA 1RW8A 4F0FA 2UZLA 3MH0A 4TYHA 3GI3A 2VX3A 3NW6A 1GZNA 2OXXA 2XM9A 5DVRA 4YTFA 5JH6A 2RSVA 3QTZA 5ACKA 4YURA 2VO7A 3RWPA 2H8HA 4RFYA 4LGHA 4MXOA 2X8DA 3ZMMA 1URCA 2C68A 5HCZA 3A7FA 3FLYA 2ZM1A 3UG1A 3MY0A 4DGGA 3ORMA 4CNHA 4FNWA 4CYIA 3K2LA 3OXZA 3C4XA 4FTIA 3R9OA 1OVEA 1CDKA 4I5CA 3IONA 3PP0A 3HDMA 2Y0AA 4EQMA 2ZV8A 5AV1A 5KO1