5EHOA

Rapid discovery of pyrido[3,4-d]pyrimidine inhibitors of monopolar spindle kinase 1 (mps1) using a structure-based hydridization approach
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
279
structure length
258
Chain Sequence
QSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMQPDVGTVNYMPPEAIKDMISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Dual specificity protein kinase TTK
publication title Rapid Discovery of Pyrido[3,4-d]pyrimidine Inhibitors of Monopolar Spindle kinase 1 (MPS1) Using a Structure-Based Hydridization Approach
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 83
structure length 258
sequence length 279
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2015-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ehoA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ehoA01
1H4LA 3QKMA 2X0GA 3CJFA 1MRVA 3ZLXA 4EH6A 3EH9A 1XBBA 3CC6A 5FP5A 3CXWA 2PSQA 4D1SA 1PYXA 2WMVA 5L8LA 3FYJX 3FMMA 3O0GA 4EUTA 4CQGA 4L3JA 3NUPA 4OLIA 4FG9A 4YZ9A 4MXXA 5DG5A 5TT7A 5HZNA 2OH0E 4BBEA 3O50A 4QQ5A 2J50A 3UC4A 3QD4A 4XNEA 2DS1A 1XH5A 2R3OA 5HIDA 1ZOHA 4N0SA 4QP9A 4HVDA 1H1WA 3Q5IA 3CPBA 3L8VA 1OKZA 3FE3A 4XV3A 5JH6A 3L8SA 2NNWB 4YJNA 2QG5A 1V1KA 4O0RA 3FMNA 3BGPA 4Y46A 2QQ7A 4CRLA 4CFFA 5M07A 4IVBA 3K3IA 4RJ5A 4M97A 4RMZA 2XBAA 4RIYA 2QOCA 1XJDA 4WD5A 4DEEA 4PRJA 5AP6A 3Q2JA 1CSNA 2XBJA 3UO5A 4W8DA 2C0IA 1Q8ZA 4MD7E 3QRTA 4EBWA 4I21A 4ORKA 3RVGA 4KIKA 2RG5A 2WQOA 3QD2B 5AP4A 2C47A 1P4FA 4BCQA 2HXQA 2A2AA 3VC4A 3VW8A 1BL6A 3R7OA 3PIZA 3O8UA 4C37A 3UMXA 5J5SA 1XR1A 4PL5A 3Q96A 2C6LA 2XNPA 4M14A 4RIOA 3V6SA 4E93A 5A4TA 4MD9E 4R7BA 4QYYA 1UU9A 4EKKA 1TQIA 4C7TA 3IECA 3V3VA 4FI1A 3QTIA 4GU9A 2WTVA 4QQTA 4G16A 4G9RA 2IZTA 3C4ZA 3ACJA 3FI8A 3LHJA 1P4OA 1YWVA 2CNQA 3F2RA 4YZDA 2W06A 4HZSA 5IQGA 3F3UA 4O84A 4IVDA 3ANRA 4UXQA 4RLLA 2WQMA 3H30A 4RBLA 3SC1A 4I0TA 1OIQA 1XBCA 3MY5A 4PDPA 3O8PA 3OZ6A 4Y5HA 4C38A 4XOZA 2P4IA 2C3KA 3ZUVA 4ZMEA 3P5KA 4QMQA 4XBUA 2IW9A 5DFPA 1PMVA 3S1HA 4IMYA 4RGJA 2A19B 2QURA 4O2ZA 1GY3A 4LRKA 3VQUA 1LEWA 2OJ9A 4MNEA 1P2AA 4R8QA 2B9HA 2Y6OA 5CQUA 3SXRA 1NVRA 5E8XA 4Q5EA 5IQDA 2XK9A 2O8YA 4MWHA 4K11A 4OBOA 4QTBA 5HIBA 4U79A 4AGDA 2IW8A 2JDVA 4FNZA 3JUHA 4K8AA 3BX5A 4WG5A 3OMVA 3GVUA 4FTLA 2JAMA 3RNYA 4RPVA 4WG3A 3UMWA 3VBXA 4E6QA 3E3PA 5LCKA 5CU3A 2W7XA 3DQXA 1OMWA 1W82A 4LMNA 3R8PA 3TNHA 3R30A 2OJJA 4DEDA 3BZ3A 4I94A 4NK9A 5F9EA 2ZM3A 3ZU7A 3F5XA 3G2FA 4I6HA 3MTLA 4CFVA 4XG4A 2R3JA 3OTVA 4XCUA 4AW1A 2YHVA 3F7WA 1WBPA 2W4OA 4IXPA 4DFZE 5A9UA 4BCOA 4HYUA 2IPXA 3Q53A 2WELA 4TKSA 3VJOA 2BRMA 4MXYA 3TT0A 2XYNA 4HVGA 3C50A 3D83A 3NPCA 4E20A 3R2YA 2OZOA 4EJNA 2XNMA 5EDQA 3DQWA 3F9NA 3MIYA 4FF8A 5AIKA 2GNJA 4FL2A 2FB8A 3BRBA 5DR9A 5GIOE 5LVOA 5M06A 4DA5A 2XNEA 2YIXA 2PZIA 2UUEA 5KBQA 4FSTA 3DKCA 1K2PA 2X6EA 5IEXA 1H01A 3WZJA 4ANNA 3HRFA 1OPJA 4YJUA 4BKYA 3PA5A 4XOYA 1P5EA 3OHTA 4YHJA 2X9EA 3ROCA 1REJA 1OM1A 2HW6A 4W4YA 4DT8A 5IH4A 5AM6A 5EOBA 4YUQA 1JKTA 2C30A 2PMIA 4LV8A 4HCUA 5CZHA 4S31A 4GRBA 4PUZA 1Q99A 3R71A 4X2GA 4HYSA 5BYZA 1X8BA 2XP2A 3VS6A 4IX4A 5E4HA 2PL0A 1UNGA 3MB6A 4OTFA 5HIEA 3L9PA 4IBMA 3UPZA 4XV9A 3UP2A 4IE9A 2BFXA 5I0BA 3V5PA 3HAMA 4RIWB 4YPDA 3RM6A 4HNFA 3ZDIA 4DHFA 4JOAA 4H39A 4WIHA 4AT5A 3ORNA 5CVHA 2JAVA 2XS0A 4FVQA 4J1RA 1F3MC 3H4JA 3PXFA 2BZHB 4PV0A 2YZAA 4G17A 5A4QA 4GEOA 3I60A 3QC9A 5IA2A 4IZ7A 3JXWA 5BVKA 3WI6A 5HCYA 4G3CA 3HDMA 4OT5A 4QMXA 5A6NA 3L9MA 3RAWA 1ZZLA 3ORZA 4D9TA 5EI8A 4FIJA 1NW1A 4IB0A 2FSLX 1BX6A 3OT3A 1YDTE 2ZDTA 3IG7A 5EM7A 3QQKA 3QRKA 3HAVA 4GK3A 1SYKA 1LUFA 3IKAA 4A9UA 4DEGA 4O83A 4O7LA 5AV4A 2YIRA 2JC6A 4QRCA 4EC8A 3R6XA 3EKNA 4I5CA 3U6IA 4ZOGA 2W96B 3A7JA 4QTEA 5AFVA 3D2KA 2W4JA 2JKOA 3C0HA 2CJMA 4EWQA 3D94A 3QTSA 4CXAA 3ZFYA 3EKKA 1W84A 2HWPA 2YCRA 3P23A 2J5FA 5A46A 3LFNA 5AV2A 3OXTA 2W1EA 3ZYAA 4X3FC 3BCEA 3C0IA 3W32A 5AUTA 2V22A 3AG9A 2ITNA 3OXIA 3GP0A 1JSUA 4BDFA 4C62A 2YEXA 2Y6MA 3NNXA 5L6OA 4O0XA 4EH4A 3OG7A 4NZWB 2XA4A 1FGIA 4O6EA 4RSSA 1LR4A 2UW4A 2YJRA 3PJ3A 5DN3A 1H07A 3FC1X 4TW9A 5FEQA 5AUZA 4D1XA 4YJSA 2C0OA 5DT0A 2VTNA 5CVFA 3O7LB 2JBOA 3UVPA 4G6NA 3TKHA 5JKGA 3Q9WA 2GNGA 4F9WA 2YIWA 5FP6A 4AF3A 1G3NA 2OIDA 4Z7HA 5F4NA 1NXKA 1QPJA 3O23A 3RKBA 2JD5A 4BDHA 3MFSA 3WZUA 2OGVA 2WEVA 4X6QC 5CAOA 3QRUA 3EQPA 4AZVA 2Y9QA 4XLVA 3ZO4A 2AUHA 4AZFA 2PVHA 3BHTA 2YDJA 4DFBA 2W1IA 4GU6A 2PYWA 1WVXA 1OB3A 2BRNA 3PXKA 5HCZA 3W2PA 4AQCA 5BUIA 3CKWA 4WBOA 4YLJA 2QLQA 5HNGA 2YN8A 3KCFA 3F7ZA 4LGGA 2RL5A 2BZIB 4ZP5A 5AX9A 4DFNA 3DKGA 4I4FA 2UVYA 4JDIA 4UMQA 1WMKA 4XG9A 3UO4A 5IPJA 2W5AA 4PP7A 3HUCA 4GKHA 4U81A 4M12A 4NM7A 2P3GX 3BHVA 2FO0A 4MX9A 4BTMA 2ZM1A 2GQGA 3BU6A 4KIQA 4LOPA 5M4UA 4L8MA 4OAUC 3FEGA 3V51A 3MS9A 3LFCA 3WE8A 2VUWA 3KVWA 2XK8A 2JDSA 5AV3A 2I0YA 3GCVA 2CPKE 3FV8A 3KQ7A 4F99A 5AP0A 5BX0A 3D7TB 4IWOA 5ACKA 4PTCA 3JPVA 3OCTA 5C1QB 3TG1A 4KIPA 4WBBB 4PNIA 3TJDA 2DWBA 3ID6C 4PPAA 3DBEA 4U80A 3HA6A 4CMTA 3CD8A 2VTOA 3MVHA 3ORXA 3G15A 2X7FA 1JVPP 5IUIA 5HBHA 4YURA 2F4JA 4BHNA 3MB7A 2EB2A 3BHYA 3OC1A 4MQ1A 5LMBA 3NYOA 4L9IA 3PPZA 3GXLA 2V0DA 3SGCA 3MSSA 1YXXA 5JN2A 5GZAA 2EUFB 4KABA 3KF7A 3PIYA 4IC7A 1GIHA 4LL5A 4QMWA 3KXMA 3D5WA 3LFSA 3Q4CA 4QTCA 5JZNA 4F1TA 2C5NA 4D2VA 3KRRA 4EORA 4OGRA 5HG8A 4BKZA 3FI2A 3GEQA 2I6LA 3A2CA 3DJ5A 3NSZA 5I9WA 4L3LA 4RJ8A 4O7YA 3BHHA 4AG8A 4DFUA 4QMNA 3RK7A 2WMQA 1BUHA 1OITA 3VUHA 2WPAA 4AXAA 1ZYCA 4IFGA 3LQ5A 3FZOA 1JQHA 4FV2A 1RJBA 2F2UA 4G6OA 3UOHA 2BZKB 3KL8A 5HX6A 3ULZA 3SG8A 3ZXTA 3A8XA 4DLJA 2JLDA 4GG7A 1L3RE 3FMDA 5FLFA 5AAEA 4FTNA 5DEWA 5AX3A 2IVTA 2CLQA 4H1MA 4EOMA 1KWPA 3BEGA 3MVLA 2ITYA 4ZS0A 4IAFA 3WF5A 3VS0A 2P0CA 5C03A 2HZNA 2VNWA 3W10A 5AUVA 4BTJA 3EMGA 4HOKA 3F66A 1PF8A 1R39A 3NW7A 2XK6A 3QGWA 5I9UA 1KOAA 2FSMX 4EWHA 3R7EA 3QCSA 4Z55A 4NCTA 4NIFA 4FV8A 4DBNA 3SX9A 5BVWA 3E3BX 3PZEA 2ZV8A 3WBLA 3B8RA 2ITZA 2QCSA 4I23A 5CAPA 3K2LA 1LP4A 3QL8A 4E4MA 2YACA 5EG3A 4USDA 4C4IA 4QP7A 1U59A 5FEDA 4E3CA 1ZWSA 4AGUA 4ZTHA 3OT8A 4ONAA 3HNGA 4YTIA 4JBQA 5BVEA 4EKLA 2WIHA 1Q97A 4FZFB 3ZS5A 1RDQE 2WOUA 1WBTA 2QODA 4DCEA 1XBAA 2C1AA 4FKPA 3AMBA 3GCSA 4J96A 5D12A 4YJOA 3L9NA 4PMPA 4RIYB 2IZRA 3NIZA 3OOMA 4BYIA 1RW8A 4FIHA 3E7OA 3DB6A 4MF0A 5HG5A 3OW4A 2H6DA 5AAFA 2BRGA 4RWIA 1JBPE 2WQNA 3C4CA 3PIXA 3QXPA 5FTOA 1URCA 3RPSA 1PXOA 3G6GA 4X2FA 3DZOA 2V55A 2ITXA 3RCDA 4KIKB 2XCKA 4YC8A 4EHZA 2QC6A 3RPOA 3U4WA 3BYUA 3THBA 1CKJA 2YM3A 4M84A 2B9IA 4S30A 4EL9A 4BR3A 2Z60A 4GYGA 2B1PA 3LKMA 4MHAA 4B7TA 5KZ0A 4EQCA 2PUIA 4FSNA 3GBZA 3KC3A 4UMTA 2PUUA 3R9DA 3JS2A 3HMOA 1SZMA 4RVKA 3Q9XA 5IDNA 2CGVA 3VULA 2QD9A 3RAIA 3RPYA 3MPTA 3ZLWA 4YZMA 5KMLA 3UYSA 5K4JA 4H3QA 5B7VA 4V01A 1ND4A 4QYFA 2PUNA 4C57A 2VTAA 4HPTE 4ZZOA 3NUAA 1RQQA 4U45A 1YKRA 3R63A 4ZJVA 5L2IA 4G3FA 3ODZX 4TYEA 3R8VA 5HOAA 5LVPA 3PY3A 4FKQA 2EXMA 4GV1A 4U7ZA 1FVVA 2OF4A 4QMMA 4ZAUA 3BIZA 1W0XC 4II5A 3W2QA 1FMOE 2HELA 4TN6A 3MPMA 4J71A 5CU4A 4F6UA 4FYOA 3KXGA 4RVMA 3NVKI 4DN5A 5IQEA 1YVJA 1KV1A 2ESMA 3JVRA 3GOPA 4DLIA 4O0UA 3AC5A 5HU3A 3P0MA 4QP2A 2VWIA 5A4CA 3PA4A 4FKJA 4PPBA 4ASZA 2XZSA 4HVHA 4FSMA 5I9ZA 1DI9A 4Y85A 3GB2A 2E9UA 2XIZA 5CI6A 3VNTA 1IAJA 5JZJA 2E9VA 3PJ1A 5CLPA 2PE0A 3Q6UA 3LCTA 4V0GA 3LCKA 1UA2A 2GNLA 5C8KA 2WMUA 2GNHA 3FLQA 3LFBA 4JR7A 4O1OA 5CEIA 3PE1A 2A4LA 4J7BA 4O7TA 2PZYA 3F3WA 4LOOA 3GU7A 5FTQA 4E4NA 5IA1A 5C4LA 3KN5A 4FA2A 4XUFA 5HBEA 4FSRA 4FL3A 5IMEA 1H1PA 2WFYA 1OIYA 4JBOA 4W4VA 4LRJA 4EZ3A 5LMKC 4NFMA 2YISA 2ZMCA 3NEWA 4W8EA 4TWCA 2UZDA 4RX8A 1E1XA 4IJPA 4XG2A 4XRLA 4EQUA 5GZ8A 2J2IB 3OY3A 4O96A 4QYGA 2HWOA 2VTHA 5AM7A 3ERKA 5FQDC 5C01A 3TN8A 2HK5A 4DH5A 4DH3A 3ZM4A 2ZVAA 4YSJA 3LVPA 4RFZA 5E8ZA 5IKWA 3UVRA 3MW1A 4B0GA 3VUGA 3OBJA 5HQ0A 3QCYA 3GUBA 2RGPA 4AX8A 1MRUA 3CD3A 4D4RA 2I1MA 1PY5A 5HO8A 2Z7QA 4HZRA 1SMHA 2GTNA 2AC3A 3DGKA 4QMYA 4FSWA 3WZDA 4BDGA 4UN0C 4HW7A 3D7ZA 2ITPA 4FTQA 4RC3A 5GNKA 3UIUA 4C2VA 4EONA 2R3NA 2UW9A 4P5ZA 1OKYA 4P5QA 2GDOA 2I0VA 2Y0AA 2XJ0A 4ACCA 4C59A 4F9BA 1ZXEA 3BEAA 1BI8A 3MIAA 1PKDA 4F64A 3SLSA 5CTPA 1AD5A 2BHHA 3PJ8A 5L6PA 1ZY5A 4M0ZA 3CBLA 5BNJA 3HV6A 1BYGA 3NWWA 4LUDA 3FXZA 1BMKA 4Q5HA 2OKRA 5DNRA 1JSVA 2QNJA 3TDVA 3W18A 2ITVA 4JS8A 3ANQA 2E9NA 5AV0A 1KE7A 3G0EA 4FICA 3U6HA 4CLIA 2UZUE 4G6LA 4JG6A 4RLKA 5A4LA 3FL5A 2PU8A 2PULA 3CPCA 3WOWA 1IG1A 5ANDA 3ALNA 3OFMA 4NSTA 5M4IA 2VWXA 2VTJA 4FT7A 3HRBA 3QX4A 1T46A 2PWLA 3D2IA 4CTBA 1Q24A 5J7HA 4GFGA 2R3PA 3K5UA 3O17A 4NJDA 4DGMA 4U42A 2ONLC 4FKLA 2WTDA 2RFDA 2JDTA 4WG4A 5G6VA 3UODA 4ENXA 5HTIA 4JIKA 2Z7RA 3IOPA 3SHEA 3NAYA 4CFWA 4IAIA 3HV3A 3TUBA 4FEVA 4G3GA 1UNLA 2XYUA 3FY2A 3JY9A 3PTGA 3OCBA 3IDPA 2X1NA 4EH7A 3AXWA 4O0SA 4AAAA 4DEAA 4C3PA 2X8IA 2QOIA 5AMNA 3IW4A 4J97A 3IDCA 1SM2A 4JI9A 4E1ZA 2DUVA 4TRLA 5DH3A 2XIXA 2XNBA 3TNQB 2PVMA 3LQ3A 2JEDA 5HORA 3UOJA 4BDAA 4IX3A 2QO7A 4C33A 4ZEGA 2FGIA 4GVJA 3VUIA 5IH5A 3ZUUA 5B2MA 3NW6A 5A3XA 4WRSA 3KRLA 2C4GA 4WHZA 3A7HA 3W2SA 1ZMVA 2C1BA 4CRSA 2H96A 4RX5A 2HYYA 5CASA 4QOXA 3A4OX 4QMPA 2GFSA 4IZYA 4AN9A 3EL8A 4D2WA 4U0IA 2W1HA 3PP1A 4RX7A 5FXRA 4DTBA 5A4EA 4UYNA 1ATPE 3VUMA 4DFXE 4ZTRA 3TACA 5M53A 1UU7A 2X8DA 1OL7A 3COHA 3C1XA 4TYHA 1XQZA 3F3TA 1XKKA 4HYHA 4RQVA 5LVNA 5GZ9A 1YDRE 4JAJA 2Y7JA 3UE4A 4Y73A 3OY1A 3VJNA 4EHVA 1JAMA 2ZV7A 4KAOA 3I79A 4O6LA 1CDKA 3SD0A 2C6MA 4A9TA 3CS9A 3H10A 4YPSA 1OECA 3R2BA 4IX5A 2WD1A 2C5OA 5G1XA 5FGKA 3RM7A 5HD4A 3D15A 3ZZEA 2FUMA 3I1AA 4CFXA 3GU4A 3TDWA 4OT6A 4IB1A 3GCPA 5EQEA 2VX3A 1OKWA 1VZOA 3A60A 4L01A 5KUPA 3UBDA 5DBXA 4PTGA 2VTPA 3A7GA 4MXOA 3BBWA 3EQDA 2J0MB 4UBAA 4PDSA 1VYWA 1XWSA 3KU2A 3LLAA 3GOKA 3SOAA 3ZHPC 4R6VA 2PMNX 3KRJA 4D4VA 5IUHA 1YDSE 1SVHA 2VTQA 3ZUTA 2J90A 3QRIA 4CMOA 3S95A 5GHVA 3ZXZA 3REPA 1XO2B 4MYGA 4U43A 4QP1A 4B4LA 4U44A 2VGPA 2VN9A 4XEYA 1GNGA 3ACKA 4FOBA 4Y95A 4M13A 3U4UA 2GNIA 3HMIA 3HL7A 2UZBA 4FNXA 4HCVA 3BE2A 4FUYA 2QI8A 3EN7A 2J0JA 5AEPA 2YERA 4JX7A 2ITTA 1PKGA 1NT2A 3HV5A 3ZC5A 3KMWA 5DPVA 2XVDA 3V5WA 2W1ZA 2JFLA 4QPMA 4EOKA 2QHNA 1YI3A 2XK7A 2ZV9A 4V05A 4KNBA 3VVHA 3UYTA 4K18A 4CKRA 4G5PA 1PXJA 3TXOA 4X3FA 2GS2A 4OUCA 5C8MA 3PG3A 4EYMA 4ZZNA 4OAVB 5AADA 4AGCA 2W05A 2VZ6A 3VRYA 4GKIA 3E88A 4RA5A 5HCXA 3ZTXA 3G51A 3U51A 3ZC6A 3W55A 4E5AX 3QAME 1YOMA 3WILA 1Q3DA 2YDKA 1IASA 3EJ1A 4K6ZA 1YXUA 2X9FA 3RJCA 5JQ5A 3EQCA 4D2TA 4IAKA 4AS0A 3AD5A 1GZKA 3ZSHA 5GJFA 3IW6A 4BBFA 4BHZA 4I5HA 3K5VA 4S2ZA 2ZOQA 3BBTB 3CEKA 5AR7A 4NM5A 4HPUE 2JKMA 4H58A 3HKOA 2BVAA 4YNEA 4CKJA 1IA8A 5ANJA 5JFVA 4BGGA 3NVMB 3E63A 3FC2A 5L2SA 3UDBA 5KMKA 4DH8A 3HV7A 1WAKA 4IWQA 3ZDUA 2R7BA 2ITOA 5CSXA 4BZOA 3T3VA 4FGBA 1QL6A 3LE6A 3V5JA 4A07A 3DKFA 4E5WA 1U5RA 5E91A 3GI3A 3FMLA 5LOHA 4DBXA 4RJ7A 2EU9A 5ANKA 2R3RA 2WMTA 2C68A 1GOLA 5IA3A 3EOCA 5KKRB 4FKVA 3R8UA 2IG7A 4QMTA 2WMWA 1QPEA 3QZFA 5EM6A 5LARA 3VBTA 1XH6A 2WTKB 2B53A 4FSUA 3DT1A 3BV2A 3F3VA 5F20A 4NIFB 2GTMA 3FY0A 2XK4A 5DE2A 5J95A 5T6KA 4ANOA 5CU2A 5FRIA 3KREA 4RJ4A 3F82A 2R3GA 5H2UA 1V0OA 4OR5A 4CD0A 3RMFA 4YO6A 4QP4A 1WVWA 5JRQA 2CNVA 1QPCA 2PMOX 1YHVA 2CKEA 1R78A 2RG6A 1MP8A 5JMSA 3LFDA 2QOFA 1KE5A 2W4KA 2GMXA 4DTAA 2C69A 4L7FA 4MKCA 3MFUA 1IEPA 4RWJA 2YCSA 4TYGA 4ZK5A 1OVEA 4EHEA 5HNIX 2VAGA 2O64A 2C6EA 2J0KA 3EN9A 4EH2A 3ENHA 4I1ZA 3PXZA 3HMPA 2F7ZE 3PJ2A 4MQ2A 3N4TA 3EQBA 3PUPA 4FUXA 5EKOA 5DA3A 5F95A 1BL7A 2PZPA 4QO9A 3OWPA 4IB3A 5L8JA 3IO7A 3MBLA 3MFTA 3P1AA 3SKCA 4BGHA 1ZY4A 4FKGA 1O6LA 4CZYB 1GJOA 3KY2A 2IVUA 1E1VA 5BYLA 2G15A 4K9YA 5EHOA 4LMUA 2WXVA 3LFAA 5AR2A 3EFWA 4K33A 2QVSE 3UIXA 4HGLA 4OTPA 4RJ3A 4D4YA 5E92A 3AGMA 3ZLSA 2AC5A 2Y4IB 4QYHA 5IQHA 4YJTA 2JKKA 5I3RA 2I0HA 1U54A 3BYSA 3LQ8A 1SVEA 1OIRA 2YM4A 3W16A 4W9WA 3IQ7A 4IDVA 4UEUA 4F9YA 2CLXA 2BFYA 1Z5MA 2VO7A 4BTKA 4F6SA 2GQSA 5E9EA 4ZJJA 4UWCA 5CSPA 1LEZA 4BDEA 5IQIA 3D9VA 4D0WA 4FTCA 4NT4A 2VV9A 4PPCA 2PZRA 1UV5A 2JFMA 4L3PA 5JGBA 4OTQA 4E4LA 4I92A 1J1CA 2JKQA 2WHBA 3AT2A 4FNWA 4FTUA 4QMSA 5DLSA 4CFUA 1O9UA 3FMJA 3I7CA 3KKVA 3UNKA 2YLFA 4FIGA 4F0GA 4RRVA 4FZDB 4JRVA 2NO3A 3TWJA 5GJGA 1Q62A 4NEUA 1W8CA 3E8EA 1F0QA 2VO0A 2XM9A 4ANQA 4NYEA 4ASDA 3DLSA 4D4SA 2W99B 4RVTA 3QQHA 3FLSA 3RCJA 4CQEA 4C36A 2PVFA 3HLLA 1UWHA 4P2KA 1YI6A 2B4SB 3EL7A 3QD0A 1TVOA 2PE2A 3PG1A 4RQKA 3DY7A 4O7ZA 3QWJA 4NJ3A 4BFMA 4FV1A 3MY1A 4A9RA 2W0JA 4UMRA 2QOBA 3IDBA 5A6OA 5LXMA 4XV1A 3QHWA 3QTXA 5I5ZA 2ZDUA 4TNBA 4QPAA 3I7BA 4O7NA 3ZMMA 3TM0A 2AYPA 2QO2A 4ZSJA 5C4KA 4UMPA 3DCVA 4D58A 4I6BA 3HP2A 3ATTA 1M52A 2Y4PA 5DMZA 3JY0A 5I3OA 1M14A 3EWHA 4V0GB 3C4FA 1IA9A 4FYNA 4A9YA 3VS7A 1M2QA 2IJMA 3R0TA 1Q8UA 5CX9A 2W9FB 4LM5A 5CWZA 3MFRA 5CU0A 4L42A 4BCJA 2GHGA 3E5AA 1FMKA 2ETMA 2G9XA 3HP5A 3KB7A 4M68A 4RZVA 4TY1A 3OOGA 4AA5A 4ZSAA 3DKOA 3KULA 1Q5KA 3F5PA 5HHWA 3CIKA 4BWXA 3FKOA 4BDCA 5LQFA 2OBJA 3NLBA 3LCDA 3G9NA 4MK0A 5GIPE 3SAYA 2BIKB 3M11A 2WMSA 3MGYA 3DTCA 3QRJA 3PSDA 4LUEA 4QMUA 3WF9A 4Z16A 5I9VA 5LCJA 4BIBA 2WTJA 4L52A 4L43A 1SNXA 3OROA 3UPXA 4D9UA 4QQCA 4X2JA 2B52A 3DZQA 5HX8A 4V04A 2YCFA 3UNJA 4FEQA 4FK3A 2DYLA 4JJRA 1M7NA 2O3PA 4LRMA 5HBJA 2NP8A 1KSWA 2XNOA 3D5UA 3EYGA 3FZRA 2P33A 2X7GA 2C5YA 3Q4TA 4X0MA 5D41A 2J0LA 4I6FA 3SV0A 4R3CA 3VUTA 2FSOX 5M4CA 5CS6A 2BIYA 2XJ2A 4ZMFA 1IRKA 2C3LA 3MH2A 4H05A 5IQCA 5KHWA 4UB7A 1XH7A 3AT4A 5EYKA 1ZYSA 3VS4A 3VS5A 4BI1A 3DK3A 4IHPA 4YSMA 5L2WA 3P9JA 4RWLA 2WGJA 2J4ZA 3DDPA 3EHAA 3Q9YA 2W1GA 1WFCA 3WZKA 5IU2A 4MEDA 4Z9LA 4L00A 4KWPA 2A1AB 2YWVA 5I9XA 2PE1A 1OUKA 5DOSA 5HLWA 3CE3A 3KA0A 3QUPA 2W5BA 3O2MA 2W5HA 3BGZA 4PDOA 3R9HA 4UV0A 5EDPA 3FWQA 4FBXA 3MA6A 1TQMA 5CSHA 3DNDA 3QC4A 3UIMA 4BDDA 3RHKA 3GENA 1H26A 3PPJA 3R01A 1MQBA 4FT0A 2BDJA 3MVMA 4AP7A 3L8XA 4ZTNA 1Y8GA 3V5TA 3A4PA 4JNWA 5CXZA 5HTBA 3EYHA 4WRGA 3A7FA 3ALOA 3LZBA 3KEXA 3MH0A 2LAVA 3RK5A 2WMBA 4CV8A 3TZMA 4C2WA 3MWUA 3ODYX 3R1SA 5DRBA 4FVPA 3AC2A 3AMYA 4U5JA 3WZEA 3G90X 5AA8A 3TKUA 3RALA 4AT3A 3GCQA 1MUOA 2PVRA 4WSQA 4F0FA 2F7XE 3VHKA 2ZJWA 4GFOA 3R7YA 2OG8A 1VEBA 4H36A 3LMHA 4JLCA 2XIYA 3LXLA 4RZWA 1M2PA 4Y83A 3K54A 5B2LA 2R3LA 5AUXA 2R3QA 2R2PA 2X4ZA 3IK3A 4GYIA 3F61A 5DRDA 1REKA 2SRCA 4A7CA 3DFAA 5IDPA 2YM5A 1MQ4A 5IZFA 2XJ1A 2ZMDA 1M2RA 3AD6A 2HY0A 1YQJA 2XMYA 4O21A 2UZVA 2OSCA 4FT3A 4L44A 5DHJA 4LGHA 3CGFA 4RT7A 4M3QA 5D7VA 2YZLA 4UY9A 4J99A 5CI7A 2X4FA 2GFCA 3NS9A 3PY1A 3QF9A 1O6YA 3DJ7A 3EFJA 5IQAA 3CQEA 3FL4A 4U40A 3GGFA 3RP9A 1J7LA 4ANSA 3GNIB 2R9SA 4FTIA 3VN9A 5ETCA 3AQVA 1GZ8A 4TYHB 5FBNC 3BWFA 3C51A 1H0WA 4CV9A 3UOLA 3R8LA 2PPQA 1OIUA 2QO9A 4RVLA 4UWBA 4AZSA 2X7OA 2XKCA 4JX3A 4QNAA 3UOKA 4I93A 4N4SA 3F2AA 2J5EA 3KXXA 3NUYA 1OPLA 4JDKA 2PUPA 1J7UA 1FGKA 5EW9A 3QQLA 4CGAA 5CSVA 4DGOA 4USEA 2PVJA 3DLZA 3FZTA 4QQJA 2BTSA 2HENA 1H24A 3EFKA 4ZSEA 5EKNA 2B7AA 2J51A 2XK3A 3KN6A 3UNZA 5HVYA 3F6XA 4E26A 3T3UA 3G33A 3KGAA 4G34A 4BGQA 3GU8A 4JIAA 3E8CA 3GU6A 4ID7A 4EOQA 5E90A 4TPTA 3V5LA 4YP8A 3COKA 5LVLA 3DXPA 2RFSA 3NYNA 4ENYA 4XRJA 3VF9A 2HZ4A 3PY0A 4IFCA 4YLKA 1EH4A 3D5XA 3EIDA 2UW6A 4C34A 5CT0A 4RA4A 5CEQA 3EQGA 4PMTA 2ERZE 4CYIA 4BDIA 3ORMA 4E6CA 1TKIA 3HUBA 4GS6A 5ANEA 2BTRA 4EOSA 4BI2A 2J6MA 5JFXA 2OH4A 3CTQA 4I3ZA 5M4FA 4DFYA 1ZAOA 4YJQA 5M08A 4AU8A 1K9AA 4AA4A 5IA4A 2PZ5A 1KE9A 2ETKA 2XNGA 3QD3A 3ROYA 2X2LA 3MVJA 5AP3A 4I20A 5M55A 5IF1A 4D28A 1A48A 1W7HA 3HZTA 3NDMA 4N70A 5JK3A 3N4UA 4Z3VA 2VTIA 3G6HA 3HMNA 3R8ZA 2RFEA 4JDHA 4X3FB 4M7IA 5H9BA 3S3IA 3ZO3A 2VX1A 3MA3A 5I4NA 3N4VA 1JLUE 3WE4A 3VO3A 2ZV2A 4D55A 4O86A 1GIJA 1H25A 5LVMA 3R04A 5E8YA 4NL0A 4L46A 3VRZA 3COIA 1OZ1A 4O22A 4UYAA 5LMAA 4KBKA 4Z7GA 3POOA 3HGKA 4G5JA 3UIBA 4DC2A 2VO3A 4XS2A 3R00A 5HE1A 5M57A 4EBVA 4C3RA 4EOOA 4GFMA 3RTPA 3E7VA 3GC8A 3ZRKA 2BAJA 1FPUA 4XG8A 2C6DA 3PRFA 5D9HA 4YTCA 4FKTA 2C6TA 4JDJA 5KMIA 2CKOA 1V0PA 1OL2A 4ACGA 2BILB 3T8OA 3H9FA 4BCFA 5CQWA 4O91A 3C5IA 4E6DA 5E1SA 3C4EA 3B2WA 5DT3A 2R3HA 4CKIA 2UZTA 3R1NA 4MF1A 3ZOSA 3KRXA 2YITA 5AA9A 2C5VA 2ITUA 2IWIA 5CXHA 5J5TA 4NM3A 5IQBA 4YJRA 3QUEA 5E8TA 4DH1A 5D1JA 1PRYA 3AOXA 5ITAA 4IB5A 4YBJA 3LFQA 4KRDA 4WNPA 4ZTLA 4KS8A 3W33A 2G1TA 4DEBA 3UO6A 2WIPA 4F9CA 5CF6A 5J9LA 4GIIA 4K1BA 1J1BA 4YHTA 3D5VA 4F4PA 2YM6A 4ERKA 3QA0A 3R21A 1KE6A 1V0BA 3O51A 4XX9A 4YGAA 5ETFA 3V8SA 4ACHA 1U4DA 4X2KA 2UW0A 3QZHA 4W9XA 5EW3A 1OPKA 4YJVA 4JG8A 3TNPC 1O6KA 1S9IA 5KHXA 1SVGA 5L4QA 2R3IA 4I0SA 4RX9A 5HG9A 4OBQA 3P79A 4PNKA 5DVRA 5HTCA 3ZH8A 3DJ6A 3HX4A 2XRUA 2YIYA 3BI6A 2X6DA 4I6QA 4OTHA 3U87A 1YHSA 4QP3A 4QD6A 2HCKA 3S00A 3NNUA 2YJSA 3EZRA 1J3HA 2UZWE 4YNOA 3UG2A 1DI8A 4FKOA 4GSBA 4EH9A 4D1ZA 5J79A 5EYCA 3DTWA 4BVUA 4BIDA 2RF9A 3CP9A 3AT3A 3EN6A 3TZ9A 1M17A 2OXDA 3DDQA 3L1SA 1UKIA 3P08A 3HMMA 4GG5A 1OBGA 5DT4A 2BUJA 5CEKA 2YWPA 2BPMA 3PWDA 5L3AA 4FKRA 5H8BA 2OIBA 4A4OA 4BCHA 4MWIA 3NUSA 4DG0E 3ZO1A 5CNNA 1KE8A 4FL1A 4GW8A 1ZARA 4ZZMA 2F7EE 3VS1A 1YOJA 1Y91A 3GFWA 2WU7A 3HVCA 3UC3A 4CCBA 3KMUA 4WT6A 4GCJA 4LYNA 3MY0A 4K0YA 1U54B 2CN8A 2GNFA 2ITQA 3H9RA 3OEFX 4JR3A 3UGCA 2OK1A 2R64A 4KBAA 5HLPA 4CG8A 3PSBA 4HYIA 4QTAA 4AE6A 3L8PA 4QP8A 1FVTA 5CAVA 3OWLA 3KCKA 4QMZA 3W2RA 5BVNA 3Q3BA 5EI6A 4R3PA 4ZJIA 3OWKA 4EOJA 4U3ZA 4QMOA 2BRBA 4TT7A 1UWJA 3UP7A 4IW0A 4R77A 2HIWA 4IWPA 1AQ1A 3NRMA 2BDFA 4F9AA 5AAGA 3DNEA 2W1CA 4CT2A 3FXXA 5EQPA 3FJQE 3ZFXA 2YM8A 3A8WA 2O2UA 5K0KA 4AZWA 4QPSA 3W8QA 4IIRA 4XHKB 4AOJA 3Q6WA 4P4CA 2YDIA 2RSVA 2F2CB 4CTCA 5DR2A 2YCQA 3FXWA 1GZNA 4ANBA 5E8SA 5HO7A 5E7RA 2QR8A 4YBKA 5AP1A 4AT4A 4XBRA 3P7CA 4PTEA 1Q4LA 2CGXA 3QQUA 4G31A 4JL9A 4MCVA 4FV7A 3FQEA 3PA3A 2FYSA 4IACA 4F1OA 4YC6A 2C3JA 4TTHB 3BLRA 5AUYA 3QTZA 4S34A 3BKBA 4TXCA 4ZSGA 1TQPA 3KMMA 4IEBA 2V5QA 4IM3A 5DI1A 4D2RA 3KVXA 1I09A 3CLYA 1APME 3LMGA 4BIEA 2A27A 2XCHA 1SNUA 3RWPA 3BU5A 5L2QA 3WYXA 4EK8A 2BZJA 2F9GA 4NTTA 5EYDA 3POZA 3E62A 1UU8A 1CMKE 3NUNA 2ZB1A 3HECA 3FAAA 2XUUA 3KULB 1U5QA 3LFFA 3Q04A 2GS6A 3NMUF 2BRHA 3MTFA 4TYJA 1Y8YA 1PW2A 2HOGA 1H27A 4FZ7A 3VBYA 2OO8X 3VBVA 4RC2A 4APPA 2X39A 3MI9A 4E7WA 2CN5A 2GHLA 3E8NA 3ORIA 4F7LA 1H1SA 2B54A 3C0GA 2WMAA 4J95A 4BKJA 1E9HA 3LXPA 4GJ3A 5EYMA 3ZO2A 2ZM4A 3I6WA 3PJCA 1PXIA 4DGLC 4B9DA 4F6WA 4IAAA 3FDNA 4AFEA 4Q2AA 3PXRA 4GT3A 4TWOA 4CFMA 1URWA 3R28A 3LXNA 4H1JA 3D4QA 5T68A 5JGDA 5CY3A 3CGOA 2UV2A 3DAKA 2OXXA 4FIFA 5F94A 4TL0A 3CSVA 2KTYA 3R9OA 2G2IA 2WAJA 4GVAA 4FIIA 3SW4A 2G2HA 4BWPA 4FT9A 5CVGA 1KOBA 1PYEA 2OWBA 5A14A 3SG9A 4N6YA 4O0TA 2VO6A 4ITIA 1ZYJA 2R7IA 3PDTA 3U55A 3RAHA 4YO4A 4CZUA 5HESA 1VJYA 3LIJA 5EDRA 4MVFA 1JKLA 3VS3A 3W2OA 4DGNA 4E6AA 4RIXA 5LWMA 2E9PA 4XYFA 5JFWA 3VF8A 4FTJA 4JBVA 4LGDA 5CEPA 5EFQA 4EH3A 4MXCA 4ANLA 3UTOA 5KO1A 3P86A 3UZTA 4I5PA 5KBRA 3QGYA 2Q0BA 2QOHA 2BALA 3TNIA 4R5YA 3TTIA 4DYMA 3AMAA 3NYXA 3CKXA 2O5KA 3VHEA 3WYYA 2WO6A 3HV4A 3R8MA 1H08A 5IEVA 2C3IB 3H0YA 1QMZA 3QALE 4EZ5A 2QLUA 3WF7A 5DEYA 3ZSGA 3ZEWA 2XIRA 3OD6X 4R1YA 4ALVA 4FK6A 3U6JA 4QT1A 2R5TA 3B2TA 4IZAA 1PHKA 3ITZA 5JEBA 4UX9A 4KINA 2P2IA 2VGOA 4LL0A 1JPAA 1OUYA 2I40A 4KUJA 3TL8A 2UZOA 4LOQA 4M69A 1JSTA 2WQEA 1Y6AA 3CQUA 3E92A 4ZY6A 4M67A 2BKKA 3NR9A 3MESA 4FOCA 3M42A 2YABA 5E1EA 4CLJA 4IANA 2Y8OA 4WNMA 3MPAA 4A9SA 1P14A 4GH2A 4BWKA 2UZLA 5HEZA 3AC4A 2HZ0A 3PPKA 4JQ7A 2VWBA 5TF9A 3RZFA 2ZB0A 2XB7A 2CSNA 3BLHA 3WF8A 5EM5A 3N9XA 4DF3A 5E8UA 5FDXA 4J8MA 5E8VA 3P4KA 4AA0A 5HU9A 4YHFA 3QYWA 3NCGA 4FTKA 5IMXA 3CY3A 2VWWA 3NNWA 4XP0A 4EOPA 3GC9A 4O27B 4R7HA 1ZMUA 4LFIA 3ZRLA 2UZNA 3DXQA 3BPRA 4AGWA 2FSTX 4UZDA 5C27A 3R73A 3T9IA 5FDPA 2OICA 2IZSA 4PWNA 3LJ1A 1KV2A 4BC6A 3FHIA 5IH6A 1Y6BA 3S0OA 1UKHA 3EQIA 4RG0A 4L67A 4IQ6A 4WO5A 4I0RA 4OBPA 2IW6A 3QKKA 4C4FA 4C58A 4R7IA 2GU8A 3AC1A 3SXFA 2OU7A 3QCXA 2UW5A 1K3AA 5AP7A 4BCPA 4DG3E 3QTRA 2YIQA 3CR0A 5JRSA 4KKEA 3DK6A 3LFEA 4I24A 1FBNA 3BQCA 5TO8A 3EQHA 3TZ7A 3F5UA 3OUKA 1JOWB 4D2PA 1F5QA 2R4BA 3FLWA 3BU3A 3GQLA 4C35A 5KX8A 4FEUA 4FGRA 2LGCA 2QKRA 4X3JA 4X6RA 2WEIA 1ZYDA 2C0TA 4ITHA 2XEYA 2E9OA 2Z7LA 4LG4A 2WTIA 4ALUA 4F1MA 3GFEA 5HG7A 4FNYA 2CGUA 4HCTA 2UVZA 4FKIA 4GT5A 3E93A 5KZIA 1FOTA 3A62A 3LCSA 3TI1A 2JBPA 1WZYA 3ZRMA 3ZBXA 4BTFA 5CF5A 5IA0A 1I44A 3RPRA 4IX6A 2H9VA 4F7JA 1WBWA 3TCPA 3R7IA 4BDBA 4EHGA 3NZ0A 2WB8A 2VTSA 1R1WA 3OF0A 3I0OA 4FTTA 4FV0A 4PL3A 3EFLA 5T3QA 5AP2A 1IAHA 2IN6A 3IW5A 3PRIA 2Q83A 5KE0A 3LLTA 2O65A 2QOQA 2UW8A 5TE0A 5KNJA 4KS7A 5HLNA 4D0XA 4J98A 3CCNA 4FZAB 1BI7A 3ZONA 4NH1A 5FG8A 4G2FA 3QHRA 3SXSA 3QTWA 5ANOA 2XF0A 4BCMA 4FEWA 2VU3A 1YWRA 1CTPE 4C4GA 3O7LD 3TIZA 4AWIA 4GT4A 4DAWA 1JWHA 4K77A 1VYZA 2VTTA 4Y5QA 2JITA 4U9AA 4F7NA 3UVQA 3H0ZA 3FBVA 1H1QA 4FV3A 4IJ9A 1PXNA 5JT2A 3VS2A 4XLIA 5BVDA 3BQRA 4UWYA 2ZYBA 3MH1A 5J9ZA 2OZAA 3IONA 4PF4A 3P7AA 3ULIA 3I4BA 2UVXA 4YMJA 3LPBA 3PVGA 5B2KA 4A06A 3ENMA 3II5A 4EK5A 3JR1A 4WUAA 3ZBFA 4EH5A 4ZXTA 5AR5A 5HE2A 4AFJA 3GU5A 5A54A 5IEYA 5DWRA 5L6WL 3TKIA 1IR3A 4F70A 3UQGA 4BB4A 3W8LA 2VD5A 4S32A 2PVNA 5AUWA 4YU2A 2CNUA 4G3DA 5LJJA 2ERKA 4BF2A 4WOVA 4FV6A 5HICA 5BUJA 2CKPA 2HXLA 5H8EA 2IZUA 3B8QA 2QG7A 2RKUA 3I0QA 4IVCA 4L45A 2BCJA 5CF4A 3DAEA 5K0XA 4O1PA 2PMLX 3TV6A 4BDJA 5FD2A 3PLAE 3V6RA 4BL1A 5IQFA 3FI3A 4XP2A 4R5SA 4L53A 5IUGA 4O81A 3R9NA 2Q0NA 4GL9A 1OKVA 3VUDA 4MH7A 4W4XA 3U9CA 3WF6A 4EK3A 4D5HA 3R7VA 3TV7A 4BCNA 2OJGA 3CJGA 2PY3A 1YXSA 5J9YA 5CSWA 3AC8A 2J7TA 5FM2A 5HI2A 3NCZA 3H9OA 4DE4A 2CHLA 2XKEA 3NUXA 3RZBA 2P2HA 2OJFE 3ORLA 1NY3A 3LCOA 3KK9A 2JIVA 4FODA 4FC0A 2VTLA 1OL5A 4IWDA 2E2BA 4BCGA 1OI9A 5HNBA 4KD1A 4NKAA 4Q9SA 4F7SA 3SRVA 3W1FA 2O63A 4OTIA 3LAUA 4IM2A 1ZMWA 5D7AA 4O7RA 4O7WA 2REIA 3ATSA 5AR8A 3I5ZA 3SVVA 4ZLYA 1DM2A 1Y57A 2V62A 3TNWA 4ASEA 1HCKA 5CZIA 4QP6A 4TNDA 4MXZA 3EB0A 4BN1A 4MBIA 1ZOEA 3OVVA 4O2PA 5AV1A 3DAJA 4BZNA 2GPHA 1J7IA 3EQFA 3V01A 2H8HA 2CKQA 4MBLA 3VUKA 2ACXA 2QOOA 3FI4A 4JQ8A 3MJ2A 5D11A 2Z02A 2CMWA 5BPYA 3TUDA 4CEGA 4EZ7A 2YLEA 3Q4ZA 4AOIA 4YR8A 3MJ1A 4FE2A 4DEIA 3A61A 4B8LA 3GCUA 4FKUA 4JAIA 5HO6A 4NW5A 4QYEA 4LQMA 3DFCB 1XH4A 3PE2A 4QMLA 4ZS4A 4FSQA 4Y72A 3I6UA 2WKMA 4I5MA 4DCAA 4FMQA 3FZPA 4U97A 2DQ7X 1QCFA 1Z57A 3MDYA 4BRXA 2BROA 2XKDA 3DBFA 3A99A 4E73A 5AIRA 4UXLA 3HA8A 4L7SA 4EQMA 4KKGA 2QOKA 3FSFA 1G5SA 4CCUA 3IPHA 4F08A 3C4XA 4BI0A 1Q61A 4JRNA 4NU1A 1W83A 5FWKK 2IVVA 2GSFA 2UW7A 2W9ZB 2YFXA 3LOKA 4EK6A 4FVRA 5HE3A 3R7UA 3R1YA 4DTKA 4AN3A 2NRUA 1YXTA 3N51A 3FKNA 2EWAA 2OIQA 3NIEA 2OFVA 4E4XA 4ZLOA 4C4EA 4F65A 3NNVA 3LMIA 2ETRA 4HVSA 1J91A 1RE8A 3LM5A 3P7BA 3QYZA 4I22A 4O0WA 4MNFA 4EUUA 3KF4A 4EC9A 3OW3A 2P55A 3OBGA 3RPVA 5HE0A 3NAXA 4ITJA 1L8TA 3D0EA 1YRPA 5C9CA 1OL1A 3ZFMA 3PXYA 5DR6A 3F88A 3RGFA 2NPQA 3QXOA 2XM8A 4GUEA 4A4XA 4FR4A 1GAGA 2XIKA 3BE9A 2Z8CA 3DBDA 4PMMA 4YZNA 3EN4A 4YC3A 5LMKA 2EXEA 4X21A 5J7BA 2RIOA 3MH3A 2PVYA 1PMUA 2CDZA 3OCSA 3DK7A 2QKWB 3VBWA 2YM7A 4RC4A 4WNKA 3Q9ZA 3RK9A 3QUDA 2QONA 5KMMA 2EB3A 1OL6A 3AC3A 2FVDA 3QU0A 4PP9A 3TZ8A 3F3ZA 2W1DA 3FYKX 5EI2A 4DFLA 3R9RA 1OBDA 4TZRA 1WVYA 5ACBC 4O7SA 2WTWA 2YA9A 3ORPA 3IGGA 2FH9A 3R1QA 4OTGA 4G9CA 3RINA 5BMSA 1NVSA 1YOLA 4NUSA 2IO6A 5H8GA 5EK7A 4DITA 2BHEA 3O8TA 4MAOA 5AR4A 3QLGA 5TR6A 3RI1A 2XH5A 2O0UA 3L9LA 3IS5A 5ANGA 5J87A 3DA6A 5CYIA 4GK2A 4CVAA 3QLFA 4I41A 4EH8A 4C02A 1Q3WA 4MD8E 4YLLA 4IAYA 1WBVA 3V04A 3OUNB 5BMMA 4G1WA 2G01A 4RIXB 4XH6A 3M2WA 4K2RA 4E8AA 1XHAA 4WA9A 3AGLA 4NKSA 4EI4A 3RNIA 5M44A 4P7EA 4GUBA 5AWMA 3COMA 2BKZA 3FSKA 2G2FA 4NWMA 3T9TA 2XNNA 2X2MA 3ORTA 4TYIA 5K5XA 3ETAA 4JXFA 3QA8A 4U41A 2VNYA 5EQYA 2X81A 4PX6A 3BYMA 1GZOA 2GCDA 3FZSA 4FT5A 4HGEA 4RFMA 3OP5A 4M8TA 4OTWA 3R83A 4BCIA 4YTFA 5E8WA 1Q8TA 3PXQA 4AOTA 5CT7A 4EOIA 3SDJA 4XG6A 2EXCX 2F57A 5EH0A 2F49A 2B9FA 3OCGA 5TKDA 3FLNC 1B38A 4KKHA 4JQEA 4OW8A 3VBQA 4YZCA 2ONLA 4C0TA 2QU6A 4J52A 4RWKA 5IG1A 3K3JA 3QCQA 4R1VA 2PVKA 2XKFA 4NFNA 3BGQA 3KXNA 3RBWA 4FTMA 4F09A 4M69B 3U8WA 2I7QA 5CF8A 2YAKA 4ZTMA 4DT9A 3RAKA 5B0XA 1LPUA 1A9UA 3O96A 3DPKA 3OS3A 5ETAA 4U8ZA 5K4IA 3G5DA 4ZSLA 4WSYA 3QQJA 4C3FA 3SW7A 5IA5A 5K9IA 1T45A 4KRCA 2YAAA 5DYJA 3EQRA 5KMJA 3KFAA 4IC8A 3DOGA 1W98A 5H3QA 1HOWA 2C6OA 4FTOA 3TJCA 4ACMA 1PXMA 4AZEA 4DGGA 4Q9ZA 4X2NA 2BAKA 2OI4X 2B9JA 1GIIA 1ZZ2A 3LW0A 5EM8A 3JVSA 5HVKA 3TTJA 3DS6A 5D10A 3FPQA 3UZPA 3ZEPA 3ZZWA 4U3YA 4R78A 2B55A 3FQSA 1FINA 1FVRA 1YW2A 4ERWA 5I9YA 4BYJA 3W2CA 3NYVA 2WQBA 4ZTQA 5FXSA 5FEEA 3NX8A 3UG1A 1UU3A 1Q8YA 1R0EA 2KULA 4ANMA 4OTDA 4NW6A 4YTHA 2QR7A 4ALWA 4R3RA 2OJIA 3P78A 2OLCA 4DH7A 2IVSA 4XJ0A 5J1VA 2C6KA 1QPDA 3HYHA 3Q32A 3Q52A 4IVAA 3C13A 2HAKA 3EZVA 3V5QA 4ACDA 5CALA 2VTRA 3HRCA 4N57A 4FEXA 3BYVA 4JT3A 1R3CA 4J53A 3UQCA 3C5UA 3FLYA 4I4EA 4ZY5A 1B39A 5AJQA 1B6CB 2WOTA 4USFA 2PVLA 4W4WA 1PMNA 5AUUA 4O82A 4JG7A 1CM8A 3QZGA 4F63A 3FLZA 5AR3A 2WNTA 3LJ2A 4AW5A 3CTJA 2R0IA 4C4JA 4OTRA 3ET7A 4WKQA 3PWYA 2VWYA 3C9WA 3Q60A 5EHLA 2J9MA 4FX3A 3QQFA 5JSMA 3EN5A 3F5GA 1KUTA 4FV5A 1ERKA 3DU8A 1PMEA 4FV9A 3WIGA 3CTHA 2CGWA 4O0VA 2PK9A 3HDNA 4PMSA 4KA3A 2VTMA 4XP3A 3O71A 2JGZA 4PQNA 4PY1A 3VIDA 4B99A 4BICA 1VR2A 4RIWA 4AN2A 2QU5A 3CQWA 2FA2A 4XG3A 3QFVA 4AE9A 4P90A 4D5KA 2NRYA 4EEVA 4BCKA 5L2TA 4MNEB 3KXHA 3UQFA 3PLSA 4GJ2A 1CKPA 3DB8A 2HY81 1AGWA 4MXAA 4EOLA 2HZIA 5BYYA 3I5NA 3KXZA 3S2PA 1DAYA 4B6LA 3IW7A 3RHXA 5CAQA 4BBMA 1R0PA 4HGSA 4DEHA 1U46A 3BWJA 3ORKA 4L68A 4CYJA 3E8DA 3OXZA 5F1ZA 5CEOA 4H3BA 4KSPA 5J8IA 2B0QA 2X8EA 2QOLA 2V7AA 1H0VA 3DBQA 2GHMA 3PVUA 2H34A 1H8FA 3QZIA 1JKSA 1XH9A 2JIIA 2I0EA 4PDYA 4CT1A 2W17A 1YXVA 3DXNA 4HGTA 3KK8A 4WNOA 2OF2A 4N6ZA 5AP5A 4JVGA 3DV3A 4FKWA 2J0IA 2QHMA 3FMKA 4FV4A 4KBCA 4M15A 4WUNA 4DG2E 2OZAB 4TWPA 5HKMA 5HGIA 2JDOA 2VWZA 4ZLZA 5CEMA 2UW3A 2OXYA 1A06A 3PVWA 3TV4A 1S9JA 1WCCA 5BUEA 5JQ8A 3U54A 4JBPA 4PL4A 4XMOA 5DIAA 1NA7A 2WMRA 4FG7A 1Z9XA 4KIOA 3FUPA 5HVJA 3NW5A 5KMOA 3G9LX 3NGAA 3WARA 2WZJA 4MTAA 4D2SA 5CANA 1H00A 4ZIMA 3R22A 4TWNA 4DINA 3GQIA 5LWNA 4O38A 1ZYLA 4XG7A 4LV5A 4CG9A 3IGOA 4UZHA 2WTCA 4CSVA 2XEZA 2XRWA 4IH8A 3QBNA 4RFYA 5KCVA 2Z7SA 4AZTA 1WBOA 3CY2A 3GC0A 2BR1A 3KRWA 4QTDA 4C8BA 4YZBA 5M51A 3ZM9A 2ZAZA 4S33A 4B8MA 3V8TA 1UNHA 4GMYA 3BLQA 3FZ1A 5EHYA 3ZCLA 4UMUA 2VX0A 2CCIA 4UALA 2R3FA 2C5XA 1G8SA 1PXLA 4FTRA 3OWJA 5EW8A 4NTSA 3LM0A 5CU6A 5FM3A 3BYOA 2R3MA 3Q2MA 3PP0A 3MV5A 2UZEA 3QTQA 4L6QA 4X7QA 3M1SA 5JGAA 4ASXA 3RWQA 3SQQA 2ITWA 2OFUA 1H28A 2BAQA 4KB8A 4IADA 3ZLYA 5KKRC 3S4QA 5C26A 4M0YA 5CENA 2R3KA 4G3EA 3MYGA 4FTAA 2WTKC 3DBCA 1ZLTA 5ANIA 1YHWA 3JYAA 3Q5ZA 4MBJA 1YI4A 2W1FA 4NCTC 3FMEA 5FXQA 2VRXA 5FUTA 1WBNA 3F2NA 3VQHA 3LJ0A 4U6RA 4CZTA 3Q4UA 4FSYA 3SRVB 1JKKA 3PVBA 2WMXA 4AW0A 5JFSA 5L8KA 5CAUA 3IOKA 3TUCA 3D7TA 1HCLA 2JIUA 3WIKA 1PJKA 3QTUA 4AW2A 5FTGA 2Z2WA 4ZTSA 3OTUA 3V8WA 3FPMA 2VWUA 3R7GA 4IM0A 3QWKA 2C6IA 3C7QA 4RJ6A 4EJ7A 4FZ6A 3BV3A 4BDKA 4EK4A 5ETIA 5J1WA 2X2KA 3E87A 4FG8A 3G0FA 5M56A 3GC7A 3QKLA 3TIYA 3U9NA 1H1RA 3PYYA 2JDRA 3GT8A 5EOLA 3UJGA 3VW6A 5BVFA 5C8NA 1ZRZA 1Q8WA 4HJOA 4HVIA 4HNIA 3BELA 4NM0A 1UVRA 4Y8DA 2BMCA 4J8NA 5GJDA 3PFQA 3NUUA 4GK4A 4CNHA 5KMNA 1PXPA 3LXKA 3OEZA 4QNYA 1MRYA 2PTKA 4A4LA 4BY9E 4XV2A 3FKLA 4IDTA 3ELJA 3PSCA 4O7VA 1ZOGA 3R02A 1YWNA 5HD7A 3MN3A 5IISA 2Y4IC 1FQ1B 5K5NA 2GQRA 4O0YA 4EYJA 4F0IA 2BDWA 3FQHA 3QQGA 2RFNA 3F69A 4IZ5A 5CNOA 5DGZA 2WU6A 1STCE 3HEGA 3ZSIA 3D14A 1DAWA 4E5BA 4ZY4A 2R0UA 2OW3A 2V7OA 4C4HA 4AUAA 3AD4A 3TEIA 1G8AA 3C4WA 2PHKA 1Q41A 3VAPA 4IAZA 2GS7A 4GIHA 3QX2A 4FIEA 3SOCA 1XH8A 3BHUA 5K3YA 4CFNA 4QMVA 5BVOA 3FHRA 3I81A 4ARKA 3E64A 3FMHA 4H3PA 5FBOA 5BQ0A 4C61A 3SA0A 2EVAA 4LI5A 1M7QA 2CCHA 4APCA 2HW7A 4CMUA 3PZHA 2VWVA 4FSZA 2A0CX 4AACA 1JNKA 5M09A 1BLXA 5GINE 4FKSA 4M66A 1DS5A 1PXKA 3A7IA 1NVQA 3VWAA 1CKIA 1WBSA 3UZRA 3H3CA 1OGUA 3IW8A 4YJPA 1BKXA 4KSQA 5TOZA 5ICPA 4BZDA
chains in the Genus database with same CATH superfamily
1H4LA 3QKMA 2X0GA 3CJFA 1MRVA 3ZLXA 4EH6A 3EH9A 1XBBA 3CC6A 5FP5A 3CXWA 2PSQA 4D1SA 1PYXA 2WMVA 5L8LA 3FYJX 3FMMA 3O0GA 4EUTA 4CQGA 4L3JA 3NUPA 4OLIA 4FG9A 4YZ9A 4MXXA 5DG5A 5TT7A 5HZNA 2OH0E 4BBEA 3O50A 4QQ5A 2J50A 3UC4A 3QD4A 4XNEA 2DS1A 1XH5A 2R3OA 5HIDA 1ZOHA 4N0SA 4QP9A 4HVDA 1H1WA 3Q5IA 3CPBA 3L8VA 1OKZA 3FE3A 4XV3A 5JH6A 3L8SA 2NNWB 4YJNA 2QG5A 1V1KA 4O0RA 3FMNA 3BGPA 4Y46A 2QQ7A 4CRLA 4CFFA 5M07A 4IVBA 3K3IA 4RJ5A 4M97A 4RMZA 2XBAA 4RIYA 2QOCA 1XJDA 4WD5A 4DEEA 4PRJA 5AP6A 3Q2JA 1CSNA 2XBJA 3UO5A 4W8DA 2C0IA 1Q8ZA 4MD7E 3QRTA 4EBWA 4I21A 4ORKA 3RVGA 4KIKA 2RG5A 2WQOA 3QD2B 5AP4A 2C47A 1P4FA 4BCQA 2HXQA 2A2AA 3VC4A 3VW8A 1BL6A 3R7OA 3PIZA 3O8UA 4C37A 3UMXA 5J5SA 1XR1A 4PL5A 3Q96A 2C6LA 2XNPA 4M14A 4RIOA 3V6SA 4E93A 5A4TA 4MD9E 4R7BA 4QYYA 1UU9A 4EKKA 1TQIA 4C7TA 3IECA 3V3VA 4FI1A 3QTIA 4GU9A 2WTVA 4QQTA 4G16A 4G9RA 2IZTA 3C4ZA 3ACJA 3FI8A 3LHJA 1P4OA 4AXFA 1YWVA 2CNQA 3F2RA 4YZDA 2W06A 4HZSA 5IQGA 3F3UA 4O84A 4IVDA 3ANRA 4UXQA 4RLLA 2WQMA 3H30A 4RBLA 3SC1A 4I0TA 1OIQA 1XBCA 3MY5A 4PDPA 3O8PA 3OZ6A 4Y5HA 4C38A 4XOZA 2P4IA 2C3KA 3ZUVA 4ZMEA 3P5KA 4QMQA 4XBUA 2IW9A 5DFPA 1PMVA 3S1HA 4IMYA 4RGJA 2A19B 2QURA 4O2ZA 2XALA 1GY3A 4LRKA 3VQUA 1LEWA 2OJ9A 4MNEA 1P2AA 4R8QA 2B9HA 2Y6OA 5CQUA 3SXRA 1NVRA 5E8XA 4Q5EA 5IQDA 2XK9A 2O8YA 4MWHA 4K11A 4OBOA 4QTBA 5HIBA 4U79A 4AGDA 2IW8A 2JDVA 4FNZA 3JUHA 4K8AA 3BX5A 4WG5A 3OMVA 3GVUA 4FTLA 2JAMA 3RNYA 4RPVA 4WG3A 3UMWA 3VBXA 4E6QA 3E3PA 5LCKA 5CU3A 2W7XA 3DQXA 1OMWA 1W82A 4LMNA 3R8PA 3TNHA 3R30A 2OJJA 4DEDA 3BZ3A 4I94A 4NK9A 5F9EA 2ZM3A 3ZU7A 3F5XA 3G2FA 4I6HA 3MTLA 4CFVA 4XG4A 2R3JA 3OTVA 4XCUA 4AW1A 2YHVA 3F7WA 1WBPA 2W4OA 4IXPA 4DFZE 5A9UA 4BCOA 4HYUA 2IPXA 3Q53A 2WELA 4TKSA 3VJOA 2BRMA 4MXYA 3TT0A 2XYNA 4HVGA 3C50A 3D83A 3NPCA 4E20A 1VLRA 3R2YA 2OZOA 4EJNA 2XNMA 5EDQA 3DQWA 3F9NA 3MIYA 4FF8A 5AIKA 2GNJA 4FL2A 2FB8A 3BRBA 5DR9A 5GIOE 5LVOA 5M06A 4DA5A 2XNEA 2YIXA 2PZIA 2UUEA 5KBQA 4FSTA 3DKCA 1K2PA 2X6EA 2X0PA 5IEXA 1H01A 2IF8A 3WZJA 4ANNA 3HRFA 1OPJA 4YJUA 4BKYA 3PA5A 4XOYA 1P5EA 3OHTA 4YHJA 2X9EA 3ROCA 1REJA 1OM1A 2HW6A 4W4YA 4DT8A 5IH4A 5AM6A 5EOBA 4YUQA 1JKTA 2C30A 2PMIA 4LV8A 4HCUA 5CZHA 4S31A 4GRBA 4PUZA 1Q99A 3R71A 4X2GA 4HYSA 5BYZA 3VONA 1X8BA 2XP2A 3VS6A 4IX4A 5E4HA 2PL0A 1UNGA 3MB6A 4OTFA 5HIEA 3L9PA 4IBMA 3UPZA 4XV9A 3UP2A 4IE9A 2BFXA 5I0BA 3V5PA 3HAMA 4RIWB 4YPDA 3RM6A 4HNFA 3ZDIA 4DHFA 4JOAA 4H39A 4WIHA 4AT5A 3ORNA 5CVHA 2JAVA 2XS0A 4FVQA 4J1RA 1F3MC 3H4JA 3PXFA 2BZHB 4PV0A 2YZAA 4G17A 5A4QA 4GEOA 3I60A 3QC9A 5IA2A 4IZ7A 3JXWA 5BVKA 3WI6A 5HCYA 4G3CA 3HDMA 4OT5A 4QMXA 5A6NA 3L9MA 3RAWA 1ZZLA 3ORZA 4D9TA 5EI8A 4FIJA 1NW1A 4IB0A 2FSLX 1BX6A 3OT3A 1YDTE 2ZDTA 3IG7A 5EM7A 3QQKA 3QRKA 3HAVA 4GK3A 1SYKA 1LUFA 3IKAA 4A9UA 4DEGA 4O83A 4O7LA 5AV4A 2YIRA 2JC6A 4QRCA 4EC8A 3R6XA 3EKNA 4I5CA 3U6IA 4ZOGA 2W96B 3A7JA 4QTEA 5AFVA 3W0MA 3D2KA 2W4JA 2JKOA 3C0HA 2CJMA 4EWQA 3D94A 3QTSA 4CXAA 3ZFYA 3EKKA 1W84A 2HWPA 2YCRA 3P23A 2J5FA 5A46A 3LFNA 5AV2A 3OXTA 2W1EA 3ZYAA 4X3FC 3BCEA 3C0IA 3W32A 5AUTA 2V22A 3AG9A 2ITNA 3OXIA 3GP0A 1JSUA 4BDFA 4C62A 2YEXA 2Y6MA 3NNXA 5L6OA 4O0XA 4EH4A 3OG7A 4NZWB 2XA4A 1FGIA 4O6EA 4RSSA 1LR4A 2UW4A 2YJRA 3PJ3A 5DN3A 1H07A 3FC1X 4TW9A 5FEQA 5AUZA 4D1XA 4YJSA 2C0OA 5DT0A 2VTNA 5CVFA 1ST0A 3O7LB 2JBOA 3UVPA 4G6NA 3TKHA 5JKGA 3Q9WA 2GNGA 4F9WA 2YIWA 5FP6A 4AF3A 1G3NA 2OIDA 3AKJA 4Z7HA 5F4NA 1NXKA 1QPJA 3O23A 3RKBA 2JD5A 4BDHA 3MFSA 3WZUA 2OGVA 2WEVA 4X6QC 5CAOA 3QRUA 3EQPA 4AZVA 2Y9QA 4XLVA 3ZO4A 2AUHA 4AZFA 2PVHA 3BHTA 2YDJA 4DFBA 2W1IA 4GU6A 2PYWA 1WVXA 1OB3A 2BRNA 3PXKA 5HCZA 3W2PA 4AQCA 5BUIA 3CKWA 4WBOA 4YLJA 2QLQA 5HNGA 2YN8A 3KCFA 3F7ZA 4LGGA 2RL5A 2BZIB 4ZP5A 5AX9A 4DFNA 3DKGA 4I4FA 2UVYA 4JDIA 4UMQA 1WMKA 4XG9A 3UO4A 5IPJA 2W5AA 4PP7A 3HUCA 4GKHA 4U81A 4M12A 4NM7A 3BHVA 2P3GX 2FO0A 4MX9A 4BTMA 2ZM1A 2GQGA 3BU6A 4KIQA 4LOPA 5M4UA 4L8MA 4OAUC 3FEGA 3V51A 3MS9A 3LFCA 3WE8A 2VUWA 3KVWA 2XK8A 2JDSA 5AV3A 2I0YA 3GCVA 2CPKE 3FV8A 3KQ7A 4F99A 5AP0A 5BX0A 3D7TB 4IWOA 5ACKA 4PTCA 3JPVA 3OCTA 5C1QB 3TG1A 4KIPA 4WBBB 4PNIA 3TJDA 2DWBA 3ID6C 4PPAA 3DBEA 4U80A 3HA6A 4CMTA 3CD8A 2VTOA 3MVHA 3ORXA 3G15A 2X7FA 1JVPP 5IUIA 5HBHA 4YURA 2F4JA 4BHNA 3MB7A 2EB2A 3BHYA 3OC1A 4MQ1A 5LMBA 3NYOA 4L9IA 3PPZA 3GXLA 2V0DA 3SGCA 3MSSA 1YXXA 5JN2A 5GZAA 2EUFB 4KABA 3KF7A 3PIYA 4IC7A 1GIHA 4LL5A 4QMWA 3KXMA 3D5WA 3LFSA 3Q4CA 4QTCA 5JZNA 4F1TA 2C5NA 4D2VA 3KRRA 4EORA 4OGRA 5HG8A 4BKZA 3FI2A 3GEQA 2I6LA 3A2CA 3DJ5A 3NSZA 5I9WA 4L3LA 4RJ8A 4O7YA 3BHHA 4AG8A 4DFUA 4QMNA 3RK7A 2WMQA 1BUHA 1OITA 2XAOA 3VUHA 2WPAA 4AXAA 4QEBA 1ZYCA 4IFGA 3LQ5A 3FZOA 1JQHA 4FV2A 1RJBA 2F2UA 4G6OA 3UOHA 2BZKB 3KL8A 5HX6A 3ULZA 3SG8A 3ZXTA 3A8XA 4DLJA 2JLDA 4GG7A 1L3RE 3FMDA 5FLFA 5AAEA 4FTNA 5DEWA 5AX3A 2IVTA 2CLQA 4H1MA 3BL9A 4EOMA 1KWPA 3BEGA 3MVLA 2ITYA 4ZS0A 4IAFA 3WF5A 3VS0A 2P0CA 5C03A 2HZNA 2VNWA 3W10A 3PUFC 5AUVA 4BTJA 3EMGA 4DHJA 4HOKA 3F66A 1PF8A 1R39A 3NW7A 2XK6A 3QGWA 5I9UA 1KOAA 2FSMX 4EWHA 4BJJB 3R7EA 3QCSA 4Z55A 4NCTA 4NIFA 4FV8A 4DBNA 3SX9A 5BVWA 3E3BX 3PZEA 2ZV8A 3WBLA 3B8RA 2ITZA 2QCSA 4I23A 5CAPA 3K2LA 1LP4A 3QL8A 4E4MA 2YACA 5EG3A 4USDA 4C4IA 4QP7A 1U59A 5FEDA 4E3CA 1ZWSA 4AGUA 4ZTHA 1G8JA 3OT8A 4ONAA 3HNGA 4YTIA 4JBQA 5BVEA 4EKLA 2WIHA 1Q97A 4FZFB 3ZS5A 1RDQE 2WOUA 1WBTA 2QODA 4DCEA 1XBAA 2C1AA 4FKPA 3AMBA 3GCSA 4J96A 5D12A 4YJOA 3L9NA 4PMPA 4RIYB 2IZRA 3NIZA 3OOMA 4BYIA 1RW8A 4FIHA 3E7OA 3DB6A 4MF0A 5HG5A 3OW4A 2H6DA 4QDVA 5AAFA 2BRGA 4RWIA 1JBPE 2WQNA 3C4CA 3PIXA 3QXPA 5FTOA 1URCA 1TFFA 3RPSA 1PXOA 3G6GA 4X2FA 3DZOA 2V55A 2ITXA 3RCDA 4KIKB 2XCKA 4YC8A 4EHZA 2QC6A 3RPOA 3U4WA 3BYUA 3THBA 1CKJA 2YM3A 4M84A 2B9IA 4S30A 4EL9A 4BR3A 2Z60A 4GYGA 2B1PA 3LKMA 4MHAA 4B7TA 5KZ0A 4EQCA 2PUIA 4FSNA 3GBZA 3KC3A 4UMTA 2PUUA 3R9DA 3JS2A 3HMOA 1SZMA 4RVKA 3Q9XA 5IDNA 2CGVA 4AAYA 3VULA 2QD9A 3RAIA 3RPYA 3MPTA 3ZLWA 4YZMA 5KMLA 3UYSA 5K4JA 4H3QA 5B7VA 4V01A 1ND4A 4QYFA 2PUNA 4C57A 2VTAA 4HPTE 4ZZOA 3NUAA 1RQQA 4U45A 1YKRA 3R63A 4ZJVA 5L2IA 3W0SA 4G3FA 3ODZX 4TYEA 3R8VA 5HOAA 5LVPA 3PY3A 4FKQA 2EXMA 4GV1A 4U7ZA 1FVVA 2OF4A 4QMMA 4ZAUA 4I6LA 3BIZA 1W0XC 4II5A 3W2QA 1FMOE 2HELA 4TN6A 3MPMA 4J71A 5CU4A 4F6UA 4FYOA 3KXGA 4RVMA 3UDZA 3NVKI 4DN5A 5IQEA 1YVJA 1KV1A 2ESMA 3JVRA 3GOPA 4DLIA 4O0UA 3AC5A 5HU3A 3P0MA 4QP2A 2VWIA 5A4CA 3PA4A 4FKJA 4PPBA 4ASZA 2XZSA 4HVHA 4FSMA 5I9ZA 1DI9A 4Y85A 3GB2A 2E9UA 2XIZA 5CI6A 3VNTA 1IAJA 5JZJA 4AXEA 2E9VA 3PJ1A 5CLPA 2PE0A 3Q6UA 3LCTA 4V0GA 3LCKA 1UA2A 2GNLA 5C8KA 2WMUA 2GNHA 3FLQA 3LFBA 4JR7A 4O1OA 5CEIA 3PE1A 2A4LA 4J7BA 4FJVA 2PZYA 3F3WA 4LOOA 3GU7A 5FTQA 4E4NA 5IA1A 5C4LA 3KN5A 4FA2A 4XUFA 5HBEA 4FSRA 4FL3A 5IMEA 1H1PA 2WFYA 1OIYA 4JBOA 4W4VA 4LRJA 4EZ3A 5LMKC 4NFMA 2YISA 2ZMCA 3NEWA 4W8EA 4TWCA 2UZDA 4RX8A 1E1XA 4IJPA 4XG2A 4XRLA 4EQUA 5GZ8A 2J2IB 3OY3A 4O96A 4QYGA 2HWOA 2VTHA 5AM7A 3ERKA 5FQDC 5C01A 3TN8A 2HK5A 4DH5A 4DH3A 3ZM4A 2ZVAA 4YSJA 3LVPA 4RFZA 5E8ZA 5IKWA 3UVRA 3MW1A 4B0GA 3VUGA 3OBJA 5HQ0A 3QCYA 4O4DA 3GUBA 2RGPA 4AX8A 1MRUA 3CD3A 4D4RA 2I1MA 1PY5A 5HO8A 2Z7QA 4HZRA 1SMHA 2GTNA 2AC3A 3DGKA 4QMYA 4FSWA 3WZDA 4BDGA 4UN0C 4HW7A 3D7ZA 2ITPA 4FTQA 4RC3A 5GNKA 3UIUA 4C2VA 4EONA 2XANA 2R3NA 2UW9A 4P5ZA 1OKYA 4P5QA 2GDOA 2I0VA 2Y0AA 2XJ0A 4ACCA 4C59A 4F9BA 1ZXEA 3BEAA 1BI8A 3MIAA 1PKDA 4F64A 3SLSA 5CTPA 1AD5A 2BHHA 3PJ8A 5L6PA 1ZY5A 4M0ZA 2NYAA 3CBLA 5BNJA 3HV6A 1BYGA 3NWWA 4LUDA 3FXZA 1BMKA 4Q5HA 2OKRA 5DNRA 1JSVA 2QNJA 3TDVA 3W18A 2ITVA 4JS8A 3ANQA 2E9NA 5AV0A 1KE7A 3G0EA 4FICA 3U6HA 4CLIA 2UZUE 4G6LA 4JG6A 4RLKA 5A4LA 3FL5A 2PU8A 2PULA 3CPCA 3PFYA 3WOWA 1IG1A 5ANDA 3ALNA 3OFMA 4NSTA 5M4IA 2VWXA 2VTJA 4FT7A 3HRBA 3QX4A 1T46A 2PWLA 3D2IA 4CTBA 1Q24A 5J7HA 4GFGA 2R3PA 3K5UA 3O17A 4NJDA 4DGMA 4U42A 2ONLC 4FKLA 2WTDA 2RFDA 2JDTA 4WG4A 5G6VA 3UODA 4ENXA 5HTIA 4JIKA 2Z7RA 3IOPA 3SHEA 3NAYA 4CFWA 4IAIA 3HV3A 3TUBA 4FEVA 4G3GA 1UNLA 2XYUA 3FY2A 3JY9A 3PTGA 3OCBA 3IDPA 2X1NA 4EH7A 3AXWA 4O0SA 4AAAA 4DEAA 4C3PA 2X8IA 2QOIA 5AMNA 3IW4A 4J97A 3IDCA 1SM2A 4JI9A 4E1ZA 2DUVA 4TRLA 5DH3A 2XIXA 2XNBA 3TNQB 2PVMA 3LQ3A 2JEDA 5HORA 3UOJA 4BDAA 4IX3A 2QO7A 4C33A 4ZEGA 2FGIA 4GVJA 3VUIA 5IH5A 3ZUUA 5B2MA 3NW6A 5A3XA 4WRSA 3W0RA 3KRLA 2C4GA 4WHZA 3A7HA 3W2SA 1ZMVA 2C1BA 4CRSA 2H96A 4RX5A 2HYYA 5CASA 4QOXA 3A4OX 4QMPA 2GFSA 1W2DA 4IZYA 4AN9A 3EL8A 4D2WA 4U0IA 2W1HA 3PP1A 4RX7A 5FXRA 4DTBA 5A4EA 4UYNA 1ATPE 3VUMA 4DFXE 4ZTRA 3TACA 5M53A 1UU7A 1W2CA 2X8DA 1OGYA 1OL7A 3COHA 3C1XA 4TYHA 1XQZA 3F3TA 1XKKA 4HYHA 4RQVA 5LVNA 5GZ9A 1YDRE 4JAJA 2Y7JA 3UE4A 4Y73A 3OY1A 3VJNA 4EHVA 1JAMA 2ZV7A 4KAOA 3I79A 4O6LA 1CDKA 3SD0A 2C6MA 4A9TA 3CS9A 3H10A 4YPSA 1OECA 3R2BA 4IX5A 2WD1A 2C5OA 5G1XA 5FGKA 3RM7A 5HD4A 1ST4A 3D15A 3ZZEA 2FUMA 3I1AA 4CFXA 3GU4A 3TDWA 4OT6A 4IB1A 3GCPA 5EQEA 2VX3A 1OKWA 1VZOA 3A60A 4L01A 5KUPA 3UBDA 5DBXA 4PTGA 2VTPA 3A7GA 4MXOA 3BBWA 3EQDA 2J0MB 4UBAA 4PDSA 1VYWA 1XWSA 3KU2A 3LLAA 4BJJA 3GOKA 3SOAA 3ZHPC 4R6VA 2PMNX 3KRJA 4D4VA 5IUHA 1YDSE 1SVHA 2VTQA 3ZUTA 2J90A 4FRFA 3QRIA 4CMOA 3S95A 5GHVA 3ZXZA 3REPA 1XO2B 4MYGA 4U43A 4QP1A 4B4LA 4U44A 2VGPA 2VN9A 4XEYA 1GNGA 3ACKA 4FOBA 4Y95A 4M13A 3U4UA 2GNIA 3HMIA 3HL7A 2UZBA 4FNXA 4HCVA 3BE2A 4FUYA 2QI8A 3EN7A 2J0JA 5AEPA 2YERA 4JX7A 2ITTA 1PKGA 1NT2A 3HV5A 3ZC5A 3KMWA 5DPVA 2XVDA 3V5WA 2W1ZA 2JFLA 4QPMA 4EOKA 2QHNA 4MUQA 1YI3A 2XK7A 2ZV9A 4V05A 4KNBA 3VVHA 3UYTA 4K18A 4CKRA 4G5PA 1PXJA 3TXOA 4X3FA 2GS2A 4OUCA 5C8MA 3PG3A 4EYMA 4ZZNA 4OAVB 3ML1A 5AADA 4AGCA 2W05A 2VZ6A 3VRYA 4GKIA 3E88A 4RA5A 5HCXA 3ZTXA 3G51A 3U51A 3ZC6A 3W55A 4E5AX 3QAME 1YOMA 3WILA 1Q3DA 2YDKA 1IASA 3EJ1A 4K6ZA 1YXUA 2X9FA 3RJCA 5JQ5A 3EQCA 4D2TA 4IAKA 4AS0A 3AD5A 1GZKA 3ZSHA 5GJFA 3IW6A 4BBFA 4BHZA 4I5HA 3K5VA 4S2ZA 2ZOQA 3BBTB 3CEKA 5AR7A 4NM5A 4HPUE 2JKMA 4H58A 3HKOA 2BVAA 4YNEA 4CKJA 1IA8A 5ANJA 5JFVA 4BGGA 3NVMB 3E63A 1TZDA 3FC2A 5L2SA 3UDBA 5KMKA 4DH8A 3HV7A 1WAKA 4IWQA 3ZDUA 2R7BA 2ITOA 5CSXA 4BZOA 3T3VA 4FGBA 1QL6A 3LE6A 3V5JA 4A07A 3DKFA 4E5WA 1U5RA 5E91A 3GI3A 3FMLA 5LOHA 4AQKA 4DBXA 4RJ7A 2EU9A 5ANKA 2R3RA 2WMTA 2C68A 1GOLA 5IA3A 3EOCA 5KKRB 4FKVA 3R8UA 2IG7A 4QMTA 2WMWA 1QPEA 3QZFA 5EM6A 5LARA 3VBTA 1XH6A 2WTKB 2B53A 4FSUA 3DT1A 3BV2A 3F3VA 5F20A 4NIFB 2GTMA 3FY0A 2XK4A 5DE2A 5J95A 5T6KA 4ANOA 5CU2A 5FRIA 3KREA 4RJ4A 3F82A 2R3GA 5H2UA 1V0OA 4OR5A 4CD0A 3RMFA 4YO6A 4QP4A 1WVWA 5JRQA 2CNVA 1QPCA 2PMOX 1YHVA 2CKEA 1R78A 2RG6A 1MP8A 5JMSA 3LFDA 2QOFA 1KE5A 2W4KA 2GMXA 4DTAA 2C69A 4L7FA 4MKCA 3MFUA 1IEPA 4RWJA 2YCSA 4TYGA 4ZK5A 1OVEA 4EHEA 5HNIX 2VAGA 2O64A 2C6EA 2J0KA 2X0OA 3EN9A 3ENHA 4EH2A 4I1ZA 3PXZA 3HMPA 2F7ZE 3PJ2A 4MQ2A 3N4TA 3EQBA 3PUPA 4FUXA 5EKOA 5DA3A 5F95A 1BL7A 2PZPA 4QO9A 3OWPA 4IB3A 5L8JA 3IO7A 3MBLA 3MFTA 3P1AA 3SKCA 4BGHA 1ZY4A 4FKGA 1O6LA 4CZYB 1GJOA 3BL7A 3KY2A 2IVUA 1E1VA 5BYLA 2G15A 4K9YA 5EHOA 4LMUA 2WXVA 3LFAA 5AR2A 3EFWA 4K33A 2QVSE 3UIXA 4HGLA 4OTPA 4RJ3A 4D4YA 5E92A 3AGMA 3ZLSA 2AC5A 2Y4IB 4QYHA 5IQHA 4YJTA 2JKKA 5I3RA 4AXCA 2I0HA 1U54A 3BYSA 3LQ8A 1SVEA 1OIRA 2YM4A 3W16A 4W9WA 3IQ7A 4IDVA 4UEUA 4F9YA 2CLXA 2BFYA 1Z5MA 2VO7A 4BTKA 4F6SA 2GQSA 5E9EA 4ZJJA 4UWCA 5CSPA 1LEZA 4BDEA 5IQIA 3D9VA 4D0WA 4FTCA 4NT4A 2VV9A 4PPCA 2PZRA 1UV5A 2JFMA 4L3PA 5JGBA 4OTQA 4E4LA 4I92A 1J1CA 2JKQA 2WHBA 3AT2A 4FNWA 4FTUA 4QMSA 5DLSA 4CFUA 1O9UA 3FMJA 3I7CA 3KKVA 3UNKA 2YLFA 4FIGA 4F0GA 4RRVA 4FZDB 4JRVA 2NO3A 3TWJA 5GJGA 1Q62A 4NEUA 1W8CA 3E8EA 1F0QA 2VO0A 2XM9A 4ANQA 4NYEA 4ASDA 3DLSA 4D4SA 2W99B 4RVTA 3QQHA 3FLSA 3RCJA 4CQEA 4C36A 2PVFA 3HLLA 1UWHA 4P2KA 1YI6A 2B4SB 3EL7A 3QD0A 1TVOA 2PE2A 3PG1A 4RQKA 3DY7A 4O7ZA 3QWJA 4NJ3A 4BFMA 4FV1A 3MY1A 4A9RA 2W0JA 4UMRA 2QOBA 3IDBA 5A6OA 5LXMA 4XV1A 3QHWA 3QTXA 5I5ZA 2ZDUA 4TNBA 4QPAA 3I7BA 4O7NA 3ZMMA 3TM0A 2AYPA 2QO2A 4ZSJA 5C4KA 4UMPA 3DCVA 4D58A 4I6BA 3HP2A 3ATTA 1M52A 2Y4PA 5DMZA 3JY0A 5I3OA 1M14A 3EWHA 4V0GB 3C4FA 1IA9A 4FYNA 4A9YA 3VS7A 1M2QA 2IJMA 3R0TA 1Q8UA 5CX9A 2W9FB 4LM5A 5CWZA 3MFRA 5CU0A 4L42A 4BCJA 2GHGA 3E5AA 1FMKA 2ETMA 2G9XA 3HP5A 3KB7A 4M68A 4RZVA 4TY1A 2ZFYA 3OOGA 4AA5A 4ZSAA 3DKOA 3KULA 1Q5KA 3F5PA 5HHWA 3CIKA 4BWXA 3FKOA 4BDCA 5LQFA 2OBJA 3NLBA 3LCDA 3G9NA 4MK0A 5GIPE 3SAYA 2BIKB 3M11A 2WMSA 3MGYA 3DTCA 3QRJA 3PSDA 4LUEA 4QMUA 3WF9A 4Z16A 5I9VA 5LCJA 4BIBA 2WTJA 4JMQA 4L52A 4L43A 1SNXA 3OROA 3UPXA 4D9UA 4QQCA 4X2JA 2B52A 3DZQA 5HX8A 4V04A 2YCFA 3UNJA 4FEQA 4FK3A 4LDTA 2DYLA 4JJRA 1M7NA 2O3PA 4LRMA 5HBJA 2NP8A 1KSWA 2XNOA 3D5UA 3EYGA 3FZRA 2P33A 2X7GA 2C5YA 3Q4TA 4X0MA 5D41A 2J0LA 4I6FA 3SV0A 4R3CA 3VUTA 2FSOX 5M4CA 5CS6A 2BIYA 2XJ2A 4ZMFA 1IRKA 2C3LA 3MH2A 4H05A 5IQCA 5KHWA 4UB7A 1XH7A 3AT4A 5EYKA 1ZYSA 3VS4A 3VS5A 4BI1A 3DK3A 4IHPA 4YSMA 5L2WA 3P9JA 4RWLA 2WGJA 2J4ZA 3DDPA 3EHAA 3Q9YA 2W1GA 1WFCA 3WZKA 5IU2A 4MEDA 4Z9LA 4L00A 4KWPA 2A1AB 2YWVA 5I9XA 2PE1A 1OUKA 5DOSA 5HLWA 3CE3A 3KA0A 3QUPA 2W5BA 3O2MA 2W5HA 3BGZA 4PDOA 3R9HA 4UV0A 5EDPA 3FWQA 4FBXA 4O4BB 3MA6A 1TQMA 5CSHA 3DNDA 3QC4A 3UIMA 4BDDA 3RHKA 3GENA 1H26A 3PPJA 3R01A 1MQBA 4FT0A 2BDJA 3MVMA 4AP7A 3L8XA 4ZTNA 1Y8GA 3V5TA 3A4PA 4JNWA 5CXZA 5HTBA 3EYHA 4WRGA 3A7FA 3ALOA 3LZBA 3KEXA 3MH0A 2LAVA 3RK5A 2WMBA 4CV8A 3TZMA 4C2WA 3MWUA 3ODYX 3R1SA 5DRBA 4FVPA 3AC2A 3AMYA 4U5JA 3WZEA 3G90X 5AA8A 3TKUA 3RALA 4AT3A 3GCQA 1MUOA 2PVRA 4WSQA 4F0FA 2F7XE 3VHKA 2ZJWA 4GFOA 3R7YA 2OG8A 1VEBA 4H36A 3LMHA 3W0QA 4JLCA 2XIYA 3LXLA 4RZWA 1M2PA 4Y83A 1G8KA 3K54A 5B2LA 2R3LA 5AUXA 2R3QA 2R2PA 2X4ZA 3IK3A 4GYIA 3F61A 5DRDA 1REKA 2SRCA 4A7CA 3DFAA 5IDPA 2YM5A 1MQ4A 5IZFA 2XJ1A 2ZMDA 1M2RA 3AD6A 2HY0A 1YQJA 2XMYA 4O21A 2UZVA 2OSCA 4FT3A 4L44A 5DHJA 4LGHA 3CGFA 4RT7A 4M3QA 5D7VA 2YZLA 4UY9A 4J99A 5CI7A 2X4FA 2GFCA 3NS9A 3PY1A 3QF9A 1O6YA 3DJ7A 3EFJA 5IQAA 3CQEA 3FL4A 4U40A 3GGFA 3RP9A 1J7LA 4ANSA 3GNIB 2R9SA 4FTIA 3VN9A 5ETCA 3AQVA 1GZ8A 4TYHB 5FBNC 3BWFA 3C51A 3NFGB 1H0WA 4CV9A 3UOLA 3R8LA 2PPQA 1OIUA 2QO9A 4RVLA 4UWBA 4DDGA 4AZSA 2X7OA