4FF8A

Inhibitor bound structure of the kinase domain of the murine receptor tyrosine kinase tyro3 (sky)
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
218
structure length
169
Chain Sequence
KEFDHPHVAKLVILPFMKHGDLHAFLLASRIPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVAVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMVYDLMYQCWSADPKQRPSFTCLRMELENIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase receptor TYRO3
publication title Highly selective 2,4-diaminopyrimidine-5-carboxamide inhibitors of Sky kinase.
pubmed doi rcsb
source organism Mus musculus
total genus 53
structure length 169
sequence length 218
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ff8A00
1OVEA 4USFA 3EL8A 2PHKA 3HECA 2DQ7X 4UMTA 3HV7A 4XV2A 3HUCA 3QAME 5KMOA 1ZRZA 3DK3A 3OT8A 4CFUA 3L9PA 3C7QA 1ERKA 3IW5A 2REIA 3ZRMA 3RPRA 3FYKX 4MNFA 2V62A 3QQUA 4AGWA 1YDSE 2R0IA 4H3QA 4L46A 3DKCA 3P86A 3ZC6A 5CEKA 3EWHA 3TTIA 2JFMA 3WZKA 1H26A 5CENA 3LCKA 2E9UA 3CC6A 5IA4A 1NY3A 2HXQA 1PXJA 4KRCA 3G6HA 3RPSA 2W1CA 2PUUA 4YLKA 3RAIA 1YI6A 4FKSA 2QI8A 3DOGA 2DUVA 3TEIA 4FSWA 4DINA 4ZLYA 5B7VA 3I60A 3ZMMA 4U0IA 1R39A 3ORLA 4I92A 3R02A 2IW9A 4D0XA 1XH4A 3FMMA 2ITYA 2GSFA 4MXCA 1FQ1B 2YZAA 2QC6A 4HVSA 4RVMA 3VVHA 2WU6A 4RX8A 4BIBA 2W06A 2H6DA 3NW5A 3NX8A 4YC6A 2RFNA 5HE3A 4EEVA 5CYIA 4GFMA 4IAAA 3VBQA 2ZAZA 2PE0A 4RZVA 3F7WA 2X7OA 3D14A 4JT3A 1ZY5A 5E8YA 2XRUA 3UOHA 3TI1A 3OUNB 3ZUTA 4HVDA 3PSBA 3A7GA 3FMJA 4GG5A 3FC1X 1JSUA 3FLQA 3KRJA 2E2BA 4C8BA 3G6GA 4NCTA 4RG0A 4W4XA 5IUIA 2VNWA 2PMOX 1V1KA 3DNEA 5E8WA 3OVVA 3EN9A 5FP6A 2XKEA 3R7GA 3W8LA 4ACHA 5DLSA 4GK3A 2HAKA 5HU9A 3HNGA 2JLDA 3JVRA 2ITPA 4ZXTA 2ONLA 5FD2A 4GUEA 3IECA 3MGYA 2B52A 3FLZA 1H27A 2BTSA 1J91A 3IONA 3VRYA 3FQHA 4NCTC 5CEMA 2OWBA 3IGOA 3BHTA 3QLGA 5FEQA 2I40A 5ETAA 4FV4A 3PJ2A 5AR7A 4J1RA 3LFQA 4ZP5A 1XH9A 2WQEA 3QCSA 3KRXA 5I3OA 2WTJA 4IACA 4JR7A 3SW7A 3WZEA 2XUUA 3DFCB 3FMLA 3MVMA 2GQGA 3UG1A 3VO3A 5CZIA 4YUQA 4YTHA 3OWPA 4ALWA 3V01A 4C4EA 3AD5A 2X8EA 2CGVA 2QURA 4M0YA 4XG3A 4I0SA 4MX9A 2JC6A 3HV5A 3F3WA 3QFVA 3POZA 4EHGA 5L8LA 1K3AA 2GFSA 4MYGA 4BIDA 5DE2A 2JDOA 4BBEA 3PA4A 1ZAOA 4JNWA 2ZDUA 1CKJA 3AG9A 5F1ZA 3ZOSA 4YC8A 4ENYA 1DAWA 3QCYA 5AV1A 3LFAA 4FK3A 5LVNA 3HP5A 4QTCA 5KZIA 4Y5QA 2VO6A 2QOQA 4AOIA 4MD9E 3TL8A 4TWNA 3AT2A 2RFSA 4ZY4A 4IAYA 2B54A 4R7HA 3G0EA 3ZSIA 1LEZA 3C4ZA 2WTKC 2G9XA 1CKIA 4O0XA 3EFJA 4OTPA 2UZNA 2WMWA 3QX4A 4IADA 4APCA 4CKJA 1B6CB 3NNUA 4G3FA 1UU3A 4MBJA 4PTEA 2C6DA 4AWIA 2GDOA 2WFYA 4O0RA 4L53A 3E3BX 4CYJA 3SHEA 1I44A 4FV7A 3BCEA 4CQEA 2HIWA 3PYYA 5EM7A 4JDJA 2QD9A 1O6YA 4B6LA 5CY3A 3CKXA 2HZNA 2RFDA 1Y8GA 4FT7A 3R9HA 3DJ5A 3MPMA 2WMQA 1MQ4A 3UG2A 5KHWA 5J9LA 3Q6WA 4QP3A 4NJDA 5GJFA 1M2RA 4E5AX 5KKRC 3NNWA 4IXPA 3FZOA 4RZWA 1OL7A 4LQMA 4YBJA 3TV4A 5HORA 1H1WA 4TWPA 5DR6A 5LMAA 5IA0A 3FZPA 3QQHA 4U7ZA 5FWKK 2QCSA 1FGKA 2OK1A 4I22A 4IH8A 5AADA 4WOVA 4NEUA 5CS6A 3TZ7A 3BPRA 3EKKA 4BHZA 4BRXA 2EXMA 1QPDA 3RWQA 1LEWA 5E8UA 4MK0A 3GXLA 3LAUA 1H01A 4M12A 4P2KA 4PPCA 3DTWA 5CALA 1ZMWA 3SX9A 4IM0A 1Y6AA 4HYHA 5HX8A 2SRCA 2UZWE 5FTOA 1OIRA 4FICA 5D7VA 3LHJA 1CSNA 2PVFA 5IEXA 4FVQA 5EYCA 4C02A 3JS2A 4WD5A 5A4LA 2YAKA 5CQUA 1WFCA 4G1WA 3QD4A 2E9NA 3AQVA 3EKNA 3F5XA 3EZVA 3VHEA 5EKNA 3ODYX 2X39A 3DBFA 4FZDB 4R5YA 4TRLA 5G1XA 5LOHA 4AW1A 5IDNA 2QONA 2YIRA 4JDHA 2XJ1A 2J4ZA 4QYHA 5HU3A 4KS7A 2J7TA 2PVYA 3QUPA 4ITHA 4WG5A 2PE1A 2QG5A 3MFSA 3C5UA 4W9WA 3DPKA 2ZMDA 4BCHA 1MUOA 4OT5A 1ZMUA 2WEIA 4KRDA 4G17A 5LWNA 4XG4A 1O6KA 2OJGA 4NTSA 2QO7A 2R3JA 3OOGA 4ZJIA 1UU8A 1CTPE 3FZRA 4GH2A 4YTFA 3WZJA 2JDVA 2F7XE 2BRMA 4S30A 4TNDA 3D2IA 2W1GA 4R3CA 4I6BA 5AP3A 3FHRA 1ZLTA 2R3QA 4ZJJA 4IWOA 2OBJA 1Q3DA 1Q5KA 1S9IA 3I79A 3RVGA 4DG3E 5IDPA 1Y8YA 4X3FC 1ZYCA 1ZOEA 1NA7A 3I5ZA 3O7LD 4DTKA 4TZRA 4M66A 5TE0A 3FXWA 4QP1A 2QLUA 1V0BA 3PXRA 3F5PA 1WVXA 3C9WA 5CVGA 5DOSA 1WCCA 4GRBA 5CZHA 4AG8A 4Y85A 3OBJA 2Z7RA 4KD1A 1TKIA 3BLRA 4ZZMA 4I1ZA 3ZCLA 5AWMA 2V5QA 3C0IA 4K2RA 2IVUA 2C6MA 3KRWA 4JX7A 4ASXA 3PIZA 5LVLA 4JDKA 4FV3A 4JL9A 4KKGA 3QTIA 4LMNA 5FBNC 2ETKA 3KB7A 2QOOA 2YM8A 5CAPA 3PA5A 3QF9A 4U41A 3EN6A 3LQ5A 4JI9A 5E1SA 3QKMA 4C4FA 4E4MA 3FSKA 2UW9A 3A7FA 3VIDA 3VNTA 3BZ3A 4TYGA 5F4NA 5LARA 3UGCA 1S9JA 3ZBFA 4NH1A 3CS9A 3SV0A 3BIZA 5JZJA 3BBWA 1PMEA 3QTXA 3V5TA 4RJ6A 5HIEA 4F1MA 3FMKA 4KKEA 4L01A 4UXLA 2QO2A 3R6XA 3UIBA 4OBQA 3SOCA 4BKJA 4DEIA 4OAUC 5EOLA 3PRIA 3OMVA 3TTJA 2BAKA 3W18A 3P1AA 1REKA 1ZZ2A 4BI0A 1R0EA 4CQGA 1MRYA 3NUUA 2FH9A 4EH9A 1BX6A 3CQUA 2W99B 3GVUA 3REPA 3VS2A 4CMOA 2F2UA 3ORIA 3PVGA 1MQBA 2Y9QA 4FG7A 3SRVB 2EWAA 4AA5A 3D94A 4IW0A 2C6TA 4A9SA 1OUYA 3VBWA 2XVDA 1FVVA 4X2FA 3ZC5A 2YCFA 4RC4A 4EC9A 4XMOA 1OL5A 1RE8A 1TQMA 4EHZA 2AC3A 2I0HA 3Q53A 3TN8A 3M2WA 3K54A 3LE6A 4FKQA 4ZS0A 4MF1A 5TO8A 3UO4A 2VTJA 4F6WA 4I20A 4FV1A 4J99A 5AP0A 3V6RA 3CCNA 2QKWB 5HG8A 2Q0NA 5DG5A 1XBBA 3DAEA 4OTIA 2Y4IB 5CU3A 2ITQA 1CMKE 3OUKA 4HVGA 3C4CA 2GNLA 4BCJA 4DGNA 3ZBXA 4UYNA 1PXOA 4OTWA 5AP6A 3POOA 3FKLA 4I41A 4ZTHA 2B9HA 5CU2A 1XKKA 5DEYA 3UPXA 3W32A 1YQJA 3RK9A 2GTNA 4YHTA 2EVAA 3Q4TA 4BF2A 5LMKA 2PVNA 3D2KA 3ORMA 2QNJA 2B9FA 2XRWA 2XIXA 3K5VA 2IJMA 2W1EA 4JBVA 3UDBA 4BDGA 2A27A 3UBDA 1A06A 5J9ZA 4QYYA 4ENXA 3BYOA 4XP3A 4ALUA 5CAUA 4M7IA 4OTQA 5AUYA 1J3HA 3FZ1A 2JEDA 4FSUA 2BALA 3LFNA 1GIIA 5J7BA 4O96A 1ZOHA 4KWPA 3R8PA 5I9WA 4KSQA 4J97A 2PZYA 3DY7A 2C6KA 3EQDA 5FXRA 2BFYA 4E6AA 4AQCA 3PJCA 2YIQA 3QKKA 1T46A 4O0SA 2CPKE 4ASDA 4CT1A 2C6OA 2ERKA 3DLZA 3UMWA 4I4EA 4EOIA 1PXMA 5A6NA 4PP9A 4XJ0A 1AD5A 4J98A 3VBTA 5DN3A 5E8XA 1KOBA 2G01A 4X7QA 3PWDA 4OGRA 4M0ZA 1STCE 1FMKA 4GIIA 3GU8A 2GHMA 2VU3A 5FGKA 5AR4A 2YM7A 3Q52A 2XNBA 4NM5A 5DRDA 4RX5A 2VTNA 5M53A 3CPCA 5JKGA 1PKGA 5AV4A 3VBXA 5DGZA 2OSCA 2VWVA 1QPEA 5GZ9A 4AA0A 4UWBA 2WMVA 2J9MA 5DR9A 2CGUA 4FUXA 4BKZA 4WUAA 2BRNA 4E4XA 5BMMA 3AC8A 3EIDA 1W84A 3ORXA 4I93A 4L3PA 3RZBA 2JAMA 4BB4A 1FGIA 4FG8A 4JLCA 4OTRA 4GUBA 4BDFA 2VTRA 5HD7A 4AT3A 4EYMA 4JG6A 2VX0A 2O5KA 1YOMA 3RP9A 2O64A 2PZIA 5M56A 2P0CA 3NUXA 3NEWA 3A4OX 3VJOA 3TNHA 2EXEA 3WYXA 4RRVA 1AQ1A 3ORKA 1XH5A 4MQ1A 4BGGA 4QMTA 3VQUA 3Q3BA 4LV8A 4EBVA 3TZ8A 3LCTA 5AAFA 3UQGA 3G9NA 4IVCA 3R63A 2PL0A 3GCSA 4TYEA 4W4WA 4JS8A 3GFWA 2OW3A 5HVYA 3HVCA 3S2PA 1PXNA 4J71A 2YM6A 5EK7A 3A61A 4JRNA 5CVHA 3MB7A 4G3DA 4RVTA 5IU2A 4KIOA 4QRCA 4EBWA 4L3JA 3R9DA 4B4LA 5ANKA 5BVEA 3PXZA 3QQJA 3TG1A 5KMIA 4BZOA 2F49A 3F88A 4FBXA 4OBPA 3VS0A 2C0TA 4GMYA 3ZSGA 3NW6A 3QBNA 3VUTA 2W5BA 3HZTA 2OJJA 2CGXA 2C5YA 5J95A 4DEDA 3VUIA 4BKYA 4QYGA 3VS7A 3T9IA 5CSPA 2YM4A 3MBLA 5B0XA 5J8IA 4ZTLA 1PXIA 4ZEGA 5BUEA 5BYYA 3ETAA 3F82A 4LGDA 3F5GA 3R1QA 1PKDA 1WBSA 1WBTA 4USDA 4XH6A 4C0TA 4BDEA 3CLYA 5JMSA 5H3QA 2J0IA 3G0FA 4QMZA 3CGOA 1REJA 2ITZA 2YA9A 2Y8OA 2W9FB 3KEXA 4QP2A 1OIYA 3UYTA 4RWIA 2XBAA 3JVSA 3OZ6A 4I24A 3RCJA 3RGFA 4AZFA 3OC1A 3ZRLA 2J0KA 5J5TA 3C1XA 3FSFA 5JT2A 3SVVA 2W5HA 2UZTA 3PG1A 1GOLA 5I0BA 1Q99A 2O8YA 3KY2A 3CPBA 4GK4A 3WF9A 1XH6A 4ANOA 2O65A 4MKCA 5EH0A 2UZEA 3EFWA 4OT6A 5K4JA 2R3NA 3CQEA 3RNYA 3VS6A 1OGUA 3C51A 1M2PA 1SZMA 3WF7A 5IUHA 3VUMA 3R7VA 1ZXEA 4EZ5A 1YHWA 1IRKA 4LV5A 3BYMA 3ZXZA 3ZTXA 4BYJA 3MWUA 3UOKA 1I09A 3I1AA 4ZSGA 4BZNA 2HZIA 4TL0A 1V0PA 4D1ZA 3KKVA 3U4WA 2R4BA 4FSTA 4BGQA 4IWPA 2C3IB 5ACBC 2XK3A 1BL7A 1Y57A 3GUBA 4Y95A 3F5UA 5DI1A 2F9GA 3MB6A 3UO6A 3BHHA 2QHMA 3PIXA 1OL6A 3IOPA 5E90A 3ZZEA 4I0TA 3BU5A 4RWJA 3GCPA 4ZTSA 4DEHA 3GU7A 2GS6A 3A62A 4A9UA 5C8KA 2QODA 3GC7A 5KKRB 3PIYA 4O91A 4H1JA 1XQZA 2YIXA 5EYDA 3Q4UA 4CCUA 3P9JA 4W8DA 5E8SA 4BFMA 3QZGA 5AUXA 2C0OA 3JPVA 1R78A 1ZYJA 4XRLA 1B39A 2RIOA 1YOLA 4WRSA 3ZS5A 5CXZA 1SYKA 5AR3A 5FDXA 2EU9A 2W96B 4BN1A 4BCIA 5JGAA 4YTCA 4BDHA 2P4IA 3R9NA 4EOJA 5CAVA 1OPKA 5CANA 4I0RA 3V5JA 3WF8A 2JITA 1BL6A 4GJ3A 3QXPA 4QP6A 2Z7LA 3ZDIA 1P14A 3OCBA 4OR5A 4IX5A 4DH1A 3Q32A 1XHAA 4FTCA 4P4CA 4CFNA 5D12A 1GNGA 3TWJA 4LOQA 5HEZA 2CN8A 2GHGA 2RG5A 1W98A 4RJ4A 3NUPA 4NFNA 3ACKA 3DZOA 4FOCA 4L3LA 3DAKA 4KB8A 2X7FA 4FKVA 1P4OA 5D41A 2J6MA 4NW6A 3SRVA 3MA6A 3Q6UA 3PP0A 3TNQB 1VJYA 1KV1A 5IMEA 3R30A 3SXRA 1U46A 2ITUA 2J51A 2ZM3A 4NK9A 5DIAA 4QMLA 4AW5A 5JSMA 2WO6A 5E8VA 3V5WA 4CZUA 3C13A 5KBRA 3DGKA 3HGKA 4AZWA 2F2CB 2LAVA 4ID7A 4GT5A 3MI9A 4M84A 4E6CA 4E6QA 3EFLA 3ZUUA 2HY0A 5KUPA 2YWPA 5KX8A 2VGPA 3OWJA 4LRMA 4RGJA 3VF9A 2XCKA 4BDKA 4F65A 1DM2A 4IB5A 4UALA 2V22A 2ZV2A 3UNZA 2J90A 2H34A 3SA0A 3VF8A 3Q4CA 3HDNA 5T68A 4Q2AA 3ZSHA 4BL1A 3MJ1A 3PE2A 1WBNA 1KV2A 4H3PA 4BDCA 2P2IA 2YACA 3IKAA 4G31A 5CEIA 3VS5A 5LXMA 2H8HA 3VQHA 3B8RA 4K18A 2VTPA 2XNGA 2J0LA 4BCNA 1XBCA 4IWQA 5CEOA 2WMSA 2X1NA 1YI4A 5H8GA 4YHJA 2WB8A 2UVZA 3IW8A 5TOZA 2XMYA 2YITA 5EHOA 5TF9A 5LCJA 1JPAA 4X3FB 5AEPA 4AGCA 5JGDA 3DKFA 4JQ7A 3WIKA 4B8LA 3DFAA 1MRVA 1GZOA 3H9RA 5E1EA 4EQCA 3UE4A 5FDPA 2V0DA 5HVJA 5AP2A 2FUMA 4FUYA 4E3CA 2WAJA 3RPYA 4AF3A 3DS6A 2X81A 4RVKA 3I81A 4AP7A 2IO6A 1PJKA 4DGOA 2BTRA 4MVFA 4UWCA 2F4JA 4EOQA 4FTUA 4E7WA 5TKDA 3ORNA 2PVJA 3Q2MA 2NO3A 3E8NA 2UZUE 3MH1A 3F2AA 3TJCA 2BR1A 3DBDA 4JQEA 3VW6A 3U6HA 4ZSLA 3DT1A 2X8DA 3ITZA 4Q5EA 1WBWA 1JLUE 3DA6A 4XNEA 3QD3A 1XBAA 3D0EA 3EQHA 4FTAA 3FI3A 3T3UA 4F0FA 4IQ6A 4Z9LA 4JJRA 4ACDA 4GT3A 5L2SA 2C4GA 1E1VA 4RSSA 5K0XA 2ZM1A 2PZPA 4R3RA 5CU6A 2W1ZA 3THBA 4B9DA 4P90A 1QPCA 4F0GA 2C3LA 1F0QA 4FL2A 4CTCA 4ALVA 4KAOA 4QTBA 3WF5A 4J53A 4BTMA 4C3FA 2VX1A 3DK6A 4HNFA 4KBKA 3LVPA 3BRBA 3R1SA 3G90X 1UWHA 3PWYA 3WZDA 3F3VA 3BU6A 3LJ0A 1T45A 3E7OA 1WBOA 1J1CA 3PPKA 1M7QA 4BIEA 3HV3A 1H1SA 3CJGA 4FI1A 4S34A 3FPQA 4IEBA 1GZ8A 5EYKA 2IW8A 4FTQA 5LMBA 4RQVA 4RJ7A 3ZO3A 4CV8A 2NPQA 3DBEA 4HGEA 4ZLZA 4DEGA 4RWLA 3WARA 2UW8A 4XLIA 5FQDC 5J1WA 4U8ZA 3MPAA 3QYZA 3F9NA 5DEWA 2VTLA 3IK3A 3O7LB 4EOSA 2Z2WA 4LG4A 5KNJA 3EN4A 4BYIA 4RIWA 2RSVA 5JQ8A 3OY3A 3FQSA 5I4NA 2HXLA 4ANQA 3ZLYA 4Z7HA 3MJ2A 4PL5A 4A7CA 4HJOA 5BMSA 4U43A 2WOTA 4YPDA 4PTCA 1M52A 1OUKA 4ZSAA 1H28A 3R7UA 2R0UA 4FF8A 4PDPA 3KL8A 3QA8A 4EL9A 4X2GA 2OGVA 3TNWA 3RM6A 4UV0A 3MTFA 4II5A 5CI6A 4FT9A 4FX3A 4GV1A 4TY1A 4AN3A 1V0OA 1X8BA 5FM3A 4CFMA 2A4LA 3BGQA 3W33A 3RAHA 3FLSA 5ANDA 5DWRA 1Z5MA 4ZJVA 5M4UA 4HCVA 4JIKA 4FL1A 1FPUA 2JFLA 5C03A 3KULB 3VUHA 2J50A 2VTQA 2UV2A 2PMNX 3FC2A 3HP2A 3TKIA 4AFJA 1LPUA 5HNIX 5L6OA 3ALOA 3PTGA 3I5NA 3KA0A 4IB0A 4FVPA 5FBOA 5KMLA 4W8EA 3O8PA 2B4SB 1WAKA 2WZJA 3L8XA 4F64A 1W82A 4FODA 4F08A 4KS8A 3KN5A 3RPVA 4Z16A 2IZUA 4FTKA 2RFEA 4ASEA 4D2TA 4X2NA 1BYGA 2BAJA 2C6IA 5J87A 2X4FA 2XYUA 1LUFA 4HCUA 4FNXA 2OZOA 3NCGA 4PDSA 5A4CA 4H39A 4FR4A 3QZHA 4I5CA 4ZK5A 1ATPE 1YWVA 3QD2B 4I94A 2WIPA 3OWLA 4J95A 4RC2A 5JFVA 3GBZA 2YFXA 4F9CA 4KIKB 4D28A 1TQPA 4TYJA 4J52A 2VRXA 3P4KA 2ZM4A 5HTBA 3PXQA 1Q8UA 3F61A 3E5AA 3BLQA 3H4JA 4I6FA 4K9YA 4XBRA 4EH5A 3LFEA 2JDTA 2ETMA 4FKPA 4AE6A 2HW6A 5AP5A 3Q5ZA 3DJ7A 4CMTA 4BZDA 1OITA 4LGGA 2C1BA 3TUDA 3EOCA 1F5QA 4RX7A 2YAAA 4C59A 3FXXA 4FL3A 3TZMA 1PHKA 3NWWA 3MN3A 4BDDA 4F6SA 2C5XA 1Z9XA 4LYNA 3SLSA 4MD8E 3D15A 3F7ZA 4E26A 2XYNA 4EOOA 4USEA 3V6SA 1ZYLA 4I5HA 4RIOA 2J0JA 4EJNA 4O2ZA 4FC0A 3A8XA 4TT7A 4XX9A 3R7IA 3VAPA 2WMUA 3OY1A 4BDJA 3RBWA 4AA4A 4ACCA 5DHJA 3KK9A 4QQCA 3OCTA 2VTIA 3AD6A 2QKRA 3QQKA 3ULIA 5A6OA 1IASA 4M69B 4NW5A 2XM8A 4QTAA 3R8ZA 3KXHA 2C3KA 5L2TA 4JBQA 3BI6A 4FTOA 3CQWA 4NU1A 2HWOA 3PZEA 4ZTRA 3WYYA 3PSDA 2CKEA 2ITTA 2XB7A 3RHXA 3DDQA 2VO3A 3H3CA 3W8QA 3R1YA 4WG4A 2X6EA 2ZMCA 3OXTA 4NM7A 5C01A 4CNHA 3UTOA 2ETRA 4EH6A 4YR8A 4W4YA 1FINA 5EW9A 4GFGA 4CMUA 1KE5A 2FYSA 5KMJA 3ERKA 4NFMA 3VC4A 4AZVA 3UNJA 2GNHA 1PYXA 2W17A 4ZSEA 5JRSA 4F6UA 2WELA 5GZ8A 5KMKA 4IJPA 4NT4A 2Y0AA 5C9CA 4BGHA 3TCPA 2P3GX 4O0VA 4HGLA 3HDMA 4IZ5A 2Z7SA 3GC0A 4WNOA 3R8MA 5GNKA 4WHZA 4AT5A 4EHEA 2OKRA 3KVWA 3FV8A 1Q61A 5C26A 4S33A 2X0GA 3BHVA 2R3KA 5I9YA 4OLIA 1IA8A 4GVJA 3U51A 1W8CA 1KSWA 1RDQE 2VGOA 3R0TA 4K8AA 5H9BA 4V0GB 1YXTA 3T3VA 4AOTA 1H00A 4BCPA 4DFZE 4EQUA 4M8TA 4FKOA 4CKRA 5M44A 2X2MA 1K9AA 5IA5A 1UU7A 5L2IA 4RT7A 4IM2A 1VR2A 2ITOA 4UB7A 4HPUE 3GCUA 3QC4A 4K11A 3F2NA 2UW3A 1U54B 4UBAA 2YERA 3LOKA 4C4HA 3EYHA 1YWNA 3HMIA 2J2IB 3WOWA 2XIKA 4ERWA 4X3FA 3I7BA 2XKFA 5HICA 3SXSA 4WSQA 4AZEA 2PWLA 3DBCA 5AX3A 3W2CA 3BHUA 1KE6A 1ZY4A 3AD4A 1XWSA 4E8AA 1YXSA 3KFAA 5DNRA 5T3QA 3ZLSA 4BBMA 5L2QA 2RL5A 4Y8DA 2VWZA 2XIYA 3AGLA 5M55A 4M67A 5AA8A 4OUCA 2XIZA 1Q97A 4DFXE 4FIJA 4I6QA 3T9TA 5K3YA 4QPMA 3SW4A 2JIUA 4Z7GA 4B8MA 4TNBA 3ANRA 1U5QA 1YI3A 3NUNA 2ZV8A 4X0MA 3LM0A 2V7AA 5I5ZA 3DKGA 5E8TA 4PUZA 5IEVA 1YDTE 1R0PA 5CSVA 4QYEA 3BV3A 2FGIA 4I4FA 4GCJA 4G34A 4BI2A 1U5RA 4HZSA 4L52A 5CASA 2JDRA 3GOPA 1W83A 5AIRA 3FWQA 4FT0A 3RZFA 4I21A 4P5QA 5HESA 3ZFXA 4N6ZA 4YJUA 5M4FA 2H9VA 4XP2A 4UXQA 3O50A 3DZQA 2BDJA 5HD4A 5IMXA 4TXCA 2IVVA 2P2HA 5HLNA 2GNJA 1Y91A 2XNOA 3DKOA 2UZDA 1CKPA 3KQ7A 5I9XA 1PXKA 3UP2A 4AN9A 4OAVB 3JY0A 2VWXA 2YDKA 4J7BA 1JWHA 3MIAA 2CN5A 3V8TA 2BVAA 2VTSA 4P7EA 3DV3A 3NYOA 2CLXA 4O6LA 4S31A 3OW3A 4BDIA 4DH3A 1H07A 1BKXA 2UZVA 1Q8WA 2PVMA 3NR9A 3PUPA 5ANIA 1KOAA 4ZZOA 5AV3A 4OTFA 2PVHA 4M13A 4RLKA 3ZXTA 2KTYA 3HEGA 2W5AA 4U97A 2GFCA 4QQTA 4K1BA 2BROA 3NLBA 4E4LA 4YJSA 3SD0A 4CLJA 3GU4A 5IPJA 2OJIA 2VTAA 3HYHA 3II5A 3OFMA 4F99A 2ESMA 3MFTA 2WMRA 4XOYA 2OJFE 2XK7A 3LFSA 3MH0A 4NJ3A 5AUTA 1PMUA 4BBFA 4IMYA 4GU6A 2W7XA 3HUBA 3I7CA 5AUZA 2YDJA 4RBLA 4KIPA 4ONAA 4QPSA 5JFXA 4IB3A 3IGGA 4A07A 4WNPA 4QP9A 4I23A 2XS0A 3LXNA 5J7HA 5HLPA 3ELJA 2AUHA 4P5ZA 2JDSA 3P5KA 3PLSA 5FEDA 4X21A 4D9TA 2UZBA 3EQCA 2X2KA 3I6WA 3LQ8A 4FSQA 4GSBA 2RKUA 1M14A 2YLFA 3OF0A 3F66A 3KXNA 4YZ9A 3R8UA 4BTFA 1GIHA 4YMJA 2P33A 4DGLC 2QR7A 4L44A 5CXHA 3HMMA 2XK8A 4PWNA 5HE2A 3KULA 3D5VA 3K5UA 5B2MA 4BCOA 4XG9A 4EQMA 4GS6A 4ITJA 3EQFA 1H24A 3DDPA 2DS1A 5D7AA 4PMTA 5HCZA 3MYGA 4F9WA 1IR3A 5CQWA 3U6IA 3OEFX 1NVQA 1PY5A 4MXYA 4O38A 2YJSA 1RQQA 3QTZA 3UOJA 4ACMA 3V5LA 2E9PA 2X6DA 3QHWA 2A1AB 4TW9A 2WMAA 4DHFA 4M68A 4PX6A 1RJBA 2QHNA 3EZRA 4E4NA 5L8KA 3BWJA 5CAQA 4F7LA 2GNIA 4YP8A 3MH3A 4IZYA 4DLIA 2XM9A 1UKHA 3NIEA 3OCGA 4K6ZA 1Y6BA 1AGWA 1OL2A 2VUWA 5LVPA 2O2UA 2WKMA 3BHYA 3AC2A 3P23A 2OF4A 4FVRA 4ARKA 4JXFA 4C4IA 4QP8A 2R3LA 3G51A 4ZOGA 5DR2A 3MPTA 5CEPA 1OM1A 1OIQA 4YLJA 3HKOA 2YLEA 4H36A 2XEYA 4L8MA 3ZO1A 5AA9A 4DH8A 4KIKA 3NCZA 4GYIA 3P79A 4MQ2A 3LXKA 5I9VA 3K3JA 2PVKA 5BUJA 4MHAA 3ZRKA 2R64A 4YJNA 3FPMA 3T8OA 4R3PA 3O8TA 4RPVA 3AT3A 4WBOA 3UZTA 5IUGA 3ZH8A 2QLQA 4FTLA 4CZTA 4YU2A 4RIYB 3C4XA 4BTKA 2VWBA 3PZHA 4YC3A 4Y83A 4KABA 3PJ3A 4PTGA 4ZY6A 4TTHB 4WIHA 4Y73A 2BPMA 2VO0A 4RFZA 4GJ2A 3TUCA 3O2MA 4FKWA 4LOOA 2XK4A 1R1WA 5EI6A 3RHKA 4N4SA 1YXVA 4EI4A 3FYJX 2ZYBA 3HV4A 5CX9A 4RX9A 4Z3VA 3CP9A 3D5UA 3MFRA 2R3PA 3QALE 4XG8A 4M69A 3GNIB 2YISA 4IVBA 4JX3A 5KO1A 4G3GA 3RPOA 3QWKA 4BTJA 3RJCA 3U4UA 4XV9A 1UU9A 3CGFA 4D1XA 4S32A 3S3IA 4GU9A 4AS0A 4HZRA 4C4GA 5TR6A 4RIWB 4U3YA 3TNIA 3QXOA 4G5JA 1Q4LA 2YCRA 3D5WA 2C5VA 1XO2B 4PPAA 4WBBB 3EQBA 2BHEA 4O6EA 4O0WA 2R3FA 5BNJA 3CD3A 4D55A 1DI9A 2XNPA 3A8WA 3TJDA 3VRZA 4RIXB 4LRKA 2C6LA 4WA9A 2WQMA 4AX8A 3FLNC 3V8SA 3D4QA 1YHSA 4JG7A 2WMXA 1HOWA 2Z8CA 4EYJA 2R3MA 3OTUA 3BYUA 3PP1A 3QC9A 3A2CA 1SVEA 2UVXA 4ANSA 4C4JA 4V0GA 2OXDA 3LCSA 3OCSA 3Q9WA 4LMUA 4QQJA 5HE0A 4U44A 5TT7A 5BUIA 2B9JA 3H0ZA 3E64A 3OG7A 4L42A 5AM7A 4EK3A 1H1PA 3NYVA 3AMYA 1KE8A 4DG2E 3BKBA 2OF2A 3IDPA 2EUFB 4V01A 3BE9A 2VAGA 4EK4A 4RQKA 2J0MB 1QMZA 2VZ6A 3UO5A 2VWUA 2WU7A 3FKOA 1U54A 4CTBA 5EDQA 4HYSA 2EB2A 3FXZA 4AFEA 2UVYA 1O6LA 2ITWA 4DCEA 3EMGA 1VYZA 4GG7A 3E92A 4L7SA 4ANBA 5L8JA 3IO7A 2CCIA 4F4PA 3V51A 5CWZA 2QU5A 4FIIA 4PL4A 3WIGA 2R3HA 2F57A 4IE9A 3HLLA 2YEXA 5CU0A 5A54A 1VEBA 5JFSA 2R2PA 4UN0C 2BRGA 2H96A 3E88A 1M2QA 4C2WA 3AOXA 3NGAA 4IFGA 4ZTMA 2BDFA 3FZSA 3G5DA 4R1VA 3AGMA 4CV9A 2QOFA 5LJJA 4R7IA 5EM6A 4YO4A 4FZ7A 4F9AA 4DFYA 4HVIA 3O51A 3LCOA 4PDOA 4RWKA 3F3ZA 3GU5A 3UVQA 1SVGA 3C0GA 3KXGA 3L8PA 4NM3A 5M51A 3L8VA 2HCKA 4BCQA 3KF4A 2QOKA 5CLPA 4IWDA 4HNIA 5HO8A 3RK7A 4G16A 3TACA 2OIQA 1WZYA 3H10A 4V04A 3WI6A 2CHLA 5JK3A 3M42A 5H8BA 4AACA 3IDBA 4LM5A 3KMUA 4G2FA 2OXXA 4ZIMA 3DB8A 3HMNA 4EZ7A 3UVRA 4F9YA 3LFFA 3NNXA 2BZKB 3OEZA 4N70A 1Q8ZA 4M14A 5BX0A 2PK9A 4YSMA 2FA2A 2X7GA 3W2SA 4D5HA 2QOHA 3UIMA 3ODZX 3H9OA 5F9EA 5J1VA 1Q24A 1NXKA 4FTTA 1WVYA 5AUWA 5EI8A 4JR3A 2BZJA 4FYNA 1MRUA 4AU8A 4JAJA 4UMRA 2B55A 3COHA 3GEQA 5CT0A 3WF6A 4E73A 3EN7A 3N9XA 5AAEA 5BVDA 2WHBA 4PPBA 4M3QA 2O63A 3ULZA 5LCKA 4U3ZA 3KU2A 5IA3A 5E8ZA 4EH3A 3MFUA 3R2BA 3VS1A 1QL6A 3L9NA 4PMPA 2Z60A 4FV2A 4TYHB 4L68A 4CFWA 4EOMA 2OICA 1DAYA 3BU3A 4XG7A 3BEGA 1JAMA 2XNEA 3GI3A 3FL4A 3NRMA 3UC4A 4HGSA 5KZ0A 1ZWSA 2WGJA 3R22A 5HBHA 3HA6A 3ROYA 2B53A 5J79A 2J5EA 5CF6A 1YRPA 3LCDA 4IAKA 1R3CA 4FV8A 4O0UA 1JSVA 4FMQA 4U9AA 4WT6A 3C4EA 4G6LA 1KE7A 4FKLA 3I0QA 3ZUVA 3D9VA 3GGFA 3TV7A 4JVGA 1HCLA 3EJ1A 3FMDA 5AJQA 1APME 3LFCA 2OIDA 3FQEA 5HG7A 4IAIA 4PMMA 3SXFA 3MVJA 2WOUA 2IW6A 3B2TA 5C8NA 3IOKA 5CVFA 5I9ZA 4XS2A 2WTVA 3L9LA 5BPYA 2PVLA 3IW6A 3DJ6A 4N0SA 4B0GA 4Q9SA 1H0VA 4DEBA 5A4EA 5EM8A 3R83A 1JOWB 5E7RA 3OOMA 5HO7A 4FZAB 4TN6A 1G5SA 5DVRA 5L6WL 3TIYA 2JD5A 3UIXA 4QD6A 3VN9A 5LVOA 5K9IA 3MH2A 2AYPA 4RJ8A 3DNDA 4YZMA 4FKTA 3H0YA 3IS5A 3RK5A 4CVAA 5HNBA 2XH5A 5CI7A 2IZSA 2F7EE 3CR0A 1UVRA 3ALNA 3PY1A 5ANEA 2VWYA 3JUHA 3R9OA 5AM6A 3LMGA 1A9UA 3LPBA 3HMOA 4YNOA 5EHYA 3QLFA 2C5OA 5DBXA 5DPVA 4D2PA 2WNTA 4JBOA 4CFVA 4WNMA 2OI4X 2VTOA 3IQ7A 3R7OA 3SKCA 3CBLA 1HCKA 1OKYA 2OIBA 5CNNA 3R01A 5B2LA 4MEDA 3TT0A 3QQLA 3KRRA 5EG3A 3EN5A 4AW0A 4NIFA 4H3BA 3AMBA 5C1QB 5KMMA 2XK9A 3W2QA 2C3JA 2FVDA 5JFWA 4JG8A 4LL0A 3BYSA 3NW7A 3QL8A 3TKUA 4E6DA 4FGBA 1M7NA 3MV5A 3Q04A 2GU8A 3ZDUA 2ZDTA 4YZDA 3A60A 3FY2A 4F1OA 4C3PA 2OFVA 2RG6A 2XP2A 4CRLA 1BI8A 4FK6A 3RMFA 3A7HA 3W55A 5JZNA 5AP7A 2CJMA 5HKMA 1U59A 2W1FA 2XNMA 3DCVA 4NTTA 3K2LA 5FLFA 5K4IA 4HCTA 1VYWA 4RIYA 5JQ5A 3F3UA 3V8WA 3TIZA 1P5EA 1NVSA 3PE1A 4BCMA 4BVUA 4AN2A 5IH6A 5EYMA 3VULA 2O3PA 2X9EA 5D9HA 1Q62A 5IISA 3KF7A 3LXPA 3MDYA 4WG3A 1CM8A 3WILA 4A4LA 1YOJA 4AE9A 2YJRA 4AGDA 4CFFA 1W7HA 4C34A 4ZLOA 2A2AA 4CXAA 3EH9A 4QYFA 4NKSA 4QO9A 5IA2A 1OKVA 4JAIA 1PXPA 4MBLA 2C69A 5AIKA 2EXCX 2WTIA 5EW3A 3NZ0A 4J8MA 4FNWA 5HZNA 2WTDA 1KE9A 4L67A 3FI2A 3C4FA 1JSTA 3FLYA 3MA3A 2FSMX 4EK6A 1ZYSA 5BQ0A 4D2RA 5LWMA 2UW6A 4QTEA 5F94A 3TXOA 3ZLWA 3WE8A 4GW8A 3RWPA 3G2FA 4MTAA 2ZOQA 2HELA 4D4YA 5IEYA 1YDRE 2VN9A 3SAYA 2XIRA 4FKRA 3MVLA 3QHRA 4L45A 2WD1A 4MXAA 4RIXA 4WKQA 4R1YA 3RI1A 2R3IA 4C36A 5F95A 4BDAA 2CLQA 4CSVA 2HWPA 3NS9A 4A4OA 3KK8A 4BWXA 5M4CA 2BZIB 2PE2A 3QX2A 2KULA 2G2IA 3L8SA 3NIZA 4AT4A 5IZFA 4UEUA 4C33A 4RVLA 2C0IA 5B2KA 1JNKA 4YO6A 4C2VA 1PMVA 3A4PA 3JYAA 3Q96A 3U8WA 3COIA 3UPZA 5G6VA 4U80A 3CEKA 2I6LA 3VS3A 2W0JA 4MAOA 4BCGA 4X3JA 1GZNA 1OB3A 1VZOA 4PMSA 2PSQA 3G33A 5H2UA 2XEZA 5E92A 4YTIA 3FI4A 4NZWB 1FVTA 2GCDA 2B9IA 3KXXA 3M1SA 4F63A 2FO0A 1EH4A 1J1BA 1ZMVA 5GHVA 3FHIA 3Q4ZA 2HY81 2QVSE 4MWHA 4NKAA 4O1PA 5DH3A 3BQRA 3R71A 5AV0A 2I0EA 4EOKA 2IWIA 3BV2A 2Z7QA 2R7BA 3ZO2A 4XBUA 4CFXA 4YPSA 3FE3A 1WBPA 4DGGA 2VWIA 3E87A 2NRYA 1CDKA 2ONLC 2OXYA 2PTKA 3RAKA 1WBVA 1GAGA 4YGAA 2YM3A 3ZYAA 3QUDA 4CEGA 3LFDA 4EORA 3ZEPA 4IZAA 4EK8A 4XG6A 5BVOA 1KWPA 4BHNA 2ZB1A 3VUDA 2C6EA 5AUUA 4X2JA 4GYGA 2C68A 4LFIA 3HRBA 4UZHA 2BKZA 3QA0A 4IZ7A 3R7EA 4I6HA 2OG8A 3R1NA 3ENHA 3QRKA 3QTQA 4MXXA 4Y72A 5JH6A 3V5QA 3ZONA 4FKUA 4J96A 3FL5A 3R2YA 1ZOGA 3R04A 3O96A 4FKIA 4WUNA 4H58A 3QZIA 3ZLXA 3A7JA 5GJDA 4YNEA 5AP4A 4AZTA 4DEAA 4FKGA 4EK5A 2W4JA 1QPJA 4D2VA 4ZTNA 4KNBA 3TNPC 4PP7A 2C5NA 2P55A 3QD0A 3QRTA 4D1SA 4E5WA 2R3OA 4G3CA 3KXZA 5AMNA 2J5FA 2WQOA 4AZSA 2GS7A 2NP8A 3B2WA 4BDBA 3VJNA 5A3XA 4LUDA 4O0TA 3QCQA 2VTTA 2IN6A 4XHKB 3GENA 3OP5A 4CRSA 5FG8A 4DLJA 2JKMA 1YXUA 3OW4A 4UYAA 1URCA 3AT4A 4YZBA 3ZM4A 2V55A 2YIYA 2ZVAA 4YJOA 4FSYA 3VWAA 2YABA 5FTQA 1SNXA 2LGCA 2IVTA 5ICPA 3PRFA 5IKWA 2GPHA 3JY9A 2OZAB 4ANNA 4CLIA 3PPZA 3SC1A 3K3IA 4YHFA 1GIJA 1H8FA 3EQIA 1OI9A 3F3TA 3NUYA 4TYHA 4WRGA 1Q8TA 5ANGA 2XJ0A 4YZCA 5C27A 4Z55A 2BZHB 2R3RA 4MWIA 4XRJA 3RCDA 4C58A 2WMBA 3VBVA 3FUPA 3UQFA 1SNUA 4XV3A 3OXZA 4JRVA 4IB1A 4DN5A 1PXLA 3NDMA 4QQ5A 5HI2A 2WMTA 1TVOA 3BELA 3QRUA 4A4XA 4EH7A 2BRHA 5LVMA 3GB2A 3H9FA 4Y5HA 3HX4A 4W4VA 3OROA 2WTWA 2C47A 2W9ZB 3P78A 5F20A 5ETCA 1BLXA 4FOBA 3S0OA 3AC4A 5A46A 5A4TA 2JIVA 3RNIA 1XJDA 3D5XA 3NYNA 4EH8A 4ACGA 3OTVA 4YZNA 3D7TA 4C62A 3IDCA 4DGMA 3CTQA 2JKQA 4RMZA 4NSTA 3DB6A 1IEPA 4ZSJA 2GNFA 2R5TA 3CTHA 3WZUA 5HG9A 3MSSA 4U79A 2W05A 3A99A 3DAJA 2R3GA 3LM5A 4N6YA 4GIHA 4QMNA 3R21A 4K33A 3OBGA 3R8LA 5HTCA 3GU6A 4KIQA 4OTGA 2O0UA 3QYWA 4EOLA 4BCKA 4F70A 4FT5A 3FBVA 3AC3A 3UJGA 2OH0E 4EUUA 3BE2A 2UW5A 4U81A 5HNGA 4A9YA 3AC5A 2QU6A 1ZYDA 4A9RA 4YSJA 2BAQA 4MF0A 5CAOA 2PMIA 4A06A 1YWRA 2WXVA 5D11A 4RC3A 3PY0A 3A7IA 3VHKA 5CF4A 1JBPE 5ITAA 4I3ZA 5I9UA 2QOIA 2W1DA 4I5PA 2OO8X 4L7FA 4ZY5A 3B8QA 4D4SA 4AUAA 3HA8A 4GK2A 3BGZA 3QKLA 3NAXA 2BUJA 4U6RA 4X2KA 5AV2A 4C37A 1OZ1A 3DXNA 4MXOA 3FLWA 5I3RA 1L3RE 3U9CA 3UNKA 5A9UA 4RFMA 2WEVA 2UW4A 5ETFA 5ETIA 4QMWA 2E9OA 2GMXA 3FDNA 4NUSA 5HCXA 3QTRA 3UP7A 2Y7JA 4XEYA 3EQRA 4RJ5A 1MP8A 4JBPA 2HW7A 1WVWA 3CY3A 3TZ9A 4BCFA 4AW2A 2PY3A 5AR2A 4DAWA 2B7AA 3EFKA 4UMPA 3HRCA 3E3PA 4U5JA 2BHHA 3PXFA 2IZRA 3QQGA 3UOLA 5HO6A 4F7SA 1UKIA 4C7TA 4XV1A 2BDWA 3E63A 2BILB 2XNNA 3E93A 4O2PA 5GZAA 4FSZA 3KXMA 4L00A 3NYXA 5FP5A 1YVJA 2IZTA 4L6QA 4FIHA 4IANA 1LR4A 4FNZA 4KBCA 5L4QA 3R28A 4DH7A 2VD5A 3ZHPC 3G9LX 3CTJA 4XG2A 4UX9A 4FZ6A 2FSOX 3FY0A 4D2SA 2Y6OA 3CY2A 1YXXA 4HPTE 2I0YA 5EI2A 3O17A 2JBOA 2VNYA 3CKWA 2WQNA 3Q9YA 5J9YA 3U6JA 3PA3A 4D4RA 4MBIA 2CSNA 2PVRA 2QOBA 4IJ9A 2Y6MA 4DYMA 1OIUA 1SM2A 3O8UA 4JIAA 4F09A 2A0CX 4NM0A 4CYIA 3RAWA 3S1HA 4BWKA 5JGBA 4X6QC 4BWPA 4X6RA 4U40A 3TKHA 4QP4A 1O9UA 2VTMA 2W4KA 5CTPA 3E7VA 3CXWA 4EUTA 4FA2A 2GHLA 3ET7A 4LGHA 1UNLA 3ANQA 2JBPA 3PJ8A 4QMOA 2V7OA 3DQWA 2I1MA 3EQGA 4FEQA 4MCVA 3VS4A 3ZEWA 4MNEB 1ZARA 5DMZA 4L9IA 4YJRA 4F7JA 3GC9A 4G6OA 2HZ4A 1FVRA 1IG1A 1P2AA 3OXIA 2W1HA 2CCHA 3IW4A 4EWQA 2X9FA 4FV6A 3L9MA 3UMXA 1SMHA 3SOAA 5EFQA 5HHWA 3UZPA 4OTDA 4TPTA 2ITNA 2WPAA 4F9BA 4C3RA 2OJ9A 3EYGA 3O23A 3Q5IA 4BC6A 4E93A 5HBEA 4FV0A 1YKRA 1M17A 2UW0A 4ZAUA 1JKLA 3KGAA 4YJPA 2YN8A 2UZLA 1H0WA 2YHVA 2IVSA 1JKKA 3KRLA 5HCYA 1OL1A 4B99A 5M57A 1F3MC 4WNKA 3QRIA 3U87A 3F6XA 4ANLA 2JKKA 4I5MA 4B7TA 3H30A 4RLLA 2HK5A 2JIIA 3LJ1A 4DBNA 3DQXA 2X2LA 3IPHA 4M15A 5HVKA 4Q9ZA 4GVAA 3KCKA 2DYLA 3FMHA 5D1JA 4WSYA 4LL5A 4LOPA 4O1OA 3SDJA 4QMQA 3NAYA 2CGWA 3O0GA 2ITXA 5AR5A 1XR1A 3TUBA 5AR8A 3IG7A 3P7CA 4HVHA 4NIFB 2WIHA 4MD7E 1Q41A 1UNGA 5A14A 3ZO4A 4TYIA 4DFLA 2VTHA 3JXWA 4FTRA 3S95A 5K5NA 5AAGA 4PQNA 4XP0A 4D4VA 5LMKC 4IVDA 4DEEA 4K0YA 3FZTA 3F69A 5KMNA 4QNAA 4LRJA 4FIEA 3PVUA 4KKHA 5CF8A 4YJQA 3PVWA 4QMYA 4UWYA 5HX6A 1GZKA 3DTCA 2ZV7A 3DBQA 3ORZA 5IH4A 4EH2A 2XF0A 5CSXA 1E9HA 3UYSA 5IF1A 4QMPA 2YCQA 3FKNA 3W1FA 3R73A 4GEOA 4BICA 2BIKB 3KVXA 3R8VA 3RALA 4IX3A 1OECA 4IX4A 5ANOA 4ZZNA 2QOLA 4CD0A 3BX5A 3W2RA 3NUSA 4W9XA 3ORPA 4AOJA 3QTSA 4ERKA 5HIDA 4IDVA 4QNYA 2HZ0A 3UVPA 3COKA 3GP0A 2BCJA 4XCUA 3NNVA 5K0KA 4E20A 5L3AA 2QQ7A 3LXLA 1UV5A 3W2PA 2Q0BA 3C50A 4DG0E 4F0IA 1E1XA 2GS2A 3HV6A 4EONA 1YHVA 4IAFA 4U42A 5DT4A 3UQCA 4EKKA 3QZFA 2X4ZA 2FB8A 3WBLA 5JN2A 3COMA 4MXZA 2OZAA 1ZZLA 2YDIA 4G9CA 3KCFA 5EOBA 1PMNA 3SQQA 4IX6A 1JQHA 3M11A 5DRBA 2YCSA 2ZJWA 3QQFA 4TWOA 5EHLA 2I0VA 4R5SA 4GFOA 3PG3A 2UZOA 1XH7A 5E91A 4XYFA 5DT3A 1PF8A 3LZBA 5FM2A 4GL9A 3W10A 4YLLA 4QPAA 5JRQA 2XCHA 4FT3A 2OFUA 4D9UA 4ITIA 4C38A 5FRIA 1Z57A 4ASZA 1UWJA 3NSZA 2BMCA 4XOZA 1G3NA 1QCFA 2UW7A 2XKCA 2YIWA 1U4DA 5BYZA 3PSCA 4FZFB 2CDZA 5GJGA 4C57A 3O71A 4G9RA 4BI1A 2VX3A 3ENMA 4NWMA 1H1RA 4M97A 3HL7A 2VWWA 4DFNA 3BGPA 3D83A 4RA5A 1P4FA 5K5XA 1JKSA 3GCQA 4QMSA 4JOAA 2AC5A 2BFXA 2XA4A 3BEAA 3D7ZA 4FG9A 4KSPA 3PPJA 2VO7A 3OD6X 3GCVA 4UZDA 4IC8A 3RKBA 4D0WA 1BUHA 4O22A 5CSWA 3BWFA 3ACJA 3CIKA 1BMKA 3ZFMA 1GJOA 1DI8A 2HYYA 4YJVA 2OU7A 5AUVA 5FXSA 4APPA 4YBKA 3MY5A 2OH4A 3DK7A 1YW2A 3MIYA 4PL3A 3AC1A 4IFCA 3WE4A 5HTIA 4AGUA 4PNKA 3DU8A 3LFBA 4H1MA 4EHVA 5CU4A 3Q60A 2R9SA 4PF4A 3GC8A 5DA3A 3LW0A 3S4QA 4OW8A 1RW8A 4TKSA 5HG5A 4RJ3A 4UMUA 3EB0A 3KMWA 4LI5A 5ACKA 3QTWA 5HIBA 2XKDA 3W2OA 4DH5A 3PVBA 2BIYA 4U45A 2G2HA 5M4IA 3V3VA 2ERZE 3OHTA 3MTLA 5AX9A 2Y4PA 4RA4A 4KINA 4PY1A 4IAZA 4JQ8A 5BVFA 4PV0A 4FTMA 2PZ5A 3HMPA 2RGPA 2A19B 5FEEA 4HOKA 2WTKB 5BVKA 4D58A 3I0OA 4D2WA 3RTPA 3BQCA 5L2WA 4IM3A 4S2ZA 3P7AA 3KMMA 3VUGA 3CJFA 1H1QA 4A9TA 2QO9A 3R00A 5CSHA 3V5PA 3GQIA 2YM5A 5KCVA 3VUKA 4IC7A 4DC2A 3GOKA 5AP1A 3UC3A 5EKOA 5CT7A 3P7BA 1JKTA 2VV9A 3BBTB 4IDTA 1UNHA 3FJQE 3AXWA 4EZ3A 4E1ZA 2FSTX 2ITVA 3Q9XA 2JKOA 3AMAA 3FMNA 4R8QA 4IVAA 2PZRA 3FAAA 4XUFA 3UODA 4HYUA 3ZZWA 4FIFA 4HW7A 3GT8A 5D10A 5CEQA 2XBJA 4G6NA 4ANMA 4FTNA 1JVPP 4EC8A 4C35A 3QWJA 4QT1A 4KA3A 4KBAA 4YJTA 3GQLA 4FKJA 3PXKA 3C0HA 4FIGA 3VBYA 4HYIA 5LQFA 2E9VA 3FMEA 5HQ0A 2HENA 1H25A 1GY3A 2W4OA 4UMQA 3N51A 3QCXA 4OBOA 3OS3A 2ZB0A 3QTUA 5DT0A 2WTCA 1NVRA 2EB3A 3GFEA 5DFPA 3CE3A 1K2PA 5CF5A 3EHAA 4E5BA 4QMXA 4RFYA 3LLTA 3OT3A 4FNYA 3E8DA 3MY1A 4FV5A 5EW8A 4AAAA 5HBJA 4MNEA 4PRJA 2G2FA 5IA1A 3I6UA 5KE0A 3MVHA 3EL7A 2QR8A 3V04A 3QUEA 4G5PA 4EH4A 4K77A 5IG1A 5IH5A 4EWHA 4J8NA 4QMVA 1FMOE 2BRBA 1URWA 3E62A 4FTJA 4TWCA 2X8IA 4IBMA 4CCBA 3Q9ZA 5HE1A 5T6KA 4QMUA 3RINA 4QTDA 3KN6A 3D7TB 3DLSA 4UY9A 3UIUA 2G1TA 3BYVA 4R6VA 3MW1A 5BVNA 3S00A 2FSLX 3EQPA 4WO5A 1Q3WA 4CZYB 3ZU7A 1H08A 4O27B 3U9NA 2XZSA 3L1SA 5A4QA 1W0XC 4C61A 2C30A 3QU0A 2QOCA 3HRFA 4QOXA 4FTIA 4IIRA 4FV9A 4FYOA 5HOAA 3I4BA 4XLVA 3LJ2A 5JEBA 1OPJA 3CD8A 4FSRA 1PW2A 5H8EA 5C8MA 4G3EA 4YURA 3IW7A 3KC3A 1WMKA 4QP7A 4AXAA 3LIJA 4EKLA 4FSMA 3P0MA 1OMWA 4OTHA 2CMWA 2F7ZE 4MH7A 4LUEA 4DITA 5J5SA 5KBQA 2JAVA 2ZV9A 3ROCA 1TQIA 4IHPA 4ZTQA 1B38A 5HGIA 4QMMA 2JGZA 3W16A 3ORTA 4Y46A 1FOTA 5CNOA 4O0YA 5L6PA 3MS9A 3PFQA 3E8CA 5EM5A 1UA2A 4Q5HA 2W1IA 4D5KA 2ACXA 2Y4IC 1LP4A 5EDRA 1XH8A 2HOGA 3OWKA 4GT4A 4F1TA 2DWBA 3PY3A 3NPCA 4CKIA 2C1AA 4EOPA 3TV6A 2UUEA 1SVHA 1H4LA 5BVWA 3PXYA 4V05A 1BI7A 1DS5A 1OKWA 2GTMA 5ANJA 4CT2A 1PYEA 2NRUA 2XJ2A 5EDPA 3VW8A 3QGYA 4L43A 2XK6A 4F7NA 4JDIA 3QGWA 3P08A 3MY0A 4HGTA 2G15A 5HLWA 2WQBA 3ZFYA 3BLHA 2R7IA 2RF9A 3E8EA 3PJ1A 3R7YA 1OKZA 2GNGA 5KHXA 5FXQA 4PNIA 3C4WA 1Q8YA 2PMLX 1OPLA 4O21A 3QRJA 4FSNA 2B1PA 3RM7A
chains in the Genus database with same CATH superfamily
1OVEA 4USFA 3EL8A 2PHKA 3HECA 2DQ7X 4UMTA 3HV7A 4XV2A 3HUCA 3QAME 5KMOA 1ZRZA 3DK3A 3OT8A 4CFUA 3L9PA 3C7QA 1ERKA 3IW5A 2REIA 3ZRMA 3RPRA 3FYKX 4MNFA 2V62A 3QQUA 4AGWA 1YDSE 2R0IA 4H3QA 4L46A 3DKCA 3P86A 3ZC6A 5CEKA 3EWHA 3TTIA 2JFMA 3WZKA 1H26A 1W2FA 3LCKA 5CENA 2E9UA 3CC6A 5IA4A 1NY3A 2HXQA 1PXJA 4KRCA 3G6HA 3RPSA 2W1CA 2PUUA 4YLKA 3RAIA 1YI6A 4FKSA 2QI8A 3DOGA 2DUVA 3TEIA 4FSWA 4DINA 4ZLYA 5B7VA 3I60A 3ZMMA 4U0IA 1R39A 3ORLA 4I92A 3R02A 2IW9A 4D0XA 1XH4A 3FMMA 2ITYA 2GSFA 4MXCA 1FQ1B 2YZAA 2QC6A 4HVSA 4RVMA 3VVHA 2WU6A 4RX8A 4BIBA 2W06A 2H6DA 3NW5A 3NX8A 4YC6A 2RFNA 5HE3A 4EEVA 5CYIA 4GFMA 4IAAA 3VBQA 2ZAZA 2PE0A 4RZVA 3F7WA 2X7OA 3D14A 4JT3A 1ZY5A 5E8YA 2XRUA 3UOHA 3TI1A 3OUNB 3ZUTA 4HVDA 3PSBA 3A7GA 3FMJA 4GG5A 3FC1X 1JSUA 3FLQA 3KRJA 2E2BA 4C8BA 3G6GA 4NCTA 4RG0A 4W4XA 5IUIA 2VNWA 2PMOX 1V1KA 3DNEA 5E8WA 3OVVA 3EN9A 5FP6A 2XKEA 3R7GA 3W8LA 4ACHA 5DLSA 4GK3A 2HAKA 5HU9A 3HNGA 2JLDA 3JVRA 2ITPA 4ZXTA 2ONLA 5FD2A 4GUEA 3IECA 3MGYA 2B52A 3FLZA 1H27A 2BTSA 1J91A 3IONA 3VRYA 3FQHA 4NCTC 5CEMA 2OWBA 3IGOA 3BHTA 3QLGA 5FEQA 2I40A 5ETAA 4FV4A 3PJ2A 5AR7A 4J1RA 3LFQA 4ZP5A 1XH9A 2WQEA 3QCSA 3KRXA 5I3OA 2WTJA 4IACA 4JR7A 3SW7A 3WZEA 2XUUA 3DFCB 3FMLA 3MVMA 2GQGA 3UG1A 3VO3A 5CZIA 4YUQA 4YTHA 3OWPA 4ALWA 3V01A 4C4EA 3AD5A 2X8EA 2CGVA 2QURA 4M0YA 4XG3A 4I0SA 4MX9A 2JC6A 3HV5A 3F3WA 3QFVA 3POZA 4EHGA 5L8LA 1K3AA 2GFSA 4MYGA 4BIDA 5DE2A 2JDOA 4BBEA 3PA4A 1ZAOA 4JNWA 2ZDUA 1CKJA 3AG9A 5F1ZA 3ZOSA 4YC8A 4ENYA 1DAWA 3QCYA 5AV1A 3LFAA 4FK3A 5LVNA 3HP5A 4QTCA 5KZIA 4Y5QA 2VO6A 2QOQA 4AOIA 4MD9E 3TL8A 4TWNA 3AT2A 2RFSA 4ZY4A 4IAYA 2B54A 4R7HA 3G0EA 3ZSIA 1LEZA 3C4ZA 2WTKC 2G9XA 1CKIA 4O0XA 3EFJA 4OTPA 2UZNA 2WMWA 3QX4A 4IADA 4APCA 4CKJA 1B6CB 3NNUA 4G3FA 1UU3A 4MBJA 4PTEA 2C6DA 4AWIA 2GDOA 2WFYA 4O0RA 4L53A 3E3BX 4CYJA 3SHEA 1I44A 4FV7A 3BCEA 4CQEA 2HIWA 3PYYA 5EM7A 4JDJA 2QD9A 1O6YA 4B6LA 5CY3A 3CKXA 2HZNA 2RFDA 1Y8GA 4FT7A 3R9HA 3DJ5A 3MPMA 2WMQA 1MQ4A 3UG2A 5KHWA 5J9LA 3Q6WA 4QP3A 4NJDA 5GJFA 1M2RA 4E5AX 5KKRC 3NNWA 4IXPA 3FZOA 4RZWA 1OL7A 4LQMA 4YBJA 3TV4A 5HORA 1H1WA 4TWPA 5DR6A 5LMAA 5IA0A 3FZPA 3QQHA 4U7ZA 5FWKK 2QCSA 1FGKA 2OK1A 4I22A 4IH8A 5AADA 4WOVA 4NEUA 5CS6A 3TZ7A 3BPRA 3EKKA 4BHZA 4BRXA 2EXMA 1QPDA 3RWQA 1LEWA 5E8UA 4MK0A 3GXLA 3LAUA 1H01A 4M12A 4P2KA 4PPCA 3DTWA 5CALA 1ZMWA 3SX9A 4IM0A 1Y6AA 4HYHA 5HX8A 2SRCA 2UZWE 5FTOA 1OIRA 4FICA 5D7VA 3LHJA 1CSNA 2PVFA 5IEXA 4FVQA 5EYCA 4C02A 3JS2A 4WD5A 5A4LA 2YAKA 5CQUA 1WFCA 4G1WA 3QD4A 2E9NA 3AQVA 3EKNA 3F5XA 3EZVA 3VHEA 5EKNA 3ODYX 2X39A 3DBFA 4FZDB 4R5YA 4TRLA 5G1XA 5LOHA 4AW1A 5IDNA 2QONA 2YIRA 4JDHA 2XJ1A 2J4ZA 4QYHA 5HU3A 4KS7A 2J7TA 2PVYA 3QUPA 4ITHA 4WG5A 2PE1A 2QG5A 3MFSA 3C5UA 4W9WA 3DPKA 2ZMDA 4BCHA 1MUOA 4OT5A 1ZMUA 2WEIA 4KRDA 4G17A 5LWNA 4XG4A 1O6KA 2OJGA 4NTSA 2QO7A 2R3JA 3OOGA 4ZJIA 1UU8A 1CTPE 3FZRA 4GH2A 4YTFA 3WZJA 2JDVA 2F7XE 2BRMA 4S30A 4TNDA 3D2IA 2W1GA 4R3CA 4I6BA 5AP3A 3FHRA 1ZLTA 2R3QA 4ZJJA 4IWOA 2OBJA 1Q3DA 1Q5KA 1S9IA 3I79A 3RVGA 4DG3E 5IDPA 1Y8YA 4X3FC 1ZYCA 1ZOEA 1NA7A 3I5ZA 3O7LD 4DTKA 4TZRA 4M66A 5TE0A 3FXWA 4QP1A 2QLUA 1V0BA 3PXRA 3F5PA 1WVXA 3C9WA 5CVGA 5DOSA 1WCCA 4GRBA 5CZHA 4AG8A 4Y85A 3OBJA 2Z7RA 4KD1A 1TKIA 3BLRA 4ZZMA 4I1ZA 3ZCLA 5AWMA 2V5QA 3C0IA 4K2RA 2IVUA 2C6MA 3KRWA 4JX7A 4ASXA 3PIZA 5LVLA 4JDKA 4FV3A 4JL9A 4KKGA 3QTIA 4LMNA 5FBNC 2ETKA 3KB7A 2QOOA 2YM8A 5CAPA 3PA5A 3QF9A 4U41A 2X0PA 3EN6A 3LQ5A 4JI9A 5E1SA 3QKMA 4C4FA 4E4MA 3FSKA 2UW9A 3A7FA 3VIDA 3VNTA 3BZ3A 4TYGA 5F4NA 5LARA 3UGCA 1S9JA 3ZBFA 4NH1A 3CS9A 3SV0A 3BIZA 5JZJA 3BBWA 1PMEA 3QTXA 3V5TA 4RJ6A 5HIEA 4F1MA 3FMKA 4KKEA 4L01A 4UXLA 2QO2A 3R6XA 3UIBA 4OBQA 3SOCA 4BKJA 4DEIA 4OAUC 5EOLA 3PRIA 3OMVA 3TTJA 2BAKA 3W18A 3P1AA 1REKA 1ZZ2A 4BI0A 1R0EA 4CQGA 1MRYA 3NUUA 2FH9A 4EH9A 1BX6A 3CQUA 2W99B 3GVUA 3REPA 3VS2A 4CMOA 2F2UA 3ORIA 1W2CA 1MQBA 2Y9QA 3PVGA 4FG7A 2EWAA 3SRVB 4AA5A 3D94A 4IW0A 2C6TA 4A9SA 1OUYA 3VBWA 4O4FA 2XVDA 1FVVA 4X2FA 3ZC5A 2YCFA 4RC4A 4EC9A 4XMOA 1OL5A 1RE8A 1TQMA 4EHZA 2AC3A 2I0HA 3Q53A 3TN8A 3M2WA 3K54A 3LE6A 4FKQA 4ZS0A 4MF1A 5TO8A 3UO4A 2VTJA 4F6WA 4I20A 4FV1A 4J99A 5AP0A 3V6RA 3CCNA 2QKWB 5HG8A 2Q0NA 5DG5A 1XBBA 3DAEA 4OTIA 2Y4IB 5CU3A 2ITQA 1CMKE 3OUKA 4HVGA 3C4CA 2GNLA 4BCJA 4DGNA 3ZBXA 4UYNA 1PXOA 4OTWA 5AP6A 3POOA 3FKLA 4I41A 4ZTHA 2B9HA 5CU2A 1XKKA 5DEYA 3UPXA 3W32A 1YQJA 3RK9A 2GTNA 4YHTA 2EVAA 3Q4TA 4BF2A 5LMKA 2PVNA 3D2KA 3ORMA 2QNJA 2B9FA 2XRWA 2XIXA 3K5VA 2IJMA 2W1EA 4JBVA 3UDBA 4BDGA 2A27A 3UBDA 1A06A 5J9ZA 4QYYA 4ENXA 3BYOA 4XP3A 4ALUA 5CAUA 4M7IA 4OTQA 5AUYA 1J3HA 3FZ1A 2JEDA 4FSUA 2BALA 3LFNA 1GIIA 5J7BA 4O96A 1ZOHA 4KWPA 3R8PA 5I9WA 4KSQA 4J97A 2PZYA 3DY7A 2C6KA 3EQDA 5FXRA 2BFYA 4E6AA 4AQCA 3PJCA 2YIQA 3QKKA 1T46A 4O0SA 2CPKE 4ASDA 4CT1A 2C6OA 2ERKA 3DLZA 3UMWA 1W2DA 4I4EA 1PXMA 4EOIA 5A6NA 4PP9A 4XJ0A 1AD5A 4J98A 3VBTA 5DN3A 5E8XA 1KOBA 2G01A 4X7QA 3PWDA 4OGRA 4M0ZA 1STCE 1FMKA 4GIIA 3GU8A 2GHMA 2VU3A 5FGKA 5AR4A 2YM7A 3Q52A 2XNBA 4NM5A 5DRDA 4RX5A 2VTNA 5M53A 3CPCA 5JKGA 1PKGA 5AV4A 3VBXA 5DGZA 2OSCA 2VWVA 1QPEA 5GZ9A 4AA0A 4UWBA 2WMVA 2J9MA 5DR9A 2CGUA 4FUXA 4BKZA 4WUAA 2BRNA 4E4XA 5BMMA 3AC8A 3EIDA 1W84A 3ORXA 4I93A 4L3PA 3RZBA 2JAMA 4BB4A 1FGIA 4FG8A 4JLCA 4OTRA 4GUBA 4BDFA 2VTRA 5HD7A 4AT3A 4EYMA 4JG6A 2VX0A 2O5KA 1YOMA 3RP9A 2O64A 2PZIA 5M56A 2P0CA 3NUXA 3NEWA 3A4OX 3VJOA 3TNHA 2EXEA 3WYXA 4RRVA 1AQ1A 3ORKA 1XH5A 4MQ1A 4BGGA 4QMTA 3VQUA 3Q3BA 4LV8A 4EBVA 3TZ8A 3LCTA 5AAFA 3UQGA 3G9NA 4IVCA 3R63A 2PL0A 3GCSA 4TYEA 4W4WA 4JS8A 3GFWA 2OW3A 5HVYA 3HVCA 3S2PA 1PXNA 4J71A 2YM6A 5EK7A 3A61A 4JRNA 5CVHA 3MB7A 4G3DA 4RVTA 5IU2A 4KIOA 4QRCA 4EBWA 4L3JA 3R9DA 4B4LA 5ANKA 5BVEA 3PXZA 3QQJA 3TG1A 5KMIA 4BZOA 2F49A 3F88A 4FBXA 4OBPA 3VS0A 2C0TA 4GMYA 3ZSGA 3NW6A 3QBNA 3VUTA 2W5BA 3HZTA 2OJJA 2CGXA 2C5YA 5J95A 4DEDA 3VUIA 4BKYA 2IEWA 4QYGA 3T9IA 3VS7A 2YM4A 3MBLA 5B0XA 5J8IA 5CSPA 4ZTLA 1PXIA 4ZEGA 5BUEA 5BYYA 3ETAA 3F82A 4LGDA 3F5GA 3R1QA 1PKDA 1WBSA 1WBTA 4USDA 4XH6A 4C0TA 4BDEA 3CLYA 5JMSA 5H3QA 2J0IA 3G0FA 4QMZA 3CGOA 1REJA 2ITZA 2YA9A 2Y8OA 2W9FB 3KEXA 4QP2A 1OIYA 3UYTA 4RWIA 2XBAA 3JVSA 3OZ6A 4I24A 3RCJA 3RGFA 4AZFA 3OC1A 3ZRLA 2J0KA 5J5TA 3C1XA 3FSFA 5JT2A 3SVVA 2W5HA 2UZTA 3PG1A 1GOLA 5I0BA 1Q99A 2O8YA 3KY2A 3CPBA 4GK4A 3WF9A 1XH6A 4ANOA 2O65A 4MKCA 5EH0A 2UZEA 3EFWA 4OT6A 5K4JA 2R3NA 3CQEA 3RNYA 3VS6A 1OGUA 3C51A 1M2PA 1SZMA 3WF7A 5IUHA 3VUMA 3R7VA 1ZXEA 4EZ5A 1YHWA 1IRKA 4LV5A 3BYMA 3ZXZA 3ZTXA 4BYJA 3MWUA 3UOKA 1I09A 3I1AA 4ZSGA 4BZNA 2HZIA 4TL0A 1V0PA 4D1ZA 3KKVA 3U4WA 2R4BA 4FSTA 4BGQA 4IWPA 2C3IB 5ACBC 2XK3A 1BL7A 1Y57A 3GUBA 4Y95A 3F5UA 5DI1A 2F9GA 3MB6A 3UO6A 3BHHA 2QHMA 3PIXA 1OL6A 3IOPA 5E90A 3ZZEA 4I0TA 3BU5A 4RWJA 3GCPA 4ZTSA 4DEHA 3GU7A 2GS6A 3A62A 4A9UA 5C8KA 2QODA 3GC7A 5KKRB 3PIYA 4O91A 4H1JA 1XQZA 2YIXA 5EYDA 3Q4UA 4CCUA 3P9JA 4W8DA 5E8SA 4BFMA 3QZGA 5AUXA 2C0OA 3JPVA 1R78A 1ZYJA 4XRLA 1B39A 2RIOA 1YOLA 4WRSA 3ZS5A 5CXZA 1SYKA 5AR3A 5FDXA 2EU9A 2W96B 4BN1A 4BCIA 5JGAA 4YTCA 4BDHA 2P4IA 3R9NA 4EOJA 5CAVA 1OPKA 5CANA 4I0RA 3V5JA 3WF8A 2JITA 1BL6A 4GJ3A 3QXPA 4QP6A 2Z7LA 3ZDIA 1P14A 3OCBA 4OR5A 4IX5A 4DH1A 3Q32A 1XHAA 4FTCA 4P4CA 4CFNA 5D12A 1GNGA 3TWJA 4LOQA 5HEZA 2CN8A 2GHGA 2RG5A 1W98A 4RJ4A 3NUPA 4NFNA 3ACKA 3DZOA 4O4DA 4FOCA 4L3LA 3DAKA 4KB8A 2X7FA 4FKVA 1P4OA 5D41A 2J6MA 4NW6A 3SRVA 3MA6A 3Q6UA 3PP0A 3TNQB 1VJYA 1KV1A 5IMEA 3R30A 3SXRA 1U46A 2ITUA 2J51A 2ZM3A 4NK9A 5DIAA 4QMLA 4AW5A 5JSMA 2WO6A 5E8VA 3V5WA 4CZUA 3C13A 5KBRA 3DGKA 3HGKA 4AZWA 2F2CB 2LAVA 4ID7A 4GT5A 3MI9A 4M84A 4E6CA 4E6QA 3EFLA 3ZUUA 2HY0A 5KUPA 2YWPA 5KX8A 2VGPA 3OWJA 4LRMA 4RGJA 3VF9A 2XCKA 4BDKA 4F65A 1DM2A 4IB5A 4UALA 2V22A 2ZV2A 3UNZA 2J90A 2H34A 3SA0A 3VF8A 3Q4CA 3HDNA 5T68A 4Q2AA 3ZSHA 4BL1A 3MJ1A 3PE2A 1WBNA 1KV2A 4H3PA 4BDCA 2P2IA 2YACA 3IKAA 4G31A 5CEIA 3VS5A 5LXMA 2H8HA 3VQHA 3B8RA 4K18A 2VTPA 2XNGA 2J0LA 4BCNA 1XBCA 4IWQA 5CEOA 2WMSA 2X1NA 1YI4A 2X0QA 5H8GA 4YHJA 2WB8A 2UVZA 3IW8A 5TOZA 2XMYA 2YITA 5EHOA 5TF9A 5LCJA 1JPAA 4X3FB 5AEPA 4AGCA 5JGDA 3DKFA 4JQ7A 3WIKA 4B8LA 3DFAA 1MRVA 1GZOA 3H9RA 5E1EA 4EQCA 3UE4A 5FDPA 2V0DA 5HVJA 5AP2A 2FUMA 4FUYA 4E3CA 2WAJA 3RPYA 4AF3A 3DS6A 2X81A 4RVKA 3I81A 4AP7A 2IO6A 1PJKA 4DGOA 2BTRA 4MVFA 4UWCA 2F4JA 4EOQA 4FTUA 4E7WA 5TKDA 3ORNA 2PVJA 3Q2MA 2NO3A 3E8NA 2UZUE 3MH1A 3F2AA 3TJCA 2BR1A 3DBDA 4JQEA 3VW6A 3U6HA 4ZSLA 3DT1A 2X8DA 3ITZA 4Q5EA 1WBWA 1JLUE 3DA6A 4XNEA 3QD3A 1XBAA 3D0EA 3EQHA 4FTAA 3FI3A 3T3UA 4F0FA 4IQ6A 4Z9LA 4JJRA 4ACDA 4GT3A 5L2SA 2C4GA 1E1VA 4RSSA 5K0XA 2ZM1A 2PZPA 4R3RA 5CU6A 2W1ZA 3THBA 4B9DA 4P90A 1QPCA 4F0GA 2C3LA 1F0QA 4FL2A 4CTCA 4ALVA 4KAOA 4QTBA 3WF5A 4J53A 4BTMA 4C3FA 2VX1A 3DK6A 4HNFA 4KBKA 3LVPA 3BRBA 3R1SA 3G90X 1UWHA 3PWYA 3WZDA 3F3VA 3BU6A 3LJ0A 1T45A 3E7OA 1WBOA 1J1CA 3PPKA 1M7QA 4BIEA 3HV3A 1H1SA 3CJGA 4FI1A 4S34A 3FPQA 4IEBA 1GZ8A 5EYKA 2IW8A 4FTQA 5LMBA 4RQVA 4RJ7A 3ZO3A 4CV8A 2NPQA 3DBEA 4HGEA 4ZLZA 4DEGA 4RWLA 3WARA 2UW8A 4XLIA 5FQDC 5J1WA 4U8ZA 3MPAA 3QYZA 3F9NA 5DEWA 2VTLA 3IK3A 3O7LB 4EOSA 2Z2WA 4LG4A 5KNJA 3EN4A 4BYIA 4RIWA 2RSVA 5JQ8A 3OY3A 3FQSA 5I4NA 2HXLA 4ANQA 3ZLYA 4Z7HA 3MJ2A 4PL5A 4A7CA 4HJOA 5BMSA 4U43A 2WOTA 4YPDA 4PTCA 1M52A 1OUKA 4ZSAA 1H28A 3R7UA 2R0UA 4FF8A 4PDPA 3KL8A 3QA8A 4EL9A 4X2GA 2OGVA 3TNWA 3RM6A 4UV0A 3MTFA 4II5A 5CI6A 4FT9A 4FX3A 4GV1A 4TY1A 4AN3A 1V0OA 1X8BA 5FM3A 4CFMA 2A4LA 3BGQA 3W33A 3RAHA 3FLSA 5ANDA 5DWRA 1Z5MA 4ZJVA 5M4UA 4HCVA 4JIKA 4FL1A 1FPUA 2JFLA 5C03A 3KULB 3VUHA 2J50A 2VTQA 2UV2A 2PMNX 3FC2A 3HP2A 3TKIA 4AFJA 1LPUA 5HNIX 5L6OA 3ALOA 3PTGA 3I5NA 3KA0A 4IB0A 4FVPA 5FBOA 5KMLA 4W8EA 3O8PA 2B4SB 1WAKA 2WZJA 3L8XA 4F64A 1W82A 4FODA 4F08A 4KS8A 3KN5A 3RPVA 4Z16A 2IZUA 4FTKA 2RFEA 4ASEA 4D2TA 4X2NA 1BYGA 2BAJA 2C6IA 5J87A 2X4FA 2XYUA 1LUFA 4HCUA 4FNXA 2OZOA 3NCGA 4PDSA 5A4CA 4H39A 4FR4A 3QZHA 4I5CA 4ZK5A 1ATPE 1YWVA 3QD2B 4I94A 2WIPA 3OWLA 4J95A 4RC2A 5JFVA 3GBZA 2YFXA 4F9CA 4KIKB 4D28A 1TQPA 4TYJA 4J52A 2VRXA 3P4KA 2ZM4A 5HTBA 3PXQA 1Q8UA 3F61A 3E5AA 3BLQA 3H4JA 4I6FA 4K9YA 4XBRA 4EH5A 3LFEA 2JDTA 2ETMA 4FKPA 4AE6A 2HW6A 5AP5A 3Q5ZA 3DJ7A 4CMTA 4BZDA 1OITA 4LGGA 2C1BA 3TUDA 3EOCA 1F5QA 4RX7A 2YAAA 4C59A 3FXXA 4FL3A 3TZMA 1PHKA 3NWWA 3MN3A 4BDDA 4F6SA 2C5XA 1Z9XA 4LYNA 3SLSA 4MD8E 3D15A 3F7ZA 4E26A 2XYNA 4EOOA 4USEA 3V6SA 1ZYLA 4I5HA 4RIOA 2J0JA 4EJNA 4O2ZA 4FC0A 3A8XA 4TT7A 4XX9A 3R7IA 3VAPA 2WMUA 3OY1A 4BDJA 3RBWA 4AA4A 4ACCA 5DHJA 3KK9A 4QQCA 3OCTA 2VTIA 3AD6A 2QKRA 3QQKA 3ULIA 5A6OA 1IASA 4M69B 4NW5A 2XM8A 4QTAA 3R8ZA 3KXHA 2C3KA 5L2TA 4JBQA 3BI6A 4FTOA 3CQWA 4NU1A 2HWOA 3PZEA 4ZTRA 3WYYA 3PSDA 2CKEA 2ITTA 2XB7A 3RHXA 3DDQA 2VO3A 3H3CA 3W8QA 3R1YA 4WG4A 2X6EA 2ZMCA 3OXTA 4NM7A 5C01A 4CNHA 3UTOA 2ETRA 4EH6A 4YR8A 4W4YA 1FINA 5EW9A 4GFGA 4CMUA 1KE5A 2FYSA 5KMJA 3ERKA 4NFMA 3VC4A 4AZVA 3UNJA 2GNHA 1PYXA 2W17A 4ZSEA 5JRSA 4F6UA 2WELA 5GZ8A 5KMKA 4IJPA 4NT4A 2Y0AA 5C9CA 4BGHA 3TCPA 2P3GX 4O0VA 4HGLA 3HDMA 4IZ5A 2Z7SA 3GC0A 4WNOA 3R8MA 5GNKA 4WHZA 4AT5A 4EHEA 2OKRA 3KVWA 3FV8A 1Q61A 5C26A 4S33A 2X0GA 3BHVA 2R3KA 5I9YA 4OLIA 1IA8A 4GVJA 3U51A 1W8CA 1KSWA 1RDQE 2VGOA 3R0TA 4K8AA 5H9BA 4V0GB 1YXTA 3T3VA 4AOTA 1H00A 4BCPA 4DFZE 4EQUA 4M8TA 4FKOA 4CKRA 5M44A 2X2MA 1K9AA 5IA5A 1UU7A 5L2IA 4RT7A 4IM2A 1VR2A 2ITOA 4UB7A 4HPUE 3GCUA 3QC4A 4K11A 3F2NA 2UW3A 1U54B 4UBAA 2YERA 3LOKA 4C4HA 3EYHA 1YWNA 3HMIA 2J2IB 3WOWA 2XIKA 4ERWA 4X3FA 3I7BA 2XKFA 5HICA 3SXSA 4WSQA 4AZEA 2PWLA 3DBCA 5AX3A 3W2CA 3BHUA 1KE6A 1ZY4A 3AD4A 1XWSA 4E8AA 1YXSA 3KFAA 5DNRA 5T3QA 3ZLSA 4BBMA 5L2QA 2RL5A 4Y8DA 2VWZA 2XIYA 3AGLA 5M55A 4M67A 5AA8A 4OUCA 2XIZA 1Q97A 4DFXE 4FIJA 4I6QA 3T9TA 5K3YA 4QPMA 3SW4A 2JIUA 4Z7GA 4B8MA 4TNBA 3ANRA 1U5QA 1YI3A 3NUNA 2ZV8A 4X0MA 3LM0A 2V7AA 5I5ZA 3DKGA 5E8TA 4PUZA 5IEVA 1YDTE 1R0PA 5CSVA 4QYEA 3BV3A 2FGIA 4I4FA 4GCJA 4G34A 4BI2A 1U5RA 4HZSA 4L52A 5CASA 2JDRA 3GOPA 1W83A 5AIRA 3FWQA 4FT0A 3RZFA 4I21A 4P5QA 5HESA 3ZFXA 4N6ZA 4YJUA 5M4FA 2H9VA 4XP2A 4UXQA 3O50A 3DZQA 2BDJA 5HD4A 5IMXA 4TXCA 2IVVA 2P2HA 5HLNA 2GNJA 1Y91A 2XNOA 3DKOA 2UZDA 2A98A 1CKPA 3KQ7A 5I9XA 1PXKA 3UP2A 4AN9A 4OAVB 3JY0A 2VWXA 2YDKA 4J7BA 1JWHA 3MIAA 2CN5A 3V8TA 2BVAA 2VTSA 4P7EA 3DV3A 3NYOA 2CLXA 4O6LA 4S31A 3OW3A 4BDIA 4DH3A 1H07A 1BKXA 2UZVA 1Q8WA 2PVMA 3NR9A 3PUPA 5ANIA 1KOAA 4ZZOA 5AV3A 4OTFA 2PVHA 4M13A 4RLKA 3ZXTA 2KTYA 3HEGA 2W5AA 4U97A 2GFCA 4QQTA 4K1BA 2BROA 3NLBA 4E4LA 4YJSA 3SD0A 4CLJA 3GU4A 5IPJA 2OJIA 2VTAA 3HYHA 3II5A 3OFMA 4O4BB 4F99A 2ESMA 3MFTA 2WMRA 4XOYA 2OJFE 2XK7A 3LFSA 3MH0A 4NJ3A 5AUTA 1PMUA 4BBFA 4IMYA 4GU6A 2W7XA 3HUBA 3I7CA 5AUZA 2YDJA 4RBLA 4KIPA 4ONAA 4QPSA 5JFXA 4IB3A 3IGGA 4A07A 4WNPA 4QP9A 4I23A 2XS0A 3LXNA 5J7HA 5HLPA 3ELJA 2AUHA 4P5ZA 2JDSA 3P5KA 3PLSA 5FEDA 4X21A 4D9TA 2UZBA 3EQCA 2X2KA 3I6WA 3LQ8A 4FSQA 4GSBA 2RKUA 1M14A 2YLFA 3OF0A 3F66A 3KXNA 4YZ9A 3R8UA 4BTFA 1GIHA 4YMJA 2P33A 4DGLC 2QR7A 4L44A 5CXHA 3HMMA 2XK8A 4PWNA 5HE2A 3KULA 3D5VA 3K5UA 5B2MA 4BCOA 4XG9A 4EQMA 4GS6A 4ITJA 3EQFA 1H24A 3DDPA 2DS1A 5D7AA 4PMTA 5HCZA 3MYGA 4F9WA 1IR3A 5CQWA 3U6IA 3OEFX 1NVQA 1PY5A 4MXYA 4O38A 2YJSA 1RQQA 3QTZA 3UOJA 4ACMA 3V5LA 2E9PA 2X6DA 3QHWA 2A1AB 4TW9A 2WMAA 4DHFA 4M68A 4PX6A 1RJBA 2QHNA 3EZRA 4E4NA 5L8KA 3BWJA 5CAQA 4F7LA 2GNIA 4YP8A 3MH3A 4IZYA 4DLIA 2XM9A 1UKHA 3NIEA 3OCGA 4K6ZA 1Y6BA 1AGWA 1OL2A 2VUWA 5LVPA 2O2UA 2WKMA 3BHYA 3AC2A 3P23A 2OF4A 4FVRA 4ARKA 4JXFA 4C4IA 4QP8A 2R3LA 3G51A 4ZOGA 5DR2A 3MPTA 5CEPA 1OM1A 1OIQA 4YLJA 3HKOA 2YLEA 4H36A 2XEYA 4L8MA 3ZO1A 5AA9A 4DH8A 4KIKA 3NCZA 4GYIA 3P79A 4MQ2A 3LXKA 5I9VA 3K3JA 2PVKA 5BUJA 4MHAA 3ZRKA 2R64A 4YJNA 3FPMA 3T8OA 4R3PA 3O8TA 4RPVA 3AT3A 4WBOA 3UZTA 5IUGA 3ZH8A 2QLQA 4FTLA 4CZTA 4YU2A 4RIYB 3C4XA 4BTKA 2VWBA 3PZHA 4YC3A 4Y83A 4KABA 3PJ3A 4PTGA 4ZY6A 4TTHB 4WIHA 4Y73A 2BPMA 2VO0A 4RFZA 4GJ2A 3TUCA 3O2MA 4FKWA 4LOOA 2XK4A 1R1WA 5EI6A 3RHKA 4N4SA 1YXVA 4EI4A 3FYJX 2ZYBA 3HV4A 5CX9A 4RX9A 4Z3VA 3CP9A 3D5UA 3MFRA 2R3PA 3QALE 4XG8A 4M69A 3GNIB 2YISA 4IVBA 4JX3A 5KO1A 4G3GA 3RPOA 3QWKA 4BTJA 3RJCA 3U4UA 4XV9A 1UU9A 3CGFA 4D1XA 4S32A 3S3IA 4GU9A 4AS0A 4HZRA 4C4GA 5TR6A 4RIWB 4U3YA 3TNIA 3QXOA 4G5JA 1Q4LA 2YCRA 3D5WA 2C5VA 1XO2B 4PPAA 4WBBB 3EQBA 2BHEA 4O6EA 4O0WA 2R3FA 5BNJA 3CD3A 4D55A 1DI9A 2XNPA 3A8WA 3TJDA 3VRZA 4RIXB 4LRKA 2C6LA 4WA9A 2WQMA 4AX8A 3FLNC 3V8SA 3D4QA 1YHSA 4JG7A 2WMXA 1HOWA 2Z8CA 4EYJA 2R3MA 3OTUA 3BYUA 3PP1A 3QC9A 3A2CA 1SVEA 2UVXA 4ANSA 4C4JA 4V0GA 2OXDA 3LCSA 3OCSA 3Q9WA 4LMUA 4QQJA 5HE0A 4U44A 5TT7A 5BUIA 2B9JA 3H0ZA 3E64A 3OG7A 4L42A 5AM7A 4EK3A 1H1PA 3NYVA 3AMYA 1KE8A 4DG2E 3BKBA 2OF2A 3IDPA 2EUFB 4V01A 3BE9A 2VAGA 4EK4A 4RQKA 2J0MB 1QMZA 2VZ6A 3UO5A 2VWUA 2WU7A 3FKOA 1U54A 4CTBA 5EDQA 4HYSA 2EB2A 3FXZA 4AFEA 2UVYA 1O6LA 2ITWA 4DCEA 3EMGA 1VYZA 4GG7A 3E92A 4L7SA 4ANBA 5L8JA 3IO7A 2CCIA 4F4PA 3V51A 5CWZA 2QU5A 4FIIA 4PL4A 3WIGA 2R3HA 2F57A 4IE9A 3HLLA 2YEXA 5CU0A 5A54A 1VEBA 5JFSA 2R2PA 4UN0C 2BRGA 2H96A 3E88A 1M2QA 4C2WA 3AOXA 3NGAA 4IFGA 4ZTMA 2BDFA