3ODZX

Crystal structure of p38alpha y323r active mutant
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
350
structure length
335
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLAVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPRDQSFESRDLLIDEWKSLTYDEVISFVPPPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Active mutants of the TCR-mediated p38alpha alternative activation site show changes in the phosphorylation lip and DEF site formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 92
structure length 335
sequence length 350
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2010-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3odzX02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3odzX01
4IADA 3H10A 5FXRA 4D9UA 3RTPA 2BAQA 5KKRB 5AR7A 2Z7QA 5E8UA 3T3UA 1KV2A 5M4CA 3PP0A 2W7XA 3MB7A 3PYYA 3FHIA 4AT3A 4RJ6A 4U0IA 5AIKA 2OKRA 4ZJIA 4ZSEA 1JBPE 4YJOA 2X4FA 3ZO2A 3GP0A 5AV2A 3WIGA 5ANDA 3R9NA 3V51A 4UZHA 4ACMA 3DTWA 4FZ7A 5AAEA 1OL5A 4X2KA 2WGJA 4ASZA 5HG8A 1FMOE 2UVXA 4WHZA 5M09A 2Z60A 4TL0A 5AR4A 4CFUA 2W5HA 4IVCA 3Q04A 2FVDA 2XRUA 3RHKA 2QHMA 5KMOA 1LEWA 4PMPA 2W06A 4I0RA 2YISA 3OZ6A 2EWAA 4W8DA 1MRUA 5JT2A 1O6LA 5AUVA 4EOPA 4HPTE 3PRFA 4S31A 2C47A 4YZ9A 5J9ZA 2XNOA 4JBPA 4NK9A 2UUEA 2IZUA 4WRGA 5L2TA 3ZFMA 4LG4A 5DFPA 3UVQA 3KMWA 5CTPA 2QURA 2Z2WA 1ZWSA 4LL0A 3CIKA 5DPVA 4EYMA 3WZJA 4APPA 5DEYA 5CAPA 3L9MA 4ANBA 5AAFA 4AW5A 3VHEA 3CBLA 3IGGA 2RGPA 2XIZA 2AYPA 4FNXA 4JOAA 5DEWA 3WILA 4BFMA 4BCPA 5K0XA 3QKLA 3I1AA 3SW4A 4F4PA 2EU9A 4AW2A 1PXKA 3GENA 4CFXA 2PL0A 3LCSA 3QD4A 1LPUA 2VV9A 3IONA 2EXEA 3VQUA 4CZYB 4CZTA 4QNAA 3VIDA 3UOJA 1ZYJA 4WNKA 3LQ8A 3BYUA 3HYHA 1XR1A 1Q5KA 3IW6A 4NW6A 4WD5A 1H28A 3P23A 4C2WA 1QPCA 3DY7A 4YLKA 4BKZA 1OITA 2W96B 5CQUA 5HD7A 3TM0A 2ITZA 4AT5A 4N0SA 4CYIA 2YFXA 4EC9A 3A60A 4E1ZA 2XYNA 3CY3A 3RCJA 1GZKA 3UGCA 1QMZA 3PJ2A 4HNFA 3UOLA 3POOA 3BWJA 1PKGA 3QF9A 4TKSA 2W4KA 3RM7A 5LVOA 4U3ZA 3IOPA 4XMOA 1J3HA 2P3GX 3BRBA 5CU4A 2XB7A 3KQ7A 3EOCA 4MWHA 4ZMFA 5E9EA 5FLFA 2VRXA 4JS8A 5EQPA 3KULB 4X3JA 2BRGA 3QWKA 4FF8A 4ITIA 5B0XA 4R3RA 3HLLA 4GK2A 4KRCA 2A4LA 1M7QA 2KULA 2ZAZA 4AZFA 2BZJA 5FDPA 5JH6A 3AT2A 4DF3A 4HGTA 4QMYA 1MQ4A 4BTJA 3DJ6A 3FWQA 2HENA 4DH8A 5HBHA 3ATTA 2BDFA 4AS0A 1KE5A 4Y73A 2XS0A 4FIGA 4JI9A 4J71A 4O7WA 3PJ8A 3VWAA 5F1ZA 1U5QA 2PMNX 1Y8YA 3A8XA 3QXOA 3N4TA 3O7LD 3B8RA 3DTCA 4TYGA 4O1OA 1WBNA 1ZRZA 4ZSJA 3S4QA 3V5QA 4QD6A 3ZRKA 3O7LB 4DFZE 4FSWA 4LOPA 3RAHA 1ZOHA 3KA0A 3QKMA 3HV4A 3GQLA 5D7VA 5J1VA 3BV2A 1JQHA 3CCNA 4DEDA 3HDMA 4HVIA 4NL0A 2XCKA 4CFVA 4R78A 2WU6A 3NMUF 3LKMA 3I7CA 5HVKA 2QOQA 2Y8OA 5CVHA 2VNWA 4ALVA 1HOWA 1JVPP 4GV1A 4S32A 1URCA 4KIKB 4ID7A 5C8MA 1SVHA 5JEBA 4JT3A 3OT8A 1A48A 4YTHA 4ZLYA 5CSVA 2P2IA 4BCFA 2BIKB 2BR1A 3VF9A 4HNIA 4DCAA 4R7IA 1YDSE 5CYIA 4ZSLA 3OY3A 3D7ZA 3IG7A 4FTNA 2YWPA 4I5MA 2X8EA 4DC2A 1PRYA 3SXSA 4GCJA 2OW3A 3L8XA 3BE9A 2R0UA 3R7VA 4M0YA 3EL7A 3H0ZA 3UIBA 3SD0A 4IZ7A 4MD8E 2QOBA 2ZB1A 3C13A 4YO6A 3VVHA 3QC9A 2H8HA 4LGDA 3T9TA 4RWIA 4U41A 2WMVA 5AA8A 3GUBA 3EKNA 4FSQA 4GYIA 2F57A 2XUUA 5AV3A 4MH7A 3R7YA 4RA4A 4IWOA 3F88A 3RALA 3IW5A 2WD1A 2R3GA 3FBVA 3OOMA 4XLVA 3ZDIA 1H0VA 2F4JA 4GT4A 4KBCA 3A2CA 4OGRA 3EFLA 1ZARA 4GT3A 4KIOA 4FV1A 3RWQA 1Q62A 5HNBA 3RM6A 3OXTA 2R3OA 3RPVA 3OUKA 3ET7A 2YABA 4XG2A 2GFCA 4GK3A 3PXKA 2JDTA 4D55A 4E4MA 4MKCA 3JY0A 4DBNA 1GAGA 4K11A 1HCLA 3Q5ZA 4NFMA 4FYOA 3R9DA 4RLLA 3RINA 4FKTA 5T3QA 1MQBA 2P0CA 2IVUA 2BFXA 3HECA 4OBPA 4W4WA 1TQMA 4BGGA 5IEXA 5K3YA 3C4CA 4GJ3A 2YCSA 2J9MA 3LXNA 3V8WA 4EWHA 4AFJA 2ITQA 5LCKA 3HGKA 3VRYA 3G9NA 4XCUA 3NIEA 3DFCB 4JG6A 4MWIA 4IB3A 4RFMA 4ZTSA 3VHKA 3EYGA 3RPOA 4QPSA 4DG2E 3L1SA 4DTAA 4YTIA 5AV4A 4DAWA 4FTOA 3ZOSA 4PTCA 5LMAA 2QR7A 3MFRA 3PFQA 2VTNA 2ITPA 3RWPA 3LW0A 4JQ8A 5HCZA 3R7UA 4L00A 4W8EA 4EHZA 4BYJA 4MQ1A 3DBFA 3OBJA 4FV6A 1OL6A 5IU2A 2XZSA 3OWJA 5IH6A 4MF1A 4FTRA 5IH5A 3O17A 2OO8X 4LV8A 5M51A 3QCYA 4KAOA 4G2FA 4RWJA 5LARA 2G15A 3WYYA 2W1CA 4CYJA 5JGDA 3SV0A 2IVVA 3BEGA 2XKCA 3NIZA 2WEIA 4IAFA 5AV0A 3S2PA 3OOGA 4FTAA 2VTMA 4BWPA 4G3GA 1YI6A 3NYNA 3AT3A 5JRQA 3LFAA 4K6ZA 4D5HA 4FIIA 3ZFYA 4I1ZA 5HNGA 2YLEA 4FT9A 3DB8A 3C4XA 1PXOA 5FXSA 3Q96A 4IFGA 3UQGA 5FG8A 5HG5A 4FT7A 2W5BA 4F1OA 2HZIA 3OG7A 3R2BA 1YKRA 5M08A 3IW4A 4XV3A 2GS2A 2V22A 4E6CA 3QQGA 4NSTA 3HRCA 4MNEA 1FVTA 4ZTNA 3TL8A 4Q5HA 1GOLA 3OCBA 3UIUA 3LFDA 4KABA 3ORIA 4FKQA 5IQCA 4MD9E 1RW8A 4Y5QA 3R8MA 3C1XA 3FLZA 1TKIA 2XK9A 4OBOA 3SDJA 4XG3A 4DG3E 3BWFA 3BQCA 2O65A 3DQXA 4RIOA 4L6QA 1G5SA 2ITUA 2OXDA 3L9PA 4PP9A 5AV1A 1O6KA 5A54A 4NH1A 3QD3A 3Q9XA 4CMOA 1OZ1A 4O2ZA 3FY0A 2HWPA 2FSLX 4AU8A 4CRLA 4OTWA 4MXXA 3CKWA 3SLSA 5FGKA 4BDCA 1H1WA 1WBSA 4BCNA 1M2PA 3KN6A 4QMSA 4M15A 3ZLSA 1JWHA 4JG7A 3IOKA 4UBAA 4ZTQA 1SNXA 4Z9LA 2VO6A 1JKSA 4ZP5A 5AADA 3UO4A 3KC3A 5CZIA 5IQGA 2I0EA 4LV5A 3KF4A 5HTIA 3HUCA 3K3JA 3P7CA 4OT5A 4U3YA 3NW7A 3R30A 1SYKA 5IA2A 4BL1A 3QZFA 3HEGA 5AX3A 5IQHA 2JKQA 3QRKA 4QMQA 4EK8A 3CQEA 3O51A 3SOCA 2GNIA 1LP4A 1PMVA 4FEQA 4HZRA 3ZZWA 1WVYA 3MH1A 4HOKA 4JQEA 2XM8A 5EFQA 4IANA 3TIYA 2VO0A 1OUKA 3DLZA 5FM2A 3I5NA 5C8KA 4F6UA 4YPDA 4KS7A 2PE1A 4QQJA 1P4OA 5LCJA 4I6HA 4E6QA 3MESA 2ETMA 4XV9A 3MDYA 3D9VA 5E1EA 4FIHA 2JC6A 3VS6A 1Q97A 4RZVA 2VWWA 3HV5A 4MXYA 4RQKA 3RPSA 1M17A 2W05A 3MTLA 4ZZOA 1VJYA 3LJ2A 5CWZA 1YXXA 3ORNA 2ZB0A 1YI4A 5EYCA 4G6OA 1PY5A 3R0TA 4FV5A 3G6GA 3T9IA 4AACA 2WMXA 4EH5A 2I0HA 1B39A 3V5JA 3R7OA 4K2RA 4N4SA 4NFNA 3R8PA 4C38A 5LWMA 2RG5A 4ANOA 2BHHA 2C3JA 2PMIA 4J8MA 1Y6AA 4CKIA 2ONLA 4FKSA 3AMYA 3Q32A 1KE8A 4JLCA 4KIKA 3W18A 2JAVA 3BU5A 4S34A 3VS0A 3UYSA 2WIPA 3SG8A 4BWXA 3AT4A 3R8UA 4AF3A 3AC3A 5DT4A 5AA9A 4C2VA 2JGZA 5HU9A 2XP2A 4YJNA 3DS6A 3ZC5A 1SM2A 2F49A 3D5UA 2BIYA 5B2LA 5IPJA 4A9UA 3CTJA 4U6RA 4JRVA 4RJ4A 2VWVA 5HIBA 2GNGA 2VD5A 3OS3A 3PZEA 5JFVA 1Q61A 5GNKA 3C5IA 5KMLA 4U5JA 3ZRMA 4CCBA 3RP9A 3TNIA 2JDOA 2WMBA 4C37A 3HUBA 4FBXA 5CSWA 2EB3A 1PXMA 3QGWA 3S00A 3BLHA 5FTGA 3F3UA 4L7FA 3C7QA 1FMKA 5IA4A 4O82A 5EKNA 4JQ7A 3ZUTA 5TF9A 4ZY5A 4QO9A 2I6LA 3OUNB 3TXOA 2XK8A 2E9NA 4WO5A 3QU0A 3ANRA 2B4SB 4ALUA 4EH8A 2WEVA 4LYNA 4HVDA 4AWIA 4EZ7A 5KMKA 2NPQA 4OTFA 4BC6A 4IZYA 4X7QA 4RJ5A 4F99A 1H24A 2V7OA 2G9XA 3OTVA 4I5CA 3F2RA 3QUDA 3IQ7A 4FKPA 4LRKA 4RSSA 4X3FA 2VO3A 3C4ZA 3CLYA 3PIZA 3W2RA 2W4OA 4KS8A 5HE1A 1PYEA 4U79A 4DGGA 3Q2MA 4FSRA 4K8AA 5A4TA 2WU7A 3AG9A 3UYTA 2Q83A 5IMEA 4FMQA 4ORKA 5M4FA 3U9NA 4CT2A 3GOPA 5CASA 1GIHA 2PWLA 3KRXA 4QMUA 1J91A 4NCTA 4RBLA 1FBNA 1UWHA 2CHLA 5HHWA 3R9HA 2HZNA 3LQ5A 3AC8A 3LFQA 4QNYA 4UWYA 5H9BA 3LLTA 3N51A 5AX9A 4C4HA 4JBQA 4IWPA 4ZTHA 4O0VA 4YLLA 3TWJA 5CY3A 4WKQA 4CQGA 4HCUA 3HMPA 4JXFA 2X1NA 4BTMA 4D2WA 5JGAA 3QQLA 2QQ7A 4YJPA 4F9BA 3CR0A 2QOIA 1H26A 1ERKA 2ETKA 4FVPA 3TJCA 3I6UA 4DITA 1SNUA 3POZA 3GCPA 4YGAA 4AZWA 3W2QA 5CS6A 3TV6A 4GG7A 4BDAA 4EK3A 5AUYA 2CGWA 1J1CA 4Q9SA 5CEPA 5IQIA 2GHGA 5CU2A 3V6RA 4ONAA 4JBOA 2GNJA 3PJ3A 4IM3A 4ANSA 5M07A 2EXMA 3AD6A 1XH9A 4B0GA 4EKKA 4ZZMA 2JKOA 2PHKA 3NYVA 3GB2A 4TTHB 3DNDA 1EH4A 3C0HA 5E8TA 2B53A 4WT6A 2VTJA 4I92A 2C6DA 3EN4A 3DDQA 4ZS4A 4IXPA 3PXZA 3EN5A 5IA1A 4QMMA 3QTWA 1OGUA 2QOFA 2ERKA 4GUBA 5HI2A 4AOJA 5L8LA 4L68A 5KO1A 5BYLA 4BIEA 3NPCA 3FSFA 2FA2A 3GVUA 4C4GA 2PYWA 5C1QB 2ZM1A 3R7GA 5JMSA 2BAKA 3PRIA 4LGHA 2WNTA 1NVSA 5M57A 4J53A 4FV3A 4IVBA 5J5SA 5I4NA 1A06A 3VW8A 2PVFA 3CQUA 5ETCA 3WF6A 3UNZA 5BX0A 2AC3A 3OY1A 3RAKA 3FXWA 4G5JA 2FSTX 3VQHA 3WF9A 5HO7A 4QMXA 3TUBA 3FZOA 4XP3A 5CSHA 2R3MA 4WA9A 4TXCA 3VULA 5A4QA 4MTAA 1YW2A 2HXQA 2VX3A 3BYOA 3F3TA 3GC9A 2ITYA 4G34A 4LUEA 3RK9A 3ZEWA 2C1BA 4O7YA 4F1MA 2E9VA 3QHRA 4AW1A 2XH5A 5CVFA 2DS1A 2YIRA 1XBAA 2C69A 3MIAA 2XNNA 3ITZA 1JOWB 1M2QA 3QYWA 5HGIA 5C8NA 3OP5A 3NNXA 3L8PA 2C5YA 4LMNA 3RAIA 5LMBA 4QMNA 4RGJA 3UO6A 3Q5IA 4BIDA 2ESMA 2EUFB 3FPMA 3BEAA 3QRUA 5A9UA 2GQSA 3TNHA 5EW8A 2QG7A 1JAMA 1OPKA 3LXLA 4NM3A 3UO5A 3GU7A 3MA6A 2BZKB 2Y6OA 3CPCA 3E62A 3TZ8A 2ZVAA 5BYZA 2R0IA 3ORLA 4J98A 3ZFXA 3DT1A 4IE9A 4PNKA 4H1MA 4F1TA 3WZKA 3DFAA 1H07A 2ACXA 5H3QA 4CMTA 4MBJA 1W84A 4IM2A 3D7TB 4OTPA 3ZHPC 3Q9ZA 1WVXA 4RC4A 3EH9A 3LMHA 4M8TA 4IVDA 5FEEA 3EQIA 3OHTA 1SVGA 1V0BA 4PV0A 5EK7A 3TNWA 3VJOA 4EBWA 3V3VA 4GT5A 4BDIA 2J6MA 4IHPA 2ITOA 4HCVA 2OJJA 3I0OA 1JLUE 3FMMA 1KWPA 1URWA 1TVOA 4PPBA 4EK6A 3VS4A 2YIWA 4P4CA 5CSPA 3DDPA 1OM1A 2V0DA 1XWSA 3MWUA 1P4FA 2CNUA 1ZZ2A 3VW6A 5GZAA 4KUJA 2B1PA 3HMMA 2LGCA 2YM4A 1F0QA 2EB2A 3FAAA 3IW8A 5HKMA 4BTFA 2W99B 3E8CA 3REPA 2DYLA 4D2PA 1FQ1B 4UALA 1PKDA 2VTHA 1G8SA 4I22A 4PL4A 5LVNA 3MVLA 4FK3A 4TW9A 2HW7A 5CQWA 4Z3VA 4P5ZA 4JG8A 3K54A 3O8PA 4CD0A 1VEBA 2WMSA 2GS6A 4F9AA 1O9UA 2Z8CA 4YNOA 1M52A 5HOAA 4DEAA 1OL1A 1DI8A 2CN5A 2X9FA 3IECA 4EJNA 2PVKA 4UEUA 2QNJA 4U7ZA 5AR8A 3FKOA 1K3AA 3MPTA 4NM0A 4NYEA 2ZMDA 3FMEA 3I79A 3KCFA 3F3VA 4R7HA 3W32A 3PUPA 2R3IA 5CEKA 1B6CB 2OK1A 3EIDA 2GCDA 1R0EA 3C51A 4JRNA 2BRMA 4R8QA 4M67A 5A46A 5KMJA 5L2WA 4O2PA 2BPMA 4EOKA 5HO8A 4JAIA 3GOKA 4BCIA 1GIIA 2ZV2A 4D4RA 3K2LA 4IJ9A 3MW1A 4O7NA 3SGCA 3R2YA 2R64A 2Q0BA 1OKZA 3LZBA 4LOQA 5HU3A 3DV3A 3ZBXA 3D83A 1OVEA 2OSCA 2YJRA 4I0SA 3NWWA 2XKDA 2VWXA 2R3JA 5EDQA 3R7EA 2YIQA 5DHJA 5BQ0A 3A7JA 3R8ZA 1REJA 4XV2A 3PY0A 2YIYA 4O91A 5B7VA 5DR2A 5IA0A 4H36A 4EH2A 3VS5A 2VWUA 3LLAA 2Y4PA 2W9ZB 3LFFA 4QQTA 1IG1A 3ORTA 3TTJA 2I7QA 3I7BA 4K77A 2XEYA 4A9TA 4JDHA 4JJRA 3VUKA 4D1SA 1UKHA 3WZEA 5LMKC 4N57A 2ZOQA 4E6DA 4AT4A 3KFAA 5CEQA 3OCGA 2FB8A 5J87A 5CU3A 5AAGA 2JIUA 3CKXA 3QTRA 4QYEA 1UVRA 3OTUA 1W83A 3PDTA 2YM6A 2Z7SA 3WBLA 2YCQA 2WTKB 2VTOA 3FKLA 1WZYA 3NNUA 3LFEA 2J90A 3QQUA 4GU6A 5K4IA 5L6PA 4APCA 3GQIA 2IW8A 2XA4A 3IDCA 2WXVA 2XIXA 4DEHA 2ITNA 3C4WA 4XBUA 4E5WA 4UMQA 4UB7A 5DH3A 4RVMA 5HG7A 4CT1A 1QPDA 3LM0A 4MBLA 4G9CA 1QL6A 2HY81 4OTIA 3MN3A 3A62A 4MNEB 4MD7E 3MBLA 2XRWA 4L3JA 4OUCA 5ANKA 3GT8A 4BBFA 5EDRA 3P86A 5J8IA 3COHA 3S95A 4WNOA 3NUAA 2GNHA 1UKIA 4DYMA 5I0BA 4XP2A 3FSKA 3UBDA 3O50A 3DKOA 2PE2A 3GCSA 4F64A 3E5AA 5FM3A 1Z5MA 1ZOEA 5F94A 3BU3A 3P9JA 1ZLTA 3ORZA 4F7SA 4OAVB 1R3CA 5CAQA 3LMIA 5FXQA 5BVNA 2PVMA 4R6VA 4RVKA 4FTTA 3RCDA 1H01A 3AC4A 3FLQA 3RK7A 4A4XA 2GDOA 4BIBA 3QCXA 4PTEA 4C7TA 3OT3A 4EYJA 4O86A 5F9EA 1M7NA 3U54A 1H1SA 4G6NA 4MXZA 1S9IA 5TT7A 3NUNA 1A9UA 4O21A 1DS5A 2IO6A 5FEQA 2BTSA 3HP5A 5GJGA 5TE0A 4IAKA 3FPQA 3HZTA 3PVUA 4YJQA 4C02A 4CKJA 2UZLA 2UZDA 1BMKA 4EOQA 3FZRA 5CU6A 4RFYA 2VNYA 3VC4A 4L9IA 5HZNA 5AUUA 1WFCA 2CSNA 1MP8A 1Y8GA 2XIYA 3DQWA 3NS9A 1DAWA 3OCTA 4PY1A 2QOKA 3MV5A 2QO9A 2ZYBA 4DFXE 4GKIA 2P4IA 2UZBA 2UZUE 2ERZE 1YWNA 5HE0A 4OTHA 4FTUA 1OIYA 5D7AA 4WG4A 5I9XA 1WCCA 4HYIA 5J7HA 2W9FB 4RFZA 4FL1A 1V0OA 3TZMA 5J5TA 2PMLX 3BGQA 3DZOA 5ANOA 4ACDA 3GFWA 2CNQA 4EHVA 3Q53A 2AUHA 4IWQA 2X8DA 4FV7A 4DLIA 1GZ8A 5LXMA 1UWJA 4E5AX 5A6NA 5CAOA 4CNHA 4C3RA 2R3NA 2R3RA 4JDJA 1YOJA 3QTIA 3D5VA 1OKVA 4FKGA 3ZSGA 2JDVA 3PXQA 1WAKA 4CFFA 2WMQA 3DBDA 4I24A 3DAKA 4FTCA 3E93A 4JX3A 5M06A 3FV8A 3ZLYA 2BCJA 4MHAA 3MY0A 4I5HA 4ERKA 3FMJA 4NW5A 5EYDA 4DINA 5BVEA 3AQVA 2X7OA 2CJMA 1ZYLA 4LOOA 4ZZNA 3GU5A 3HV7A 4YTFA 5D1JA 5HLWA 2VZ6A 4TNBA 2BZHB 2Y9QA 3RGFA 4DEBA 1LEZA 1SVEA 2W1FA 3BBTB 1Q4LA 2XNPA 3A4OX 4FUYA 5EKOA 4DG0E 3MH3A 2YCFA 1H1QA 4QQCA 4I4FA 4O7SA 4BDFA 5ICPA 5C01A 5KCVA 3D7TA 2QI8A 1WBWA 5C26A 2E9OA 4RIYA 4E7WA 3QZGA 4WG5A 3QUPA 2PUUA 3QXPA 4TZRA 2O0UA 2P55A 2R3KA 4E20A 4XBRA 4F9CA 4II5A 4C58A 4O6LA 4IX5A 4DEGA 1UU9A 5K5XA 2OIBA 3GGFA 3UZPA 4HPUE 4IJPA 4YJUA 5M4UA 3DGKA 4HJOA 4X6RA 2QD9A 4XJ0A 4D4VA 4C33A 5KMIA 2C4GA 1WBPA 4C8BA 2HZ4A 5EQYA 5GIPE 1IASA 4YNEA 4E3CA 4ZY4A 4FX3A 5BVOA 4MVFA 3HX4A 3VS7A 3PIYA 4BDHA 2YERA 4NJDA 4PL5A 3NUUA 4QMZA 4LMUA 5AWMA 4CMUA 3FZ1A 3P5KA 4IZ5A 3V8SA 2QHNA 3MA3A 2PZPA 4UMUA 3DU8A 3QD2B 3GCQA 4BDDA 5M56A 5DI1A 4QPMA 3SXRA 4DN5A 3HMIA 1NW1A 4LQMA 5AFVA 3WE8A 3M1SA 4BN1A 4EQCA 3M11A 4C4FA 3LE6A 3E7OA 4C35A 4X2GA 4DGMA 3CSVA 3ENMA 1UNHA 3EB0A 3QQFA 1RDQE 1S9JA 4FG8A 2JDSA 1NY3A 1GY3A 2BDWA 4DCEA 2ZJWA 3KKVA 3OWLA 4IDVA 4Y95A 5IUIA 2IG7A 1DI9A 4BI2A 3JY9A 5DT3A 2C1AA 1WBVA 4FKIA 4FGBA 4B9DA 4E8AA 1YWVA 4MXAA 5JFSA 2W1HA 4X3FB 1YOLA 2RFDA 4AE6A 3C4FA 3F2AA 4B4LA 5BUIA 5CAVA 5TOZA 5DMZA 5IQBA 4UZDA 4OLIA 3VUTA 4LL5A 4A9RA 4YSJA 5IUGA 2FSOX 4CLIA 2X2MA 3EYHA 4IFCA 1PXNA 1OPJA 3EQDA 3ZSIA 2OLCA 4TYJA 3R04A 5I3RA 4G5PA 1KE6A 1PXJA 4RIXA 2UVZA 4YJSA 4U80A 4YHTA 5EI6A 2BRHA 4FV0A 2YM3A 4FTKA 4MF0A 5BVFA 3R9RA 5ACKA 3BPRA 1UNGA 2JKMA 4G1WA 4X2NA 2YIXA 1KE9A 3ZUVA 4FSUA 4KA3A 2PE0A 4QP2A 4A4LA 4PX6A 3PVWA 3ELJA 2FYSA 3BBWA 3GBZA 2HIWA 2YAAA 4FTMA 2QKRA 3UOKA 4EOOA 2XM9A 4HVGA 1JSTA 1KOAA 1U46A 2CLXA 3ZO4A 4PUZA 4JL9A 2XIKA 3FXZA 4QTCA 1ZY5A 3MH2A 4NM7A 5AMNA 3HP2A 3U51A 1YDTE 4ARKA 3A99A 2F7XE 1W7HA 3KRRA 4HGSA 2PZRA 4XH6A 3BYVA 4F9WA 1JKTA 3ZONA 5IDPA 3R1YA 4V04A 4XX9A 3NAYA 3Q4ZA 1AQ1A 5IQFA 3BU6A 1DAYA 4HYSA 3R28A 4YBJA 3W2PA 4X0MA 1H27A 1PMUA 5DR6A 2UW9A 3FI4A 3E3PA 2LAVA 4BDJA 3EQRA 5CVGA 4QTEA 3W2OA 5C4KA 3RZFA 4GVJA 3W33A 4FT5A 2PVRA 3D14A 4FT0A 2WTWA 4U9AA 3ODZX 1ZAOA 5C27A 2JLDA 3E64A 4BDEA 2REIA 4QYGA 2B7AA 5HCYA 4XYFA 3GEQA 5LVPA 4U44A 3F3ZA 3VBQA 1B38A 5H2UA 2XYUA 3P78A 5FWKK 2WAJA 3IDPA 5ANJA 4YP8A 3G2FA 3ZXTA 2PK9A 4ANNA 1MRVA 3DJ7A 3HV3A 4KSQA 1GIJA 4QYFA 4F9YA 3G33A 1U54B 4F70A 3NYXA 2XF0A 4J52A 3ORKA 4RX9A 4ASEA 4BKYA 4PDSA 2OZOA 2NRYA 1AD5A 4FKRA 1UU7A 1IR3A 2ZV8A 4PWNA 4FODA 2NNWB 4CG9A 3NNWA 2FSMX 4ACGA 2V62A 3CE3A 4FKWA 4J96A 2XBJA 5FQDC 4O83A 1Q3WA 4CFWA 3PWDA 1J7UA 3HAMA 2XCHA 2BDJA 4MCVA 4ERWA 3WF5A 2WTJA 3P08A 3KVXA 5EM6A 4CFNA 5TKDA 4O84A 2W1IA 3E8NA 4OBQA 1CDKA 4ASDA 2XNEA 4FKOA 5BVDA 3FMNA 1Q8YA 3ERKA 2WQNA 3MVMA 4MAOA 4OR5A 4Y46A 5K0KA 4BWKA 4F0IA 3CGOA 2E9UA 4FTIA 4FVRA 3RZBA 2QOHA 2WHBA 5J1WA 3GC8A 2V5QA 3RBWA 4S33A 4FE2A 4F65A 4WOVA 3VBWA 4BCGA 4WUAA 2X2LA 1Q24A 4RG0A 5AUTA 4ZJVA 4ZK5A 4I23A 2IJMA 3LPBA 4ZIMA 4ZSAA 4F0GA 1H4LA 4DTBA 3C9WA 2JFMA 5DRBA 5L6OA 2YAKA 3F3WA 3VUMA 4I41A 1FPUA 3BHUA 3FMDA 3H9FA 5BNJA 3PIXA 3QTSA 2ZDTA 4JR7A 1YVJA 4RJ3A 3R6XA 1XH7A 4R1YA 2GNFA 3N4UA 4C57A 1Q41A 3QBNA 4IAIA 4BCMA 4QOXA 1OL2A 3ULZA 3NZ0A 2I40A 1H08A 3U9CA 5ANIA 3M42A 3FLWA 5B2MA 4Z7GA 3R21A 5D41A 4YZDA 3UJGA 5D10A 3TJDA 4WUNA 2DWBA 5JZNA 4OTDA 5IISA 1V1KA 1RJBA 4FIFA 4RLKA 3ULIA 1R39A 4O0TA 2A27A 3I5ZA 3ZO1A 4DFLA 2B54A 2XVDA 5AP2A 4UN0C 2B9JA 4FIEA 2XNMA 4FEXA 4KIQA 4Q9ZA 3DB6A 5AUXA 3KXNA 5KUPA 3FI3A 5FTQA 3MJ1A 4TWPA 3QLFA 2QODA 5AIRA 3NGAA 3IPHA 4BCOA 1OIQA 5KX8A 5AP0A 5K5NA 1XBCA 3QQJA 1BL7A 5BUJA 3V6SA 3DNEA 4G3DA 3VUGA 4YSMA 4NU1A 5EOLA 3OWKA 3F5GA 1TQIA 2WQMA 4ZY6A 3ALOA 3RPYA 3Q4TA 4OTQA 4WBOA 5BUEA 4O7LA 1V0PA 1BYGA 2Q0NA 1XH8A 4PQNA 2OWBA 5CU0A 4TYIA 5CLPA 3EFWA 3H30A 3VS1A 3DKCA 1ZXEA 4C3PA 3EN7A 4H3PA 3ZO3A 2VTRA 3A7IA 3OXIA 4NTSA 4QP1A 2UZEA 5EYKA 5JK3A 2YZLA 2R9SA 1KSWA 2WIHA 5EHYA 2ITXA 3MYGA 4QTBA 3TNQB 1YRPA 2PZ5A 3W8LA 3R22A 1L3RE 2QOCA 2X6EA 2YITA 3PTGA 2UVYA 4R77A 4YJRA 2H9VA 4ZLOA 3R63A 4BCJA 4L3LA 3D94A 2VAGA 4UV0A 4EEVA 4EL9A 3UQCA 3MJ2A 5KZIA 4P90A 1H1PA 1U5RA 3WARA 4L3PA 4QP4A 2OG8A 4OTGA 2JBOA 5DGZA 5CENA 4E93A 5HD4A 2JDRA 4W4VA 1KOBA 4EHEA 3FC2A 4DA5A 4A9SA 3P79A 2XK4A 4QYHA 4E6AA 3ZTXA 2VX1A 2Z02A 3QA8A 1P5EA 4RPVA 3ZRLA 3HVCA 2E2BA 4TYHA 1FVVA 3FY2A 3TKIA 3WYXA 3CD8A 5AJQA 3I4BA 3DAJA 1VYZA 5FEDA 1OIUA 5DN3A 3ZM4A 4BR3A 2RFEA 3OVVA 3W16A 4I94A 3QTUA 4QMLA 2J0MB 5HICA 5L8KA 4XHKB 3PPZA 4M12A 2B9FA 3BHVA 3VO3A 5IEYA 3R02A 4UWCA 2OF2A 1W0XC 3MFUA 5L2QA 5KNJA 5DYJA 3PVBA 2R3QA 3R1SA 5A3XA 3HNGA 4DEIA 4RX5A 4HVSA 3JPVA 4A4OA 4ZLZA 1WMKA 3LM5A 4KBAA 2GQGA 1XQZA 4PMTA 3NW5A 2BVAA 4I3ZA 3BLQA 4TRLA 3VN9A 2WMAA 4V0GB 5HCXA 3KXMA 4FVQA 4TYEA 4UY9A 5L2SA 4OTRA 2HOGA 5KBRA 2Z7LA 3E3BX 1KV1A 3PP1A 4NTTA 4QTAA 3NAXA 3KY2A 4L67A 3HDNA 5C9CA 3AD5A 3JS2A 5ANEA 1E9HA 2YDKA 5BVKA 4FSTA 1H0WA 5CSXA 2BKZA 3D5WA 4MXOA 4RIWB 3TV4A 2GNLA 3W1FA 1YXUA 3DAEA 4NIFA 4I93A 4C3FA 5LOHA 4NWMA 3H0YA 5AP7A 4YC8A 3R01A 4F09A 2B55A 4G3FA 5E92A 4GFMA 5EOBA 2G1TA 3BLRA 4QMPA 4XG9A 4AN2A 4V05A 2BROA 1I44A 2OXXA 3S3IA 3MGYA 5HE2A 3L9NA 4EZ3A 3ZUUA 3QTXA 5F95A 4DGNA 3JVRA 3E7VA 2XK7A 2NRUA 1H00A 4AA5A 3QFVA 1KUTA 3G6HA 4I20A 2OI4X 2C6OA 4FSNA 3EZRA 3E8EA 1PXLA 2XNBA 4EH7A 5B2KA 3UIMA 4RX8A 4GRBA 2WB8A 4LI5A 4TWCA 3KCKA 2HY0A 2C6MA 5L4QA 4E4NA 5CI6A 5FP6A 3LJ0A 5DLSA 4XG7A 4AGWA 3SG9A 4AX8A 4DFYA 3HAVA 4YZMA 3GC0A 2X2KA 5CX9A 3EQHA 4BYIA 2IW9A 2JEDA 4BDKA 4DH5A 4FOCA 4EI4A 4BDGA 1XH5A 4BB4A 4MYGA 4YO4A 2VTAA 2ZM4A 3QRTA 3R73A 2YM7A 3BX5A 1U54A 1WBOA 5EI8A 2FUMA 4QP6A 3BYSA 4IZAA 2GTMA 1OUYA 3QZHA 2W1DA 3LFCA 3P4KA 4E4LA 1UA2A 4M13A 4PNIA 2IZSA 2VTSA 5J9YA 1NVQA 4GMYA 5H8EA 4KKGA 2WELA 3OBGA 1ZYDA 2VTLA 4L8MA 2BZIB 4BZDA 3QQHA 4FTJA 2JD5A 3PG3A 2UW6A 3NEWA 5LVLA 1VR2A 2ITVA 4UX9A 3WIKA 4JR3A 2J2IB 4NT4A 2XNGA 4J1RA 3PG1A 2R3LA 4PTGA 4WIHA 4TWNA 3TKHA 5D12A 2QO2A 2OH0E 4UXQA 4NZWB 3C5UA 3LAUA 2VTTA 3LXKA 4FYNA 3KVWA 5HVJA 2NO3A 4O96A 5GJDA 1PMNA 4RA5A 4R5YA 1ZOGA 4Y72A 5TO8A 4P7EA 3SVVA 4FSMA 4GVAA 2O8YA 1J7IA 3CGFA 3PA3A 5IEVA 3FLSA 4EC8A 4K33A 5E4HA 1LR4A 2C5OA 3TV7A 4H39A 2YN8A 3ZXZA 5FBOA 3LMGA 3ZBFA 5CF5A 5HTCA 4GU9A 3U87A 2BTRA 3OC1A 3QYZA 5IA3A 5K4JA 3PSBA 5M53A 4MX9A 3AC1A 2F2CB 3BIZA 5L8JA 3MS9A 2C30A 3WOWA 2OIQA 3R83A 3PXFA 5HTBA 4D4YA 4A7CA 3GNIB 3H9RA 4KIPA 4RIYB 3VS3A 5I9ZA 3CJFA 1CMKE 4XS2A 5EM5A 4BBEA 3UTOA 2O5KA 3PPJA 3SW7A 4CRSA 1PF8A 4HGEA 4KD1A 2VWZA 2ZM3A 3MH0A 4MK0A 5FD2A 5IDNA 5G6VA 2CKQA 2O63A 2VGOA 4FG7A 3ZH8A 4M0ZA 4C4IA 5HG9A 4ALWA 4EORA 2ETRA 5BMMA 3KGAA 2YHVA 3B2WA 4NEUA 3VUHA 3E92A 2UW3A 3KF7A 2IW6A 3A8WA 3GXLA 1L8TA 4FNZA 2PVNA 3PLSA 3SRVB 3O71A 5EM7A 4P5QA 3TUDA 1OIRA 3Q60A 2R3HA 4LM5A 5EI2A 5I9UA 3Q9WA 1Q99A 2GFSA 3CTQA 2XK3A 4M66A 4DH1A 3FMHA 2IPXA 3U55A 3QZIA 3VBTA 1JKLA 2CN8A 2UW8A 3K5UA 5E7RA 4Z55A 4GJ2A 3DBCA 2EXCX 4F63A 2UZOA 4FTLA 4NM5A 2O3PA 4YPSA 3TDWA 1WBTA 4XP0A 4CVAA 4U81A 5DOSA 3HA6A 5A4EA 3D4QA 3UDBA 4D2RA 1GZNA 4PPAA 5EM8A 3LQ3A 3OEZA 3Q4UA 3F5XA 1Y6BA 2J4ZA 2OJFE 5KKRC 3F82A 3KEXA 3U6IA 1OECA 2OFUA 2W1ZA 4GFOA 1M14A 4FKVA 1GJOA 5J79A 4Y5HA 4LGGA 4JIKA 2OICA 1H8FA 2QLUA 2R3FA 4Y85A 5EYMA 4E26A 3EL8A 4GFGA 4M14A 3AMBA 2QOLA 2X7GA 2FH9A 4EOJA 2YM5A 2J0JA 4PL3A 2W0JA 2O2UA 4NKAA 3EQFA 4Y83A 3KRJA 3BV3A 4RIXB 3W2SA 4AQCA 4H58A 4UMTA 1G3NA 3NCZA 3COKA 3UVPA 3HV6A 3C50A 2RIOA 3DKGA 3DBEA 5DA3A 5FRIA 3IK3A 2CCIA 1W82A 4L52A 3BELA 3GCVA 4FEWA 3SHEA 3AC2A 2CCHA 2C0OA 3FXXA 5D11A 2IZTA 1Q8ZA 4ZS0A 3DXPA 4BCKA 2XEZA 3KK9A 5DVRA 4DFNA 3LVPA 2GU8A 3NVKI 2Y4IB 1U59A 3UG2A 4PP7A 4FZAB 4RMZA 3LCTA 4O0SA 5HIEA 2C0TA 3E63A 3V01A 5F4NA 5AUZA 2GPHA 3T8OA 3FI8A 5KHXA 3A7GA 5IQEA 5FBNC 1YHSA 4Q2AA 4AE9A 2JAMA 1H1RA 2VTIA 3EFKA 4PRJA 5J95A 3GU8A 4BI1A 5T68A 1DM2A 4C36A 4UMPA 1UU3A 5JN2A 4G31A 4A9YA 4FL2A 1R1WA 2X0GA 2J0LA 3MY1A 4V0GA 3NDMA 3R8VA 3THBA 2BILB 3BGZA 1UV5A 3Q52A 3V5TA 5JKGA 4GS6A 1VYWA 3E88A 3WF7A 3QX2A 1OBGA 4QMWA 1OKYA 3BHYA 3ID6C 4JDKA 4UXLA 3W2CA 2X9EA 4RIWA 4WSYA 5HNIX 4EQMA 3V5PA 4AGUA 4FIJA 4L7SA 2BALA 3FE3A 2XJ0A 5AEPA 3EKKA 3FMLA 2QLQA 5AR3A 1IEPA 2UW5A 1CKIA 3MIYA 1JSVA 3LIJA 3H3CA 4X2JA 2VWYA 5A14A 1FOTA 1VZOA 2QVSE 3H4JA 2X81A 4BF2A 2V55A 3AC5A 4IX3A 4TNDA 3S1HA 3EFJA 3KXXA 4O0XA 4ANLA 3LFBA 4XRLA 3VBYA 4D28A 4IWDA 1BUHA 2GS7A 2XKEA 3PSDA 4O0YA 2X8IA 4XNEA 3UC3A 4IB0A 5LWNA 2B0QA 2A19B 5A6OA 1Z57A 3NUYA 3B8QA 2W1GA 4PF4A 2QR8A 2UZNA 3F9NA 3OCSA 2CNVA 3JXWA 3BCEA 1XH6A 2PZIA 4YC3A 2AC5A 4FV4A 4IB5A 4OW8A 3E8DA 4QP9A 5T6KA 1G8AA 3UODA 2OZAA 3LCOA 3RNIA 2QU5A 3GFEA 2WMTA 3NCGA 4LRMA 3I81A 5DNRA 3PXRA 5CAUA 4G16A 4TT7A 3KRWA 3O96A 5HVYA 4KINA 3NRMA 2SRCA 4FT3A 4GYGA 3RKBA 1RE8A 4KKHA 4RZWA 5DG5A 2WTVA 3CS9A 4J97A 3CJGA 5AP3A 4U42A 4FZFB 4IAAA 5AP1A 3TUCA 1Q8TA 4DE4A 5HIDA 3ZCLA 2DQ7X 4F6SA 3VUIA 4CKRA 2V7AA 3QLGA 2C3KA 5AM6A 3TT0A 4UMRA 3FMKA 4IBMA 1FINA 1R78A 2IWIA 3R1NA 2PVYA 4KBKA 3TKUA 3UNJA 4D2TA 4Z16A 3JR1A 4G3EA 4W4XA 3UP2A 5E8YA 4JNWA 5JSMA 4QRCA 2BFYA 4I5PA 2YCRA 2YEXA 2GHMA 4C59A 4ZTLA 1Z9XA 4O0WA 2F7ZE 4YUQA 5AUWA 3U6HA 3GU6A 3F7ZA 3FI2A 3NUXA 3DXNA 2ONLC 5CNNA 5EDPA 3EMGA 3F7WA 3V5WA 3U4UA 3ZU7A 4CV9A 2JITA 2PULA 3PLAE 2JIVA 4L45A 5FDXA 3R1QA 3VJNA 3QA0A 3CEKA 4MQ2A 4WNMA 4O81A 1RQQA 3KMMA 4ENXA 2J5FA 2JIIA 3PJCA 1NVRA 4CQEA 4QQ5A 4ZMEA 3FYJX 3R71A 2W1EA 4FK6A 4J99A 3DK6A 4C0TA 1O6YA 3SXFA 2WTDA 4F7NA 2QONA 3MSSA 1F3MC 4U40A 4FEVA 2BUJA 3GI3A 4EBVA 5AM7A 5BVWA 4USFA 1PMEA 1J1BA 3OF0A 5M44A 4M69A 4EOLA 3QX4A 2CLQA 3DCVA 3LFSA 1CM8A 4I6QA 4R1VA 3FKNA 3LXPA 3ZYAA 1QPEA 2BMCA 3ATSA 2YDIA 2XKFA 3BQRA 4I0TA 3UIXA 5GINE 4EH3A 1ZYCA 4DGOA 2W17A 5JFWA 4R5SA 2R3PA 2J0KA 4EUTA 4EK4A 2C6LA 4H3BA 4AZTA 4B8MA 5DBXA 4HW7A 4RT7A 4IQ6A 3PY3A 2PTKA 1BI8A 1YQJA 2R4BA 5TR6A 4EKLA 5CI7A 3MVJA 3MFTA 4I4EA 1BX6A 3AOXA 4G3CA 5IKWA 4CXAA 4U43A 4D5KA 3FLYA 3SRVA 3O0GA 2WOUA 3LJ1A 2B9HA 4X3FC 3MPAA 4GL9A 5ETAA 3QRJA 5CXHA 2OF4A 4IMYA 5CZHA 2R2PA 5DE2A 3FQHA 3SOAA 4K1BA 3T3VA 3DXQA 5ACBC 4V01A 2W5AA 2VTQA 2PVHA 3VBVA 5LVMA 3FC1X 4CEGA 3G9LX 2PU8A 3A4PA 3SX9A 5BPYA 3UNKA 4LFIA 4RRVA 3UQFA 3UP7A 2JKKA 4IEBA 4TYHB 1M2RA 1KE7A 4PDOA 4C34A 4M97A 4IAYA 3C4EA 3DPKA 4NCTC 4WG3A 3SAYA 4CFMA 4E4XA 2J50A 1XJDA 1Y57A 4MBIA 3Q9YA 3MVHA 4ITHA 4TPTA 2GQRA 4O7VA 4CGAA 3DK3A 1OPLA 5CALA 4HCTA 5KBQA 2C6EA 1ZYSA 2HZ0A 3WE4A 4KNBA 1YHVA 1BLXA 4PPCA 4RVTA 1PHKA 1LUFA 3MB6A 3LOKA 3ODYX 3JYAA 4WBBB 3FQEA 3CQWA 1PW2A 3EHAA 2W4JA 3ZC6A 4FKJA 3VS2A 3UPZA 4O7TA 4BY9E 1E1VA 3KXHA 5E8ZA 2C5VA 2UZWE 4C62A 4ZTRA 1QPJA 2WFYA 2WMRA 3KU2A 4G6LA 4D9TA 3G5DA 4YJVA 1W98A 5FTOA 5KE0A 3RJCA 1FGIA 1XBBA 2HAKA 4NIFB 1Q8UA 2UW7A 4HVHA 2QOOA 5CEIA 2F2UA 4IB1A 3COIA 4RWKA 4C4EA 2PUPA 4HYUA 2J7TA 2YLFA 4TY1A 4BCQA 3Q4CA 3FQSA 2CKPA 2OH4A 3OW3A 4BBMA 4AOIA 5CT7A 2HK5A 4L53A 3U4WA 4WNPA 2ITTA 2R5TA 4G17A 4S30A 2J0IA 4NUSA 4GUEA 2QC6A 2RKUA 2XJ2A 2Z7RA 5L3AA 1IA9A 3OFMA 4YHFA 5HEZA 4BGQA 4DTKA 5IZFA 1P14A 4UWBA 4O38A 4YC6A 3NW6A 4R7BA 3CP9A 2JFLA 4FOBA 1NA7A 4O7ZA 1ZMUA 3FZTA 4QTDA 4AOTA 2X7FA 1PYXA 1YHWA 4CTCA 1HCKA 3F2NA 3ZSHA 5M4IA 2VTPA 3QHWA 2OIDA 4IX4A 3WZUA 5CEOA 3OD6X 3KB7A 5EHOA 2YJSA 3DK7A 4ZSGA 4RJ7A 3PA4A 2I1MA 4BHZA 4YZCA 3IS5A 5A4LA 5JZJA 1OL7A 1YXSA 2OJIA 2RSVA 1H25A 4IDTA 3O23A 5BMSA 2PSQA 2QCSA 4IM0A 3FHRA 4PDYA 4AN9A 4O0UA 3KREA 5IQDA 4YLJA 4FKUA 2CKOA 4DBXA 3GCUA 4EQUA 4WRSA 3PSCA 4FC0A 4ACHA 4FGRA 3NNVA 4QP7A 4IC7A 4DGLC 2UW0A 4CSVA 2VWIA 4F08A 1BL6A 2PUIA 2DUVA 2C3LA 3O8TA 4W4YA 3F5UA 3OWPA 4FG9A 3TIZA 5GIOE 4RC2A 3TCPA 2J5EA 1YDRE 2A1AB 2GMXA 5GZ9A 5LMKA 2OXYA 2YZAA 4G9RA 3QL8A 4FNYA 3UOHA 3Q6WA 2OBJA 3F6XA 2ITWA 5HO6A 1PJKA 1TQPA 4H1JA 3FZPA 4LRJA 5CF6A 3DZQA 3QTZA 3MPMA 5E91A 3OMVA 5H8GA 4F6WA 2ZMCA 3RPRA 4C4JA 2PVLA 3U6JA 5CF4A 2IVTA 4JVGA 4IW0A 3GC7A 4M68A 1E1XA 4N70A 4TN6A 2OU7A 2YDJA 4FKLA 1QCFA 2CMWA 3AMAA 4OT6A 4ZTMA 2XBAA 2G2FA 5HX8A 3P7AA 2C68A 3FJQE 5I5ZA 4QMVA 3RAWA 1T46A 4KRDA 3F66A 2GTNA 4D0XA 4GEOA 4EH4A 5J9LA 3EQCA 3UZRA 3WZDA 4O0RA 3VBXA 2RL5A 4ZXTA 4KKEA 4AZEA 4EH9A 5GZ8A 1U4DA 2BHEA 5L6WL 3KN5A 3K3IA 3FDNA 4FNWA 4H3QA 4O22A 5DR9A 3Q6UA 2G2IA 3LCKA 3BYMA 4L43A 5E8SA 2Y7JA 1P2AA 4HGLA 4HZSA 4GK4A 3KXZA 4J95A 4QPAA 4YZBA 5AP4A 5ITAA 4OAUC 5H8BA 3U8WA 2C6TA 3QQKA 1XO2B 3RI1A 3AGLA 2FO0A 3KULA 2QU6A 3ZEPA 4M3QA 5HLPA 3RVGA 4EONA 3EQBA 5A4CA 3GU4A 5I9WA 3MTFA 4CV8A 5C4LA 1J7LA 3CXWA 3II5A 2CGVA 4EZ5A 4ITJA 4Y8DA 5EW9A 4B7TA 3PE2A 2WPAA 5CANA 5IF1A 4DLJA 4U97A 4W9WA 2E9PA 4EHGA 4FV2A 3P7BA 1WVWA 1BKXA 2XIRA 3BGPA 3DBQA 3F69A 4B6LA 4CLJA 3I6WA 1F5QA 4QMTA 4BVUA 4EUUA 3LHJA 3FZSA 1REKA 2G01A 4GH2A 4QMOA 4IVAA 2WQOA 2WQBA 2CGXA 4DHFA 4IC8A 3UC4A 3MY5A 5KMNA 3IO7A 5FP5A 4EJ7A 2C6IA 2X39A 1PXPA 2UV2A 3HRFA 3FEGA 1YOMA 5DT0A 2BKKA 4DFUA 3ZM9A 1W8CA 2C3IB 4AAAA 4AG8A 3G15A 4GKHA 3EJ1A 3AD4A 3TZ9A 1ZMWA 3H9OA 1CSNA 4AA4A 2P33A 4D1ZA 2C6KA 4K0YA 3R7IA 5HE3A 1X8BA 3EN6A 3NVMB 3I0QA 3ACKA 3PJ1A 5EH0A 4BGHA 4D58A 4ZJJA 5JQ5A 3JUHA 4E73A 1T45A 4IIRA 2XMYA 4ZAUA 5ANGA 3A7FA 3UMXA 5I9YA 4EOSA 4PMMA 2G2HA 1OKWA 3NSZA 5E8XA 3HL7A 2BRBA 2OJ9A 2O64A 2H6DA 3NUPA 3CD3A 5JRSA 2ZDUA 4R3CA 2VO7A 4BICA 1OI9A 2HW6A 4USEA 1NT2A 3O2MA 4R3PA 4QYYA 3KL8A 5BYYA 3N4VA 4X6QC 4DH7A 3C0GA 3PXYA 5IUHA 5FUTA 4FSYA 5HORA 3DJ5A 5EG3A 3CY2A 4L44A 3HMOA 4AUAA 2VN9A 4XEYA 5C03A 2H96A 5HLNA 5J7BA 4U8ZA 3TACA 3V04A 4N6YA 3V8TA 4E5BA 5CT0A 1PXIA 3S0OA 4NJ3A 3OXZA 5D9HA 2RF9A 3PPKA 4MXCA 3AGMA 3SQQA 3ZLXA 1Q3DA 5IG1A 5K9IA 3D0EA 3FUPA 4CTBA 3PE1A 4K18A 5IMXA 2J51A 2I0VA 2WQEA 1MRYA 4YHJA 2A2AA 4JAJA 4IX6A 1JKKA 3KXGA 2VU3A 2X6DA 2HCKA 4O1PA 3ORMA 4XRJA 3SC1A 3W10A 4AZVA 4YURA 4TWOA 4BRXA 4GG5A 2B9IA 2PY3A 2WO6A 4JX7A 4CCUA 5F20A 3CC6A 3QKKA 2QKWB 4XOZA 4FI1A 4FEUA 4KWPA 3KMUA 4F7LA 3F5PA 3W8QA 4ZEGA 2YACA 4O6EA 3UMWA 2Y6MA 4PMSA 4F7JA 3ANQA 2IVSA 4AA0A 2P2HA 4AXAA 2NP8A 5G1XA 3ALNA 2FGIA 1JPAA 4M7IA 5I9VA 4GIIA 2PUNA 1R0PA 4DFBA 5HX6A 2UW4A 1IAJA 3ZMMA 4FV9A 5L2IA 1JNKA 4EWQA 2XJ1A 1K2PA 2RFSA 3DLSA 4BZNA 2OJGA 4D2VA 5DRDA 1CKJA 4DEEA 3TDVA 3ZLWA 1MUOA 1SMHA 3K5VA 2OFVA 4FTQA 4K9YA 3NR9A 1OMWA 3PVGA 3R9OA 5IH4A 2WTIA 3WI6A 2GSFA 4O7RA 4FUXA 3G0FA 4MNFA 3BZ3A 1OB3A 3FL4A 4YZNA 1K9AA 4IH8A 3D5XA 4USDA 5EW3A 4XG4A 4BZOA 5E8VA 4B8LA 4XLIA 4JIAA 4BKJA 2OZAB 1BI7A 4XG6A 3P0MA 4BI0A 3Q3BA 3IKAA 4L01A 3DOGA 3HRBA 3PY1A 1GNGA 5EHLA 3ROYA 4A07A 2PZYA 4J8NA 3OEFX 1Q8WA 2WMWA 4EH6A 3QCSA 1YWRA 5KMMA 3NYOA 3Q2JA 4FL3A 3ACJA 4HYHA 4ASXA 4ZOGA 3IDBA 4RX7A 4C61A 3TG1A 4YBKA 4L46A 2I0YA 4RQVA 4D4SA 1Y91A 1ZZLA 3A61A 3V5LA 4CZUA 1AGWA 4FICA 4BTKA 4DT9A 3VAPA 3LCDA 4AFEA 4DH3A 4I21A 5CXZA 4QP3A 2CPKE 4FZDB 3RHXA 4EOIA 2YM8A 2UZTA 4RJ8A 5AR2A 4YU2A 4Z7HA 4P2KA 1UNLA 1SZMA 3EQPA 3FL5A 3TZ7A 4FSZA 3BHTA 3SA0A 4ACCA 2XK6A 3HKOA 4J7BA 5DWRA 4CG8A 5HQ0A 4FZ6A 4W9XA 5AR5A 1FGKA 5HBJA 2IN6A 4JDIA 4ENYA 5LQFA 2PPQA 3MFSA 2C5XA 4H05A 2VUWA 3FLNC 1UU8A 2X4ZA 5LJJA 1IRKA 5EQEA 4A06A 3G0EA 3UVRA 4B99A 2BAJA 2JBPA 3NLBA 3QTQA 4L42A 5JQ8A 5AP5A 1CKPA 4UYAA 2WTCA 4EOMA 2QG5A 3AXWA 3QC4A 3ROCA 4YMJA 5ETIA 3IW7A 4NKSA 5HESA 3G90X 3P1AA 1YXTA 4S2ZA 1XH4A 2UZVA 2WZJA 2A0CX 2VGPA 4KB8A 3TNPC 4RC3A 2B52A 4QT1A 4ANMA 3ORPA 4AP7A 3N9XA 5CEMA 5KHWA 4M69B 3KRLA 3BKBA 3G51A 3PZHA 2HYYA 3R00A 3ENHA 4M84A 4I6BA 5I3OA 2HXLA 5E1SA 1APME 5GJFA 4O27B 4YJTA 1YXVA 4U45A 4D2SA 2HELA 4Q5EA 4FA2A 3IGOA 1IA8A 4GSBA 3BE2A 2R7IA 3ETAA 4X2FA 2CDZA 5CNOA 2CGUA 3NUSA 3RK5A 4AZSA 4KSPA 3HMNA 3B2TA 3SKCA 3VUDA 4WSQA 2YWVA 1ND4A 5KZ0A 2WKMA 3CTHA 4N6ZA 2BRNA 3VNTA 5JGBA 3TN8A 2CKEA 3EN9A 3KK8A 2F7EE 4QP8A 3F61A 5IA5A 3VF8A 3L9LA 3ZS5A 3D15A 4DT8A 2OGVA 1YI3A 5AP6A 5M55A 2PVJA 3BHHA 5E90A 3TEIA 3UE4A 3EZVA 3JVSA 2RFNA 2VX0A 1GZOA 4BCHA 3L8SA 4X21A 2ZV9A 3WF8A 1I09A 1ATPE 3QCQA 3OROA 2QO7A 4LUDA 5HBEA 3LFNA 4F0FA 4XG8A 2PMOX 3L8VA 4IACA 2IZRA 1XHAA 4AW0A 4PDPA 3M2WA 3QRIA 4RVLA 3ZZEA 4XV1A 5ETFA 4JBVA 3O8UA 4EK5A 2ZV7A 2KTYA 3RNYA 3BI6A 4UYNA 3ZDUA 4AGDA 1JSUA 4GW8A 4XUFA 4D0WA 2YA9A 2F9GA 3QUEA 3TTIA 5IQAA 4ANQA 4AN3A 3HA8A 2WOTA 3NX8A 1ZMVA 3DKFA 4FR4A 4BDBA 3EWHA 2RG6A 3QAME 3VRZA 4IAZA 3UG1A 2HWOA 4XOYA 5CF8A 2H34A 5DIAA 3DA6A 3PWYA 3FYKX 2Y4IC 3RMFA 2WMUA 1NXKA 1FVRA 3PA5A 3CPBA 4RWLA 2VWBA 3W55A 4D1XA 3EQGA 3UPXA 1CTPE 4I6FA 5JFXA 2R7BA 1XKKA 3TI1A 2C5NA 3COMA 3OW4A 2Y0AA 3MI9A 3QALE 3E87A 4FV8A 3C0IA 1OBDA 1ZY4A 3I60A 3D2IA 5GHVA 2EVAA 3R8LA 4BHNA 3D2KA 3QD0A 3ORXA 1STCE 2C0IA 2WTKC 3UZTA 5E8WA 2GHLA 4YTCA 3QWJA 4MEDA 4AGCA 1IAHA 4GIHA 3A7HA 4YR8A 3QGYA
chains in the Genus database with same CATH superfamily
4IADA 3H10A 5FXRA 4D9UA 3RTPA 2BAQA 5KKRB 5AR7A 2Z7QA 5E8UA 3T3UA 1KV2A 5M4CA 3PP0A 2W7XA 3MB7A 3PYYA 3FHIA 4AT3A 4RJ6A 4U0IA 5AIKA 2OKRA 4ZJIA 4ZSEA 1JBPE 4YJOA 2X4FA 3ZO2A 3GP0A 5AV2A 3WIGA 5ANDA 3R9NA 3V51A 4UZHA 4ACMA 3DTWA 4FZ7A 5AAEA 1OL5A 4X2KA 2WGJA 4ASZA 5HG8A 1FMOE 2UVXA 4WHZA 5M09A 2Z60A 4TL0A 4O4EA 3W0QA 5AR4A 4CFUA 2W5HA 4IVCA 3Q04A 2FVDA 2XRUA 3RHKA 2QHMA 5KMOA 1LEWA 4PMPA 2W06A 4I0RA 2YISA 3OZ6A 2EWAA 4W8DA 1MRUA 5JT2A 1O6LA 5AUVA 4EOPA 4HPTE 3PRFA 4S31A 2C47A 4YZ9A 5J9ZA 2XNOA 4JBPA 4NK9A 2UUEA 2IZUA 4WRGA 5L2TA 3ZFMA 4LG4A 5DFPA 3UVQA 3KMWA 5CTPA 2QURA 2Z2WA 1ZWSA 4LL0A 3CIKA 5DPVA 4EYMA 3WZJA 4APPA 5DEYA 5CAPA 3L9MA 4ANBA 5AAFA 4AW5A 3VHEA 3CBLA 3IGGA 2RGPA 2XIZA 2AYPA 4FNXA 4JOAA 5DEWA 3WILA 4BFMA 4BCPA 5K0XA 3QKLA 3I1AA 3SW4A 4QEBA 4F4PA 2EU9A 4AW2A 1PXKA 3GENA 4CFXA 2PL0A 3LCSA 3QD4A 1LPUA 2VV9A 3IONA 2EXEA 3VQUA 4CZYB 4CZTA 4QNAA 3VIDA 3UOJA 1ZYJA 1XMMA 4WNKA 3LQ8A 3BYUA 3HYHA 1XR1A 1Q5KA 3IW6A 4NW6A 4WD5A 1H28A 3P23A 4C2WA 1QPCA 3DY7A 4YLKA 4I6LA 4BKZA 1OITA 2W96B 5CQUA 5HD7A 3TM0A 2ITZA 4AT5A 4N0SA 4CYIA 2YFXA 4EC9A 3A60A 4E1ZA 2XYNA 3CY3A 3RCJA 1GZKA 3UGCA 1QMZA 3PJ2A 4HNFA 3UOLA 3POOA 3BWJA 1PKGA 3QF9A 4TKSA 2W4KA 3RM7A 5LVOA 3BL7A 4U3ZA 3IOPA 4XMOA 1J3HA 2P3GX 3BRBA 5CU4A 2XB7A 3KQ7A 3EOCA 4MWHA 3ML1A 4ZMFA 5E9EA 5FLFA 2VRXA 4JS8A 5EQPA 3KULB 4X3JA 2BRGA 3QWKA 4FF8A 4ITIA 5B0XA 4R3RA 3HLLA 4GK2A 4KRCA 2A4LA 1M7QA 2KULA 2ZAZA 4AZFA 2BZJA 5FDPA 5JH6A 3AT2A 4DF3A 4HGTA 4QMYA 1MQ4A 4BTJA 3DJ6A 3FWQA 2HENA 4DH8A 5HBHA 3ATTA 2BDFA 4AS0A 1KE5A 4Y73A 2XS0A 4FIGA 4JI9A 1W2FA 4J71A 4O7WA 3PJ8A 3VWAA 5F1ZA 1U5QA 2PMNX 1Y8YA 3A8XA 3QXOA 3N4TA 3O7LD 3B8RA 3DTCA 4TYGA 4O1OA 1WBNA 1ZRZA 4ZSJA 3S4QA 3V5QA 4QD6A 3ZRKA 3O7LB 4DFZE 4FSWA 4LOPA 3RAHA 5BV3A 1ZOHA 3KA0A 3QKMA 3HV4A 3GQLA 5D7VA 5J1VA 3BV2A 1JQHA 3CCNA 4DEDA 3HDMA 4HVIA 4NL0A 2XCKA 4CFVA 4R78A 2WU6A 3NMUF 3LKMA 3I7CA 5HVKA 2QOQA 2Y8OA 5CVHA 2VNWA 4ALVA 1HOWA 1JVPP 4GV1A 4S32A 1URCA 4KIKB 4ID7A 5C8MA 1SVHA 5JEBA 4JT3A 3OT8A 1A48A 4YTHA 4ZLYA 5CSVA 2P2IA 4BCFA 2BIKB 2BR1A 3VF9A 4HNIA 4DCAA 4R7IA 1YDSE 5CYIA 4ZSLA 3OY3A 3D7ZA 3IG7A 4FTNA 2YWPA 4I5MA 2X8EA 4DC2A 1PRYA 3SXSA 4GCJA 2OW3A 3L8XA 3BE9A 2R0UA 3R7VA 4M0YA 3EL7A 3H0ZA 3UIBA 3SD0A 4IZ7A 4MD8E 2QOBA 2ZB1A 3C13A 4YO6A 3VVHA 3QC9A 2H8HA 4LGDA 3T9TA 4RWIA 4U41A 2WMVA 5AA8A 3GUBA 3NFFB 3EKNA 4FSQA 4GYIA 2F57A 2XUUA 5AV3A 4MH7A 3R7YA 4RA4A 4IWOA 3F88A 3RALA 3IW5A 2WD1A 2R3GA 3FBVA 3OOMA 4XLVA 3ZDIA 1H0VA 2F4JA 4GT4A 4KBCA 3A2CA 4OGRA 3EFLA 1ZARA 4GT3A 4KIOA 4FV1A 3RWQA 1Q62A 5HNBA 3RM6A 3OXTA 2R3OA 3RPVA 3OUKA 3ET7A 2YABA 4XG2A 2GFCA 4GK3A 3PXKA 2JDTA 4D55A 4E4MA 4MKCA 3JY0A 4DBNA 1GAGA 4K11A 1HCLA 3Q5ZA 4NFMA 4FYOA 3R9DA 4RLLA 3RINA 4FKTA 5T3QA 1MQBA 2P0CA 2IVUA 2BFXA 3HECA 4OBPA 4W4WA 1TQMA 4BGGA 5IEXA 5K3YA 3C4CA 4GJ3A 2YCSA 2J9MA 3LXNA 3V8WA 4EWHA 4AFJA 2ITQA 5LCKA 3HGKA 3VRYA 3G9NA 4XCUA 3NIEA 3DFCB 4JG6A 4MWIA 4IB3A 4RFMA 4ZTSA 3VHKA 3EYGA 3RPOA 4QPSA 4DG2E 3L1SA 4DTAA 4YTIA 5AV4A 4DAWA 4FTOA 3ZOSA 4JMQA 4PTCA 5LMAA 2QR7A 3MFRA 3PFQA 2VTNA 2ITPA 3RWPA 3LW0A 4O4CA 4JQ8A 5HCZA 3R7UA 4L00A 4W8EA 4EHZA 4BYJA 4MQ1A 3DBFA 3OBJA 4FV6A 1OL6A 5IU2A 2XZSA 3OWJA 5IH6A 4MF1A 4FTRA 5IH5A 3O17A 2OO8X 4LV8A 5M51A 3QCYA 4KAOA 4G2FA 4RWJA 5LARA 2G15A 3WYYA 2W1CA 4CYJA 5JGDA 3SV0A 2IVVA 3BEGA 2XKCA 3NIZA 2WEIA 4IAFA 5AV0A 3S2PA 3OOGA 4FTAA 3W0PA 2VTMA 4BWPA 4G3GA 1YI6A 3NYNA 1G8JA 3AT3A 5JRQA 3LFAA 4K6ZA 4D5HA 4FIIA 3ZFYA 4I1ZA 5HNGA 2YLEA 4FT9A 3DB8A 3C4XA 1PXOA 5FXSA 3Q96A 4IFGA 3UQGA 5FG8A 5HG5A 4FT7A 2W5BA 4F1OA 2HZIA 3OG7A 3R2BA 1YKRA 5M08A 3IW4A 4XV3A 2GS2A 2V22A 4E6CA 3QQGA 4NSTA 3HRCA 4MNEA 1FVTA 4ZTNA 3TL8A 4Q5HA 1GOLA 3OCBA 3UIUA 3LFDA 4KABA 3ORIA 4FKQA 5IQCA 4MD9E 1RW8A 4Y5QA 3R8MA 3C1XA 3FLZA 1TKIA 2XK9A 4OBOA 3SDJA 4XG3A 4DG3E 3BWFA 3KIOC 3BQCA 2O65A 3DQXA 4RIOA 4L6QA 1G5SA 2ITUA 2OXDA 3L9PA 4PP9A 5AV1A 1O6KA 5A54A 4NH1A 3QD3A 3Q9XA 4CMOA 1OZ1A 4O2ZA 3FY0A 2HWPA 2FSLX 4AU8A 4CRLA 4OTWA 4MXXA 3W0RA 3CKWA 3SLSA 5FGKA 4BDCA 1H1WA 1WBSA 4BCNA 1M2PA 3KN6A 4QMSA 4M15A 3ZLSA 1JWHA 4JG7A 3IOKA 4UBAA 4ZTQA 1SNXA 4Z9LA 2VO6A 1JKSA 4ZP5A 5AADA 3UO4A 3KC3A 5CZIA 5IQGA 2I0EA 4LV5A 3KF4A 5HTIA 3HUCA 3K3JA 3P7CA 4OT5A 4U3YA 3NW7A 3R30A 1SYKA 5IA2A 4BL1A 4LDTA 3QZFA 3HEGA 5AX3A 5IQHA 2JKQA 3QRKA 4QMQA 4EK8A 3CQEA 3O51A 3SOCA 2GNIA 1LP4A 1PMVA 4FEQA 4HZRA 3ZZWA 1WVYA 3MH1A 4HOKA 4JQEA 2XM8A 5EFQA 4IANA 3TIYA 2VO0A 1OUKA 3DLZA 5FM2A 3I5NA 5C8KA 4F6UA 4YPDA 4KS7A 2PE1A 4QQJA 1P4OA 5LCJA 4I6HA 4E6QA 3MESA 2ETMA 4XV9A 3MDYA 3D9VA 5E1EA 4FIHA 2JC6A 3VS6A 1Q97A 4RZVA 2VWWA 3HV5A 4MXYA 4RQKA 3RPSA 1M17A 2W05A 3MTLA 4ZZOA 1VJYA 3LJ2A 5CWZA 2A98A 1YXXA 3ORNA 2ZB0A 1YI4A 5EYCA 4G6OA 1PY5A 3R0TA 4FV5A 3G6GA 3T9IA 4AACA 2WMXA 2XARA 4EH5A 2I0HA 1B39A 3V5JA 3R7OA 4K2RA 4N4SA 4NFNA 3R8PA 4C38A 5LWMA 2RG5A 4ANOA 2BHHA 2C3JA 2PMIA 4J8MA 1Y6AA 4CKIA 2ONLA 4FKSA 3AMYA 3Q32A 1KE8A 4JLCA 4KIKA 3W18A 2JAVA 3BU5A 4S34A 3VS0A 3UYSA 2WIPA 3SG8A 4BWXA 3AT4A 3R8UA 4AF3A 3AC3A 5DT4A 5AA9A 4C2VA 2JGZA 5HU9A 2XP2A 4YJNA 3DS6A 3ZC5A 1SM2A 2F49A 3D5UA 2BIYA 5B2LA 5IPJA 1ST4A 4A9UA 3CTJA 4U6RA 4JRVA 4RJ4A 2VWVA 5HIBA 2GNGA 2VD5A 3OS3A 3PZEA 5JFVA 1Q61A 5GNKA 3C5IA 5KMLA 4U5JA 3ZRMA 4CCBA 3RP9A 3TNIA 2JDOA 2WMBA 4C37A 3HUBA 4FBXA 5CSWA 2EB3A 1PXMA 3QGWA 3S00A 3BLHA 5FTGA 3F3UA 4L7FA 3C7QA 1FMKA 5IA4A 4O82A 5EKNA 4JQ7A 3ZUTA 5TF9A 4ZY5A 4QO9A 2I6LA 3OUNB 3TXOA 2XK8A 2E9NA 4WO5A 3QU0A 1G8KA 3ANRA 2B4SB 4ALUA 4EH8A 2WEVA 4LYNA 4HVDA 4AWIA 4EZ7A 5KMKA 2NPQA 4OTFA 4BC6A 4IZYA 4X7QA 4RJ5A 4F99A 1H24A 2V7OA 2G9XA 3OTVA 4I5CA 3F2RA 3QUDA 3IQ7A 4FKPA 4LRKA 4RSSA 4X3FA 2VO3A 3C4ZA 3CLYA 3PIZA 3W2RA 2W4OA 4KS8A 5HE1A 1PYEA 4U79A 4DGGA 3Q2MA 4FSRA 4K8AA 5A4TA 4DHIB 2WU7A 3AG9A 3UYTA 2Q83A 5IMEA 4FMQA 4ORKA 5M4FA 1TZDA 3U9NA 3NFGB 4CT2A 3GOPA 5CASA 1GIHA 2PWLA 3KRXA 4QMUA 1J91A 4NCTA 4RBLA 1FBNA 1UWHA 2CHLA 5HHWA 3R9HA 2HZNA 3LQ5A 3AC8A 3LFQA 4QNYA 4UWYA 5H9BA 3LLTA 3N51A 5AX9A 4C4HA 4JBQA 4IWPA 4ZTHA 4O0VA 4YLLA 3TWJA 5CY3A 4WKQA 4CQGA 4HCUA 3W0MA 3HMPA 4JXFA 2X1NA 4BTMA 4D2WA 5JGAA 3QQLA 2QQ7A 4YJPA 4F9BA 1W2DA 3CR0A 2QOIA 1H26A 1ERKA 3UDSA 2ETKA 4FVPA 3TJCA 3I6UA 4DITA 1SNUA 3POZA 3GCPA 4YGAA 4AZWA 3W2QA 5CS6A 3TV6A 1OGYA 4AXFA 4GG7A 4BDAA 2AQXA 4EK3A 5AUYA 2CGWA 1J1CA 4Q9SA 5CEPA 5IQIA 2GHGA 5CU2A 3V6RA 4ONAA 4JBOA 2GNJA 3PJ3A 4IM3A 4ANSA 5M07A 2EXMA 3AD6A 1XH9A 4B0GA 4EKKA 4ZZMA 2JKOA 2PHKA 3NYVA 3GB2A 4TTHB 3DNDA 1EH4A 3C0HA 5E8TA 2B53A 4WT6A 2VTJA 4I92A 2C6DA 3EN4A 3DDQA 4ZS4A 4IXPA 1XMLA 3PXZA 3EN5A 5IA1A 4QMMA 3QTWA 1OGUA 2QOFA 2ERKA 4GUBA 5HI2A 4AOJA 5L8LA 4L68A 5KO1A 5BYLA 4BIEA 3NPCA 3FSFA 2FA2A 3GVUA 4C4GA 2PYWA 5C1QB 2ZM1A 3R7GA 5JMSA 2BAKA 3PRIA 4LGHA 2WNTA 1NVSA 5M57A 4J53A 4FV3A 4IVBA 5J5SA 5I4NA 1A06A 3VW8A 2PVFA 3CQUA 5ETCA 3WF6A 3UNZA 5BX0A 2AC3A 3OY1A 3RAKA 3FXWA 4G5JA 2FSTX 3VQHA 3WF9A 5HO7A 4QMXA 3TUBA 3FZOA 4XP3A 5CSHA 2R3MA 4WA9A 4TXCA 3VULA 5A4QA 4MTAA 1YW2A 3UDZA 2HXQA 2VX3A 3BYOA 3F3TA 3GC9A 2ITYA 4G34A 4LUEA 3RK9A 3ZEWA 2C1BA 4O7YA 4F1MA 2E9VA 3QHRA 4AW1A 2XH5A 5CVFA 2DS1A 2YIRA 1XBAA 2C69A 3MIAA 2XNNA 3ITZA 1JOWB 1M2QA 3QYWA 5HGIA 5C8NA 3OP5A 3NNXA 3L8PA 2C5YA 4LMNA 3RAIA 5LMBA 4QMNA 4RGJA 3UO6A 3Q5IA 4BIDA 2ESMA 2EUFB 3FPMA 3BEAA 3QRUA 5A9UA 2GQSA 3TNHA 5EW8A 2QG7A 1JAMA 1OPKA 3LXLA 4NM3A 3UO5A 3GU7A 3MA6A 2BZKB 2Y6OA 3CPCA 3E62A 3TZ8A 2ZVAA 3VONA 5BYZA 2R0IA 3ORLA 4J98A 3ZFXA 3DT1A 4IE9A 4PNKA 4H1MA 4F1TA 3WZKA 3DFAA 1H07A 2ACXA 5H3QA 4CMTA 4MBJA 1W84A 4IM2A 3D7TB 4OTPA 3ZHPC 3Q9ZA 1WVXA 4RC4A 3EH9A 3LMHA 4M8TA 4IVDA 5FEEA 4O4FA 3EQIA 3OHTA 1SVGA 1V0BA 4PV0A 5EK7A 3TNWA 3VJOA 4EBWA 3V3VA 4GT5A 4BDIA 2J6MA 4IHPA 2ITOA 4HCVA 2OJJA 3I0OA 1JLUE 3FMMA 1KWPA 1URWA 1TVOA 4PPBA 4EK6A 3VS4A 2YIWA 4P4CA 5CSPA 3DDPA 1OM1A 2V0DA 1XWSA 3MWUA 1P4FA 2CNUA 1ZZ2A 3VW6A 5GZAA 4KUJA 2B1PA 3HMMA 2LGCA 2YM4A 1F0QA 2EB2A 3FAAA 3IW8A 5HKMA 4BTFA 2W99B 3E8CA 3REPA 2DYLA 4D2PA 1FQ1B 4UALA 1PKDA 2VTHA 1G8SA 4I22A 4PL4A 5LVNA 3MVLA 4FK3A 4TW9A 2HW7A 5CQWA 4Z3VA 4P5ZA 4JG8A 3K54A 3O8PA 4CD0A 1VEBA 2WMSA 2GS6A 4F9AA 2XAOA 1O9UA 2Z8CA 4YNOA 1M52A 5HOAA 4DEAA 1OL1A 1DI8A 2CN5A 2X9FA 3IECA 4EJNA 2PVKA 4UEUA 2QNJA 4U7ZA 4QDVA 5AR8A 3FKOA 1K3AA 3MPTA 4NM0A 4NYEA 2ZMDA 3FMEA 3I79A 3KCFA 3F3VA 4R7HA 3W32A 3PUPA 2R3IA 5CEKA 1B6CB 2OK1A 3EIDA 2GCDA 4AXCA 1R0EA 3C51A 4JRNA 2BRMA 4R8QA 4M67A 5A46A 5KMJA 5L2WA 4O2PA 2BPMA 4EOKA 5HO8A 4JAIA 3GOKA 4BCIA 1GIIA 2ZV2A 4D4RA 3K2LA 4IJ9A 3MW1A 4O7NA 3SGCA 3R2YA 2R64A 2Q0BA 1OKZA 3LZBA 4LOQA 5HU3A 3DV3A 3ZBXA 3D83A 1OVEA 2OSCA 2YJRA 4I0SA 3NWWA 2XKDA 2VWXA 2R3JA 5EDQA 3R7EA 2YIQA 5DHJA 5BQ0A 3A7JA 3R8ZA 1REJA 4XV2A 3PY0A 2YIYA 4O91A 5B7VA 5DR2A 5IA0A 4H36A 4EH2A 3VS5A 2VWUA 3LLAA 2Y4PA 2W9ZB 3LFFA 4QQTA 1IG1A 3ORTA 3TTJA 2I7QA 3I7BA 4K77A 2XEYA 4A9TA 4JDHA 4JJRA 3VUKA 4D1SA 1UKHA 3WZEA 5LMKC 4N57A 2ZOQA 4E6DA 4AT4A 3KFAA 5CEQA 3OCGA 2FB8A 5J87A 5CU3A 5AAGA 2JIUA 3CKXA 3QTRA 4QYEA 1UVRA 3OTUA 1W83A 3PDTA 2YM6A 2Z7SA 3WBLA 2YCQA 2WTKB 2VTOA 3FKLA 1WZYA 3NNUA 3LFEA 2J90A 3QQUA 4GU6A 5K4IA 5L6PA 4APCA 3GQIA 2IW8A 2XA4A 3IDCA 2WXVA 2XIXA 4DEHA 2ITNA 3C4WA 4XBUA 4E5WA 4UMQA 4UB7A 5DH3A 4RVMA 5HG7A 4CT1A 1QPDA 3LM0A 4MBLA 4G9CA 1QL6A 2HY81 4OTIA 3MN3A 3A62A 4MNEB 4O4DA 4MD7E 3MBLA 2XRWA 4L3JA 4OUCA 5ANKA 3GT8A 4BBFA 5EDRA 3P86A 5J8IA 3COHA 3S95A 4WNOA 3NUAA 2GNHA 1UKIA 4DYMA 5I0BA 4XP2A 3FSKA 3UBDA 3O50A 2NYAA 3DKOA 2PE2A 3GCSA 4F64A 3E5AA 5FM3A 1Z5MA 1ZOEA 5F94A 3BU3A 3P9JA 1ZLTA 3ORZA 4F7SA 4OAVB 1R3CA 5CAQA 3LMIA 5FXQA 5BVNA 2PVMA 4R6VA 4RVKA 4FTTA 3RCDA 1H01A 3AC4A 3FLQA 3RK7A 4A4XA 2GDOA 4BIBA 3QCXA 4PTEA 4C7TA 3OT3A 4EYJA 4O86A 5F9EA 1M7NA 3U54A 1H1SA 4G6NA 4MXZA 1S9IA 5TT7A 3NUNA 1A9UA 4O21A 1DS5A 2IO6A 5FEQA 2BTSA 3HP5A 5GJGA 5TE0A 4IAKA 3FPQA 3HZTA 3PVUA 4YJQA 4C02A 4CKJA 2UZLA 2UZDA 1BMKA 4EOQA 3FZRA 5CU6A 4RFYA 2VNYA 4BDBA 3VC4A 4L9IA 5HZNA 5AUUA 1WFCA 2CSNA 1MP8A 1Y8GA 2XIYA 3DQWA 3NS9A 1DAWA 3OCTA 4PY1A 2QOKA 3MV5A 2QO9A 2ZYBA 4DFXE 4GKIA 2P4IA 2UZBA 2UZUE 2ERZE 1YWNA 5HE0A 4OTHA 4FTUA 1OIYA 5D7AA 4WG4A 5I9XA 1WCCA 4HYIA 5J7HA 2W9FB 4RFZA 4FL1A 1V0OA 3TZMA 5J5TA 2PMLX 3BGQA 3DZOA 5ANOA 4ACDA 3GFWA 2CNQA 4EHVA 3Q53A 2AUHA 4IWQA 2X8DA 4FV7A 4DLIA 1GZ8A 5LXMA 1UWJA 4E5AX 5A6NA 5CAOA 4CNHA 4C3RA 2R3NA 2R3RA 4JDJA 1YOJA 3QTIA 3D5VA 1OKVA 4FKGA 3ZSGA 2JDVA 3PXQA 1WAKA 4CFFA 2WMQA 3DBDA 4I24A 3DAKA 4FTCA 3E93A 4JX3A 5M06A 3FV8A 3ZLYA 2BCJA 4MHAA 3MY0A 4I5HA 4ERKA 3FMJA 4NW5A 5EYDA 4DINA 5BVEA 3AQVA 2X7OA 2CJMA 1ZYLA 4LOOA 4ZZNA 3GU5A 3HV7A 4YTFA 5D1JA 5HLWA 3BLAA 2VZ6A 4AQKA 4TNBA 2BZHB 2Y9QA 3RGFA 4DEBA 1LEZA 1SVEA 2W1FA 3BBTB 1Q4LA 2XNPA 3A4OX 4FUYA 5EKOA 4DG0E 3MH3A 2YCFA 1H1QA 4QQCA 4I4FA 4O7SA 4BDFA 5ICPA 5C01A 5KCVA 3D7TA 2QI8A 1WBWA 5C26A 2E9OA 4RIYA 4E7WA 3QZGA 4WG5A 3QUPA 2PUUA 3QXPA 4TZRA 2O0UA 2P55A 2R3KA 4E20A 4FJVA 4XBRA 4F9CA 4II5A 4C58A 4O6LA 4IX5A 4DEGA 4AXDA 1UU9A 5K5XA 2OIBA 3GGFA 3UZPA 4HPUE 4IJPA 4YJUA 5M4UA 3DGKA 4HJOA 4X6RA 2QD9A 4XJ0A 4D4VA 2AEGA 4C33A 5KMIA 2C4GA 1WBPA 4C8BA 2HZ4A 5EQYA 5GIPE 1IASA 4YNEA 4E3CA 4ZY4A 4FX3A 5BVOA 4MVFA 3HX4A 3VS7A 3PIYA 4BDHA 2YERA 4NJDA 4PL5A 3NUUA 4QMZA 4LMUA 5AWMA 4CMUA 3FZ1A 3P5KA 4IZ5A 3V8SA 2QHNA 3MA3A 2PZPA 4UMUA 3DU8A 3QD2B 3GCQA 4BDDA 5M56A 5DI1A 4QPMA 3SXRA 4DN5A 3HMIA 1NW1A 4LQMA 5AFVA 3WE8A 3M1SA 4BN1A 4EQCA 3M11A 4C4FA 3LE6A 3E7OA 4C35A 4X2GA 4DGMA 3CSVA 3ENMA 1UNHA 3EB0A 3QQFA 1RDQE 1S9JA 4FG8A 2JDSA 1NY3A 1GY3A 2BDWA 4DCEA 2ZJWA 3KKVA 3OWLA 4IDVA 4Y95A 5IUIA 2IG7A 1DI9A 4BI2A 3JY9A 5DT3A 2C1AA 1WBVA 4FKIA 4FGBA 4B9DA 4E8AA 1YWVA 4MXAA 5JFSA 2W1HA 4X3FB 1YOLA 2RFDA 4AE6A 3C4FA 3F2AA 4B4LA 5BUIA 5CAVA 5TOZA 5DMZA 5IQBA 4UZDA 4OLIA 3VUTA 4LL5A 4A9RA 4YSJA 5IUGA 2FSOX 4CLIA 2X2MA 3EYHA 4IFCA 1PXNA 1OPJA 3EQDA 3ZSIA 2OLCA 4TYJA 3R04A 5I3RA 4G5PA 1KE6A 1PXJA 4RIXA 2UVZA 4YJSA 4U80A 4YHTA 5EI6A 2BRHA 4FV0A 2YM3A 4FTKA 4MF0A 5BVFA 3R9RA 5ACKA 3BPRA 1UNGA 2JKMA 4G1WA 4X2NA 2YIXA 1KE9A 3ZUVA 4FSUA 4KA3A 2PE0A 4QP2A 4A4LA 4PX6A 3PVWA 3ELJA 2FYSA 3BBWA 3GBZA 2HIWA 2YAAA 4FTMA 2QKRA 3UOKA 4EOOA 2XM9A 4HVGA 1JSTA 1KOAA 1U46A 2CLXA 3ZO4A 4PUZA 4JL9A 2XIKA 3FXZA 4QTCA 1ZY5A 3MH2A 4NM7A 5AMNA 3HP2A 3U51A 1YDTE 4ARKA 3A99A 2F7XE 1W7HA 3KRRA 4HGSA 2PZRA 3AKJA 4XH6A 3BYVA 4F9WA 1JKTA 3ZONA 5IDPA 3R1YA 4V04A 4XX9A 3NAYA 3Q4ZA 1AQ1A 5IQFA 3BU6A 1DAYA 4HYSA 3R28A 4YBJA 3W2PA 4X0MA 1H27A 1PMUA 5DR6A 2UW9A 3FI4A 3E3PA 2LAVA 4BDJA 3EQRA 5CVGA 4QTEA 3W2OA 5C4KA 3RZFA 4GVJA 3W33A 4FT5A 2PVRA 3D14A 4FT0A 2WTWA 4U9AA 3PUFC 2X0QA 3ODZX 1ZAOA 2X0PA 5C27A 2JLDA 3E64A 4BDEA 2REIA 4QYGA 2B7AA 5HCYA 4XYFA 3GEQA 5LVPA 4U44A 3F3ZA 3VBQA 1B38A 5H2UA 2XYUA 3P78A 5FWKK 2WAJA 3IDPA 5ANJA 4YP8A 3G2FA 3ZXTA 2PK9A 4ANNA 1MRVA 3DJ7A 3HV3A 4KSQA 1GIJA 4QYFA 4F9YA 3G33A 1U54B 4F70A 3NYXA 2XF0A 4J52A 3ORKA 4RX9A 4ASEA 4BKYA 4PDSA 2OZOA 2NRYA 1AD5A 4FKRA 1UU7A 1IR3A 2ZV8A 4PWNA 4FODA 2NNWB 4CG9A 3NNWA 2FSMX 4ACGA 2V62A 3CE3A 4FKWA 4J96A 2XBJA 5FQDC 4O83A 1Q3WA 4CFWA 3PWDA 1J7UA 3HAMA 2XCHA 2BDJA 4MCVA 4ERWA 3O5AA 3WF5A 2WTJA 3P08A 3KVXA 5EM6A 4CFNA 5TKDA 4O84A 2W1IA 3E8NA 4OBQA 1CDKA 4ASDA 2XNEA 4FKOA 5BVDA 3FMNA 1Q8YA 3ERKA 2WQNA 3MVMA 4MAOA 4OR5A 4Y46A 5K0KA 4BWKA 4F0IA 3CGOA 2E9UA 4FTIA 4FVRA 3RZBA 2QOHA 2WHBA 5J1WA 3GC8A 2V5QA 3RBWA 4S33A 4FE2A 4F65A 4WOVA 3VBWA 4BCGA 4WUAA 2X2LA 1Q24A 4RG0A 5AUTA 4ZJVA 4ZK5A 4I23A 2IJMA 3LPBA 4ZIMA 4ZSAA 4F0GA 1H4LA 4DTBA 3C9WA 2JFMA 5DRBA 5L6OA 2YAKA 3F3WA 3VUMA 4I41A 1FPUA 3BHUA 3FMDA 3H9FA 5BNJA 3PIXA 3QTSA 2ZDTA 4JR7A 1YVJA 4RJ3A 3R6XA 1XH7A 4R1YA 2GNFA 3N4UA 4C57A 1Q41A 3QBNA 4IAIA 4BCMA 4QOXA 1OL2A 3ULZA 3NZ0A 2I40A 1H08A 3U9CA 5ANIA 3M42A 3FLWA 5B2MA 4Z7GA 3R21A 5D41A 4YZDA 3UJGA 5D10A 3TJDA 4WUNA 2DWBA 5JZNA 4OTDA 5IISA 1V1KA 1RJBA 4FIFA 4RLKA 3ULIA