4ANNA

Crystal structure staphylococcus aureus essb cytoplasmic fragment
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
176
structure length
176
Chain Sequence
LDMREIPKSSIKPEHFHLMYLLEQHSPYFIDAELTELRDSFQIHYDINDNHTPFDNIKSFTKNEKLRYLLNIKNLEEVNRTRYTFVLAPDELFFTRDGLPIAKTRGLQNVVDPLPVSEAEFLTRYKALVICAFNEKQSFDALVEGNLELHKGTPFETKVIEAATLDLLTAFLDEQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords ESSB
publication title Characterization of Staphylococcus Aureus Essb, an Integral Membrane Component of the Type Vii Secretion System: Atomic Resolution Crystal Structure of the Cytoplasmic Segment.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus nctc 8325
total genus 54
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2012-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4annA00
1ZARA 1NVSA 3LFQA 3MPTA 4G34A 4Y46A 3BQCA 3QUEA 4FSRA 3VVHA 2EXCX 2UW9A 5BVDA 5HE3A 1F3MC 5IDPA 5JSMA 2UW3A 2BFYA 2VX0A 3BU6A 3PXFA 3F9NA 4IJ9A 4FZDB 4KBAA 3W33A 3ZFYA 3DBCA 3VUIA 3PYYA 2JITA 1SZMA 4R3RA 4GFGA 4JT3A 3KXGA 4UMQA 4WBOA 4EOKA 4IIRA 4LUEA 3UYTA 2PUUA 2WTWA 2WTCA 5DNRA 3O8UA 2F7XE 2ZV2A 3KL8A 4R3CA 4WRGA 5HOAA 1E1XA 1OECA 3P86A 1H27A 1XQZA 4ASEA 4EZ7A 4F99A 4YUQA 3DFAA 4BN1A 1XBBA 5H8EA 4A7CA 5BVKA 4EOLA 3CQWA 3P79A 2RG6A 3COIA 4RWLA 4IX6A 2CKEA 3QD2B 4AAAA 2W1CA 3EFKA 3GC9A 3CIKA 4O96A 5E8TA 4WO5A 3C4WA 3LXNA 3Q4TA 2J0IA 3E62A 4D4SA 2OGVA 2YLEA 2WMRA 4UWYA 5FWKK 4P5QA 2G2IA 3BWJA 4BGQA 5EW9A 4EK3A 3PWDA 2WD1A 2YLFA 4B9DA 4C4IA 4XP2A 3LM0A 5FEQA 2HENA 4Y8DA 1OB3A 4I4FA 3OXIA 4O0XA 2Y4IC 1QPEA 2XK3A 4I0TA 3P08A 4R5SA 5IH6A 4XUFA 4Q9SA 5CX9A 4RA4A 5HE2A 1UNLA 1FPUA 4K18A 3F6XA 4YJUA 4BIEA 1W0XC 2C47A 4E1ZA 4X3FA 1OIRA 4MXCA 3JVRA 4OLIA 5HLPA 1ZZLA 4YJNA 2W4OA 4PL5A 4XBUA 5T68A 5ANGA 3D9VA 1FMOE 4QMPA 3ZOSA 5FDPA 2XIRA 3OTUA 3ULIA 5IA1A 5HQ0A 4O22A 3GU6A 3GEQA 1YI3A 2VNWA 3QCYA 2C5YA 3PP0A 4FKWA 4IM0A 3FI4A 4DINA 1OI9A 2J5EA 4FTOA 4MXXA 3LLTA 4ZTNA 3EQBA 4FKQA 3V8SA 3U51A 1K9AA 3W2RA 4AU8A 5J9LA 1GOLA 2BRHA 2R0UA 1SNXA 4YLKA 4AZVA 4O0SA 3FLNC 4HZSA 3A4PA 3VUHA 2WELA 4RX9A 1U5QA 4QYFA 2I0HA 5FGKA 3WE4A 5I4NA 3ENHA 3VW6A 2OF4A 4D2SA 4F7LA 3UZTA 3R7GA 2PVYA 3BHYA 3PXZA 4Q5EA 4F9BA 3RCJA 1DI9A 4IJPA 4MEDA 4NSTA 2Z60A 3NUPA 4E7WA 3TCPA 3VBYA 4WG4A 3PSBA 4D4VA 3D2KA 4WOVA 3UO6A 4DC2A 5HEZA 4EH9A 3CQEA 3O71A 2XBJA 3PZHA 4D58A 2LGCA 3P7AA 2UZDA 3HA6A 3SRVB 3AC3A 4HVGA 1LP4A 3KXNA 2ITPA 4L01A 4N70A 5CVFA 3ZLWA 3OEFX 5EM7A 2XCKA 1YXTA 3PE2A 5ETFA 4RLLA 3BGPA 4CMUA 4CRLA 4X2GA 1W8CA 5ACBC 4ZSJA 2HZ0A 3GBZA 2WQBA 4KIKA 2C6OA 1UWHA 4KIPA 2X8DA 5CZIA 4C61A 4QP1A 1OL6A 2H9VA 1XO2B 2O63A 5AJQA 4A9UA 4CYIA 2GHGA 4U97A 4E5BA 3BV3A 4ERKA 1XHAA 3ORIA 4EUUA 4ALVA 4C2VA 3QQKA 4JI9A 3PPKA 4D0WA 3UIUA 2ITOA 1TQIA 3D2IA 4R7IA 4U8ZA 3T3UA 1PXOA 1Y8GA 3R2BA 5M56A 4OTGA 3WARA 2YM3A 4BCOA 2XK7A 2UW5A 1JQHA 2UW7A 4MX9A 2WB8A 5HVKA 3FZTA 2JIIA 2BTSA 3BYVA 2AC3A 2G01A 3NLBA 2ETRA 4RIWA 3NZ0A 3F88A 4JIAA 4HPTE 3SXRA 4YSJA 3WE8A 3W2CA 1OKWA 1YWRA 4A9SA 2XNEA 3TIYA 4JVGA 4RFZA 4AGWA 5CXHA 2J0MB 3ANQA 2F9GA 1H1QA 2XJ0A 4G31A 4KS7A 3TWJA 1XH5A 1ZOGA 2YCSA 4FA2A 5HU3A 4WNKA 4DEHA 3AC5A 4TN6A 2QURA 2BROA 4GT3A 2YM4A 3V04A 4A06A 4FV7A 3CQUA 2QG5A 4LI5A 4CFFA 4NJDA 3IW8A 4CMTA 2F49A 4FIIA 4ANSA 2ZM3A 2C3KA 3C5UA 4AT4A 2W17A 4I92A 3O23A 2W9ZB 3LOKA 2GS2A 3FKNA 4NZWB 4QMTA 2PHKA 4HYHA 3HP2A 2ESMA 4EOMA 2GS6A 5IA0A 4O1PA 1BMKA 4LGHA 1UWJA 4FGBA 1XH4A 1GZOA 5LMAA 3WZKA 1GIIA 2O5KA 3NAXA 3Q9YA 2PE2A 4JQ8A 1FGKA 1Y8YA 4RX7A 5T3QA 3W8LA 3A7GA 4DCEA 5BQ0A 4JXFA 3WF8A 3KVXA 5CASA 4FTNA 5A46A 3Q4ZA 4EK8A 3OHTA 4IX5A 2VGOA 3ZHPC 4F9YA 5KBQA 2UZLA 3EYHA 4BYJA 2JKMA 3EH9A 5J79A 4NK9A 2VTQA 4F1OA 3R04A 4KIOA 4QTEA 3AGLA 4U43A 2VX1A 4D0XA 3UTOA 4I5HA 4BBMA 2VTLA 4R6VA 2UZEA 5BYZA 4EH5A 4BCFA 2WMVA 5M55A 5L4QA 3PFQA 3I0OA 4JDKA 1CSNA 1LEWA 1BYGA 4IDVA 2QR7A 4MBJA 3QRTA 4GS6A 3R9DA 1BLXA 1H26A 2YCQA 3V8WA 4I0RA 3SX9A 3DAKA 3DK6A 5EOLA 5AV3A 4NW6A 3DK7A 3QU0A 4QNYA 5M53A 1ZYLA 5L6PA 3SV0A 3CD3A 5CSXA 4TRLA 1LR4A 3WYYA 4FV9A 2J2IB 4KBKA 4AT3A 3HP5A 5AA8A 4ZJIA 4F70A 3KA0A 4IWOA 4XG2A 4RQKA 3UOKA 4APPA 4YZNA 3LFDA 2WMQA 3KKVA 3PTGA 4YPSA 5IUHA 4FTLA 3FY2A 3POOA 3V5JA 3H30A 4UMUA 4G6OA 2XJ1A 4FKOA 5EI6A 5AV4A 4P2KA 4JR7A 4K0YA 3AMBA 4FUXA 4OTFA 2E9VA 3VC4A 4IAKA 2XIXA 4ZZNA 5GNKA 3KCKA 5EYCA 2OICA 3FBVA 4C3FA 5D12A 4RWIA 2OJ9A 1JVPP 4O0VA 4EOSA 4FSWA 4AZWA 3LIJA 5ICPA 1BKXA 5HCYA 3TN8A 2XNPA 5DWRA 4BCQA 3LCTA 4MKCA 4RJ3A 3PIYA 4H39A 4O0TA 3Q5IA 4BCJA 5IH4A 3ORLA 3R21A 2RSVA 3PRIA 2P3GX 3LCOA 3LJ1A 4ZK5A 2RFNA 2WMSA 1H24A 3BLRA 2CPKE 3VIDA 2C69A 4B6LA 1LUFA 4DAWA 4YTFA 2PVJA 4HOKA 2UW6A 4D4YA 3PWYA 3CKWA 4IFCA 5LVNA 4FSQA 3UC3A 5HTCA 2HYYA 5EW3A 5HGIA 5AAFA 2J0KA 4E6CA 4OR5A 3IS5A 4R1YA 3FZ1A 4F09A 1Q3WA 4MNEA 4BDEA 1UU7A 2HK5A 4QP6A 4C2WA 3WIGA 5CAOA 4EQCA 4AW5A 4TKSA 3E8DA 2C1AA 3BBWA 3HRCA 2CGWA 1SVHA 2J0JA 5DVRA 4TYIA 5BVEA 1Y91A 5K0XA 4DFNA 3KRLA 5KNJA 1Y57A 3RALA 2BAQA 2WTVA 4EH2A 2VTNA 4JRVA 3UVRA 2C3JA 2ZM4A 3HMIA 1CM8A 2A1AB 3QLFA 2X8IA 5E8WA 3I6UA 5IKWA 4AUAA 3OWJA 5I9WA 4J96A 4BZNA 4C59A 3PUPA 1J3HA 3OF0A 3PJCA 3OW4A 3QC9A 4IACA 4DN5A 1PKGA 5KMLA 4MQ1A 2PZYA 5GZAA 2FVDA 3KF4A 3F3WA 3V51A 5I9YA 2XJ2A 1JKTA 4K33A 5K5XA 4UMTA 2B9IA 4HNFA 4QTDA 3I4BA 5C03A 4J8NA 4JQ7A 4CZUA 4O91A 3RHXA 3MTFA 1CKJA 4FKRA 3TL8A 4IEBA 4G5PA 5E7RA 4HYIA 2QO9A 4GU9A 2YM5A 4YPDA 2BCJA 4WIHA 3E63A 1OPJA 3HMPA 2B9JA 3OBJA 4YC3A 4NCTC 3SVVA 1ZYJA 2CHLA 3E5AA 1OMWA 3F66A 1DAYA 4FSNA 4TTHB 1ZLTA 3DDQA 3Q9WA 4BL1A 3CPCA 2V7AA 4WHZA 3QTXA 4EH4A 4FKLA 4H1JA 3D14A 1PMUA 4V0GA 4KSPA 3HDMA 4TPTA 5J95A 4KD1A 3VULA 3IPHA 4QP3A 1H0WA 3R1YA 4YZMA 3BHHA 3R6XA 1BI8A 3G5DA 1JOWB 3G6GA 1QPJA 5B7VA 5FXRA 3HDNA 4O0WA 4UYAA 2X4FA 4I6HA 3WZDA 3NW7A 4BTMA 2UZTA 2WU6A 4NEUA 3MVHA 5DFPA 2OIBA 3ZTXA 5CT7A 4ZTLA 3ZEWA 2WPAA 3W16A 4EH7A 4V04A 4GV1A 4ERWA 5L2SA 2UZUE 3NNXA 1APME 4FYOA 5DN3A 1OKZA 1Q41A 5AR8A 3QC4A 5JK3A 2ITNA 2UZVA 3HV7A 4PWNA 5LVOA 3L8XA 4E4XA 3A8XA 3F3UA 4QQJA 2XUUA 2OK1A 5CY3A 3II5A 3P23A 4Y72A 4QP2A 3HV3A 3HL7A 3KULB 2VTIA 2YHVA 1MP8A 1M17A 1PXMA 2R5TA 4WD5A 3UDBA 5J7BA 4AW2A 2GNHA 3DAEA 2QOHA 4X21A 4L3JA 5GJGA 3ZFXA 3GFWA 5IA2A 4CRSA 3CGOA 4MCVA 4E26A 3NYOA 2ZV7A 3NDMA 3PIZA 2R3OA 4YJRA 4J99A 4RRVA 2OF2A 3WF6A 4GCJA 4HVIA 1U4DA 2W4JA 1OZ1A 3ZXZA 4FC0A 4X6RA 4YJVA 3QTWA 5HNGA 4FZ6A 4PV0A 2XB7A 4M69B 3ZUUA 2P55A 3LW0A 5DA3A 1GZKA 4WSQA 2QR8A 3HGKA 4FF8A 3FHIA 3K3JA 4FK3A 4F9AA 4GEOA 3GI3A 3V01A 1GIJA 2FGIA 5FXQA 1OUYA 2ITXA 4MF1A 1IA8A 3W55A 3LFAA 2QOKA 3DU8A 1KV2A 3THBA 4DYMA 3PLSA 2QOBA 2QO2A 3ETAA 4KSQA 1WBNA 4YLLA 4L53A 5FXSA 4FVRA 2ZM1A 2YM8A 3PA4A 4WNPA 3U6IA 4I1ZA 2YIYA 4IAZA 4MBIA 4W4VA 2WQEA 3DBDA 3VBTA 4C0TA 1PHKA 1M2RA 2JBOA 4L6QA 4L7FA 1UVRA 4DGMA 2NRYA 3OOMA 5M51A 3MPAA 3DXNA 2P0CA 1BI7A 2WIHA 3FMMA 2B52A 3VUMA 5J5SA 3AD6A 1AQ1A 3HV5A 3ZBFA 3BYSA 2XNOA 5BUJA 3FLZA 4LL0A 4YP8A 4MD8E 4EH3A 1H1WA 4CCBA 5CTPA 3BELA 3L8PA 3UODA 1QL6A 3HMNA 3KXZA 1UU3A 3GC8A 3HX4A 4NJ3A 2VTOA 2IN6A 4P7EA 4RIYB 4EC9A 5I0BA 3DJ6A 1RE8A 4D2WA 3VHEA 3G33A 2ETKA 5HE0A 3V6SA 2XVDA 2P33A 4F08A 2FSOX 2W96B 1O9UA 4YMJA 2UW4A 1KE7A 3NYNA 3M42A 2UVXA 3A7HA 3GU7A 3KK8A 1PXJA 3HMMA 5LCKA 4AW1A 2BTRA 3QXOA 4YHFA 2RFSA 3FC2A 4NM5A 3O8PA 4O2ZA 5KHWA 2GNGA 3VBXA 4NUSA 4JDJA 4V01A 3SW7A 2X2MA 3R00A 5ETIA 3VS0A 4O38A 5K9IA 2VWIA 3CEKA 3OZ6A 3DLZA 5CNOA 5KKRC 1ZAOA 4IX4A 4CQGA 5IZFA 3MYGA 4IHPA 1U5RA 4QT1A 5LJJA 3JUHA 2JAMA 2XRWA 4G3CA 5C8NA 3TXOA 2WMTA 1Q99A 3KXMA 3T9TA 4KABA 4JBQA 3NX8A 5CVGA 3RPVA 1WMKA 4YR8A 5IMEA 2F57A 2FSMX 2R7BA 3I1AA 4DTKA 4FT7A 4XG3A 3T3VA 4KAOA 4W4XA 2HELA 2CSNA 4RWJA 4YC8A 4WKQA 3KVWA 4K1BA 4FT3A 3KQ7A 4HCVA 5GJDA 2C6IA 4QMWA 2A0CX 3GOPA 1YXVA 5FG8A 4ANMA 4FSTA 3G2FA 5AUTA 5DIAA 1UNGA 4IZ5A 5FP6A 2BUJA 3ORPA 1JKSA 3UG1A 5CU4A 5DR2A 4U44A 4OAVB 5HIBA 1BX6A 4QTCA 3D7TA 3HRFA 2C6TA 3EFLA 2RIOA 3DB8A 3QGYA 3VHKA 3FE3A 3JY0A 3MVJA 4C8BA 2A2AA 4D55A 3ODYX 5HCZA 5IUGA 3DQXA 4IAIA 4CZYB 1Y6AA 5E90A 5HX8A 2YITA 2OBJA 4C34A 2BZIB 4CKIA 3DFCB 4ZIMA 4IFGA 4M3QA 5HG9A 4NKAA 4X7QA 4QOXA 3ANRA 5H8BA 1YOMA 2A27A 1MQ4A 3QWJA 1WBPA 5JH6A 3G9NA 4NFNA 3PVBA 4BCNA 5CXZA 4FMQA 5CI7A 3UQCA 4RIXB 4L43A 4J1RA 2HOGA 2YIRA 2FO0A 1J1CA 5HHWA 3OWKA 5HG7A 2B1PA 5AUYA 3UJGA 1WAKA 5IH5A 2WFYA 4AE6A 3ZCLA 3FSKA 3ZONA 4FIGA 3CJGA 4U79A 4Z9LA 3ZM4A 1PMNA 3IDCA 3EZVA 5CF4A 4A07A 3GT8A 1Z57A 3I7BA 4YHTA 4EQMA 2XNGA 5AV2A 4D2PA 2J6MA 3QTUA 4F63A 3P7CA 5AUZA 2OH4A 2JD5A 4L3PA 1P4FA 1Q8TA 1W84A 1JNKA 2JDTA 4G16A 4BB4A 5LMKA 4BIDA 2BDJA 4QNAA 1YXUA 5K0KA 5AA9A 5JEBA 2RL5A 2PVFA 4HCUA 4Z55A 4WG5A 3Q32A 3MS9A 2HY81 4XNEA 4EK4A 4IVAA 5CQWA 5CVHA 3QKKA 3Q96A 4JDHA 2EU9A 4WSYA 5ANEA 4CYJA 3SHEA 5IF1A 3SXFA 4CTBA 2VTRA 3S2PA 1VJYA 1OGUA 1X8BA 2ETMA 5ITAA 5K5NA 4PL3A 5TF9A 2RF9A 1K3AA 2W1ZA 4FOBA 4NH1A 1WBOA 3G0EA 4QQCA 4FT0A 3RM7A 5JMSA 3AT3A 2JDSA 4ASXA 4F6WA 2EB2A 5CU0A 3SA0A 4C62A 3NUSA 4W8EA 4IAYA 5F1ZA 2IZRA 3QFVA 4JBPA 5LARA 3NUXA 3UNKA 4A9TA 4X3FB 5FM3A 2GCDA 4HGSA 3TNPC 4BTFA 3OTVA 4RJ6A 2HXLA 3L9NA 4GFOA 4IWQA 1OVEA 4FNWA 3BGQA 1Q8YA 2UW0A 4BWKA 4D2TA 5M44A 4U45A 5E8SA 2GNFA 3OROA 3DKGA 2IZSA 2WAJA 5TOZA 2IW9A 3DBFA 5KX8A 2R3PA 4K77A 4GIHA 4ARKA 4ALUA 5JFXA 1O6YA 5CU6A 4ANBA 1YDRE 2JIVA 4DGOA 3RBWA 3DCVA 4MQ2A 3H9RA 3F82A 4CTCA 4RX5A 3C0IA 3DB6A 1H1SA 2PMNX 3DGKA 3Q5ZA 1QPDA 4IZ7A 5C27A 2C0TA 4U40A 4CVAA 4CCUA 4GVAA 4FSYA 2I0VA 5AP0A 1JSUA 5AEPA 4UN0C 5C26A 3CBLA 4R7HA 3RINA 4UB7A 3VBVA 2R3QA 3VS2A 2XK4A 3RP9A 2R2PA 4BI0A 5A54A 2WTKB 3R8ZA 3VRZA 5EM8A 3PY3A 4FV8A 1OITA 4X2KA 5EG3A 3QTRA 4PPAA 1Q3DA 2C6EA 4EWHA 2EXEA 2X39A 3IONA 2C3LA 4RJ5A 3W2QA 4RPVA 5IG1A 5IA5A 2PWLA 4E4LA 3ZFMA 4GRBA 4TYGA 5FEEA 4RLKA 3UBDA 3IOPA 2V0DA 1VEBA 3O51A 3PA3A 4HPUE 3TV4A 3VS3A 4FZ7A 4CLIA 4L8MA 4BC6A 4KIKB 3KXXA 4PPCA 5CSHA 4USFA 3JXWA 3UOJA 4XG6A 2GDOA 4ANLA 3CTQA 2XKEA 3FL4A 1YXSA 3PXQA 2YIQA 3BGZA 3RZBA 3VUTA 5CAPA 3MI9A 3EQHA 3O2MA 5HIDA 4G3DA 3PJ8A 3GU5A 4FNXA 4KRCA 4WRSA 5TO8A 3ZC5A 1UKHA 3EQIA 2W1EA 3QD3A 4W4WA 4RT7A 4YZ9A 4ZJVA 3OW3A 5DH3A 3SDJA 5M4FA 2JKOA 4ENYA 5BX0A 3QZIA 5KE0A 3TUDA 5DLSA 2FSLX 3KEXA 1PMVA 4XEYA 4XP0A 5BMMA 3HA8A 1JSTA 4M12A 3UC4A 4YJOA 2W5HA 4EEVA 4IDTA 4RIWB 1MUOA 3MFRA 1YHVA 4OTRA 5JZNA 2J90A 4D1SA 2O64A 4B4LA 3O7LB 4RC4A 2QD9A 2WNTA 4NM3A 4LM5A 1R78A 4BHZA 3DV3A 4BRXA 5DT3A 1JSVA 3CE3A 5EK7A 4J8MA 4GIIA 5JN2A 4KNBA 2WEVA 2IJMA 3F2NA 4BTKA 5IA3A 5HE1A 3A7IA 2JEDA 1P14A 3PG3A 3FQHA 2YJRA 3OC1A 3V5LA 5FTQA 1KE8A 3DLSA 4TWCA 5AM6A 1NY3A 4ZSLA 5HVJA 2F7ZE 4CSVA 4FV4A 2Z7QA 3ZU7A 2CGXA 5M4CA 4XOZA 3PG1A 3FZOA 2VO6A 5AP3A 4ONAA 3ZXTA 1UV5A 4I24A 3JPVA 3ROYA 4NCTA 3GCSA 4TL0A 4QMYA 2YM7A 3QRUA 4V05A 3QCQA 4GSBA 4BKJA 3GCQA 5HO8A 3AOXA 1EH4A 4AF3A 3F5GA 3HNGA 2FH9A 2P4IA 1ZYCA 4E4NA 3GP0A 2LAVA 4CFXA 4DFZE 4CKRA 3QBNA 3EB0A 4IB3A 4Q2AA 2C6MA 5JFVA 3MBLA 1WBTA 3QXPA 2G1TA 2H8HA 3AT4A 4YTHA 2WU7A 1JKKA 4AOTA 4BCKA 1YOJA 3GCUA 3EN9A 4DH7A 5JQ5A 4EBVA 2RFDA 3BCEA 4O0UA 5FBOA 3BPRA 4HCTA 4X3JA 3H9OA 3PP1A 3M11A 4YNEA 1S9IA 2YCFA 4IB0A 4EOQA 4EUTA 4PPBA 5KO1A 2RFEA 3FC1X 5E8ZA 4TYHA 1UA2A 3G0FA 4CZTA 4IH8A 2C3IB 3VO3A 4ZJJA 2OZAA 3UOLA 3LPBA 3IGOA 4IADA 4QQ5A 4PP7A 2E9NA 5CF8A 4BDKA 3BWFA 3ZLXA 3KGAA 3P9JA 5AP6A 3HLLA 2UZBA 2EWAA 4YZBA 4AN3A 3ZRLA 5HD4A 3OFMA 3F3VA 4A4LA 3EFWA 3QTZA 3QA0A 3FMNA 2YIWA 4OTHA 2A4LA 3FI3A 2PY3A 5JGDA 3DS6A 5EYKA 4ACDA 3MFUA 3QHWA 4H58A 4NKSA 3CY3A 4F9WA 2ITQA 2BIYA 3W10A 5DMZA 4GJ2A 3E64A 5J7HA 4Z3VA 1H1PA 2OSCA 4QMOA 3W32A 1DM2A 5I9ZA 3Q04A 1Q97A 1AD5A 2OXXA 3TZMA 3FZRA 4BIBA 2JBPA 4C35A 4DFLA 4MXAA 4JDIA 3PJ2A 3AC2A 4AQCA 3N9XA 3AD4A 3A60A 3OBGA 3MSSA 5F95A 4ACMA 3FAAA 4L3LA 4RZVA 4BDDA 2VTAA 4I3ZA 4YBJA 4YGAA 3GCPA 4GUEA 4W9XA 1T46A 4IZYA 5JFWA 4EHEA 4M66A 4FG7A 2Z7LA 2DQ7X 5L2WA 3G51A 1GJOA 4ASDA 3W2SA 4J7BA 2IVTA 2FYSA 2F2UA 2PMLX 4IB5A 3MV5A 3RTPA 2V22A 4TYEA 3UNZA 5AMNA 2YWPA 3NSZA 1M14A 5T6KA 2JFMA 3NNWA 5EI8A 5IDNA 2PZPA 3P1AA 1OL1A 3TUBA 5EDPA 2C6KA 2WIPA 4MNEB 3PJ3A 2X2LA 5HVYA 3VS6A 2CMWA 2OJIA 4XHKB 2J5FA 4Y95A 4DGNA 4NTSA 1XH7A 1Z5MA 1E9HA 4K8AA 4NM7A 2ZV9A 3C13A 4MNFA 3WOWA 2JDVA 1KV1A 5DE2A 4ZZOA 3E88A 3R9HA 1RQQA 3MDYA 2A19B 4I41A 4AN2A 4C4HA 2UUEA 3CXWA 2BFXA 2QCSA 3DJ5A 3PRFA 3AC4A 3TI1A 4C4GA 5KMNA 3MIYA 4X2JA 3HECA 3MW1A 2WMAA 1GY3A 2XNNA 4L44A 2G2FA 4KKEA 3PVGA 2XKDA 5ANIA 3UGCA 4BCHA 3RZFA 4OTDA 4DFXE 4AX8A 4ZTMA 4XX9A 4JL9A 3NWWA 2XK9A 4MTAA 3ET7A 3AQVA 3FXXA 4D2RA 3ITZA 2V7OA 2C5XA 1ZY5A 2R3MA 3RAHA 3D7ZA 2ZAZA 3QUPA 3ORKA 3GQLA 2HIWA 5HKMA 5K3YA 4BDGA 2G15A 3EKNA 1XH9A 4FIFA 4FVPA 2R3NA 3ROCA 3ORTA 4GVJA 5AX9A 4EH8A 3O8TA 5J87A 4CFWA 3KN5A 4N4SA 4HNIA 2V5QA 5CI6A 1XJDA 2X6DA 5EM6A 3UPZA 3OUKA 1FMKA 1U59A 5JFSA 1WVXA 3D83A 1I44A 4L52A 5HICA 4U80A 3TUCA 2JAVA 4RG0A 3GGFA 3KN6A 1J91A 4FT5A 4A9RA 5HBEA 5K4IA 3FDNA 1V0BA 3IW7A 4F65A 3COMA 2X6EA 3I0QA 3OXTA 3LCSA 4GJ3A 4PY1A 5I9UA 4V0GB 3ALNA 4E5WA 3ULZA 2X0GA 1YWVA 2FB8A 3D5UA 4IBMA 4QP8A 3NRMA 4EKKA 4PNKA 4IWPA 3R73A 2QC6A 2WZJA 2RG5A 3E8NA 3EQCA 5BVWA 2BIKB 2QU6A 3PY1A 4OGRA 4S2ZA 1PY5A 2JC6A 4BF2A 5JGAA 4KB8A 1URWA 3VQUA 4ZP5A 3EKKA 4IW0A 4D1XA 3R30A 4TYJA 5FBNC 2IZTA 3E3BX 2ITWA 3VBWA 3M1SA 5HBJA 2GMXA 4EI4A 3LFNA 5AR2A 2O8YA 3D0EA 4J53A 3ZDUA 3U6JA 4HJOA 4QYYA 5EHLA 2ITZA 3P7BA 2J4ZA 3GC0A 2Z7SA 1Q8WA 3PSCA 4EHVA 4PTCA 5CAVA 3UYSA 4FNZA 2XZSA 2X4ZA 2Y0AA 3DBEA 4IM2A 4ZSEA 4DFYA 2XNBA 5E8UA 4AP7A 3N51A 1PXLA 3FUPA 3PIXA 4GK2A 3F69A 4RSSA 3FKLA 1H4LA 4F6UA 4E8AA 4X3FC 1REJA 1Q8UA 3BYMA 4PUZA 5CNNA 1OIYA 3TJCA 3O7LD 3MJ2A 5B2MA 4BKZA 3POZA 3TZ8A 1MQBA 3QTQA 3WF5A 3WIKA 4L45A 2YFXA 3H0YA 3ZUTA 2J7TA 5CSWA 2R4BA 3L9MA 4TWOA 1ATPE 4UXLA 3FZPA 3AG9A 2PVHA 4PL4A 3LJ0A 5KZ0A 5HTIA 3RJCA 4TY1A 5CLPA 2C4GA 5ANJA 3VS1A 4UWBA 1IG1A 1NXKA 4Q9ZA 4ACGA 3DDPA 4LGDA 5JKGA 1CDKA 2CJMA 5CAQA 4C38A 4QPSA 4HGTA 1NVRA 4ZS0A 2PK9A 2R3HA 4AGCA 2BKZA 3E7OA 3LFSA 4JNWA 4AT5A 3IK3A 1BL7A 4OBOA 3ZC6A 3DZOA 4R5YA 1H08A 4RJ4A 4EZ5A 2JLDA 2B4SB 3EN6A 2FSTX 2QOFA 4DEEA 4XG8A 2NPQA 2WTKC 1OPKA 2XM9A 3OUNB 3GB2A 4Q5HA 3UE4A 4U5JA 4JAJA 2Y4IB 4L42A 3VS7A 4I5PA 4QO9A 3UQFA 3EWHA 5DEYA 4QPMA 2UVYA 5J5TA 3R63A 1PW2A 4LMNA 4MWIA 4WUAA 4AACA 5E8YA 5AUWA 5FLFA 2I0YA 4I94A 4E6DA 2HWPA 4JAIA 2ONLC 4LOQA 2C5NA 4EL9A 4G3EA 3KB7A 4FIEA 1JAMA 2QHNA 4FTUA 4XLVA 1AGWA 4M13A 3EQFA 4XJ0A 3SC1A 3QQHA 4LRKA 5A4QA 2OFVA 1LEZA 1H28A 1PYEA 3JVSA 3SD0A 3UP7A 3GU4A 3NCZA 4L9IA 5HIEA 4RX8A 4BTJA 2QI8A 4EJNA 4GH2A 3AC8A 1KOBA 1YHSA 5EFQA 3V6RA 2YDIA 4F7JA 3R2YA 2VWVA 3LXKA 4D5HA 4LUDA 1OKVA 2W05A 2YDKA 2F7EE 4MXZA 1H01A 3BU5A 3BLQA 3TKIA 3MH3A 3ERKA 3NS9A 3LMGA 4H3PA 4RBLA 2Q0BA 2DS1A 2VTPA 3MH1A 4GT4A 4F0GA 5CEKA 3OD6X 4MXYA 5JT2A 4PX6A 2CCIA 1V0OA 5M4UA 4QP7A 1SM2A 3FYKX 4IZAA 5DR9A 3DPKA 2ITVA 4PMSA 5D1JA 3UOHA 3KC3A 5A4TA 4IQ6A 2H34A 4AFEA 5L8KA 2VO7A 2XCHA 4QD6A 2H6DA 4EYMA 4DG0E 3I81A 4QQTA 3RHKA 5I3OA 4BDJA 5FQDC 2Y6OA 3KFAA 4PQNA 3RPYA 3ZRMA 4CQEA 4ID7A 4UWCA 4J52A 3D7TB 4EOOA 4UBAA 5D10A 2IW8A 2BZKB 3IQ7A 1DI8A 3OMVA 4RA5A 2GNLA 3ZRKA 4XV2A 4XV3A 1YDSE 4KRDA 1H00A 5AUVA 5CANA 2ITYA 3IGGA 3R8MA 2V55A 5BVOA 1P5EA 4FV5A 4WUNA 3V8TA 4ZTSA 4DH1A 3DZQA 4GK4A 1PXNA 3K2LA 2WGJA 1FOTA 2J51A 3MPMA 3ORMA 4FG8A 4G6LA 2YA9A 3E93A 4BDCA 4NWMA 4U0IA 4XG4A 3FL5A 2P2IA 2VU3A 4QP9A 2XP2A 4CV8A 3BEGA 4U6RA 4O6LA 4YNOA 3NGAA 3NCGA 4GU6A 4AZTA 2HWOA 5FD2A 4H3BA 3B8RA 4YU2A 4FV2A 4YZCA 1WCCA 3C50A 2YISA 2WOTA 4PDSA 4LGGA 4B8MA 5D41A 3NEWA 2E2BA 3OY1A 2JDRA 3I5ZA 4AA4A 1GIHA 3H0ZA 3QL8A 3KRRA 3C4FA 3AD5A 3AGMA 3SOCA 4FV6A 4FSZA 4IX3A 1P2AA 2R64A 4HGLA 3UO4A 3V5QA 3TACA 4LFIA 4C02A 4ZLZA 5AR7A 2R3FA 4HYUA 4NIFB 5AP2A 4D2VA 3SKCA 1H25A 3DKCA 3EJ1A 4GYGA 4ACCA 4M7IA 5AV0A 4PTGA 3U9NA 3S3IA 4JX3A 2VO0A 4BWPA 3VJOA 4DBNA 1XBCA 3QGWA 3C51A 2GNIA 5A6NA 3S00A 4AA5A 3ZYAA 5DGZA 1M2QA 4G3FA 4J71A 3QYZA 4H3QA 4YJTA 3OEZA 4EWQA 4ZY5A 3ZSGA 1Q8ZA 4JQEA 4BGGA 5CEQA 3GCVA 3R1SA 2BHHA 4XH6A 3BRBA 4EQUA 2BAKA 4IVBA 4GFMA 4K9YA 2OH0E 1YW2A 5LVPA 3PPZA 5HNIX 3CC6A 1YOLA 2Y9QA 3E8CA 5E1EA 3DNEA 2FA2A 4U7ZA 5E91A 5FEDA 1PJKA 1PKDA 3FXWA 4FODA 4DEGA 5B2KA 4C33A 3ORXA 4RGJA 3VN9A 4ZOGA 1Q5KA 3FMJA 3QD4A 5DRBA 4AE9A 3W1FA 5GZ9A 3CTJA 5L2QA 4YO4A 4NM0A 4XV9A 3WZEA 1R0PA 3MWUA 4I22A 3VUDA 4FYNA 2VWZA 2HY0A 3MN3A 4GG7A 3G90X 4LV8A 1VR2A 3VBQA 4IVCA 5CAUA 3AT2A 4BGHA 2BRNA 2VTHA 2HXQA 3HKOA 1ZMUA 2YM6A 4M15A 4U42A 3RNYA 2VGPA 3S95A 3HZTA 5A14A 2UZWE 4UX9A 3UQGA 2C0IA 1J1BA 3D15A 3ZO4A 5HBHA 1OL2A 2GTNA 1PXPA 4QTBA 4BDFA 5AUUA 5F9EA 5LWNA 1FQ1B 1VYWA 2XF0A 3M2WA 4LOOA 1G3NA 4WNMA 3ELJA 3JYAA 3UIBA 4D28A 1U54A 3K5UA 4UALA 4C58A 1WBWA 4KBCA 2R3KA 1RJBA 1L3RE 2QHMA 1ZXEA 1QMZA 2G9XA 3RI1A 4ITJA 2X7FA 4B0GA 2WQMA 1URCA 4LL5A 4OT5A 2CN5A 4FIHA 4IM3A 5FM2A 4WT6A 5JQ8A 3TKUA 4USDA 2W0JA 2ZV8A 3WF7A 1KSWA 3I7CA 2OI4X 3LXPA 4FKGA 2OFUA 4BCPA 2FUMA 3NW5A 4Z16A 4GG5A 4PP9A 4I5MA 3QYWA 4GT5A 4QYGA 4KA3A 4M0YA 4CMOA 2UZNA 3F3ZA 4FL2A 1OPLA 4ZTHA 3CR0A 3ENMA 5IEXA 4JIKA 3QUDA 4HVSA 3TKHA 3HVCA 3Q6UA 4FKIA 3P78A 4MBLA 5HCXA 3IG7A 3Q3BA 4N0SA 3R8PA 3C9WA 4PDPA 3A2CA 5AR3A 4F7SA 2PZ5A 3PJ1A 1FVVA 5LMBA 2XIYA 3R7IA 2QVSE 2JKQA 1ZYSA 3W2PA 3OWLA 4L67A 3TIZA 1JKLA 4DEAA 2PTKA 3KXHA 2F4JA 1GZ8A 3FMLA 3O0GA 2YIXA 3I79A 4FTCA 4E5AX 5KHXA 1KOAA 1BUHA 3IW6A 3GC7A 3NAYA 4JR3A 4FICA 5AP4A 3RWQA 3ZO1A 3MIAA 4AFJA 3OXZA 2XYNA 3FMEA 1UU9A 2G2HA 3BLHA 4YTIA 3GUBA 3BX5A 4IC8A 4M68A 3HUCA 2KTYA 3LFFA 3MVMA 4GL9A 3GOKA 4I6FA 4JG7A 4MD7E 5CWZA 2JDOA 2XH5A 4PMTA 3R0TA 5EOBA 5HLWA 4FSMA 4DH3A 2XM8A 4P4CA 4RFYA 5LVMA 3H9FA 3HRBA 2ERKA 5CEPA 5JZJA 5KUPA 3FWQA 3GVUA 4XRJA 4MF0A 3JY9A 3U9CA 3R7EA 4YURA 3G9LX 2J9MA 4D1ZA 3GNIB 2JIUA 5C8MA 2BR1A 2C1BA 2GFSA 3FLQA 2YERA 4EOIA 3LQ8A 2R3IA 2OKRA 3D4QA 3R1QA 3EQPA 4FTJA 4GUBA 4RQVA 3FQEA 1NVQA 4AA0A 4P5ZA 2WXVA 2X9EA 3MGYA 3Q6WA 5ANKA 5FP5A 4EK5A 4NW5A 2R7IA 3OY3A 1OIUA 1UNHA 4TZRA 4AXAA 4E3CA 4EOPA 4GYIA 2NO3A 5KMKA 3SW4A 3E3PA 3QHRA 4YJSA 3KF7A 1XBAA 4FL1A 2ERZE 3TNQB 3R01A 3ODZX 3TT0A 5BNJA 3ACKA 3VW8A 5K4JA 1HCKA 2YACA 4ZSGA 5C1QB 3RK7A 3UPXA 2OJGA 4YTCA 3TG1A 4C36A 5A3XA 3D5VA 3OT8A 4KINA 5L2TA 3LQ5A 3NIEA 3W2OA 2QOQA 3CY2A 1H1RA 4M84A 4ZLYA 4ACHA 4TNBA 4RC2A 4OW8A 4YO6A 1BL6A 2AC5A 3RMFA 4U3ZA 4D9TA 3MA3A 3QQFA 3FJQE 2OZOA 5CSVA 3C1XA 3QQGA 5J9YA 4FZFB 4A4OA 1ZMWA 2Z8CA 5A4LA 3DY7A 3UO5A 5DPVA 2Y7JA 5DT4A 4P90A 3LCDA 5DR6A 5LVLA 5BVFA 4YJQA 2GU8A 3CP9A 4I0SA 4TYHB 1PMEA 5TT7A 4QYHA 3ALOA 3E7VA 3RCDA 3VF8A 4QPAA 4HW7A 3VNTA 2OZAB 3OG7A 3PXKA 4XS2A 4ZAUA 3R9OA 5C9CA 4UYNA 1KE9A 1R39A 3VUKA 4HZRA 1SYKA 2AYPA 5AX3A 1OL7A 1OM1A 3NUNA 3ORNA 2HW7A 5HG5A 2PE1A 2OJJA 2R3JA 4RFMA 1MRUA 4ZSAA 3IKAA 4LMUA 4NU1A 3R7UA 3TNWA 3A8WA 5LQFA 1KWPA 1QCFA 4ZTRA 5AADA 2ZB1A 4WNOA 1FVTA 2W1HA 2XK6A 3RPSA 4YC6A 3SAYA 3FY0A 5EYDA 3QRKA 2XNMA 4XCUA 1Q24A 4K6ZA 3WILA 4ANOA 4USEA 2BZJA 1CKIA 5EI2A 3TV7A 4AOIA 4J95A 5M57A 5IEVA 3HUBA 3BBTB 4FX3A 3F5XA 5HD7A 3E87A 5BYYA 3C7QA 4X2FA 4C3PA 4E4MA 4F1MA 2XIKA 1E1VA 3H3CA 4O0RA 2ITTA 3W18A 4TWPA 3ZBXA 5BUIA 4PNIA 5AUXA 3BZ3A 4CFVA 1W83A 5IEYA 2GFCA 4HVDA 4FNYA 5ANDA 2XBAA 5FTOA 2XEZA 4FTTA 4TXCA 5LWMA 2BDFA 2IWIA 3BU3A 5KMJA 3QRIA 4FKSA 2IVUA 2SRCA 5AIRA 3HYHA 5IISA 1CTPE 2ZJWA 3C0HA 4BDHA 3L9LA 4JG8A 1MRYA 1WBSA 3MJ1A 4FTAA 5CU3A 3P4KA 2ZOQA 3BE9A 4TNDA 5DRDA 2W9FB 3C0GA 2PVLA 2B54A 1UKIA 3FLYA 3QZFA 3R28A 5ETCA 4AZSA 3QKLA 4G2FA 1OIQA 4BI1A 4EH6A 5DBXA 1JWHA 4BHNA 1M52A 4JG6A 3WBLA 4APCA 4AOJA 5JRQA 5ACKA 4JLCA 4CT2A 5B0XA 4FTKA 4ZEGA 2QLQA 2CDZA 4IAAA 4OTWA 4QYEA 2YCRA 3VJNA 4DG3E 3IECA 3CS9A 4MXOA 2VTTA 5H9BA 4F9CA 2VTSA 2ZDTA 5J9ZA 4Y5QA 4UZHA 1HCLA 4C4FA 4EOJA 2ONLA 2OW3A 5HO6A 4C4JA 4TT7A 2XKCA 4ZZMA 4IXPA 3UVQA 2PVNA 5I9VA 2VWYA 1OL5A 3TZ9A 1V0PA 3OWPA 2BAJA 2XIZA 5EDRA 4OTQA 2H96A 5H3QA 3SQQA 4Z7GA 4D9UA 2X81A 1REKA 2VTJA 4BDBA 1FVRA 1Q61A 4G1WA 3MA6A 4JX7A 3NNVA 3UMWA 5CU2A 2O2UA 5CALA 3RK9A 5J1WA 2XMYA 4CT1A 4CV9A 1PYXA 2REIA 4JRNA 5JGBA 3QLGA 1Z9XA 4I20A 5TR6A 5KKRB 1CKPA 1B39A 4L46A 4S30A 1WVWA 3DK3A 2W1DA 4DEIA 3RM6A 4ITIA 5AIKA 4AZEA 2QNJA 4JBOA 4Y83A 3FHRA 3R02A 3PE1A 4RZWA 4S34A 3VAPA 4U41A 4I6QA 3F5UA 3R1NA 5DEWA 4EC8A 4A9YA 4EYJA 4ASZA 1B38A 1YXXA 3NR9A 4D4RA 3DTCA 4MD9E 2WMUA 4DHFA 3SXSA 3EL8A 3MB6A 4G9RA 3V5WA 5EKOA 3CKXA 4C57A 3MVLA 3QCSA 2BILB 4RJ7A 3R9NA 4X2NA 3R83A 2CGUA 3DAJA 3ORZA 4HYSA 4L00A 4N6YA 3VQHA 2R3LA 3ACJA 4LQMA 5LMKC 3B2TA 3L8VA 4F0FA 4I21A 4DGLC 5KMMA 2BRMA 4DLIA 2DWBA 4XV1A 4AW0A 4EKLA 1KE5A 4HGEA 3A7FA 2J0LA 3ZLSA 3ZEPA 3CJFA 2YZAA 3PPJA 3Q9XA 4RMZA 5ETAA 3F61A 3C4CA 4BZDA 1ERKA 2W4KA 4YSMA 3DKOA 3G6HA 1JLUE 2DYLA 1GZNA 5CENA 5CF5A 2YDJA 2OJFE 3BHUA 3BV2A 1H07A 1STCE 2XRUA 3ZS5A 5CZHA 2W99B 3FMHA 5I9XA 4K2RA 3WZJA 3SRVA 4IE9A 3VRYA 4FKVA 5HTBA 4XBRA 3LVPA 2GS7A 5KMIA 3QD0A 4GW8A 2QONA 4BFMA 3HMOA 1Q62A 1S9JA 3P5KA 2PVMA 2I6LA 2X7OA 3DKFA 2E9PA 2QOLA 3KRXA 4NT4A 5D9HA 3RPRA 3VS5A 3PY0A 3QQUA 3U4WA 3F7ZA 2DUVA 3DBQA 5A4CA 3LAUA 4XYFA 2VWXA 2WMXA 4PF4A 4DGGA 4M0ZA 2C6DA 2HW6A 2C5VA 2E9OA 3MY1A 2ZVAA 4LYNA 1NA7A 4RC3A 2UVZA 5E92A 2AUHA 4FK6A 1YQJA 2ITUA 2GPHA 3F5PA 2IO6A 2X9FA 3BYUA 4DLJA 4F4PA 3I6WA 1SVEA 3ZH8A 3B2WA 2NRUA 4DITA 3EMGA 4BBFA 4OBPA 3FYJX 4B7TA 2P2HA 3MFTA 2WEIA 4H36A 5HZNA 2HZNA 2PZRA 2VWWA 3H4JA 4R3PA 3NW6A 4Y5HA 2B55A 1CMKE 2O65A 3EN4A 4F64A 4UMRA 1YRPA 2PMOX 3RVGA 1WFCA 3LJ2A 2BALA 3RAIA 4AWIA 4I93A 4YZDA 4AZFA 3L8SA 4JBVA 3DA6A 2O0UA 2GTMA 3D94A 4MH7A 2EVAA 2XS0A 4U81A 5IMXA 2ZB0A 4UEUA 5HO7A 2BDWA 3OT3A 5IUIA 2YN8A 3DJ7A 4FV0A 3QA8A 4RWKA 4UV0A 1JBPE 3T9IA 1ZOHA 3U87A 4BCIA 4M97A 4FR4A 5HESA 3L1SA 4FZAB 1A9UA 4JS8A 5DG5A 4G17A 3EIDA 4W4YA 4XP3A 3FQSA 1IR3A 2R3RA 3ZMMA 5D11A 3GQIA 2VV9A 3C4XA 4M67A 2QQ7A 1GNGA 4EHGA 4BCMA 2O3PA 3Q2MA 3RK5A 4LV5A 4RVTA 2X2KA 4QMQA 3UNJA 4F0IA 4W8DA 4FUYA 3QCXA 4R1VA 2PVRA 2Y6MA 3C4ZA 2YJSA 4TWNA 5EHYA 1M2PA 4KKGA 2RGPA 2WTJA 3TTIA 3W8QA 4FTRA 5L8JA 2JFLA 4FSUA 5BPYA 3UMXA 2VNYA 2XK8A 4L68A 3VWAA 2QOCA 3V5TA 2B9FA 3HV4A 4E6AA 2ZYBA 3VUGA 2OG8A 4EZ3A 2WMWA 3TNHA 1DAWA 2W1GA 3OCTA 4EHZA 3NIZA 4UMPA 3O50A 1F0QA 3E8EA 1OKYA 4X6QC 5M4IA 2BMCA 1YWNA 3BHVA 3UG2A 2OIQA 5L6WL 3REPA 3EQGA 4QMNA 4PDOA 4CKJA 3R7OA 3AXWA 3DNDA 4KWPA 1H8FA 3LHJA 2C6LA 3E92A 5AM7A 3UVPA 4OBQA 4H1MA 2WQNA 4ALWA 2OIDA 4BDAA 4CNHA 2EXMA 2VTMA 3QX2A 4O0YA 4WA9A 4JOAA 4F7NA 5BUEA 5IA4A 2C5OA 2ZMDA 4QRCA 5HLNA 3R22A 4FL3A 4FIJA 2BHEA 3F7WA 4ZY6A 4F1TA 3F3TA 1HOWA 1W98A 4I4EA 2Q0NA 2XKFA 2R9SA 3BKBA 4ANQA 3NUUA 4XLIA 4LOPA 2XEYA 5E8VA 3UIMA 3F2AA 4E73A 5HU9A 5G6VA 3FMKA 3LFEA 4FVQA 5I3RA 3Q4UA 2VZ6A 2WKMA 2PMIA 2VAGA 5AP1A 2VD5A 4BKYA 3KMUA 2VUWA 3EQRA 4RVMA 3EQDA 3ZO3A 5AP7A 3R8LA 4S31A 1O6KA 3RKBA 3LE6A 2QKWB 3OOGA 3K5VA 2WO6A 4FTMA 3C4EA 3ZZEA 2WOUA 3U4UA 2VWUA 4BI2A 1WBVA 1H0VA 1U46A 2BZHB 3ZSIA 5KBRA 4MK0A 1TKIA 3IO7A 5CF6A 5EH0A 3IDBA 4FT9A 4EONA 2YEXA 3GENA 4RIOA 4BBEA 4RJ8A 3V3VA 2YAAA 4CFMA 3P0MA 3FZSA 1YVJA 2BVAA 4FG9A 5D7VA 1YI6A 2I40A 3FLWA 3NNUA 1PXIA 1DS5A 4BWXA 5IU2A 2E9UA 1VYZA 2C0OA 4G5JA 4G9CA 5HORA 5JRSA 2C30A 3R7YA 3TEIA 3WF9A 1O6LA 2QU5A 5EDQA 4DEBA 5F20A 1JPAA 3EYGA 5FRIA 3U6HA 4CXAA 2QO7A 3T8OA 3U8WA 5LXMA 2VWBA 3L9PA 4C7TA 3QF9A 5A6OA 4O6EA 3S1HA 2IVSA 4YBKA 4IAFA 4XG7A 4ZLOA 1IEPA 2CLXA 1TQPA 4C37A 4I5CA 3SOAA 3OS3A 4Y85A 4XRLA 5CSPA 5CYIA 4OTPA 4OUCA 4UXQA 2UV2A 3FV8A 2PE0A 2WHBA 3BI6A 3O96A 4B8LA 1I09A 1W82A 3MH0A 4ZXTA 4M14A 1TQMA 1ZOEA 3BE2A 5GJFA 1TVOA 2W1FA 3DOGA 3Q52A 2R0IA 4BVUA 4Z7HA 2R3GA 3ZUVA 4DH8A 3SLSA 2YABA 3TV6A 2KULA 2Y4PA 4ITHA 4IANA 3KMWA 5AP5A 5DI1A 2ZMCA 4YHJA 2QOOA 1SMHA 4JJRA 4PTEA 2Z7RA 1R0EA 5DT0A 3A7JA 4I6BA 4E6QA 2X8EA 4ENXA 2OXYA 3BHTA 4IVDA 3PVUA 3R71A 2QODA 2Z2WA 5E8XA 3RNIA 3K54A 5IPJA 1RDQE 1W7HA 2ACXA 3QQJA 3RPOA 2VRXA 4II5A 5BMSA 4L7SA 4C3RA 5HG8A 4CFUA 3GFEA 1M7QA 3OCGA 5ANOA 4J98A 3AC1A 2GHLA 4OT6A 5J1VA 3NPCA 2HAKA 4XOYA 3EN7A 5GHVA 4R8QA 5CQUA 1U54B 2QLUA 5EYMA 5GZ8A 2I1MA 2YAKA 1FINA 3Q53A 2HZIA 3QALE 3TZ7A 2B7AA 1T45A 3RAWA 4AGUA 4M8TA 1ZYDA 3AMAA 4XG9A 3TNIA 5FDXA 1B6CB 3FPMA 2HCKA 2I0EA 1VZOA 3A61A 2VN9A 4QMXA 5CT0A 3D5XA 4CD0A 4HVHA 5C8KA 4J97A 3TJDA 4I23A 4IWDA 2IW6A 5HX6A 3UIXA 3BIZA 3HEGA 3WZUA 4BYIA 2W1IA 1YKRA 3ZSHA 5KMOA 1IRKA 2CCHA 4CEGA 4FV3A 4PMPA 3AMYA 3PXYA 5EKNA 2UZOA 2OWBA 4DG2E 1P4OA 4FOCA 1KE6A 2UW8A 4KKHA 1LPUA 2W5AA 3QTSA 4MAOA 3KULA 4GMYA 4UY9A 4WBBB 3WYXA 1WZYA 4DEDA 3A62A 4O27B 4EBWA 2GQGA 2EB3A 3QZHA 4O2PA 3S4QA 4QMUA 3FKOA 1ZRZA 1R1WA 2C68A 3COKA 3OVVA 2ZDUA 4IMYA 3VF9A 3LXLA 3IOKA 3ZLYA 4MWHA 2X7GA 3QWKA 4TW9A 3WI6A 2WQOA 2WMBA 3COHA 5LCJA 3D5WA 1UU8A 3DT1A 4FTQA 5AR4A 3V5PA 4DH5A 3A99A 2EUFB 2X1NA 3ZZWA 1IASA 2IVVA 4M69A 3R8VA 5I5ZA 2XYUA 2JGZA 2XA4A 5EW8A 3OCBA 2PVKA 4N6ZA 5BVNA 4IC7A 1FGIA 4AN9A 4E93A 3EHAA 5DHJA 3MY5A 5E1SA 4LRJA 1XH8A 4UZDA 4FKJA 4YLJA 3TTJA 3CTHA 5F4NA 3FPQA 3RAKA 3KU2A 5CEIA 3UP2A 3KMMA 3FI2A 1XKKA 1G5SA 3GU8A 5L3AA 2GHMA 3MB7A 4AG8A 4BICA 4K11A 1ZMVA 2PL0A 2V62A 3IW5A 1ZWSA 2QKRA 3PZEA 3Q9ZA 4Y73A 3QRJA 5G1XA 3K3IA 3EFJA 3EOCA 4XMOA 5L8LA 2VO3A 3CPBA 4OAUC 1OUKA 4KIQA 4QP4A 5KZIA 4FBXA 3FXZA 3DQWA 5CEOA 1WVYA 3QQLA 2BRGA 2CLQA 3BQRA 1Q4LA 2JKKA 2Y8OA 4PRJA 3MFSA 4PMMA 1Y6BA 4QMLA 5H8GA 2WTIA 3IW4A 5L2IA 3KK9A 4RIYA 1ZZ2A 3KRWA 4B99A 3LCKA 1GAGA 3NYVA 3I5NA 1K2PA 5DOSA 1R3CA 3PVWA 3OP5A 4FTIA 4BDIA 1PF8A 3MH2A 3QKMA 5B2LA 3NYXA 1MRVA 4EORA 4EK6A 4FKPA 4RVKA 4W9WA 5D7AA 4IB1A 3FSFA 3RGFA 4S33A 4C4EA 2J50A 4U3YA 3UZPA 3B8QA 3QZGA 4FKTA 3Q60A 2RKUA 1RW8A 3S0OA 3CLYA 5A9UA 5AWMA 1A06A 3BYOA 3R8UA 3LFBA 3PA5A 4FV1A 5HI2A 4FI1A 4RVLA 2QOIA 3BEAA 3H10A 5TKDA 3RWPA 5AR5A 5AV1A 5TE0A 3QAME 3QX4A 5L6OA 3ZDIA 4CFNA 4LG4A 2W7XA 1YHWA 4NIFA 5EM5A 5F94A 3EN5A 3KCFA 4QMZA 1XH6A 4AS0A 4G3GA 2OXDA 2PZIA 4O21A 5EHOA 4D5KA 3QTIA 1V1KA 3IDPA 4GK3A 3LZBA 1XR1A 4O1OA 4BCGA 3LFCA 3PXRA 4FEQA 2W06A 5KCVA 4LRMA 4MYGA 3MTLA 2PSQA 4ZY4A 4ZTQA 1YI4A 2GSFA 3OCSA 1ZY4A 3CD8A 4A4XA 2IZUA 3EZRA 4FKUA 4QMMA 5AAGA 3LM5A 3NUYA 2GNJA 1YDTE 3CGFA 3VS4A 1SVGA 1M7NA 3FLSA 3HV6A 4CLJA 2CN8A 2NP8A 3R7VA 4BZOA 2BRBA 4KS8A 4MVFA 2B9HA 4QTAA 5HNBA 2B53A 4S32A 5J8IA 4NTTA 4E20A 3KRJA 5CS6A 3O17A 4MHAA 1F5QA 5LOHA 4F6SA 2CGVA 3I60A 4G6NA 4YJPA 3GXLA 3A4OX 2W5BA 2BPMA 4QMSA 4ANNA 4U9AA 3KY2A 3JS2A 3ZO2A 2OO8X 5H2UA 4AGDA 1QPCA 3FMDA 2F2CB 3CCNA 1SNUA 2OU7A 2HZ4A 5C01A 3PSDA 4X0MA 2VX3A 3EL7A 2WTDA 5CEMA 4RIXA 3MY0A 4NFMA 5A4EA 3DTWA 4QMVA 4OTIA 1XWSA 4WG3A 5AAEA 1PXKA 3Q4CA
chains in the Genus database with same CATH superfamily
1ZARA 1NVSA 3LFQA 3MPTA 4G34A 4Y46A 3BQCA 3QUEA 4FSRA 3VVHA 2EXCX 2UW9A 5BVDA 5HE3A 1F3MC 5IDPA 5JSMA 2UW3A 2BFYA 2VX0A 3BU6A 3PXFA 3F9NA 4IJ9A 4FZDB 4KBAA 3W33A 3ZFYA 3DBCA 3VUIA 3PYYA 2JITA 1SZMA 4R3RA 4GFGA 4JT3A 3KXGA 4UMQA 4WBOA 4EOKA 4IIRA 4LUEA 3UYTA 2PUUA 2WTWA 2WTCA 5DNRA 3O8UA 2F7XE 2ZV2A 3KL8A 4R3CA 4WRGA 5HOAA 1E1XA 1OECA 3P86A 1H27A 1XQZA 4ASEA 4EZ7A 4F99A 4YUQA 3DFAA 4BN1A 1XBBA 5H8EA 4A7CA 5BVKA 4EOLA 3CQWA 3P79A 2RG6A 3COIA 4RWLA 4IX6A 2CKEA 3QD2B 4AAAA 2W1CA 3EFKA 3GC9A 2X0OA 3CIKA 4O96A 5E8TA 4WO5A 3C4WA 3LXNA 3Q4TA 2J0IA 3E62A 4D4SA 2OGVA 2YLEA 2WMRA 2IF8A 4UWYA 5FWKK 4P5QA 2G2IA 3BWJA 4BGQA 5EW9A 4EK3A 3PWDA 2WD1A 2YLFA 4B9DA 4C4IA 4XP2A 3LM0A 5FEQA 2HENA 4Y8DA 1OB3A 4I4FA 3OXIA 4O0XA 2Y4IC 1QPEA 2XK3A 4I0TA 3P08A 4R5SA 5IH6A 4XUFA 4Q9SA 5CX9A 4RA4A 5HE2A 1UNLA 1FPUA 4K18A 3F6XA 4YJUA 4BIEA 1W0XC 2C47A 4E1ZA 4X3FA 1OIRA 4MXCA 3JVRA 4OLIA 5HLPA 1ZZLA 4YJNA 2W4OA 4PL5A 4XBUA 5T68A 5ANGA 3D9VA 1FMOE 4QMPA 3ZOSA 5FDPA 2XIRA 3OTUA 3ULIA 5IA1A 5HQ0A 4O22A 3GU6A 3GEQA 1YI3A 2VNWA 3QCYA 2C5YA 3PP0A 4FKWA 4IM0A 3FI4A 4DINA 1OI9A 2J5EA 4FTOA 4MXXA 3LLTA 4ZTNA 3EQBA 4FKQA 3V8SA 3U51A 1K9AA 3W2RA 4AU8A 5J9LA 1GOLA 2BRHA 2R0UA 1SNXA 4YLKA 4AZVA 4O0SA 3FLNC 4HZSA 3A4PA 3VUHA 2WELA 4RX9A 1U5QA 2AQXA 4QYFA 2I0HA 5FGKA 3WE4A 1W2DA 5I4NA 3ENHA 3VW6A 2OF4A 4D2SA 4F7LA 3UZTA 3R7GA 2PVYA 3BHYA 3PXZA 4Q5EA 4F9BA 3RCJA 1DI9A 4IJPA 4MEDA 4NSTA 2Z60A 3NUPA 4E7WA 3TCPA 3VBYA 4WG4A 3PSBA 4D4VA 3D2KA 4WOVA 3UO6A 4DC2A 5HEZA 4EH9A 3CQEA 3O71A 2XBJA 3PZHA 4D58A 2LGCA 3P7AA 2UZDA 3HA6A 3SRVB 3AC3A 4HVGA 1LP4A 3KXNA 2ITPA 4L01A 4N70A 5CVFA 3ZLWA 3OEFX 5EM7A 2XCKA 1YXTA 3PE2A 5ETFA 4RLLA 3BGPA 1TZDA 4CMUA 4CRLA 4X2GA 1W8CA 5ACBC 4ZSJA 2HZ0A 3GBZA 2WQBA 4KIKA 2C6OA 1UWHA 4KIPA 2X8DA 5CZIA 4C61A 4QP1A 1OL6A 2H9VA 1XO2B 2O63A 5AJQA 4A9UA 4CYIA 2GHGA 4U97A 4E5BA 3BV3A 4ERKA 1XHAA 3ORIA 4EUUA 4ALVA 4C2VA 3QQKA 4JI9A 3PPKA 4D0WA 3UIUA 2ITOA 1TQIA 3D2IA 4R7IA 4U8ZA 3T3UA 1PXOA 1Y8GA 3R2BA 5M56A 4OTGA 3WARA 2YM3A 4BCOA 2XK7A 2UW5A 1JQHA 2UW7A 4MX9A 2WB8A 5HVKA 3FZTA 2JIIA 2BTSA 3BYVA 2AC3A 2G01A 3NLBA 2ETRA 4RIWA 3NZ0A 3F88A 4JIAA 4HPTE 3SXRA 4YSJA 3WE8A 3W2CA 1OKWA 1YWRA 4A9SA 2XNEA 3TIYA 4JVGA 4RFZA 4AGWA 5CXHA 2J0MB 3ANQA 2F9GA 1H1QA 2XJ0A 4G31A 4KS7A 3TWJA 1XH5A 1ZOGA 2YCSA 4FA2A 5HU3A 4WNKA 4DEHA 3AC5A 4TN6A 2QURA 2BROA 4GT3A 2YM4A 3V04A 4A06A 4FV7A 3CQUA 2QG5A 4LI5A 4CFFA 4NJDA 3IW8A 4CMTA 2F49A 4FIIA 4ANSA 2ZM3A 2C3KA 3C5UA 4AT4A 2W17A 4I92A 3O23A 2W9ZB 3LOKA 2GS2A 3FKNA 4NZWB 4QMTA 2PHKA 4HYHA 3HP2A 2ESMA 4EOMA 2GS6A 5IA0A 4O1PA 1BMKA 4LGHA 1UWJA 4FGBA 1XH4A 1GZOA 5LMAA 3WZKA 1GIIA 2O5KA 3NAXA 3Q9YA 2PE2A 4JQ8A 1FGKA 1Y8YA 4RX7A 5T3QA 3W8LA 3A7GA 4DCEA 5BQ0A 4JXFA 3WF8A 3KVXA 5CASA 4FTNA 5A46A 3Q4ZA 4EK8A 3OHTA 4IX5A 2VGOA 3ZHPC 4F9YA 5KBQA 2UZLA 3EYHA 4BYJA 2JKMA 3EH9A 5J79A 4NK9A 2VTQA 4F1OA 3R04A 4KIOA 4QTEA 3AGLA 4U43A 2VX1A 4D0XA 3UTOA 4I5HA 4BBMA 2VTLA 4R6VA 2UZEA 5BYZA 4EH5A 4BCFA 2WMVA 5M55A 5L4QA 3PFQA 3I0OA 4JDKA 1CSNA 1LEWA 1BYGA 4IDVA 2QR7A 4MBJA 3QRTA 4GS6A 3R9DA 1BLXA 1H26A 2YCQA 3V8WA 4I0RA 3SX9A 3DAKA 3DK6A 5EOLA 5AV3A 4NW6A 3DK7A 3QU0A 4QNYA 5M53A 1ZYLA 5L6PA 3SV0A 3CD3A 5CSXA 4TRLA 1LR4A 3WYYA 4FV9A 2J2IB 4KBKA 4AT3A 3HP5A 5AA8A 4ZJIA 4F70A 3KA0A 4IWOA 4XG2A 4RQKA 3UOKA 4APPA 4YZNA 3LFDA 2WMQA 3KKVA 3PTGA 4YPSA 5IUHA 4FTLA 3FY2A 3POOA 3V5JA 3H30A 4UMUA 4G6OA 2XJ1A 4FKOA 5EI6A 5AV4A 4P2KA 4JR7A 4K0YA 3AMBA 4FUXA 4OTFA 2E9VA 3VC4A 4IAKA 2XIXA 4ZZNA 5GNKA 3KCKA 5EYCA 2OICA 3FBVA 4C3FA 5D12A 4RWIA 2OJ9A 1JVPP 4O0VA 4EOSA 4FSWA 4AZWA 3LIJA 5ICPA 1BKXA 5HCYA 3TN8A 2XNPA 5DWRA 4BCQA 3LCTA 4MKCA 4RJ3A 3PIYA 4H39A 4O0TA 3Q5IA 4BCJA 5IH4A 3ORLA 3R21A 2RSVA 3PRIA 2P3GX 3LCOA 3LJ1A 4ZK5A 2RFNA 2WMSA 1H24A 3BLRA 2CPKE 3VIDA 2C69A 4B6LA 1LUFA 4DAWA 4YTFA 2PVJA 4HOKA 2UW6A 4D4YA 3PWYA 3CKWA 4IFCA 5LVNA 4FSQA 3UC3A 5HTCA 2HYYA 5EW3A 5HGIA 5AAFA 2J0KA 4E6CA 4OR5A 3IS5A 4R1YA 3FZ1A 4F09A 1Q3WA 4MNEA 4BDEA 1UU7A 2HK5A 4QP6A 4C2WA 3WIGA 5CAOA 4EQCA 4AW5A 4TKSA 3E8DA 2C1AA 3BBWA 3HRCA 2CGWA 1SVHA 2J0JA 5DVRA 4TYIA 5BVEA 1Y91A 5K0XA 4DFNA 3KRLA 5KNJA 1Y57A 3RALA 2BAQA 2WTVA 4EH2A 2VTNA 4JRVA 3UVRA 2C3JA 2ZM4A 3HMIA 1CM8A 2A1AB 3QLFA 2X8IA 5E8WA 3I6UA 5IKWA 4AUAA 3OWJA 5I9WA 4J96A 4BZNA 4C59A 3PUPA 1J3HA 3OF0A 3PJCA 3OW4A 3QC9A 4IACA 4DN5A 1PKGA 5KMLA 4MQ1A 2PZYA 5GZAA 2FVDA 3KF4A 3F3WA 3V51A 5I9YA 2XJ2A 1JKTA 4K33A 5K5XA 4UMTA 2B9IA 4HNFA 4QTDA 3I4BA 5C03A 4J8NA 4JQ7A 4CZUA 4O91A 3RHXA 3MTFA 1CKJA 4FKRA 3TL8A 4IEBA 4G5PA 5E7RA 4HYIA 2QO9A 4GU9A 2YM5A 4YPDA 2BCJA 4WIHA 3E63A 1OPJA 3HMPA 2B9JA 3OBJA 4YC3A 4NCTC 3SVVA 1ZYJA 2CHLA 3E5AA 1OMWA 3F66A 1DAYA 4FSNA 4TTHB 1ZLTA 3DDQA 3Q9WA 4BL1A 3CPCA 2V7AA 4WHZA 3QTXA 4EH4A 4FKLA 4H1JA 3D14A 1PMUA 4V0GA 4KSPA 3HDMA 4TPTA 5J95A 4KD1A 3VULA 3IPHA 4QP3A 1H0WA 3R1YA 4YZMA 3BHHA 3R6XA 1BI8A 3G5DA 1JOWB 3G6GA 1QPJA 5B7VA 5FXRA 3HDNA 4O0WA 4UYAA 2X4FA 4I6HA 3WZDA 3NW7A 4BTMA 2UZTA 2WU6A 4NEUA 3MVHA 5DFPA 2OIBA 3ZTXA 5CT7A 4ZTLA 3ZEWA 2WPAA 3W16A 4EH7A 4V04A 4GV1A 4ERWA 5L2SA 2UZUE 3NNXA 1APME 4FYOA 5DN3A 1OKZA 1Q41A 5AR8A 3QC4A 5JK3A 2ITNA 2UZVA 3HV7A 4PWNA 5LVOA 3L8XA 4E4XA 3A8XA 3F3UA 4QQJA 2XUUA 2OK1A 5CY3A 3II5A 3P23A 4Y72A 4QP2A 3HV3A 3HL7A 3KULB 2VTIA 4FRFA 2YHVA 1MP8A 1M17A 1PXMA 2R5TA 4WD5A 3UDBA 5J7BA 4AW2A 2GNHA 3DAEA 2QOHA 4X21A 4L3JA 5GJGA 3ZFXA 3GFWA 5IA2A 4CRSA 3CGOA 4MCVA 4E26A 3NYOA 2ZV7A 3NDMA 3PIZA 2R3OA 4YJRA 4J99A 4RRVA 2OF2A 3WF6A 4GCJA 4HVIA 1U4DA 2W4JA 1OZ1A 3ZXZA 4FC0A 4X6RA 4YJVA 3QTWA 5HNGA 4FZ6A 4PV0A 2XB7A 4M69B 3ZUUA 2P55A 3LW0A 5DA3A 1GZKA 4WSQA 2QR8A 3HGKA 4FF8A 3FHIA 3K3JA 4FK3A 4F9AA 4GEOA 3GI3A 3V01A 1GIJA 2FGIA 5FXQA 1OUYA 2ITXA 4MF1A 1IA8A 3W55A 3LFAA 2QOKA 3DU8A 1KV2A 3THBA 4DYMA 3PLSA 2QOBA 2QO2A 3ETAA 4KSQA 1WBNA 4YLLA 4L53A 5FXSA 4FVRA 2ZM1A 2YM8A 3PA4A 4WNPA 3U6IA 4I1ZA 2YIYA 4IAZA 4MBIA 4W4VA 2WQEA 3DBDA 3VBTA 4C0TA 1PHKA 1M2RA 2JBOA 4L6QA 4L7FA 1UVRA 4DGMA 2NRYA 3OOMA 5M51A 3MPAA 3DXNA 2P0CA 1BI7A 2WIHA 3FMMA 2B52A 3VUMA 5J5SA 3AD6A 1AQ1A 3HV5A 3ZBFA 3BYSA 2XNOA 5BUJA 3FLZA 4LL0A 4YP8A 4MD8E 4EH3A 1H1WA 4CCBA 5CTPA 3BELA 3L8PA 3UODA 1QL6A 3HMNA 3KXZA 1UU3A 3GC8A 3HX4A 4NJ3A 2VTOA 2IN6A 4P7EA 4RIYB 4EC9A 5I0BA 3DJ6A 1RE8A 4D2WA 3VHEA 3G33A 2ETKA 5HE0A 3V6SA 2XVDA 2P33A 4F08A 2FSOX 2W96B 1O9UA 4YMJA 2UW4A 1KE7A 3NYNA 3M42A 2UVXA 3A7HA 3GU7A 3KK8A 1PXJA 3HMMA 5LCKA 4AW1A 2BTRA 3QXOA 4YHFA 2RFSA 3FC2A 4NM5A 3O8PA 4O2ZA 5KHWA 2GNGA 3VBXA 4NUSA 4JDJA 4V01A 3SW7A 2X2MA 3R00A 5ETIA 3VS0A 4O38A 5K9IA 2VWIA 3CEKA 3OZ6A 3DLZA 5CNOA 5KKRC 1ZAOA 4IX4A 4CQGA 5IZFA 3MYGA 4IHPA 1U5RA 4QT1A 5LJJA 3JUHA 2JAMA 2XRWA 4G3CA 5C8NA 3TXOA 2WMTA 1Q99A 3KXMA 3T9TA 4KABA 4JBQA 3NX8A 5CVGA 3RPVA 1WMKA 4YR8A 5IMEA 2F57A 2FSMX 2R7BA 3I1AA 4DTKA 4FT7A 4XG3A 3T3VA 4KAOA 4W4XA 2HELA 2CSNA 4RWJA 4YC8A 4WKQA 3KVWA 4K1BA 4FT3A 3KQ7A 4HCVA 5GJDA 2C6IA 4QMWA 2A0CX 3GOPA 1YXVA 5FG8A 4ANMA 4FSTA 3G2FA 5AUTA 5DIAA 1UNGA 4IZ5A 5FP6A 2BUJA 3ORPA 1JKSA 3UG1A 5CU4A 5DR2A 4U44A 4OAVB 5HIBA 1BX6A 4QTCA 3D7TA 3HRFA 2C6TA 3EFLA 2RIOA 3DB8A 3QGYA 3VHKA 3FE3A 3JY0A 3MVJA 4C8BA 2A2AA 4D55A 3ODYX 5HCZA 5IUGA 3DQXA 4IAIA 4CZYB 1Y6AA 5E90A 5HX8A 2YITA 2OBJA 4C34A 2BZIB 4CKIA 3DFCB 4ZIMA 4IFGA 4M3QA 5HG9A 4NKAA 4X7QA 4QOXA 3ANRA 5H8BA 1YOMA 2A27A 1MQ4A 3QWJA 1WBPA 5JH6A 3G9NA 4NFNA 3PVBA 4BCNA 5CXZA 4FMQA 5CI7A 3UQCA 4RIXB 4L43A 4J1RA 2HOGA 2YIRA 2FO0A 1J1CA 5HHWA 3OWKA 5HG7A 2B1PA 5AUYA 3UJGA 1WAKA 5IH5A 2WFYA 4AE6A 3ZCLA 3FSKA 3ZONA 4FIGA 3CJGA 4U79A 4Z9LA 3ZM4A 1PMNA 3IDCA 3EZVA 5CF4A 4A07A 3GT8A 1Z57A 3I7BA 4YHTA 4EQMA 2XNGA 5AV2A 4D2PA 2J6MA 3QTUA 4F63A 3P7CA 5AUZA 2OH4A 2JD5A 4L3PA 1P4FA 1Q8TA 1W84A 1JNKA 2JDTA 4G16A 4BB4A 5LMKA 4BIDA 2BDJA 4QNAA 1YXUA 5K0KA 5AA9A 5JEBA 2RL5A 2PVFA 4HCUA 4Z55A 4WG5A 3Q32A 3MS9A 2HY81 4XNEA 4EK4A 4IVAA 5CQWA 5CVHA 3QKKA 3Q96A 4JDHA 2EU9A 4WSYA 5ANEA 4CYJA 3SHEA 5IF1A 3SXFA 4CTBA 2VTRA 3S2PA 1VJYA 1OGUA 1X8BA 2ETMA 5ITAA 5K5NA 4PL3A 5TF9A 2RF9A 1K3AA 2W1ZA 4FOBA 4NH1A 1WBOA 3G0EA 4QQCA 4FT0A 3RM7A 5JMSA 3AT3A 2JDSA 4ASXA 4F6WA 2EB2A 5CU0A 3SA0A 4C62A 3NUSA 4W8EA 4IAYA 5F1ZA 2IZRA 3QFVA 4JBPA 5LARA 3NUXA 3UNKA 4A9TA 4X3FB 5FM3A 2GCDA 4HGSA 3TNPC 4BTFA 3OTVA 4RJ6A 2HXLA 3L9NA 4GFOA 4IWQA 1OVEA 4FNWA 3BGQA 1Q8YA 2UW0A 4BWKA 4D2TA 5M44A 4U45A 5E8SA 2GNFA 3OROA 3DKGA 2IZSA 2WAJA 5TOZA 2IW9A 3DBFA 5KX8A 2R3PA 4K77A 4GIHA 4ARKA 4ALUA 5JFXA 1O6YA 5CU6A 4ANBA 1YDRE 2JIVA 4DGOA 3RBWA 3DCVA 4MQ2A 3H9RA 3F82A 4CTCA 4RX5A 3C0IA 3DB6A 1H1SA 2PMNX 3DGKA 3Q5ZA 1QPDA 4IZ7A 5C27A 2C0TA 4U40A 4CVAA 4CCUA 4GVAA 4FSYA 2I0VA 5AP0A 1JSUA 5AEPA 4UN0C 5C26A 3CBLA 4R7HA 3RINA 4UB7A 3VBVA 2R3QA 3VS2A 2XK4A 3RP9A 2R2PA 4BI0A 5A54A 2WTKB 3R8ZA 3VRZA 5EM8A 3PY3A 4FV8A 1OITA 4X2KA 5EG3A 3QTRA 4PPAA 1Q3DA 2C6EA 4EWHA 2EXEA 2X39A 3IONA 2C3LA 4RJ5A 3W2QA 4RPVA 5IG1A 5IA5A 2PWLA 4E4LA 3ZFMA 4GRBA 4TYGA 5FEEA 4RLKA 3UBDA 3IOPA 2V0DA 1VEBA 3O51A 3PA3A 4HPUE 3TV4A 3VS3A 4FZ7A 4CLIA 4L8MA 4BC6A 4KIKB 3KXXA 4PPCA 5CSHA 4USFA 3JXWA 3UOJA 4XG6A 2GDOA 4ANLA 3CTQA 2XKEA 3FL4A 1YXSA 3PXQA 2YIQA 3BGZA 3RZBA 3VUTA 5CAPA 3MI9A 3EQHA 3O2MA 5HIDA 4G3DA 3PJ8A 3GU5A 4FNXA 4KRCA 4WRSA 5TO8A 3ZC5A 1UKHA 3EQIA 2W1EA 3QD3A 4W4WA 4RT7A 4YZ9A 4ZJVA 3OW3A 5DH3A 3SDJA 5M4FA 2JKOA 4ENYA 5BX0A 3QZIA 5KE0A 3TUDA 5DLSA 2FSLX 3KEXA 1PMVA 4XEYA 4XP0A 5BMMA 3HA8A 1JSTA 4M12A 3UC4A 4YJOA 2W5HA 4EEVA 4IDTA 4RIWB 1MUOA 3MFRA 1YHVA 4OTRA 5JZNA 2J90A 1W2FA 4D1SA 2O64A 4B4LA 3O7LB 4RC4A 2QD9A 2WNTA 4NM3A 4LM5A 1R78A 4BHZA 3DV3A 4BRXA 5DT3A 1JSVA 3CE3A 5EK7A 4J8MA 4GIIA 5JN2A 4KNBA 2WEVA 2IJMA 3F2NA 4BTKA 5IA3A 5HE1A 3A7IA 2JEDA 1P14A 3PG3A 3FQHA 2YJRA 3OC1A 3V5LA 5FTQA 1KE8A 3DLSA 4TWCA 5AM6A 1NY3A 4ZSLA 5HVJA 2F7ZE 4CSVA 4FV4A 2Z7QA 3ZU7A 2CGXA 5M4CA 4XOZA 3PG1A 3FZOA 2VO6A 5AP3A 4ONAA 3ZXTA 1UV5A 4I24A 3JPVA 3ROYA 4NCTA 3GCSA 4TL0A 4QMYA 2YM7A 3QRUA 4V05A 3QCQA 4GSBA 4BKJA 3GCQA 5HO8A 3AOXA 1EH4A 4AF3A 3F5GA 3HNGA 2FH9A 2P4IA 1ZYCA 4E4NA 3GP0A 2LAVA 4CFXA 4DFZE 4CKRA 3QBNA 3EB0A 4IB3A 4Q2AA 2C6MA 5JFVA 3MBLA 1WBTA 3QXPA 2G1TA 2H8HA 3AT4A 4YTHA 2WU7A 1JKKA 4AOTA 4BCKA 1YOJA 3GCUA 3EN9A 4DH7A 5JQ5A 4EBVA 2RFDA 3BCEA 4O0UA 5FBOA 3BPRA 4HCTA 4X3JA 3H9OA 3PP1A 3M11A 4YNEA 1S9IA 2YCFA 4IB0A 4EOQA 4EUTA 4PPBA 5KO1A 2RFEA 3FC1X 5E8ZA 4TYHA 1UA2A 3G0FA 4CZTA 4IH8A 2C3IB 3VO3A 4ZJJA 2OZAA 3UOLA 3LPBA 3IGOA 4IADA 4QQ5A 4PP7A 2E9NA 5CF8A 4BDKA 3BWFA 3ZLXA 3KGAA 3P9JA 5AP6A 3HLLA 2UZBA 2EWAA 4YZBA 4AN3A 3ZRLA 5HD4A 3OFMA 3F3VA 4A4LA 3EFWA 3QTZA 3QA0A 3FMNA 2YIWA 4OTHA 2A4LA 3FI3A 2PY3A 5JGDA 3DS6A 5EYKA 4ACDA 3MFUA 3QHWA 4H58A 4NKSA 3CY3A 4F9WA 2ITQA 2BIYA 3W10A 5DMZA 4GJ2A 3E64A 5J7HA 4Z3VA 1H1PA 2OSCA 4QMOA 3W32A 1DM2A 5I9ZA 3Q04A 1Q97A 1AD5A 2OXXA 3TZMA 3FZRA 4BIBA 2JBPA 4C35A 4DFLA 4MXAA 4JDIA 3PJ2A 3AC2A 4AQCA 3N9XA 3AD4A 3A60A 3OBGA 3MSSA 5F95A 4ACMA 3FAAA 4L3LA 4RZVA 4BDDA 2VTAA 4I3ZA 4YBJA 4YGAA 3GCPA 4GUEA 4W9XA 1T46A 4IZYA 5JFWA 4EHEA 4M66A 4FG7A 2Z7LA 2DQ7X 5L2WA 3G51A 1GJOA 4ASDA 3W2SA 4J7BA 2IVTA 2FYSA 2F2UA 2PMLX 4IB5A 3MV5A 3RTPA 2V22A 4TYEA 3UNZA 5AMNA 2YWPA 3NSZA 1M14A 5T6KA 2JFMA 3NNWA 5EI8A 5IDNA 2PZPA 3P1AA 1OL1A 3TUBA 5EDPA 2C6KA 2WIPA 4MNEB 3PJ3A 2X2LA 5HVYA 3VS6A 2CMWA 2OJIA 4XHKB 2J5FA 4Y95A 4DGNA 4NTSA 1XH7A 1Z5MA 1E9HA 4K8AA 4NM7A 2ZV9A 3C13A 4MNFA 3WOWA 2JDVA 1KV1A 5DE2A 4ZZOA 3E88A 3R9HA 1RQQA 3MDYA 2A19B 4I41A 4AN2A 4C4HA 2UUEA 3CXWA 2BFXA 2QCSA 3DJ5A 3PRFA 3AC4A 3TI1A 4C4GA 5KMNA 3MIYA 4X2JA 3HECA 3MW1A 2WMAA 1GY3A 2XNNA 4L44A 2G2FA 4KKEA 3PVGA 2XKDA 5ANIA 3UGCA 4BCHA 3RZFA 4OTDA 4DFXE 4AX8A 4ZTMA 4XX9A 4JL9A 3NWWA 2XK9A 4MTAA 3ET7A 3AQVA 3FXXA 4D2RA 2X0QA 3ITZA 2V7OA 2C5XA 1ZY5A 2R3MA 3RAHA 3D7ZA 2ZAZA 3QUPA 3ORKA 3GQLA 2HIWA 5HKMA 5K3YA 4BDGA 2G15A 3EKNA 1XH9A 4FIFA 4FVPA 2R3NA 3ROCA 3ORTA 4GVJA 5AX9A 4EH8A 3O8TA 5J87A 4CFWA 3KN5A 4N4SA 4HNIA 2V5QA 5CI6A 1XJDA 2X6DA 5EM6A 3UPZA 3OUKA 4O4FA 1FMKA 1U59A 5JFSA 1WVXA 3D83A 1I44A 4L52A 5HICA 4U80A 3TUCA 2JAVA 4RG0A 3GGFA 3KN6A 1J91A 4FT5A 4A9RA 5HBEA 5K4IA 3FDNA 1V0BA 3IW7A 4F65A 3COMA 2X6EA 3I0QA 3OXTA 3LCSA 4GJ3A 4PY1A 5I9UA 4V0GB 3ALNA 4E5WA 3ULZA 2X0GA 1YWVA 2FB8A 3D5UA 4IBMA 4QP8A 3NRMA 4EKKA 4PNKA 4IWPA 3R73A 2QC6A 2WZJA 2RG5A 3E8NA 3EQCA 5BVWA 2BIKB 2QU6A 3PY1A 4OGRA 4S2ZA 1PY5A 2JC6A 4BF2A 5JGAA 4KB8A 1URWA 3VQUA 4ZP5A 3EKKA 4IW0A 4D1XA 3R30A 4TYJA 5FBNC 2IZTA 3E3BX 2ITWA 3VBWA 3M1SA 5HBJA 2GMXA 4EI4A 3LFNA 5AR2A 2O8YA 3D0EA 4J53A 3ZDUA 3U6JA 4HJOA 4QYYA 5EHLA 2ITZA 3P7BA 2J4ZA 3GC0A 2Z7SA 1Q8WA 3PSCA 4EHVA 4PTCA 5CAVA 3UYSA 4FNZA 2XZSA 2X4ZA 2Y0AA 3DBEA 4IM2A 4ZSEA 4DFYA 2XNBA 5E8UA 4AP7A 3N51A 1PXLA 3FUPA 3PIXA 4GK2A 3F69A 4RSSA 3FKLA 1H4LA 4F6UA 4E8AA 4X3FC 1REJA 1Q8UA 3BYMA 4PUZA 5CNNA 1OIYA 3TJCA 3O7LD 3MJ2A 5B2MA 4BKZA 3POZA 3TZ8A 1MQBA 3QTQA 3WF5A 3WIKA 4L45A 2YFXA 3H0YA 3ZUTA 2J7TA 5CSWA 2R4BA 3L9MA 4TWOA 1ATPE 4UXLA 3FZPA 3AG9A 2PVHA 4PL4A 3LJ0A 5KZ0A 5HTIA 3RJCA 4TY1A 5CLPA 2C4GA 5ANJA 3VS1A 4UWBA 1IG1A 1NXKA 4Q9ZA 4ACGA 3DDPA 4LGDA 5JKGA 1CDKA 2CJMA 5CAQA 4C38A 4QPSA 4HGTA 1NVRA 4ZS0A 2PK9A 2R3HA 4AGCA 2BKZA 3E7OA 3LFSA 4JNWA 4AT5A 3IK3A 1BL7A 4OBOA 3ZC6A 3DZOA 4R5YA 1H08A 4RJ4A 4EZ5A 2JLDA 2B4SB 3EN6A 2FSTX 2QOFA 4DEEA 4XG8A 2NPQA 2WTKC 1OPKA 2XM9A 3OUNB 3GB2A 4Q5HA 3UE4A 4U5JA 4JAJA 2Y4IB 4L42A 3VS7A 4I5PA 4QO9A 3UQFA 3EWHA 5DEYA 4QPMA 2UVYA 5J5TA 3R63A 1PW2A 4LMNA 4MWIA 4WUAA 4AACA 5E8YA 5AUWA 5FLFA 2I0YA 4I94A 4E6DA 2HWPA 4JAIA 2ONLC 4LOQA 2C5NA 4EL9A 4G3EA 3KB7A 4FIEA 1JAMA 2QHNA 4FTUA 4XLVA 1AGWA 4M13A 3EQFA 4XJ0A 3SC1A 3QQHA 4LRKA 5A4QA 2OFVA 1LEZA 1H28A 1PYEA 3JVSA 3SD0A 3UP7A 3GU4A 3NCZA 4L9IA 5HIEA 4RX8A 4BTJA 2QI8A 4EJNA 4GH2A 3AC8A 1KOBA 1YHSA 5EFQA 3V6RA 2YDIA 4F7JA 3R2YA 2VWVA 3LXKA 4D5HA 4LUDA 1OKVA 2W05A 2YDKA 2F7EE 4MXZA 1H01A 3BU5A 3BLQA 3TKIA 3MH3A 3ERKA 3NS9A 3LMGA 4H3PA 4RBLA 2Q0BA 2DS1A 2VTPA 3MH1A 4GT4A 4F0GA 5CEKA 3OD6X 4MXYA 5JT2A 4PX6A 2CCIA 1V0OA 5M4UA 4QP7A 1SM2A 3FYKX 4IZAA 5DR9A 3DPKA 2ITVA 4PMSA 5D1JA 3UOHA 3KC3A 5A4TA 4IQ6A 2H34A 4AFEA 5L8KA 2VO7A 2XCHA 4QD6A 2H6DA 4EYMA 4DG0E 3I81A 4QQTA 3RHKA 5I3OA 4BDJA 5FQDC 2Y6OA 3KFAA 4PQNA 3RPYA 3ZRMA 4CQEA 4ID7A 4UWCA 4J52A 3D7TB 4EOOA 4UBAA 5D10A 2IW8A 2BZKB 3IQ7A 1DI8A 3OMVA 4RA5A 2GNLA 3ZRKA 4XV2A 4XV3A 1YDSE 4KRDA 1H00A 5AUVA 5CANA 2ITYA 3IGGA 3R8MA 2V55A 5BVOA 1P5EA 4FV5A 4WUNA 3V8TA 4ZTSA 4DH1A 3DZQA 4GK4A 1PXNA 3K2LA 2WGJA 1FOTA 2J51A 3MPMA 3ORMA 4FG8A 4G6LA 2YA9A 3E93A 4BDCA 4NWMA 4U0IA 4XG4A 3FL5A 2P2IA 2VU3A 4QP9A 2XP2A 4CV8A 3BEGA 4U6RA 4O6LA 4YNOA 3NGAA 3NCGA 4GU6A 4AZTA 2HWOA 5FD2A 4H3BA 3B8RA 4YU2A 4FV2A 4YZCA 1WCCA 3C50A 2YISA 2WOTA 4PDSA 4LGGA 4B8MA 5D41A 3NEWA 2E2BA 3OY1A 2JDRA 3I5ZA 4AA4A 1GIHA 3H0ZA 3QL8A 3KRRA 3C4FA 3AD5A 3AGMA 3SOCA 4FV6A 4FSZA 4IX3A 1P2AA 2R64A 4HGLA 3UO4A 3V5QA 3TACA 4LFIA 4C02A 4ZLZA 5AR7A 2R3FA 4HYUA 4NIFB 5AP2A 4D2VA 3SKCA 1H25A 3DKCA 3EJ1A 4GYGA 4ACCA 4M7IA 5AV0A 4PTGA 3U9NA 3S3IA