3ODZX

Crystal structure of p38alpha y323r active mutant
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
350
structure length
335
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLAVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPRDQSFESRDLLIDEWKSLTYDEVISFVPPPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 14
publication title Active mutants of the TCR-mediated p38alpha alternative activation site show changes in the phosphorylation lip and DEF site formation.
pubmed doi rcsb
source organism Homo sapiens
total genus 92
structure length 335
sequence length 350
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2010-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3odzX02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3odzX01
5DRDA 5HCZA 4AW5A 3NPCA 4CFUA 3VS5A 2XIZA 2WFYA 3NCGA 4WA9A 3DTCA 2UZDA 3BYUA 4PRJA 1GOLA 3BU5A 1HCKA 2BPMA 1T46A 5IQGA 3WIKA 1UKHA 3NYNA 4ALWA 3OT3A 4C36A 5CAUA 2X2LA 3GI3A 3MFTA 2YA9A 3PJ8A 3LFCA 3AXWA 4PQNA 4KINA 2OF2A 3I5ZA 2HZ4A 5DN3A 2R7IA 4V05A 3OY1A 2JFLA 2RFNA 1YXSA 5AA9A 3O7LB 3BE9A 3CTHA 5JT2A 5I9XA 4I3ZA 1ZY4A 4V04A 2I0EA 4HYIA 4QMQA 4LYNA 3DJ5A 4MD9E 3MN3A 3CXWA 2YM6A 2ZV8A 4L3LA 2X6DA 2XBAA 3MY5A 3R71A 4U7ZA 2C6OA 4O86A 4TYEA 2C1AA 2BROA 5HORA 3S0OA 5CAOA 2WMQA 1OZ1A 1PYXA 3ANRA 2UZTA 3CJGA 3GCQA 2VN9A 3KXHA 3PXZA 5D10A 2GFCA 2X81A 1ZY5A 3KK9A 2RG6A 3JUHA 5AV0A 3V5WA 1FGIA 4WD5A 1PXOA 2YHVA 2WOUA 3ZSIA 3BX5A 4RJ8A 2OK1A 5ANIA 3NNWA 3PVUA 1PHKA 3HV6A 3QRTA 4JVGA 4CT1A 1PXIA 1YDRE 4R7HA 4ZLZA 4UX9A 2ETMA 5A54A 4ENXA 4JJRA 2HXQA 2NPQA 3OEFX 1U54A 4UYNA 5EM6A 2VRXA 2QO9A 3ZUUA 2X9FA 1S9IA 1ZLTA 2QU5A 3BQRA 2CCHA 4CCBA 1R78A 4OGRA 2VWXA 3L9NA 3DA6A 4DN5A 3F2RA 2AC5A 2W1DA 1G8AA 2JBPA 4U41A 3S3IA 1BUHA 4I5MA 1VYZA 3PPJA 3G51A 4E7WA 4F9YA 2ZMDA 4FV4A 4R3CA 3WZUA 4MXYA 1GJOA 4OBPA 1O6LA 4QOXA 5FEDA 5A14A 3VUDA 4F7SA 3PLAE 1XJDA 3P79A 3FXZA 4FG9A 2IW6A 1V0BA 1E1XA 2P4IA 2F7EE 3IPHA 1GY3A 4YLJA 2J0MB 4J8MA 4O21A 2ITQA 3AC5A 4D2TA 2I40A 4HCTA 1RW8A 3A7HA 3RZFA 3SV0A 1LUFA 3U8WA 4IEBA 2HZ0A 2JFMA 2YJSA 3FHRA 4OTWA 2FA2A 1U59A 4IX6A 2VWUA 3LQ3A 4GFMA 3HP2A 5I9YA 4CLJA 2Y7JA 2B55A 3BEAA 4U0IA 4YO4A 3ZLXA 2QHMA 3GT8A 2QD9A 3D83A 4RWJA 4U9AA 5C01A 3NVMB 3QD3A 2BFXA 2CCIA 1IA8A 3RWPA 4J96A 5E8UA 5KMNA 3VBTA 2QURA 5A4TA 3S1HA 3EQIA 5JN2A 5KO1A 4J1RA 4TPTA 4Z7HA 4JBPA 4O0YA 2VWBA 3SKCA 2WQNA 5F1ZA 3GENA 3DFCB 3C4XA 4DG3E 4P4CA 3W2OA 1UKIA 5HOAA 4J7BA 4QMMA 4FNXA 5DFPA 2PE0A 1YW2A 5IQFA 1SVEA 2Z02A 4E4NA 2HELA 2X2MA 2J7TA 2V5QA 3LM5A 1FVRA 2VWIA 5KBRA 5CAQA 3T3VA 4L42A 4AGWA 4BDEA 2B54A 3VBXA 1CSNA 4BDDA 4FEWA 2IJMA 5FM2A 3GP0A 1V1KA 3FQSA 4YLLA 5FBNC 3RP9A 4AF3A 4AT3A 3AGLA 5HO7A 3QGYA 5K9IA 4O7YA 2RFSA 2XB7A 4Z55A 2VTRA 3HMOA 4N6YA 2FB8A 4DCEA 3E87A 3QLFA 3NIZA 3RNYA 2C5NA 2AUHA 3DBFA 3GB2A 3NYVA 3AC4A 2CGWA 4W9WA 3PTGA 3TACA 3SHEA 4YURA 4Y85A 5CVGA 2ITWA 2R3GA 4CYIA 1ZYSA 4NTTA 5C8NA 3DTWA 3I0OA 3P7CA 4KD1A 3OEZA 3H0YA 2VTMA 4Q5HA 2P55A 2ONLA 5AUVA 1FVTA 4BICA 2VTOA 3ZYAA 4QYGA 4XV9A 1SYKA 4R3PA 4WT6A 4C4HA 4HOKA 4BDJA 3ZO2A 4O0XA 3WARA 2ZB0A 1PY5A 2YZLA 4M0ZA 3R7VA 2XJ0A 4D9UA 3SOCA 3W2QA 4IE9A 4IZAA 2QR8A 2PZYA 3EL8A 2QODA 4CTBA 2UUEA 4GV1A 1STCE 3E63A 5DT3A 3DLZA 5IUIA 4R1VA 2WTDA 2OH0E 3C0IA 4D4YA 1H24A 4FIJA 2FYSA 4H1MA 5J79A 4QP3A 4DH3A 2XKEA 3ZEWA 4D5HA 5FDPA 4QP7A 4RBLA 3U6IA 3QCXA 4FL2A 3RI1A 3V01A 3R9OA 2WMAA 4N0SA 3W16A 3FYKX 3R8MA 5D11A 1ZZLA 2CGUA 4L68A 1KE8A 2ZDTA 3QCQA 1YKRA 1CKPA 4AT5A 2ZYBA 3UG2A 1UWHA 2QR7A 1NVQA 2HXLA 4I6QA 4IAAA 4K2RA 2XKDA 4PDPA 2EU9A 4BBEA 2HWPA 4F7LA 5M4IA 4PDOA 1HOWA 2RGPA 2BMCA 2XEZA 4CFXA 5IDNA 4QQCA 3R8PA 5GZ9A 4BDCA 3H9RA 4LOPA 5DR6A 2HENA 2XM9A 4R5SA 4QQ5A 2I1MA 3EYGA 4YZNA 4FKPA 2F4JA 4KRDA 4Q9ZA 3O17A 2OJGA 1L3RE 3A7IA 4LGGA 1KOBA 1GZKA 3LVPA 4ONAA 4E4XA 1WBOA 3BYVA 1TKIA 2VO0A 3SX9A 5M4CA 4IAZA 1SNXA 4GK2A 5E8VA 5HVJA 3CPCA 3ZC5A 3RINA 4IB1A 3AQVA 4D28A 4CG9A 1Z9XA 3DPKA 4RWKA 5EDPA 2C6KA 2F2UA 4YZDA 4J71A 1VEBA 2XK7A 3R1YA 4BCQA 1UWJA 1MUOA 3QA8A 3QTWA 1ATPE 4FT9A 2O0UA 4YGAA 5C1QB 4XP2A 4U45A 4BTMA 2WQEA 4NM3A 2F2CB 3QA0A 5LMKA 2VD5A 4FKWA 4DG0E 5JEBA 4M3QA 3OWLA 5L2TA 4QP4A 2WMXA 2CGVA 4M12A 4RJ4A 2F7XE 4GT3A 3TNQB 2XK6A 4WUNA 4YTIA 4DFXE 3FBVA 5CNNA 3OXZA 1VZOA 4MH7A 4XLVA 3ORMA 5CYIA 4FSQA 3KRXA 3C4FA 2GU8A 2WMWA 3EQFA 3PP1A 4K1BA 5ANDA 4DCAA 2IVVA 4DEAA 2BILB 4ZLYA 2BRGA 4M68A 4U42A 2BKKA 3H9FA 2RL5A 1PXPA 4OBOA 2JKOA 4RIXA 3U55A 4G6LA 3MW1A 4Y5QA 3K54A 4YR8A 3VRZA 1JBPE 3CR0A 3NWWA 3DZQA 1FBNA 5KBQA 2X2KA 4O7NA 2C0IA 5L2QA 4U40A 5CI7A 2IG7A 5CSVA 4E6CA 3KY2A 4UXLA 3AMBA 3ETAA 3ORLA 4NYEA 4MVFA 5LARA 2QKWB 3UOKA 1Y57A 5GJGA 5HVKA 3R9NA 3EQRA 5DG5A 1VR2A 4BWKA 4PY1A 5EHYA 2GPHA 3MBLA 2RFEA 3MTLA 4YO6A 5AP2A 5LJJA 3MPMA 3CJFA 1ZZ2A 1DS5A 4FSRA 4IAIA 2YJRA 3AC3A 4KNBA 3F69A 4N57A 1HCLA 3D5VA 4JAJA 4TYHA 2UW6A 3I1AA 4G3FA 3KRLA 3PA3A 3ET7A 3CQUA 2WKMA 3E7VA 3LFSA 4PMSA 3FL4A 2ITNA 2YLEA 4WRSA 3R7OA 4DTBA 3UZTA 2UZEA 3TDWA 4RA4A 3QLGA 3SOAA 5AUWA 2W1IA 3ANQA 2XKFA 3IG7A 3RBWA 2WTJA 3CGOA 3DDQA 4GFGA 4PV0A 3MGYA 3EN7A 3U4WA 4DFNA 5EYDA 4FE2A 2UV2A 4DBNA 4BL1A 5B7VA 4O7LA 5EKNA 3VULA 3P86A 3VC4A 4MCVA 3D7ZA 4D5KA 3E8EA 2WB8A 1LPUA 3COKA 3FYJX 4FTTA 4RJ7A 4G2FA 2UW5A 2H8HA 3GU5A 4P90A 4RVKA 4ZP5A 3LXKA 5JMSA 4GCJA 4O91A 4G3DA 5CU0A 3UDBA 2O64A 1KUTA 4D1SA 4ZLOA 3W1FA 2XK8A 3Q4CA 4HJOA 4J99A 4RIYA 3ZMMA 4EKLA 5CEMA 2XCKA 5T68A 2YERA 3ZRKA 3Q52A 3MTFA 4C35A 4DH1A 2ETKA 2QCSA 2IZRA 1XBCA 1NA7A 2NP8A 2WNTA 3QU0A 4DH5A 2YM4A 3L8SA 3RAKA 4YZBA 1MQBA 1I09A 2JIUA 2HZNA 4BC6A 5BVOA 1PF8A 4N4SA 2I0VA 3PRIA 3R1SA 5HI2A 3WF6A 4EH4A 4MBLA 4IX5A 1OL7A 3VS4A 4RC2A 4EORA 3M2WA 5M09A 5CU6A 5I0BA 4HZRA 3F3TA 1M17A 4LM5A 4XBRA 4CYJA 2C1BA 4KB8A 3HV4A 4JOAA 2XKCA 5CENA 1OL6A 2XNEA 5C9CA 2WAJA 3UO6A 3VS2A 3C50A 5E92A 4A7CA 4BDFA 5KMLA 3ZU7A 4LFIA 4C8BA 2OW3A 2Z7LA 2IZSA 4BZNA 1FVVA 5E9EA 2PMLX 3DZOA 1A06A 1P5EA 4BYJA 4NL0A 2R3NA 4G3EA 2G2FA 1DI9A 5KX8A 5CSWA 3MV5A 4ANQA 4USFA 3GC7A 4J95A 2QOLA 4JBOA 2OZAA 3LFBA 4JDJA 4U43A 1NY3A 3VHEA 3Q5IA 3PP0A 5EQPA 5J87A 2C6TA 1L8TA 3GCVA 5ICPA 2Z7RA 5ACKA 5IQCA 4X21A 5FP6A 4ZXTA 3IOKA 5IA5A 3S00A 2I6LA 4FK3A 3R8VA 4O6EA 4WHZA 2OJIA 2ITTA 4L43A 2IN6A 3C0GA 3ODZX 3CTQA 5EW8A 2YEXA 5M06A 4IDVA 4XHKB 2YM3A 4FGRA 3IKAA 1FGKA 1JAMA 5DA3A 4Z7GA 4PUZA 1KE5A 4AA5A 3VS0A 5IF1A 4RT7A 4EC9A 4XP0A 2ITUA 1Y8YA 3BBTB 1OKVA 2C5XA 4LOQA 2R9SA 2PVNA 2GFSA 4H1JA 4QMVA 5BVNA 1LR4A 3MIAA 3NEWA 4MKCA 3RWQA 4FTAA 2VTHA 1W8CA 4TWCA 4IHPA 2IZUA 4XG6A 5M08A 1PKGA 3OW3A 3QTUA 5K5NA 1WBVA 3II5A 5M55A 4LI5A 4DTKA 1H0VA 4CKIA 2A4LA 2BHEA 4FTJA 4YPSA 3PA5A 4C37A 5HCXA 4F0IA 3HAVA 2IVUA 2QG5A 3MFRA 4IADA 4C2VA 2WQOA 1Q5KA 1XR1A 4G34A 3CQWA 2C4GA 5ACBC 5J5SA 4IB5A 4TW9A 4ZY5A 5CZHA 1BYGA 2WIHA 3EOCA 3KRWA 2P2HA 5JZNA 5TT7A 3PJ3A 5JZJA 2F9GA 1U4DA 4AW2A 5IQEA 3KXGA 1REKA 2QKRA 5AX9A 3UMWA 1JLUE 4EEVA 1MRYA 4F9WA 2PVRA 4J8NA 4OAUC 5B2LA 3OZ6A 3UE4A 4O7ZA 3DOGA 4D55A 1WBSA 4RPVA 3RAHA 3FQHA 4XG8A 2YIQA 3D7TB 3POZA 4W4XA 4WUAA 4HVGA 4H3BA 4A4OA 3UOLA 4BHZA 2QU6A 2RKUA 4CMUA 4BTFA 1JOWB 2YDIA 3QXPA 3UTOA 5AR3A 4WNPA 2ITXA 3G9LX 4X3FC 5DH3A 2KTYA 4APCA 5BYZA 4CQGA 2XRUA 2O65A 4NJDA 3QYWA 3D15A 2C3LA 3QWJA 5D1JA 4E6AA 4ZTHA 3ORXA 4UMPA 2GQRA 4IFGA 5H8BA 2BR1A 2P2IA 5J5TA 3O7LD 5CNOA 2B9IA 5AFVA 3GFEA 4CKRA 4BCPA 5CANA 5BYLA 4RZVA 3TKIA 2CLXA 1ZOHA 5KNJA 3UQCA 4WBBB 3TKHA 1H1PA 4MXCA 1GIIA 2PVJA 3Q2MA 4L53A 3Q4UA 1YHSA 4IW0A 4EOPA 1OPKA 5DEWA 3QQKA 4JQEA 3ZBXA 4AOIA 2CSNA 4F08A 2ERKA 5DVRA 3EN6A 4JS8A 5EYMA 2W17A 3DT1A 2W4OA 1K3AA 1PXJA 5K0KA 2FGIA 2WQMA 4DITA 1BI7A 2RG5A 1UV5A 3V8TA 3R22A 4LMUA 4D2VA 3BBWA 2YDKA 4ACDA 2LGCA 5F94A 4I94A 4YBJA 2Y9QA 5BQ0A 5CXZA 4PL3A 4EHZA 3MVMA 1BI8A 4AFEA 5K4IA 1P4OA 2C6EA 3UZRA 4FZ7A 1TQPA 1P14A 3BPRA 3ZO3A 5L8KA 5EQEA 4U81A 3OUKA 4HNFA 4IBMA 5EM7A 2GQSA 2C3JA 4TY1A 5A46A 3LFDA 2PVFA 4H58A 4IZ5A 4C3RA 5IA2A 2BZJA 3A61A 5IEYA 3QTIA 4H36A 4QD6A 3RHXA 3V5JA 4HGLA 3QTRA 4L9IA 4OW8A 5FEQA 4K8AA 3SXSA 4E6DA 5IA0A 4UZHA 4X2JA 4EHVA 3MA3A 4IH8A 3WOWA 3W8LA 4U80A 5KMKA 5L2IA 4KWPA 4O0WA 2J0LA 4UN0C 4I4EA 5J9LA 3C13A 4C34A 2W1ZA 3TCPA 1WBPA 1BL7A 3Q6WA 3CTJA 2ZOQA 4AS0A 4DINA 4EUTA 1PXKA 3SLSA 5EKOA 4F9CA 3LCTA 1NT2A 1WVXA 4XOZA 4L7FA 4N6ZA 5HG8A 4O27B 5LWMA 5FP5A 2BALA 3TZ7A 1QPJA 3COMA 5EHOA 2XVDA 3P78A 2QLUA 2XNOA 3QZFA 3F61A 1Q8TA 2QO2A 3PPZA 4I1ZA 3A62A 2VZ6A 4FC0A 4XG4A 5GIPE 2OXYA 3DAJA 3DBQA 3ZCLA 3JY0A 4USEA 3ROYA 3EWHA 4A07A 4YPDA 5IKWA 2R3FA 1XO2B 5AM6A 5KMMA 2C69A 4F0FA 4KIOA 2QLQA 1Y8GA 4RIWA 3MY0A 3IQ7A 3QZHA 5G1XA 2BRMA 1H01A 4F1MA 4D0WA 1PJKA 3O2MA 4QYEA 5EDRA 4EI4A 4HYSA 4G16A 3W55A 1H1RA 5M44A 2FSMX 5EM5A 3FI8A 2W96B 3E64A 3NZ0A 2J2IB 2O3PA 4TXCA 4O7TA 3LHJA 4QP2A 4QP9A 4GUEA 5AAGA 3GOPA 3LCOA 4Y95A 4O96A 5IQDA 3COIA 3IW4A 3IW8A 2C5VA 3SXRA 2R3KA 4FSZA 3KN5A 2QI8A 3PIYA 2PK9A 5BYYA 2PYWA 5C4LA 2A0CX 4O1PA 3EN9A 5EOBA 1SZMA 5EOLA 5KMJA 5KMIA 1IA9A 4JR7A 3ALNA 4W8DA 3DBDA 3V6RA 4L8MA 2CNVA 5L6PA 3VBVA 1TVOA 2WU7A 3NW6A 3ODYX 4CKJA 4GH2A 1J7LA 2FO0A 2Y6MA 5GJFA 1YXVA 4U79A 2YWVA 4XX9A 5TF9A 3VUGA 3HZTA 5IUHA 4JQ7A 2OXDA 3FLSA 1OB3A 3E7OA 3UYTA 3WE4A 4MD7E 3JY9A 2OSCA 2A2AA 3BHYA 3HDMA 5KHXA 3HYHA 2GS7A 3A4PA 3Q6UA 3R00A 2PE1A 4MQ1A 2R3MA 5AV3A 4ACMA 4C33A 2XK9A 2ZAZA 4P5QA 4K18A 3ZM4A 3M11A 2BKZA 3P23A 3R9RA 5HIBA 4AU8A 5CU2A 5GIOE 4M15A 4I0RA 4QMUA 4R8QA 2IW9A 3V8WA 4QNAA 4CD0A 5D7AA 3PSCA 2CNQA 5BVKA 2YLFA 3EZVA 2X4FA 3MJ1A 3IECA 5K3YA 3VW6A 2UW0A 4AZTA 3DKOA 4XJ0A 4D0XA 4CXAA 4RA5A 3G15A 2BZKB 2UZOA 3ZFYA 3O8UA 4JQ8A 4EK8A 5DT0A 4ZZOA 4FODA 3ZDUA 3LKMA 2YITA 3PJCA 4C59A 3SD0A 4AQCA 1OVEA 5HU3A 1H08A 4OTDA 3Q2JA 4YJRA 3VQUA 1OBDA 1XBAA 4FSWA 2OWBA 3TEIA 3A7FA 3QQLA 1RE8A 3V51A 3SG8A 1OM1A 4JLCA 4Q5EA 4AN3A 4IWOA 3HL7A 3VF9A 3RVGA 4CSVA 1OPJA 3LFEA 3TXOA 2GDOA 2CDZA 2PUUA 2ZMCA 4W9XA 5CF4A 3L8PA 4KKGA 3TUBA 3TNWA 3SQQA 3FQEA 4XG7A 3WYYA 5JFSA 5TO8A 3T9TA 5I9VA 3VAPA 2CKQA 1OGUA 2FVDA 3QC4A 3GGFA 3GC9A 4BBFA 4E4MA 4O0VA 4Y46A 2OIQA 4U3YA 5EW9A 4IAKA 4R5YA 5AUZA 5HX8A 4FTNA 4CV9A 2XP2A 3IW5A 4DGLC 5J8IA 3OG7A 5AV1A 2HCKA 4G9RA 2PPQA 3VS3A 3FSKA 5DBXA 5E91A 3G9NA 1ZMWA 3C7QA 4QMWA 3IO7A 5HCYA 3SG9A 4AGUA 1UNGA 2PVHA 4DFZE 3F2NA 4S2ZA 2PVYA 1Q41A 2W5AA 2VX0A 3KXMA 4IDTA 4O1OA 2X9EA 5EH0A 4BB4A 2QNJA 4EK4A 3LLTA 1F3MC 5J7HA 3MY1A 3E8CA 4GMYA 1ZRZA 1WFCA 5AP4A 2WMSA 4M84A 1SM2A 4WSYA 2EVAA 4DBXA 3UNJA 4CCUA 1OIUA 4I5CA 5AAFA 3JPVA 2CHLA 3FSFA 3BYMA 5DEYA 4IFCA 5EG3A 4JR3A 3FPQA 5CZIA 2PMIA 4F6WA 3KXNA 4KS7A 1BMKA 4RLLA 2JEDA 4NCTA 3TJCA 4CZYB 2WTKB 3AD6A 3BV3A 4M69A 4GT4A 4FSNA 3ZDIA 1PW2A 4HVSA 2JC6A 4D2WA 3EN4A 4DLJA 4GJ3A 2HOGA 2XIKA 1KE9A 4IB3A 5ETAA 5B2KA 4KUJA 3BIZA 3EQCA 5L2WA 4PWNA 3NX8A 4AOJA 4FKLA 3DV3A 5LVNA 2ZM4A 3R6XA 3BHTA 5LOHA 3AMAA 3CPBA 3SW7A 5IQIA 4KSQA 3ZZWA 1AQ1A 2C3IB 2ERZE 4UWCA 4YTFA 5JKGA 3QC9A 3I60A 2FSLX 5CAVA 5E8TA 4EH7A 2YCSA 3H10A 2PZ5A 4RQVA 4FV1A 4NZWB 4FV3A 4OTPA 3MH1A 4ASZA 4A9SA 3U87A 3ZO1A 4M7IA 1LP4A 2YCQA 4BWPA 3D5UA 4YP8A 3EL7A 3EZRA 3CIKA 3F3VA 1XH8A 3KFAA 4RX7A 3WF7A 1URWA 1LEZA 3GEQA 1TQIA 1XWSA 4C3FA 1S9JA 4NUSA 3KF4A 2IW8A 4C4JA 1ZXEA 3D5XA 3PSDA 5IQBA 4CEGA 2BRHA 4AX8A 4UXQA 3BELA 3FL5A 5HBEA 2J5EA 4R3RA 4ZY6A 4AT4A 4F0GA 4EQCA 4FZFB 4AGCA 3PIZA 3P7AA 5DIAA 3FLQA 4RRVA 2JIVA 2R3IA 2ZM1A 3DDPA 4R7BA 3KEXA 2PULA 2H96A 4H3QA 2VTPA 3OUNB 1DI8A 5EFQA 1P2AA 4TN6A 4X2NA 1H27A 4ZJIA 4WG5A 3EQBA 3NUXA 1OMWA 3M1SA 4HGSA 3BGPA 3N4TA 3FKOA 3D9VA 1URCA 2OXXA 2YIYA 4K77A 3FLWA 4U3ZA 1B38A 2G1TA 4E73A 3O50A 3EFKA 3A2CA 3BLQA 3LCDA 3SW4A 3FPMA 4ZSJA 3FZPA 5DMZA 5GZAA 4IQ6A 4I21A 4KKHA 4G3GA 5B2MA 4M66A 3G5DA 2YIRA 3ENHA 3CKWA 2ZV2A 5CU3A 3ZLSA 4FL3A 5CSPA 2CLQA 3DKGA 4XOYA 5LCJA 3KU2A 2QOCA 1M2QA 1NVRA 2AYPA 4NWMA 4DHFA 2XYNA 3HUCA 4GG5A 4PPBA 4TWPA 3Q4TA 5L6WL 4EHGA 4EOLA 3ATSA 3R02A 3ALOA 3HMMA 1FQ1B 5EW3A 3N4UA 4ANBA 4E8AA 4RX5A 4EZ7A 3FAAA 5HVYA 4FT5A 3U4UA 3AT2A 5HTBA 3PUPA 4ERWA 5CEIA 3IDBA 4OTHA 3IGOA 5L4QA 4QP8A 5L6OA 3GC8A 4UY9A 3L9LA 3VRYA 3PXYA 3ORTA 2W7XA 4PPAA 5HE3A 1GIJA 2R3JA 4TNBA 5FXSA 5LMBA 1IAJA 4XS2A 3GCPA 3S4QA 4O7RA 5HTCA 4X3FB 3RHKA 4UZDA 4EH5A 3D94A 3LJ2A 4ZTLA 3BWFA 3ZTXA 1LEWA 5F95A 3PRFA 1KV2A 3OS3A 4FIGA 4IMYA 3NCZA 4BCNA 3PSBA 4OAVB 2YIWA 3UJGA 4DGNA 5DR9A 4DEBA 3BYSA 4V01A 3UZPA 3UNKA 5IQAA 2GSFA 4KIKB 3I5NA 3BV2A 2JDRA 2QO7A 3FMDA 4F1TA 1V0OA 1OPLA 4FKTA 4FZDB 2BRNA 1F5QA 5DPVA 4HPUE 3RK9A 5FXRA 2UW9A 2B52A 3OFMA 3ULZA 4GK4A 1WVYA 3ZXZA 4ASEA 4EOIA 3G33A 1X8BA 5HU9A 5CX9A 4NIFB 3V5PA 2HY81 5HKMA 3V3VA 2GNLA 5DHJA 4HGEA 2PZRA 2WTCA 1UU3A 3BHUA 3ZSGA 3ZHPC 4FEUA 4IXPA 1FPUA 3MVLA 5F20A 2W1EA 3PFQA 3VO3A 3F9NA 2Q0BA 3FV8A 5E1EA 3P5KA 2XEYA 4P7EA 3TKUA 3HAMA 3ZM9A 5JSMA 3OD6X 3B2WA 3MYGA 3EYHA 3DK6A 3WZDA 3LFNA 5ETCA 1KE7A 2R3LA 3AGMA 3V5LA 3C4CA 4W8EA 3UQGA 1P4FA 2JGZA 3CP9A 4ANSA 4FUYA 1OKZA 2UZWE 4AAAA 4AW1A 2GNHA 3VJOA 2G15A 5KUPA 4XMOA 3BWJA 1RJBA 2R3PA 2CGXA 3E93A 4KBAA 4CFFA 1IASA 3O8TA 2WMBA 1TQMA 4DEEA 1MRUA 4BKZA 3OBGA 2IVSA 2W1GA 3TV6A 4PMMA 4IVCA 3EQDA 3T8OA 4RMZA 1PXNA 4FTRA 5JGBA 2VO6A 3LPBA 4JBVA 1YOMA 3GBZA 4BGQA 2WD1A 4JG7A 5M4UA 2Q83A 4M0YA 5KKRB 3FWQA 3UC3A 3BCEA 4IX4A 3VUTA 3QBNA 3ZH8A 4AWIA 1XH5A 4CFMA 5FWKK 4E5WA 4DTAA 3PXFA 1Q61A 1YXXA 2PY3A 2JDOA 3ZXTA 2ZDUA 2C0OA 4DAWA 4AA4A 3R8LA 5EYCA 2W5BA 3KGAA 4FOBA 4RSSA 2WOTA 5AIRA 1UNLA 3PXRA 4CQEA 3BRBA 4WBOA 3VS7A 3VS6A 4ANNA 2PMNX 3NAXA 2NNWB 4O83A 1PMEA 2OU7A 2BRBA 3EHAA 4ZSAA 1W98A 3L8VA 4JNWA 3GQIA 2FUMA 4O7VA 2XIRA 5ETFA 3OY3A 4F7JA 3EB0A 3G2FA 3SVVA 3K3JA 4RGJA 3MPTA 5HE1A 5IPJA 4JIAA 4NH1A 4Z3VA 1H1QA 2WGJA 3FXXA 3PE2A 2YCRA 5C27A 4K9YA 5LXMA 3ZS5A 4CMTA 3A99A 3LMHA 4QMNA 2KULA 2Y4IC 2E9NA 4UYAA 4AZFA 4WNOA 3RMFA 1CTPE 2WQBA 4G1WA 4FK6A 3H3CA 3TL8A 1G8SA 2B9HA 3EKKA 4Q2AA 5M4FA 3LXPA 3UPXA 3ZZEA 2X7OA 4RWLA 2ITOA 3ZEPA 3UIMA 1T45A 4C4EA 3ORKA 3DCVA 4QQTA 4MNFA 4XNEA 3V04A 4BCIA 3HA6A 4EONA 4Z9LA 3ZRMA 3RTPA 1XKKA 4TYGA 3W8QA 2YWPA 3B8RA 4F64A 2GCDA 3QF9A 3D0EA 4G6OA 4L45A 5TR6A 5HG5A 2DUVA 2Y4PA 3NUUA 4FKGA 4IIRA 5EHLA 2CNUA 3SGCA 4EH2A 2JBOA 4OTGA 4UMQA 3SRVB 4A06A 4EK5A 4BI2A 2X0GA 3HRBA 1YOJA 4V0GB 3F7WA 3NW5A 4QMPA 3ACJA 2E9VA 3AT3A 2A27A 2HW7A 4D1XA 1CDKA 3ID6C 4ZS0A 4DE4A 3A7JA 5KMOA 5FBOA 5AR8A 4YJTA 2W5HA 4JDHA 3PG1A 2OBJA 2ZB1A 4DEHA 2XJ2A 3THBA 5EI2A 4O82A 5IDPA 2C3KA 4L52A 3ZBFA 3NUAA 1NVSA 5DYJA 4XV2A 3ORPA 2ITZA 4J97A 2ITPA 4IC8A 4EH6A 4ERKA 3HEGA 4C7TA 3CD3A 3O23A 4FTLA 3CEKA 3PYYA 2XNPA 4O2ZA 2HIWA 4C0TA 4RJ6A 3IDCA 1O6KA 2UW7A 2HAKA 4A9YA 2AC3A 2C6DA 2CN8A 2H34A 3OT8A 4EK6A 2WEIA 3FZSA 5G6VA 1RQQA 3G0EA 2DQ7X 4E1ZA 3FEGA 2JLDA 4XG3A 2R4BA 2ACXA 3ITZA 4GS6A 3HMIA 5H2UA 4EYMA 1AD5A 3OWPA 4PTCA 3U9CA 4E6QA 4YNOA 2YM5A 4HCVA 2OF4A 3PWDA 3WF9A 2VUWA 4I20A 4RIOA 4FG7A 5JQ5A 3ZO4A 2GTNA 3PVWA 1OIYA 1Q4LA 4FV7A 3QD0A 3TTIA 2JKQA 3RPSA 3NNVA 5M07A 3DY7A 1QL6A 1M52A 3MH2A 1YWRA 5E8XA 5IEXA 4BGHA 4II5A 4MYGA 3ERKA 4MHAA 3QX2A 1NXKA 4MXZA 1JKSA 2XK4A 2G9XA 4HNIA 5FGKA 5KCVA 4U8ZA 4ZTSA 2C5OA 4HYHA 1JPAA 4ZSLA 4LRMA 4TTHB 3Q9XA 3NIEA 4S31A 3DJ6A 1F0QA 1ZYLA 1JVPP 2ONLC 3DQWA 4AFJA 4ANLA 5JK3A 4IWDA 3Q9ZA 3QCSA 3KF7A 2W99B 2B7AA 4RX8A 1ND4A 2BDWA 3DAKA 4O38A 4CT2A 2FH9A 3VHKA 2UW8A 2XH5A 3E8DA 4BDBA 1SVGA 4O0RA 1YWNA 4LL5A 3CSVA 3ORZA 4CNHA 2F57A 3MH3A 4G17A 4PDSA 4Y83A 3FI2A 3CGFA 4FV8A 3NLBA 2QOKA 4MF1A 5BUEA 4O7WA 3UOJA 5BX0A 5BUIA 3FKNA 4RVLA 1GIHA 4FT7A 4R78A 5FUTA 3RK7A 5CF5A 3OXTA 4PP9A 1BLXA 4PTEA 4C4GA 4EOMA 2WMRA 3TIZA 3U9NA 3QZIA 3ORNA 5AV2A 5BMSA 2CPKE 3EFWA 5A4LA 3MI9A 4BKJA 4I4FA 1Z57A 1H0WA 2XJ1A 3F3ZA 2BAKA 4NTSA 5A6OA 3A8XA 3QQJA 3DKCA 3EKNA 2W1HA 3NDMA 5E8WA 5AP6A 4A9TA 5CF8A 1U5QA 1KWPA 4X2KA 2HZIA 2PHKA 2G2IA 3GNIB 3I0QA 4LOOA 4QTBA 2EB2A 2GTMA 2XIXA 4I22A 3F3UA 3UQFA 4E4LA 4PF4A 3TV7A 4ASDA 5CLPA 4DLIA 4BIDA 4K0YA 3PA4A 1EH4A 5AR7A 3RAIA 4BVUA 4DFLA 4E5BA 4QYYA 2BTSA 3GFWA 2H9VA 5CEPA 3PG3A 2CKEA 3W2SA 3ZOSA 3ZLYA 3OTUA 4IB0A 4USDA 2GNIA 5H3QA 1CKJA 1DAWA 3R63A 4S34A 3T9IA 2X1NA 1VYWA 2XK3A 2JDVA 2OG8A 2X4ZA 3CE3A 4FZ6A 4CZTA 3QRKA 5BVDA 4XRJA 3NW7A 5E1SA 3KK8A 2OZOA 4BY9E 4H05A 4IM3A 1Q8WA 3KL8A 1CM8A 1J91A 2ITYA 1M2PA 3K5UA 5HZNA 1PXMA 4B9DA 5ETIA 3EQHA 4C4IA 4DT9A 1JKLA 4CMOA 5LMKC 3KULB 2VTIA 3F88A 3TT0A 1UNHA 2Z8CA 5FTQA 3WZKA 4DEIA 2YABA 4JT3A 3TN8A 3DFAA 4IZ7A 2XCHA 4TT7A 3CBLA 5CVFA 1M2RA 3ZSHA 5HE0A 5AR2A 4FV0A 3UVRA 2HY0A 4FIIA 4RVTA 3RK5A 2Y0AA 5H9BA 3IONA 4ZZMA 4FL1A 5A9UA 3WYXA 4F09A 4D58A 4MXAA 3G6HA 4GVJA 4TKSA 4ZK5A 2LAVA 5GNKA 3MFUA 4NU1A 5CI6A 4JBQA 5K5XA 3QTXA 4FTCA 1W0XC 1XH6A 4H39A 4I0TA 4KRCA 3FMNA 3S2PA 1UU8A 4BN1A 4LMNA 5BNJA 2YAAA 3N4VA 4FEVA 1H8FA 3O71A 4NK9A 3TZ9A 4QT1A 4WRGA 5HBHA 3ZUVA 4AG8A 4XYFA 5HICA 3HV7A 3KCKA 4EC8A 4PDYA 3MH0A 3UG1A 1H1SA 5IH5A 4O7SA 3ZFMA 3ZLWA 3ZUTA 4MNEB 1Q97A 4WNMA 3KN6A 2NO3A 4I23A 5D9HA 1WMKA 1WAKA 4LV8A 3SDJA 4BDGA 1IRKA 2RIOA 4L67A 2YZAA 4YZCA 5I9UA 3FC2A 4BIBA 4TYIA 4IAYA 5HLWA 4FSUA 3SXFA 5AA8A 4BCHA 1W7HA 2JDTA 4ENYA 3DBCA 4AXAA 3FZRA 5LQFA 2VAGA 4FTOA 3DXQA 2VX1A 1YQJA 3EN5A 1WBTA 3KMUA 1GZNA 4FUXA 4DH7A 1Z5MA 4GJ2A 2WXVA 5BVWA 4PMPA 3MJ2A 1JKKA 2CKOA 3IW7A 1J1BA 3R9HA 1APME 3D7TA 3LXNA 3NNUA 5DR2A 3EH9A 3AD5A 4FV6A 3WZJA 3UOHA 4EOSA 2X8DA 4RJ3A 5JH6A 2GQGA 3AOXA 2VX3A 3C4ZA 4AACA 2J51A 4YMJA 3KREA 3UPZA 4QTEA 1AGWA 4KABA 4GL9A 5HD4A 3OOGA 2EXCX 4EH8A 4PNKA 5FG8A 1GZ8A 4XV1A 3PXKA 4J53A 2CJMA 4XH6A 5CT0A 5IA1A 2A1AB 5KZ0A 2J0KA 4QYFA 2OO8X 3S95A 4EOQA 2NRYA 3ROCA 4AUAA 4JX7A 4QMXA 4RC3A 3FMHA 2B4SB 4BCFA 4D2RA 1UU7A 4ZTQA 4CTCA 3TV4A 5IEVA 5JRQA 2QVSE 3UGCA 3QTQA 1Q3DA 3DK3A 3R21A 4MWIA 1OECA 4WOVA 4ORKA 5I9WA 3QUPA 3UIXA 5A6NA 3A4OX 4TRLA 5J95A 5IZFA 3FMJA 5DGZA 2R5TA 2QOQA 4FX3A 4IAFA 4F63A 1QPCA 2JKKA 3R28A 3GOKA 1FOTA 3NUYA 2Z60A 1R0PA 3DLSA 4UMUA 4FGBA 3KCFA 3OVVA 4B8MA 4JDIA 3H0ZA 5IU2A 4I41A 4X0MA 4EWHA 1CKIA 3FI3A 2EXEA 4ITIA 2PE2A 3BU6A 2VWYA 1R39A 4FOCA 2QC6A 2J50A 2W9ZB 2QONA 3C4WA 3KVXA 2CMWA 3HGKA 2VTLA 2F7ZE 5CSHA 3R1NA 1JSVA 5IH4A 3H30A 2W1FA 3E5AA 4L44A 3RALA 5JFVA 2FSOX 1W82A 3DJ7A 4FI1A 5AUUA 2Z7QA 4GYIA 3R8UA 5LVLA 2GS6A 4FKIA 2C68A 3LM0A 4YJVA 3KKVA 3UIUA 2OICA 3EQGA 4AZWA 4K6ZA 2ESMA 3WF5A 5D12A 4BR3A 3FMMA 2B9FA 2XF0A 3R7EA 4RLKA 5C8MA 4CVAA 4ZY4A 2PUNA 3HV5A 1U54B 4OT6A 3TTJA 3HLLA 4F99A 3F2AA 3FDNA 3QX4A 5CTPA 5AV4A 3VF8A 4QYHA 2Y4IB 4KIPA 4EH3A 1UVRA 5DT4A 4FVRA 3UP7A 3VIDA 2OH4A 3PWYA 4RG0A 4EOKA 3QRIA 2VTNA 4L3PA 4HPTE 5DOSA 5DRBA 3OC1A 2VGPA 1QMZA 4FR4A 4GUBA 2X7GA 1QPEA 3BU3A 4Y72A 4BDHA 5IQHA 4NJ3A 3HMPA 2UZLA 5HLPA 4O22A 2R3QA 4QTDA 5AR4A 5KZIA 2ZM3A 1PMVA 1JSUA 3CS9A 3MWUA 5GHVA 3NVKI 3NUNA 4DGOA 5AP7A 3F66A 3R2BA 3BGQA 4F9AA 2R3HA 5CS6A 3U54A 5AUXA 4ACCA 4DH8A 5L3AA 3R30A 3AT4A 3ATTA 1YOLA 1FINA 2WU6A 2JIIA 1W84A 4EJ7A 4GYGA 3F5GA 2PVLA 1K2PA 2PWLA 4N70A 4EH9A 1PYEA 1IAHA 3RZBA 2YIXA 4Y5HA 4BCGA 4BHNA 5EK7A 1A9UA 5CEOA 4UV0A 4CRLA 3QTSA 4HYUA 5FDXA 4D2SA 4FEQA 5DNRA 4EUUA 4BDAA 1ZWSA 4ZIMA 4YJUA 2X7FA 1ZYDA 3CQEA 4H3PA 4RFMA 1H1WA 4ZSEA 4TL0A 5I3OA 4AN9A 1XH4A 2WMTA 4EJNA 3OXIA 4WIHA 1YHVA 3MVHA 1U5RA 4UEUA 4NM5A 2BZHB 4QMYA 5HHWA 3WIGA 3FXWA 4GU6A 1WCCA 4LRJA 4S30A 2WTIA 4D2PA 4U6RA 4YSJA 2BDFA 3KC3A 4OTQA 4UWBA 2VWVA 2IO6A 4HW7A 5AUTA 5LWNA 2H6DA 3OHTA 4GEOA 3A7GA 2V7AA 4FKRA 4JI9A 4EHEA 5JFWA 3Q32A 4M13A 3TM0A 2BIKB 4QRCA 5GZ8A 3I6WA 3JYAA 4LQMA 2WELA 4R77A 5EYKA 4YC3A 4FA2A 5HE2A 4DEGA 4MWHA 3NMUF 2OLCA 4JRVA 3MVJA 5CF6A 3SA0A 2CN5A 4YJNA 3HRFA 3LCSA 3QKMA 3F6XA 3OF0A 2PZIA 3VWAA 4QO9A 4EZ3A 3FMLA 3CLYA 3D2KA 4HVDA 3PXQA 3DBEA 2JKMA 3RNIA 2VV9A 4DFUA 2XMYA 3NSZA 3GCUA 4OLIA 1JWHA 3TDVA 4IVAA 4M14A 3KXZA 3DB6A 3DNEA 4I5PA 3HA8A 3I81A 2C30A 3RPYA 3VVHA 1FMOE 4R6VA 3BGZA 5HTIA 1ZOGA 3QYZA 3R2YA 4L00A 3P4KA 2GNJA 5K4JA 2WIPA 4AZEA 5AWMA 4ZS4A 5IUGA 4APPA 2QOOA 1JQHA 4ID7A 4QP1A 4CRSA 3F5PA 3KB7A 4DYMA 5I9ZA 1YXUA 1OIQA 4GSBA 4EQUA 2PTKA 3HNGA 4FVQA 2BHHA 4I0SA 2WEVA 4BFMA 1B39A 2ITVA 5M53A 2O5KA 2XIYA 2X6EA 3LZBA 5HX6A 3PZHA 3TNHA 3I6UA 3UVQA 2UW3A 5TE0A 4AE6A 3FZTA 1PXLA 3FLYA 2V22A 5JRSA 4Z16A 5IISA 4P2KA 2ZVAA 1H07A 3MFSA 2VTQA 3C51A 4G6NA 2W06A 2YCFA 4WG3A 5AP3A 5A4CA 3HMNA 5BUJA 4HZSA 1R3CA 5HQ0A 2G2HA 3E3BX 3E62A 4QMSA 3LOKA 4EOJA 2HWOA 2WMUA 4GG7A 4MBJA 4BBMA 3FJQE 3PVBA 5CWZA 5M56A 5FRIA 4R1YA 4F6SA 3CKXA 4NW5A 3OCBA 3BLHA 4LRKA 5DI1A 3RCJA 1E9HA 2W1CA 5CSXA 3C5IA 1ERKA 4F7NA 4YZ9A 2QQ7A 3Q4ZA 5HIDA 3FUPA 2UW4A 3CC6A 4K33A 4XP3A 3RM7A 5AP0A 4OUCA 3PPKA 1W83A 3HECA 4QNYA 3C0HA 4B0GA 5M57A 3OROA 3Q04A 4ZEGA 3N9XA 4JXFA 4TWNA 5C03A 3P7BA 3H4JA 4O0SA 3W18A 2QOFA 4J52A 4YJPA 3IDPA 4FKSA 4O0UA 3NNXA 3RKBA 3RPVA 1M7NA 4EBWA 5HGIA 3AC1A 2BVAA 1YHWA 2P3GX 2YM8A 4JDKA 4P5ZA 4FTUA 4RWIA 4WO5A 5E8YA 4DA5A 3F3WA 1DM2A 2C47A 3Q53A 4XG2A 5D41A 5FXQA 5LMAA 3UP2A 4DEDA 1SNUA 4FF8A 4G3CA 3EMGA 4QMOA 4AP7A 4I24A 1R0EA 4B99A 2RF9A 3KVWA 3MB7A 4YTHA 5AJQA 2VNWA 3HV3A 2WO6A 4BZOA 5CVHA 3F7ZA 3QL8A 2XBJA 3KMMA 2I0YA 3MS9A 4F6UA 2J6MA 3TUCA 4JG8A 4MTAA 4X2FA 3SAYA 3FZOA 3M42A 4FICA 4GVAA 3QD4A 2QHNA 4KAOA 1H28A 2DS1A 4FV5A 4QMLA 3VS1A 1OBGA 4R7IA 1WBWA 4I92A 3CY2A 3IOPA 4LUDA 4BCMA 2BIYA 3I7CA 4QTAA 5J1VA 1KSWA 3BE2A 2QOBA 4YJQA 3HKOA 5GJDA 3R7GA 2GHMA 3VUKA 4IC7A 4OBQA 1YI6A 4QPMA 1YDSE 4TYJA 4NKAA 1VJYA 1Y91A 4AN2A 2GS2A 3Q60A 5CEKA 3QZGA 1R1WA 5LCKA 5AP1A 3EIDA 3FI4A 2VTJA 2BCJA 3W33A 3DNDA 3LQ5A 3JVRA 4NT4A 4MQ2A 4FNWA 1PMUA 4W4VA 4XEYA 5AMNA 3OW4A 4OTFA 3TZ8A 4EOOA 4S33A 1GZOA 4NW6A 4DG2E 4RIXB 2CKPA 5HG9A 4ZMEA 3BHHA 3R9DA 3PVGA 2W9FB 3QWKA 5ANOA 5AEPA 5I3RA 1H4LA 3MB6A 5ANEA 2R7BA 4EWQA 4C3PA 1BKXA 2C6LA 2IVTA 3BQCA 2B9JA 3SC1A 2PVMA 2V55A 2O8YA 3R7YA 2GHLA 1OKYA 2GMXA 2R2PA 2XS0A 3E3PA 4D4RA 2VTSA 3FKLA 2J9MA 4WNKA 2JAVA 5HESA 4LUEA 1KE6A 3QKKA 3IW6A 4HCUA 4YJSA 4BKYA 5F9EA 4QPSA 1XH9A 4TZRA 3GU8A 3QALE 3DXPA 4ACGA 2OIBA 1Q24A 3PIXA 4DT8A 4D9TA 4NM0A 2PU8A 4FYOA 2J5FA 4TYHB 2OI4X 3G0FA 4IWPA 2UZBA 4FNYA 4ASXA 1OL2A 3MIYA 1I44A 4XRLA 2EUFB 3VQHA 4B4LA 3LE6A 5CAPA 3O51A 1ZOEA 3LLAA 2UZNA 1YI4A 3L9PA 5JGAA 5HNBA 3MPAA 3R73A 4X6QC 5HNGA 4BI1A 3K5VA 3GU4A 4KSPA 3T3UA 3FHIA 3F5UA 4IVDA 1BL6A 4X3FA 1FMKA 1IEPA 4IVBA 3KRRA 1IG1A 3PJ2A 1OUKA 4Y8DA 3DQXA 3OOMA 3MSSA 1SMHA 5HLNA 4CGAA 3NUSA 3NR9A 4W4YA 3C1XA 4X2GA 5LVOA 4QMTA 4MXOA 4C62A 4C38A 2V7OA 4ANOA 4OTIA 3LXLA 4BGGA 3A60A 4EKKA 3UMXA 1DAYA 4KIKA 3D5WA 4RZWA 2JITA 3UVPA 1JSTA 4FG8A 5T6KA 3P08A 4GT5A 4RFZA 4RIYB 3O96A 2PMOX 3QUDA 1XH7A 1YWVA 3U6JA 5C26A 5CASA 3UO5A 3AG9A 5EM8A 3ORIA 3B8QA 4NIFA 3TWJA 4FV9A 3W32A 2XYUA 4FIEA 3V5QA 4DGGA 4MF0A 4QMZA 4FBXA 3AMYA 2R3RA 2R0UA 4U44A 4ZOGA 2Y6OA 2PUIA 5CY3A 4QTCA 1GNGA 2WZJA 3QQGA 5AM7A 1J3HA 4BF2A 2IPXA 2I0HA 2W4JA 4FIFA 2PUPA 2GHGA 4NCTC 3UO4A 4FKVA 3W2PA 5M51A 2O2UA 2VWWA 5HD7A 4AGDA 5KHWA 5EI8A 1WZYA 5LVPA 3OWKA 2R3OA 4C58A 5I4NA 4M67A 4YNEA 3KMWA 4Q9SA 2X39A 3L9MA 3VBYA 4HVIA 4FSMA 4AOTA 4EZ5A 2J90A 3EFJA 3IS5A 4WSQA 1A48A 4NFNA 2OZAB 4GIIA 4UMRA 4NM7A 4J98A 4L01A 3NYOA 2X8IA 4YHJA 5HEZA 3U6HA 4O81A 4S32A 5IA3A 4UWYA 2OFUA 4IACA 3OCGA 3P0MA 4EL9A 3PY3A 2XM8A 3RPOA 3VUHA 3EJ1A 1G3NA 2BAJA 4NFMA 1Q8ZA 3CY3A 3WF8A 4DF3A 3BLRA 3WI6A 4PP7A 2E2BA 3QGWA 2VTTA 2WPAA 4QP6A 4JAIA 1O9UA 4W4WA 3VBWA 2OIDA 4RVMA 4YTCA 2XRWA 3Q3BA 1H00A 3AD4A 3BI6A 2XNBA 4LGHA 4A9RA 5J7BA 3O0GA 4OR5A 3FE3A 2BTRA 3Q96A 1ZAOA 3FY2A 4FTKA 5BMMA 3RM6A 3TIYA 5AADA 1IR3A 3TNPC 5ANGA 3WBLA 3RCDA 4KBCA 4X6RA 4GRBA 5I5ZA 5IA4A 4TNDA 3HDNA 5KE0A 5CQUA 4RX9A 3LCKA 5B0XA 1O6YA 2C6IA 1V0PA 3F82A 3ACKA 5AAEA 3BZ3A 3LFFA 3HP5A 4F9BA 4B8LA 5L8JA 4C4FA 3R04A 4IJ9A 4ITJA 5A3XA 3GU6A 4IX3A 5AR5A 3I4BA 4C02A 4PMTA 3E92A 3FZ1A 2EB3A 3KA0A 2J0IA 3R7UA 1JNKA 2UZVA 4ZTRA 5E7RA 4ZZNA 3LFQA 3C4EA 4XLIA 1Y6AA 5T3QA 4I6HA 3GXLA 5HO6A 4FTQA 4GKIA 4EQMA 1ZYJA 3FLZA 2EXMA 2ZV9A 3AC8A 4FSYA 4X7QA 4DGMA 3DGKA 2I7QA 2EWAA 2WTKC 4XCUA 5DE2A 3GCSA 5FM3A 3D4QA 4AE9A 2YM7A 3TI1A 3BEGA 3W2CA 3H9OA 3SRVA 3R7IA 3JS2A 1YXTA 2Z2WA 2HK5A 4V0GA 1REJA 2V0DA 5TOZA 4ZAUA 2YDJA 2IZTA 3K2LA 3Q9WA 4M97A 3G90X 2FSTX 3IGGA 3OBJA 4IANA 4YUQA 1H25A 3ULIA 4ALUA 2UVYA 2XNGA 3DAEA 4O0TA 4YSMA 3CD8A 4MD8E 5ANJA 2WMVA 5H8EA 3REPA 3QRUA 4GU9A 3UNZA 1Q3WA 3C5UA 2Q0NA 4PL4A 3VJNA 4K11A 3BYOA 4LV5A 3VUIA 5EQYA 2OJ9A 4BIEA 2F49A 4C57A 4CFNA 1PKDA 3I7BA 5DLSA 2XZSA 3W2RA 4KS8A 5FEEA 4FMQA 2ZJWA 3TJDA 4CFVA 1H26A 3P1AA 4F1OA 2BAQA 2GNGA 5BVEA 2DYLA 2QOIA 4D4VA 3GQLA 1MP8A 5CQWA 4G31A 1PMNA 5DWRA 4DFBA 2E9UA 4LL0A 1G5SA 1NW1A 3QQFA 4FTMA 5CEQA 1M7QA 4NEUA 2JD5A 2HYYA 4MX9A 3IK3A 5FD2A 3VNTA 3PDTA 3HVCA 4L7SA 3GU7A 4BCKA 3QQHA 1J1CA 2VO7A 3LJ0A 5JFXA 2O63A 4E3CA 1Q99A 3LW0A 4GFOA 2OGVA 3FMEA 4G5PA 3QQUA 2B1PA 4YC6A 1J7UA 4UALA 4HVHA 4BDIA 3OWJA 4E20A 5JGDA 4PL5A 4O6LA 5EDQA 2E9OA 2PVKA 1XHAA 3Q5ZA 3QTZA 4PX6A 4FKOA 2OJFE 4FT3A 3LMGA 2RSVA 3GC0A 3I79A 4YBKA 2B0QA 1K9AA 4Y73A 1E1VA 5BPYA 1OL1A 4IJPA 3D2IA 1Q8UA 3P9JA 3DK7A 4FVPA 4ZTNA 3KRJA 3U51A 4BCJA 4BWXA 3MESA 4O2PA 4WG4A 5HNIX 3R8ZA 4PPCA 4UBAA 3NS9A 1WBNA 3CCNA 5FQDC 1Q62A 4PNIA 5FTOA 1JKTA 4U5JA 3DU8A 5E8SA 2BZIB 2IWIA 4PTGA 4TWOA 3JR1A 4GKHA 3QKLA 5E90A 3QHRA 3L1SA 4FV2A 4FT0A 3VW8A 2HW6A 5HG7A 4QQJA 2BDJA 4BTKA 4NKSA 5A4QA 2UZUE 3QHWA 4JL9A 4E5AX 3O8PA 1Q8YA 5HO8A 3V5TA 4MK0A 4AA0A 3Q9YA 3UIBA 4BDKA 1RDQE 3R01A 4NSTA 3PLSA 3NGAA 3R0TA 5A4EA 1PRYA 2JAMA 1UA2A 4LGDA 2P33A 1J7IA 5J1WA 3MDYA 3TUDA 4FTIA 4UMTA 2YN8A 3EFLA 4A4LA 4BRXA 3LAUA 4G5JA 4ANMA 3HX4A 4ACHA 4AW0A 2VU3A 4MXXA 2G01A 3V8SA 4XUFA 4RIWB 4FKUA 4BZDA 1QPDA 3QRJA 3LJ1A 3ZONA 3B2TA 4RC4A 4D1ZA 5K0XA 1OL5A 3A8WA 3R83A 4ALVA 3LQ8A 4MEDA 2BUJA 3WE8A 2B53A 3DS6A 3OCTA 1CMKE 4KIQA 5L2SA 4CG8A 1GAGA 3NRMA 2W4KA 4JIKA 2PL0A 3BHVA 2BFYA 4ARKA 5CALA 3BKBA 2VO3A 4DFYA 1ZMVA 1XBBA 5CXHA 4FEXA 2C6MA 3V6SA 3ZFXA 3AC2A 4MAOA 3E88A 3W10A 5FTGA 1ZYCA 4A9UA 3PJ1A 3COHA 4YHTA 4IZYA 3RPRA 1OIRA 3NUPA 2X8EA 4RQKA 3TZMA 3VBQA 2OJJA 3EQPA 4GIHA 1OITA 4AZVA 1MRVA 3RAWA 3C9WA 3DKFA 4JX3A 1ZMUA 4KKEA 4MBIA 4JG6A 4JRNA 4GK3A 3LFAA 2A19B 4G9CA 4D4SA 2WHBA 4KBKA 4YLKA 3WILA 2DWBA 2WTWA 4IM2A 3POOA 3G6GA 3QD2B 4F70A 3KULA 4I5HA 5FLFA 1KV1A 3QFVA 2UVZA 1OKWA 3FLNC 1Y6BA 3UBDA 3VN9A 4EYJA 1B6CB 2VTAA 4FKJA 5AP5A 5C4KA 5HBJA 3QCYA 3WZEA 3ZRLA 4CZUA 4F4PA 5JQ8A 4YZMA 5KKRC 4LG4A 2REIA 2OFVA 3HUBA 4ZSGA 4XBUA 5L8LA 2QOHA 1UU9A 2RFDA 1BX6A 4XV3A 3DXNA 2YAKA 3PE1A 3R1QA 4IM0A 4U97A 5E4HA 4EBVA 1MQ4A 5ANKA 3GUBA 4CFWA 4A4XA 3HRCA 5HIEA 3UODA 2XNNA 3ZC6A 5LVMA 4E26A 3F5XA 3UYSA 4XG9A 2VNYA 1YI3A 3FY0A 4L3JA 5BVFA 2UVXA 4YHFA 3E8NA 4C61A 3N51A 1WVWA 4RFYA 2J0JA 2W0JA 4IWQA 3VUMA 5J9ZA 2YACA 4FSTA 5H8GA 4F65A 2SRCA 2NRUA 2PZPA 5ITAA 4BTJA 2JDSA 4O84A 4X3JA 3RJCA 4WKQA 4MNEA 4M8TA 3D14A 4B7TA 5D7VA 1OI9A 3PY1A 5AX3A 3L8XA 5IH6A 5IMEA 4YC8A 4ZTMA 3ELJA 3TG1A 3ENMA 1SVHA 3PZEA 4QPAA 3OMVA 2Y8OA 4ZJVA 5C8KA 1YVJA 2GNFA 2PSQA 3MA6A 2P0CA 4BYIA 4HGTA 2ZV7A 4L6QA 1YRPA 2C0TA 5E8ZA 4L46A 4FIHA 4FNZA 3RGFA 4GW8A 5AUYA 4AZSA 2OKRA 4CLIA 1KOAA 1M14A 2XA4A 4UB7A 5EI6A 2R64A 4FYNA 2W05A 4BI0A 4YJOA 2WTVA 3DB8A 3JXWA 3UC4A 2Z7SA 3FMKA 4CV8A 4DC2A 4EK3A 4YU2A 4ZMFA 3TNIA 4I6BA 1OUYA 1YDTE 1U46A 1XQZA 4OTRA 4RJ5A 4E93A 5GINE 2C5YA 5TKDA 3QUEA 3JVSA 2ETRA 3FC1X 2QG7A 4OT5A 3KXXA 3NYXA 2VWZA 4FKQA 2R0IA 3PY0A 5IMXA 2XNMA 2YISA 3KQ7A 3NAYA 3QXOA 4FZAB 4B6LA 5J9YA 4KA3A 2VGOA 4ZJJA 4ITHA 4I93A 3QAME 3LIJA 3OP5A 2J4ZA 5IG1A 2YFXA 2V62A 4BCOA 3K3IA 2E9PA 4I6FA 3OTVA 5AIKA 1QCFA 5CU4A 3LMIA 2XUUA 5CT7A 3GVUA 4C2WA 4M69B 3OCSA 5F4NA 1ZARA
chains in the Genus database with same CATH superfamily
5DRDA 5HCZA 4AW5A 3NPCA 4CFUA 3VS5A 2XIZA 2WFYA 3NCGA 4WA9A 3DTCA 2UZDA 3BYUA 4PRJA 1GOLA 3BU5A 1HCKA 2BPMA 1T46A 3TMOA 3WIKA 1UKHA 3NYNA 4ALWA 3OT3A 4C36A 5CAUA 2X2LA 3GI3A 3MFTA 2YA9A 3PJ8A 3LFCA 3AXWA 4PQNA 4KINA 2OF2A 3I5ZA 2HZ4A 1G8JA 5DN3A 2R7IA 4V05A 3OY1A 2JFLA 2RFNA 1YXSA 5AA9A 3O7LB 3BE9A 3CTHA 5JT2A 5I9XA 4I3ZA 1ZY4A 4V04A 2I0EA 4HYIA 4QMQA 4LYNA 3DJ5A 4MD9E 3MN3A 3CXWA 2YM6A 2ZV8A 4L3LA 2X6DA 2XBAA 3MY5A 3R71A 4U7ZA 2C6OA 4O86A 4TYEA 4BJJA 2C1AA 2BROA 5HORA 3S0OA 5CAOA 2WMQA 1OZ1A 1PYXA 3ANRA 2UZTA 3CJGA 3GCQA 2VN9A 3KXHA 3PXZA 5D10A 2GFCA 2X81A 1ZY5A 3KK9A 2RG6A 3JUHA 5AV0A 3V5WA 1FGIA 4WD5A 1PXOA 2YHVA 2WOUA 3ZSIA 3BX5A 4RJ8A 2OK1A 5ANIA 3NNWA 3PVUA 1PHKA 3HV6A 3QRTA 4JVGA 4O4EA 4CT1A 1PXIA 1YDRE 4R7HA 4ZLZA 4UX9A 2ETMA 5A54A 4ENXA 4JJRA 2HXQA 2NPQA 3OEFX 1U54A 4UYNA 5EM6A 2VRXA 2QO9A 3ZUUA 2X9FA 1S9IA 1ZLTA 2QU5A 3BQRA 2CCHA 3NFFB 4CCBA 1R78A 4OGRA 2VWXA 3L9NA 3DA6A 4DN5A 3F2RA 2AC5A 2W1DA 1G8AA 2JBPA 4U41A 3S3IA 1BUHA 4I5MA 1VYZA 3PPJA 3G51A 4E7WA 4F9YA 2ZMDA 4FV4A 4R3CA 3WZUA 4MXYA 4AXEA 1GJOA 4OBPA 1O6LA 4QOXA 5FEDA 5A14A 3VUDA 4F7SA 3PLAE 1XJDA 3P79A 3FXZA 4FG9A 2IW6A 1V0BA 1E1XA 2P4IA 2F7EE 3IPHA 1GY3A 4YLJA 2J0MB 4J8MA 4O21A 2ITQA 3AC5A 4D2TA 2I40A 4HCTA 1RW8A 3A7HA 3RZFA 3SV0A 1LUFA 3U8WA 4IEBA 2HZ0A 2JFMA 2YJSA 3FHRA 4OTWA 2FA2A 3W0RA 1U59A 4IX6A 2VWUA 3LQ3A 4GFMA 3HP2A 5I9YA 4CLJA 2Y7JA 2B55A 3BEAA 4U0IA 4YO4A 3ZLXA 2QHMA 3GT8A 2QD9A 3D83A 4RWJA 4U9AA 5C01A 3NVMB 3QD3A 2BFXA 2CCIA 1IA8A 3RWPA 4J96A 5E8UA 5KMNA 3VBTA 2QURA 5A4TA 3S1HA 3EQIA 5JN2A 5KO1A 4J1RA 4TPTA 4AXFA 4Z7HA 4JBPA 4O0YA 2VWBA 3SKCA 2WQNA 5F1ZA 3GENA 3DFCB 3C4XA 4DG3E 4P4CA 3W2OA 1UKIA 5HOAA 4J7BA 4QMMA 4FNXA 5DFPA 2PE0A 1ST0A 1YW2A 5IQFA 1SVEA 2Z02A 4E4NA 2HELA 2X2MA 2J7TA 2V5QA 3LM5A 1FVRA 2VWIA 5KBRA 5CAQA 3T3VA 4L42A 4AGWA 3PUFC 4BDEA 2B54A 3VBXA 1CSNA 4BDDA 4FEWA 2IJMA 5FM2A 5IQGA 3GP0A 1V1KA 3FQSA 4YLLA 5FBNC 3RP9A 4AF3A 4AT3A 3AGLA 5HO7A 3QGYA 5K9IA 4O7YA 2RFSA 2XB7A 4Z55A 2VTRA 3HMOA 4N6YA 2FB8A 4DCEA 3E87A 3QLFA 4JMQA 3NIZA 3RNYA 2C5NA 2AUHA 3DBFA 3GB2A 3NYVA 3AC4A 2CGWA 4W9WA 3PTGA 3TACA 3SHEA 4YURA 4Y85A 5CVGA 2ITWA 2R3GA 4CYIA 1ZYSA 4NTTA 5C8NA 4DHIB 3DTWA 3I0OA 3P7CA 4KD1A 3OEZA 3H0YA 2VTMA 4Q5HA 2P55A 2ONLA 5AUVA 1FVTA 4BICA 2VTOA 3ZYAA 4QYGA 4XV9A 1SYKA 4R3PA 4WT6A 4C4HA 4HOKA 4BDJA 3ZO2A 4O0XA 3WARA 2ZB0A 1PY5A 2YZLA 4M0ZA 3R7VA 2XJ0A 4D9UA 3SOCA 3W2QA 4IE9A 4IZAA 2QR8A 2PZYA 3EL8A 2QODA 4CTBA 2UUEA 4GV1A 1STCE 3E63A 5DT3A 3DLZA 5IUIA 4R1VA 2WTDA 2OH0E 3C0IA 4D4YA 1H24A 4FIJA 2FYSA 4H1MA 5J79A 4QP3A 4DH3A 2XKEA 3ZEWA 4D5HA 5FDPA 4QP7A 4RBLA 3U6IA 3QCXA 4FL2A 3RI1A 3V01A 3R9OA 2WMAA 4N0SA 3W16A 3FYKX 3R8MA 5D11A 1ZZLA 2CGUA 4L68A 1KE8A 2ZDTA 3QCQA 1YKRA 1CKPA 4AT5A 2ZYBA 3UG2A 1UWHA 2QR7A 1NVQA 2HXLA 4I6QA 4IAAA 4K2RA 2XKDA 4PDPA 2EU9A 4BBEA 2HWPA 4F7LA 5M4IA 4PDOA 1HOWA 2RGPA 2BMCA 2XEZA 4CFXA 5IDNA 4QQCA 3R8PA 5GZ9A 4BDCA 3H9RA 4LOPA 5DR6A 2HENA 2XM9A 4R5SA 4QQ5A 2I1MA 3EYGA 4YZNA 4FKPA 2F4JA 4KRDA 4Q9ZA 3O17A 2OJGA 1L3RE 3A7IA 4LGGA 1KOBA 1GZKA 3LVPA 4ONAA 4E4XA 1WBOA 3BYVA 1TKIA 2VO0A 3SX9A 5M4CA 4IAZA 1SNXA 4GK2A 5E8VA 5HVJA 3CPCA 3ZC5A 3RINA 4IB1A 3AQVA 4D28A 4CG9A 1Z9XA 3DPKA 4RWKA 5EDPA 2C6KA 2F2UA 4YZDA 4J71A 1VEBA 2XK7A 3R1YA 4BCQA 1UWJA 1MUOA 3QA8A 3QTWA 1ATPE 4FT9A 2O0UA 4YGAA 5C1QB 4XP2A 4U45A 4BTMA 2WQEA 4NM3A 2F2CB 3QA0A 5LMKA 2VD5A 4FKWA 4DG0E 5JEBA 4M3QA 3OWLA 5L2TA 4QP4A 2WMXA 4MUQA 2CGVA 4M12A 4RJ4A 2F7XE 4GT3A 3TNQB 2XK6A 4WUNA 4YTIA 4DFXE 3FBVA 5CNNA 3OXZA 1VZOA 4MH7A 4XLVA 3ORMA 5CYIA 4FSQA 3KRXA 3C4FA 2GU8A 2WMWA 3EQFA 3PP1A 4K1BA 5ANDA 4DCAA 2IVVA 4DEAA 2BILB 4ZLYA 2BRGA 4M68A 4U42A 2BKKA 3H9FA 2RL5A 1PXPA 4OBOA 2JKOA 4RIXA 3U55A 4G6LA 3MW1A 4Y5QA 3K54A 4YR8A 3VRZA 1JBPE 3CR0A 3NWWA 3DZQA 1FBNA 5KBQA 2X2KA 4O7NA 2C0IA 5L2QA 4U40A 5CI7A 2IG7A 5CSVA 4E6CA 3KY2A 4UXLA 3AMBA 3ETAA 3ORLA 4NYEA 4MVFA 5LARA 2QKWB 3UOKA 1Y57A 5GJGA 5HVKA 3R9NA 3EQRA 5DG5A 1VR2A 4BWKA 4PY1A 5EHYA 2GPHA 3MBLA 2RFEA 3MTLA 4YO6A 5AP2A 5LJJA 3MPMA 3CJFA 1ZZ2A 1DS5A 4FSRA 4IAIA 2YJRA 3AC3A 4KNBA 3F69A 4N57A 1HCLA 3D5VA 4JAJA 4TYHA 2UW6A 3I1AA 4G3FA 3KRLA 3PA3A 3ET7A 3CQUA 2WKMA 3E7VA 3LFSA 4PMSA 3FL4A 2ITNA 2YLEA 4WRSA 3R7OA 4DTBA 3UZTA 2UZEA 3TDWA 4RA4A 3QLGA 3SOAA 5AUWA 2W1IA 3ANQA 2XKFA 3IG7A 3RBWA 2WTJA 3CGOA 3DDQA 4GFGA 4PV0A 3MGYA 3EN7A 3U4WA 4DFNA 5EYDA 4FE2A 2UV2A 4DBNA 4BL1A 5B7VA 4O7LA 5EKNA 3VULA 3P86A 3VC4A 4MCVA 3D7ZA 4D5KA 3E8EA 2WB8A 1LPUA 3COKA 3FYJX 4FTTA 4RJ7A 4G2FA 2UW5A 2H8HA 3GU5A 4P90A 4RVKA 4ZP5A 3LXKA 5JMSA 4GCJA 4O91A 4G3DA 5CU0A 3UDBA 2O64A 1KUTA 4D1SA 4ZLOA 3W1FA 2XK8A 3Q4CA 4HJOA 4J99A 4RIYA 3ZMMA 4EKLA 5CEMA 2XCKA 5T68A 2YERA 5BV3A 3ZRKA 3Q52A 3MTFA 4C35A 4DH1A 2ETKA 2QCSA 2IZRA 1XBCA 1NA7A 2NP8A 2WNTA 3QU0A 4DH5A 2YM4A 3L8SA 3RAKA 4YZBA 1MQBA 1I09A 2JIUA 2HZNA 4BC6A 5BVOA 1PF8A 4N4SA 2I0VA 3PRIA 3R1SA 5HI2A 3WF6A 4EH4A 4MBLA 4IX5A 1OL7A 3VS4A 4RC2A 4EORA 3M2WA 5M09A 5CU6A 5I0BA 4HZRA 3F3TA 1M17A 4LM5A 4XBRA 4CYJA 2C1BA 4KB8A 3HV4A 4JOAA 2XKCA 5CENA 1OL6A 2XNEA 5C9CA 2WAJA 3UO6A 3VS2A 3C50A 5E92A 4A7CA 4BDFA 5KMLA 3ZU7A 4LFIA 4C8BA 2OW3A 2Z7LA 2IZSA 4BZNA 1FVVA 5E9EA 2PMLX 3DZOA 1A06A 1P5EA 4BYJA 4NL0A 2R3NA 4G3EA 2G2FA 1DI9A 5KX8A 5CSWA 3MV5A 4ANQA 4USFA 3GC7A 4J95A 2QOLA 4JBOA 2OZAA 3LFBA 4JDJA 4U43A 1NY3A 3VHEA 3Q5IA 3PP0A 5EQPA 5J87A 2C6TA 1L8TA 3GCVA 5ICPA 2Z7RA 5ACKA 5IQCA 4X21A 5FP6A 4ZXTA 3IOKA 5IA5A 3S00A 2I6LA 4FK3A 3R8VA 4O6EA 4WHZA 2OJIA 2ITTA 4L43A 2IN6A 3C0GA 3ODZX 3CTQA 5EW8A 2YEXA 5M06A 4IDVA 4XHKB 2YM3A 4FGRA 3IKAA 1FGKA 1JAMA 5DA3A 4Z7GA 4PUZA 1KE5A 4AA5A 3VS0A 5IF1A 4RT7A 4EC9A 4XP0A 2ITUA 1Y8YA 3BBTB 1OKVA 2C5XA 4LOQA 2R9SA 2PVNA 2GFSA 4H1JA 4QMVA 5BVNA 1LR4A 3MIAA 3NEWA 4MKCA 3RWQA 4FTAA 2VTHA 1W8CA 4TWCA 4IHPA 2IZUA 4XG6A 5M08A 1PKGA 3OW3A 3QTUA 5K5NA 1WBVA 3II5A 5M55A 4LI5A 4DTKA 1H0VA 4CKIA 2A4LA 2BHEA 4FTJA 4YPSA 3PA5A 4C37A 5HCXA 4F0IA 3HAVA 2IVUA 2QG5A 3MFRA 4IADA 4C2VA 2WQOA 1Q5KA 1XR1A 4G34A 3CQWA 2C4GA 5ACBC 5J5SA 4IB5A 4TW9A 4ZY5A 5CZHA 1BYGA 2WIHA 3EOCA 3KRWA 2P2HA 5JZNA 5TT7A 3PJ3A 5JZJA 2F9GA 1U4DA 4AW2A 5IQEA 3KXGA 1REKA 2QKRA 5AX9A 3UMWA 1JLUE 4EEVA 1MRYA 4F9WA 2PVRA 4J8NA 4OAUC 5B2LA 3OZ6A 3UE4A 4O7ZA 3DOGA 4D55A 1WBSA 4RPVA 3RAHA 3FQHA 4XG8A 2YIQA 3D7TB 3POZA 4W4XA 4WUAA 4HVGA 4H3BA 4A4OA 3UOLA 4BHZA 2QU6A 2RKUA 4CMUA 4BTFA 1JOWB 2YDIA 3QXPA 3UTOA 5AR3A 4WNPA 2ITXA 3G9LX 4X3FC 5DH3A 2KTYA 4APCA 5BYZA 4CQGA 2XRUA 2O65A 4NJDA 3QYWA 3D15A 2C3LA 3QWJA 5D1JA 4E6AA 4ZTHA 3ORXA 4UMPA 2GQRA 4IFGA 5H8BA 2BR1A 2P2IA 5J5TA 3O7LD 5CNOA 2B9IA 5AFVA 3GFEA 4CKRA 4BCPA 5CANA 5BYLA 4RZVA 3TKIA 2CLXA 1ZOHA 5KNJA 3UQCA 4WBBB 3TKHA 1H1PA 4MXCA 1GIIA 2PVJA 3Q2MA 4L53A 3Q4UA 1YHSA 4IW0A 4EOPA 1OPKA 3BLAA 5DEWA 3QQKA 4JQEA 4O4DA 3ZBXA 4AOIA 2CSNA 4F08A 2ERKA 5DVRA 3EN6A 4JS8A 5EYMA 2W17A 3DT1A 2W4OA 1K3AA 1PXJA 5K0KA 2FGIA 2WQMA 4DITA 1BI7A 2RG5A 1UV5A 3V8TA 3R22A 4LMUA 4D2VA 3BBWA 2YDKA 4ACDA 2LGCA 5F94A 4I94A 4YBJA 2Y9QA 5BQ0A 5CXZA 4PL3A 4EHZA 3MVMA 1BI8A 4AFEA 5K4IA 1P4OA 2C6EA 3UZRA 4FZ7A 1TQPA 1P14A 3BPRA 3ZO3A 5L8KA 5EQEA 4U81A 3OUKA 4HNFA 4IBMA 5EM7A 2GQSA 2C3JA 4TY1A 5A46A 3LFDA 2PVFA 4H58A 4IZ5A 4C3RA 5IA2A 2BZJA 3A61A 5IEYA 3QTIA 4H36A 4QD6A 3RHXA 3V5JA 4HGLA 3QTRA 4L9IA 4OW8A 5FEQA 4K8AA 3SXSA 4E6DA 5IA0A 4UZHA 4X2JA 4EHVA 3MA3A 4IH8A 3WOWA 3W8LA 4U80A 5KMKA 5L2IA 4KWPA 4O0WA 2J0LA 4UN0C 4I4EA 5J9LA 3C13A 4C34A 2W1ZA 3TCPA 1WBPA 1BL7A 3Q6WA 3CTJA 2ZOQA 4AS0A 4DINA 4EUTA 1PXKA 3SLSA 5EKOA 4F9CA 3LCTA 1NT2A 1WVXA 4XOZA 4L7FA 4N6ZA 5HG8A 4O27B 5LWMA 5FP5A 2BALA 3TZ7A 1QPJA 3COMA 5EHOA 2XVDA 3P78A 2QLUA 2XNOA 3QZFA 3F61A 1Q8TA 2QO2A 3PPZA 4I1ZA 3A62A 2VZ6A 4FC0A 4XG4A 5GIPE 2OXYA 3DAJA 3DBQA 3ZCLA 3JY0A 4USEA 3ROYA 3EWHA 4A07A 4YPDA 5IKWA 2R3FA 1XO2B 5AM6A 5KMMA 2C69A 4F0FA 4KIOA 2QLQA 1Y8GA 4RIWA 3MY0A 3IQ7A 3QZHA 5G1XA 2BRMA 1H01A 4F1MA 4D0WA 1PJKA 3O2MA 4QYEA 5EDRA 4EI4A 4HYSA 4G16A 3W55A 1H1RA 5M44A 2FSMX 5EM5A 3FI8A 2W96B 3E64A 3NZ0A 2J2IB 2O3PA 4TXCA 4O7TA 3LHJA 4QP2A 4QP9A 4GUEA 5AAGA 3GOPA 3LCOA 4O4BB 4Y95A 4O96A 5IQDA 3COIA 3IW4A 3IW8A 2C5VA 3SXRA 2R3KA 4FSZA 3KN5A 2QI8A 3PIYA 2PK9A 5BYYA 2PYWA 5C4LA 2A0CX 4O1PA 3EN9A 5EOBA 1SZMA 5EOLA 5KMJA 5KMIA 1IA9A 4JR7A 3ALNA 4W8DA 3DBDA 3V6RA 4L8MA 2CNVA 5L6PA 3VBVA 1TVOA 2WU7A 3NW6A 3ODYX 4CKJA 4GH2A 1J7LA 2FO0A 2Y6MA 5GJFA 1YXVA 4U79A 2YWVA 4XX9A 5TF9A 3VUGA 3HZTA 5IUHA 4JQ7A 2OXDA 3FLSA 1OB3A 3E7OA 3UYTA 3WE4A 4MD7E 3JY9A 2OSCA 2A2AA 3BHYA 3HDMA 5KHXA 3HYHA 2GS7A 3A4PA 3Q6UA 3R00A 2PE1A 4MQ1A 2R3MA 5AV3A 4ACMA 4C33A 2XK9A 2ZAZA 3NFGB 4P5QA 4K18A 3ZM4A 3M11A 2BKZA 3P23A 3R9RA 5HIBA 4AU8A 5CU2A 5GIOE 4M15A 4I0RA 4QMUA 4R8QA 2IW9A 3V8WA 4QNAA 4CD0A 5D7AA 3PSCA 2CNQA 5BVKA 4AXCA 2YLFA 3EZVA 2X4FA 3MJ1A 3IECA 5K3YA 3VW6A 2UW0A 4AZTA 3DKOA 4XJ0A 4D0XA 4CXAA 4RA5A 3G15A 2BZKB 2UZOA 3ZFYA 3O8UA 4JQ8A 4EK8A 5DT0A 2X0QA 4FODA 3ZDUA 4ZZOA 3LKMA 2YITA 3PJCA 4C59A 3SD0A 4AQCA 1OVEA 5HU3A 1H08A 4OTDA 3Q2JA 4YJRA 3VQUA 1OBDA 1XBAA 4FSWA 2OWBA 3TEIA 3A7FA 3QQLA 1RE8A 3V51A 3SG8A 1OM1A 4JLCA 4Q5EA 4AN3A 4IWOA 3HL7A 3VF9A 3RVGA 4CSVA 1OPJA 3LFEA 3TXOA 2GDOA 2CDZA 2PUUA 2ZMCA 4W9XA 5CF4A 3L8PA 4KKGA 3TUBA 3TNWA 3SQQA 3FQEA 4XG7A 3WYYA 5JFSA 5TO8A 3T9TA 5I9VA 3VAPA 2CKQA 1OGUA 2FVDA 3QC4A 3GGFA 3GC9A 4BBFA 4E4MA 4O0VA 4AQKA 4Y46A 4AAYA 2OIQA 4U3YA 5EW9A 4IAKA 4R5YA 5AUZA 5HX8A 4FTNA 4CV9A 2XP2A 3IW5A 4DGLC 5J8IA 3OG7A 5AV1A 2HCKA 4G9RA 2PPQA 3VS3A 3FSKA 5DBXA 5E91A 3G9NA 1ZMWA 3C7QA 4QMWA 3IO7A 5HCYA 3SG9A 4AGUA 1UNGA 2PVHA 4DFZE 3F2NA 4S2ZA 2PVYA 1Q41A 2W5AA 2VX0A 3KXMA 4IDTA 4O1OA 2X9EA 5EH0A 4BB4A 2QNJA 4EK4A 3LLTA 1F3MC 5J7HA 3MY1A 3E8CA 4GMYA 1ZRZA 1WFCA 5AP4A 2WMSA 4M84A 1SM2A 4WSYA 2EVAA 4DBXA 3UNJA 4CCUA 1OIUA 4I5CA 5AAFA 3JPVA 2X0OA 2CHLA 3FSFA 3BYMA 5DEYA 4IFCA 5EG3A 4JR3A 3FPQA 5CZIA 2PMIA 4F6WA 3KXNA 4KS7A 1BMKA 4RLLA 2JEDA 4NCTA 3TJCA 4CZYB 2WTKB 3AD6A 3BV3A 4M69A 4GT4A 4FSNA 3ZDIA 1PW2A 4HVSA 2JC6A 4D2WA 3EN4A 4DLJA 4GJ3A 2HOGA 2XIKA 1KE9A 4IB3A 5ETAA 5B2KA 4KUJA 3BIZA 3EQCA 5L2WA 4PWNA 3NX8A 4AOJA 4FKLA 3DV3A 5LVNA 2ZM4A 3R6XA 3BHTA 5LOHA 3AMAA 3CPBA 3SW7A 5IQIA 4KSQA 3ZZWA 1AQ1A 2C3IB 2ERZE 4UWCA 4YTFA 5JKGA 3QC9A 3I60A 2FSLX 5CAVA 5E8TA 4EH7A 2YCSA 3H10A 2PZ5A 4RQVA 4FV1A 4NZWB 4FV3A 4OTPA 3MH1A 4ASZA 4A9SA 3U87A 3ZO1A 4M7IA 1LP4A 2YCQA 4BWPA 3D5UA 4YP8A 3EL7A 3EZRA 3CIKA 3F3VA 1XH8A 3KFAA 4RX7A 3WF7A 1URWA 1LEZA 4DDGA 3GEQA 1TQIA 1XWSA 4C3FA 1S9JA 1XMLA 4LDTA 4NUSA 3KF4A 2IW8A 4C4JA 1ZXEA 3D5XA 3PSDA 5IQBA 4CEGA 2BRHA 4AX8A 4UXQA 3BELA 3FL5A 5HBEA 2J5EA 4R3RA 4ZY6A 4AT4A 4F0GA 4EQCA 4FZFB 4O4CA 4AGCA 3PIZA 3P7AA 5DIAA 3FLQA 4RRVA 2JIVA 2R3IA 2ZM1A 3DDPA 4R7BA 3KEXA 2PULA 2H96A 4H3QA 2VTPA 3OUNB 1DI8A 5EFQA 1P2AA 4FRFA 4TN6A 4X2NA 1H27A 4ZJIA 4WG5A 3EQBA 3NUXA 1OMWA 3M1SA 4HGSA 3BGPA 3N4TA 3FKOA 3D9VA 1URCA 2OXXA 2YIYA 4K77A 3FLWA 4U3ZA 1B38A 2G1TA 4E73A 3O50A 3EFKA 3A2CA 3BLQA 3LCDA 3SW4A 3FPMA 4ZSJA 3FZPA 5DMZA 5GZAA 4IQ6A 4I21A 4KKHA 3W0QA 4G3GA 5B2MA 4M66A 3G5DA 2YIRA 3ENHA 3CKWA 2ZV2A 5CU3A 3ZLSA 4FL3A 5CSPA 2CLQA 3DKGA 4XOYA 5LCJA 3KU2A 2QOCA 1M2QA 1NVRA 2AYPA 4NWMA 4DHFA 3UDZA 2XYNA 3HUCA 4GG5A 4PPBA 4TWPA 3Q4TA 5L6WL 4EHGA 4EOLA 3ATSA 3R02A 3ALOA 3HMMA 1FQ1B 5EW3A 3N4UA 4ANBA 4E8AA 4RX5A 4EZ7A 3FAAA 5HVYA 4FT5A 3U4UA 3AT2A 5HTBA 3PUPA 4ERWA 5CEIA 3IDBA 4OTHA 3IGOA 5L4QA 4QP8A 5L6OA 3GC8A 4UY9A 3L9LA 3VRYA 3PXYA 3ORTA 2W7XA 4PPAA 5HE3A 1GIJA 2R3JA 4TNBA 5FXSA 5LMBA 1IAJA 4XS2A 3GCPA 3S4QA 4O7RA 5HTCA 4X3FB 3RHKA 4UZDA 4EH5A 3D94A 3LJ2A 4ZTLA 3BWFA 3ZTXA 1LEWA 5F95A 3PRFA 1KV2A 3OS3A 4FIGA 4IMYA 3NCZA 4BCNA 3PSBA 4OAVB 2YIWA 3UJGA 4DGNA 5DR9A 4DEBA 3BYSA 4V01A 3UZPA 3UNKA 5IQAA 2GSFA 4KIKB 3I5NA 3BV2A 2JDRA 2QO7A 3FMDA 4F1TA 1V0OA 1OPLA 4FKTA 4FZDB 2BRNA 1F5QA 5DPVA 4HPUE 3RK9A 5FXRA 2UW9A 2B52A 3OFMA 3ULZA 4GK4A 1WVYA 3ZXZA 4ASEA 4EOIA 3G33A 1X8BA 5HU9A 5CX9A 4NIFB 3V5PA 2HY81 5HKMA 3V3VA 2GNLA 5DHJA 4HGEA 2PZRA 2WTCA 1UU3A 3BHUA 3ZSGA 3ZHPC 4FEUA 4IXPA 1FPUA 3MVLA 5F20A 2W1EA 3PFQA 3VO3A 3F9NA 2Q0BA 3FV8A 5E1EA 3P5KA 2XEYA 4P7EA 3TKUA 3HAMA 3ZM9A 5JSMA 3OD6X 3B2WA 3MYGA 3EYHA 3DK6A 3WZDA 3LFNA 5ETCA 1KE7A 2R3LA 3AGMA 3V5LA 3C4CA 4W8EA 3UQGA 1P4FA 2JGZA 3CP9A 4ANSA 4FUYA 1OKZA 2UZWE 4AAAA 4AW1A 2GNHA 3VJOA 2G15A 5KUPA 4XMOA 3BWJA 1RJBA 2R3PA 2CGXA 3E93A 4KBAA 4QDVA 4CFFA 1IASA 3O8TA 2WMBA 1TQMA 4DEEA 1MRUA 4BKZA 3OBGA 2IVSA 1W2CA 2W1GA 4PMMA 4IVCA 3EQDA 3T8OA 3TV6A 4RMZA 1PXNA 4FTRA 5JGBA 2VO6A 3LPBA 4JBVA 1YOMA 3GBZA 4BGQA 2WD1A 4JG7A 5M4UA 2Q83A 4M0YA 5KKRB 3FWQA 3UC3A 3BCEA 4IX4A 3VUTA 3QBNA 3ZH8A 4AWIA 1XH5A 4CFMA 5FWKK 4E5WA 4DTAA 3PXFA 1Q61A 1YXXA 2PY3A 2JDOA 3ZXTA 2ZDUA 2C0OA 4DAWA 4AA4A 3R8LA 5EYCA 2W5BA 3KGAA 4FOBA 4RSSA 2WOTA 5AIRA 1UNLA 3PXRA 4CQEA 3BRBA 4WBOA 3VS7A 3VS6A 4ANNA 2PMNX 3NAXA 2NNWB 4O83A 1PMEA 2OU7A 2BRBA 3EHAA 4ZSAA 1W98A 3L8VA 4JNWA 3GQIA 2FUMA 4O7VA 2XIRA 5ETFA 3OY3A 4F7JA 3EB0A 3G2FA 3SVVA 3K3JA 4RGJA 3MPTA 5HE1A 5IPJA 3W0NA 4JIAA 4NH1A 4Z3VA 1H1QA 2WGJA 3FXXA 3PE2A 2YCRA 5C27A 4K9YA 5LXMA 3ZS5A 4CMTA 3A99A 3LMHA 4QMNA 2KULA 2Y4IC 2E9NA 4UYAA 4AZFA 4WNOA 3RMFA 1CTPE 2WQBA 4G1WA 4FK6A 3H3CA 3TL8A 1G8SA 2B9HA 3EKKA 4Q2AA 5M4FA 3LXPA 3UPXA 3ZZEA 2X7OA 4RWLA 2ITOA 3ZEPA 3UIMA 1T45A 4C4EA 3ORKA 3DCVA 4QQTA 4MNFA 4XNEA 3V04A 4BCIA 3HA6A 4EONA 4Z9LA 3ZRMA 3RTPA 1XKKA 4TYGA 3W8QA 2YWPA 3B8RA 4F64A 2GCDA 3QF9A 3D0EA 4G6OA 4L45A 5TR6A 5HG5A 2DUVA 2Y4PA 3NUUA 4FKGA 4IIRA 5EHLA 2CNUA 3SGCA 4EH2A 2JBOA 4OTGA 4UMQA 3SRVB 4A06A 4EK5A 4BI2A 2X0GA 3HRBA 1YOJA 4V0GB 3F7WA 3NW5A 4QMPA 3ACJA 2E9VA 3AT3A 2A27A 2HW7A 4D1XA 1CDKA 3ID6C 4ZS0A 4DE4A 3A7JA 5KMOA 5FBOA 5AR8A 4YJTA 2W5HA 4JDHA 3PG1A 2OBJA 2ZB1A 4DEHA 1TFFA 2XJ2A 3THBA 5EI2A 4O82A 5IDPA 2C3KA 4L52A 3ZBFA 3NUAA 1NVSA 5DYJA 4XV2A 3ORPA