4FF8A

Inhibitor bound structure of the kinase domain of the murine receptor tyrosine kinase tyro3 (sky)
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
218
structure length
169
Chain Sequence
KEFDHPHVAKLVILPFMKHGDLHAFLLASRIPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVAVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMVYDLMYQCWSADPKQRPSFTCLRMELENIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase receptor TYRO3
publication title Highly selective 2,4-diaminopyrimidine-5-carboxamide inhibitors of Sky kinase.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase/transferase inhibitor
total genus 53
structure length 169
sequence length 218
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ff8A00
1Q61A 1T45A 2WIHA 4J96A 4RIXA 3V8TA 3V01A 2XCKA 5IA2A 1DAYA 3M1SA 4C59A 4QD6A 4DBNA 3OCSA 3FKLA 4MX9A 4M67A 4PP9A 4XMOA 2C30A 1JVPP 3FY2A 2X39A 3DBDA 3IDPA 3LVPA 4IWPA 3RM7A 3ZMMA 5KBRA 3R7EA 3TKUA 5HU9A 3ODZX 3PXZA 3OC1A 5HD4A 3QKKA 4C4EA 3KFAA 1JAMA 3C50A 4IVCA 5GJFA 5L2WA 3IO7A 3WZKA 4IAIA 4MBLA 5DFPA 4EC8A 5KMJA 1OPJA 2BPMA 5I5ZA 3O8UA 4OT5A 3FSFA 3ZOSA 4GU6A 2PVLA 2BZKB 1QL6A 2YCQA 4CTBA 1Q41A 4BCQA 3N9XA 5KMOA 3R7UA 4ASEA 4KNBA 3LAUA 1VZOA 4FTCA 4CXAA 4JR7A 3UVQA 4OT6A 2XRUA 2PZPA 4HGEA 1Q8WA 4X7QA 5TF9A 1CKIA 2Z7RA 3UG1A 4XP3A 1V0BA 4FK3A 5E8XA 4EYMA 2IJMA 2F49A 4KRCA 4R7HA 3QTSA 1M7NA 1ZWSA 2QR8A 4FSWA 3R8VA 2QOCA 4MVFA 5LMKA 3EN7A 1YXTA 4EK6A 5A46A 1PXIA 4RC4A 3KMMA 1RQQA 3ANQA 3SV0A 5BVDA 1PXMA 4L46A 4U45A 2ITUA 4UWYA 4YHTA 2RFSA 4FTMA 5KMKA 3P4KA 1WZYA 2ZYBA 3DTWA 3IGGA 4RX8A 5AUXA 3VF8A 3ZSGA 2XP2A 4RX9A 4Q9ZA 4BDJA 5DRBA 4QNAA 5CAQA 4NM3A 2FSOX 2YAKA 3CD3A 3Q52A 5HX6A 2GHGA 3QLFA 4O0RA 2ACXA 3PA3A 3ZUTA 3FZSA 4BKZA 2VX0A 3S2PA 1FPUA 4QPMA 3PG1A 4C38A 3ORMA 3CIKA 3P1AA 4S2ZA 2WZJA 3AC5A 3II5A 3ACKA 3RPRA 5KHWA 4MQ1A 5HVJA 1UVRA 3FMJA 4RIWB 3MYGA 3F82A 4DFLA 3SX9A 4E7WA 2ITWA 3SC1A 4E6DA 3AC4A 4FT0A 4TYHB 3KN6A 4R5YA 2A4LA 2YA9A 3DFAA 3MY5A 1O6KA 2I40A 4NZWB 4USEA 4IWOA 4F9YA 3PUPA 3FI4A 4QP4A 2X8EA 1SYKA 2F7ZE 5AR4A 5DG5A 2VTPA 5AV3A 4U8ZA 3TI1A 3CPCA 4H36A 1R1WA 4IB1A 3PYYA 5FGKA 5H8EA 3E64A 2H6DA 4TNBA 2QI8A 4NW6A 3BGPA 4FKPA 4C57A 2AC3A 3NYOA 2HCKA 4B4LA 3RGFA 4OTGA 2O3PA 3PY3A 5M44A 3ZRMA 4N0SA 5C03A 4NSTA 3NUSA 4R1VA 3SXFA 3V6SA 4QP7A 3VUHA 4EQCA 4YJVA 4YSMA 3TACA 5AIRA 2VTHA 2PTKA 3MFRA 4JT3A 1O6LA 4M8TA 2Q0BA 5IA4A 2VRXA 3CY3A 3OHTA 5TT7A 4RMZA 4ZSJA 5JKGA 3R7OA 3PY0A 5L2TA 5E92A 3O96A 3HUCA 1GIIA 3CCNA 4D5HA 4G9CA 4JAIA 1UWJA 1AGWA 4W8EA 3UMWA 1J91A 2A19B 2BDFA 4YJQA 3ORLA 2C0IA 5HG7A 3NLBA 1Y91A 5AMNA 1AQ1A 5AUTA 3HYHA 4KKEA 3OBGA 4BCNA 2VWXA 4GK4A 4MXYA 2B4SB 3FXWA 3PE1A 2UW4A 4JL9A 4J52A 3DB6A 4RIWA 2YM8A 5J5TA 3R0TA 3MBLA 3LFFA 5GZ9A 1OL1A 2VO6A 2YIRA 4TYHA 3PSBA 1QMZA 4BDEA 3ZONA 3LOKA 3LM0A 3GQLA 3LQ8A 3LCSA 2W9FB 3MVMA 2VTIA 3SHEA 4ZTLA 3BYOA 4OTDA 4QQCA 4ZZNA 3WF8A 3DLSA 4NTSA 4D2WA 5EDQA 4ZTQA 2XBAA 3RNIA 4EOJA 2ETRA 3CLYA 4GIIA 5HBHA 4IAYA 3M42A 4RBLA 5E1SA 4RWJA 3ZEPA 3LPBA 2XEZA 3V8WA 1ZMUA 3L9PA 4AAAA 3E88A 3FLQA 3QD2B 4FV2A 1LEWA 2WQMA 2OI4X 3PJ2A 3HP2A 3I6UA 3QQFA 4M13A 1P14A 1KSWA 3UNZA 3PJ8A 3WBLA 4DFXE 1OKVA 2W1IA 1R78A 3GC0A 3ZRLA 4EONA 4D1XA 2B9JA 1H24A 3NW6A 4KIKB 4IZ5A 4YTIA 2XMYA 4QQTA 2PE2A 3TNIA 4N4SA 3DDQA 5CF4A 3OWJA 4G31A 2HELA 4L67A 1OPLA 4EOSA 5AUYA 3MFUA 4CMTA 3BU3A 4YJNA 1PHKA 2C5YA 1UKHA 2VWWA 4H1MA 3FC2A 1VYZA 2VTSA 3F7ZA 3QHWA 4LFIA 3BLHA 3R6XA 4BI1A 4RA4A 3AC2A 5EI8A 4EOQA 2WMUA 5AP5A 1WVWA 4UZHA 5FM2A 2B9FA 2G2FA 2ZJWA 4QMNA 1RDQE 3R8LA 3ZZEA 1SMHA 1PKGA 1H8FA 4GS6A 4TYGA 3EIDA 2FSLX 4IFGA 4X3JA 3EL7A 3C51A 3GOKA 4FSUA 4GG5A 4FNZA 5HCXA 1U46A 5J5SA 3QX2A 4FKOA 1V0OA 4G3FA 3GBZA 1P5EA 3EFWA 3QQHA 3I81A 4X0MA 4UX9A 3R1YA 3RI1A 3V5PA 2QU6A 3NAXA 4QMMA 4HW7A 4D55A 1GZOA 1SVEA 4JG6A 3QZGA 3Q5ZA 4X3FC 4XV1A 1U5QA 1UU7A 3ZBXA 3WE8A 3HLLA 3TJCA 4JRVA 2B7AA 4QMUA 3Q9ZA 1YHSA 2ZOQA 3P7AA 2G2IA 4CQEA 3GXLA 3ZDUA 5JFWA 3PP1A 4CSVA 3MJ1A 2J4ZA 4C4IA 4BTJA 2UZLA 4L3PA 4U81A 3ZC6A 4EWQA 3OG7A 1JWHA 3GCPA 2PUUA 1Q24A 4YMJA 1KWPA 2HZ4A 2QHNA 2C69A 3FI3A 5CYIA 5H8BA 3EHAA 2OICA 4IX3A 3RAHA 3DQWA 3KF4A 4F63A 4FV9A 3VN9A 3EJ1A 2WELA 2R2PA 2XF0A 2RFEA 4X21A 4Q2AA 3OWKA 3W2SA 5HLWA 2VD5A 5AR5A 2GS7A 2OFVA 1ZYCA 4LM5A 2WGJA 1H1PA 3GGFA 1JKKA 3HEGA 3OP5A 4HZSA 4PPCA 3DAEA 4NJ3A 1XKKA 2HW6A 3OROA 5DEWA 5EM7A 5C26A 4NEUA 3UC4A 3VVHA 4IEBA 3ZDIA 3FPMA 3P7BA 1JKTA 4JQEA 3HMMA 4AN2A 2V62A 3EFKA 4IADA 4F6WA 4OTRA 5LVPA 2VO7A 2WTKB 2VGOA 4Z7HA 3PPZA 2VNYA 4JDHA 2UVZA 3KULA 3WF9A 5DOSA 4CTCA 4EOKA 3BV3A 4QP8A 3PG3A 4K1BA 3BU5A 1QPEA 2R7BA 5K4IA 2ITTA 5CSWA 3UE4A 3VJOA 4EZ3A 1LEZA 4ALVA 2AC5A 4JQ7A 5CNOA 2BFYA 3ACJA 1GJOA 3PIYA 3TWJA 4APPA 3D0EA 3FWQA 1YHWA 3U6HA 2ETKA 4G6OA 3FQHA 3WF7A 5IUIA 3JS2A 4GEOA 3KMWA 1RW8A 3FLNC 4G3CA 5CVGA 5AM7A 5K4JA 5K5XA 3AMYA 3JYAA 3Q6WA 3MTLA 4HNIA 5H3QA 2RKUA 1XJDA 3R02A 4CZTA 4LV8A 3S00A 2P2HA 3GB2A 3IW7A 4G2FA 3VS0A 4E3CA 4OTWA 4B9DA 1H25A 3PPJA 4EC9A 4JJRA 4FTKA 5AP3A 1URCA 4I23A 4RLLA 5DI1A 1MQBA 4DEIA 3QYZA 3RALA 5KO1A 4JAJA 1J1CA 2G9XA 1OKZA 2WTVA 3BU6A 5DWRA 3VO3A 3MH0A 5CSPA 2R3IA 3OVVA 4FT9A 5HBEA 1ZOHA 2W05A 3KXXA 4FICA 5HZNA 3QUDA 2QR7A 4QMOA 3UBDA 3Q96A 2C6MA 4WUNA 4BCFA 5KE0A 2BRGA 4J71A 3F5UA 2WU7A 4IWQA 2VNWA 4BCKA 4DEBA 4QT1A 3EQFA 1W0XC 2C5XA 4KIOA 3GENA 5ANGA 4IDTA 4LGHA 1G5SA 4WIHA 1OKWA 3I5ZA 4TTHB 1TKIA 4YNOA 4UMTA 3KC3A 4NM0A 4UWCA 4TYEA 2YM4A 3HRFA 3F3TA 2R7IA 3C4CA 5EH0A 1CKJA 2OZAB 2WTJA 4C33A 1QPDA 3F2AA 3ZRKA 4D1ZA 3IOKA 2DS1A 2YACA 3QALE 2J7TA 3PVGA 5JEBA 4FYNA 3PXRA 2ITOA 4J95A 1H1SA 4QTEA 4XLIA 3PXYA 3FZRA 1Y6BA 4NK9A 5CNNA 4E5BA 2CGVA 3ZLSA 3L9NA 5IF1A 1LR4A 3D14A 3DV3A 2JD5A 2QD9A 4QP6A 5M4IA 1J1BA 3W8QA 1ZXEA 3F2NA 3RWQA 3Q9WA 5HD7A 4K6ZA 4BFMA 4HCVA 4XOZA 2XIXA 4DTKA 4ZY4A 4FT7A 2XNBA 4DG2E 2BUJA 1P4OA 5FTQA 3VW8A 4M15A 3PA5A 5J9YA 2WEVA 4DH8A 5E1EA 4ANLA 3P08A 3UPXA 4YTCA 4RIOA 2OF2A 3UP2A 4IX6A 4G5PA 3ZTXA 1F3MC 2PVJA 3OTVA 3E87A 3AOXA 4D2SA 4IXPA 4TY1A 3FMMA 4GH2A 1JSTA 4ONAA 4ZSLA 3ORNA 2J50A 4YZMA 4XCUA 4O6LA 4UB7A 3R73A 4R3CA 2PE0A 4A4OA 4PQNA 5E91A 4XX9A 5EKNA 2X7FA 3VC4A 5IA0A 3RHXA 4RRVA 4D4YA 3EOCA 2NRUA 4ZEGA 3E8EA 5FWKK 3MH3A 2UW6A 3JPVA 3F61A 4AACA 3PXFA 3PXKA 3W2QA 4CRSA 3DBFA 2W5BA 4DGNA 2RFDA 5BPYA 2PMOX 1YHVA 4FBXA 3VQUA 2OZAA 4GJ3A 3V5TA 2JKQA 2WXVA 3Q60A 5IG1A 3A61A 2O0UA 2W1CA 3CTHA 2F2UA 2IVUA 4PY1A 4YGAA 3FI2A 3H9FA 3R21A 4FKQA 3A7FA 4XH6A 1H1QA 1JSVA 4KIPA 5TR6A 4CFWA 4ZLZA 4I92A 4IMYA 4ZTRA 1UU3A 3OXZA 3VHEA 1Z57A 3AG9A 4E4XA 5DLSA 2Y0AA 5CI7A 3KRXA 4K0YA 5L8LA 2YM5A 5EW9A 3OT3A 3O23A 5T68A 3V5JA 3VAPA 4FIJA 5AR2A 3F3VA 3QC4A 3V51A 2R3JA 4YZ9A 4YHJA 4IQ6A 4DH7A 4APCA 4E5WA 3GFEA 3AT2A 3R30A 3O17A 1BL6A 3RNYA 1S9JA 2C3KA 5BVKA 3EH9A 5EFQA 2AYPA 3RPSA 2OU7A 3OXIA 3W2CA 4C2WA 3R2YA 5EW8A 3HP5A 5HE0A 4OTIA 3VUKA 4AZEA 1Z5MA 3MS9A 4FC0A 4L9IA 4NKSA 3R7IA 1REJA 5I4NA 3DB8A 3C4FA 4FZAB 4H3QA 3BIZA 4ITIA 5L2IA 2V5QA 2G15A 4JOAA 3SD0A 5CU2A 1Q97A 2X4FA 4FGBA 3R7GA 3MVLA 4W8DA 2IW6A 2XZSA 3E5AA 5AR7A 4FV3A 4LI5A 5H2UA 2C6KA 3NNWA 4GFOA 4LMNA 5CEOA 2QVSE 1VR2A 2FSMX 4ZLOA 3TNWA 1KE5A 3P9JA 3UQFA 2ZV8A 5I9VA 3PSCA 4GV1A 3KVWA 1BMKA 4G5JA 4KSPA 3COIA 2ZB0A 1CKPA 1KV2A 4FOBA 4I94A 3EQRA 2UW0A 5F1ZA 4BKJA 2BDJA 4Z16A 4HYHA 4J8MA 4E73A 4AOJA 4Q5HA 3T3VA 2WTIA 3HRBA 3I1AA 3EQPA 3IW5A 4QMZA 3NPCA 4RGJA 5E8YA 4F64A 1B39A 4AT3A 4GT5A 3MFTA 4HJOA 5EYKA 4V04A 4AN9A 2RGPA 2C3JA 2C6LA 2HWPA 2Y7JA 2VWIA 4ACCA 4J97A 3CQWA 4CYIA 4KB8A 4U97A 3VRYA 2VWVA 3RK7A 2QURA 1NVSA 4BDDA 5I3RA 4QRCA 3PA4A 2FO0A 1BI8A 3FHRA 3OY3A 3RCDA 4HGSA 4TN6A 5CAVA 2G2HA 3ZH8A 3IKAA 4L68A 4X2FA 3K5VA 3DPKA 1OL6A 2OH4A 3FLYA 3TV4A 5LWNA 2WKMA 4XV3A 2CKEA 3OUNB 5HO7A 3B2TA 3DAJA 4EK4A 3PPKA 4CFXA 4IAAA 1OMWA 1YKRA 3UOKA 5E8WA 3H9RA 1U5RA 3FY0A 4YTFA 5I9YA 2QODA 4F0FA 5BUEA 3MA3A 1UNHA 4BTKA 2EU9A 3EZRA 2XNEA 3ENMA 4IX5A 3C1XA 4L7FA 5CT0A 3W55A 5IH4A 2CGXA 4ANSA 4CMUA 1W84A 3R71A 3DS6A 3A99A 4G3GA 4OBOA 1ERKA 1R0PA 3QRTA 5HVYA 2C68A 4L3LA 2JFMA 4ERKA 2XK9A 1BX6A 3QYWA 4MHAA 2B1PA 3ROYA 3ZSHA 5CS6A 1FMOE 4D4VA 4P4CA 2W1DA 5A14A 3NEWA 5EHLA 4K2RA 5D11A 3GUBA 2JDRA 4BGQA 5IMXA 4XBRA 4BTMA 4FVQA 4Y73A 3VF9A 5HEZA 4A9SA 4CKRA 4KABA 4MXXA 3CBLA 2W4JA 4M7IA 2ZV9A 1PW2A 1UNGA 2YABA 5HU3A 2QC6A 2W1ZA 3HX4A 2JDTA 4F6UA 4RFYA 5FLFA 4G17A 3QGWA 3UGCA 4EEVA 2UVYA 3ZLYA 5CSHA 1PMEA 4RPVA 4LUEA 5HNIX 4BTFA 5F20A 5LQFA 5CASA 2C47A 2YDKA 4OW8A 4MD9E 2YDJA 5LMBA 3DA6A 3ULZA 4FTOA 4DAWA 5ETCA 3WOWA 4QMTA 4W4VA 5JMSA 2WMAA 1S9IA 2WD1A 3DDPA 3KQ7A 3EWHA 1KE6A 3UDBA 5FEDA 4JX7A 3VBYA 2HZNA 4KD1A 4BCHA 5CI6A 4XLVA 2DWBA 1YDRE 4N6ZA 5HTBA 2R0IA 4LRKA 3HVCA 3I5NA 2ZVAA 4RFMA 3NX8A 4BL1A 3ALOA 3QL8A 4O0VA 4K18A 4AE9A 3KCFA 4YZNA 2X9EA 5JFSA 4W4YA 4EL9A 1EH4A 3FAAA 3S0OA 3FMDA 3OY1A 3PTGA 4U0IA 2ZMDA 4WNKA 2J0JA 4UWBA 5CEIA 4CCUA 2KTYA 4PTCA 3BWFA 4JBQA 3QCSA 4PPAA 3MDYA 1W8CA 3F5XA 1DI9A 2Y6MA 1ZYLA 3OBJA 4M12A 4TWNA 1JPAA 2QOKA 4LRMA 2HZIA 1FOTA 3PWDA 3HDNA 3QTIA 4FTLA 4I5HA 3TEIA 2R3NA 3UO5A 3F9NA 4RVLA 1ZOGA 2BROA 4FYOA 2E9PA 4Y83A 2R9SA 4BDBA 4EUTA 2HOGA 3GU8A 2XH5A 2UUEA 2GU8A 4O22A 4YJRA 5HO8A 4BN1A 3NWWA 4DLIA 4AZSA 2SRCA 2WQBA 2XJ0A 2XIZA 3AC8A 3QCQA 2X7OA 4J53A 5JGBA 3O7LD 2XNGA 2IZSA 4E4LA 4C58A 4GFGA 3A7GA 4FSTA 4ZTMA 5ANDA 4TWCA 1OL2A 2XM9A 4AZWA 4ITHA 4M68A 4QYGA 4RJ4A 4IZYA 4WSYA 2I0VA 3QBNA 5BVNA 4YZCA 5HQ0A 5IEYA 4U5JA 2CN8A 3QTZA 4ZTHA 3UODA 4BB4A 2GFCA 5B7VA 2YERA 1TQPA 3POZA 4MF1A 2ZMCA 3VUIA 3LXLA 3D94A 4FZDB 2HAKA 1XH4A 3KEXA 3TL8A 4F7SA 3AC1A 3UMXA 2JBPA 4AFJA 4YLJA 3ZO1A 3EN6A 3G33A 3R1SA 3NUPA 4FKLA 4ZJJA 1H08A 4FSYA 4OBQA 4YLKA 3FLSA 3A60A 1Z9XA 5AUZA 5IU2A 1XR1A 3FSKA 1Q5KA 4FTRA 3VUTA 4AOIA 4M3QA 4A7CA 4JBPA 2F9GA 5EYMA 2KULA 4JDJA 4WKQA 2VWBA 1PKDA 2UW7A 3QTQA 1JBPE 2B54A 2F2CB 4WOVA 5M4FA 5ANOA 1H28A 5LXMA 4OBPA 4II5A 4GVAA 5KKRB 3VQHA 4G3DA 4F9AA 4L8MA 2R3LA 1YDTE 3P23A 3HMNA 4HCUA 4FZFB 4Q9SA 5A3XA 2W1HA 5HIBA 4DITA 2W17A 4RSSA 4UV0A 3G6HA 5JZNA 3NIZA 3SKCA 4YJOA 5IUHA 2CLQA 3MH2A 4P90A 4MNEA 4XNEA 5AP0A 3W2RA 4I22A 5CEPA 2CN5A 3FZ1A 3MIYA 1ZY4A 5CXHA 3KB7A 4ASZA 2UVXA 5FDXA 4F6SA 3V5WA 3COMA 4OTPA 5KUPA 1F0QA 3KK9A 4CFUA 3DZQA 4JIAA 3DGKA 5DR9A 1FGKA 3W8LA 1W98A 2GSFA 4I21A 4EYJA 3MTFA 4M97A 3Q3BA 3CGFA 2XNMA 3VBTA 2J0IA 3O2MA 5L8JA 1U4DA 3OWPA 3TIYA 2EXMA 2PZ5A 4WD5A 4ZJIA 4Y5HA 5EM5A 4FNYA 5E7RA 1ZZLA 4BCOA 2HW7A 2H96A 4DEHA 4UYNA 4X3FB 4ZK5A 5JFXA 4RWIA 2I0HA 4BICA 2R3RA 2XKDA 3DBCA 3LW0A 4QYYA 5FBNC 5J8IA 2QONA 1WBVA 3L9MA 3O7LB 4BCMA 3GU4A 1H01A 3MSSA 4FV7A 5DHJA 3TCPA 3FZPA 2BRNA 4PL5A 3CQEA 3FQSA 2WQEA 4RC3A 5CSVA 5EOBA 3E8DA 4QP3A 3PJ1A 4QMYA 3SXSA 3G51A 4C0TA 4YU2A 5ITAA 3LCTA 4IBMA 2XYUA 3HV5A 3U51A 3DKCA 1NA7A 2JIIA 3KCKA 4IM2A 1IRKA 4F9WA 4M66A 4FKWA 4U3YA 3OT8A 2OIBA 3WF6A 4FV1A 4RA5A 5I3OA 5DMZA 3E3PA 2FUMA 2VO0A 4F7LA 5HTIA 4FG9A 2RG5A 2GTNA 4PMTA 2UZDA 3D7ZA 3ZFMA 3SVVA 3U4UA 3SRVA 2JDSA 2PMIA 4CEGA 4ZAUA 4UMRA 3UIXA 2OWBA 3KF7A 5CQUA 2PE1A 5ANEA 5IDPA 4E5AX 2Z8CA 5EHOA 4PDOA 4EH6A 2J51A 2WMRA 3IDBA 3A62A 4PWNA 3KXGA 4XS2A 3O50A 4E8AA 2ITPA 1OGUA 2CPKE 2VV9A 4RT7A 3DU8A 4ALWA 4AU8A 4HVSA 1H27A 4FV0A 2BVAA 4K11A 3E7VA 3QD3A 3T9IA 2O5KA 2GQGA 4O0WA 1PYEA 4YHFA 4LOOA 4DG3E 4FTQA 3MY0A 5BMSA 5EDPA 2OJ9A 3I7BA 4F7JA 4BDHA 5KMMA 4K8AA 4X3FA 3I0QA 4A9UA 3RVGA 1H1RA 2F4JA 4QO9A 4A06A 1PY5A 5HG8A 4GK2A 3UJGA 3TKHA 3T3UA 5LARA 5CLPA 2C1AA 2XNPA 3Q4ZA 4FV4A 3MWUA 4GMYA 4DGLC 2PL0A 4BDFA 1M2QA 1XH9A 3G6GA 3ZLXA 2X4ZA 3PZHA 4C35A 3NUXA 3WZEA 2W96B 4U40A 2C5VA 4BBMA 5KCVA 4YUQA 4KS7A 4I5PA 4QNYA 5F4NA 3QXPA 4BGHA 4HGLA 2E9NA 5E8VA 4C34A 2QLQA 2ZM4A 3Q4TA 4O2ZA 3NW5A 4MNFA 3UZPA 4AOTA 2IN6A 4CLIA 1VJYA 4A4XA 4FT3A 3OF0A 3FUPA 3LCOA 3W33A 5IISA 3A8XA 4IB5A 3TNQB 4GJ2A 3C4XA 4MD8E 4UMQA 4Z3VA 3ORXA 1SNUA 1XBBA 3HZTA 4XG8A 3GCSA 3VUMA 3TNHA 3R2BA 5H9BA 3Q6UA 4XRJA 3FBVA 4USDA 2J0KA 4C3FA 2Z7LA 2UZOA 4NUSA 5JQ8A 2BTSA 1UKIA 3KRRA 1ZLTA 2XKEA 2B52A 5D9HA 4HVIA 4K77A 1RE8A 1FVTA 5DGZA 3U9CA 5IH6A 4ASXA 2UW9A 2QOFA 1OM1A 3BQRA 5KKRC 4RQKA 4AXAA 4CKIA 4AZVA 4CCBA 1FVVA 2HY0A 3C0HA 3L8SA 4ZS0A 4XEYA 3NS9A 4G6NA 3VS3A 5AP1A 4CFVA 1UNLA 3ZXTA 4BCJA 4BI2A 3KXZA 2A2AA 4RZVA 4C4JA 2B9HA 3QWJA 2OJFE 2VTRA 2WMBA 3E7OA 3VULA 4B8MA 3A7JA 4EOOA 2QOLA 2QOHA 5FP6A 4FIGA 2CGWA 3NYVA 2QOBA 2RIOA 4ZTSA 5AX3A 3ZZWA 4HVGA 4IC8A 2I0EA 1YOLA 3O71A 5D1JA 4DFNA 3VBVA 4ACDA 5ETIA 3WYYA 1XH7A 3OW4A 4YSJA 1H4LA 2W1FA 2WU6A 5A4EA 1PXOA 2QLUA 4KKHA 3D7TB 3KULB 4AW5A 4E93A 1ZY5A 2NPQA 2C4GA 3BRBA 3F7WA 2Y9QA 2VTLA 5J9LA 1WBPA 3P86A 3GI3A 5BYYA 4CNHA 4FSMA 2UZTA 4PMPA 3Q9YA 1JKLA 1IEPA 2JLDA 3MH1A 1GZ8A 3B8QA 1G3NA 3BBTB 3EN9A 3C0GA 3THBA 3NGAA 3TTJA 3IW4A 5A4QA 2GNHA 3FMKA 1YWNA 4QMLA 1OI9A 1WBSA 3HMIA 4AW0A 5L2SA 2YM3A 1Q8TA 4JRNA 1JNKA 5JRSA 3BV2A 2JAVA 5E8UA 4AA5A 2YEXA 5K5NA 2YIXA 4FV5A 1PXNA 4QTDA 2C6DA 4RC2A 2R3GA 2BHHA 1YXXA 5EW3A 4FVRA 2GNLA 4IH8A 3RKBA 5KMLA 4U7ZA 2P55A 4BKYA 3VS7A 2RL5A 2Z7QA 2G01A 1XHAA 3TZ9A 5LCJA 3AGMA 4Z7GA 3E62A 4L7SA 4BWPA 3G2FA 3V5QA 5I9WA 1CMKE 2VO3A 4BF2A 3AMBA 5L2QA 4FZ6A 5A4CA 1CSNA 4P2KA 4BDKA 3NNVA 2VX3A 4LGDA 4JDKA 5HG5A 3D7TA 2PMNX 3LCKA 4EUUA 2XBJA 2XK6A 2UW8A 3R1QA 2JGZA 5CWZA 5HIEA 5JT2A 2EXCX 3LJ1A 1K3AA 1SVHA 2OG8A 4XYFA 2VN9A 2ZB1A 4UXQA 1VYWA 5BVWA 5AIKA 4YURA 2ZAZA 5H8GA 2WMSA 3CC6A 3NNXA 4O2PA 2BDWA 3FMNA 4KBAA 1FVRA 3PZEA 4RVTA 3IW8A 2BZIB 4YBJA 2R3KA 1DS5A 2OIDA 3QD0A 3LFSA 5AP6A 4TYIA 3FXZA 1GOLA 5AR3A 3R00A 3RP9A 4FKUA 3VWAA 3LE6A 1KOAA 5BX0A 3ENHA 5TKDA 1UU8A 3L9LA 2XUUA 2IW9A 2REIA 1REKA 3F66A 2XYNA 2R4BA 4ZOGA 5B2MA 3DJ7A 3BWJA 4ZSEA 3WZJA 3LFCA 1STCE 2R3FA 5LWMA 3MB6A 3QTXA 4CFNA 4ZIMA 3IK3A 3PIXA 4U79A 3RPOA 5AUWA 3KA0A 4JVGA 3TKIA 5IKWA 1E9HA 4I6HA 2W5AA 3C9WA 4D0WA 3AT3A 4AFEA 2XNOA 2GFSA 5IA5A 2Q0NA 3DK3A 5HI2A 5D10A 4AZFA 4ZZOA 4WSQA 3R9DA 3U6JA 4AGWA 4IB3A 3CGOA 2C3LA 4I41A 3UTOA 3EZVA 3EKNA 3DKGA 2PHKA 5CU6A 1OIYA 2PK9A 4XP2A 3R7YA 4BWKA 3GFWA 4IACA 4JI9A 2QOQA 3KMUA 5GZ8A 3KXMA 3O0GA 5C8MA 5HTCA 3DTCA 1YVJA 4L53A 4V0GB 3RJCA 4X6QC 2IVTA 4FIFA 3EQBA 3V8SA 4F1MA 4YJSA 2CSNA 3O8TA 1P4FA 2VTJA 2B9IA 2V7OA 2ETMA 5HICA 5C1QB 2OXDA 3FMEA 5CEQA 4O0TA 4O96A 2W99B 3CTQA 4AS0A 4C3PA 4ZSAA 3BCEA 2GPHA 2J0LA 4RIYB 1UV5A 2ONLC 4FI1A 2VAGA 5CF6A 1H0WA 1MUOA 2P3GX 4W9WA 3D83A 3VUGA 3CJGA 4GT3A 4TNDA 2IZTA 4MBJA 1B38A 5DR2A 3HNGA 3OTUA 2QNJA 3FQEA 3OS3A 3HUBA 5KMNA 2QG5A 5M56A 1PXPA 2H34A 5CVFA 2WFYA 3ZEWA 2NRYA 3ZC5A 3N51A 3R8MA 4MTAA 4EOMA 4XG4A 2VUWA 1DI8A 4G16A 3G0FA 1Q62A 5FBOA 2JFLA 4FV8A 4R1YA 1J3HA 5J95A 4E20A 3FZOA 2OO8X 4NFMA 3GCQA 4PMSA 4D2TA 4EK8A 3EFLA 4JXFA 5B2KA 3FDNA 4QMPA 5AAGA 4FSQA 5AP4A 4Z9LA 2V55A 5HLPA 4MYGA 2BTRA 3JVSA 4EZ5A 3UVPA 4TRLA 5G6VA 2FB8A 3BI6A 3LXKA 5DT0A 3UIMA 1WBTA 2GDOA 2E9OA 3PRFA 2W5HA 4FKVA 4DFYA 4AW2A 2YCRA 5JFVA 4FL1A 3D5WA 4BBEA 3UC3A 2PMLX 4FL3A 3MV5A 3PLSA 4TKSA 4BYIA 4BCPA 5BVOA 4V0GA 3SDJA 3K2LA 3D4QA 4PDSA 4C61A 2WOTA 4FEQA 3K3IA 2OKRA 3FJQE 4BDCA 3K54A 4BZOA 1PXLA 1GNGA 5A4TA 5EI2A 4RIYA 1YI6A 4DH1A 3LZBA 5HE1A 3NIEA 5C27A 4I0TA 4FODA 4LL0A 2C3IB 2ZV2A 1MRUA 3BLQA 2ZM3A 1W82A 3H0YA 3Q4CA 3SOAA 4H1JA 5HKMA 4HGTA 4QMSA 5A9UA 4J1RA 4LQMA 4GU9A 4YNEA 2WMTA 4NCTA 4U43A 2WAJA 4HYIA 3VBQA 3DY7A 3MPTA 4FT5A 1IASA 3QGYA 3ZHPC 2WIPA 3ORZA 4DGOA 5CAOA 5I0BA 2E2BA 5KMIA 3DCVA 3MIAA 4PV0A 4QTCA 5FXSA 4ERWA 3QTRA 2OFUA 2UZEA 4V05A 1ATPE 4WNMA 3ZXZA 5AADA 4EOIA 3LFEA 5BVEA 4D58A 2YIYA 2ZDUA 3GNIB 4CV9A 2QQ7A 2YAAA 1PMNA 4PRJA 4WRGA 4C8BA 3UNKA 3MVHA 3FL5A 4Y46A 3VRZA 5AV1A 3WARA 5B2LA 4MD7E 3LM5A 3HA8A 4FTTA 4S34A 1BLXA 4XJ0A 3SXRA 5DEYA 5AUVA 4I0RA 1ZARA 3FMLA 4PDPA 1YWRA 5CEKA 5JZJA 3UZTA 2CDZA 3GCVA 3SQQA 1I44A 4Y5QA 3I4BA 4JBOA 4O0UA 1NVQA 2GNGA 2DUVA 3QRIA 2R64A 4IJ9A 4QPAA 3ZSIA 5B0XA 3UNJA 5J9ZA 4NFNA 3WI6A 4ZY6A 3AXWA 3VBWA 4GT4A 5L6OA 2IO6A 3GVUA 4PNIA 2AUHA 4N6YA 5DRDA 4K9YA 2JKMA 2A27A 2HY81 2XJ1A 4R3PA 4E4NA 3DK7A 3KXHA 5L8KA 3COHA 3QZFA 4FTNA 4ACMA 1YWVA 2UZBA 5E8SA 2BAQA 3RAIA 4G34A 2OK1A 3C0IA 2CGUA 4TXCA 1H26A 1SVGA 3DBEA 3DXNA 2XK3A 3BPRA 5AEPA 2WNTA 3ORPA 5EK7A 2UZWE 3NDMA 3QA0A 5TE0A 3HV7A 4R6VA 4BBFA 3SAYA 1PXKA 3NR9A 2QO2A 5KNJA 2ITYA 5C8KA 3DNEA 1O6YA 2Y6OA 2HIWA 4MAOA 4PMMA 4F0IA 4ANMA 5HOAA 2O64A 2XK4A 3NUNA 5IH5A 2FYSA 4K33A 4BYJA 5JH6A 1V0PA 5D41A 5TO8A 4AGCA 3CQUA 2A1AB 4USFA 5IMEA 5LJJA 2OJJA 5IEVA 4NCTC 3D5XA 3PRIA 3RAKA 3V04A 2ESMA 3POOA 3RINA 5AUUA 5K0KA 3TXOA 3W2PA 1PXJA 4HZRA 3R9HA 5DIAA 4BVUA 2VTMA 4IM0A 5BUIA 4IE9A 4F1OA 2OF4A 4XHKB 3WE4A 5DN3A 3DT1A 3RAWA 5DPVA 4RJ5A 1UA2A 4KIQA 4X6RA 1Q8UA 3C4ZA 3MI9A 4NM5A 5ICPA 4FMQA 4YLLA 4FKTA 4WBBB 4QYEA 3VW6A 4DGGA 3OFMA 3S4QA 2OIQA 1KV1A 1SM2A 5BUJA 3KVXA 2XEYA 3MPAA 4YPDA 5HG9A 1LPUA 2OXYA 4MXZA 3MA6A 3PJCA 2HZ0A 3HV6A 3F3UA 3MVJA 5HCZA 4JIKA 4F99A 1VEBA 4PUZA 1Q8YA 4NM7A 4NJDA 4UMUA 4RQVA 5CZIA 3V3VA 2RFNA 3R63A 1NXKA 2X8DA 4YJUA 3FKNA 5EYDA 2R3HA 2B53A 4FKRA 2J6MA 4L44A 5EHYA 3VJNA 3L1SA 1XWSA 5EKOA 3B8RA 3VS5A 3I7CA 2UW5A 4IM3A 4A9RA 2XIKA 3DLZA 4QMVA 3PIZA 4A4LA 2BFXA 3U9NA 4QPSA 3OWLA 4O21A 5LVOA 2X9FA 3EN4A 3F5GA 3PVBA 3A7HA 4FSNA 4FVPA 4R8QA 4ZJVA 1M52A 2UZVA 3PWYA 4O0SA 3NUUA 3LFNA 4I3ZA 2WEIA 4CFMA 4E6CA 5M4CA 2C0OA 4FG7A 4C4GA 2ERKA 2I0YA 3P78A 3M11A 2VWYA 4HOKA 2WHBA 2ITNA 4DEEA 5A6NA 5ACBC 1RJBA 1JQHA 2O2UA 3H3CA 3KGAA 3KRLA 5CAUA 1T46A 4WG4A 3MB7A 2CLXA 4JS8A 5J1WA 1URWA 4IVDA 2FA2A 2DYLA 4R7IA 3BGQA 4BDGA 4DEGA 5AP7A 3NRMA 2V0DA 4TT7A 4WNOA 4UALA 4YR8A 1OB3A 4IHPA 4NIFB 3UQCA 5J7BA 1TQMA 4DEDA 1FMKA 3QF9A 4RVMA 3ZM4A 4N70A 3LFQA 5CU3A 2WTDA 4QP1A 3FYJX 1YXSA 4AE6A 2HXLA 4D4RA 4Y95A 1XQZA 4F4PA 2ZM1A 5L3AA 3TN8A 3DKOA 5CZHA 4DFZE 4JDIA 3UP7A 4QYFA 4C4FA 4X2JA 4CT2A 4DGMA 3IGOA 5LVNA 3QD4A 1SNXA 5IDNA 3F3WA 5AWMA 3CTJA 2R3QA 4I6FA 4DEAA 4MNEB 4R3RA 2EWAA 4WG3A 2ZDTA 4O1PA 4OAVB 2QKRA 3FHIA 3E93A 4EKLA 4FR4A 1M14A 2IWIA 3AC3A 4CZYB 3UIBA 4D1SA 3EB0A 2VTTA 4JG8A 4XG9A 3HV4A 2Z2WA 4E1ZA 3U6IA 2XVDA 4BIDA 4EK3A 3QHRA 1DM2A 1M7QA 3E8NA 3I79A 4RG0A 5EG3A 1FQ1B 4PPBA 2W7XA 3VS2A 1OUKA 2JDVA 5JGAA 2GTMA 1HCLA 4HYSA 4U44A 5BNJA 5KBQA 4EORA 3OUKA 2HWOA 4UYAA 3ORIA 5FM3A 4I93A 4E6AA 3Q53A 4EOLA 3HECA 3QRUA 4O27B 3TTIA 5DVRA 4RWLA 4CT1A 4PP7A 4L6QA 2ITQA 4ENXA 4JNWA 3ELJA 1KE7A 3D5UA 4UMPA 3TUDA 3R9OA 1BKXA 2OW3A 4GSBA 5FD2A 3ZO4A 3ITZA 4TL0A 4PF4A 3COKA 4FTAA 3B2WA 1E1XA 4U3ZA 4AP7A 2YISA 3WF5A 2X81A 4NIFA 4L43A 4QQ5A 2WMQA 2QU5A 4XOYA 5JSMA 3KXNA 1KE9A 1A9UA 3IS5A 4GK3A 2YM6A 4XUFA 4FIIA 5CU0A 3UG2A 1FGIA 4EKKA 3I6WA 1OIUA 3CR0A 4LYNA 5HVKA 2WB8A 4D2RA 3EQGA 2YM7A 3RHKA 3JVRA 3SRVB 2PVRA 3CY2A 4D0XA 3C7QA 4FIHA 3DJ6A 3GOPA 1ZMVA 3UOHA 2QKWB 2HXQA 3D9VA 3PVUA 3S3IA 3LFDA 2BILB 4HYUA 2OH0E 2VX1A 3EN5A 5HE3A 4YC8A 4FKJA 3CD8A 4KINA 2CHLA 2F7EE 3S1HA 2OGVA 2GHMA 4GIHA 4LL5A 4F70A 5IUGA 5EI6A 4YO4A 2RG6A 4LG4A 3BLRA 3BELA 4ITJA 4IX4A 3RZBA 5GZAA 3TJDA 2WOUA 1P2AA 1BUHA 1IA8A 4BZNA 4GRBA 1ZYDA 3C4EA 3QFVA 4F08A 5K0XA 4AA0A 4FTIA 5F94A 2FSTX 2RSVA 1Q99A 3TG1A 4ZZMA 4FV6A 1V1KA 2X2MA 4FNXA 2YN8A 4I6QA 3LLTA 4O1OA 3FLWA 2X6EA 5CSXA 3R8ZA 3WZDA 4M0ZA 2YJSA 4E4MA 3OOGA 2J9MA 1JKSA 3DKFA 4FOCA 4DN5A 1F5QA 4JG7A 4WG5A 4XG3A 3RTPA 3F69A 4AF3A 2W06A 4KS8A 3JY9A 2C6TA 1WMKA 1YRPA 4IAZA 4HVHA 3PY1A 3ROCA 1GAGA 1H00A 2P2IA 3FL4A 4NTTA 4A07A 4FG8A 4FSZA 4U9AA 3BHVA 1WCCA 1O9UA 2YIWA 4Y72A 2G1TA 1PF8A 4Z55A 3JY0A 4ZLYA 4YTHA 4RLKA 2GS2A 1HCKA 3NYXA 4QTBA 2BKZA 1APME 1Q4LA 3E8CA 4FIEA 3L8VA 3D15A 4GUBA 4UXLA 5FEQA 3MW1A 5A4LA 2XCHA 4NW5A 2GMXA 5ETAA 3RWPA 1MQ4A 4TYJA 3DJ5A 4F0GA 1JOWB 4QP2A 2BRBA 4FK6A 4OGRA 4D28A 3ZUVA 5CXZA 1Q8ZA 5M55A 4FKGA 4TPTA 2E9VA 4YJTA 2FH9A 3EQCA 5CT7A 4D2PA 4WUAA 3KU2A 3SOCA 4ACHA 3NSZA 2YCFA 2WTCA 3NUYA 3AQVA 3R1NA 3BQCA 2J90A 3RZFA 5CF5A 2Y8OA 3AT4A 5IA3A 3BE2A 2IZUA 4FX3A 3HV3A 2Y4IB 4PL4A 4EH3A 2VTNA 4DYMA 3EL8A 4C62A 3GU6A 2O65A 5J87A 2W4KA 2WQOA 5AV0A 3ORTA 3QU0A 2O8YA 4Y85A 5DT3A 5LMKC 2JBOA 4LRJA 3QAME 3EQHA 4AWIA 4EH4A 5LVMA 4L45A 2EXEA 2XKFA 4CD0A 4CYJA 4EQMA 2PVHA 3GU7A 4O0XA 3NCZA 2JIUA 4IVAA 3BYMA 4C2VA 4DINA 3QXOA 1TVOA 5HNBA 4B0GA 3QQKA 2C6OA 2PZRA 2W4OA 5LMAA 3HMOA 1BYGA 4NH1A 4E26A 4CKJA 2QCSA 5DR6A 4EQUA 1IR3A 2IVVA 3A4PA 4AA4A 4IANA 3TV6A 4WNPA 4ASDA 5FXRA 4XV9A 1WBOA 4H3PA 2EB2A 5CTPA 1LUFA 3VS1A 2YLEA 4YC6A 4I6BA 1OL7A 3GEQA 3TZ8A 2X7GA 4F7NA 4PL3A 2JEDA 1ZYJA 5JK3A 3CKWA 1NY3A 5HESA 3MJ2A 1ZMWA 4J7BA 3HMPA 4FZ7A 4FL2A 5AJQA 5EM8A 4AGUA 4CMOA 4X2GA 2EB3A 3BKBA 3IECA 4Y8DA 4ZXTA 4G3EA 4BIEA 4IWDA 4MEDA 3QZHA 3WILA 2PZIA 4ANNA 3KRWA 3R28A 2X2KA 2XK8A 2ZV7A 5DE2A 5JRQA 4BDAA 3EYHA 3TUCA 3C5UA 1OZ1A 5C01A 1UWHA 1R0EA 1W83A 3LJ2A 3GU5A 2C6EA 2CCHA 4RJ3A 4MWIA 2BZJA 2P0CA 3O8PA 3FYKX 3PJ3A 4GG7A 1ZAOA 4DC2A 3GC9A 2VZ6A 2R3OA 2XM8A 4D5KA 4EI4A 5FDPA 3PVWA 4L00A 3Q9XA 4HPTE 3KY2A 2X2LA 4XG2A 3RMFA 5FEEA 1KE8A 2WQNA 3DBQA 2WMXA 4F1TA 3RBWA 3MY1A 4FKIA 3I0OA 4FKSA 5ANJA 5KZIA 4XP0A 2LGCA 1WFCA 3LIJA 3R04A 2XK7A 3WIGA 4C4HA 4MQ2A 5CEMA 3GC7A 4MKCA 1XO2B 3IPHA 2J0MB 4EH2A 3D2IA 4NWMA 2PY3A 1ZZ2A 3MPMA 4ANOA 1OKYA 2X6DA 4LOQA 4FSRA 3PSDA 4M84A 5CVHA 4HPUE 3A7IA 4CRLA 4EZ7A 4CQGA 5J79A 4DH5A 3QTWA 4UEUA 4DLJA 2PSQA 5HNGA 4GFMA 3GP0A 3OW3A 4P5ZA 3BEGA 5F95A 5EYCA 2XS0A 3OD6X 4W4XA 1X8BA 3CPBA 2ITVA 5AX9A 2ONLA 5DA3A 4S31A 5GJGA 4KKGA 4KRDA 3QUPA 4KIKA 1M2PA 1Y8GA 3M2WA 5E8TA 3W10A 3IOPA 1WBWA 4AX8A 1XH8A 2PVYA 4A9TA 4ZSGA 1H1WA 4WA9A 3UOJA 4D4SA 3O51A 3EQIA 3Q04A 1GIHA 4I0SA 2VGPA 4IZAA 2OJGA 1M2RA 2J5FA 2UV2A 2BALA 3ORKA 3HDMA 3VBXA 3MFSA 4RJ7A 3FPQA 5EOLA 4EHZA 2YIQA 3HL7A 3VS4A 5LOHA 2OZOA 4L01A 2QOIA 3ODYX 1Q3WA 4O0YA 5CY3A 4PNKA 4BCGA 3QQUA 1QCFA 4X2NA 4RVKA 3Q5IA 3L8PA 3QWKA 4M69B 4I4EA 4WRSA 4YZBA 4AT5A 1DAWA 4RWKA 2HYYA 5HORA 1YQJA 3DK6A 2VTOA 2BRMA 3BEAA 5KX8A 1OL5A 3BBWA 4KBCA 3PP0A 4KBKA 5CALA 3ZBFA 3EQDA 4LMUA 5FG8A 2BZHB 4EK5A 3BHUA 3CS9A 3ETAA 2Y4IC 1JLUE 4BHZA 2YDIA 3VUDA 5FP5A 2C5OA 4EHVA 3FV8A 4F09A 3LQ5A 4FA2A 3BGZA 2YFXA 4J99A 3QRJA 2Y4PA 3GQIA 4O91A 2IW8A 4BC6A 1E1VA 3KRJA 1Y57A 3OZ6A 4W9XA 5FXQA 4NU1A 1LP4A 3UVRA 4EOPA 3I60A 4XV2A 2W0JA 3H4JA 3KL8A 4YP8A 2XIRA 2X8IA 3OOMA 5GJDA 3FE3A 4GCJA 4JX3A 2WTWA 3TIZA 2UZNA 4BIBA 5M4UA 3FXXA 4M14A 5J1VA 2CMWA 2I6LA 3JUHA 3W18A 4V01A 2YJRA 1QPJA 3H30A 3QQLA 4LGGA 4OTHA 4P7EA 5J7HA 4L3JA 3CP9A 4GYGA 2XNNA 2XIYA 2X0GA 3IG7A 2YHVA 3P79A 4B99A 4UN0C 3CXWA 4KWPA 4U42A 4JQ8A 4XG6A 5CENA 3WZUA 4BZDA 2VWUA 5T3QA 4FUXA 3NYNA 1A06A 4BRXA 4M69A 4M0YA 4PTEA 3OXTA 4CZUA 5C9CA 5AV2A 4KAOA 4KSQA 4ZY5A 5HCYA 4ANQA 3K5UA 4IW0A 1XBAA 3UQGA 1K2PA 4WT6A 3RPVA 4H58A 3S95A 3BE9A 1PMUA 4TWOA 3HA6A 2R5TA 2BAKA 4F9BA 2Z7SA 4CVAA 3E63A 5ACKA 4MBIA 5LCKA 2YCSA 4QOXA 3VS6A 4EHEA 5AR8A 3D2KA 3NCGA 2OXXA 2P33A 4Q5EA 4YC3A 5AAFA 5GHVA 4C7TA 2E9UA 2GNIA 2PVFA 5EM6A 3R8UA 3LCDA 2PVNA 5FQDC 4CV8A 3QTUA 3R22A 4P5QA 2J5EA 2JITA 3GC8A 4YZDA 2R3PA 2YZAA 1OVEA 3Q32A 1YXVA 4MXOA 4A9YA 4QMQA 3FKOA 2YITA 5T6KA 2YWPA 3P5KA 1MRYA 3PFQA 4LV5A 3UYSA 3BHTA 3P0MA 1U59A 5GNKA 4AN3A 4BHNA 4C3RA 2WMWA 3W1FA 4G9RA 2UZUE 4C36A 4RX5A 3ZUUA 5HLNA 2GNFA 1ZOEA 1SZMA 2GS6A 5K3YA 4FTJA 2V22A 3VHKA 4I5CA 1UU9A 3FMHA 4IAKA 4RJ6A 5IZFA 4AG8A 3NAYA 5D7AA 3C4WA 4GYIA 3ALNA 1FINA 2WPAA 4EH7A 2FVDA 2IZRA 3GT8A 2C0TA 5I9XA 3UO6A 4GL9A 4I20A 2P4IA 3SW4A 3VNTA 2LAVA 5M57A 2R0UA 1KOBA 3REPA 5TOZA 3H9OA 3ZFYA 3BHHA 5BYZA 3ZFXA 3P7CA 1K9AA 4TWPA 3RK9A 3UIUA 3LMGA 1PMVA 5HX8A 2HENA 3BYSA 3IW6A 3PXQA 3QKLA 3RK5A 3ZCLA 3G5DA 3A8WA 4I5MA 2JKKA 1B6CB 3UPZA 2R3MA 4PTGA 4D9TA 5KZ0A 3QQJA 3V5LA 3W16A 2W1GA 2F7XE 3DAKA 3G9LX 3QCYA 2XRWA 1OIQA 4QQJA 3AGLA 3DZOA 2QHMA 5AA8A 2BIYA 4FF8A 3KKVA 3QUEA 4FNWA 4O38A 4QYHA 4AUAA 4B7TA 3F88A 3QC9A 4B8LA 2VWZA 4W4WA 4F9CA 1CM8A 4S30A 4QTAA 2WTKC 4HNFA 4GUEA 4MXCA 3LXNA 4BI0A 3ZLWA 1WVXA 5L6PA 3NNUA 4S32A 3Q4UA 3OMVA 4EH5A 3Q2MA 3R7VA 3TZ7A 4AZTA 1YI3A 5ANKA 4B6LA 4MWHA 5AM6A 4EHGA 3QQGA 2XA4A 3SW7A 3EFJA 4OR5A 3UYTA 2I1MA 4YBKA 3T9TA 2X1NA 4ACGA 3W2OA 2BCJA 1NVRA 1R39A 3U8WA 3G0EA 3RCJA 3R01A 4H39A 4MF0A 4I1ZA 4JLCA 4U80A 4ZTNA 3R8PA 1HOWA 3HGKA 2W9ZB 4EH9A 5CU4A 4OLIA 3V6RA 4I4FA 5D7VA 4S33A 4IVBA 4XRLA 3LJ0A 2VTQA 4MXAA 4QP9A 3ULIA 1H0VA 2W1EA 4RJ8A 3FZTA 1GIJA 2PVMA 5IPJA 4IFCA 1W7HA 2VU3A 3D5VA 3H0ZA 4J8NA 2ERZE 5CF8A 4R5SA 5M53A 5HIDA 1YDSE 3BYUA 4HCTA 3TV7A 3LFAA 4QMWA 4UZDA 2C5NA 5FRIA 5DBXA 4DH3A 1GZKA 3AD5A 3QX4A 1YI4A 2EVAA 4ANBA 4IAFA 3BYVA 4BWXA 1H07A 1YW2A 3LHJA 5F9EA 4ID7A 2QO9A 2WMVA 4U6RA 4IIRA 3E3BX 5KHXA 3OEZA 2A0CX 4EBVA 4YPSA 5BMMA 4AT4A 2J2IB 2DQ7X 2V7AA 5I9UA 4BGGA 3E92A 4RFZA 4EBWA 4L52A 3R83A 2C1BA 4AQCA 1XH5A 3AD6A 2XB7A 3UO4A 5CX9A 5LVLA 4TW9A 1ZYSA 4JR3A 5JGDA 4FUYA 4PX6A 1YOMA 1JSUA 1Y6AA 2CJMA 3U87A 2F57A 4E6QA 2H9VA 2B55A 1M17A 4I24A 1CDKA 3W32A 4EWHA 4D2VA 3BZ3A 4NKAA 2C6IA 5ETFA 3OCTA 1GZNA 3ANRA 3A4OX 4O6EA 4J98A 2JC6A 3DOGA 4RX7A 5BQ0A 5CAPA 3JXWA 2BHEA 2VTAA 3NW7A 5ANIA 1L3RE 1U54B 2QOOA 1WBNA 5G1XA 3G9NA 4OUCA 2IVSA 5AA9A 5HBJA 1YXUA 3QA8A 5E8ZA 5L6WL 4DG0E 3LFBA 3ZYAA 5A54A 2ITZA 2YLFA 3FLZA 3EKKA 3H10A 2O63A 4C02A 5AV4A 4MK0A 2JKOA 4YO6A 3L8XA 2UW3A 4NT4A 1ZRZA 3BHYA 5JQ5A 5EDRA 5BVFA 5HGIA 4CLJA 2OBJA 3PE2A 2NO3A 2FGIA 1GY3A 1Y8YA 3G90X 3GCUA 2GNJA 3CJFA 1BL7A 5CQWA 1MP8A 2BMCA 4RZWA 3AMAA 4F65A 4ARKA 5A6OA 4WHZA 1PJKA 2BR1A 3SA0A 4GW8A 4X2KA 5CANA 2XKCA 4BCIA 5AAEA 2NP8A 5FTOA 5HE2A 3ZO3A 3QRKA 4AW1A 3DFCB 4IZ7A 3WYXA 5AP2A 1OPKA 1OUYA 3K3JA 4WO5A 3ZU7A 3VIDA 4LUDA 1OECA 2OJIA 3OCGA 5DNRA 2QO7A 4WBOA 1AD5A 3QZIA 4YJPA 3ZO2A 3ZS5A 4XG7A 4AGDA 3EMGA 5JN2A 2ITXA 2PVKA 2JIVA 3HRCA 4RIXB 4IDVA 1WAKA 2PZYA 1YOJA 3CE3A 1MRVA 3F5PA 3OCBA 1CTPE 4GVJA 1XBCA 3AD4A 1U54A 4EH8A 4D9UA 3RPYA 3KN5A 3U4WA 3MGYA 4ENYA 2BRHA 4DHFA 1R3CA 2H8HA 3CKXA 4IJPA 4QMXA 2PWLA 4XBUA 5E90A 3QCXA 3C13A 2BIKB 3T8OA 4BDIA 2JDOA 3IONA 4TZRA 4HVDA 1BI7A 2CCIA 3QLGA 5DT4A 3OEFX 4H3BA 3RM6A 4OTQA 4IB0A 4ZP5A 3A2CA 4DCEA 5C8NA 5I9ZA 5IEXA 4OTFA 5HO6A 4CFFA 3CEKA 2BAJA 1I09A 3UOLA 5IA1A 3MN3A 5L4QA 1OIRA 3WIKA 3HKOA 1TQIA 2XJ2A 5K9IA 4UY9A 3F3ZA 5HHWA 4C37A 4OAUC 3DNDA 3NZ0A 2WO6A 4U41A 5D12A 4G1WA 2GCDA 2EUFB 3R9NA 4MH7A 4ALUA 2GHLA 4L42A 1OITA 4LOPA 4KA3A 2Z60A 4FTUA 4JBVA 3TNPC 2RF9A 3LXPA 1IG1A 4G6LA 5DH3A 3IDCA 3F6XA 3QKMA 3SLSA 1XH6A 2OSCA 1WVYA 1Q3DA 3DQXA 3KK8A 4MCVA 2HK5A 4UBAA 3BX5A 1QPCA 2JAMA 4IC7A 3TUBA 3TT0A 3EYGA 3FC1X 5M51A 4EJNA 1PYXA 3ERKA 3IQ7A 3TZMA 3ET7A
chains in the Genus database with same CATH superfamily
1Q61A 1T45A 2WIHA 4J96A 4RIXA 3V8TA 3V01A 2XCKA 5IA2A 1DAYA 3M1SA 4C59A 4QD6A 4DBNA 3OCSA 3FKLA 4MX9A 4M67A 4PP9A 4XMOA 2C30A 1JVPP 3FY2A 2X39A 3DBDA 3IDPA 3LVPA 4IWPA 3RM7A 3ZMMA 5KBRA 3R7EA 3TKUA 5HU9A 3ODZX 3PXZA 3OC1A 5HD4A 3QKKA 4C4EA 3KFAA 1JAMA 3C50A 4IVCA 5GJFA 5L2WA 3IO7A 3WZKA 4IAIA 4MBLA 5DFPA 4EC8A 5KMJA 1OPJA 2BPMA 5I5ZA 3O8UA 4OT5A 3FSFA 3ZOSA 4GU6A 2PVLA 2BZKB 1QL6A 2YCQA 4CTBA 1Q41A 4BCQA 3N9XA 5KMOA 3R7UA 4ASEA 4KNBA 3LAUA 1VZOA 4FTCA 4CXAA 4JR7A 3UVQA 4OT6A 2XRUA 2PZPA 4HGEA 1Q8WA 4X7QA 5TF9A 1CKIA 2Z7RA 3UG1A 4XP3A 1V0BA 4FK3A 5E8XA 4EYMA 2IJMA 2F49A 4KRCA 4R7HA 3QTSA 1M7NA 1ZWSA 2QR8A 4FSWA 3R8VA 2QOCA 4MVFA 5LMKA 3EN7A 1YXTA 4EK6A 5A46A 1PXIA 4RC4A 3KMMA 1RQQA 3ANQA 3SV0A 5BVDA 1PXMA 4L46A 4U45A 2ITUA 4UWYA 4YHTA 2RFSA 4FTMA 5KMKA 3P4KA 1WZYA 2ZYBA 3DTWA 3IGGA 4RX8A 5AUXA 3VF8A 3ZSGA 2XP2A 4RX9A 4Q9ZA 4BDJA 5DRBA 4QNAA 5CAQA 4NM3A 2FSOX 2YAKA 3CD3A 3Q52A 5HX6A 2GHGA 3QLFA 4O0RA 2ACXA 3PA3A 3ZUTA 3FZSA 4BKZA 2VX0A 3S2PA 1FPUA 4QPMA 3PG1A 4C38A 3ORMA 3CIKA 3P1AA 4S2ZA 2WZJA 3AC5A 3II5A 3ACKA 3RPRA 5KHWA 4MQ1A 5HVJA 1UVRA 3FMJA 4RIWB 3MYGA 3F82A 4DFLA 3SX9A 4E7WA 2ITWA 3SC1A 4E6DA 3AC4A 4FT0A 4TYHB 3KN6A 4R5YA 2A4LA 2YA9A 3DFAA 3MY5A 1O6KA 2I40A 4NZWB 4USEA 4IWOA 4F9YA 3PUPA 3FI4A 4QP4A 2X8EA 1SYKA 2F7ZE 5AR4A 5DG5A 2VTPA 5AV3A 4U8ZA 3TI1A 3CPCA 4H36A 1R1WA 4IB1A 3PYYA 5FGKA 5H8EA 3E64A 2H6DA 4TNBA 2QI8A 4NW6A 3BGPA 4FKPA 4C57A 2AC3A 3NYOA 2HCKA 4B4LA 3RGFA 4OTGA 2O3PA 3PY3A 5M44A 3ZRMA 4N0SA 5C03A 4NSTA 3NUSA 1W2FA 4R1VA 3SXFA 3V6SA 4QP7A 3VUHA 4EQCA 4YJVA 4YSMA 3TACA 5AIRA 2VTHA 2PTKA 3MFRA 4JT3A 1O6LA 4M8TA 2Q0BA 5IA4A 2VRXA 3CY3A 3OHTA 5TT7A 4RMZA 4ZSJA 5JKGA 3R7OA 3PY0A 5L2TA 5E92A 3O96A 3HUCA 1GIIA 3CCNA 4D5HA 4G9CA 4JAIA 1UWJA 1AGWA 4W8EA 3UMWA 1J91A 2A19B 2BDFA 4YJQA 3ORLA 2C0IA 5HG7A 3NLBA 1Y91A 5AMNA 1AQ1A 5AUTA 3HYHA 4KKEA 3OBGA 4BCNA 2VWXA 4GK4A 4MXYA 2B4SB 3FXWA 3PE1A 2UW4A 4JL9A 4J52A 3DB6A 4RIWA 2YM8A 5J5TA 3R0TA 3MBLA 3LFFA 5GZ9A 1OL1A 2VO6A 2YIRA 4TYHA 3PSBA 1QMZA 4BDEA 3ZONA 3LOKA 3LM0A 3GQLA 3LQ8A 3LCSA 2W9FB 3MVMA 2VTIA 3SHEA 4ZTLA 3BYOA 4OTDA 4QQCA 4ZZNA 3WF8A 3DLSA 4NTSA 4D2WA 5EDQA 4ZTQA 2XBAA 3RNIA 4EOJA 2ETRA 3CLYA 4GIIA 5HBHA 4IAYA 3M42A 4RBLA 5E1SA 4RWJA 3ZEPA 3LPBA 2XEZA 3V8WA 1ZMUA 3L9PA 4AAAA 3E88A 3FLQA 3QD2B 4FV2A 1LEWA 2WQMA 2OI4X 3PJ2A 3HP2A 3I6UA 3QQFA 4M13A 1P14A 1KSWA 3UNZA 3PJ8A 3WBLA 4DFXE 1OKVA 2W1IA 1R78A 3GC0A 3ZRLA 4EONA 4D1XA 2B9JA 1H24A 3NW6A 4KIKB 4IZ5A 4YTIA 2XMYA 4QQTA 2PE2A 3TNIA 4N4SA 3DDQA 5CF4A 3OWJA 4G31A 2HELA 4L67A 1OPLA 4EOSA 5AUYA 3MFUA 4CMTA 4O4CA 3BU3A 4YJNA 1PHKA 2C5YA 1UKHA 2VWWA 4H1MA 3FC2A 1VYZA 2VTSA 3F7ZA 3QHWA 4LFIA 3BLHA 3R6XA 4BI1A 4RA4A 3AC2A 5EI8A 4EOQA 2WMUA 5AP5A 1WVWA 4UZHA 5FM2A 2B9FA 2G2FA 2ZJWA 4QMNA 1RDQE 3R8LA 3ZZEA 1SMHA 1PKGA 1H8FA 4GS6A 4TYGA 3EIDA 2FSLX 4IFGA 4X3JA 3EL7A 3C51A 3GOKA 4FSUA 4GG5A 4FNZA 5HCXA 1U46A 5J5SA 3QX2A 4FKOA 1V0OA 4G3FA 3GBZA 1P5EA 3EFWA 3QQHA 3I81A 4X0MA 4UX9A 1W2CA 3R1YA 3RI1A 3V5PA 2QU6A 3NAXA 4QMMA 4HW7A 4D55A 1GZOA 1SVEA 4JG6A 3QZGA 3Q5ZA 4X3FC 4XV1A 1U5QA 1UU7A 3ZBXA 3WE8A 3HLLA 3TJCA 4JRVA 2B7AA 4QMUA 3Q9ZA 4O4BB 1YHSA 2ZOQA 3P7AA 2G2IA 4CQEA 3GXLA 3ZDUA 5JFWA 3PP1A 4CSVA 3MJ1A 2J4ZA 4C4IA 4BTJA 2UZLA 4L3PA 4U81A 3ZC6A 4EWQA 3OG7A 1JWHA 3GCPA 2PUUA 2IEWA 1Q24A 4YMJA 1KWPA 2HZ4A 2QHNA 2C69A 3FI3A 5CYIA 5H8BA 3EHAA 2OICA 4IX3A 3RAHA 3DQWA 3KF4A 4F63A 4FV9A 3VN9A 3EJ1A 2WELA 2R2PA 2XF0A 2RFEA 4O4EA 4Q2AA 3OWKA 4X21A 3W2SA 5HLWA 2VD5A 5AR5A 2GS7A 2OFVA 1ZYCA 4LM5A 2WGJA 1H1PA 3GGFA 1JKKA 3HEGA 3OP5A 4HZSA 4PPCA 3DAEA 4NJ3A 1XKKA 2HW6A 3OROA 5DEWA 5EM7A 5C26A 4NEUA 3UC4A 3VVHA 4IEBA 3ZDIA 3FPMA 3P7BA 1JKTA 4JQEA 3HMMA 4AN2A 2V62A 3EFKA 4IADA 4F6WA 4OTRA 5LVPA 2VO7A 2WTKB 2VGOA 4Z7HA 3PPZA 2VNYA 4JDHA 2UVZA 3KULA 3WF9A 5DOSA 4CTCA 4EOKA 3BV3A 4QP8A 3PG3A 4K1BA 3BU5A 1QPEA 2R7BA 5K4IA 2ITTA 5CSWA 3UE4A 3VJOA 4EZ3A 1LEZA 4ALVA 2AC5A 4JQ7A 5CNOA 2BFYA 3ACJA 1GJOA 3PIYA 3TWJA 4APPA 3D0EA 3FWQA 1YHWA 3U6HA 2ETKA 4G6OA 3FQHA 3WF7A 5IUIA 3JS2A 4GEOA 3KMWA 1RW8A 3FLNC 4G3CA 5CVGA 5AM7A 5K4JA 5K5XA 3AMYA 3JYAA 3Q6WA 3MTLA 4HNIA 5H3QA 2RKUA 1XJDA 3R02A 4CZTA 4LV8A 3S00A 2P2HA 3GB2A 3IW7A 4G2FA 3VS0A 4E3CA 4OTWA 4B9DA 1H25A 3PPJA 4EC9A 4JJRA 4FTKA 5AP3A 1URCA 4I23A 4RLLA 5DI1A 1MQBA 4DEIA 3QYZA 3RALA 5KO1A 4JAJA 1J1CA 2G9XA 1OKZA 2WTVA 3BU6A 5DWRA 3VO3A 3MH0A 5CSPA 2R3IA 3OVVA 4FT9A 5HBEA 1ZOHA 2W05A 3KXXA 4FICA 5HZNA 3QUDA 2QR7A 4QMOA 3UBDA 3Q96A 2C6MA 4WUNA 4BCFA 5KE0A 2BRGA 4J71A 3F5UA 2WU7A 4IWQA 2VNWA 4BCKA 4DEBA 4QT1A 3EQFA 1W0XC 2C5XA 4KIOA 3GENA 5ANGA 4IDTA 4LGHA 1G5SA 4WIHA 1OKWA 3I5ZA 4TTHB 1TKIA 4YNOA 4UMTA 3KC3A 4NM0A 4UWCA 4TYEA 2YM4A 3HRFA 3F3TA 2R7IA 3C4CA 5EH0A 1CKJA 2OZAB 2WTJA 4C33A 1QPDA 3F2AA 3ZRKA 4D1ZA 3IOKA 2DS1A 2YACA 3QALE 2J7TA 3PVGA 5JEBA 4FYNA 3PXRA 2ITOA 4J95A 1H1SA 4QTEA 4XLIA 3PXYA 3FZRA 1Y6BA 4NK9A 5CNNA 4E5BA 2CGVA 3ZLSA 3L9NA 5IF1A 1LR4A 3D14A 3DV3A 2JD5A 2QD9A 4QP6A 5M4IA 1J1BA 3W8QA 1ZXEA 3F2NA 3RWQA 3Q9WA 5HD7A 4K6ZA 4BFMA 4HCVA 4XOZA 2XIXA 4DTKA 4ZY4A 4FT7A 2XNBA 4DG2E 2BUJA 1P4OA 5FTQA 3VW8A 4M15A 3PA5A 5J9YA 2WEVA 4DH8A 5E1EA 4ANLA 3P08A 3UPXA 4YTCA 4RIOA 2OF2A 3UP2A 4IX6A 4G5PA 3ZTXA 1F3MC 2PVJA 3OTVA 3E87A 3AOXA 4D2SA 4IXPA 4TY1A 3FMMA 4GH2A 1JSTA 4ONAA 4ZSLA 3ORNA 2J50A 4YZMA 4XCUA 4O6LA 4UB7A 3R73A 4R3CA 2PE0A 4A4OA 4PQNA 5E91A 4XX9A 5EKNA 2X7FA 3VC4A 5IA0A 4FRFA 3RHXA 4RRVA 4D4YA 3EOCA 2NRUA 4ZEGA 3E8EA 5FWKK 3MH3A 2UW6A 3JPVA 3F61A 4AACA 3PXFA 3PXKA 3W2QA 4CRSA 3DBFA 2W5BA 4DGNA 2RFDA 5BPYA 2PMOX 1YHVA 4FBXA 3VQUA 2OZAA 4GJ3A 3V5TA 2JKQA 2WXVA 3Q60A 5IG1A 3A61A 2O0UA 2W1CA 3CTHA 2F2UA 2IVUA 4PY1A 4YGAA 3FI2A 3H9FA 3R21A 4FKQA 3A7FA 4XH6A 1H1QA 1JSVA 4KIPA 5TR6A 4CFWA 4ZLZA 4I92A 4IMYA 4ZTRA 1UU3A 3OXZA 3VHEA 1Z57A 3AG9A 4E4XA 5DLSA 2Y0AA 5CI7A 3KRXA 4K0YA 5L8LA 2YM5A 5EW9A 3OT3A 3O23A 5T68A 3V5JA 3VAPA 4FIJA 5AR2A 3F3VA 3QC4A 3V51A 2R3JA 4YZ9A 4YHJA 4IQ6A 4DH7A 4APCA 4E5WA 3GFEA 3AT2A 3R30A 3O17A 1BL6A 3RNYA 1S9JA 2C3KA 5BVKA 3EH9A 5EFQA 2AYPA 3RPSA 2OU7A 3OXIA 3W2CA 4C2WA 3R2YA 5EW8A 3HP5A 5HE0A 4OTIA 3VUKA 4AZEA 2A98A 1Z5MA 3MS9A 4FC0A 4L9IA 4NKSA 3R7IA 1REJA 5I4NA 3DB8A 3C4FA 4FZAB 4H3QA 3BIZA 4ITIA 5L2IA 2V5QA 2G15A 4JOAA 3SD0A 5CU2A 1Q97A 2X4FA 4FGBA 3R7GA 3MVLA 4W8DA 2IW6A 2XZSA 3E5AA 5AR7A 4FV3A 4LI5A 5H2UA 2C6KA 3NNWA 4GFOA 4LMNA 5CEOA 2QVSE 1VR2A 2FSMX 4ZLOA 3TNWA 1KE5A 3P9JA 3UQFA 2ZV8A 5I9VA 3PSCA 4GV1A 3KVWA 1BMKA 4G5JA 4KSPA 3COIA 2ZB0A 1CKPA 1KV2A 4FOBA 4I94A 3EQRA 2UW0A 5F1ZA 4BKJA 2BDJA 4Z16A 4HYHA 4J8MA 4E73A 4AOJA 4Q5HA 3T3VA 2WTIA 3HRBA 3I1AA 3EQPA 3IW5A 4QMZA 3NPCA 4RGJA 5E8YA 4F64A 1B39A 4AT3A 4GT5A 3MFTA 4HJOA 5EYKA 4V04A 4AN9A 2RGPA 2C3JA 2C6LA 2HWPA 2Y7JA 2VWIA 4ACCA 4J97A 3CQWA 4CYIA 4KB8A 4U97A 3VRYA 2VWVA 3RK7A 2QURA 1NVSA 4BDDA 5I3RA 4QRCA 3PA4A 2FO0A 1BI8A 3FHRA 3OY3A 3RCDA 4HGSA 4TN6A 5CAVA 2G2HA 3ZH8A 3IKAA 4L68A 4X2FA 3K5VA 3DPKA 1OL6A 2OH4A 3FLYA 3TV4A 5LWNA 2WKMA 4XV3A 2CKEA 3OUNB 5HO7A 3B2TA 3DAJA 4EK4A 3PPKA 4CFXA 4IAAA 1OMWA 1YKRA 3UOKA 5E8WA 3H9RA 1U5RA 3FY0A 4YTFA 5I9YA 2QODA 4F0FA 5BUEA 3MA3A 1UNHA 4BTKA 2EU9A 3EZRA 1TZDA 2XNEA 3ENMA 4IX5A 3C1XA 4L7FA 5CT0A 3W55A 5IH4A 2CGXA 4ANSA 4CMUA 1W84A 3R71A 3DS6A 3A99A 4G3GA 4OBOA 1ERKA 1R0PA 4O4DA 3QRTA 5HVYA 2C68A 4L3LA 2JFMA 4ERKA 2XK9A 1BX6A 3QYWA 4MHAA 2B1PA 3ROYA 3ZSHA 5CS6A 1FMOE 4D4VA 4P4CA 2W1DA 5A14A 3NEWA 5EHLA 4K2RA 5D11A 3GUBA 2JDRA 4BGQA 5IMXA 4XBRA 4BTMA 4FVQA 4Y73A 3VF9A 5HEZA 4A9SA 4CKRA 4KABA 4MXXA 3CBLA 2W4JA 4M7IA 2ZV9A 1PW2A 1UNGA 2YABA 5HU3A 2QC6A 2W1ZA 3HX4A 2JDTA 4F6UA 4RFYA 5FLFA 4G17A 3QGWA 3UGCA 4EEVA 2UVYA 3ZLYA 5CSHA 1PMEA 4RPVA 4LUEA 5HNIX 4BTFA 5F20A 5LQFA 5CASA 2C47A 2YDKA 4OW8A 4MD9E 2YDJA 5LMBA 3DA6A 3ULZA 4FTOA 4DAWA 5ETCA 3WOWA 4QMTA 4W4VA 5JMSA 2WMAA 1S9IA 2WD1A 3DDPA 3KQ7A 3EWHA 1KE6A 3UDBA 5FEDA 4JX7A 3VBYA 2HZNA 4KD1A 4BCHA 5CI6A 4XLVA 2DWBA 1YDRE 4N6ZA 5HTBA 2R0IA 4LRKA 3HVCA 3I5NA 2ZVAA 4RFMA 3NX8A 4BL1A 3ALOA 3QL8A 4O0VA 4K18A 4AE9A 3KCFA 4YZNA 2X9EA 5JFSA 4W4YA 4EL9A 1EH4A 3FAAA 3S0OA 3FMDA 3OY1A 3PTGA 4U0IA 2ZMDA 4WNKA 2J0JA 4UWBA 5CEIA 4CCUA 2KTYA 4PTCA 3BWFA 4JBQA 3QCSA 4PPAA 3MDYA 1W8CA 3F5XA 1DI9A 2Y6MA 1ZYLA 3OBJA 4M12A 4TWNA 1JPAA 2QOKA 4LRMA 2HZIA 1FOTA 3PWDA 3HDNA 3QTIA 4FTLA 4I5HA 3TEIA 2R3NA 3UO5A 3F9NA 4RVLA 1ZOGA 2BROA 4FYOA 2E9PA 4Y83A 2R9SA 4BDBA 4EUTA 2HOGA 3GU8A 2XH5A 2UUEA 2GU8A 4O22A 4YJRA 5HO8A 4BN1A 3NWWA 4DLIA 4AZSA 2SRCA 2WQBA 2XJ0A 2XIZA 3AC8A 3QCQA 2X7OA 4J53A 5JGBA 3O7LD 2XNGA 2IZSA 4E4LA 4C58A 4GFGA 3A7GA 4FSTA 4ZTMA 5ANDA 4TWCA 1OL2A 2XM9A 4AZWA 4ITHA 4M68A 4QYGA 4RJ4A 4IZYA 4WSYA 2I0VA 3QBNA 5BVNA 4YZCA 5HQ0A 5IEYA 4U5JA 2CN8A 3QTZA 4ZTHA 3UODA 4BB4A 2GFCA 5B7VA 2YERA 1TQPA 3POZA 4MF1A 2ZMCA 3VUIA 3LXLA 3D94A 4FZDB 2HAKA 1XH4A 3KEXA 3TL8A 4F7SA 3AC1A 3UMXA 2JBPA 4AFJA 4YLJA 3ZO1A 3EN6A 3G33A 3R1SA 3NUPA 4FKLA 4ZJJA 1H08A 4FSYA 4OBQA 4YLKA 3FLSA 3A60A 1Z9XA 5AUZA 5IU2A 1XR1A 3FSKA 1Q5KA 4FTRA 3VUTA 4AOIA 4M3QA 4A7CA 4JBPA 2F9GA 5EYMA 2KULA 4JDJA 4WKQA 2VWBA 1PKDA 2UW7A 3QTQA 1JBPE 2B54A 2F2CB 4WOVA 5M4FA 5ANOA 1H28A 5LXMA 4OBPA 4II5A 4GVAA 5KKRB 3VQHA 4G3DA 4F9AA 4L8MA 2R3LA 1YDTE 3P23A 3HMNA 4HCUA 4FZFB 4Q9SA 5A3XA 2W1HA 5HIBA 4DITA 2W17A 4RSSA 4UV0A 3G6HA 5JZNA 3NIZA 3SKCA 4YJOA 5IUHA 2CLQA 3MH2A 4P90A 4MNEA 4XNEA 5AP0A 3W2RA 4I22A 5CEPA 2CN5A 3FZ1A 3MIYA 1ZY4A 5CXHA 3KB7A 4ASZA 2UVXA 5FDXA 4F6SA 3V5WA 3COMA 4OTPA 5KUPA 1F0QA 3KK9A 4CFUA 3DZQA 4JIAA 3DGKA 5DR9A 1FGKA 3W8LA 1W98A 2GSFA 4I21A 4EYJA 3MTFA 4M97A 3Q3BA 3CGFA 2XNMA 3VBTA 2J0IA 3O2MA 5L8JA 1U4DA 3OWPA 3TIYA 2EXMA 2PZ5A 4WD5A 4ZJIA 4Y5HA 5EM5A 4FNYA 5E7RA 1ZZLA 4BCOA 2HW7A 2H96A 4DEHA 4UYNA 4X3FB 4ZK5A 5JFXA 4RWIA 2I0HA 4BICA 2R3RA 2XKDA 3DBCA 3LW0A 4QYYA 5FBNC 5J8IA 2QONA 1WBVA 3L9MA 3O7LB 4BCMA 3GU4A 1H01A 3MSSA 4FV7A 5DHJA 3TCPA 3FZPA 2BRNA 4PL5A 3CQEA 3FQSA 2WQEA 4RC3A 5CSVA 5EOBA 3E8DA 4QP3A 3PJ1A 4QMYA 3SXSA 3G51A 4C0TA 4YU2A 5ITAA 3LCTA 4IBMA 2XYUA 3HV5A 3U51A 3DKCA 1NA7A 2JIIA 3KCKA 4IM2A 1IRKA 4F9WA 4M66A 4FKWA 4U3YA 3OT8A 2OIBA 3WF6A 4FV1A 4RA5A 5I3OA 5DMZA 3E3PA 2FUMA 2VO0A 4F7LA 5HTIA 4FG9A 2RG5A 2GTNA 4PMTA 2UZDA 3D7ZA 3ZFMA 3SVVA 3U4UA 3SRVA 2JDSA 2PMIA 4CEGA 4ZAUA 4UMRA 3UIXA 2OWBA 3KF7A 5CQUA 2PE1A 5ANEA 5IDPA 4E5AX 2Z8CA 5EHOA 4PDOA 4EH6A 2J51A 2WMRA 3IDBA 3A62A 4PWNA 3KXGA 4XS2A 3O50A 4E8AA 2ITPA 1OGUA 2CPKE 2VV9A 4RT7A 3DU8A 4ALWA 4AU8A 4HVSA 1H27A 4FV0A 2BVAA 4K11A 3E7VA 3QD3A 3T9IA 2O5KA 2GQGA 4O0WA 1PYEA 4YHFA 4LOOA 4DG3E 4FTQA 3MY0A 5BMSA 5EDPA 2OJ9A 3I7BA 4F7JA 4BDHA 5KMMA 4K8AA 4X3FA 3I0QA 4A9UA 3RVGA 1H1RA 2F4JA 4QO9A 4A06A 1PY5A 5HG8A 4GK2A 3UJGA 3TKHA 3T3UA 5LARA 5CLPA 2C1AA 2XNPA 3Q4ZA 4FV4A 3MWUA 4GMYA 4DGLC 2PL0A 4BDFA 1M2QA 1XH9A 3G6GA 3ZLXA 2X4ZA 3PZHA 4C35A 3NUXA 3WZEA 2W96B 4U40A 2C5VA 4BBMA 5KCVA 4YUQA 4KS7A 4I5PA 4QNYA 5F4NA 3QXPA 4BGHA 4HGLA 2E9NA 5E8VA 4C34A 2QLQA 2ZM4A 3Q4TA 4O2ZA 3NW5A 4MNFA 3UZPA 4AOTA 2IN6A 4CLIA 1VJYA 4A4XA 4FT3A 3OF0A 3FUPA 3LCOA 3W33A 5IISA 3A8XA 4IB5A 3TNQB 4GJ2A 3C4XA 4MD8E 4UMQA 4Z3VA 3ORXA 1SNUA 1XBBA 3HZTA 4XG8A 3GCSA 3VUMA 3TNHA 3R2BA 5H9BA 3Q6UA 4XRJA 3FBVA 4USDA 2J0KA 4C3FA 2Z7LA 2UZOA 4NUSA 5JQ8A 2BTSA 1UKIA 3KRRA 1ZLTA 2XKEA 2B52A 5D9HA 4HVIA 4K77A 1RE8A 1FVTA 5DGZA 3U9CA 5IH6A 4ASXA 2UW9A 2QOFA 1OM1A 3BQRA 5KKRC 4RQKA 4AXAA 4CKIA 4AZVA 4CCBA 1FVVA 2HY0A 3C0HA 3L8SA 4ZS0A 4XEYA 3NS9A 4G6NA 3VS3A 5AP1A 4CFVA 1UNLA 3ZXTA 4BCJA 4BI2A 3KXZA 2A2AA 4RZVA 4C4JA 2B9HA 3QWJA 2OJFE 2VTRA 2WMBA 3E7OA 3VULA 4B8MA 3A7JA 4EOOA 2QOLA 2QOHA 5FP6A 4FIGA 2CGWA 3NYVA 2QOBA 2RIOA 4ZTSA 5AX3A 3ZZWA 4HVGA 4IC8A 2I0EA 1YOLA 3O71A 5D1JA 4DFNA 3VBVA 4ACDA 5ETIA 3WYYA 1XH7A 3OW4A 4YSJA 1H4LA 2W1FA 2WU6A 5A4EA 1PXOA 2QLUA 4KKHA 3D7TB 3KULB 4AW5A 4E93A 1ZY5A 2NPQA 2C4GA 3BRBA 3F7WA 2Y9QA 2VTLA 5J9LA 1WBPA 3P86A 3GI3A 5BYYA 4CNHA 4FSMA 2UZTA 4PMPA 3Q9YA 1JKLA 1IEPA 2JLDA 3MH1A 1GZ8A 3B8QA 1G3NA 3BBTB 3EN9A 3C0GA 3THBA 3NGAA 3TTJA 3IW4A 5A4QA 2GNHA 3FMKA 1YWNA 4QMLA 1OI9A 1WBSA 3HMIA 4AW0A 5L2SA 2YM3A 1Q8TA 4JRNA 1JNKA 5JRSA 3BV2A 2JAVA 5E8UA 4AA5A 2YEXA 5K5NA 2YIXA 4FV5A 1PXNA 4QTDA 2C6DA 4RC2A 2R3GA 2BHHA 1YXXA 5EW3A 4FVRA 2GNLA 4IH8A 3RKBA 5KMLA 4U7ZA 2P55A 4BKYA 3VS7A 2RL5A 2Z7QA 2G01A 1XHAA 3TZ9A 5LCJA 3AGMA 4Z7GA 3E62A 4L7SA 4BWPA 3G2FA 3V5QA 5I9WA 1CMKE 2VO3A 4BF2A 3AMBA 5L2QA 4FZ6A 5A4CA 1CSNA 4P2KA 4BDKA 3NNVA 2VX3A 4LGDA 4JDKA 5HG5A 3D7TA 2PMNX 3LCKA 4EUUA 2XBJA 2XK6A 2UW8A 3R1QA 2JGZA 5CWZA 5HIEA 5JT2A 2EXCX 3LJ1A 1K3AA 1SVHA 2OG8A 4XYFA 2VN9A 2ZB1A 4UXQA 1VYWA 5BVWA 5AIKA 4YURA 2ZAZA 5H8GA 2WMSA 3CC6A 3NNXA 4O2PA 2BDWA 3FMNA 4KBAA 1FVRA 3PZEA 4RVTA 3IW8A 2BZIB 4YBJA 2R3KA 1DS5A 2OIDA 3QD0A 3LFSA 5AP6A 4TYIA 3FXZA 1GOLA 5AR3A 3R00A 3RP9A 4FKUA 3VWAA 3LE6A 1KOAA 5BX0A 3ENHA 5TKDA 1UU8A 3L9LA 2XUUA 2IW9A 2REIA 1REKA 3F66A 2XYNA 2R4BA 4ZOGA 5B2MA 3DJ7A 3BWJA 4ZSEA 3WZJA 3LFCA 1STCE 2R3FA 5LWMA 3MB6A 3QTXA 4CFNA 4ZIMA 3IK3A 3PIXA 4U79A 3RPOA 5AUWA 3KA0A 4JVGA 3TKIA 5IKWA 1E9HA 4I6HA 2W5AA 3C9WA 4D0WA 3AT3A 4AFEA 2XNOA 2GFSA 5IA5A 2Q0NA 3DK3A 5HI2A 5D10A 4AZFA 4ZZOA 4WSQA 3R9DA 3U6JA 4AGWA 4IB3A 3CGOA 2C3LA 4I41A 3UTOA 3EZVA 3EKNA 3DKGA 2PHKA 5CU6A 1OIYA 2PK9A 4XP2A 3R7YA 4BWKA 3GFWA 4IACA 4JI9A 2QOQA 3KMUA 5GZ8A 3KXMA 3O0GA 5C8MA 5HTCA 3DTCA 1YVJA 4L53A 4V0GB 3RJCA 4X6QC 2IVTA 4FIFA 3EQBA 3V8SA 4F1MA 4YJSA 2CSNA 3O8TA 1P4FA 2VTJA 2B9IA 2V7OA 2ETMA 5HICA 5C1QB 2OXDA 3FMEA 5CEQA 4O0TA 4O96A 2W99B 3CTQA 4AS0A 4C3PA 4ZSAA 3BCEA 2GPHA 2J0LA 4RIYB 1UV5A 2ONLC 4FI1A 2VAGA 5CF6A 1H0WA 1MUOA 2P3GX 4W9WA 3D83A 3VUGA 3CJGA 4GT3A 4TNDA 2IZTA 4MBJA 1B38A 5DR2A 3HNGA 3OTUA 2QNJA 3FQEA 3OS3A 3HUBA 5KMNA 2QG5A 2X0OA 5M56A 1PXPA 2H34A 5CVFA 2WFYA 3ZEWA 2NRYA 3ZC5A 3N51A 3R8MA 4MTAA 4EOMA 4XG4A 2VUWA 1DI8A 4G16A 3G0FA 1Q62A 5FBOA 2JFLA 4FV8A 4R1YA 1J3HA 5J95A 4E20A 3FZOA 2OO8X 4NFMA 3GCQA 4PMSA 4D2TA 4EK8A 3EFLA 4JXFA 5B2KA 3FDNA 4QMPA 5AAGA 4FSQA 5AP4A 4Z9LA 2V55A 5HLPA 4MYGA 2BTRA 3JVSA 4EZ5A 3UVPA 4TRLA 5G6VA 2FB8A 3BI6A 3LXKA 5DT0A 3UIMA 1WBTA 2GDOA 2E9OA 3PRFA 2W5HA 4FKVA 4DFYA 4AW2A 2YCRA 5JFVA 4FL1A 3D5WA 4BBEA 3UC3A 2PMLX 4FL3A 3MV5A 3PLSA 4TKSA 4BYIA 4BCPA 5BVOA 4V0GA 3SDJA 3K2LA 3D4QA 4PDSA 4C61A 2WOTA 4FEQA 3K3IA 2OKRA 3FJQE 4BDCA 3K54A 4BZOA 1PXLA 1GNGA 5A4TA 5EI2A 4RIYA 1YI6A 4DH1A 3LZBA 5HE1A 3NIEA 5C27A 4I0TA 4FODA 4LL0A 2C3IB 2ZV2A 1MRUA 3BLQA 2ZM3A 1W82A 3H0YA 3Q4CA 3SOAA 4H1JA 5HKMA 4HGTA 4QMSA 5A9UA 4J1RA 4LQMA 4GU9A 4YNEA 2WMTA 4NCTA 4U43A 2WAJA 4HYIA 3VBQA 3DY7A 3MPTA 4FT5A 1IASA 3QGYA 3ZHPC 2WIPA 3ORZA 4DGOA 5CAOA 5I0BA 2E2BA 5KMIA 3DCVA 3MIAA 4PV0A 4QTCA 5FXSA 4ERWA 3QTRA 2OFUA 2UZEA 4V05A 1ATPE 4WNMA 3ZXZA 5AADA 4EOIA 3LFEA 5BVEA 4D58A 2YIYA 2ZDUA 3GNIB 4CV9A 2QQ7A 2YAAA 1PMNA 4PRJA 4WRGA 4C8BA 3UNKA 3MVHA 3FL5A 4Y46A 3VRZA 5AV1A 3WARA 5B2LA 4MD7E 3LM5A 3HA8A 4FTTA 4S34A 1BLXA 4XJ0A 3SXRA 5DEYA 5AUVA 4I0RA 1ZARA 3FMLA 4PDPA 1YWRA 5CEKA 5JZJA 3UZTA 2CDZA 3GCVA 3SQQA 1I44A