5EHOA

Rapid discovery of pyrido[3,4-d]pyrimidine inhibitors of monopolar spindle kinase 1 (mps1) using a structure-based hydridization approach
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
279
structure length
258
Chain Sequence
b'QSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMQPDVGTVNYMPPEAIKDMISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Dual specificity protein kinase TTK
publication title Rapid Discovery of Pyrido[3,4-d]pyrimidine Inhibitors of Monopolar Spindle kinase 1 (MPS1) Using a Structure-Based Hydridization Approach
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 83
structure length 258
sequence length 279
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2015-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ehoA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ehoA01
4IB0A 4AW2A 4E4XA 4AN3A 3PRFA 1U59A 4FL3A 3PE1A 2OIQA 4PQNA 3BZ3A 3NYVA 3LXKA 2CSNA 2F57A 3FHRA 2ZAZA 4PUZA 2ZDTA 4RIYB 5IQDA 2ZV9A 3F9NA 3DB8A 4NU1A 2AYPA 1Q8UA 2VTLA 2UZWE 2BCJA 4HZSA 4P90A 5AV4A 2ETMA 4J99A 4QMSA 2VNYA 5A4CA 3LMIA 2HXLA 1ZYSA 3TL8A 2W1IA 5HTCA 3NR9A 3TKUA 3ZHPC 5IMXA 4RIXB 3BYUA 3MESA 5KKRB 3AC4A 2B55A 2FSMX 2O64A 4QMQA 5I9YA 3B8QA 1WBTA 3ROYA 1VYWA 5DT4A 3ULIA 4W4VA 4U8ZA 5I5ZA 3JR1A 3BYSA 4LOPA 4YZMA 3PA4A 3V5QA 5I9VA 4M0ZA 4MCVA 4NM0A 4K77A 5CAQA 3A4OX 3NUYA 3FPQA 4J98A 4C7TA 4FEWA 3FV8A 2E9NA 3FAAA 4FIJA 4QYFA 4RA4A 3HDNA 4QTAA 2WU6A 4WG4A 3DKGA 3P78A 4U42A 2W9ZB 5AR4A 4X2FA 2GPHA 3GNIB 4UX9A 2F7ZE 1DAYA 3KN5A 2REIA 1NVQA 3CE3A 5D1JA 4U6RA 5LQFA 4MH7A 5AR3A 1U46A 4F0FA 3E62A 2C1AA 3WIKA 2W17A 3HA6A 3LFAA 5M4FA 3MFRA 4EH6A 3S3IA 1J7LA 1O6KA 4K0YA 4K33A 3ZRMA 1MUOA 1STCE 3KKVA 5CI7A 3UIXA 4BI1A 1M7NA 3ETAA 2CCHA 4YLKA 2VO6A 1JKTA 3K5VA 4ANOA 4H36A 5BNJA 2PMLX 5KHXA 5KKRC 1W83A 4FK3A 3WZEA 2ONLA 4FIEA 2CGXA 5L6WL 1U5RA 4G1WA 2O3PA 3UOKA 4ASDA 2BRNA 3ODZX 4XS2A 3AMBA 4LUEA 5M51A 4X2JA 1NVSA 1ZZLA 2OJGA 4RIWB 3SHEA 5J5TA 5J1WA 1L8TA 4ACDA 1U5QA 1PXJA 5CTPA 3BU6A 4FTOA 4IEBA 3ZMMA 5BYLA 3BYOA 1YXXA 4PP9A 3QQFA 3RAKA 4RWIA 4AZWA 5EDRA 3R1YA 1U54A 3MPTA 3EQPA 4EH8A 2C47A 3U6IA 2PTKA 3I0OA 2FSTX 5AR8A 1Z5MA 4ID7A 5ANEA 3CGFA 4Y95A 4QP2A 4CFFA 3G9LX 1WBNA 1ZXEA 4QMMA 2PVFA 4J1RA 4E5WA 1VEBA 4XUFA 5HKMA 3GFWA 2NRUA 3QAME 4MF0A 2R3IA 4PMMA 4JG6A 4WNMA 3DLZA 5D12A 2WD1A 4FK6A 4BWPA 2IZTA 2JD5A 1YDSE 4LMUA 2UVYA 4APCA 2O8YA 5M55A 1YI3A 1K9AA 1H01A 4U45A 1VZOA 4YJRA 4X3JA 3O8PA 5CEPA 5CQWA 4FT9A 4PL4A 4KIQA 2PMOX 2PY3A 5EI2A 2ZYBA 3WZKA 4BICA 3GQIA 3O2MA 4ALWA 2X7GA 4KBAA 4F9CA 3VHEA 4KNBA 5KMMA 4TYIA 2F7EE 4IB3A 2PVRA 1NA7A 2JKMA 3DPKA 3MB6A 3UQCA 5CU4A 3W18A 5IA2A 4K8AA 4AW1A 3OOMA 2QD9A 2Q83A 1SYKA 4FBXA 1Y57A 5CAVA 4CV9A 3I79A 2J90A 3DBFA 3PE2A 5JMSA 2EXMA 3KC3A 1KE7A 2H8HA 4DH1A 4E4NA 4GRBA 3IW7A 3KQ7A 4N0SA 2IVSA 3QBNA 4I23A 3QTWA 3ZUUA 4M14A 3HZTA 3ORTA 3OOGA 1AD5A 2C5XA 3HKOA 3TIYA 4CYJA 2R2PA 3OT3A 1E1XA 3DAKA 3QFVA 2VTIA 4FVQA 2GNJA 4JDKA 4DGMA 3G2FA 2HWOA 3CIKA 5KZ0A 4GVJA 2RFEA 2VAGA 4L3PA 3ZYAA 3TKIA 3ZZEA 4FTCA 3NVKI 3FBVA 5AR5A 1CMKE 4N6YA 3O8UA 4CLIA 2PUIA 4C4FA 5E9EA 5EG3A 4V0GA 3CTQA 4XEYA 4BIDA 4P5QA 4D1SA 4EK4A 3R7YA 2QCSA 5KCVA 4O82A 4IW0A 5L2QA 3LFQA 4NCTA 3VVHA 3R01A 3OC1A 4EONA 3BLQA 3Q52A 2JBOA 5CEMA 4TNBA 4YJPA 2Z7LA 2PUPA 1LPUA 2ITZA 3W2PA 4DG3E 4YSMA 4EWQA 3KF7A 5AV1A 2C5NA 3AC3A 5J87A 1R0PA 2QLUA 3MYGA 4N57A 1TQPA 2UV2A 4FIFA 1RJBA 3MFTA 3W16A 2IW6A 4IHPA 4BCNA 2W1EA 4O7TA 5AP5A 2PE1A 4PTCA 4RJ5A 4C57A 3Q9YA 1O9UA 4USFA 5L8LA 3GU8A 3GP0A 4MNEA 1PY5A 1OPJA 4DH8A 3AOXA 4YTIA 5I9XA 2PU8A 3SRVA 3E3PA 1H1RA 3BLHA 3KRXA 2J0JA 1CKJA 2GHMA 3C51A 2W1CA 3JY9A 5J9LA 3TDVA 4F7NA 3ORMA 2OXDA 3DU8A 5FP5A 2X7OA 3ENHA 1ZOEA 4O2PA 2Q0BA 3PVBA 1APME 2B53A 2OG8A 4QMZA 3R7UA 4QQCA 5D10A 3SVVA 4TWPA 2WO6A 4Y5QA 1IEPA 2B4SB 4QPAA 2XH5A 3NUXA 2XEYA 3I6WA 5C03A 3QC9A 3GOPA 4Q9SA 3BYMA 1CDKA 3BHTA 1Y8YA 2J5FA 4JBQA 4MXZA 4X21A 5D9HA 2GSFA 5GJDA 4AN2A 3P08A 2JAVA 1X8BA 4ERKA 2LGCA 3C4ZA 4GJ3A 2J5EA 3UTOA 3SX9A 3HMIA 3NNXA 5GNKA 4E5AX 4AOTA 4DTAA 3CSVA 5HBEA 4W4YA 5M56A 5JFSA 1YWNA 1R0EA 1XQZA 3FLWA 2WEIA 2R64A 3MH3A 3F66A 4EQMA 4O81A 3GENA 3NNUA 4E6CA 2ITWA 4AU8A 4BDDA 1ZYCA 4BGGA 3QLFA 3BYVA 4K2RA 5BYZA 3HV6A 3VUKA 3FWQA 5EHLA 2UW6A 4DH3A 5LOHA 3T8OA 3UZPA 1UU3A 4X6QC 4F09A 3GU4A 4J71A 2WTDA 2QG7A 4ORKA 2V22A 4NJ3A 3ULZA 3KCFA 4TNDA 3S2PA 1QPDA 4XG9A 4YJOA 5CZIA 2W1DA 3V6RA 4U40A 4ACMA 1Y91A 3KK8A 2IVVA 3OF0A 1OKZA 2BR1A 4HCVA 4CRSA 3WYXA 2X2MA 3JYAA 4TYGA 4AE9A 3HGKA 3L8VA 2R3NA 3GC7A 1GAGA 2BTRA 3LMGA 4C37A 4V01A 4HPUE 4DBXA 2R3FA 1Q41A 3D7TA 3HL7A 3LM5A 5E90A 4U97A 2P4IA 3VO3A 3W2RA 3HV5A 1FBNA 4RVTA 3HP2A 5IMEA 5DR6A 1FVRA 4R5SA 2WMTA 4JR3A 3U9CA 1Q8TA 5TR6A 4XYFA 1BUHA 3C0GA 3R7VA 2YDIA 1WBVA 3HRFA 4FL1A 4IC8A 3UG1A 5J1VA 2YCQA 3DDPA 5B7VA 2QVSE 3DNDA 3L9NA 2JKQA 5EKNA 2IVUA 3QTQA 2JC6A 3R71A 4ZY6A 1ZZ2A 5I9WA 4PL3A 3DLSA 4Y85A 4BKZA 5HBJA 5HBHA 5IEYA 3LIJA 3VUGA 5BVWA 4XNEA 3PY3A 2EXCX 2W4OA 2UZVA 3C0IA 2P33A 3BWJA 3BE2A 1VYZA 2BVAA 2WELA 5A3XA 1KE5A 4O0RA 4Y46A 5AP7A 3VW8A 4UMUA 4A9TA 2YM3A 3OHTA 4RC2A 5AFVA 4L46A 2YFXA 2ITTA 4J7BA 4BDBA 3IDPA 4RX5A 1XWSA 2LAVA 1UWHA 3BBTB 5EW3A 3FLZA 2IZSA 3PVGA 2GTMA 4I1ZA 1KSWA 4EEVA 3VS6A 3QQLA 3FJQE 3KULB 2C6DA 2R5TA 4JDIA 2OK1A 3TIZA 1Q24A 3Q96A 4PPBA 2A4LA 4QTBA 3BIZA 2UW3A 3QQUA 4GG5A 5FLFA 3N9XA 3LLTA 3LXPA 4JBOA 2YWPA 3ZEPA 4QMUA 4LG4A 1W84A 2HY81 3CGOA 3R7OA 5AAFA 3UOLA 3EFLA 4DEEA 3TEIA 5AUYA 2VO0A 3KXXA 3QQKA 4FSWA 2G1TA 4IAYA 4EOQA 2WPAA 1ZY4A 3A7JA 4MQ1A 4A4LA 3EN7A 4RJ4A 3F5UA 1E1VA 2HY0A 2J9MA 4WNPA 1BL7A 3V04A 2ESMA 1M2RA 2FSLX 4EK3A 3V5WA 5BUJA 5LVNA 1Z9XA 5IISA 4O83A 4IB5A 3RPVA 4DF3A 3R9DA 5DR2A 1NW1A 2P0CA 5DH3A 4AZTA 4TW9A 5FBNC 4FSQA 3LFSA 4FV6A 2C6TA 3S00A 2BRGA 1OIRA 2BDFA 5TT7A 4DEIA 4O7ZA 5FM2A 3KRJA 5KHWA 4FGRA 4GYGA 4YPSA 4R8QA 2BKKA 3R00A 5HX8A 3A8WA 2VTMA 4FT3A 2QOFA 2QOLA 1MQBA 2VX1A 3MVMA 3U51A 4NM5A 3WBLA 3MA6A 3CP9A 2O5KA 4BCJA 2WU7A 4WRGA 3IPHA 2G01A 3ORPA 2R3HA 3NUAA 4BCPA 2CLXA 1ZMVA 2I0YA 4C3FA 2BZJA 4IVDA 2R0IA 1LR4A 3PJ8A 4HGSA 4UV0A 4DITA 1Q8YA 5DPVA 2NO3A 2QU6A 4TYHA 3SLSA 4FKIA 3TZ7A 1OMWA 3VS3A 4YLJA 4QMLA 2A19B 3FQEA 4QTCA 4APPA 4ASEA 3PRIA 3F3VA 4WNOA 5J7BA 1QPEA 1OI9A 4JR7A 4IWQA 1Y8GA 3CQWA 2Q0NA 5M4IA 2ETKA 2OIDA 3POOA 1M17A 1DI8A 2JITA 3Q5IA 5M09A 4WUAA 3DV3A 4RBLA 5JK3A 1G8AA 1OGUA 5HU9A 5LWNA 4WOVA 4U9AA 3OXZA 5EW8A 4S30A 4FTQA 3UIMA 3AD6A 5AUTA 2W0JA 4YZCA 5AA8A 5IQEA 4XG3A 2R7BA 3R8MA 3MW1A 2E2BA 4FKQA 5AV2A 2XIZA 3MVJA 2J7TA 4YZNA 5AJQA 4IX4A 3ZC5A 1YXSA 2Z7SA 3QXPA 1OBGA 2YLEA 4L01A 3BBWA 3ZH8A 4IJ9A 4IX6A 4FEUA 5EI8A 3FLSA 2QNJA 1H1SA 3LCOA 4IWPA 4L7SA 3SD0A 4D5KA 3BQRA 5BUIA 4AE6A 3LM0A 5DBXA 2OICA 2QR8A 2V5QA 2E9VA 3G0FA 3KVXA 4QO9A 2YDKA 3QA8A 4O0WA 2YIQA 4V04A 3COMA 3VJOA 4KBCA 5CEKA 5A6NA 5H3QA 3JUHA 1Y6BA 4E6DA 4QP4A 3OW3A 4H1JA 5B2KA 2ZMDA 5FP6A 4O96A 4U80A 4PY1A 2XKEA 3C4EA 2IO6A 4QMOA 5CT0A 5E7RA 5EFQA 5EM7A 3ZFMA 4UZDA 3H9FA 1CM8A 3FKLA 3UC3A 3R7EA 4ITHA 4GJ2A 4FMQA 1M52A 3SG8A 1JKSA 4H39A 3IOPA 3UBDA 2PHKA 1M14A 4CMOA 1H4LA 4G34A 2O63A 4UALA 5LMBA 5BMSA 4A9YA 4BHZA 3ATSA 2X81A 4X3FB 2C6MA 3JXWA 4ZZMA 4UEUA 1P4FA 3W8LA 3CQUA 5EYDA 4DC2A 4EH9A 2PVHA 4E6QA 4D4VA 2PSQA 3CJGA 4J52A 3DFAA 2GQSA 3QTXA 3ZDIA 5EDQA 2HOGA 2OF2A 4EHEA 4EYJA 2XJ0A 4NZWB 3PPZA 2UZOA 3DJ5A 4U0IA 5JQ5A 3MTLA 3I60A 5A9UA 4YO4A 4I4EA 4DHFA 2QODA 2W05A 1OL2A 2BRHA 4FTKA 4PPCA 4ALUA 1CKIA 2W1HA 5HVKA 3P86A 4MF1A 4G6NA 4JXFA 5CU0A 2BALA 5DWRA 4PRJA 4XX9A 2BHEA 5IQCA 4BB4A 3KMMA 1IRKA 3QWJA 5F1ZA 5HLWA 1IR3A 2EU9A 3NWWA 2JLDA 4MKCA 4FKUA 5DA3A 3TDWA 3RAHA 1H08A 1Q3DA 2X4FA 3RVGA 3TI1A 1GOLA 4DEGA 5HIDA 3R6XA 5EQPA 1FOTA 3EFWA 2JIVA 5H8GA 3O0GA 3O17A 4X3FC 4MXCA 5AAGA 4DT9A 1XH9A 4XP3A 4L9IA 4XP0A 5CSPA 2OW3A 5B0XA 3L9LA 4IANA 2CDZA 1BI7A 2Y0AA 5G1XA 3PA3A 3AG9A 4L52A 4U7ZA 4G3GA 3R9HA 1T45A 2YJSA 3F88A 2PMIA 2UZNA 3FHIA 3EQIA 4FKSA 2R3RA 4NTTA 1F0QA 4TY1A 4CTBA 3UPZA 1ZYDA 3L9PA 3GCQA 2PVKA 3L8XA 4IC7A 2YZAA 2PE0A 2JDSA 3NPCA 1EH4A 1R1WA 4ZJVA 3DQXA 3DNEA 5FXRA 1YI4A 1ZAOA 4FSRA 5EYMA 1B39A 2V0DA 4G9CA 5HX6A 4IFCA 4AA0A 4KBKA 3VBYA 4O7WA 5HG5A 4Z7HA 4FZDB 3D5VA 4WUNA 2G9XA 2HW7A 3QUDA 3VRYA 2IZUA 3F3UA 5CAUA 5KX8A 4ACHA 2O65A 5CSXA 4RC4A 1KOBA 3T3UA 4CFNA 4B8LA 3FXWA 2QOCA 2YM4A 2G2IA 2XP2A 4UXQA 2VV9A 3NW7A 4C62A 4LGGA 4NIFA 4FX3A 4XG7A 1P2AA 3OY3A 4AGDA 4FTIA 4MTAA 1GNGA 4L44A 1F3MC 1K2PA 1PMEA 4PP7A 4YSJA 4YTCA 2WTIA 2GNIA 1T46A 3BGZA 3C1XA 4EOOA 3ZZWA 5A4LA 2BAJA 3C5IA 5IQIA 4IM0A 4IMYA 1QPJA 4IH8A 5KNJA 2GQGA 3D0EA 3BPRA 2JDTA 2OZAB 2XIRA 4I4FA 2C5OA 2WMQA 2XB7A 3PWYA 4F1TA 4ITIA 5IA4A 4JS8A 3CS9A 2WHBA 4CKJA 4FICA 3O7LD 4KIKB 5FTOA 4GIIA 2XNNA 4WD5A 3RNIA 4F0IA 4LUDA 3UO5A 3IONA 2PUNA 1H0WA 4J96A 4BDAA 2XM9A 2VTAA 4NKSA 5EK7A 4AX8A 4I20A 4IB1A 3HMNA 4GT3A 1OUYA 5IQBA 1NT2A 3F82A 1V0OA 2WQEA 3OCBA 2YACA 3TV6A 1ZWSA 3D83A 3FLNC 3VUIA 3GU7A 4LMNA 4X2GA 2WMAA 2WQOA 2X4ZA 4IM3A 1KUTA 5CXZA 3HEGA 1G8SA 2YM5A 2IN6A 4DINA 2HZ0A 3HMPA 1ZYLA 4LL5A 2AC5A 3K54A 2R3GA 4MWHA 4RT7A 5I4NA 2Y8OA 4FKWA 1OUKA 4BN1A 4M7IA 4QNYA 3Q6UA 3UZRA 3PP0A 4A06A 2VN9A 3EQRA 2BDJA 2UZUE 3ZO3A 3R8PA 4HVGA 3VAPA 2XJ2A 4D9TA 3AT3A 2A2AA 4F9YA 2YWVA 4EL9A 4C02A 3DJ7A 4IZ5A 4S34A 4IQ6A 5AMNA 3FZ1A 1FMKA 4PDOA 3TN8A 4LQMA 2ACXA 3ZCLA 4O7NA 1QPCA 1OIQA 4A7CA 4EOLA 3TUCA 4C36A 3JVSA 5LWMA 4RZVA 4XV1A 2G2HA 1JQHA 5ANDA 4CCBA 5K9IA 4FZ7A 4U5JA 4I5PA 4IAKA 4CKIA 4DFZE 3TJDA 5CEIA 3UMXA 5JFXA 1XH6A 4KKHA 3EKNA 3HV7A 4AZVA 4MNFA 3A8XA 1KV2A 5IQFA 4HYIA 3VW6A 2CKEA 3U54A 1Q5KA 3A2CA 3U9NA 1KE9A 3FXZA 4JG8A 4PX6A 3RK5A 3ZO4A 5DRDA 4IXPA 4TXCA 2RIOA 2WKMA 3QKKA 4FV4A 4YBJA 5AR7A 1UU9A 2VWZA 3EN6A 2XK3A 5HOAA 3ZUTA 4J8MA 4LGHA 3W8QA 3PWDA 3OCGA 4DFNA 3JPVA 4O7VA 2CNVA 4DGGA 3ET7A 4NFNA 1MRVA 3I5NA 5LVMA 2XMYA 4FKRA 4I92A 4C2VA 4DG0E 5C26A 5C27A 2YCSA 1UU7A 2XVDA 4BI0A 3TNHA 3IQ7A 4EJ7A 4IDVA 3GU6A 5ITAA 1BX6A 4FIHA 1G5SA 4BC6A 1OL6A 3VHKA 4CEGA 4HVDA 1IA9A 1F5QA 1WBWA 1W8CA 3AMYA 1XJDA 2XYUA 2H96A 3I7BA 4KA3A 5ETFA 4RGJA 3EOCA 5HG8A 1WFCA 5FDXA 4OT6A 4E73A 3KL8A 2JIUA 4FSNA 1JOWB 4D2SA 2ZM1A 3H4JA 3NUSA 1UKHA 2BAKA 3LAUA 3RPSA 5FTQA 2C5YA 2QOOA 4I22A 3G15A 1SZMA 4BTMA 2C4GA 2VWBA 3R63A 3RPRA 4ANQA 1OPLA 4NWMA 2P2HA 4ZMEA 3RNYA 5IH5A 3LOKA 3QQGA 4GS6A 4W4WA 4YHTA 3MJ1A 4YP8A 4RQVA 5JZJA 4LV5A 3ODYX 3PIZA 4DFBA 2R3LA 5CI6A 4OR5A 4IAZA 4K11A 1J1BA 3B2WA 2F2CB 1WZYA 1W0XC 3G0EA 4R77A 4ZJJA 1W82A 3C4FA 2YITA 3CEKA 2QR7A 4IWDA 4AQCA 1AGWA 2YM7A 5LMKA 3KB7A 2WMXA 2CCIA 3BU3A 3FC2A 3H10A 2W4JA 2VTSA 1IAHA 4BKJA 4HYHA 1PJKA 3OWJA 2BTSA 2PVNA 5AP1A 4ZS0A 5JEBA 4HNFA 4RC3A 4GKHA 3HRCA 3LFDA 4G3EA 4KIOA 2GFSA 4OTHA 3TTJA 4X7QA 3T9IA 5AUVA 3KRWA 1U54B 2KULA 3TTIA 4BYJA 2PMNX 4EC8A 4RSSA 5HI2A 1PF8A 1DM2A 1FVTA 4FUXA 4GEOA 3UNKA 2XRUA 5J9ZA 4CXAA 4U44A 1ZRZA 3AD5A 3P5KA 5A6OA 5BYYA 4DCAA 3GVUA 4AGUA 2BILB 3RWQA 1PMVA 1FGIA 4ZIMA 1ZOHA 4O0SA 1XBAA 3N51A 2CHLA 3UJGA 4A9RA 2CLQA 4PTGA 4FIIA 4WO5A 3E87A 2I0EA 4FKTA 3S0OA 3MVLA 4FSZA 3WE8A 4UY9A 2ONLC 4EKKA 2W99B 4KABA 4R5YA 1FINA 2ZM4A 3MJ2A 4RX8A 5EI6A 5JZNA 2BZIB 4JJRA 4WHZA 4EH2A 4NJDA 5CY3A 3CQEA 4JX7A 2A0CX 5C4KA 4JDJA 4BCMA 2ITUA 3DXPA 2XF0A 3CLYA 2YISA 4PNIA 3GI3A 3FSKA 4R1YA 3FUPA 4MXAA 1CSNA 3JVRA 3II5A 5E8WA 4A9SA 2QKRA 3GCSA 4JBPA 5A54A 1H00A 1GZOA 1Q61A 5GZAA 3QALE 3TNQB 3K3IA 2UW7A 1PXIA 2VX3A 2VGOA 3GBZA 4MYGA 3HMOA 2UW5A 1YWRA 4U3YA 4YUQA 5HO7A 3WILA 2XNMA 4FKLA 5JRQA 5AUZA 2ETRA 2FSOX 4M8TA 1ZLTA 5FXSA 4TN6A 4WA9A 3IKAA 3NLBA 2WMBA 3RPYA 4L67A 4F08A 4Z7GA 2UZBA 3D5UA 4UYAA 3DY7A 4L43A 3ITZA 5IKWA 3AC1A 3RI1A 4ASZA 4DG2E 2UW9A 5BMMA 3RCJA 5KMIA 4FZFB 4GYIA 2QC6A 3FZPA 5CF6A 5ANIA 4WRSA 5DN3A 1JVPP 4UWBA 4V0GB 5E91A 3SOCA 3V8WA 5LVPA 4G9RA 3M42A 2I40A 2YCRA 4EOSA 3QZGA 4FNWA 4WIHA 3CKWA 3O23A 1MP8A 4CFXA 3SDJA 3ZFXA 4F64A 4O84A 3QGYA 4UMRA 2VTNA 3UQFA 4U41A 3C7QA 3MBLA 4QP6A 1A48A 4L42A 3RP9A 4BIBA 3L9MA 4DFXE 4YPDA 5DT0A 3ZSIA 2B9IA 4BHNA 4D0WA 2C3KA 2UZEA 4L00A 4QMNA 5BPYA 3SA0A 3AD4A 5C8MA 3AGMA 1UV5A 4EKLA 3V6SA 4MNEB 3CY3A 5IQAA 3CC6A 2VWYA 5HO6A 2PZPA 4TTHB 3MH1A 3HECA 4JOAA 3SRVB 4PMSA 3DCVA 2JFLA 3KXHA 3OBJA 5DHJA 3C13A 2ZJWA 1VJYA 2W4KA 2QOKA 2PZ5A 4U79A 5KMLA 4FL2A 2WQNA 4RMZA 5FTGA 5FBOA 4D28A 4EK5A 5F20A 5G6VA 2SRCA 2CMWA 3H9OA 2DWBA 2B1PA 2QQ7A 4RWJA 2ERZE 4L3JA 2A1AB 3V5LA 4O7RA 3HVCA 5J7HA 4DYMA 2J4ZA 3ALNA 2BUJA 3V8TA 2PZRA 2XUUA 4ENYA 3D94A 2EXEA 3NSZA 4L45A 4F1MA 3A60A 5EH0A 5EHOA 5CF4A 3LJ2A 3SOAA 3V5JA 1R39A 1XR1A 4FI1A 4FV8A 4FV1A 2OJFE 3BKBA 4WSYA 4MBIA 4JT3A 4TWOA 4QPMA 2YA9A 4HCTA 4OT5A 5CNNA 3IDBA 3NNVA 4ZY4A 2E9PA 4MXYA 2Z02A 4ANSA 1LEWA 2XBJA 3PSDA 2EVAA 3ZTXA 3DKFA 5DNRA 3V3VA 3WIGA 2VWUA 3RGFA 3O96A 1OKWA 3PA5A 3I0QA 3K2LA 3KRLA 3EN9A 3T3VA 5FUTA 2QKWB 4ZZOA 4Q9ZA 3OT8A 1IA8A 2Y6OA 2WFYA 4RFMA 1GZ8A 2XEZA 3QCSA 5CXHA 3OUKA 2DYLA 3DBDA 5E1EA 5EKOA 4TPTA 3PIYA 3ZXTA 3ZXZA 2RG6A 3MIAA 5I0BA 4E5BA 3LFCA 3BELA 3PYYA 2VTOA 1RW8A 4PPAA 4B7TA 3UNJA 2O0UA 5HCZA 1Z57A 2ERKA 4MBJA 3TNWA 2GQRA 5AM7A 3LFEA 2EUFB 4C59A 4LRMA 3C50A 5FG8A 5HG9A 3R8LA 1URWA 4FT0A 5EOLA 3DGKA 2ZDUA 3R7GA 4ONAA 3FC1X 3SAYA 4ZS4A 5BVNA 3OG7A 2P3GX 1KE6A 3FKNA 4GCJA 1YRPA 4X6RA 4WT6A 4BDGA 2VO7A 3CCNA 3QD3A 4ZTHA 3RK9A 1YHSA 3ORLA 2X39A 4O6LA 3D7TB 2J0MB 3MV5A 3MY1A 4F7JA 1Q97A 4NH1A 4I0RA 3BWFA 2XKCA 3OW4A 4GK3A 3UDBA 4FE2A 3NCGA 4HVHA 1O6YA 3WI6A 3TXOA 3FI2A 4JAJA 2C6OA 3FE3A 4IX3A 5DVRA 3DAJA 5GJGA 3UG2A 1SNUA 3PVWA 4G16A 4ZTNA 4I0TA 5M57A 3ORNA 2EWAA 3KRRA 3NUNA 3NX8A 3P0MA 3OXTA 4G3CA 4JBVA 2XM8A 3TZ9A 3E7OA 3NAXA 4ASXA 4HVIA 4D2VA 1XH8A 5AUWA 3BRBA 3QGWA 4MHAA 4GUBA 3WZJA 4BGQA 2YAKA 5ETIA 4KUJA 2HYYA 3ENMA 1ZARA 3NUUA 3F6XA 3Q9WA 3GGFA 3U4UA 4EUUA 5IA0A 3QD2B 4AF3A 2X6DA 2C6LA 5C8NA 3DXQA 4EBWA 4RX7A 2FB8A 3V5PA 3EQGA 2WZJA 4YNOA 3VS7A 5A46A 2QO7A 3BHUA 4G3FA 3HDMA 3QZFA 1OKVA 3DB6A 3EH9A 4O91A 3NIEA 4U81A 3UYTA 2XNBA 3ELJA 3H0YA 2WMSA 3NYNA 3U6HA 5DYJA 1OPKA 3COHA 4M3QA 4PWNA 4TWNA 5K0XA 3ORXA 2F7XE 2X1NA 3LFFA 4HZRA 4W8DA 4AXAA 4EORA 4XRJA 3HAMA 2X2LA 2YM6A 4IADA 3L8SA 4I5HA 3D2KA 2BRMA 2J50A 3R0TA 4FZAB 5K0KA 3Q3BA 4C0TA 3MH0A 3HA8A 4OTFA 4O0YA 1WVXA 3M2WA 3Q53A 3QKMA 4EQCA 3PPKA 4GFOA 3GUBA 2RG5A 3ZEWA 3SXRA 4QYHA 2YERA 2QHNA 4NM3A 2XK6A 5CEOA 2OH0E 3UQGA 4M67A 2J0KA 3PZHA 5C9CA 3EJ1A 4RVKA 4O7YA 3EYHA 3FLQA 4D0XA 5IH4A 3OP5A 4EZ3A 5FQDC 3DK3A 5DE2A 4CV8A 2HK5A 1PW2A 3QTRA 3DKCA 3TKHA 5HVYA 2FH9A 4H05A 4UBAA 4S32A 3GC0A 3C4XA 5KBRA 4F9AA 3CTJA 5ACKA 2QO9A 4D2PA 2GS7A 3U55A 3R9NA 4HCUA 3T9TA 3OS3A 2WOUA 3Q4TA 3W2SA 4FIGA 1KE8A 3MDYA 5JQ8A 5DRBA 2ITOA 4A9UA 4FTRA 3O7LB 3R21A 2W5BA 1UNLA 4M15A 1OM1A 4MVFA 3QYZA 4O0TA 1ND4A 2RL5A 3F69A 3ZONA 3E3BX 4PMTA 2OI4X 3NDMA 4ACCA 4IVBA 5IUIA 2F4JA 2BROA 1YXTA 4I5CA 1XO2B 4LFIA 4CQEA 5LVOA 4E93A 3FMLA 5HQ0A 4K9YA 4ZJIA 5M4UA 4WG3A 2E9OA 2WMWA 3D9VA 3R9RA 1WBOA 3O71A 3UIBA 4AT4A 3M1SA 5IUGA 3OD6X 4M69A 4HGTA 4C34A 3HUBA 3VC4A 4EK6A 4CG9A 5D41A 2CN8A 3W33A 5EM5A 4F7SA 3OWKA 3VS0A 3ZLYA 5C8KA 1Q3WA 4MD8E 1JBPE 4AT5A 3CR0A 3UGCA 3NMUF 3AGLA 5T6KA 3Q9ZA 4JI9A 1PXKA 5IA3A 2ITNA 3C4WA 1WVWA 4KB8A 5ACBC 4AS0A 3KVWA 4P4CA 4USDA 3REPA 3ZO1A 2WIPA 3TZMA 4BDJA 2YIXA 2CJMA 3D7ZA 2UZDA 4RJ8A 4C38A 3QQHA 5AM6A 2X9EA 3AC8A 5F94A 3LMHA 2P55A 3QF9A 4CSVA 1B38A 3WF5A 2X8EA 4MEDA 4QP8A 1MRYA 2F2UA 3QRIA 3ZFYA 3NNWA 2Y4IB 3IW6A 4LL0A 3OWLA 5L8JA 1CKPA 2PL0A 5FD2A 3COIA 5DEYA 3ZC6A 3PXZA 2CNQA 1H0VA 2WTKB 4DEDA 1FGKA 2YM8A 4CKRA 3SQQA 2F9GA 4L3LA 4O38A 4QYYA 4R1VA 3FI8A 2JAMA 5J9YA 3P4KA 2JGZA 4EOKA 3R73A 2I0HA 4DGOA 4YC3A 2BIYA 3PSCA 3EQFA 1YOJA 2X6EA 5FM3A 5CASA 4RJ7A 3R30A 4WKQA 1BLXA 2JDRA 4OGRA 3Q6WA 4E26A 3A7HA 3SXFA 3PLAE 4XV3A 4FVRA 5FWKK 3MIYA 4GKIA 4DN5A 1BI8A 3IGGA 5I9ZA 5F4NA 5IG1A 5L2TA 4Z3VA 3KA0A 3RMFA 3ZSHA 2JKKA 4M68A 4GG7A 3DXNA 4GU6A 5LMAA 3FMEA 2YAAA 3PFQA 5JFVA 2UZLA 4AP7A 3UZTA 5KZIA 5DGZA 4FOCA 2EB3A 4F6WA 5AV3A 3NUPA 3B8RA 5DMZA 2Y4IC 5BX0A 3ZRKA 3FQSA 4BI2A 5EQYA 3FMHA 4L8MA 1KWPA 4MK0A 3WYYA 3V01A 4Z55A 2RFSA 3MGYA 3P9JA 4FTAA 4JQ7A 4AZEA 4EOJA 4ZSLA 2XK9A 3MS9A 2QG5A 3W10A 4BR3A 2XNEA 4RLKA 4YZBA 5D7VA 3QD4A 3HX4A 1XKKA 3LW0A 5CYIA 5TF9A 3VQUA 4H3PA 1BL6A 2PE2A 2DS1A 1YHWA 5AR2A 4FNZA 4XOZA 4C8BA 3EZVA 1H1QA 3BX5A 5TOZA 2CGWA 4UN0C 2Z60A 4FVPA 4NSTA 5AP3A 2JIIA 3FL4A 3IS5A 5C01A 5EM8A 4KINA 4RVMA 4Z9LA 2ITVA 3KXMA 4BZOA 1HOWA 3PJCA 3EMGA 3OTUA 4MXXA 4TRLA 4B99A 3W32A 2IZRA 2Y7JA 4YO6A 4II5A 4F6UA 2OJJA 4FTLA 2GMXA 3Q60A 4RX9A 4C3PA 4H58A 4OBOA 4AT3A 3QQJA 5DIAA 1H1PA 5EW9A 5K4IA 3EQCA 5LARA 1GIJA 2OWBA 4RA5A 2X0GA 3D4QA 4IIRA 2P2IA 5E8UA 5CANA 4JDHA 1R3CA 2CN5A 3QX4A 3KGAA 5HGIA 4YMJA 4XG4A 5CF8A 4GT4A 1V1KA 2IW9A 3IW8A 2GCDA 4XCUA 2CNUA 1OB3A 4HOKA 5LVLA 4ZMFA 4BFMA 4X2KA 4C4EA 3JS2A 1ATPE 3NS9A 4XP2A 2B54A 1H8FA 3OEZA 4G6OA 3HMMA 3TNIA 5CVGA 4GK2A 2C5VA 2J51A 2Z2WA 2BIKB 3ATTA 4YNEA 4ITJA 4RLLA 2RKUA 3R9OA 5J5SA 5KMKA 2OO8X 3FQHA 5HLPA 4D4RA 4O86A 3BHYA 3QCXA 4BDKA 4MAOA 5D7AA 1PXOA 2PVYA 3RPOA 4NIFB 5BQ0A 1S9JA 4KRCA 4CD0A 3OUNB 3DQWA 4NEUA 3TV7A 3W1FA 4M0YA 2VTQA 5HNIX 2ZB0A 4YZDA 1YWVA 5IA5A 2J6MA 5K4JA 5ETAA 4CT1A 4RWLA 3CTHA 5IQGA 4EH4A 4WBOA 4PL5A 2YLFA 4RZWA 4F1OA 1TQMA 3GCUA 4IAIA 2AC3A 4I41A 3E88A 3PZEA 3PXFA 4WBBB 4PMPA 3RM6A 2R3QA 4QOXA 1P14A 2C1BA 2GNHA 2VTJA 3BGQA 2UW0A 3KF4A 3NW5A 4FSTA 4IFGA 4QP3A 3R83A 2CKOA 3RALA 4EWHA 1YXUA 1OIYA 1YI6A 3C4CA 3NGAA 3Q5ZA 4C2WA 4EOIA 1KV1A 3GQLA 3QYWA 4CFWA 1H28A 5CALA 2WEVA 3LPBA 4EC9A 5K5XA 4UYNA 5ANJA 2DQ7X 3KEXA 3I81A 4XOYA 3F5XA 5H2UA 2YZLA 1O6LA 3EWHA 3OFMA 4XBUA 2B0QA 3LJ0A 3MWUA 5CF5A 4TZRA 4MWIA 1OIUA 4H3QA 5HVJA 2Z7RA 2XYNA 3EIDA 3OWPA 4KSPA 4KS7A 4S31A 5HTBA 4EH5A 4PDYA 4DLIA 5L6PA 2R3KA 3SW7A 2C3JA 1RDQE 4MXOA 1PHKA 5ANKA 3EKKA 5CSVA 5IQHA 3UPXA 4NFMA 2R0UA 4O6EA 3W2OA 3F2AA 3PY0A 4JIKA 3D5WA 3LXLA 3PXQA 3Q4UA 3AC5A 3Q9XA 3W55A 4YC6A 1PKGA 4XHKB 3IECA 2Z8CA 1ZY5A 5DG5A 4KAOA 3RBWA 4ZTSA 3VUHA 3UP2A 4L7FA 2H9VA 4CNHA 4O7SA 2XNPA 1H07A 4EUTA 4AFEA 3S95A 3DJ6A 2KTYA 2V55A 3THBA 4ANLA 1J1CA 1M2PA 1YVJA 4ANBA 5FEDA 4O1OA 4O1PA 4TT7A 4U43A 4YURA 3VQHA 4BCGA 5M06A 1WMKA 3ZSGA 4Q2AA 1YDTE 4FT5A 3FL5A 4XLIA 3RZFA 2UW4A 3GB2A 4DGLC 2VTRA 3LCKA 1YOMA 4H3BA 5BVKA 5CU6A 1ZMUA 2C0OA 3TACA 4DH5A 5K5NA 2G2FA 4K18A 3WZUA 1PXPA 3PG3A 3L8PA 2YN8A 2X8IA 4RIYA 3PXKA 2B7AA 3UVQA 3PVUA 2FGIA 2R3OA 4BVUA 3UOJA 2OZOA 3PJ2A 2WTCA 2J2IB 5IEVA 2FYSA 3ZM9A 4M66A 4EJNA 5M08A 4Q5EA 3SV0A 3IK3A 4OAVB 2Z7QA 2IJMA 2OGVA 4RIXA 4YJQA 5FEQA 4AN9A 3WF7A 2C68A 4RJ6A 4ZLOA 2IPXA 4GU9A 3R22A 2XNGA 4B0GA 2HIWA 3EYGA 4UMTA 4FR4A 5A4QA 5KMJA 5KO1A 3TZ8A 1JKLA 3BEGA 2VTTA 4JLCA 4EHVA 1H26A 3TM0A 4U3ZA 4BTKA 3ZM4A 5E8ZA 5IPJA 4QQJA 4AW5A 3RWPA 3RM7A 2W7XA 3DK7A 4PV0A 4GUEA 5DT3A 1OL1A 5CAPA 2R3MA 3E63A 4ZEGA 5L2IA 2ITXA 2JFMA 3PY1A 4ZSEA 4GVAA 4HW7A 2NNWB 2FA2A 4UWYA 3ZUVA 3RAIA 2ZB1A 3CKXA 2WTWA 3GXLA 3ORIA 4FV3A 4R7IA 3SC1A 3DKOA 1OKYA 5AWMA 4BGHA 4FV5A 4LGDA 1I44A 2HZIA 1E9HA 5HO8A 4KRDA 4TYJA 4CT2A 5L2SA 4CFVA 4UXLA 1DI9A 4PNKA 3F7ZA 4R3PA 4BDHA 3GCPA 3EN4A 1J7IA 5IF1A 4DFUA 4F7LA 4CZTA 5L8KA 2C69A 4OTDA 3VIDA 4CMUA 3QU0A 4ANNA 2Y6MA 3B2TA 4KWPA 3EFKA 2Y4PA 4J53A 4YC8A 4YHJA 5A4EA 5KMNA 4DT8A 4D4YA 2BKZA 2R7IA 4JVGA 5GIOE 5AA9A 5CAOA 3AQVA 5CNOA 5JKGA 4TL0A 3ZDUA 3PTGA 4EZ7A 3VBTA 3E8DA 1REJA 4DA5A 3UYSA 4YJSA 5AUUA 5FDPA 4UB7A 4I21A 5ETCA 3DS6A 4L53A 4YZ9A 5HD4A 4AOJA 1W98A 3EL7A 3CD8A 3DK6A 4RIWA 1J3HA 3D2IA 3LJ1A 4FSMA 5BVDA 4C35A 4QQ5A 3PP1A 4BF2A 4KIPA 5CQUA 3F61A 3PPJA 4CRLA 2OSCA 4ZY5A 3MTFA 3FI4A 3A99A 4F0GA 5LCKA 3N4UA 4XRLA 2GHLA 2OIBA 4FGBA 4YJTA 2VTHA 2WB8A 3QC4A 3FMMA 5IH6A 2OLCA 1KOAA 3KN6A 5AP6A 3DBQA 5ANOA 3VNTA 3OXIA 3L1SA 4TWCA 1UNGA 1UU8A 3H30A 3MPAA 3WOWA 1XBCA 3K5UA 1GJOA 5L4QA 5AX3A 3I1AA 1QMZA 2ITPA 3MI9A 4FG7A 3ACKA 4DE4A 2QOQA 2QONA 1JWHA 5GJFA 1A9UA 3GU5A 4M13A 5CSWA 5CVHA 4BBMA 3IO7A 4A4XA 5LJJA 4QMPA 3K3JA 3OMVA 2HXQA 4YLLA 4BWXA 2PVJA 2OFUA 2R4BA 1Q4LA 2WIHA 4YHFA 3F3TA 3R7IA 1WCCA 3WZDA 2WOTA 2X2KA 4P7EA 5LMKC 4RRVA 4FKOA 4DTKA 2PPQA 2AUHA 3KXZA 4FEXA 4M97A 4G6LA 5FEEA 3HUCA 3FMKA 3VN9A 3LHJA 4NUSA 3D5XA 2BRBA 4ZP5A 3TNPC 3MH2A 4NKAA 4AA5A 2XCHA 4BTFA 4R6VA 5A14A 4EH7A 3OVVA 2QLQA 3RJCA 2W1GA 4Y83A 4D2TA 5GZ9A 3R2YA 2XNOA 4B9DA 3RINA 5HIEA 5HCXA 3NVMB 3TUBA 3P79A 4FSUA 3QUPA 2GDOA 5AV0A 1XH5A 2ZOQA 3BLRA 4RVLA 3R8UA 3KMUA 4A4OA 3PIXA 4D55A 4F6SA 5E92A 4CZYB 3TUDA 4OBQA 3HLLA 3QTUA 4OW8A 3PJ3A 4M84A 3SXSA 1G3NA 5TE0A 2BPMA 5L3AA 4TKSA 2HENA 3MFSA 2B9JA 3UC4A 2YABA 4FTMA 4FZ6A 3KFAA 3BHVA 4OLIA 4QQTA 2XKDA 3EQDA 3E5AA 3MVHA 4E8AA 4F9WA 2HZNA 2R3PA 2J0LA 3AC2A 4LM5A 3LQ5A 4EH3A 3KY2A 3VBQA 2WQBA 3IOKA 4IE9A 2OJ9A 4DAWA 2X7FA 1MRUA 2WXVA 4GL9A 3RHKA 4GSBA 4BTJA 3GFEA 3MY0A 4JX3A 1NY3A 3TJCA 4IZ7A 3AMAA 4FUYA 5T68A 4CG8A 4GMYA 4BWKA 3AT2A 3QHWA 4NW6A 4P2KA 3FMDA 2WAJA 5C1QB 1I09A 1UKIA 2JBPA 3H9RA 1J91A 3BU5A 1DS5A 3LCTA 4MX9A 4O0XA 4AW0A 4DEBA 5ICPA 3EB0A 4UMQA 5E8XA 3QTIA 3LQ8A 4I6HA 4YR8A 4YJUA 1JSVA 3A7GA 3ERKA 1JPAA 5TKDA 4XG2A 5EOBA 4AUAA 2I0VA 2PVLA 2PZIA 3LXNA 4IVCA 3DTWA 3RZBA 3P7CA 2YIYA 2RSVA 2WMRA 2YCFA 1JKKA 5E8TA 4OBPA 2H34A 4JNWA 4JRNA 3MY5A 4O21A 1FVVA 4ZZNA 4IACA 3EQBA 3KCKA 2HCKA 2R9SA 4D2WA 5JH6A 4AFJA 3DOGA 4G5JA 3RKBA 2ZM3A 4G5PA 4FV7A 4EOMA 4G31A 5H8EA 2E9UA 4NCTC 4B4LA 5GINE 3KREA 4KS8A 1Q62A 3NIZA 4QPSA 5AP2A 5EDPA 4AZFA 2WTJA 3POZA 3UP7A 4GH2A 5JT2A 4AA4A 3ORZA 2F49A 3OBGA 3TT0A 4M12A 3MB7A 3W2QA 4W8EA 4BDEA 4XBRA 4E3CA 5IU2A 4XG6A 1SNXA 2ZV2A 1RQQA 3LFNA 2RFDA 5HE1A 3Q04A 2QOHA 2VTPA 2YIRA 3NW6A 4QTDA 2W1ZA 4G17A 4EI4A 4G3DA 4IX5A 5E8SA 4HJOA 4EK8A 5BVFA 2JEDA 3QRUA 4XLVA 5GIPE 2HZ4A 3BI6A 3UODA 3CY2A 3VS1A 4F9BA 3O50A 1OVEA 3DZQA 4OTRA 1XHAA 3C0HA 1HCLA 3DDQA 5JGDA 4Y73A 4AACA 5BUEA 2XZSA 4Y8DA 1YKRA 4QMWA 3LKMA 1JNKA 1PMUA 3AXWA 4CQGA 4CYIA 3NZ0A 3TCPA 3A7FA 3OY1A 4NT4A 2YJRA 1IAJA 4IAAA 1UWJA 3CJFA 2GFCA 3PDTA 2NP8A 3ALOA 2WTVA 1GZKA 3O51A 4QYEA 1OITA 2I6LA 4C33A 2IG7A 4DH7A 1V0PA 1QCFA 5KUPA 4IWOA 4YBKA 4I3ZA 5BVOA 4RQKA 4ZK5A 2V7AA 4J97A 4JG7A 4I24A 4QMTA 4S33A 4BCIA 3SGCA 4O0UA 4S2ZA 5C4LA 4ZSAA 5AAEA 3DBCA 5B2LA 5CX9A 2XS0A 4BCFA 4R7BA 4MD7E 5IZFA 4ZTMA 3F2RA 1SVGA 1URCA 3UIUA 2RF9A 3UVRA 4I93A 2UW8A 3JY0A 2VWIA 2W96B 3KXNA 4QD6A 3W2CA 2DUVA 4HGEA 4OTQA 3GT8A 1REKA 4ANMA 4FTNA 5B2MA 4GT5A 5HLNA 1JLUE 1PKDA 4TYEA 3HAVA 4ZTRA 2OH4A 1M7QA 2XKFA 3WF6A 4C4GA 4HGLA 5HORA 5IDPA 4N6ZA 2PYWA 4I94A 3BV2A 4UWCA 1XBBA 3UE4A 3VULA 3R02A 3PUPA 2YEXA 4R3RA 5M44A 3IW4A 3VBWA 3A4PA 3QZIA 4O22A 3VWAA 4BCKA 4D2RA 4FV0A 1GY3A 4O0VA 5DR9A 3VJNA 5CT7A 5HZNA 2RFNA 5J79A 1J7UA 4FOBA 4NL0A 1JAMA 3BE9A 4IJPA 3QL8A 4GV1A 5AP4A 4EQUA 2PZYA 1TKIA 3UO4A 3KMWA 5F9EA 5A4TA 3I7CA 3FKOA 3IW5A 4PTEA 4I5MA 4IVAA 2NRYA 4LRJA 1BKXA 3WE4A 1Q99A 1XH7A 4HNIA 3P7BA 4MBLA 3ZS5A 2GNLA 3OTVA 3ORKA 3PXRA 4XJ0A 1H25A 4C3RA 4LI5A 4E4MA 3PG1A 4E20A 3ANRA 3FEGA 2FUMA 3G6GA 3UMWA 5EQEA 2JDOA 4JRVA 2CGVA 2UUEA 2ZV7A 1MQ4A 3IG7A 3PLSA 2JKOA 4JQEA 4UZHA 4V05A 4EZ5A 5HE2A 2QO2A 4R78A 3TV4A 3A61A 1V0BA 2B9FA 5HICA 4CFUA 4I6BA 5AEPA 2OBJA 1SMHA 2OJIA 3KULA 3M11A 5IA1A 2IW8A 4QT1A 2XK8A 4O27B 5J95A 3BV3A 3FSFA 4CLJA 2WGJA 3ZLSA 2ZVAA 3QCQA 4FV2A 5CSHA 4GFMA 3PJ1A 3NRMA 3Q2JA 4LYNA 1B6CB 1YXVA 4QTEA 2BZHB 2V62A 4CVAA 3D14A 2WMUA 4QP7A 4EHZA 3ID6C 2HWPA 2XK7A 4BCHA 4AOIA 2XA4A 5F95A 3QZHA 4LOQA 4ZSJA 5KBQA 3N4VA 3F3ZA 5JN2A 4BKYA 4EYMA 1FMOE 2VO3A 3G9NA 3MFUA 2CPKE 4FNXA 3FMJA 3G51A 3QHRA 5EYCA 4F4PA 3V8SA 3ZBFA 5L6OA 2ZMCA 3ACJA 2C6IA 2PK9A 4C4IA 4D9UA 3QCYA 4EOPA 3GEQA 3IGOA 3OZ6A 3KU2A 2BDWA 4JQ8A 2W9FB 4FEVA 3QLGA 5HNBA 3WARA 4JL9A 3COKA 5GZ8A 3QTSA 4XG8A 3GC8A 4F63A 3R1NA 1OL5A 1A06A 4BBFA 4KKGA 2H6DA 5HHWA 3QD0A 4OUCA 5E8VA 4Q5HA 4E4LA 3BQCA 4O2ZA 2QI8A 3LFBA 1QL6A 4IZAA 4PDPA 1CTPE 3E8NA 3ZO2A 4ZLZA 3F5PA 4H1MA 4QRCA 1K3AA 4R7HA 5HG7A 4E6AA 3QKLA 2HELA 4EBVA 2JDVA 3FYKX 4D5HA 5CS6A 4RPVA 4BZNA 2C0IA 3H3CA 4TYHB 5HTIA 3LLAA 4FODA 3EL8A 4MD9E 4QMVA 4BDCA 4I6FA 3Q4ZA 2FO0A 1SM2A 4AAAA 1P5EA 3LVPA 4FA2A 4HYUA 2B9HA 3MA3A 1S9IA 5FGKA 2IVTA 4N70A 5CLPA 4BBEA 2X9FA 3U8WA 4BYIA 1WBSA 4AG8A 5M53A 5HE0A 1UA2A 1SVHA 4BCOA 3U87A 4ENXA 5IUHA 1DAWA 2CKQA 1PMNA 1YW2A 2Y9QA 5DEWA 2BFXA 5CWZA 3ZOSA 3DT1A 3R04A 3FZOA 4LRKA 4OTIA 3EZRA 4M69B 3MPMA 5JSMA 5LXMA 4OTPA 4KD1A 3FMNA 3KK9A 2I7QA 4ZOGA 2W5HA 3E92A 3U4WA 2VRXA 3DZOA 3FI3A 3LE6A 2HAKA 1IASA 1R78A 3PSBA 5HEZA 2X8DA 4FNYA 3CBLA 1H1WA 3ZU7A 1UVRA 4KKEA 2YHVA 4A07A 5CVFA 4AGCA 5H9BA 5HIBA 1PXMA 3ROCA 3BCEA 3VS4A 2ITYA 4ZLYA 1PXLA 2GS6A 5J8IA 4LOOA 3NYXA 3HRBA 3P7AA 4IM2A 3E7VA 3N4TA 3OCTA 2W5AA 5DLSA 5AP0A 4FV9A 1GIHA 4FSYA 4FTTA 2VUWA 3RCDA 2B52A 1AQ1A 2EB2A 3UVPA 4C4HA 3OROA 4RIOA 5AUXA 3DTCA 5CEQA 3VF8A 1OZ1A 2O2UA 2QOIA 2VWVA 4CFMA 4DFLA 4DLJA 1YDRE 5LCJA 5AX9A 3LQ3A 2OU7A 2OF4A 1RE8A 1Q8ZA 5CZHA 3RK7A 5KE0A 4BL1A 5DOSA 3QRTA 4CCUA 5AADA 1H24A 4QMXA 3NCZA 2OFVA 3GCVA 3HV3A 5DFPA 4I6QA 2OXYA 4D1XA 4DCEA 4FC0A 4GIHA 3VS5A 5CU2A 3S4QA 3P1AA 4QMYA 2VWXA 3D15A 5H8BA 4NM7A 3QTZA 1BMKA 2V7OA 5L2WA 1PXNA 4DFYA 3NAYA 3VBXA 4BIEA 4F65A 3E8EA 4X3FA 4CMTA 2PVMA 4FKPA 1GIIA 4IDTA 4MQ2A 4CGAA 4P5ZA 2YIWA 5E4HA 3BHHA 4O7LA 4K6ZA 4XV2A 3FLYA 3FY2A 1VR2A 3FXXA 3G90X 3R1SA 3FYJX 3A62A 1IG1A 4QP1A 2UVXA 4ALVA 4Y5HA 4DEAA 5EYKA 3CXWA 4AWIA 3QA0A 2R3JA 3WF9A 3NYOA 4PF4A 4USEA 4GFGA 4W4XA 1PRYA 4HYSA 4BCQA 5E8YA 2C6EA 5FRIA 4XV9A 2C30A 1FPUA 5D11A 4FKJA 4C4JA 2WTKC 3FZSA 3ZRLA 3OEFX 1ZOGA 4XH6A 5K3YA 2GNFA 3AT4A 2XRWA 1GZNA 3Q4CA 5HESA 4ZXTA 1JSTA 1WVYA 4ZTLA 4DTBA 3R1QA 3H0ZA 5JRSA 3FZRA 4WG5A 4DEHA 2C0TA 2C6KA 5JFWA 5M4CA 3QXOA 3DFCB 2VX0A 5KMOA 3SKCA 4C58A 3CPBA 4ARKA 3MSSA 3R8VA 3TG1A 3UO6A 4WSQA 1WBPA 3C5UA 3HYHA 4WNKA 3UNZA 3C9WA 3FZTA 3E64A 3QWKA 3CPCA 1OBDA 5IDNA 1BYGA 4L68A 4QP9A 3DBEA 3G6HA 1Y6AA 4F99A 4FKVA 3WF8A 2XCKA 1LEZA 3G5DA 3GOKA 4EHGA 5I3RA 4ZTQA 5EM6A 3VUMA 4ZAUA 2WQMA 3I4BA 2RGPA 4NTSA 4K1BA 4RFYA 3VUDA 2IWIA 3FPMA 3SG9A 2XK4A 5T3QA 4ACGA 4RFZA 4G2FA 3OCSA 2W1FA 1M2QA 2J0IA 3GC9A 4OTGA 4E1ZA 2QURA 2PULA 2BHHA 5HNGA 3CD3A 1OECA 4FYOA 2YDJA 2UZTA 2XIKA 5HCYA 1ZMWA 5CENA 3NEWA 4Y72A 3LCDA 2VZ6A 4FKGA 4E7WA 4DGNA 2PUUA 1ERKA 1YHVA 2GTNA 3HV4A 4GK4A 5ANGA 4AGWA 1LP4A 4BDIA 2BAQA 4D1ZA 5JGBA 4FT7A 3EHAA 2GHGA 3U6JA 4XMOA 4HVSA 5BVEA 4UMPA 4BY9E 3FY0A 3UOHA 1Q8WA 4YGAA 4GW8A 5M07A 1YQJA 3VBVA 2QOBA 1XH4A 1TQIA 5HU3A 1HCKA 2BZKB 3O8TA 2PWLA 1NVRA 2OKRA 3ZLXA 2CKPA 2BFYA 1H27A 4FTJA 2QHMA 3PXYA 3F3WA 4X0MA 2VWWA 4NYEA 2CGUA 3IDCA 4JAIA 4PDSA 4NW5A 4JIAA 3V51A 5GHVA 4NK9A 2OZAA 1W7HA 5DI1A 4QNAA 1FQ1B 4RJ3A 4B8MA 3EFJA 4KIKA 4I0SA 3S1HA 4FYNA 5E1SA 3Q32A 4FEQA 4J95A 2GU8A 2ZV8A 4QYGA 4YJVA 5I3OA 3VUTA 4ERWA 1SVEA 4D58A 2XIYA 4YJNA 3LCSA 1PYXA 1LUFA 2HW6A 2XIXA 3BGPA 4OAUC 2A27A 3R2BA 1JSUA 1PYEA 3E8CA 5AIRA 3RTPA 4DBNA 3LZBA 2ITQA 3F7WA 3F5GA 4FG8A 5IEXA 2VGPA 4J8NA 4BDFA 5TO8A 4YU2A 2VNWA 3RAWA 5HE3A 3EQHA 3EN5A 1U4DA 4ZSGA 3HNGA 3SW4A 2OXXA 2VD5A 4R3CA 3A7IA 3TWJA 3R28A 4IBMA 3VRZA 4YTHA 3KXGA 3BEAA 2GNGA 1ZYJA 4W9XA 5I9UA 4B6LA 1L3RE 3MN3A 3QUEA 3ZBXA 3ZLWA 2C3IB 1UNHA 3FDNA 2FVDA 3I5ZA 2NPQA 4FG9A 3V5TA 1OL7A 1WAKA 2VU3A 3QX2A 4IZYA 4W9WA 1TVOA 2QU5A 1NXKA 2I1MA 5EHYA 3DAEA 3DA6A 3P23A 2BMCA 3Q2MA 4RG0A 5FXQA 3VS2A 2XJ1A 4CTCA 4D4SA 4Z16A 2UVZA 2XBAA 4IAFA 4AZSA 3QRKA 3QRJA 4OTWA 2C3LA 2GS2A 4HPTE 4RWKA 5HD7A 3F2NA 1YOLA 4FF8A 4L6QA 2WNTA 4BZDA 4F70A 4FTUA 3E93A 4YTFA 3VF9A 3HP5A 4CZUA 5JGAA 4LV8A 3ANQA 3R8ZA 4BRXA 4N4SA 2W06A 2WMVA 3G33A 4KSQA 5CU3A 4X2NA 4C61A 3I6UA 1P4OA 3RHXA 5AIKA 2G15A
chains in the Genus database with same CATH superfamily
4IB0A 4AW2A 4E4XA 4AN3A 3PRFA 1U59A 4FL3A 3PE1A 2OIQA 4PQNA 3BZ3A 3NYVA 3LXKA 2CSNA 2F57A 3FHRA 2ZAZA 4PUZA 2ZDTA 4RIYB 5IQDA 2ZV9A 3F9NA 3DB8A 4NU1A 2AYPA 1Q8UA 2VTLA 2UZWE 2BCJA 4HZSA 4P90A 5AV4A 2ETMA 4J99A 4QMSA 2VNYA 5A4CA 3LMIA 2HXLA 1ZYSA 3TL8A 2W1IA 5HTCA 3NR9A 3TKUA 3ZHPC 5IMXA 4RIXB 3BYUA 3MESA 5KKRB 3AC4A 2B55A 2FSMX 2O64A 4QMQA 5I9YA 3B8QA 1WBTA 3ROYA 1VYWA 5DT4A 3ULIA 4W4VA 4U8ZA 5I5ZA 3JR1A 3BYSA 4LOPA 4YZMA 3PA4A 3V5QA 5I9VA 4M0ZA 4MCVA 4NM0A 4K77A 5CAQA 3A4OX 3NUYA 3FPQA 4J98A 4C7TA 4FEWA 3FV8A 2E9NA 3FAAA 4FIJA 4QYFA 4RA4A 3HDNA 4QTAA 2WU6A 4WG4A 3DKGA 3P78A 4U42A 2W9ZB 5AR4A 4X2FA 2GPHA 3GNIB 4UX9A 2F7ZE 1DAYA 3KN5A 2REIA 1NVQA 3CE3A 5D1JA 4U6RA 5LQFA 4MH7A 5AR3A 1U46A 4F0FA 3E62A 2C1AA 3WIKA 2W17A 3HA6A 3LFAA 5M4FA 3MFRA 4EH6A 3S3IA 1J7LA 1O6KA 4K0YA 4K33A 1TFFA 3ZRMA 1MUOA 1STCE 3KKVA 5CI7A 3UIXA 4BI1A 1M7NA 3ETAA 2CCHA 4YLKA 2VO6A 1JKTA 3K5VA 4ANOA 4H36A 5BNJA 2PMLX 5KHXA 5KKRC 1W83A 4FK3A 3WZEA 2ONLA 4FIEA 2CGXA 5L6WL 1U5RA 4G1WA 2O3PA 3UOKA 4ASDA 3W0OA 2BRNA 3ODZX 4XS2A 3AMBA 4LUEA 5M51A 4X2JA 1NVSA 1ZZLA 2OJGA 4RIWB 3SHEA 5J5TA 5J1WA 1L8TA 3W0MA 4ACDA 1U5QA 1PXJA 5CTPA 3BU6A 4FTOA 4IEBA 3ZMMA 5BYLA 3BYOA 1YXXA 4PP9A 3QQFA 3RAKA 4RWIA 4AZWA 5EDRA 3R1YA 1U54A 3MPTA 3EQPA 4EH8A 2C47A 3U6IA 4MUQA 2PTKA 3I0OA 4DDGA 2FSTX 5AR8A 1Z5MA 4ID7A 5ANEA 3CGFA 4Y95A 4QP2A 4CFFA 3G9LX 1WBNA 1ZXEA 4QMMA 2PVFA 4J1RA 4E5WA 1VEBA 3NFGB 4XUFA 5HKMA 3GFWA 2NRUA 3QAME 4MF0A 2R3IA 4PMMA 4JG6A 4WNMA 3DLZA 5D12A 2WD1A 4FK6A 4BWPA 2IZTA 2JD5A 1YDSE 4LMUA 2UVYA 4APCA 2O8YA 5M55A 1YI3A 1K9AA 1H01A 4U45A 1VZOA 4YJRA 4X3JA 3O8PA 5CEPA 5CQWA 4FT9A 4PL4A 4KIQA 2PMOX 2PY3A 5EI2A 2ZYBA 3WZKA 4BICA 3GQIA 3O2MA 4ALWA 2X7GA 4KBAA 4F9CA 3VHEA 4KNBA 5KMMA 4TYIA 2F7EE 4IB3A 2PVRA 1NA7A 2JKMA 3DPKA 3MB6A 3UQCA 5CU4A 3W18A 5IA2A 4K8AA 2IF8A 4AW1A 3OOMA 2QD9A 2Q83A 1SYKA 4FBXA 1Y57A 5CAVA 4CV9A 3I79A 2J90A 3DBFA 3PE2A 5JMSA 2EXMA 3KC3A 1KE7A 3PUFC 2H8HA 4DH1A 4E4NA 4GRBA 3IW7A 3KQ7A 4N0SA 2IVSA 3QBNA 4I23A 3QTWA 3ZUUA 4M14A 3HZTA 3ORTA 3OOGA 1AD5A 2C5XA 3HKOA 3TIYA 4CYJA 2R2PA 3OT3A 1E1XA 3DAKA 3QFVA 2VTIA 4FVQA 2GNJA 4JDKA 4DGMA 3G2FA 2HWOA 3CIKA 5KZ0A 4GVJA 2RFEA 2VAGA 4L3PA 3ZYAA 3TKIA 3ZZEA 4FTCA 3NVKI 3FBVA 5AR5A 1CMKE 4N6YA 3O8UA 4CLIA 2PUIA 4C4FA 5E9EA 5EG3A 4V0GA 3CTQA 4XEYA 4BIDA 4P5QA 4D1SA 4EK4A 3R7YA 4AXEA 2QCSA 5KCVA 4O82A 4IW0A 5L2QA 3LFQA 4NCTA 3VVHA 3R01A 3OC1A 4EONA 3BLQA 3Q52A 2JBOA 5CEMA 4TNBA 4YJPA 2Z7LA 2PUPA 1LPUA 2ITZA 3W2PA 4DG3E 4YSMA 4EWQA 3KF7A 5AV1A 2C5NA 3AC3A 5J87A 1R0PA 2QLUA 3MYGA 4N57A 1TQPA 2UV2A 3AKKA 4FIFA 1RJBA 3MFTA 3W16A 2IW6A 4IHPA 4BCNA 2W1EA 4O7TA 5AP5A 2PE1A 4PTCA 4RJ5A 4C57A 3Q9YA 1O9UA 4USFA 5L8LA 3GU8A 3GP0A 4MNEA 1PY5A 1OPJA 4DH8A 3AOXA 4YTIA 5I9XA 2PU8A 3SRVA 3E3PA 1H1RA 3BLHA 3KRXA 2J0JA 1CKJA 2GHMA 3C51A 2W1CA 3JY9A 5J9LA 3TDVA 4F7NA 3ORMA 2OXDA 3DU8A 5FP5A 2X7OA 3ENHA 1ZOEA 4O2PA 2Q0BA 3PVBA 1APME 2B53A 2OG8A 4QMZA 3R7UA 4QQCA 5D10A 3SVVA 4TWPA 2WO6A 4Y5QA 2X0OA 1IEPA 2B4SB 4QPAA 2XH5A 3NUXA 2XEYA 3I6WA 5C03A 3QC9A 3GOPA 4Q9SA 3BYMA 1CDKA 3BHTA 1Y8YA 2J5FA 4JBQA 4MXZA 4X21A 5D9HA 2GSFA 5GJDA 4AN2A 3P08A 2JAVA 1X8BA 4ERKA 2LGCA 3C4ZA 4GJ3A 2J5EA 3UTOA 3W0PA 3SX9A 3HMIA 3NNXA 5GNKA 4E5AX 4AOTA 4DTAA 3CSVA 5HBEA 4W4YA 5M56A 5JFSA 1YWNA 4FJVA 1R0EA 1XQZA 3FLWA 2WEIA 2R64A 3MH3A 3F66A 4EQMA 4O81A 3GENA 3NNUA 4E6CA 2ITWA 4AU8A 4BDDA 1ZYCA 4BGGA 3QLFA 3BYVA 4K2RA 5BYZA 3HV6A 3VUKA 3FWQA 5EHLA 2UW6A 4DH3A 5LOHA 3T8OA 3UZPA 1UU3A 4X6QC 4F09A 3GU4A 4J71A 2WTDA 2QG7A 4ORKA 2V22A 4NJ3A 3ULZA 3KCFA 4TNDA 3S2PA 1QPDA 4XG9A 4YJOA 5CZIA 2W1DA 3V6RA 4U40A 4ACMA 1Y91A 3KK8A 2IVVA 3OF0A 1OKZA 2BR1A 4HCVA 4CRSA 3WYXA 2X2MA 3JYAA 4TYGA 4AE9A 3HGKA 3L8VA 2R3NA 3GC7A 1GAGA 2BTRA 3LMGA 4C37A 4V01A 4HPUE 4DBXA 2R3FA 1Q41A 3D7TA 3HL7A 3LM5A 5E90A 4U97A 2P4IA 3VO3A 3W2RA 3HV5A 1FBNA 4RVTA 3HP2A 2NYAA 5IMEA 5DR6A 1FVRA 4R5SA 2WMTA 4JR3A 3U9CA 1Q8TA 5TR6A 4XYFA 1BUHA 3C0GA 4FRFA 3R7VA 2YDIA 1WBVA 3HRFA 4FL1A 4IC8A 3UG1A 5J1VA 2YCQA 3DDPA 5B7VA 2QVSE 3DNDA 3L9NA 2JKQA 5EKNA 2IVUA 3QTQA 2JC6A 3R71A 4ZY6A 1ZZ2A 5I9WA 4PL3A 3DLSA 4Y85A 4BKZA 5HBJA 5HBHA 5IEYA 3LIJA 3VUGA 5BVWA 4XNEA 3PY3A 2EXCX 2W4OA 2UZVA 3C0IA 2P33A 3BWJA 3BE2A 1VYZA 2BVAA 2WELA 5A3XA 1KE5A 4O0RA 4Y46A 5AP7A 3VW8A 4UMUA 4A9TA 2YM3A 4JMQA 3OHTA 4RC2A 5AFVA 4L46A 2YFXA 2ITTA 4J7BA 4BDBA 3IDPA 4RX5A 1XWSA 2LAVA 1UWHA 3BBTB 5EW3A 3FLZA 2IZSA 3PVGA 2GTMA 4I1ZA 1KSWA 4EEVA 3VS6A 3QQLA 3FJQE 3KULB 2C6DA 2R5TA 4JDIA 2OK1A 3TIZA 1Q24A 3Q96A 4PPBA 2A4LA 4QTBA 3BIZA 2UW3A 3QQUA 4GG5A 5FLFA 3N9XA 3LLTA 3LXPA 4JBOA 2YWPA 3ZEPA 4QMUA 4LG4A 1W84A 2HY81 3CGOA 3R7OA 5AAFA 3UOLA 3EFLA 4DEEA 3TEIA 5AUYA 2VO0A 3KXXA 3QQKA 4FSWA 2G1TA 4IAYA 4EOQA 1OGYA 2WPAA 1ZY4A 3A7JA 4MQ1A 4A4LA 3EN7A 4RJ4A 3F5UA 1E1VA 2HY0A 2J9MA 4WNPA 1BL7A 3V04A 2ESMA 1M2RA 2FSLX 4EK3A 3V5WA 5BUJA 5LVNA 1Z9XA 5IISA 4O83A 4IB5A 3RPVA 4DF3A 3R9DA 5DR2A 1NW1A 2P0CA 5DH3A 4AZTA 4TW9A 4O4CA 5FBNC 4FSQA 3LFSA 4FV6A 2C6TA 3S00A 2BRGA 1OIRA 3TMOA 2BDFA 5TT7A 4DEIA 4O7ZA 5FM2A 3KRJA 5KHWA 4FGRA 4GYGA 4YPSA 4R8QA 2BKKA 3R00A 5HX8A 3A8WA 2VTMA 4FT3A 2QOFA 2QOLA 1MQBA 2VX1A 3MVMA 3U51A 4NM5A 3WBLA 3MA6A 3CP9A 2O5KA 4BCJA 2WU7A 4WRGA 3IPHA 2G01A 3ORPA 2R3HA 3NUAA 4BCPA 2CLXA 1ZMVA 2XALA 2I0YA 4C3FA 2BZJA 4IVDA 2R0IA 1LR4A 3PJ8A 4HGSA 4UV0A 4DITA 1Q8YA 5DPVA 2NO3A 2QU6A 4TYHA 3SLSA 4FKIA 3TZ7A 1OMWA 3VS3A 4YLJA 4QMLA 2A19B 3FQEA 4QTCA 4APPA 4ASEA 3PRIA 3F3VA 4WNOA 5J7BA 1QPEA 1OI9A 4JR7A 4IWQA 1Y8GA 3CQWA 2Q0NA 5M4IA 2ETKA 2OIDA 3POOA 1M17A 1DI8A 2JITA 3Q5IA 5M09A 4WUAA 3DV3A 4RBLA 5JK3A 1G8AA 2XAMA 1OGUA 5HU9A 5LWNA 4WOVA 4U9AA 3OXZA 5EW8A 4S30A 4FTQA 3UIMA 3AD6A 5AUTA 2W0JA 4YZCA 5AA8A 5IQEA 4XG3A 2R7BA 3R8MA 3MW1A 2E2BA 4FKQA 5AV2A 2XIZA 3MVJA 2J7TA 4YZNA 5AJQA 4IX4A 3ZC5A 1YXSA 2Z7SA 3QXPA 1OBGA 2YLEA 4L01A 3BBWA 3ZH8A 4IJ9A 4IX6A 4FEUA 5EI8A 3FLSA 2QNJA 1H1SA 3LCOA 4IWPA 4L7SA 3SD0A 4D5KA 3BQRA 5BUIA 4AE6A 3LM0A 5DBXA 2OICA 2QR8A 2V5QA 2E9VA 3G0FA 3KVXA 4QO9A 2YDKA 3QA8A 4O0WA 2YIQA 4V04A 3COMA 3VJOA 4KBCA 5CEKA 5A6NA 5H3QA 3JUHA 1Y6BA 4E6DA 4QP4A 3OW3A 4H1JA 5B2KA 2ZMDA 1TZDA 5FP6A 4O96A 4U80A 4PY1A 2XKEA 3C4EA 2IO6A 4QMOA 5CT0A 5E7RA 5EFQA 5EM7A 3ZFMA 4UZDA 3H9FA 1CM8A 3FKLA 3UC3A 3R7EA 4ITHA 4GJ2A 4FMQA 1M52A 3SG8A 1JKSA 4H39A 3IOPA 3UBDA 2PHKA 1M14A 4CMOA 1H4LA 4G34A 2O63A 4UALA 5LMBA 5BMSA 3PFYA 4A9YA 4BHZA 3ATSA 2X81A 4X3FB 2C6MA 3JXWA 4ZZMA 4UEUA 1P4FA 3W8LA 3CQUA 5EYDA 4DC2A 4EH9A 2PVHA 4E6QA 4D4VA 2PSQA 3CJGA 4J52A 3DFAA 2GQSA 3QTXA 3ZDIA 5EDQA 2HOGA 2OF2A 4EHEA 4EYJA 2XJ0A 4NZWB 3PPZA 2UZOA 3DJ5A 4U0IA 5JQ5A 3MTLA 3I60A 5A9UA 4YO4A 4I4EA 4DHFA 2QODA 2W05A 1OL2A 2BRHA 4FTKA 4PPCA 4ALUA 1CKIA 2W1HA 5HVKA 3P86A 4MF1A 4G6NA 4JXFA 5CU0A 2BALA 5DWRA 4PRJA 4XX9A 2BHEA 3UDSA 5IQCA 4BB4A 3KMMA 1IRKA 3QWJA 5F1ZA 5HLWA 1IR3A 2EU9A 3NWWA 2JLDA 4MKCA 4FKUA 5DA3A 3TDWA 3RAHA 1H08A 1Q3DA 2X4FA 3RVGA 3TI1A 1GOLA 4DEGA 5HIDA 3R6XA 5EQPA 1FOTA 3EFWA 2JIVA 5H8GA 3O0GA 3O17A 4X3FC 4MXCA 5AAGA 4DT9A 1XH9A 4XP3A 4L9IA 4XP0A 5CSPA 2OW3A 5B0XA 3L9LA 4IANA 2CDZA 1BI7A 2Y0AA 5G1XA 3PA3A 3AG9A 4L52A 4U7ZA 4G3GA 3R9HA 1T45A 2YJSA 3F88A 2PMIA 2UZNA 3FHIA 3EQIA 4FKSA 2R3RA 4NTTA 1F0QA 4TY1A 4CTBA 3UPZA 1ZYDA 3L9PA 3GCQA 2PVKA 3L8XA 4IC7A 2YZAA 2PE0A 2JDSA 3NPCA 1EH4A 1R1WA 4ZJVA 3DQXA 3DNEA 5FXRA 3BLAA 1YI4A 1ZAOA 4FSRA 5EYMA 1B39A 2V0DA 4G9CA 5HX6A 1G8JA 4IFCA 4AA0A 4KBKA 3VBYA 4O7WA 5HG5A 4Z7HA 4FZDB 3D5VA 4WUNA 2G9XA 2HW7A 3QUDA 3VRYA 2IZUA 3F3UA 5CAUA 5KX8A 4ACHA 2O65A 5CSXA 4RC4A 1KOBA 3T3UA 4CFNA 4B8LA 3FXWA 2QOCA 2YM4A 2G2IA 3O5AA 2XP2A 4UXQA 2VV9A 3NW7A 4C62A 4LGGA 4NIFA 4FX3A 4XG7A 1P2AA 3OY3A 4AGDA 4FTIA 4MTAA 1GNGA 4L44A 1F3MC 1K2PA 1PMEA 4PP7A 4YSJA 4YTCA 2WTIA 2GNIA 1T46A 3BGZA 3C1XA 4EOOA 3ZZWA 5A4LA 2BAJA 3C5IA 5IQIA 4IM0A 4IMYA 1QPJA 4IH8A 5KNJA 2GQGA 3D0EA 3BPRA 2JDTA 2OZAB 2XIRA 4I4FA 2C5OA 2WMQA 2XB7A 3PWYA 4F1TA 4ITIA 5IA4A 4JS8A 3CS9A 2WHBA 4CKJA 4FICA 3O7LD 4KIKB 5FTOA 4GIIA 2XNNA 4WD5A 3RNIA 4F0IA 4LUDA 3UO5A 3IONA 2PUNA 1H0WA 4J96A 4BDAA 2XM9A 4O4EA 2VTAA 4NKSA 5EK7A 4AX8A 4I20A 4IB1A 3HMNA 4GT3A 1OUYA 5IQBA 1NT2A 3F82A 1V0OA 2WQEA 3OCBA 2YACA 3TV6A 1ZWSA 3D83A 3FLNC 3VUIA 3GU7A 4LMNA 4X2GA 2WMAA 2WQOA 2X4ZA 4IM3A 1KUTA 5CXZA 3HEGA 1G8SA 2YM5A 2IN6A 4DINA 2HZ0A 3HMPA 1ZYLA 4LL5A 2AC5A 3K54A 2R3GA 4MWHA 4RT7A 5I4NA 2Y8OA 4FKWA 1OUKA 4BN1A 4M7IA 4QNYA 3Q6UA 3UZRA 3PP0A 4A06A 2VN9A 3EQRA 2BDJA 2UZUE 3ZO3A 3R8PA 4HVGA 3VAPA 2XJ2A 4D9TA 3AT3A 2A2AA 4F9YA 2YWVA 4EL9A 4C02A 3DJ7A 4IZ5A 4S34A 4IQ6A 5AMNA 3FZ1A 1FMKA 4PDOA 3TN8A 4LQMA 2ACXA 3ZCLA 4O7NA 1QPCA 1OIQA 4A7CA 4EOLA 3TUCA 4C36A 3JVSA 5LWMA 4RZVA 4XV1A 2G2HA 1JQHA 5ANDA 4CCBA 5K9IA 4FZ7A 4U5JA 4I5PA 4IAKA 4CKIA 4DFZE 3TJDA 5CEIA 3UMXA 5JFXA 1XH6A 4KKHA 3EKNA 3HV7A 4AZVA 4MNFA 3A8XA 1KV2A 5IQFA 4HYIA 3VW6A 2CKEA 3U54A 1Q5KA 3A2CA 3U9NA 1KE9A 3FXZA 4JG8A 4PX6A 3RK5A 3ZO4A 5DRDA 4IXPA 4TXCA 2RIOA 2WKMA 3QKKA 4FV4A 4YBJA 5AR7A 1UU9A 2VWZA 3EN6A 2XK3A 5HOAA 3ZUTA 4J8MA 4LGHA 3W8QA 3PWDA 3OCGA 4DFNA 3JPVA 4O7VA 2CNVA 4DGGA 3ET7A 4NFNA 1MRVA 3I5NA 5LVMA 2AQXA 2XMYA 4FKRA 4I92A 4C2VA 4DG0E 4DDIA 5C26A 5C27A 2YCSA 1UU7A 2XVDA 4BI0A 3TNHA 3IQ7A 4EJ7A 4IDVA 3GU6A 5ITAA 1BX6A 4FIHA 1G5SA 4BC6A 1OL6A 3VHKA 4CEGA 4HVDA 1IA9A 1F5QA 1WBWA 1W8CA 3AMYA 3BL9A 1XJDA 2XYUA 2H96A 3I7BA 4KA3A 5ETFA 4RGJA 3EOCA 5HG8A 1WFCA 5FDXA 4OT6A 4E73A 3KL8A 2JIUA 4FSNA 1JOWB 4D2SA 2ZM1A 3H4JA 3NUSA 1UKHA 2BAKA 3LAUA 3RPSA 5FTQA 4O4DA 2C5YA 2QOOA 4I22A 3G15A 1SZMA 4BTMA 2C4GA 2VWBA 3R63A 3RPRA 4ANQA 1OPLA 4NWMA 2P2HA 4ZMEA 3RNYA 5IH5A 3LOKA 3QQGA 4GS6A 4W4WA 4YHTA 3MJ1A 4YP8A 4RQVA 5JZJA 3W0SA 4LV5A 3ODYX 3PIZA 4DFBA 2R3LA 5CI6A 4OR5A 4IAZA 4K11A 1J1BA 3B2WA 2F2CB 1WZYA 1W0XC 3G0EA 4R77A 4ZJJA 1W82A 3C4FA 2YITA 3CEKA 2QR7A 4IWDA 4AQCA 1AGWA 2YM7A 5LMKA 3KB7A 2WMXA 2CCIA 3BU3A 3FC2A 3H10A 2W4JA 2VTSA 1IAHA 4BKJA 4HYHA 1PJKA 3OWJA 2BTSA 2PVNA 5AP1A 4ZS0A 5JEBA 4HNFA 4RC3A 4GKHA 3HRCA 3LFDA 4G3EA 4KIOA 2GFSA 4OTHA 3TTJA 4X7QA 3T9IA 5AUVA 3KRWA 1U54B 2KULA 3TTIA 4BYJA 2PMNX 4EC8A 4RSSA 5HI2A 1PF8A 1DM2A 1FVTA 4FUXA 4GEOA 3UNKA 2XRUA 5J9ZA 4CXAA 4U44A 1ZRZA 3AD5A 3P5KA 5A6OA 5BYYA 4DCAA 3GVUA 4AGUA 2BILB 3RWQA 1PMVA 1FGIA 4ZIMA 1ZOHA 4O0SA 1XBAA 3N51A 2CHLA 3UJGA 4A9RA 2CLQA 4PTGA 4FIIA 4WO5A 3E87A 2I0EA 4FKTA 3S0OA 3MVLA 4FSZA 3WE8A 4UY9A 2ONLC 4EKKA 2W99B 4KABA 4R5YA 1FINA 2ZM4A 3MJ2A 4RX8A 5EI6A 5JZNA 2BZIB 4JJRA 4WHZA 4EH2A 4NJDA 5CY3A 3CQEA 4JX7A 2A0CX 5C4KA 4JDJA 4BCMA 2ITUA 3DXPA 2XF0A 3CLYA 2YISA 4PNIA 3GI3A 3FSKA 4R1YA 3FUPA 4MXAA 1CSNA 3JVRA 3II5A 5E8WA 4A9SA 2QKRA 3GCSA 4JBPA 5A54A 1H00A 1GZOA 1Q61A 5GZAA 3QALE 3TNQB 3K3IA 2UW7A 1PXIA 2VX3A 2VGOA 3GBZA 4MYGA 1G8KA 3HMOA 2UW5A 1YWRA 4U3YA 4YUQA 5HO7A 3WILA 2XNMA 4FKLA 5JRQA 5AUZA 2ETRA 2FSOX 4M8TA 1ZLTA 5FXSA 4TN6A 4WA9A 3IKAA 3NLBA 2WMBA 3RPYA 4L67A 4F08A 4Z7GA 2UZBA 3D5UA 4UYAA 3DY7A 4L43A 3ITZA 5IKWA 3AC1A 3RI1A 4ASZA 4QEBA 4DG2E 2UW9A 5BMMA 3RCJA 5KMIA 4FZFB 4GYIA 2QC6A 3FZPA 5CF6A 5ANIA 4WRSA 5DN3A 1JVPP 4UWBA 4V0GB 5E91A 3SOCA 3V8WA 5LVPA 4G9RA 3M42A 2I40A 2YCRA 4EOSA 3QZGA 4FNWA 4WIHA 3CKWA 3O23A 1MP8A 4CFXA 3SDJA 3ZFXA 4F64A 4O84A 3QGYA 3UDTA 4UMRA 2VTNA 3UQFA 4U41A 3C7QA 3MBLA 4QP6A 1A48A 4L42A 3RP9A 4BIBA 3L9MA 4DFXE 4YPDA 5DT0A 2XANA 3ZSIA 2B9IA 4BHNA 4D0WA 2C3KA 4AQKA 2UZEA 4L00A 4QMNA 5BPYA 3SA0A 3UDZA 3AD4A 5C8MA 3AGMA 1UV5A 4EKLA 3V6SA 4MNEB 3CY3A 5IQAA 3CC6A 2VWYA 5HO6A 2PZPA 4TTHB 3MH1A 3HECA 4JOAA 3SRVB 4PMSA 3DCVA 2JFLA 3KXHA 3OBJA 5DHJA 3C13A 2ZJWA 1VJYA 2W4KA 2QOKA 2PZ5A 4U79A 5KMLA 4FL2A 2WQNA 4RMZA 5FTGA 5FBOA 4D28A 4EK5A 5F20A 5G6VA 2SRCA 2CMWA 3H9OA 2DWBA 2B1PA 2QQ7A 4RWJA 2ERZE 4L3JA 2A1AB 3V5LA 4O7RA 3HVCA 5J7HA 4DYMA 2J4ZA 3ALNA 2BUJA 3V8TA 2PZRA 2XUUA 4ENYA 3D94A 2EXEA 3NSZA 3W0NA 4L45A 4F1MA 3A60A 5EH0A 5EHOA 5CF4A 3LJ2A 3SOAA 3V5JA 1R39A 1XR1A 4FI1A 4FV8A 4FV1A 3W0RA 2OJFE 3BKBA 4WSYA 4MBIA 4DHZA 4JT3A 4TWOA 4QPMA 2YA9A 4HCTA 4OT5A 5CNNA 3IDBA 3NNVA 4ZY4A 2E9PA 4MXYA 2Z02A 4ANSA 1LEWA 2XBJA 3PSDA 2EVAA 3ZTXA 3DKFA 5DNRA 3V3VA 3WIGA 2VWUA 3RGFA 3O96A 1OKWA 3PA5A 3I0QA 3K2LA 3KRLA 4DHJA 3EN9A 3T3VA 5FUTA 2QKWB 4ZZOA 4Q9ZA 3OT8A 1IA8A 2Y6OA 2WFYA 4RFMA 1GZ8A 2XEZA 3QCSA 3W0QA 5CXHA 3OUKA 4F78A 2DYLA 3DBDA 5E1EA 5EKOA 4TPTA 3PIYA 3ZXTA 3ZXZA 2RG6A 3MIAA 5I0BA 4E5BA 3LFCA 3BELA 3PYYA 2VTOA 1RW8A 3AKJA 4PPAA 4B7TA 3UNJA 2O0UA 5HCZA 1Z57A 2ERKA 4MBJA 3TNWA 2GQRA 5AM7A 3LFEA 2EUFB 4C59A 4LRMA 3C50A 5FG8A 5HG9A 3R8LA 1URWA 4FT0A 5EOLA 3DGKA 2ZDUA 3R7GA 4ONAA 3FC1X 3SAYA 4ZS4A 5BVNA 3OG7A 2P3GX 1KE6A 3FKNA 4GCJA 1YRPA 4X6RA 4WT6A 4BDGA 4AXDA 2VO7A 3CCNA 3QD3A 4ZTHA 3RK9A 1YHSA 3ORLA 2X39A 4O6LA 3D7TB 2J0MB 3MV5A 3MY1A 4F7JA 2XAOA 1Q97A 4NH1A 4I0RA 3BWFA 2XKCA 3OW4A 4GK3A 3UDBA 4FE2A 3NCGA 4HVHA 1O6YA 3WI6A 3TXOA 1W2CA 3FI2A 4JAJA 2C6OA 3FE3A 4IX3A 5DVRA 3DAJA 5GJGA 3UG2A 1SNUA 3PVWA 4G16A 4ZTNA 2XARA 4I0TA 5M57A 3ORNA 2EWAA 3KRRA 3NUNA 3NX8A 3P0MA 3OXTA 4G3CA 4JBVA 2XM8A 3TZ9A 3E7OA 3NAXA 4ASXA 4HVIA 1VLRA 4D2VA 1XH8A 5AUWA 3BRBA 4QDEA 3QGWA 4MHAA 4GUBA 3WZJA 4BGQA 2YAKA 5ETIA 4KUJA 2HYYA 3ENMA 1ZARA 4BJJA 3NUUA 3F6XA 3Q9WA 3GGFA 3U4UA 4EUUA 5IA0A 3QD2B 4AF3A 2X6DA 2C6LA 5C8NA 3DXQA 4EBWA 4RX7A 2FB8A 3V5PA 3EQGA 2WZJA 4YNOA 3VS7A 5A46A 2QO7A 3BHUA 4G3FA 3HDMA 3QZFA 1OKVA 3DB6A 3EH9A 4O91A 3NIEA 4U81A 3UYTA 2XNBA 3ELJA 3H0YA 2WMSA 3NYNA 3U6HA 5DYJA 1OPKA 3COHA 4M3QA 4PWNA 4TWNA 5K0XA 3ORXA 2F7XE 2X1NA 3LFFA 4HZRA 4W8DA 4AXAA 4EORA 4XRJA 3HAMA 2X2LA 2YM6A 4IADA 3L8SA 1XMLA 4I5HA 3D2KA 2BRMA 2J50A 3R0TA 4FZAB 5K0KA 3Q3BA 4C0TA 3MH0A 3HA8A 4OTFA 4O0YA 1WVXA 3M2WA 3Q53A 3QKMA 4EQCA 3PPKA 4GFOA 3GUBA 2RG5A 3ZEWA 3SXRA 4QYHA 3ML1A 2YERA 2QHNA 4NM3A 2XK6A 5CEOA 2OH0E 3UQGA 4M67A 2J0KA 3PZHA 5C9CA 3EJ1A 4RVKA 4O7YA 3EYHA 3FLQA 4D0XA 5IH4A 3OP5A 4EZ3A 5FQDC 3DK3A 5DE2A 4CV8A 2HK5A 1PW2A 3QTRA 3DKCA 3TKHA