5EHOA

Rapid discovery of pyrido[3,4-d]pyrimidine inhibitors of monopolar spindle kinase 1 (mps1) using a structure-based hydridization approach
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
279
structure length
258
Chain Sequence
QSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMQPDVGTVNYMPPEAIKDMISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Dual specificity protein kinase TTK
publication title Rapid Discovery of Pyrido[3,4-d]pyrimidine Inhibitors of Monopolar Spindle kinase 1 (MPS1) Using a Structure-Based Hydridization Approach
rcsb
source organism Homo sapiens
total genus 83
structure length 258
sequence length 279
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2015-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ehoA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ehoA01
4MYGA 4NKAA 4YZCA 2VWIA 3NW6A 4O6EA 4K9YA 4ANMA 4ZY4A 5GJDA 1R0PA 5I9VA 2YDJA 5DT0A 2QO2A 2VGPA 4EUUA 3C5UA 2VWWA 4XH6A 2Z7LA 4Y73A 2C30A 3KMMA 4ZP5A 5CXHA 5E9EA 1LP4A 3D94A 4QP8A 4F9YA 4E4MA 4BHNA 3JXWA 3I0QA 3NNUA 2J51A 4F99A 2HZNA 3R9HA 1H26A 1VYWA 5IU2A 3PRFA 3UNKA 3PSCA 3H9RA 2H6DA 3IS5A 3OWLA 3F2RA 3BELA 4I5CA 5HO8A 3JS2A 5AIKA 3F5PA 3FPQA 3DGKA 3OHTA 2WEVA 2QURA 4IX3A 2CCIA 2JDTA 3PPJA 3CXWA 5GINE 3KXZA 4JXFA 4KIKA 4KD1A 3WI6A 3NNXA 4UMRA 1OB3A 2PVRA 4U42A 5HG9A 4HNIA 5BVNA 3C5IA 4K33A 5CEKA 5D10A 5JN2A 2ITOA 4IADA 4C58A 1YKRA 2I0EA 3PVGA 2VTJA 4PL4A 5CSXA 3ZEPA 2J90A 4R78A 3PXRA 2BZHB 4IAKA 5J8IA 4LRMA 4HW7A 1FVVA 4Z7HA 2PL0A 2X6EA 2FGIA 1OM1A 2R3PA 5FP6A 4M12A 2PVFA 4PUZA 1SM2A 4JG6A 1G8AA 1Q8WA 3IO7A 4G6LA 4RC4A 3DTCA 3NUYA 1G5SA 1B6CB 4KIQA 4USDA 3OCSA 4EBVA 1ZLTA 4ZSLA 4MWIA 5JFSA 4UMTA 5FTOA 2QOCA 1M7NA 2ERKA 3Q6UA 5HIDA 4A9YA 1H27A 3CD3A 3KB7A 4FG7A 4FT0A 2UZLA 3SVVA 3ETAA 1XH8A 3G15A 4FZ6A 3F82A 4YJVA 3HRFA 4CFNA 2PVMA 1DAWA 5LVMA 2XNBA 1WVYA 2VX0A 1JLUE 4O0VA 3FUPA 3WE4A 1RDQE 3NNWA 5K5XA 3FLZA 1REJA 5L2WA 3S0OA 3PIXA 4G1WA 4QQCA 3VNTA 4BGGA 4IZYA 5BNJA 3EYGA 4DFNA 3OF0A 1KOBA 3H4JA 4XLVA 5DR2A 4F63A 3V5TA 5K9IA 4YC8A 3DLSA 1ATPE 3KY2A 3HRCA 2GNLA 1SNUA 2HXLA 3A61A 2BAJA 5HORA 1YDTE 3QCQA 2J0JA 4RFMA 3R7EA 4L7SA 3QYWA 5M4IA 4O38A 3PE2A 3KMUA 3GQIA 4DITA 3F88A 3MFSA 1M52A 2VTHA 4JQ7A 4KKGA 3QWJA 2NO3A 2Q0BA 2XIRA 4YJQA 3VS5A 4BDDA 4CFFA 2ZMCA 3BLHA 3CEKA 1F0QA 1H1RA 1Q61A 2V0DA 4FZAB 1J1BA 2WTIA 3CQUA 1U4DA 2ZDTA 2W4KA 5HTCA 1OKZA 4MNEB 2WOUA 2B4SB 4X2NA 5EG3A 3D7TA 4YJOA 4IZAA 4RWJA 2PVNA 5KE0A 2ITNA 3VUDA 4CFWA 4R3CA 2HYYA 4FEVA 4EK5A 2OJFE 3ODZX 4JDKA 4RIOA 4YBKA 4E4LA 3I5NA 4LRKA 1ZAOA 2UW6A 3O8TA 2BROA 4CT2A 4G17A 3II5A 1W7HA 3AGMA 4L3LA 3EQGA 3FQHA 1OUKA 3ZHPC 4W4VA 1X8BA 2B7AA 3UPZA 4PL3A 2BRNA 3PJCA 3P7AA 3R2BA 4IVDA 4MCVA 3RGFA 2CLXA 4FKIA 1NXKA 2JBPA 5LJJA 4FV1A 5FXRA 3H10A 4FVQA 4W8DA 3W8LA 3ZM4A 3V51A 2XKCA 3LCDA 3LAUA 4D4SA 5DT3A 5HO6A 3HUBA 2ITZA 4O84A 4I1ZA 2OXYA 5CQUA 3SRVA 4QPAA 2VWVA 5KX8A 1M7QA 2WTCA 1YOLA 4K1BA 3PFQA 4TXCA 3RMFA 4QP7A 3HP5A 3C4CA 3EQCA 4EYMA 1RW8A 5EKOA 3EQHA 5BVEA 2BHHA 5A6NA 5ICPA 2GDOA 5L3AA 4XG9A 5JFXA 1I09A 2HW7A 3JPVA 2BZKB 2C6KA 2JKQA 4KABA 1YXXA 3QQGA 3KXXA 2X4FA 4ZSJA 4EUTA 3R1SA 3E62A 4IH8A 3SC1A 1JSUA 4IMYA 4DN5A 4C02A 3DK7A 2I0VA 5AUYA 5H8EA 4FEUA 4P2KA 5IQAA 1FPUA 1H24A 3AGLA 1CMKE 2PY3A 3JUHA 4ZJIA 4NJDA 4IC8A 2GNJA 3GU7A 4N70A 3ZEWA 4KS7A 4S2ZA 1SZMA 3RK7A 4TT7A 3SLSA 4B6LA 4ZLYA 4PPCA 2BFXA 4TYHB 1O6YA 4K11A 4U9AA 5KMMA 2HZ4A 1HCLA 3F3TA 2UZDA 1CKPA 4S33A 4XUFA 2WQMA 3TN8A 4D2VA 5JGAA 5K3YA 5I4NA 2Y4PA 2PYWA 5HZNA 3NZ0A 3EZRA 1FMOE 4FZFB 3WZJA 3TZ7A 2XK7A 3Q4UA 4NZWB 4YJNA 2FSTX 2R7BA 4DF3A 4PL5A 4HGSA 2VNYA 3QTZA 3FZTA 4Z16A 5D7VA 4ZY5A 4NU1A 5EFQA 3S00A 3MVJA 4DLIA 4YZMA 2HENA 2RL5A 4FICA 4LGHA 2R5TA 4RIXB 4I4FA 3TNWA 3PIYA 4FSTA 1OKVA 3F5XA 4A9SA 2W5BA 5M06A 5AUVA 4PPBA 3TZMA 3QTRA 3GFEA 1YXUA 2P33A 2QLQA 1OKWA 3P23A 5IMXA 4Z7GA 3SD0A 5IEXA 4C3FA 5C03A 4H3PA 4FR4A 1MRYA 2B53A 4IZ7A 4BTFA 5DRBA 2FA2A 1SVHA 2FSOX 4LI5A 3FLYA 5K0KA 5CSPA 3N4UA 3Q2JA 5K5NA 1JSTA 3TIYA 4CVAA 4FE2A 4L52A 4JBQA 2XNGA 3FJQE 4USFA 4HGEA 3LM0A 4QMTA 3ZBXA 3QXPA 4QQTA 4XOYA 4R77A 2VX3A 4FSNA 3EMGA 2YM4A 3QD2B 3U6HA 3UP2A 1PXJA 5E8ZA 3VQUA 4ALVA 5I9YA 4NK9A 5T6KA 4I3ZA 5HBJA 3T3VA 1H08A 3PJ3A 3FXWA 3KULB 4GMYA 3V5QA 4RT7A 4FKJA 5A4QA 4Z3VA 4L3PA 2IW9A 2CJMA 3QQJA 4RQVA 4WD5A 5BUJA 1B39A 2UZTA 2ZYBA 2R0UA 4ZTLA 5TR6A 3ZXTA 5HO7A 2HOGA 3LJ0A 2W4JA 1IA8A 3VWAA 5ANKA 4AZSA 4D4VA 3MJ1A 4BIEA 4C3PA 1YI4A 3BYOA 3W32A 3P7CA 2ITQA 4Y95A 4C38A 4M14A 4ZZOA 4O7WA 3LM5A 1P5EA 3VRYA 1WBTA 4RA4A 4NWMA 4BDCA 2W1FA 4WUAA 4CMTA 4EH8A 4YR8A 4MKCA 4EHZA 2VAGA 2F2UA 4BRXA 1YDSE 3QRIA 4GG5A 1ZMWA 4FF8A 4ASXA 3PJ8A 3WZDA 4FKGA 3CKWA 5A14A 5GZ8A 3NUXA 5M51A 1J7LA 2JAMA 3EN9A 4TNDA 2XNEA 1BUHA 3HNGA 4S30A 3W18A 3RAIA 4M66A 4UXQA 3SQQA 2YZAA 4RWLA 5C1QB 2XKDA 1GIIA 3L9LA 3G90X 4U3YA 4U79A 5DR6A 2XNPA 5TOZA 4O0RA 2QOIA 4B7TA 3NNVA 4S31A 3KK8A 4QMWA 3VULA 5J1VA 3KK9A 3LMGA 4HVGA 1GOLA 4N6YA 3EN5A 5CEOA 4QO9A 3ORXA 4Q2AA 2F57A 3Q04A 2WTVA 4GEOA 3F3UA 5E92A 3Q9ZA 4EOSA 3E7OA 3EQIA 3OTUA 3I60A 5JQ8A 2GTMA 3IW5A 4FKPA 5GZ9A 1JBPE 1PMNA 4DBXA 3UNJA 2YCFA 4I6BA 3VUKA 4IDVA 4KS8A 4M67A 4FV4A 3OXTA 1PYXA 4ZTMA 4O2PA 3FQSA 3WYYA 4DH1A 2QQ7A 4MXXA 4WRSA 3O17A 2QKRA 3OP5A 4IX5A 4K0YA 3TTJA 3RPYA 3V04A 3PWYA 1MQBA 3V3VA 3CPCA 2VTLA 4FIFA 2ITXA 1SVGA 4RJ7A 5D41A 4DCEA 4JRVA 4BBMA 3BYSA 4PMTA 5E90A 3C13A 5KCVA 2B55A 2YCSA 2VO7A 3N4TA 2CN5A 4L68A 4ASDA 3H0ZA 3BEAA 4YHJA 4DLJA 4EL9A 4CKJA 5HQ0A 2JBOA 5AUXA 3TV4A 2EXEA 2G01A 3O0GA 5I9UA 4L42A 4OBOA 3BU5A 4FVPA 4GS6A 5A4EA 1Y57A 1YWVA 3MVHA 3UODA 1IAHA 4GW8A 1A9UA 3TNQB 3FYJX 5FG8A 5AR7A 2V5QA 5F4NA 3UJGA 2QOOA 3L9NA 2P2HA 1OVEA 4EWQA 1OL2A 4CV9A 4QMQA 4EI4A 5LMBA 3FLSA 4KSQA 4CRSA 3W2OA 3CY2A 3AT2A 3BHHA 3ZUTA 4DG0E 2E9PA 2UV2A 2C6DA 3R2YA 4MK0A 2WMTA 3FC2A 5F95A 3VJNA 5A4CA 4PTEA 2BAQA 3C4WA 3ERKA 4GT4A 3A7JA 3QFVA 2WOTA 3BYUA 3FKOA 3Q9XA 4RGJA 5DA3A 4FKOA 5BYZA 4ID7A 3T3UA 3ZSHA 5J9LA 4LFIA 2IWIA 3GFWA 3VIDA 4GIIA 2CDZA 4TZRA 4XG6A 2OW3A 4J96A 5HE2A 3G9NA 2I40A 3FMKA 4DGGA 3ZSGA 2WMQA 3PLSA 5AM6A 2WAJA 3KN6A 4F6WA 1Y8GA 3V8SA 4FK3A 4E5WA 3TUCA 5E8XA 3VRZA 4MF0A 3VUIA 4MNEA 3L9PA 4QYHA 3KREA 1PF8A 3QTUA 2WKMA 4C59A 2H34A 3ZCLA 1E1VA 4AA5A 2ESMA 4EBWA 3OROA 1URWA 4BCNA 5AR8A 4F0GA 3SAYA 4IW0A 5GJFA 4C8BA 3BPRA 2WQNA 3G51A 4IAFA 2C4GA 3QBNA 4JDHA 4ORKA 3LCTA 3MA6A 3ZONA 5IA1A 3NYOA 5LOHA 2CCHA 3RCJA 4XEYA 4UWBA 4WKQA 1PXNA 3QTIA 4JDIA 5C01A 5GHVA 1ZOGA 3RK5A 1GZ8A 2R64A 4E6QA 2XIZA 3U54A 3QHRA 2ZM4A 2YM8A 4N4SA 3TG1A 4H3QA 2BKKA 3WZKA 4KBKA 1YXVA 3R28A 3DBQA 3BIZA 5AX9A 5ETAA 3LXKA 5HNBA 3FI2A 5HG5A 3UQCA 1WBNA 5EW3A 4IAZA 4XG4A 3QA8A 3DS6A 2Z7RA 3DV3A 4EHGA 4EH9A 4R7HA 4ENYA 5A6OA 1U46A 4RWKA 2W9FB 4KKHA 4RVTA 3E64A 2F7XE 3S95A 2NNWB 3ULZA 2W06A 5CVHA 5C4LA 4BC6A 3FMLA 4KBAA 3PPKA 4HVHA 4NEUA 4E4NA 2PZRA 4BGHA 2VD5A 1M17A 1V0BA 1ZMUA 2FYSA 2X9FA 1T46A 3O7LB 2OFVA 4JG8A 4LYNA 4OTPA 3ZS5A 5KMOA 3B8RA 1XKKA 3SXFA 3IOPA 3ZLWA 5JQ5A 5HVYA 1ZYLA 1YRPA 3TKUA 4AN2A 2XRUA 3GC0A 2VV9A 4NW5A 4GT5A 5FP5A 4BGQA 3CGFA 4U40A 1XJDA 2XS0A 2VWZA 5AIRA 5ACBC 4MTAA 2WMWA 2OZAB 1BYGA 3A62A 3LIJA 3W2SA 4HCTA 4HNFA 1BKXA 4EH6A 2OSCA 2XB7A 4CT1A 2ONLC 5DEYA 3ID6C 4IX4A 4QMYA 4FBXA 4D4YA 4DFXE 3AC4A 2RF9A 4NM7A 4AW2A 4LUEA 3W16A 5EI8A 4O91A 2G2HA 3PSBA 3AOXA 4GK4A 3SV0A 4CZUA 4RIXA 5HU3A 1IAJA 2O5KA 2HELA 4X2JA 4JIKA 4CTBA 5ANGA 1JAMA 2YERA 5AWMA 3V5PA 4AZEA 1NVSA 1J7UA 4EOIA 2B9IA 4GV1A 4AZTA 2YISA 5I9WA 2XYUA 2BDFA 3RTPA 4CV8A 1ZOEA 1XBCA 5JMSA 3TDVA 4NH1A 4CMUA 5IH5A 5HE1A 3EFLA 2OK1A 4D5KA 4CFUA 5HVJA 3VAPA 3DTWA 5EYCA 1V0OA 3NAXA 2QOHA 1Y6BA 3QD0A 4RIWA 4LV8A 3OUKA 3PXFA 2I0YA 4O7VA 4IJPA 3R8ZA 3R83A 4BY9E 1TVOA 4C2VA 3LMIA 4QMLA 3K2LA 3KXHA 4UN0C 4L53A 5AV4A 3PY3A 1ERKA 4PMSA 4V01A 1ZARA 1H07A 4R8QA 2EUFB 4FV7A 2EU9A 2KULA 2QCSA 4J52A 3QZFA 1AQ1A 4IWPA 3V5WA 4KA3A 1G3NA 2PZYA 2WFYA 2J7TA 2XRWA 3OUNB 5FEEA 4FYNA 4UYNA 2C3JA 3WE8A 5AR2A 2YM5A 4U44A 3SKCA 4OR5A 3EFKA 4EOLA 4JBVA 4DA5A 3W8QA 1PJKA 2UZNA 3QTQA 2ETMA 4QTEA 2XK8A 2RG5A 3RI1A 3LFFA 1GIHA 2W1IA 2O3PA 2YACA 4OTQA 4TTHB 2GNGA 2JIVA 3H9FA 4XG2A 2QONA 2W1EA 2REIA 4ACCA 4YTIA 4FNZA 4G3CA 5L2SA 2UZUE 3GOPA 4JJRA 5H8BA 3WF5A 4DINA 3UBDA 4OTGA 4ZEGA 4PNKA 3L8PA 3MY1A 4XG8A 1RJBA 2C1BA 2QO9A 4MBJA 3ATSA 3FDNA 4I0SA 2IVVA 2ONLA 3EHAA 4FL3A 4L9IA 2P3GX 4FT9A 3FC1X 2XEYA 4AUAA 1KOAA 4EH3A 5CEQA 3RPRA 4D0XA 3E88A 5IQHA 2GHMA 3OMVA 3UOKA 3W2QA 4ACGA 4BVUA 5G6VA 5GIPE 2AUHA 3BQCA 3MDYA 4DTKA 2UW4A 4ZJVA 4WHZA 4AOTA 3GC8A 3UE4A 3R00A 2R3JA 1NVQA 2GQSA 3FZ1A 3UDBA 3E5AA 4UMUA 2JFMA 4DG3E 4GVJA 3PE1A 4WG4A 2OIBA 5F20A 5J5SA 1JQHA 1PY5A 3OVVA 3MSSA 2XKEA 4E6AA 3IPHA 1OIYA 3DFCB 4MD8E 4EJNA 5CU4A 2ACXA 2VO0A 3EN7A 5DI1A 5E4HA 3PYYA 2FB8A 4KBCA 4E26A 5HIEA 1YI3A 3QAME 3LFAA 2XK9A 2B9JA 4CTCA 5IDPA 4BR3A 2JEDA 3DY7A 5HG8A 5B2KA 2E9NA 4BFMA 4ZLZA 2J0KA 2Q83A 2BUJA 4KIPA 2A0CX 2WEIA 3DJ7A 4EORA 5HBEA 3FBVA 3VS2A 3ZFMA 1H1SA 3HMNA 1FVTA 1Q3DA 5EHLA 5LQFA 4BDIA 4L67A 5LCJA 2VN9A 3A2CA 1O6KA 3Q53A 2CGUA 2WTDA 2V7OA 5C27A 5CASA 1J1CA 2C6LA 4MD7E 4UXLA 3FZRA 4B8LA 4CG9A 2JLDA 5A46A 1J7IA 3VUGA 1P4FA 1QMZA 3F61A 4QNAA 2ZV9A 4MWHA 1UU7A 1WBPA 3QTWA 4C2WA 3NIEA 1LR4A 4YMJA 4IVCA 4YLJA 3WBLA 1GIJA 5E1SA 3R9OA 4DGMA 2ETRA 3BGQA 5AV0A 4LL0A 4P5ZA 5EQYA 4FX3A 5ANJA 5CALA 4AN9A 2CGXA 4BN1A 2XJ2A 4J8MA 3ZYAA 4ZSGA 3O51A 1KE6A 5M57A 2Z8CA 2G2FA 3NUNA 4MVFA 5CXZA 5I9ZA 4R7BA 3LE6A 4H1JA 4C62A 3LXNA 5CVGA 3U8WA 4EOJA 2JGZA 3DJ6A 3MH0A 4BTKA 4GT3A 4H39A 4QYGA 3PSDA 3LVPA 4O96A 4QP3A 4QRCA 1H00A 5CU3A 5C9CA 4AACA 2DWBA 3QZIA 3ZRMA 5AP3A 3KU2A 4O27B 5FUTA 2VTSA 4IACA 4RX8A 1TKIA 4H3BA 2BRMA 3JYAA 3NS9A 2O64A 4TN6A 4W9WA 4IBMA 4AAAA 4EC8A 4WNPA 3A4PA 2CMWA 4PMPA 4M15A 3LW0A 3NW5A 3HA6A 4FKQA 4OBPA 4WSQA 3PLAE 4UYAA 4U8ZA 3EKNA 3Q2MA 2HCKA 1LEZA 3ANRA 2ITTA 1XH7A 3D9VA 1NA7A 4TW9A 5EDQA 5BVFA 3P1AA 4EZ7A 4N0SA 1A48A 2P55A 1OL5A 4DEEA 4DCAA 2B9HA 5C26A 2KTYA 4EJ7A 3E3PA 1YVJA 4RX7A 4C0TA 5IDNA 4FEXA 3F6XA 3KKVA 2R4BA 3HEGA 2RFSA 4FSRA 1OPKA 3QALE 3WZUA 3LFNA 3POOA 3CC6A 2PMOX 1FMKA 3OXIA 1UKHA 4JQEA 3GC9A 4LOOA 4EHVA 3IQ7A 3RPSA 4KWPA 4S34A 1SMHA 3BV2A 4HVDA 4FC0A 3ACJA 4X3JA 2UUEA 3NLBA 4FSYA 4TWPA 4NIFA 4IANA 4Q9ZA 3CQWA 5CEIA 2WMSA 3DB6A 2YIRA 3P78A 3K3IA 1AD5A 3C9WA 1HOWA 1W82A 2UZVA 1OPLA 3QKMA 3OWJA 2PVJA 5K4IA 1R0EA 3D83A 3I81A 1V1KA 2V55A 3SG8A 1L3RE 3MBLA 2Y4IB 1Y6AA 5D9HA 4GL9A 4QMZA 3UVQA 4FTOA 2OO8X 3QTSA 4B8MA 4G3FA 2V7AA 3HRBA 4JRNA 2A1AB 2OZAA 4D2SA 1P4OA 4BKZA 4HYIA 5TF9A 1UU9A 2OH0E 2YIWA 2ZM1A 4IB0A 4MXOA 3RJCA 4EKKA 3RAKA 2NP8A 5A54A 2PE1A 3T9TA 4X0MA 4M0ZA 2VX1A 3ZUVA 3VN9A 4FA2A 3LFQA 4EOQA 2X1NA 4F70A 4U81A 2EXCX 4EEVA 2PHKA 3RAWA 1KV1A 2IW6A 3MPAA 5M4FA 3KRJA 4GYIA 4DH5A 3HAVA 1M2PA 4IDTA 1M2RA 5HI2A 4BYIA 4IWQA 5CT0A 3VS7A 3CGOA 1JWHA 4I92A 2VUWA 3ELJA 4JDJA 4Y72A 5EQPA 2O65A 5H9BA 3PZHA 3E63A 3QYZA 2YLFA 3TUBA 1Z9XA 3F2AA 4J8NA 2GTNA 3DK3A 4Y8DA 5AP6A 3F7ZA 4BBEA 2IVSA 3F2NA 4YZBA 3MH3A 3ZC5A 2XIXA 3ZO4A 3FL4A 4WSYA 2BALA 4WNOA 2C6IA 3DBEA 4DGOA 3SOCA 4O22A 4I6HA 4O0SA 4C57A 1PXIA 2XK6A 1PRYA 1ZY4A 4FTQA 3E93A 1IG1A 3UYSA 3Q96A 2QLUA 3DQXA 4B99A 3H30A 3G0EA 1YXTA 2PULA 2UZBA 2C3KA 4PPAA 3DFAA 3PPZA 5ETIA 3Q6WA 4K6ZA 3LJ2A 3K5UA 4MEDA 4CFMA 2GNHA 4BIBA 4CSVA 3BGZA 4I0TA 3ATTA 2C5NA 2A27A 2BAKA 2VWYA 4FTUA 4QP1A 3VUMA 4IQ6A 3IW8A 2WMBA 5M44A 2YDKA 2X6DA 2R9SA 5HLWA 1EH4A 4I0RA 3NDMA 4XNEA 4C33A 2ZDUA 2RSVA 5TT7A 3ENMA 3WARA 4KUJA 5IKWA 2A2AA 2WGJA 5E8VA 3R1QA 3QQLA 4WBBB 4I5PA 4O83A 3TL8A 3VS6A 5B7VA 3WOWA 2OLCA 1MP8A 3L1SA 4IEBA 4RVKA 1Q8YA 5AV3A 1O6LA 3GB2A 3I1AA 2WZJA 1PMUA 5CT7A 2W1HA 4NW6A 3EFWA 3PP0A 1UVRA 2PVKA 5E91A 3GVUA 2UW0A 3PXKA 2C0OA 3PZEA 3QWKA 3R1YA 3AD4A 1H1PA 1OL6A 2VTOA 1PXOA 2QR7A 3KCKA 4X6QC 3ODYX 3PG1A 2VTIA 3SOAA 3W33A 4DBNA 5K0XA 3ZDUA 1VEBA 5CEPA 5DBXA 4F4PA 2C68A 3OOGA 2XCHA 4FV9A 2NPQA 2JIUA 3BV3A 3HKOA 4YHFA 5ANEA 3BKBA 3IW4A 5AAEA 3SA0A 4YSJA 2PTKA 3W1FA 5CAOA 4FV5A 2VTQA 4O7SA 1SNXA 4FGRA 5IQBA 4QPSA 4V0GB 5EHOA 1H28A 4G6OA 4RC3A 5D1JA 4DGLC 2W1DA 5A4TA 3C4FA 4RFYA 4FIHA 5AV2A 3OZ6A 3GT8A 2PZPA 3A60A 3FMHA 3PVBA 3QUEA 5HLNA 2PK9A 2UW9A 3DCVA 3AQVA 3EQDA 3WYXA 4TPTA 1MUOA 5HVKA 4FUXA 3RAHA 3UIBA 5ANIA 4NM3A 3A7HA 3O7LD 4FKLA 3SG9A 3MFRA 2XK3A 3QCXA 4P4CA 2IPXA 4H58A 1QPEA 5IA3A 4D1XA 3VVHA 4J99A 4KRCA 3P5KA 4UALA 4DEIA 2CHLA 4EOKA 4EZ5A 3EB0A 4OT5A 1HCKA 3R04A 2AC3A 1IRKA 3EOCA 4F1OA 4GIHA 3CQEA 2ERZE 4LUDA 4PMMA 2C5XA 4TYGA 4O0WA 3V8WA 4HOKA 3DNEA 4YUQA 4TWOA 3E7VA 5HICA 4AGCA 3ALOA 4IZ5A 3CTHA 2B0QA 4YTFA 5EI6A 4MQ2A 4JR3A 3FMMA 5M53A 2ITWA 2WMUA 2E2BA 3OCGA 3OW4A 4WT6A 4QMUA 2IO6A 2YM3A 4EHEA 4DEHA 3KVXA 3R30A 3DBFA 2PSQA 3MFTA 5FTQA 3OOMA 4YO6A 3VBYA 2YA9A 5DN3A 4ANSA 5CAPA 4AGDA 3R9NA 5EM6A 3MGYA 2J6MA 3Q3BA 3MW1A 3WILA 4D9UA 4PWNA 1CDKA 2UW8A 3U87A 2OF2A 4R3RA 1CTPE 4BKJA 2VTAA 3DOGA 4NJ3A 4IAIA 2G9XA 2W9ZB 4QQ5A 1G8SA 4B9DA 3WZEA 3GENA 4J53A 1BL6A 2ZV7A 1OIUA 3ZH8A 1TQIA 4AP7A 2J9MA 5CF8A 3LLTA 4AX8A 2GS6A 2QD9A 4CFXA 2PZ5A 4MNFA 4DT9A 3LCOA 2JDVA 2WXVA 5EM7A 1Y8YA 3I7CA 3FLNC 1PW2A 3C51A 3FLQA 2W4OA 2XBJA 3AD5A 4BCPA 3V6RA 3E8CA 4BDHA 5HTBA 4ZLOA 4FG8A 4M0YA 3IONA 3FI8A 2BR1A 4BCIA 3ZU7A 5E8UA 3VBWA 5BYYA 4GKIA 1FGKA 2V22A 2JKKA 5L2IA 3HVCA 4FSMA 1YOMA 3W10A 4FSQA 2EWAA 3FZSA 3QKKA 4C37A 3QGYA 4YC6A 1DAYA 1K3AA 3FV8A 4NM0A 2CKQA 2IVTA 2WELA 3ORMA 3PRIA 3JY9A 1PXLA 1RQQA 2UVZA 2X0GA 3KQ7A 3NSZA 4XRJA 5DWRA 5J95A 4EQUA 5CF4A 1JKSA 5JRSA 1WMKA 4CKRA 4XV3A 4CXAA 2WTWA 4BDJA 3D7ZA 2OJGA 3Q4CA 4LOPA 3M42A 5AA9A 1K2PA 5AR3A 4E1ZA 4H36A 3RNIA 4CYJA 2JAVA 2W0JA 1QPDA 3C7QA 5IZFA 2R3NA 2YJRA 3TDWA 5BVWA 3BHYA 3F69A 4QYEA 5DGZA 4CZTA 1Q4LA 1Q8TA 2VGOA 3NUUA 3F7WA 4I24A 4YBJA 3TNIA 3BHVA 2RFNA 2BVAA 4WNMA 1XH6A 3O71A 4GFGA 5GIOE 4YJSA 4D4RA 1Z5MA 3LCSA 2YDIA 4I5MA 4YJRA 3ZDIA 1UU8A 4HVIA 4W8EA 3MH2A 2HXQA 3PVWA 2C0IA 4L6QA 4XV2A 4YZ9A 3FMJA 4BI0A 4ASZA 1WVWA 2ITPA 4FIIA 1ZRZA 4FSWA 4RJ3A 3E8DA 5HCYA 1DM2A 1ZXEA 2IG7A 4YZDA 2FSMX 4EK8A 3PY1A 3VW8A 4I93A 4JNWA 4PTGA 5ANDA 4YPSA 5HE0A 5HIBA 5CZHA 4BYJA 2QR8A 4IM2A 3FXZA 2OXXA 3AC3A 4BDBA 5IG1A 1ZYDA 4FUYA 1OIQA 3A4OX 4DE4A 3VQHA 2HWOA 4DYMA 4O21A 5IQCA 3ZM9A 2R3QA 3AT4A 2WQBA 4USEA 2VWUA 5BUEA 2ZM3A 4CD0A 1GZKA 4TYIA 3UG1A 3UC4A 5KUPA 1IASA 2F2CB 4R1YA 4QPMA 3VBTA 3L8VA 1BI8A 3MVLA 4EWHA 4GH2A 4YURA 4AT5A 3UNZA 2HAKA 5GNKA 4AW5A 4V04A 4V05A 3RM7A 2YEXA 2H96A 5HHWA 1ZYSA 3BX5A 2XIYA 4DEGA 3A7GA 5DT4A 3CY3A 4I20A 3VS4A 5KBQA 3MH1A 1JPAA 4HYHA 4QYYA 4W4XA 1W98A 2GFCA 4FTLA 2C5YA 4EOPA 2XNMA 1OZ1A 3GCSA 3QUPA 4BF2A 1F3MC 2CKEA 3NR9A 4NFNA 3B8QA 4AE9A 5DLSA 3LOKA 4QNYA 4KINA 4O7YA 4RX9A 4RQKA 4O7NA 2OIDA 2I0HA 2O8YA 4MD9E 4RLKA 3ET7A 3RZBA 5JEBA 4E6DA 3R1NA 5C8NA 2C6TA 2H8HA 3V8TA 3NVKI 3Q9WA 4M3QA 3KVWA 4AG8A 2O2UA 1PXPA 4JR7A 4RZWA 3WF6A 4YTCA 3ZLXA 2VTNA 2VWBA 4FOCA 3GUBA 3R22A 5IF1A 3QD4A 1TQMA 1J3HA 2X2MA 3AC2A 2O63A 3GCVA 2UZOA 4Q9SA 1W83A 4UB7A 5C8MA 3C4ZA 1O9UA 4AW0A 4WG3A 4E6CA 4ANLA 5CSWA 3GU6A 4HYUA 1SVEA 1YW2A 2P2IA 2GNIA 3IW7A 3LQ3A 5IPJA 1S9IA 3MY0A 3VS1A 3ZTXA 1I44A 1IA9A 3BHTA 2X2LA 3D5UA 4TYEA 3UO6A 2JKOA 2LAVA 1ZOHA 4CCBA 2PVLA 3SGCA 2RKUA 3TI1A 3R7UA 3G6GA 1WCCA 2GS2A 2J0MB 1K9AA 3O2MA 3O8PA 4NYEA 5BVDA 4Y5HA 1L8TA 3QZHA 5J9ZA 4L01A 2H9VA 4RWIA 2ZJWA 3NRMA 1GZNA 5IQGA 1XH5A 3C4XA 3OXZA 2RFDA 5L4QA 3CTQA 3LLAA 5JKGA 4U80A 3UIUA 3HDNA 4G9RA 2Y6MA 4RJ4A 3VBXA 5LMKC 4DFYA 2IZTA 2PE0A 2XJ0A 3FLWA 2WMXA 4YJUA 5H8GA 3KRWA 3LFEA 4ASEA 4M84A 2Z7SA 3EL8A 5EDRA 4YJPA 3BHUA 5IUGA 4FKRA 4H05A 3COIA 4C34A 4YTHA 4V0GA 4C4HA 4BCGA 4IFCA 2DS1A 4I6FA 2X4ZA 3AMYA 3HUCA 4EC9A 2UZWE 4F0FA 3ZZEA 5AUWA 4U45A 1YHSA 3QGWA 3A8XA 4YJTA 4IC7A 5HU9A 4G6NA 2YAKA 3AC8A 3H3CA 1GNGA 2Z2WA 4RBLA 4TYHA 5F9EA 4U6RA 4JIAA 3ORNA 2X39A 5AUZA 3AD6A 4ALUA 4FIJA 3DXPA 3AC1A 2W1CA 5TE0A 1FVRA 2XMYA 3DXNA 3VC4A 4PQNA 4OAUC 4HPUE 4II5A 4J95A 4NKSA 3TWJA 4A07A 1NW1A 2BTRA 4IHPA 4AN3A 4AWIA 3FMNA 4BIDA 1FGIA 3C0HA 1OGUA 4G5PA 5BX0A 2YITA 3RK9A 3UPXA 3R8VA 1OMWA 5AP2A 4FZ7A 3TTIA 3O8UA 3JR1A 3DB8A 4I21A 1NT2A 1XO2B 3HDMA 4D2PA 3N51A 2R3KA 3GP0A 4QOXA 5FBOA 5CAUA 2LGCA 2Y8OA 3BWFA 2QVSE 3R0TA 5IEYA 4Z55A 4I4EA 1STCE 3DLZA 1YHVA 2EB3A 2CNUA 1YOJA 1H0WA 3HYHA 3KF7A 3DNDA 2CNVA 4F64A 2G2IA 5M07A 1A06A 2XBAA 3FY2A 3SX9A 2WIPA 1QL6A 5LMAA 3KRLA 3QC4A 1XH4A 4XCUA 4CMOA 4O7ZA 5IISA 3UZTA 5LVLA 4NUSA 4F7NA 3F3VA 4J7BA 2XM9A 3ZUUA 1W8CA 4XJ0A 2Z02A 4NL0A 2YABA 4M8TA 2B1PA 2X8IA 3ENHA 2HZIA 2GCDA 2QKWB 1DI8A 4OTWA 3DXQA 1YWNA 5LMKA 1UV5A 4GUEA 3KULA 4CZYB 4ZSAA 5K4JA 3MI9A 5GZAA 1QPCA 3GI3A 3TJCA 2YHVA 2PWLA 5LVPA 3LZBA 4FGBA 5HKMA 1XBBA 2ZV2A 3EZVA 4FEQA 2F9GA 4HYSA 4PRJA 5FXSA 3RWPA 4JT3A 4RZVA 3DKOA 3MVMA 3R21A 3LXPA 3UZPA 4F1TA 3QQUA 4O6LA 4ERWA 5HTIA 1NVRA 5HGIA 3SHEA 3CJFA 4MBIA 2X7OA 2IVUA 4WBOA 2ZAZA 3FE3A 3D2KA 4RA5A 4XS2A 5FEDA 4LRJA 4JVGA 4OTRA 3UP7A 2B9FA 2UVXA 3DDPA 3QRJA 3Q32A 4GK3A 5J1WA 3NCGA 4IB5A 3BI6A 5CYIA 3RCDA 5CVFA 4E8AA 4FKWA 3RWQA 4H1MA 4R6VA 4G9CA 5CY3A 3D5XA 4FEWA 3DBCA 1U54B 2GNFA 2HY0A 2OICA 4LGDA 5BMMA 4ZTSA 4DEBA 5KMKA 2C3IB 2QG5A 3DAEA 4G34A 2P4IA 3OS3A 5BPYA 3DZQA 2I1MA 2RIOA 3AC5A 4LM5A 4AXAA 4AZWA 4NCTC 5DIAA 5HCZA 4RC2A 2QO7A 3NCZA 3P0MA 1CKJA 2QODA 5CNOA 5AUUA 4BI2A 5EOLA 3GBZA 4XP0A 2J4ZA 4GK2A 4RJ6A 2HK5A 4MXZA 2W7XA 2FO0A 5H2UA 5CWZA 5G1XA 4M13A 5HX8A 4C4EA 3ALNA 3CD8A 5HNIX 2BDJA 3KMWA 4ENXA 5J9YA 4NT4A 3IDBA 4OBQA 4D0WA 3PG3A 2WD1A 4Q5EA 3N4VA 1YHWA 4CYIA 2R3MA 1NY3A 3KCFA 1PKDA 3VW6A 3ZLYA 4CLJA 3W2PA 1CM8A 2QU6A 3C4EA 3VF8A 2VTPA 3THBA 5DMZA 3R7GA 1JNKA 4F9AA 5DH3A 4DGNA 2CPKE 4FODA 4MBLA 3UVPA 4O86A 3OWKA 2BFYA 3U51A 2OU7A 3E8EA 3AG9A 3RPOA 2UW7A 2YIQA 5HLPA 4GKHA 4FL2A 3GCPA 1JKKA 2WU6A 1BL7A 3JVRA 2C47A 4ANQA 2CKOA 3OFMA 2YAAA 3PA4A 4UMPA 1PXMA 5EQEA 3EKKA 1H25A 4A4LA 4XP2A 3ORLA 4MXCA 4W4WA 5L2QA 2CLQA 3BYMA 3MY5A 5C4KA 5I3RA 3R73A 4UV0A 1ZYJA 3R8UA 2ITYA 3I6UA 1KUTA 4U41A 2OF4A 2J50A 1MQ4A 5HBHA 1PKGA 3AMAA 1MRUA 3O50A 5AR5A 4EQMA 4QYFA 4UZHA 1GY3A 3NUPA 4O2ZA 4LMNA 3SDJA 4NCTA 2BHEA 3GXLA 1AGWA 4YLKA 3VBQA 3EIDA 4HCUA 4FSZA 4XG3A 3JVSA 3WIGA 4C4FA 5FTGA 2SRCA 3GQLA 3OY1A 4DH8A 1GJOA 2R3RA 5AM7A 4M97A 3W2RA 3FL5A 4UBAA 4G5JA 4CFVA 2XF0A 3I5ZA 4X6RA 3R7VA 2W05A 3MPTA 4FNYA 2RFEA 5TKDA 3WF7A 1SYKA 1OBGA 3MESA 3QC9A 4IB3A 3VF9A 3WF8A 5BYLA 4UEUA 2QI8A 4R3PA 3ZOSA 3H0YA 4IE9A 4AA4A 3U6IA 5CNNA 3U9NA 3UG2A 4L43A 4IWOA 3TACA 4ANBA 2VRXA 3BBWA 1H0VA 4X3FB 4FZDB 3HL7A 4O0TA 5CU2A 5B2MA 5KKRB 3Q4ZA 3K54A 4OW8A 4P7EA 3RM6A 2PMLX 3QRTA 5L8JA 3IOKA 2R3HA 3PXYA 3C0GA 4WNKA 1U5RA 4BB4A 5LVNA 5F1ZA 3FHIA 3RZFA 5EOBA 3VUHA 3LPBA 3BBTB 3P7BA 4RPVA 4LGGA 4BCKA 3HP2A 4P5QA 3TIZA 5ACKA 4BICA 5AJQA 4BTJA 4R5YA 2XJ1A 2OG8A 3FSKA 3FY0A 3NWWA 5IH6A 3OG7A 5CLPA 4AZFA 1XH9A 5FXQA 4IXPA 4EK4A 2UVYA 1WBOA 2G15A 4QTDA 3RHXA 5M08A 3DJ5A 2F49A 3H9OA 3DDQA 3EN6A 4U7ZA 2WB8A 3COHA 3OTVA 4E7WA 2X81A 4FG9A 4JAIA 4IJ9A 4D1ZA 1OIRA 3Q9YA 3QKLA 3GU4A 1YWRA 4FTIA 3QQFA 3NAYA 1WBVA 5ANOA 3DKFA 3TNHA 2GS7A 5HNGA 4BBFA 1VYZA 3S4QA 4GUBA 3UOLA 5I0BA 3CS9A 5LVOA 1F5QA 5EW8A 3D15A 4R7IA 4FTRA 5DNRA 3P08A 3V6SA 3QRUA 3TZ9A 2XKFA 4W4YA 4DEDA 2WQEA 3OT3A 3F3ZA 3VS3A 4EYJA 3MJ2A 3S1HA 5AADA 4F08A 3HV3A 2BRGA 4GVAA 1UNLA 3PIZA 4EOOA 4I5HA 5M09A 4AU8A 4OUCA 5CS6A 1FINA 5AUTA 2VTTA 1B38A 2VWXA 4HJOA 4QMOA 1Q41A 2IJMA 4AT3A 5HG7A 5EYMA 4BDKA 4B0GA 3I4BA 3DK6A 3O23A 3FXXA 4FMQA 4CKIA 4YSMA 4FTAA 1U59A 3UC3A 3DA6A 3V5LA 2R3IA 4EH2A 5FD2A 4HGTA 4TWCA 2R0IA 3ZBFA 5EW9A 3KA0A 4C3RA 4CEGA 3CIKA 3CP9A 5I3OA 1ZYCA 4JLCA 1ND4A 4ACDA 4UZDA 3QTXA 2YCRA 2J2IB 3EH9A 4FK6A 4E20A 5E8SA 4XYFA 1H1WA 2GMXA 3QD3A 4FTCA 3NYNA 5AAGA 3RNYA 3PXQA 3UOHA 3EWHA 5JFVA 4EONA 4BDFA 3TJDA 5ETFA 4IVBA 4FYOA 5EM5A 4E93A 3FZPA 4DH7A 4O82A 3UQFA 4OT6A 3OW3A 4XLIA 4L44A 4CQEA 4ZTQA 2XP2A 4X21A 3NUSA 4ITIA 3TM0A 5IA2A 3QRKA 4OTFA 5M55A 2ETKA 5IA5A 4FTJA 2YIYA 2XEZA 1U5QA 4L8MA 4BHZA 1M2QA 2XYNA 2WU7A 4AGUA 1WZYA 3HMOA 4XV9A 4JAJA 4XX9A 4HVSA 1W0XC 1OKYA 3EN4A 3LJ1A 2GFSA 4MH7A 4TNBA 4WRGA 3R7YA 4BZNA 4YO4A 4W9XA 3NMUF 4UX9A 5FWKK 2X2KA 3BLQA 4YLLA 3VO3A 4QP4A 5CF6A 2GSFA 2OXDA 4J1RA 4C61A 4U43A 4AOJA 4RJ5A 1CSNA 4GFMA 2F4JA 3DZOA 4GG7A 4CRLA 3L8XA 5HEZA 3M1SA 4IB1A 5D7AA 4C7TA 5AP0A 4BDGA 3QCYA 2CSNA 4ZS4A 2WTKB 2ZMDA 3IDCA 3KRXA 1QCFA 4WA9A 2I6LA 3P86A 4IFGA 4E4XA 5JZJA 2BZIB 2FVDA 4KB8A 1DS5A 1ZZ2A 1KE9A 1R1WA 5AR4A 4BI1A 1KE8A 5I5ZA 2X9EA 4OGRA 4AFEA 2GQGA 4G16A 4GJ2A 4APCA 4XRLA 4DH3A 2XCKA 2J0IA 3ORIA 5AFVA 1BLXA 5DPVA 3POZA 2J0LA 5CX9A 5FM3A 1U54A 5KZ0A 4E3CA 3GOKA 4EH7A 3FI4A 2BKZA 4LG4A 1URCA 4QMVA 4E73A 4NTSA 3VBVA 5A3XA 5IA4A 5FBNC 3NYXA 2YM6A 4RVMA 3ROYA 1TQPA 3KN5A 3NGAA 2FSLX 2VO6A 5B0XA 4U97A 3LCKA 4A9UA 3I6WA 1Q8UA 4QD6A 3FKLA 3I79A 4CLIA 2PE2A 3DU8A 4D28A 5LWMA 3P79A 2QOKA 5CI7A 3PDTA 4FI1A 4F0IA 3QA0A 2IW8A 3RHKA 2DQ7X 3UZRA 4A9TA 5EKNA 3NUAA 4AGWA 2PVHA 3KGAA 3Q5IA 3R6XA 3PXZA 4JL9A 4F7JA 2YWVA 2WHBA 3LFSA 1OUYA 5CEMA 3QQKA 1XQZA 1MRVA 1UWJA 2R3FA 4FSUA 3KRRA 4KRDA 3RINA 3R02A 3R9RA 2R7IA 3BCEA 2BIYA 2XNNA 1PYEA 2OIQA 4ANOA 1RE8A 3SW7A 3LFBA 4X3FC 3EQRA 5JT2A 1DI9A 1KWPA 2WMVA 3DAJA 3TCPA 3GU8A 5KKRC 5AV1A 4M69B 5KZIA 5M4CA 4BTMA 2Y9QA 1Q99A 1QPJA 3FZOA 3MFUA 4EZ3A 3COKA 4O1OA 5DHJA 3D0EA 2OJ9A 5H3QA 4C4GA 5KMNA 2JITA 4ITJA 4RIYB 4BWKA 3BYVA 1UNGA 5EK7A 4FT5A 4QP2A 5J87A 3ZO2A 1OL1A 1JVPP 4MXAA 2XA4A 4UWCA 4EK6A 1PHKA 4PP7A 4PX6A 4ZMEA 2IZSA 1WVXA 4BDEA 1V0PA 1JKLA 5C8KA 1R78A 3E87A 3REPA 1OITA 2HW6A 4LL5A 1ZZLA 5CSHA 3SW4A 5M4UA 2A4LA 3QX4A 4ZY6A 4X2GA 4D55A 3CJGA 5J7HA 4XV1A 4FKSA 2E9UA 3MTFA 2OJIA 2OFUA 4RFZA 3U55A 4LOQA 4FIGA 4NFMA 2XZSA 4ANNA 4ZJJA 3O96A 3CR0A 5T3QA 4N57A 4PDYA 1OBDA 3IDPA 1E9HA 1S9JA 1APME 3ORTA 2QOBA 4FL1A 4FNWA 2GHGA 3Q4TA 2Y4IC 3ZC6A 2YN8A 3A7FA 5L6WL 2Z7QA 4FV0A 3U4WA 3FMDA 3IG7A 3UTOA 3UQGA 1BI7A 4Z9LA 4G3DA 2E9OA 5CZIA 1UU3A 3BWJA 3CPBA 1WFCA 4D2RA 3GGFA 5L6PA 4RIWB 5KMJA 3PJ1A 3U6JA 5LXMA 4AA0A 2X8EA 4B4LA 3G5DA 5LCKA 4PTCA 4D9TA 3ORPA 4JOAA 4LV5A 2UW5A 4F7LA 3IK3A 5JK3A 4C4JA 4FV2A 4GCJA 2QC6A 3RALA 5HX6A 4AE6A 4XBUA 4L7FA 2BPMA 3EFJA 4RX5A 4KSPA 3F5GA 5E8WA 3Q52A 1Y91A 2W96B 3P4KA 4PDPA 3K5VA 1Q97A 4X3FA 3ZRKA 4MAOA 4DFZE 4I22A 3EQFA 3HECA 4TY1A 3WIKA 2XVDA 3HX4A 3DQWA 3LFCA 3F3WA 3FPMA 4FV6A 4BWXA 3HMIA 2JFLA 2OH4A 3G2FA 4N6ZA 4EKLA 5FDPA 3OCBA 5KMLA 4QMXA 3TXOA 2YCQA 3TZ8A 2HWPA 3ZXZA 3NIZA 2X8DA 3B2WA 5FQDC 3EQPA 3PTGA 4ZTRA 2YM7A 3DBDA 5E7RA 2YWPA 4U0IA 2ITVA 3EYHA 4Y83A 3UO4A 4X2KA 2P0CA 2Y6OA 2RG6A 2CKPA 3DKCA 2IN6A 4AZVA 4DTAA 3OD6X 4MXYA 4X7QA 3FAAA 5T68A 4IAYA 3ZFXA 4OTHA 2PZIA 3ORZA 3W55A 3HMMA 4EOMA 3EQBA 2DYLA 4OAVB 3DAKA 3ACKA 4ZZNA 1J91A 3CE3A 1Q62A 2HIWA 2EXMA 5LARA 3G0FA 3NW7A 3RVGA 2XM8A 4YZNA 1H8FA 3HV4A 1KE7A 2XIKA 2F7ZE 3KC3A 5M56A 4RLLA 4FTNA 1R39A 2WTKC 4UY9A 4A9RA 4KAOA 2C0TA 3QZGA 5A9UA 2W17A 1Q3WA 5AP7A 1H01A 1XHAA 1LPUA 2JDRA 3UYTA 3WF9A 4I23A 4ALWA 2NRYA 3I0OA 4F9BA 5KBRA 2CN8A 2PMIA 4AW1A 3ZO1A 1XWSA 2HY81 2VTRA 2WPAA 4RG0A 3Q60A 4YGAA 4BCJA 4PY1A 4O0YA 3MIAA 3RPVA 2V62A 4ZIMA 4BZDA 2VZ6A 2QHNA 3TNPC 3E3BX 4QP6A 5JRQA 3CSVA 3QLFA 1IEPA 4O1PA 2PUIA 4DAWA 3FHRA 3UGCA 2QU5A 3R63A 4WUNA 4D58A 3MB6A 2BIKB 1FQ1B 4G3EA 4FTMA 4F9CA 3E92A 4XBRA 1JSVA 1W84A 4FKVA 2BMCA 3A99A 2QHMA 3G33A 4OTIA 5KO1A 3HLLA 3COMA 2R3GA 2EVAA 3IGOA 4ZMFA 5EH0A 5JGBA 5DVRA 4F7SA 3U4UA 4AT4A 4PNIA 2PU8A 3MTLA 4XP3A 1XR1A 4JX3A 3PA3A 2OBJA 5FDXA 2VTMA 4M68A 5IUIA 4AF3A 4TL0A 2QOFA 2C5OA 2VNWA 2XUUA 3OWPA 4Q5HA 5EYKA 3TKHA 4CGAA 3PVUA 5CAVA 4ERKA 1KE5A 5AP4A 3A7IA 5F94A 1PXKA 4RRVA 1VJYA 2B54A 4XHKB 3VHEA 3QF9A 4C4IA 3HV7A 3D5VA 5EDPA 4DFUA 3BRBA 3QU0A 4FTTA 3VS0A 4LMUA 4E5BA 4WO5A 2ITUA 4IWDA 4DTBA 3BEGA 3BE2A 3HGKA 4FVRA 4FV8A 4G2FA 4D1SA 4LQMA 3LQ8A 2PMNX 2BRHA 5D12A 4ZTNA 3LFDA 5IMEA 4BCHA 5FEQA 3ANQA 1Z57A 1YQJA 4JQ8A 4J98A 3FEGA 3FMEA 4U3ZA 1BMKA 5EYDA 4D2WA 2ZVAA 4BCQA 3BLRA 5FRIA 1YDRE 2ZB1A 4IM3A 3TKIA 4GRBA 5BMSA 2R3LA 5CENA 3VUTA 3IGGA 4ZXTA 3R7IA 5E1EA 3ZRLA 3UVRA 4TRLA 4IVAA 2C69A 3OC1A 4KIOA 2W1ZA 3PY0A 4NSTA 4R1VA 2O0UA 3IECA 2JIIA 2WQOA 4JBPA 2HZ0A 5FGKA 5CSVA 5AX3A 2CGWA 3D2IA 3I7BA 1REKA 5DFPA 5CU0A 2YFXA 4XMOA 2XNOA 3QUDA 3ROCA 4ARKA 4GU6A 5L6OA 4I6QA 5DYJA 3MN3A 3GCQA 3T9IA 3FWQA 2NRUA 2JC6A 1UA2A 3KEXA 3MYGA 3MB7A 5BVOA 3LQ5A 3K3JA 4DT8A 4F6UA 4PDOA 1CKIA 3NVMB 4L00A 5L2TA 5LWNA 1ZWSA 4JX7A 2Y0AA 3CKXA 3U9CA 4JBOA 2C5VA 4PV0A 4RJ8A 3M11A 2BRBA 2IZRA 3MS9A 4QT1A 4APPA 2QG7A 3ZLSA 4CG8A 3S2PA 1Q8ZA 4F6SA 5AEPA 3OBGA 4QMPA 4HZRA 1LEWA 4KNBA 2PUUA 3TV6A 3LKMA 4BCMA 3GNIB 4KIKB 4YNOA 4M69A 4M7IA 4JI9A 4NIFB 3RP9A 3F9NA 4PP9A 2OI4X 3EJ1A 3NX8A 4IM0A 4S32A 1OI9A 4U5JA 4A4XA 2ZB0A 4RIYA 3TV7A 4G3GA 3OBJA 1KV2A 3UIXA 4JS8A 1GZOA 1H1QA 2C6OA 2F7EE 2FUMA 5KHXA 3D14A 2J5EA 3ITZA 2DUVA 3G9LX 3R8LA 4AS0A 4K8AA 4ZZMA 5L8KA 5HCXA 3KXNA 3HMPA 5HESA 3SXSA 1R3CA 4ZAUA 5A4LA 4C35A 3B2TA 3ZO3A 3QX2A 5GJGA 3OCTA 4PF4A 5AP1A 3SXRA 1Q5KA 4ZSEA 4RSSA 3F66A 3Q5ZA 3C50A 2VO3A 4QTBA 3ZFYA 5CANA 4O7RA 2C3LA 4GJ3A 4IX6A 3R7OA 1UWHA 3OEFX 3UO5A 5BUIA 5IQDA 2BILB 1ZY5A 3VHKA 4K77A 3GCUA 4QMSA 3ULIA 5I9XA 4DHFA 4MHAA 1GAGA 3F5UA 3IW6A 2PUNA 4MX9A 3BU6A 4D2TA 3R71A 4WIHA 5DEWA 4YU2A 4OTDA 2XH5A 4RMZA 5JH6A 5E8TA 3DKGA 3M2WA 4EH4A 4I41A 4EK3A 3DPKA 3PA5A 3FSFA 4RVLA 4R5SA 5DRDA 3NPCA 5TO8A 4A4OA 4ACMA 2BCJA 4OLIA 4F9WA 4TKSA 4X2FA 3G6HA 3GC7A 4TYJA 3PP1A 5AMNA 5JGDA 1M14A 4CNHA 3UMXA 4BKYA 5E8YA 5DR9A 4BCOA 1OECA 3ZMMA 3W2CA 4AQCA 3RBWA 4EQCA 3FKNA 4GYGA 2Q0NA 2QOQA 4QTAA 5CTPA 5HOAA 3GEQA 3HV5A 3QXOA 1OPJA 4DEAA 2GQRA 1OL7A 3D7TB 3QLGA 3UIMA 3IKAA 4XOZA 4O0UA 2J5FA 3QL8A 4BZOA 3TUDA 3QQHA 5CQWA 3AXWA 5AAFA 3ORKA 5CF5A 2YIXA 4UWYA 1XBAA 4DG2E 5CAQA 5L8LA 2AC5A 2Y7JA 2OWBA 4E5AX 3BZ3A 1IR3A 3QHWA 5DOSA 1FBNA 1PMVA 5IH4A 4FIEA 4MF1A 5JSMA 3FI3A 4FKTA 4ZK5A 3MA3A 5IQEA 2WTJA 3KXMA 3QCSA 4MQ1A 4HGLA 4ZOGA 4ZS0A 5EM8A 5IQIA 2R2PA 5HE3A 2BZJA 3DT1A 5AA8A 4K18A 2GHLA 3HV6A 2B52A 3KL8A 4PDSA 4A06A 2PPQA 5KMIA 1Q24A 3L9MA 4F1MA 2GU8A 4Y5QA 4GSBA 2JD5A 4YPDA 1VZOA 5B2LA 4Y85A 2CGVA 4WOVA 4L3JA 4BDAA 2OKRA 3KFAA 4Y46A 4YHTA 5BQ0A 4FKUA 3SRVB 3LHJA 4QQJA 3HZTA 4NM5A 4FT7A 4NTTA 4CCUA 2JDOA 3R8MA 2W5AA 4YP8A 3R9DA 2Z60A 3TT0A 2PVYA 2ZOQA 4KKEA 3HA8A 4O81A 3FQEA 5IA0A 3OT8A 4AOIA 4GU9A 3L8SA 2EB2A 2OJJA 3ZSIA 2PUPA 2RGPA 2W99B 4QP9A 3CTJA 4G31A 2YZLA 4D5HA 5IUHA 1P14A 3BGPA 5FM2A 4QTCA 3V01A 3D5WA 4ITHA 3OEZA 4P90A 4WG5A 4QMNA 3BU3A 3ZZWA 1KSWA 2CNQA 3N9XA 5BVKA 1UKIA 2A19B 2X7GA 4L46A 4O7LA 3CBLA 2JKMA 4K2RA 4O7TA 4ZTHA 3S3IA 2BTSA 5HD4A 3EL7A 3TEIA 3R8PA 4FOBA 3E8NA 5KNJA 4FNXA 4HZSA 5EHYA 4TWNA 4EH5A 4DFBA 3PUPA 1PMEA 4HCVA 4ACHA 4GFOA 1WBSA 2VU3A 3NEWA 5FLFA 5J79A 5IEVA 4AFJA 3JY0A 3FYKX 5J5TA 4JG7A 2UW3A 2W5HA 4HPTE 3CLYA 1P2AA 1H4LA 3KF4A 3MPMA 4BL1A 4FV3A 4UMQA 4BCFA 2GPHA 3C0IA 3MV5A 4F65A 3AMBA 5AP5A 4C36A 2AYPA 3MWUA 2R3OA 2BDWA 3A8WA 3T8OA 3V5JA 5CU6A 2WNTA 4L45A 4YC3A 4XG7A 3P9JA 4DC2A 4CQGA 1JKTA 5D11A 3PWDA 3UOJA 5ITAA 3AT3A 2OGVA 3OY3A 1WBWA 2QOLA 2WIHA 4J97A 2WO6A 5KHWA 2I7QA 2W1GA 5CI6A 1UNHA 1T45A 4ONAA 1WAKA 2OZOA 3BQRA 2C6MA 4DFLA 4A7CA 1BX6A 4I94A 5HD7A 2X7FA 1LUFA 2E9VA 4FTKA 3KXGA 5JZNA 1VR2A 4IAAA 4J71A 4QMMA 5EI2A 3CCNA 5ETCA 2ZV8A 2G1TA 1FOTA 2UZEA 2WMAA 3NYVA 4YNEA 3LMHA 3LXLA 4F09A 1ZMVA 1YXSA 2C1AA 3BE9A 5DG5A 3VJOA 2IZUA 3C1XA 3D4QA 2C6EA 4FT3A 4BWPA 5JFWA 2XK4A 3R01A 5IQFA 1E1XA 4O0XA 1YI6A 3HAMA 3PJ2A 2WMRA 1JOWB 3MIYA 2QNJA 2FH9A 5J7BA 2YJSA 2YLEA 3UMWA 4IIRA 3GU5A 5DE2A 2JDSA 3RKBA
chains in the Genus database with same CATH superfamily
4MYGA 4NKAA 4YZCA 2VWIA 3NW6A 4O6EA 4K9YA 4ANMA 4ZY4A 5GJDA 1R0PA 5I9VA 2YDJA 5DT0A 2QO2A 2VGPA 4EUUA 3C5UA 2VWWA 4XH6A 2Z7LA 4Y73A 2C30A 3KMMA 4ZP5A 5CXHA 5E9EA 1LP4A 3D94A 4QP8A 4F9YA 4E4MA 4BHNA 3JXWA 3I0QA 3NNUA 2J51A 4F99A 2HZNA 3R9HA 1H26A 1VYWA 5IU2A 3PRFA 3UNKA 3PSCA 3H9RA 2H6DA 3IS5A 3OWLA 3F2RA 3BELA 4I5CA 5HO8A 3JS2A 5AIKA 3F5PA 3FPQA 3DGKA 3OHTA 2WEVA 2QURA 4IX3A 2CCIA 2JDTA 3PPJA 3CXWA 5GINE 3KXZA 4JXFA 4KIKA 4KD1A 3WI6A 3NNXA 4UMRA 1OB3A 2PVRA 4U42A 5HG9A 4HNIA 5BVNA 3C5IA 4K33A 5CEKA 5D10A 5JN2A 2ITOA 4IADA 4C58A 1YKRA 2I0EA 3PVGA 2VTJA 4PL4A 5CSXA 3ZEPA 2J90A 4R78A 3PXRA 2BZHB 4IAKA 5J8IA 4LRMA 4HW7A 1FVVA 4Z7HA 2PL0A 2X6EA 2FGIA 1OM1A 2R3PA 5FP6A 4M12A 2PVFA 4PUZA 1SM2A 4JG6A 1G8AA 1Q8WA 3IO7A 4G6LA 4RC4A 3DTCA 3NUYA 1G5SA 1B6CB 4KIQA 4USDA 3OCSA 4O4BB 1ZLTA 4ZSLA 4MWIA 4EBVA 5JFSA 4UMTA 5FTOA 2QOCA 1M7NA 2ERKA 3Q6UA 5HIDA 4A9YA 1H27A 3CD3A 3KB7A 4FG7A 4FT0A 2UZLA 3SVVA 3ETAA 1XH8A 3G15A 4FZ6A 3F82A 4YJVA 3HRFA 4CFNA 1W2CA 2PVMA 1DAWA 5LVMA 2XNBA 1WVYA 2VX0A 1JLUE 4O0VA 3FUPA 3WE4A 1RDQE 3NNWA 5K5XA 3FLZA 1REJA 5L2WA 3S0OA 3PIXA 4G1WA 4QQCA 3VNTA 4BGGA 4IZYA 5BNJA 3EYGA 4DFNA 3OF0A 1KOBA 3H4JA 4XLVA 5DR2A 4F63A 3V5TA 5K9IA 4YC8A 3DLSA 1ATPE 3KY2A 3HRCA 2GNLA 1SNUA 2HXLA 3A61A 2BAJA 5HORA 1YDTE 3QCQA 2J0JA 4RFMA 3R7EA 4L7SA 3QYWA 5M4IA 4O38A 3PE2A 3KMUA 3GQIA 4DITA 3F88A 3MFSA 1M52A 2VTHA 4JQ7A 4KKGA 3QWJA 2NO3A 1W2DA 2Q0BA 2XIRA 4YJQA 3VS5A 4BDDA 4CFFA 2ZMCA 3BLHA 3CEKA 1F0QA 1H1RA 1Q61A 2V0DA 4FZAB 1J1BA 2WTIA 3CQUA 1U4DA 2ZDTA 2W4KA 5HTCA 1OKZA 4MNEB 2WOUA 2B4SB 4X2NA 5EG3A 3D7TA 4YJOA 4IZAA 4RWJA 2PVNA 5KE0A 2ITNA 3VUDA 4CFWA 4R3CA 2HYYA 4FEVA 4EK5A 2OJFE 3ODZX 4JDKA 4RIOA 4YBKA 4E4LA 3I5NA 4LRKA 1ZAOA 2UW6A 3O8TA 2BROA 4CT2A 4G17A 3II5A 1W7HA 3AGMA 4L3LA 3EQGA 3FQHA 1OUKA 3ZHPC 4W4VA 1X8BA 2B7AA 3UPZA 4PL3A 2BRNA 3PJCA 3P7AA 3R2BA 4IVDA 4MCVA 3RGFA 2CLXA 4FKIA 1NXKA 2JBPA 5LJJA 4FV1A 5FXRA 3H10A 4FVQA 4W8DA 3W8LA 3ZM4A 3V51A 2XKCA 3LCDA 3LAUA 4D4SA 5DT3A 5HO6A 3HUBA 2ITZA 4O84A 4I1ZA 2OXYA 5CQUA 3SRVA 4QPAA 2VWVA 5KX8A 1M7QA 2WTCA 1YOLA 4K1BA 3PFQA 4TXCA 3RMFA 4QP7A 3HP5A 3C4CA 3EQCA 4EYMA 1RW8A 5EKOA 3EQHA 5BVEA 2BHHA 5A6NA 5ICPA 2GDOA 5L3AA 4XG9A 5JFXA 1I09A 2HW7A 3JPVA 2BZKB 2C6KA 2JKQA 4KABA 1YXXA 3QQGA 3KXXA 2X4FA 4ZSJA 4EUTA 3R1SA 3E62A 4IH8A 3SC1A 1JSUA 4IMYA 4DN5A 4C02A 3DK7A 2I0VA 5AUYA 5H8EA 4FEUA 4P2KA 5IQAA 1FPUA 1H24A 3AGLA 1CMKE 2PY3A 3JUHA 4ZJIA 4NJDA 4IC8A 2GNJA 3GU7A 4N70A 3ZEWA 4KS7A 4S2ZA 1SZMA 3RK7A 4TT7A 3SLSA 4B6LA 4ZLYA 4PPCA 2BFXA 4TYHB 1O6YA 4K11A 4U9AA 5KMMA 2HZ4A 1HCLA 3F3TA 2UZDA 1CKPA 4S33A 4XUFA 2WQMA 3TN8A 4D2VA 5JGAA 5K3YA 5I4NA 2Y4PA 2PYWA 5HZNA 3NZ0A 3EZRA 1FMOE 4FZFB 3WZJA 3TZ7A 2XK7A 3Q4UA 4NZWB 4YJNA 2FSTX 2R7BA 4DF3A 4PL5A 4HGSA 2VNYA 3QTZA 3FZTA 4Z16A 5D7VA 4ZY5A 4NU1A 5EFQA 3S00A 3MVJA 4DLIA 4YZMA 2HENA 2RL5A 4FICA 4LGHA 2R5TA 4RIXB 4LDTA 4I4FA 3TNWA 3PIYA 4FSTA 1OKVA 3F5XA 4A9SA 2W5BA 5M06A 5AUVA 4PPBA 3TZMA 3QTRA 3GFEA 1YXUA 2P33A 2QLQA 1OKWA 3P23A 5IMXA 4Z7GA 3SD0A 5IEXA 4C3FA 2AEGA 5C03A 4H3PA 4FR4A 1MRYA 2B53A 4IZ7A 4BTFA 5DRBA 2FA2A 1SVHA 2FSOX 4LI5A 3FLYA 5K0KA 5CSPA 3N4UA 3Q2JA 5K5NA 1JSTA 3TIYA 4CVAA 4FE2A 4L52A 4JBQA 2XNGA 3FJQE 4USFA 4HGEA 3LM0A 4QMTA 3ZBXA 3QXPA 4QQTA 4XOYA 4R77A 2VX3A 4FSNA 3EMGA 2YM4A 3QD2B 3U6HA 3UP2A 1PXJA 5E8ZA 3VQUA 4ALVA 5I9YA 4NK9A 5T6KA 4I3ZA 5HBJA 3T3VA 1H08A 4BJJA 3PJ3A 3FXWA 3KULB 4GMYA 3V5QA 4RT7A 4FKJA 5A4QA 4Z3VA 4L3PA 2IW9A 2CJMA 3QQJA 4RQVA 2X0OA 4WD5A 5BUJA 1B39A 2XANA 2UZTA 2ZYBA 2R0UA 4ZTLA 5TR6A 3ZXTA 5HO7A 2HOGA 3LJ0A 2W4JA 1IA8A 3VWAA 5ANKA 4AZSA 4D4VA 3MJ1A 4BIEA 4C3PA 1YI4A 3BYOA 3W32A 3P7CA 2ITQA 4Y95A 4C38A 4M14A 4ZZOA 4O7WA 3LM5A 1P5EA 3VRYA 1WBTA 4RA4A 4NWMA 4BDCA 2W1FA 4WUAA 4CMTA 4EH8A 4YR8A 4MKCA 4EHZA 2VAGA 2F2UA 4BRXA 1YDSE 3QRIA 4GG5A 1ZMWA 4FF8A 4ASXA 3PJ8A 3WZDA 4FKGA 3CKWA 5A14A 5GZ8A 3NUXA 5M51A 1J7LA 2JAMA 3EN9A 4TNDA 2XNEA 1BUHA 3HNGA 4S30A 3W18A 3RAIA 4M66A 4UXQA 3SQQA 2YZAA 4RWLA 5C1QB 2XKDA 1GIIA 3L9LA 3G90X 4U3YA 4U79A 5DR6A 2XNPA 5TOZA 4O0RA 2QOIA 4B7TA 3NNVA 4S31A 3KK8A 4QMWA 3VULA 5J1VA 3KK9A 3LMGA 4HVGA 1GOLA 4N6YA 3EN5A 5CEOA 3W0OA 4QO9A 3ORXA 4Q2AA 2F57A 3Q04A 2WTVA 4GEOA 3F3UA 5E92A 3Q9ZA 4EOSA 3E7OA 3EQIA 3OTUA 3I60A 5JQ8A 1XMMA 2GTMA 3IW5A 4FKPA 5GZ9A 1JBPE 1PMNA 4DBXA 3UNJA 2YCFA 4I6BA 3VUKA 4IDVA 4KS8A 4M67A 4FV4A 3OXTA 1PYXA 4ZTMA 4O2PA 3FQSA 3WYYA 4DH1A 2QQ7A 4MXXA 4WRSA 3O17A 2QKRA 3OP5A 4IX5A 4K0YA 3TTJA 3RPYA 3V04A 3PWYA 1MQBA 3V3VA 3CPCA 2VTLA 4FIFA 2ITXA 1SVGA 4RJ7A 5D41A 4DCEA 4JRVA 4BBMA 3BYSA 4PMTA 5E90A 3C13A 5KCVA 2B55A 2YCSA 2VO7A 3N4TA 4AAYA 2CN5A 4L68A 4ASDA 3H0ZA 3BEAA 4YHJA 4DLJA 4EL9A 4CKJA 5HQ0A 2JBOA 5AUXA 3TV4A 2EXEA 2G01A 3O0GA 5I9UA 4L42A 4OBOA 3BU5A 4FVPA 4GS6A 5A4EA 1Y57A 1YWVA 3MVHA 3UODA 1IAHA 4GW8A 1A9UA 3TNQB 3FYJX 4AXDA 5FG8A 5AR7A 2V5QA 5F4NA 3UJGA 2QOOA 3L9NA 2P2HA 1OVEA 4EWQA 1OL2A 4CV9A 4QMQA 4EI4A 5LMBA 3FLSA 4KSQA 4CRSA 3W2OA 3CY2A 3AT2A 3BHHA 3ZUTA 4DG0E 2E9PA 2UV2A 2C6DA 3R2YA 4MK0A 2WMTA 3FC2A 5F95A 3VJNA 5A4CA 4PTEA 2BAQA 3C4WA 3ERKA 4GT4A 3A7JA 3QFVA 2WOTA 3BYUA 3FKOA 3Q9XA 4RGJA 5DA3A 4FKOA 5BYZA 4ID7A 3T3UA 3ZSHA 5J9LA 4LFIA 2IWIA 3GFWA 3VIDA 3W0QA 4GIIA 2CDZA 4TZRA 4XG6A 2OW3A 4J96A 5HE2A 3G9NA 2I40A 3FMKA 4DGGA 3ZSGA 2WMQA 3PLSA 5AM6A 2WAJA 3KN6A 4F6WA 1Y8GA 3V8SA 4FK3A 4E5WA 3TUCA 5E8XA 3VRZA 4MF0A 3VUIA 4MNEA 3L9PA 4QYHA 3KREA 1PF8A 3QTUA 2WKMA 4C59A 2H34A 3ZCLA 1E1VA 4AA5A 2ESMA 4EBWA 3OROA 1URWA 3VONA 4BCNA 5AR8A 4F0GA 3SAYA 4IW0A 5GJFA 4C8BA 3BPRA 2WQNA 3G51A 3UDTA 4IAFA 2C4GA 3QBNA 4JDHA 4ORKA 3LCTA 3MA6A 3ZONA 5IA1A 3NYOA 5LOHA 2CCHA 3RCJA 4XEYA 4UWBA 4WKQA 1PXNA 3QTIA 4JDIA 5C01A 5GHVA 1ZOGA 3RK5A 1GZ8A 2R64A 4E6QA 2XIZA 3U54A 3QHRA 2ZM4A 2YM8A 4N4SA 3TG1A 4H3QA 2BKKA 3WZKA 4KBKA 1YXVA 3R28A 3DBQA 3BIZA 5AX9A 5ETAA 3LXKA 5HNBA 3FI2A 1ST0A 5HG5A 3UQCA 1WBNA 5EW3A 4IAZA 4XG4A 3QA8A 3DS6A 2Z7RA 3DV3A 4EHGA 4EH9A 4R7HA 4ENYA 5A6OA 1U46A 4RWKA 2W9FB 4KKHA 4RVTA 3E64A 2F7XE 3S95A 2NNWB 3ULZA 2W06A 5CVHA 5C4LA 4BC6A 3FMLA 4KBAA 3PPKA 4HVHA 4NEUA 4E4NA 2PZRA 4BGHA 2VD5A 1M17A 1V0BA 1ZMUA 2FYSA 2X9FA 1T46A 3O7LB 2OFVA 4JG8A 4LYNA 4OTPA 3ZS5A 5KMOA 3B8RA 4AXEA 1XKKA 3SXFA 3IOPA 3ZLWA 5JQ5A 5HVYA 1ZYLA 1YRPA 3TKUA 4AN2A 2XRUA 3GC0A 2VV9A 4NW5A 4GT5A 5FP5A 4BGQA 3CGFA 4U40A 1XJDA 2XS0A 2VWZA 5AIRA 5ACBC 4MTAA 2WMWA 2OZAB 1BYGA 3A62A 3LIJA 3W2SA 4HCTA 4HNFA 1BKXA 4EH6A 2OSCA 2XB7A 4CT1A 2ONLC 5DEYA 3ID6C 4IX4A 4QMYA 4FBXA 4D4YA 4DFXE 3AC4A 2RF9A 4NM7A 4AW2A 4LUEA 3W16A 5EI8A 4O91A 2G2HA 3PSBA 3AOXA 4GK4A 3SV0A 4CZUA 4RIXA 5HU3A 1IAJA 2O5KA 2HELA 4X2JA 4JIKA 4CTBA 5ANGA 1JAMA 2YERA 5AWMA 3V5PA 4AZEA 1NVSA 1J7UA 4EOIA 2B9IA 4GV1A 4AZTA 2YISA 5I9WA 2XYUA 2BDFA 3RTPA 4CV8A 1ZOEA 1XBCA 5JMSA 3TDVA 4NH1A 4CMUA 5IH5A 5HE1A 3EFLA 2OK1A 4D5KA 4CFUA 5HVJA 3VAPA 3DTWA 5EYCA 1V0OA 3NAXA 2QOHA 1Y6BA 3QD0A 4RIWA 4LV8A 3OUKA 3PXFA 2I0YA 4O7VA 4IJPA 3R8ZA 3R83A 4BY9E 1TVOA 4C2VA 3LMIA 4QMLA 3K2LA 3KXHA 4UN0C 4L53A 5AV4A 3PY3A 1ERKA 4PMSA 4V01A 1ZARA 1H07A 4R8QA 2EUFB 4FV7A 2EU9A 2KULA 2QCSA 4J52A 3QZFA 1AQ1A 4IWPA 3V5WA 4KA3A 1G3NA 2PZYA 2WFYA 2J7TA 2XRWA 3OUNB 5FEEA 4FYNA 4UYNA 2C3JA 3WE8A 5AR2A 2YM5A 4U44A 3SKCA 4OR5A 3EFKA 4EOLA 4JBVA 4QDVA 4DA5A 3W8QA 1PJKA 2UZNA 3QTQA 2ETMA 2A98A 4QTEA 2XK8A 2RG5A 3RI1A 3LFFA 1GIHA 2W1IA 2O3PA 2YACA 4OTQA 4TTHB 2GNGA 2JIVA 3H9FA 4XG2A 2QONA 2W1EA 2REIA 4ACCA 4YTIA 4FNZA 4G3CA 5L2SA 2UZUE 3GOPA 4JJRA 5H8BA 3WF5A 4DINA 3UBDA 4OTGA 4ZEGA 4PNKA 3L8PA 3MY1A 4XG8A 1RJBA 2C1BA 2QO9A 4MBJA 3ATSA 3FDNA 4I0SA 2IVVA 2ONLA 3EHAA 4FL3A 4L9IA 2P3GX 4FT9A 3FC1X 2XEYA 4AUAA 1KOAA 4EH3A 5CEQA 3RPRA 4D0XA 3E88A 4DHJA 2GHMA 3OMVA 3UOKA 3W2QA 4ACGA 4BVUA 5G6VA 5GIPE 2AUHA 3BQCA 3MDYA 4DTKA 2UW4A 4ZJVA 4WHZA 4AOTA 3GC8A 3UE4A 3R00A 2R3JA 1NVQA 2GQSA 3FZ1A 3UDBA 3E5AA 4UMUA 2JFMA 4DG3E 4GVJA 3PE1A 4WG4A 2OIBA 5F20A 5J5SA 1JQHA 1PY5A 3OVVA 3MSSA 2XKEA 4E6AA 3IPHA 1OIYA 3DFCB 4MD8E 4EJNA 5CU4A 2ACXA 2VO0A 3EN7A 5DI1A 5E4HA 3PYYA 2FB8A 4KBCA 4E26A 5HIEA 1YI3A 3QAME 3LFAA 2XK9A 2B9JA 4CTCA 5IDPA 4BR3A 2JEDA 3DY7A 4QDEA 5HG8A 5B2KA 2E9NA 4BFMA 4ZLZA 2J0KA 2Q83A 2BUJA 4KIPA 2A0CX 2WEIA 3DJ7A 4EORA 5HBEA 3FBVA 3VS2A 3ZFMA 1H1SA 3HMNA 1FVTA 1Q3DA 5EHLA 3PFYA 5LQFA 4BDIA 4L67A 5LCJA 2VN9A 3UDZA 3A2CA 1O6KA 3Q53A 2CGUA 2WTDA 2V7OA 5C27A 5CASA 1J1CA 2C6LA 4MD7E 4UXLA 3FZRA 4B8LA 4CG9A 2JLDA 5A46A 1J7IA 3VUGA 1P4FA 1QMZA 3F61A 2ZFYA 4QNAA 2ZV9A 4MWHA 1UU7A 1WBPA 3QTWA 4C2WA 3NIEA 1LR4A 4YMJA 4LV7A 4IVCA 4YLJA 3WBLA 1GIJA 5E1SA 3R9OA 4DGMA 2ETRA 3BGQA 5AV0A 4LL0A 4P5ZA 5EQYA 4FX3A 5ANJA 5CALA 3NFGB 4AN9A 2CGXA 4BN1A 2XJ2A 4J8MA 3ZYAA 4ZSGA 3O51A 1KE6A 5M57A 2Z8CA 2G2FA 3NUNA 4MVFA 5CXZA 2IEWA 5I9ZA 4R7BA 3LE6A 4H1JA 4C62A 3LXNA 5CVGA 3U8WA 4EOJA 2JGZA 3DJ6A 3MH0A 4BTKA 4GT3A 4H39A 4QYGA 3PSDA 3LVPA 4O96A 4QP3A 4QRCA 1H00A 5CU3A 5C9CA 4AACA 2DWBA 3QZIA 3ZRMA 5AP3A 3KU2A 4O27B 5FUTA 2VTSA 4IACA 4RX8A 1TKIA 4H3BA 2BRMA 3JYAA 3NS9A 2O64A 4TN6A 4W9WA 4IBMA 4AAAA 4EC8A 4WNPA 3A4PA 2CMWA 4PMPA 4M15A 3LW0A 3NW5A 3HA6A 4FKQA 4OBPA 4WSQA 3PLAE 4UYAA 4U8ZA 3EKNA 3Q2MA 2HCKA 1LEZA 3ANRA 2ITTA 1XH7A 3D9VA 1NA7A 4TW9A 5EDQA 5BVFA 3P1AA 4EZ7A 4N0SA 1A48A 2P55A 1OL5A 4DEEA 4DCAA 2B9HA 5C26A 2KTYA 4EJ7A 3E3PA 1YVJA 4RX7A 4C0TA 5IDNA 4FEXA 3F6XA 3KKVA 2R4BA 3HEGA 2RFSA 4FSRA 1OPKA 3QALE 3WZUA 3LFNA 3POOA 5IQHA 3CC6A 2PMOX 1FMKA 3OXIA 1UKHA 4JQEA 3GC9A 3P5JC 4LOOA 4EHVA 3IQ7A 3RPSA 4KWPA 4S34A 1SMHA 3BV2A 4HVDA 4FC0A 3ACJA 4X3JA 2UUEA 3NLBA 4FSYA 4TWPA 4NIFA 4IANA 4Q9ZA 3CQWA 5CEIA 2WMSA 3DB6A 2YIRA 3P78A 3K3IA 1AD5A 3C9WA 1HOWA 1W82A 2UZVA 1OPLA 3QKMA 3OWJA 2PVJA 5K4IA 1R0EA 3D83A 3I81A 1V1KA 2V55A 3SG8A 1L3RE 3MBLA 2Y4IB 1Y6AA 5D9HA 4GL9A 4QMZA 3UVQA 4FTOA 2OO8X 3QTSA 4B8MA 4G3FA 2V7AA 3HRBA 4JRNA 2A1AB 2OZAA 4D2SA 1P4OA 4BKZA 4HYIA 5TF9A 1UU9A 2OH0E 2YIWA 2ZM1A 4IB0A 4MXOA 3RJCA 4EKKA 3RAKA 2NP8A 5A54A 2PE1A 3T9TA 4X0MA 4M0ZA 2VX1A 3ZUVA 3VN9A 4FA2A 3LFQA 4EOQA 2X1NA 4F70A 4U81A 2EXCX 4EEVA 2PHKA 3RAWA 1KV1A 2IW6A 3MPAA 5M4FA 3KRJA 4GYIA 4DH5A 3HAVA 1M2PA 4IDTA 1M2RA 5HI2A 4BYIA 4IWQA 5CT0A 3VS7A 2AQXA 3CGOA 1JWHA 4I92A 2VUWA 3ELJA 4JDJA 4Y72A 5EQPA 2O65A 5H9BA 3PZHA 3E63A 3QYZA 2YLFA 3TUBA 4O4DA 1Z9XA 3F2AA 4J8NA 2GTNA 3DK3A 4Y8DA 5AP6A 3F7ZA 4BBEA 2IVSA 3F2NA 4YZBA 3MH3A 3ZC5A 2XIXA 3ZO4A 3FL4A 4WSYA 2BALA 4WNOA 2C6IA 3DBEA 4DGOA 3SOCA 4O22A 4I6HA 4O0SA 4C57A 1PXIA 2XK6A 1PRYA 1ZY4A 4FTQA 3E93A 1IG1A 3UYSA 3Q96A 2QLUA 3DQXA 4B99A 3H30A 3G0EA 1YXTA 2PULA 2UZBA 2C3KA 4PPAA 3DFAA 3PPZA 5ETIA 3Q6WA 4K6ZA 3LJ2A 3K5UA 4MEDA 4CFMA 2GNHA 2X0QA 4BIBA 4CSVA 3BGZA 4I0TA 3ATTA 2C5NA 2A27A 2BAKA 2VWYA 4FTUA 4QP1A 3VUMA 4IQ6A 3IW8A 2WMBA 5M44A 2YDKA 2X6DA 2R9SA 5HLWA 3AKLA 1EH4A 4I0RA 3NDMA 4XNEA 4C33A 2ZDUA 2RSVA 5TT7A 3ENMA 3WARA 4KUJA 5IKWA 2A2AA 2WGJA 5E8VA 3R1QA 3QQLA 4WBBB 4I5PA 4O83A 3TL8A 3VS6A 5B7VA 3WOWA 2OLCA 1MP8A 3L1SA 4IEBA 4RVKA 1Q8YA 5AV3A 1O6LA 3GB2A 3I1AA 2WZJA 1PMUA 5CT7A 2W1HA 4NW6A 3EFWA 3PP0A 1UVRA 2PVKA 5E91A 3GVUA 2UW0A 3PXKA 2C0OA 3PZEA 3QWKA 3R1YA 3AD4A 1H1PA 1OL6A 2VTOA 1PXOA 2QR7A 3KCKA 4X6QC 3ODYX 3PG1A 2VTIA 3SOAA 3W33A 4DBNA 5K0XA 3ZDUA 1VEBA 5CEPA 5DBXA 4F4PA 2C68A 3BL7A 3OOGA 2XCHA 4FV9A 2NPQA 2JIUA 3BV3A 3HKOA 4YHFA 5ANEA 3BKBA 3IW4A 5AAEA 3SA0A 4YSJA 2PTKA 3W1FA 5CAOA 4FV5A 2VTQA 4O7SA 1SNXA 4FGRA 5IQBA 4QPSA 4V0GB 5EHOA 1H28A 4G6OA 4RC3A 5D1JA 4DGLC 2W1DA 5A4TA 3C4FA 4RFYA 4FIHA 5AV2A 3OZ6A 3GT8A 2PZPA 3A60A 3FMHA 3PVBA 3QUEA 5HLNA 2PK9A 2UW9A 3DCVA 3AQVA 3EQDA 3WYXA 4TPTA 1MUOA 5HVKA 4FUXA 3RAHA 2NYAA 3UIBA 5ANIA 4NM3A 3A7HA 3O7LD 4FKLA 3SG9A 3MFRA 2XK3A 3QCXA 4P4CA 2IPXA 4H58A 1QPEA 5IA3A 4D1XA 3VVHA 4J99A 4KRCA 3P5KA 4UALA 4DEIA 2CHLA 4EOKA 4EZ5A 3EB0A 4OT5A 1HCKA 3R04A 2AC3A 1IRKA 3W0RA 3EOCA 4F1OA 4GIHA 3CQEA 2ERZE 4LUDA 4PMMA 2C5XA 4TYGA 4O0WA 3V8WA 4HOKA 3DNEA 4YUQA 4TWOA 3E7VA 5HICA 4AGCA 3ALOA 4IZ5A 3CTHA 2B0QA 4YTFA 5EI6A 4MQ2A 4JR3A 3FMMA 5M53A 2ITWA 2WMUA 2E2BA 3OCGA 3OW4A 4WT6A 4QMUA 2IO6A 2YM3A 4EHEA 4DEHA 2XALA 3KVXA 3R30A 3DBFA 2PSQA 3MFTA 5FTQA 3OOMA 4YO6A 3VBYA 2YA9A 5DN3A 4ANSA 5CAPA 4AGDA 3R9NA 5EM6A 3MGYA 2J6MA 3Q3BA 3MW1A 3WILA 4D9UA 4PWNA 1CDKA 2UW8A 3U87A 2OF2A 4R3RA 1CTPE 4BKJA 2VTAA 3DOGA 4NJ3A 4IAIA 2G9XA 2W9ZB 4QQ5A 1G8SA 4B9DA 3WZEA 3GENA 4J53A 1BL6A 2ZV7A 1OIUA 3ZH8A 1TQIA 4AP7A 2J9MA 5CF8A 3LLTA 4AX8A 2GS6A 2QD9A 4CFXA 2PZ5A 4MNFA 4DT9A 3LCOA 2JDVA 2WXVA 5EM7A 1VLRA 1Y8YA 3I7CA 3FLNC 1PW2A 3C51A 3FLQA 2W4OA 2XBJA 3AD5A 4BCPA 3V6RA 3E8CA 4BDHA 5HTBA 4ZLOA 4FG8A 4M0YA 3IONA 3FI8A 2BR1A 4BCIA 3ZU7A 5E8UA 3VBWA 5BYYA 4GKIA 1FGKA 2V22A 2JKKA 5L2IA 3HVCA 4FSMA 1YOMA 2XARA 3W10A 4FSQA 2EWAA 3FZSA 3QKKA 4C37A 3QGYA 4YC6A 1DAYA 1K3AA 3FV8A 4NM0A 2CKQA 2IVTA 2WELA 3ORMA 3PRIA 3JY9A 3W0PA 1PXLA 1RQQA 2UVZA 2X0GA 3KQ7A 3NSZA 4XRJA 5DWRA 5J95A 4EQUA 5CF4A 1JKSA 5JRSA 1WMKA 4CKRA 4XV3A 4CXAA 2WTWA 4BDJA 3D7ZA 2OJGA 3Q4CA 4LOPA 3M42A 5AA9A 4O4CA 1K2PA 5AR3A 4E1ZA 4JMQA 4H36A 3RNIA 4CYJA 2JAVA 2W0JA 1QPDA 3C7QA 5IZFA 2R3NA 2YJRA 3TDWA 5BVWA 3BHYA 3F69A 4QYEA 5DGZA 4CZTA 1Q4LA 1Q8TA 2VGOA 3NUUA 3F7WA 4I24A 4YBJA 3TNIA 3BHVA 2RFNA 2BVAA 4WNMA 1XH6A 3O71A 4GFGA 4FJVA 5GIOE 4YJSA 4D4RA 1Z5MA 3LCSA 2YDIA 4I5MA 4YJRA 3ZDIA 1UU8A 4HVIA 4W8EA 3MH2A 2HXQA 3PVWA 2C0IA 4L6QA 4XV2A 4YZ9A 3FMJA 4BI0A 4ASZA 1WVWA 2ITPA 4FIIA 1ZRZA 4FSWA 4RJ3A 3E8DA 5HCYA 1DM2A 1ZXEA 2IG7A 4YZDA 3W0SA 2FSMX 4EK8A 3PY1A 3VW8A 4I93A 4JNWA 4PTGA 5ANDA 4YPSA 5HE0A 5HIBA 5CZHA 4BYJA 2QR8A 4IM2A 3FXZA 2OXXA 3AC3A 4BDBA 5IG1A 1ZYDA 4FUYA 1OIQA 3A4OX 4DE4A 3VQHA 2HWOA 4DYMA 4O21A 5IQCA 3ZM9A 2R3QA 3AT4A 2WQBA 4USEA 2VWUA 5BUEA 2ZM3A 4CD0A 1GZKA 4TYIA 3UG1A 3UC4A 5KUPA 1IASA 2F2CB 4R1YA 4QPMA 3VBTA 3L8VA 1BI8A 3MVLA 4EWHA 4GH2A 4YURA 4AT5A 3UNZA 2HAKA 5GNKA 4FRFA 4AW5A 4V04A 4V05A 3RM7A 2YEXA 2H96A 5HHWA 1ZYSA 3BX5A 2XIYA 4DEGA 3A7GA 5DT4A 3CY3A