1YDSE

Structure of camp-dependent protein kinase, alpha-catalytic subunit in complex with h8 protein kinase inhibitor [n-(2-methylamino)ethyl]-5-isoquinolinesulfonamide
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
336
structure length
334
Chain Sequence
VKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKDGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords C-AMP-DEPENDENT PROTEIN KINASE
publication title Crystal structures of catalytic subunit of cAMP-dependent protein kinase in complex with isoquinolinesulfonyl protein kinase inhibitors H7, H8, and H89. Structural implications for selectivity.
pubmed doi rcsb
source organism Bos taurus
total genus 109
structure length 334
sequence length 336
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 1996-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1ydsE01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1ydsE02
3W10A 4W9XA 3AQVA 4KBCA 1H25A 3EYHA 4DITA 3W2SA 3DA6A 5JMSA 4E26A 1OKYA 3SA0A 4M14A 1PXKA 3HMNA 3QUPA 4JL9A 5AADA 4OBOA 4UZDA 1VJYA 2YM4A 3LFSA 3MVJA 4NH1A 4F7NA 2YHVA 2WAJA 3GC0A 2Z8CA 2Y6OA 1YXVA 4OTDA 4FYOA 3R7IA 3TWJA 2AUHA 3F3UA 3KMUA 4IC7A 4TWPA 3ZM4A 1YKRA 4EZ3A 1OL5A 4ANLA 4WUAA 2JC6A 2PUUA 4OT5A 4X2NA 4FC0A 5G1XA 2WTDA 4PPBA 3T8OA 4KIKA 5I3RA 4U3YA 2IZTA 3OWKA 2P2HA 2QOFA 2W1GA 3E62A 3AT3A 4IACA 2F9GA 2VTTA 3BE2A 4R5SA 4XCUA 2RSVA 4O21A 2C6EA 3OWLA 4MKCA 2WMVA 3B8RA 4O38A 4ZY6A 3RAHA 4C34A 1DAYA 3A60A 5GZAA 3D9VA 1AGWA 3WF9A 3WYYA 2PL0A 1M7QA 3VHEA 3UDBA 5A6OA 2WOUA 3VUGA 4GCJA 3Q4CA 4X2JA 4MWIA 5HIDA 3KMMA 5AR7A 4HPUE 4ZEGA 3PIZA 4Y73A 3WBLA 2A19B 4OTGA 4AE9A 1W0XC 3Q9YA 2O64A 2XNBA 3E7VA 2X4ZA 4XG2A 4BWPA 3N51A 5FXRA 5ANGA 2J9MA 5HQ0A 4JLCA 3U9NA 2VGPA 3LHJA 2A0CX 3FLZA 2X2MA 5B2MA 4WNKA 3AC1A 1IR3A 2P4IA 4HVDA 5L2TA 5HCYA 5L2WA 2OICA 3U9CA 5HE0A 3E88A 5CU2A 3WF6A 4W4WA 3FZPA 5FWKK 5TO8A 3QTZA 3CE3A 4FNWA 3C5IA 1ZAOA 4KINA 1YOMA 3PVBA 4IEBA 2W1IA 3Q5ZA 5ETAA 3NGAA 5AUTA 4DGMA 4Q9SA 5FUTA 4HGLA 4YP8A 3WILA 3G6GA 4UMQA 3MPMA 5AUXA 4DGNA 4K18A 2P0CA 3AC5A 2BRGA 4D4YA 3VBWA 5IISA 2BAKA 4NFNA 4CTBA 2O3PA 2Z7QA 4QYFA 4XP0A 3RPYA 3CTJA 1ZMVA 3ZXZA 5EQYA 3WE8A 5E8ZA 2BDWA 1B6CB 4IQ6A 5EKOA 3ACKA 3WF5A 3TDVA 3PZHA 5F94A 4FV5A 5M4IA 3VS3A 5TKDA 2OH4A 2W5BA 4RZWA 3HMPA 3L9NA 3QD2B 4CT2A 4DGLC 3M11A 4FNXA 4XLVA 5EW8A 3MESA 2C0IA 1UU7A 4GFOA 4O6EA 4BBFA 4QTEA 4AW2A 2CSNA 2YITA 2XM9A 2DUVA 3U51A 2BZJA 5EK7A 2X8DA 4U5JA 1YOLA 2JIIA 3SQQA 3UODA 4YTCA 2ZM3A 4CKIA 2R0UA 4DT9A 1PYEA 3CBLA 4ZTMA 2PULA 3PPZA 4Y5QA 4NTSA 4O0SA 3KRJA 4QT1A 4TWNA 3C0GA 3O50A 2YJSA 3ZLWA 3HAMA 2J0IA 2OK1A 3EQDA 2FSOX 3KEXA 5DG5A 3OUKA 3QL8A 3QD3A 3GC7A 3HV5A 4IH8A 2FH9A 3JYAA 3RCJA 4E6AA 4RIYB 5ETIA 3ZDIA 3BZ3A 4IX4A 5L8JA 2EXMA 3FBVA 3BV3A 2OI4X 2VTLA 3JR1A 3R30A 2Y8OA 2C30A 2XNPA 3H9RA 3NNVA 4RGJA 3RALA 4BN1A 4F63A 3AT2A 3JVRA 3A62A 3DFAA 3NUSA 5HICA 3VVHA 5M07A 2FSLX 4JRVA 4ZK5A 3ORKA 4YZ9A 3EQHA 2EUFB 4J8MA 4ZTNA 1T45A 4FTKA 2E9PA 3FYJX 4OLIA 4APCA 3BCEA 5A54A 3NVMB 4FKTA 3AOXA 3QWKA 3HP2A 4II5A 2WKMA 3I60A 1DI8A 5L8KA 1Q4LA 2X0GA 2W9FB 4FZAB 3UG2A 3FAAA 4AOIA 4E7WA 2JAMA 3S2PA 5A4EA 1QL6A 2WO6A 1RE8A 4H39A 3SG9A 4DBXA 3HVCA 2CKPA 3AXWA 3H0YA 3IDPA 1FVTA 1SMHA 4W4XA 2PTKA 4C4HA 1STCE 3Q9WA 3G0EA 4KS8A 5AP4A 4P90A 5FLFA 1XR1A 2OGVA 4I94A 5HHWA 3ZXTA 4CTCA 4CV9A 2GQRA 3N4TA 2Y4IB 3DK6A 1KOBA 1YXUA 5AP3A 3UIBA 2R3QA 2X39A 5DR2A 2XMYA 4RT7A 3D7TA 4JT3A 5FM3A 3QALE 4EJNA 4BL1A 5BVOA 2UVZA 5FTGA 3QRTA 4J71A 1H24A 5AV1A 2GNFA 5TF9A 1XH9A 3R8PA 5JKGA 5CXZA 4GEOA 4JBPA 4TL0A 4MBJA 2UW7A 2AC3A 3EOCA 4EOQA 2UVYA 4PRJA 3TV4A 4XG4A 1GY3A 1Y8YA 5IA4A 4C4EA 3FDNA 4CQEA 4ORKA 3O8TA 2X6EA 4ALUA 3FZSA 3R9DA 4FR4A 2YISA 3QCSA 3V5TA 4A9RA 3MDYA 4BDIA 1O6LA 4BKJA 4F1OA 4R78A 5HE1A 1XH7A 4FZ7A 4EHZA 4BKYA 4RC2A 4NIFA 2ZV9A 3B8QA 5JN2A 4X2KA 3QC4A 3D2KA 4TNDA 5D7VA 2PK9A 4U41A 3RK7A 1FVVA 3ODZX 3HP5A 1CSNA 4L44A 4QMYA 5LOHA 4R1YA 5HU9A 3MFUA 5K4IA 4I5HA 2ZB1A 3SHEA 4PNIA 2X7FA 2ZYBA 3R2BA 5HCZA 4K1BA 3G9LX 4RMZA 3TTIA 5CVGA 5J87A 3GVUA 1R78A 4YZCA 4QMUA 3UVQA 2GS7A 4ERKA 5AV3A 4DEGA 5HORA 4BIEA 4LOPA 4ONAA 3UP2A 2E9NA 2QD9A 5J7BA 2YIQA 4GV1A 5AP7A 5CAUA 4RWIA 2QQ7A 2Z7RA 2YFXA 3PE1A 3QTSA 4YSMA 3G6HA 3CY2A 4AA5A 5KBQA 4DH7A 3EN5A 3L9LA 2XK7A 4LV8A 5M57A 2BRNA 3Q4ZA 1ZLTA 4YBJA 4ASZA 2FVDA 4DEAA 2BMCA 5AUUA 5BYZA 3UIUA 4IM3A 3H10A 5DE2A 2QONA 2QO7A 4CMOA 5JEBA 4BGQA 2UVXA 1UNHA 3DS6A 2IVVA 3LCDA 4HGTA 2O5KA 3GOKA 3ZONA 3LMIA 4FTRA 2B9FA 2OW3A 2J0MB 4I0SA 1Q24A 4EKKA 3TUCA 4WBOA 2W1FA 4XV2A 1UNLA 4H3PA 1UV5A 3WARA 5AV2A 3PLSA 3A4PA 4BCJA 5FP5A 4KIPA 4UV0A 2BROA 1WVXA 2XF0A 4BDAA 4GK4A 4Y83A 1BKXA 3BHVA 5TR6A 1OBDA 3SXRA 2IZRA 4QP3A 5LMBA 3QBNA 4W8DA 5EM6A 4Z7GA 2I0EA 2PYWA 5AP1A 2UZUE 3GU8A 4BCQA 3C9WA 5DLSA 2ZV7A 5E8YA 4FEXA 3BKBA 3KXMA 2JKKA 3R02A 3V6RA 3QA0A 2PMLX 3EQGA 3HNGA 5CQWA 4DFYA 5CSVA 3OBJA 3IDBA 3R1NA 3HGKA 4F64A 3NCZA 1KWPA 3LIJA 5EW3A 4HGEA 2ITWA 3KY2A 3ITZA 2VNYA 4I23A 4HZSA 4D0WA 4O84A 3R9NA 3M2WA 4M0YA 4O7SA 4GH2A 1PXPA 4TN6A 5HKMA 4FT9A 4AAAA 4U80A 2JIVA 2WQMA 1FGIA 4TYGA 3U4WA 2C1AA 1U54A 3MY5A 3RM7A 5CSPA 2J51A 3PWYA 4UEUA 3NUXA 5J1WA 5I0BA 3K5VA 2DQ7X 1OM1A 1RQQA 4TYJA 4FIHA 4G3EA 4L7SA 5A4CA 1JKLA 4MQ1A 2OXYA 5EYDA 1JSTA 4QTAA 3RINA 3EWHA 2YLEA 5FRIA 4H1MA 4BZDA 3FMKA 3VO3A 5IEYA 3Q96A 2ITTA 4O0XA 1VYWA 2VWWA 3R21A 2WQEA 3UOHA 4HVHA 5CAQA 3PLAE 3BV2A 4PTGA 5ANKA 3QQHA 4LG4A 4ITJA 4YTHA 4QTCA 3EKKA 2PZ5A 4JDIA 4EUUA 3W2QA 1PXMA 2VNWA 4OT6A 2ZDUA 4FT5A 3MA3A 4XV1A 1OL7A 2IVTA 2RG5A 3FSFA 3R8MA 3FE3A 4D28A 3UYSA 4PP7A 3S1HA 2OWBA 2RF9A 4GW8A 3CKWA 4IB1A 4ZJIA 3NZ0A 4UMTA 3BU6A 3PY0A 1K9AA 1BL6A 4IBMA 4QMPA 3GI3A 3R1QA 2Z7SA 1IEPA 4GUEA 5HVJA 5HCXA 3D7ZA 3E7OA 4BC6A 3RAIA 4M8TA 5IUHA 2PVNA 4QTDA 3W55A 3R9RA 4HYIA 3WF8A 2WTJA 4GT4A 3FC2A 4RJ8A 1PXNA 4RQKA 2Y4IC 5LVPA 1BI8A 4NEUA 5CU0A 5L3AA 3MA6A 3FUPA 1YDRE 2QO2A 4FGBA 3OCTA 3TN8A 2NNWB 3R9OA 3QGWA 3VF8A 2UZOA 3MVLA 2W1EA 3EQIA 1H08A 4HCTA 3BE9A 2C5VA 3HUCA 4PY1A 3GNIB 3NCGA 2I0YA 3AMAA 4FIEA 4RLKA 3PG3A 3DXQA 2QLQA 1ZOGA 2WTCA 5EDQA 4M13A 4BDEA 2XYNA 5EFQA 3PXYA 1UKIA 4QMMA 4UB7A 4A06A 4IDVA 5CALA 4BDBA 4I21A 2F7EE 3NYXA 4FKPA 2ITQA 1BLXA 1PF8A 3LFQA 3QRJA 4ENYA 3BQCA 1PXOA 5E7RA 3ORXA 3EH9A 2VWIA 4QMOA 3PXQA 5JGAA 3S0OA 4TY1A 4IHPA 1PXLA 4NFMA 4B8LA 4BCFA 4EWHA 5FM2A 4CFMA 2YEXA 3C1XA 4NZWB 3F3ZA 4E6QA 5KMJA 2VZ6A 4EHVA 4F0FA 2PE0A 1SVEA 1B38A 3DU8A 4FTJA 5DEWA 4K2RA 4U44A 4ZSJA 4I20A 4RIXB 3F6XA 3PIXA 2X8EA 4BYJA 2V0DA 2O63A 3R22A 4RJ3A 3QTQA 3PXZA 5HVYA 2J6MA 4TYHA 5EOBA 3V51A 2C5NA 5GIPE 4IAYA 2W4OA 3LXNA 1G3NA 4E8AA 3ZZEA 4FOCA 1FVRA 5J9YA 5IQFA 2XEZA 4RA4A 5KZIA 3QTXA 2HW6A 3K3JA 2R3GA 2FUMA 2YCSA 5LARA 3VQUA 3QRKA 3CTHA 4L53A 3BGQA 3HRCA 1DAWA 2RL5A 3COHA 2C68A 3VS5A 1MP8A 4OAVB 5T6KA 4EI4A 3LJ0A 5AM7A 4FIJA 4YURA 2WMUA 3FYKX 3P7CA 4HNIA 2OZAA 3PDTA 2BRBA 3MFSA 2G2FA 2BFXA 2BTSA 2PZPA 3FMHA 4GK2A 4V05A 3HLLA 4NKAA 3FMDA 4XG7A 3RZFA 3KF7A 4G3DA 3NSZA 4IVBA 2X2KA 3CQEA 3HYHA 2XA4A 3MSSA 1ZMUA 2VTAA 4TTHB 5M51A 4F65A 1RJBA 4D1SA 4WRGA 4X3FC 2Y4PA 5TE0A 2RG6A 3FMMA 1TVOA 3W2OA 1OITA 3HA6A 2PMIA 5DFPA 3PE2A 4KBAA 3F69A 3VBQA 5JGDA 3CJGA 3QZGA 3RGFA 5AP0A 4O7VA 4NWMA 3FLQA 4ZLOA 3GFEA 4GFGA 4O0TA 5CZHA 2UZDA 2ACXA 3TZ8A 1J7LA 5I4NA 2OF4A 3NVKI 3HMMA 4AXAA 4DN5A 3A7GA 4CSVA 1SNXA 5E8SA 1CTPE 2HYYA 3HDNA 4ACDA 4YUQA 4QP9A 3NMUF 1UVRA 4APPA 3FZRA 3UNKA 1BL7A 2QOLA 4WNMA 2PMNX 4AA4A 2J50A 4ANOA 4L01A 4DGOA 4ZIMA 4D9UA 5I9WA 2YIYA 4OTIA 4J99A 5DN3A 1WMKA 2PZYA 1ZWSA 3LPBA 4ZMFA 2Z02A 4A4OA 2IVUA 4YR8A 1OKVA 1YI6A 3ENMA 3MN3A 3REPA 4B6LA 2DS1A 3S4QA 3RNYA 2QNJA 4JIKA 3DKCA 3PA5A 4E6CA 2R7BA 4GVJA 2EB2A 5DR6A 4RVLA 3ATSA 4L45A 5AR4A 2YWVA 4KKGA 3DJ5A 1JVPP 3VC4A 2I40A 3GFWA 5AJQA 3QZFA 3S95A 3IW6A 4BBEA 2XB7A 3DAEA 4YJTA 4CFWA 5M4CA 2R3FA 5ETCA 4GT3A 4E1ZA 5IQCA 2PUNA 3TNPC 2B55A 5CVHA 4YLLA 4ZJJA 1KV1A 2X9EA 2XK3A 2G2HA 4XP2A 4X0MA 5AAFA 1XKKA 4O27B 3BELA 5GHVA 2ZDTA 3LCTA 3QHWA 4U97A 5HESA 5M53A 2WGJA 3OC1A 3I0QA 4AT5A 3ZH8A 2OJGA 1HCLA 3ZEWA 1PRYA 3TM0A 3SAYA 1ZYJA 3Q4UA 5KMIA 4NL0A 4RJ4A 2F2CB 2JDOA 4LUEA 4QMWA 4QOXA 4EOOA 3NDMA 2HZ0A 3KRWA 3KCFA 2VRXA 4XP3A 2XP2A 4D2WA 4TRLA 4RSSA 4DEDA 4RFMA 4FBXA 1NXKA 1ATPE 4W4YA 4XV3A 4E73A 3B2TA 4GRBA 3FL5A 3GU4A 4NM0A 1H1PA 3OWJA 4D0XA 3DQWA 1SVHA 4FYNA 1U4DA 2QHNA 1OPLA 3L1SA 4R3PA 5DT0A 3W8QA 5H8GA 4EC8A 1MRYA 2WMBA 4PL5A 1ZYDA 1KE9A 2WTIA 3EL7A 1Q8WA 5FTQA 3TDWA 5HG9A 2OIBA 4D1XA 5JGBA 1QPEA 2GHMA 1E1XA 3R2YA 1ZYCA 4MXZA 5CVFA 4EK6A 4EH6A 5CEOA 5IQAA 2WB8A 3F3VA 4YSJA 4C8BA 2PVJA 3C13A 3R73A 4AZWA 3RCDA 4NTTA 2WELA 2BKZA 5DVRA 3ANQA 4IWQA 4OTHA 4QMVA 3LOKA 5IU2A 4C35A 4KIQA 3UQCA 3DZQA 3V8SA 4ZSGA 3QTIA 3UO5A 2JIUA 2PZIA 4IX5A 2OXDA 4FTUA 2R3NA 2XYUA 4S33A 5I9ZA 2OJIA 3PPJA 2IZUA 3HV4A 1NVSA 2VV9A 3DK7A 3EQRA 5LJJA 3TV7A 3G5DA 5KCVA 2XH5A 2VWBA 2YM7A 1J3HA 1JSVA 2PVRA 4MXOA 5I9UA 2JDVA 3LFBA 4XHKB 3ULZA 1XO2B 1LR4A 4DH5A 4MHAA 5K5NA 1PMEA 4NM7A 4ERWA 4CV8A 2WZJA 3ALNA 1V0OA 3QQJA 3GC9A 2W5HA 4FKGA 5AAEA 3VUMA 3QX4A 1YDTE 2I1MA 2RKUA 2AC5A 3LCKA 3SC1A 5IDNA 3RJCA 3QXOA 4PF4A 4Y8DA 3H4JA 4U43A 4YTFA 4EZ7A 4FTIA 2CGXA 4M66A 2HIWA 2Z60A 3F3TA 3OCGA 3FMNA 4WRSA 3O23A 4JQEA 1LEWA 3UYTA 3EL8A 4EYMA 5A4LA 3THBA 4O2ZA 4RVTA 4C38A 3CSVA 5CX9A 4BI0A 2WEIA 4OBPA 3Q3BA 4PTEA 3VBVA 5IEXA 3ZUUA 3BGZA 3R8LA 2C3JA 3BBWA 3DTCA 4TPTA 4DH3A 1H01A 3DV3A 4IXPA 3W1FA 5IMXA 3HX4A 2J0LA 3PIYA 4PUZA 3F5PA 4QMLA 3KQ7A 4FKVA 5HX6A 4FSZA 1KE5A 3MW1A 4YJVA 5CF4A 2PVYA 4PNKA 1YXTA 3A7IA 3VS0A 4FZDB 2KTYA 1BX6A 1ZOEA 5FEEA 5AUZA 4J96A 5IQGA 4FX3A 2JEDA 4JBOA 3FZ1A 2B9HA 3CLYA 4CMTA 1OL2A 2VTPA 3QTWA 5DR9A 4B99A 2C6DA 4PX6A 2OIQA 4FOBA 3EKNA 4B0GA 2YIXA 4DH1A 3GCSA 3FY0A 5CXHA 4AX8A 5HTCA 4QPMA 3F7ZA 2BIKB 5A46A 5EKNA 5KO1A 4X6QC 2ETRA 4KIKB 2YABA 3D94A 2VWXA 2A27A 3ACJA 4J7BA 2OU7A 5DEYA 4FT3A 4QP2A 4HW7A 3IGGA 1YDSE 3R7VA 3VW6A 3OUNB 4IWDA 4F0GA 4AACA 1PHKA 3QXPA 3NUUA 5C8KA 3DJ7A 5BVFA 3QF9A 3R00A 2WMRA 5D11A 1UU9A 2VD5A 4I0TA 4IB3A 2C47A 4R8QA 5T68A 2P3GX 5CEMA 2WMTA 3MH3A 4NW6A 1R0PA 1URWA 4BI2A 2W96B 4AS0A 5LQFA 5L4QA 2GNGA 4FV3A 3FLWA 3CQWA 3I1AA 3P9JA 2HZIA 4AZFA 5CF5A 3ZC5A 2WU7A 4BWKA 3QA8A 3IECA 5HX8A 4ASDA 5IA5A 2GS2A 4D4SA 3RWPA 4MX9A 3PYYA 4RVMA 2BCJA 2JAVA 4FG7A 2C5XA 4C4IA 4Q9ZA 3LQ3A 4HPTE 3MPTA 1JNKA 3MIAA 5IUGA 5IQEA 1FMKA 2XUUA 1U46A 4IMYA 5BYYA 5HVKA 2PU8A 2GQSA 5L8LA 4DEBA 1LPUA 4O96A 1Q8YA 1Q97A 2P33A 4MTAA 1FMOE 3R8UA 1ZZ2A 1W8CA 2WPAA 1H27A 4UY9A 2B54A 4YHTA 3LMHA 4FODA 3GUBA 3OOGA 3LXKA 5J79A 4RWLA 4KABA 3MPAA 4JG7A 4C4GA 4K9YA 4ZAUA 4RJ7A 4RWJA 5BUIA 4OTQA 4FIGA 3BLHA 3TKIA 4YJNA 5IH4A 3LLAA 3GT8A 3AG9A 5M55A 5CI6A 2JKOA 3PSDA 2ITVA 4M84A 4PMTA 5AV0A 4G34A 1OKZA 1OZ1A 3ROYA 4IZ5A 3TTJA 4F1TA 2ZMCA 4TWOA 2P55A 3WZEA 2R3KA 5EI6A 4Y95A 4D2PA 3DZOA 4TW9A 1GNGA 3HUBA 2H9VA 4Y85A 3NNUA 4BWXA 3E3BX 5BPYA 4L8MA 2IW9A 3DDQA 3KN6A 3VRYA 2ZOQA 4EH4A 3UJGA 3O96A 4L46A 1BMKA 4KAOA 4C3RA 2FSTX 4EH7A 5FEQA 5EM8A 4ITIA 4RPVA 3POOA 5L6WL 2C5OA 4XUFA 2X6DA 2UZWE 3VF9A 3FEGA 1URCA 2BALA 3FKNA 4U79A 3EMGA 3MBLA 4ZS0A 4CCBA 4O7TA 3O71A 4FG8A 4UMRA 3A7HA 3LFEA 4J97A 4EYJA 5H9BA 5CENA 2X7GA 4ANNA 2JITA 3CQUA 4OUCA 4XOZA 4AT4A 3F7WA 5CWZA 4O7YA 5F1ZA 4BR3A 4EH3A 3EYGA 1XH8A 3CIKA 4N70A 5D7AA 4BDHA 1W84A 4C61A 3NW7A 4F9CA 3EN6A 3O51A 4DFZE 4L00A 5F9EA 3FMEA 5LCJA 3I79A 1A06A 3C0HA 5DPVA 2HOGA 4GSBA 5EYCA 4Z3VA 2XK8A 4ZSLA 5J5SA 4CG9A 4LL0A 4BTKA 2PHKA 5KBRA 5BUEA 2ETMA 5E91A 4DLJA 1OBGA 1Y6AA 4E5BA 3CS9A 2ZVAA 4FNZA 4MQ2A 4FKSA 4MBIA 3WZKA 3P86A 4FT0A 3TIZA 4MXAA 4E5WA 3AD6A 1T46A 4NW5A 5H2UA 5AUWA 4BTMA 2XNGA 5E1EA 3VS6A 4CRSA 5L2IA 2QKRA 4QYYA 3QCYA 3C4WA 5CSHA 4O7NA 1DM2A 2IO6A 5JH6A 2BFYA 3E92A 3QLFA 4CZUA 3RHXA 4XRLA 3HMOA 1XHAA 4D55A 2PVHA 4B4LA 3F82A 1OIRA 2H8HA 5IA2A 4PDYA 1U59A 2NP8A 2WIPA 3MB6A 5FD2A 3VS7A 3ATTA 5K4JA 4AZTA 1ZOHA 3JY9A 2YLFA 4ZSEA 3C4EA 3GGFA 3LJ2A 1PJKA 1KE8A 4FV4A 4YNOA 2PUIA 5CF8A 3Q53A 2GNLA 3QKKA 3B2WA 4RIYA 3FLNC 2JFMA 2I0HA 2OF2A 3BPRA 4MH7A 2UW6A 3PXFA 5LVNA 3CGOA 4G5PA 4IAZA 3NUPA 2WTWA 4JDKA 4TYEA 3PA4A 3VNTA 3L9MA 5CYIA 2C0TA 3BLRA 4XBUA 5E8UA 3K5UA 5FXQA 3TKHA 2BZIB 3FSKA 2VWVA 2QCSA 4WG3A 5GZ8A 4JAJA 4S2ZA 1ZRZA 3G90X 4XMOA 3BGPA 4OW8A 4NIFB 5E8VA 3JY0A 1NVRA 4X7QA 4AWIA 3UGCA 1Q8UA 4NYEA 2J0KA 3MB7A 5B2KA 2XIKA 4U3ZA 4ZTRA 3KXHA 4JR3A 3DBFA 4AU8A 2VN9A 2GFCA 4C2VA 2PSQA 3UNJA 3UOKA 4IX6A 3NIEA 4BZNA 4I5CA 4MK0A 1ZZLA 2QR7A 2HY81 2W4KA 2XIZA 3G33A 3MTLA 3QQKA 2WMAA 3O7LB 4HCVA 1XH4A 4LMNA 5JSMA 3SW4A 4JX3A 4YZMA 4JS8A 2ETKA 1ZMWA 4OTRA 4QNYA 2JDRA 2OO8X 2XKEA 3PRFA 4MBLA 3VQHA 5HIEA 5ICPA 3NUAA 4RWKA 1ZYSA 1R0EA 5DT3A 1ZARA 4G6OA 4L3LA 1H0VA 4U8ZA 5BNJA 3SXSA 4A7CA 4FIFA 1LEZA 4F08A 4Z9LA 4RVKA 4E4LA 4I6FA 4YBKA 3EFKA 1JKSA 2QHMA 4O1OA 5BMMA 2BILB 1K3AA 3MH1A 4EQCA 5KMLA 4GMYA 4JOAA 2CJMA 2UZNA 5AV4A 4GG7A 3Q9ZA 2NPQA 3DCVA 1Y57A 2R9SA 5C03A 3OT8A 3HAVA 1OMWA 2OJFE 3CY3A 4BVUA 3PVUA 5AWMA 4UMPA 3Q4TA 3PPKA 1KUTA 1OL1A 4M0ZA 5CEKA 4LL5A 2V22A 4FKRA 1Q3DA 3OW3A 3UQFA 3MH0A 4BFMA 3DBCA 5IG1A 4FV1A 1WBWA 4EOKA 1P4OA 3MGYA 4FF8A 4U45A 2X81A 2CGWA 4BIDA 5CNNA 4BTJA 2XRWA 3QC9A 5HE3A 5ITAA 2HW7A 4RFZA 4UWYA 3FKOA 4IW0A 1V0PA 2CNQA 1ZYLA 4EOLA 3Q32A 4BGHA 4ZTLA 2VUWA 3S3IA 1FINA 2C6MA 1H26A 2GMXA 3KRXA 3QWJA 2ZV8A 4A9SA 1J7IA 1QPCA 4EZ5A 2BTRA 3H30A 3Q9XA 5D41A 5JQ5A 4PL4A 3BEGA 5AFVA 4JAIA 5HO6A 3ORPA 2V62A 3BYOA 4ITHA 3FI3A 1Z57A 5E92A 4ZZOA 3I81A 4F9BA 4IDTA 3COIA 2BZKB 2JDSA 2CCIA 3FXWA 4DG0E 1Z5MA 3ZEPA 1A48A 4G2FA 2VO7A 3V5LA 3MH2A 4C3PA 4YU2A 5EQEA 3M1SA 2QO9A 3NAXA 2WFYA 4KS7A 1SZMA 3ERKA 3NNWA 4GT5A 4U0IA 5DGZA 4ASXA 4AZSA 4QQJA 2B53A 1GAGA 2GNJA 4EH8A 3VJOA 3SX9A 4EBWA 1U54B 4O81A 1PKDA 5EW9A 3CC6A 2GNHA 4H58A 4CMUA 4FSQA 3HECA 4J98A 1Y91A 2ZM1A 3ORTA 3CXWA 3FPQA 3KF4A 1CMKE 1OIQA 2RFDA 4FV2A 2PWLA 5EQPA 3KULA 4FKJA 2UW5A 2BHEA 3C7QA 4X3FA 2GFSA 4LQMA 5L6PA 1Y6BA 3QYZA 4PPCA 4CZYB 3E8EA 3ZO1A 2OIDA 4DG2E 3WE4A 1P4FA 3JS2A 2XBJA 3NS9A 1PY5A 5CLPA 3U8WA 5A4QA 4CFUA 4QO9A 2PVMA 3H0ZA 5M08A 4GJ2A 4IJ9A 5HD4A 2E2BA 3IOPA 3PUPA 4WUNA 3QRIA 4FTTA 5LMAA 3BYSA 4CVAA 2ITYA 3RAKA 4XS2A 5CEQA 2JFLA 3LCSA 4DTBA 1GIHA 4MWHA 2QKWB 4EONA 5L2QA 1YW2A 4KSPA 4F9YA 4IM2A 2XJ2A 5JK3A 4D4VA 3NYVA 3RI1A 2BIYA 3CP9A 4IZ7A 2CHLA 3I4BA 4V0GA 4O86A 4CYIA 4DFNA 2HAKA 3DBDA 5CANA 2R5TA 2VX0A 3FI2A 3DOGA 1QCFA 5CQUA 2XJ0A 5LVLA 5AAGA 1R1WA 4NM3A 1MRUA 5CY3A 4QYGA 3ORZA 2IW8A 2CCHA 2OFUA 4BDGA 4MYGA 3FJQE 4GG5A 3UIMA 4EH5A 4JBQA 3R28A 4CZTA 3PP0A 3UZTA 5JFSA 5HNIX 4KWPA 5BQ0A 3F66A 2YDKA 3ZU7A 3QUDA 3E87A 5LMKA 3EFLA 4KRDA 4O7RA 5E1SA 2HY0A 5J9LA 3CCNA 3D2IA 4FTQA 3IW7A 4FTAA 4RBLA 4G1WA 4DC2A 4DCEA 2C69A 5AR3A 4FI1A 3ZMMA 2W7XA 3WIKA 3W32A 4G6NA 5IA0A 3W2CA 2JKMA 4O91A 4GUBA 4A4LA 3T3VA 3VRZA 1VZOA 4GKHA 3BU3A 1WBNA 4JQ8A 5IQHA 3R7EA 2X9FA 4UZHA 3SG8A 5JFWA 3SD0A 4R6VA 4C62A 2XIXA 3ZDUA 5KMMA 4CCUA 3LXPA 3R71A 3VUDA 5G6VA 3WZDA 1CKPA 2QOOA 4HYSA 4WSYA 5AUYA 3R83A 4C0TA 3O2MA 3R04A 3OF0A 3F2AA 4HYUA 4K11A 1OI9A 2RGPA 4RC4A 3TXOA 4ANQA 3UZRA 4I6BA 2R64A 3E93A 3IOKA 5AP6A 3RWQA 4IWPA 3KVWA 5KMNA 3PZEA 5CZIA 5JZNA 3TUBA 2VAGA 1FOTA 3WOWA 4JQ7A 4WBBB 4UX9A 1OPJA 2XKFA 3COMA 4AW1A 1ERKA 3VS2A 5EM5A 2YCRA 4CFFA 2SRCA 4R77A 4JXFA 4F6WA 2UW8A 3BU5A 1SM2A 3EFWA 3D0EA 3HV6A 3R63A 4USDA 3ZLYA 1ZXEA 5EHOA 2XCHA 4UXQA 1O6KA 3COKA 5AP2A 3MVHA 4IB5A 3QQLA 3R7YA 2ONLA 2UZEA 3SKCA 5M4UA 4AQCA 4F6UA 5ACBC 3KC3A 4FTLA 4W4VA 3II5A 4FE2A 3VUIA 4MNEB 4CXAA 3RPSA 4C3FA 2YJRA 4TWCA 2J4ZA 4YZNA 3SXFA 1PMVA 1YXXA 4FL1A 1PW2A 3OY3A 3P1AA 4XG8A 2OZAB 1OPKA 3RM6A 4AOJA 4LI5A 4IX3A 4IM0A 3F3WA 1X8BA 3A61A 4L67A 4E4MA 3QQUA 2OZOA 4PDSA 4OAUC 1UU3A 4DA5A 3JPVA 1GIJA 1JOWB 3P5KA 4OTFA 4Y5HA 5CEIA 4CEGA 5IQDA 2XIRA 4IFGA 1K2PA 1IRKA 3D15A 2UW3A 4F7LA 5D1JA 4FSRA 2YN8A 3AMYA 4M69A 4YJPA 1RDQE 2J0JA 3O8UA 2QURA 4BCPA 3A8XA 3VUTA 3OFMA 4KB8A 2J5FA 3UTOA 4HVGA 2CDZA 3LJ1A 3GU7A 4IAFA 3EJ1A 4AP7A 1Q99A 3LW0A 4W8EA 2OG8A 4TYIA 3TEIA 5HTIA 4S34A 4EQUA 2GTMA 4FZFB 3FI4A 3QKMA 3G15A 3ORLA 4PMSA 4RX5A 3H9FA 3PFQA 1UNGA 1V1KA 5IA1A 5ANEA 3NEWA 4FK6A 2JD5A 3FC1X 2RIOA 4FSNA 2GS6A 5ACKA 3NW5A 4RJ5A 3R7OA 4QRCA 2B9JA 4OR5A 3F2RA 4I5PA 3FWQA 3HMIA 4NM5A 4X21A 3GCQA 3SRVA 5BVDA 3OHTA 4L9IA 4F7SA 3U4UA 3LXLA 4U7ZA 3L9PA 5IZFA 5JZJA 3O0GA 4AF3A 2A4LA 3DNEA 5IPJA 2WMWA 3DK3A 5AX9A 5HOAA 1M7NA 5ANIA 2W0JA 3NNXA 4M3QA 4KKHA 5BMSA 1I09A 4BHNA 2BPMA 4CGAA 4ZS4A 3FMLA 2WIHA 4FTOA 3R8ZA 4GFMA 4BHZA 2F57A 2R3JA 4Q2AA 2HCKA 4XYFA 4NKSA 5CI7A 4UYAA 4GU9A 5HBEA 2EB3A 3T9IA 5CAPA 3VUHA 2I7QA 4YPSA 2W05A 1IASA 4K6ZA 4M12A 3WIGA 3ZSIA 1JPAA 2VWZA 3KK8A 2YAAA 2NRUA 3FQHA 5GZ9A 2CKOA 1W98A 1G8AA 3KXNA 4WIHA 4M67A 1OUKA 5H3QA 4H3QA 3C0IA 4GJ3A 2YZLA 2B7AA 4FUYA 4CD0A 3BWJA 1Q8TA 2PVLA 1TQPA 4IJPA 3I7CA 3KK9A 2VTIA 3PTGA 3DQXA 1F3MC 3Q04A 2J5EA 1YWRA 1DI9A 3ZFXA 3ZS5A 2C4GA 1OGUA 2PE1A 3ZO3A 5B2LA 5KHWA 2WTKB 3P78A 2RFNA 4D4RA 4DFUA 4QNAA 1KOAA 4ACMA 1ND4A 3AGMA 2NRYA 2R7IA 3AGLA 4FT7A 5FG8A 4I4EA 5C27A 4A07A 5FDPA 1Y8GA 3A99A 4FTNA 4EBVA 4Y72A 4ACCA 1H8FA 3GQIA 4U9AA 3G2FA 5HGIA 3AMBA 2X4FA 3ANRA 3KXGA 3DPKA 2JKQA 3FZTA 2GHLA 4QMSA 2CPKE 5L2SA 2CKEA 5E4HA 3QYWA 1R39A 5JT2A 4MVFA 3TZMA 4QPSA 3UOJA 3PSCA 2UZBA 3UIXA 4IAAA 2R3LA 2ZJWA 3V5JA 3LQ8A 3MY1A 4FVRA 4GYIA 1EH4A 5HTBA 1H1WA 2FGIA 4USEA 2BRMA 2GHGA 5CEPA 3LMGA 3LFAA 1YRPA 3DFCB 1GZNA 3BHTA 4F6SA 2R3IA 3U55A 3RPVA 3UMWA 3V01A 3ZRKA 2ERZE 2QOHA 3PY3A 4A9UA 4IADA 4I24A 4WNPA 4D2TA 4R3CA 3OBGA 3SW7A 2CN5A 2XK6A 4XBRA 5DMZA 4ZTQA 4G31A 3CPCA 2AYPA 2YAKA 4CKJA 4YJRA 3HKOA 2P2IA 2WQOA 3HZTA 2FA2A 4IANA 3KL8A 4L68A 4RIWA 4JVGA 2VO6A 3KFAA 3MFTA 4L3JA 5FDXA 4FV0A 3U6JA 1H1RA 1JWHA 3R0TA 3MYGA 1IAJA 4ARKA 3FL4A 2XNOA 4QMXA 2WOTA 4EH9A 3KU2A 3PJ3A 4O22A 4UWBA 1XJDA 2OFVA 4JDHA 3V8WA 1PXJA 3AT4A 1MRVA 2HZNA 4FSYA 3ZTXA 5KHXA 2C0OA 5CS6A 4B7TA 1JSUA 2Q83A 1LUFA 5ANJA 4ZZNA 3LKMA 2ZV2A 4P5QA 3QHRA 3S00A 4RIOA 1FPUA 4XG9A 5HEZA 4AN9A 3TG1A 3OMVA 3TT0A 3VBXA 3ZUTA 4ANSA 2HK5A 4IC8A 5C8MA 3TNHA 4AW5A 3ZLSA 1CM8A 4YHFA 5BVWA 4RX9A 5GINE 1PKGA 3GU5A 3NPCA 4RRVA 2WTVA 3ZOSA 1H4LA 5A14A 3DGKA 3TCPA 2JBPA 4UWCA 3RAWA 3LFNA 5F20A 5KKRB 4YC8A 4J95A 3ID6C 4MF0A 1KSWA 2C1BA 4YHJA 3WYXA 3GEQA 2NO3A 5DRDA 1P2AA 3R7UA 2F7ZE 2E9VA 3DY7A 3MWUA 3IO7A 2VGOA 1H1QA 3R9HA 2OH0E 4TT7A 2W1ZA 2Y6MA 3CEKA 3FXXA 3OCBA 3HL7A 3ZFMA 4OBQA 4DEEA 3LLTA 2PY3A 2VWUA 3PXRA 5I5ZA 5T3QA 3LFCA 3OTUA 4FMQA 5GIOE 2IZSA 3UP7A 4O6LA 4HOKA 5DT4A 1H1SA 4L3PA 4KA3A 3TUDA 3OEFX 4D5KA 3E64A 3TZ7A 4CT1A 3DB8A 4RC3A 3NYNA 2YCQA 5DA3A 5D10A 2XJ1A 3GXLA 3QTRA 4YLKA 2LGCA 4AZEA 5BX0A 3IGOA 5IH6A 1REJA 3DT1A 4YJOA 2ZB0A 2ERKA 4AE6A 2Y7JA 2VTSA 3BWFA 2W4JA 4YJUA 3E8CA 3RP9A 4RX7A 3EZRA 2PMOX 4GU6A 2EXCX 3SVVA 2Z2WA 3N9XA 4WHZA 1Q61A 3LFFA 3KXXA 3FLYA 3MJ1A 5FEDA 1RW8A 4LOQA 4R7HA 3ROCA 4DCAA 2OLCA 3V04A 3E3PA 4EHEA 4EEVA 4F1MA 2HXQA 4RJ6A 5HO7A 2CLXA 5CU6A 3HDMA 1JKKA 3SOAA 1L8TA 2CMWA 3U54A 5JFXA 3CTQA 1MQBA 3BHYA 5HNGA 1R3CA 4J1RA 3BRBA 5DWRA 1IG1A 3BHHA 5I9VA 4I41A 2W1DA 4IVAA 4S30A 4IB0A 1ZY4A 3BQRA 3FHIA 3FKLA 4FL3A 2YDIA 5J5TA 3GCPA 3QCXA 4FEWA 3LZBA 5B7VA 4YPDA 2PPQA 3D14A 4FV9A 2H6DA 4LRMA 3PJ2A 4CNHA 2XS0A 4ENXA 4QYEA 5C01A 2ITPA 4I1ZA 4P4CA 1BUHA 4H1JA 4QQ5A 5H8BA 4PV0A 2BR1A 3FY2A 1A9UA 2W99B 4ZY4A 1IAHA 3LFDA 5KMKA 4JNWA 3VBTA 3AD5A 2H96A 4CFXA 4DFBA 3FLSA 4DBNA 4BDKA 3I0OA 4M15A 1H28A 2WQBA 4YNEA 1Q3WA 3OCSA 3Q2MA 5I3OA 4ZTSA 4N0SA 3EFJA 3QUEA 5CU4A 3FMJA 4G3GA 5LXMA 1OVEA 3LM5A 3RTPA 2PVFA 3EN4A 1L3RE 3V8TA 4CFNA 5A4TA 2FO0A 3KMWA 5EH0A 3I7BA 4FKLA 1CDKA 5KE0A 5M06A 4P2KA 1NT2A 1VYZA 2F2UA 4FG9A 4K77A 3Q6UA 2W5AA 2WTKC 3AC2A 4L6QA 4U40A 4RFYA 1M17A 2ZM4A 3O8PA 2ITZA 4G3CA 4LUDA 3RK9A 4B8MA 3SGCA 3D5XA 3G51A 4GIHA 4G6LA 4LGGA 5IMEA 2GU8A 3TACA 2R3RA 3DB6A 4V01A 4AUAA 4BDCA 1WBPA 3EQFA 4MXXA 1NY3A 3DXNA 4A4XA 5CU3A 4N4SA 4M97A 5AP5A 4EWQA 4C57A 4LV5A 3VN9A 3GB2A 5CT7A 2HELA 4YGAA 3TNQB 4U6RA 4EK4A 4QMNA 5J1VA 3G9NA 5DYJA 3RZBA 1E9HA 1HOWA 4BDJA 3D4QA 4XRJA 4IAKA 3D5UA 3SOCA 4DEIA 2XRUA 3C4ZA 5HG8A 4D2VA 5IH5A 1CKJA 3DKOA 4FTMA 1YOJA 2O2UA 3UVPA 3ZO2A 5IQIA 3RMFA 2WQNA 4FEUA 3SLSA 4FKQA 5GJDA 2VTJA 3OY1A 5BYLA 3KCKA 3ODYX 3E5AA 3VULA 4BCHA 4LRKA 2YM8A 4E4XA 3EQBA 3UVRA 3I5ZA 1IA9A 3SDJA 4WG5A 4NCTC 4O0UA 3T3UA 2QOKA 4NJ3A 4CQGA 5DHJA 2G1TA 2YACA 5DH3A 3LQ5A 4A9YA 3R6XA 3HV7A 1YWNA 4WA9A 2J90A 3RHKA 4F99A 4DEHA 3NIZA 2I6LA 3CR0A 4BDFA 3F5XA 3FI8A 3UZPA 4C2WA 4J8NA 3V5WA 1NVQA 4K0YA 4QP1A 3AD4A 3KKVA 5K0XA 4DTAA 4O82A 4LGDA 5K3YA 1U5QA 5KUPA 1PMNA 3PVGA 4QQCA 3QZIA 4DFLA 4ZY5A 5IQBA 4AZVA 4ZJVA 4GYGA 4U42A 3D7TB 3U87A 3P23A 4ASEA 4EUTA 4F70A 5EOLA 2CNUA 2EU9A 5A3XA 3NRMA 4ALVA 5GJGA 4GKIA 1W83A 4ZMEA 2IG7A 3EN7A 3P7AA 5DOSA 4I3ZA 3SV0A 4D9TA 5FP6A 2UV2A 5KNJA 2EVAA 5CSWA 4QP4A 1QPJA 5KKRC 3O17A 3A7FA 1Q41A 2HWOA 3PG1A 3ORNA 3Q52A 4C4FA 2W06A 5EYKA 2RFSA 3QCQA 4WT6A 4FK3A 4X2GA 3VW8A 1FQ1B 3MI9A 4V04A 1CKIA 4FKOA 3ZZWA 4ZLZA 3CJFA 3WF7A 5HE2A 4EOSA 2I0VA 1W7HA 3E8NA 4EH2A 4EJ7A 4FKWA 3ETAA 4O0VA 3OZ6A 1M52A 3FZOA 4C37A 1SNUA 2FSMX 4BYIA 4E4NA 1XH6A 4S32A 4CFVA 3JXWA 4DTKA 4MD7E 1YXSA 3IK3A 3OXIA 5K0KA 4HYHA 3UQGA 2C6KA 3ENHA 4I0RA 4I93A 5I9XA 2HXLA 1AD5A 4F9AA 4K8AA 3DXPA 4H05A 3O7LD 3RBWA 4YJSA 3TI1A 1KE6A 4ZTHA 2FB8A 3CD3A 3PP1A 4IAIA 2IVSA 5AM6A 2H34A 4BBMA 2XK4A 1TKIA 2F49A 3IONA 2VTRA 2OSCA 3QQFA 5HBJA 4ACHA 2R4BA 3TNIA 2VX1A 5BVKA 4IZAA 3AC4A 4X3JA 3LCOA 3DKFA 4IZYA 4G9CA 1G8SA 1UU8A 3PXKA 1WVYA 3DDPA 4KIOA 4PDPA 2GPHA 1JBPE 3TJDA 5FXSA 4OGRA 3QD0A 4M68A 1BI7A 2R3PA 5E9EA 1M2QA 5EHYA 4ZOGA 2IJMA 4IIRA 5H8EA 5HZNA 3IS5A 2O8YA 3C50A 1P5EA 5AMNA 3MIYA 3PY1A 4BTFA 4JR7A 3W2RA 5LWNA 4FZ6A 3MJ2A 2WMXA 4J52A 5DI1A 5CAVA 2BZHB 4DLIA 4EOPA 3U6HA 2YDJA 3DAKA 4KRCA 4DE4A 3TKUA 4WNOA 2BHHA 4XH6A 4ALWA 4F9WA 1NW1A 5HO8A 3FV8A 2W1CA 4BGGA 4HVSA 1GJOA 1XBBA 2A1AB 5M09A 4GK3A 4RG0A 2B4SB 2CNVA 4TXCA 5M44A 3CD8A 4FEQA 4EL9A 5AX3A 3WI6A 4UN0C 5JQ8A 3OW4A 3NR9A 4AT3A 2BKKA 4JX7A 5M56A 3UBDA 3ZHPC 3TL8A 4QP7A 4BIBA 5D9HA 3UO6A 3PVWA 3QU0A 3KRRA 1YI4A 4FV6A 4R1VA 3TZ9A 5M4FA 2GDOA 2R3HA 3OXTA 3R01A 4YLJA 4C59A 3R1YA 2PZRA 3F61A 2QLUA 3GCVA 5EI2A 2YCFA 3W18A 3G0FA 3NUYA 1XQZA 5ANOA 4C7TA 4KD1A 4PTCA 5DIAA 2QODA 2VO3A 4R5YA 1TQIA 4G17A 1H00A 1XWSA 4C36A 4Y46A 4WKQA 3OT3A 4D58A 3KULB 4CKRA 1APME 3QGYA 2OBJA 2QC6A 3BLQA 3BX5A 2ZAZA 4X3FB 5BUJA 3QKLA 4O0RA 1HCKA 5IUIA 4L43A 4UBAA 4DFXE 4RQVA 4JJRA 1G5SA 2GTNA 5FBOA 4F7JA 4FNYA 3IG7A 4FSUA 4IWOA 3TJCA 2XNNA 3EB0A 4WO5A 2WEVA 4WG4A 2DYLA 4L42A 3F88A 2XKDA 4QMTA 4H3BA 4AN2A 5BVNA 1GOLA 4XOYA 2XNEA 2YM3A 2G15A 3NX8A 3OEZA 3RPOA 3LM0A 4IVCA 1E1VA 4HGSA 4AOTA 4RA5A 3OXZA 3W16A 4EKLA 5HLNA 1J7UA 4CRLA 2WD1A 2BDFA 3I6UA 1OKWA 1SVGA 2QG5A 4AA0A 5FQDC 4FVPA 4YC3A 4MF1A 4UALA 4BCIA 4R7IA 4DHFA 4YO6A 3JVSA 4V0GB 4LFIA 3C4CA 2YM5A 3A7JA 4F4PA 4ANBA 5EM7A 4DINA 4QPAA 3ZSGA 4EC9A 1J1CA 2J2IB 4E20A 2OXXA 4WD5A 4FIIA 3NWWA 3M42A 2QG7A 5AA9A 2XVDA 3LVPA 3QTUA 4XG6A 1JLUE 2E9UA 4LOOA 4FSTA 4W9WA 1BYGA 4AW0A 3V5PA 3QZHA 5IDPA 3EQCA 1XBAA 3VS4A 3E8DA 1JQHA 3VWAA 4P7EA 4BCKA 3DLZA 2C6TA 2Q0NA 4DAWA 4EK5A 4G16A 4XX9A 1W82A 5ANDA 4Z16A 3ZM9A 4D2RA 1QPDA 2VTHA 5C4KA 4O2PA 2CGUA 3TV6A 4I22A 2HENA 4MXYA 5AR8A 3Q6WA 4LGHA 2VTQA 2X2LA 5A6NA 4YZDA 3RVGA 4BICA 3UC4A 4D2SA 1YWVA 2OJJA 3QQGA 3EN9A 2XKCA 2XM8A 3F5UA 4LMUA 4JDJA 5AEPA 3KREA 2YIRA 1PMUA 3MV5A 5GNKA 5HLPA 3N4VA 2BUJA 2WXVA 1S9IA 2GSFA 4NSTA 2XEYA 4I4FA 3UO4A 4M7IA 3K2LA 5AA8A 4O7WA 5TOZA 4JRNA 4DYMA 2CLQA 3EHAA 2A2AA 3L8XA 3L8PA 2B9IA 5HG7A 4QQTA 2YM6A 1WBOA 1ZY5A 1OL6A 4R3RA 4N6ZA 2WU6A 1WZYA 3ZBFA 3OVVA 4DGGA 2IW6A 3DJ6A 4O1PA 4DT8A 3D5WA 3OOMA 4GS6A 2QU5A 4GL9A 3GOPA 4HZRA 3BYUA 3DTWA 3EIDA 5LCKA 3E63A 4O0WA 4IFCA 2W9ZB 4EHGA 2RFEA 4CG8A 2PUPA 4A9TA 2X7OA 4C58A 1YI3A 5J95A 3P08A 2CGVA 4XLIA 3ELJA 4O83A 4DF3A 3KN5A 4O7LA 2UUEA 4GIIA 2ESMA 4OTPA 3TNWA 3LAUA 4ANMA 3OG7A 4BDDA 5LVOA 4BY9E 2GCDA 1WCCA 3QAME 4YC6A 1B39A 3C51A 4LRJA 3UPXA 3KVXA 4BZOA 5EG3A 3KXZA 4TYHB 2JBOA 5JRSA 3W8LA 3MY0A 3RKBA 1FBNA 2JDTA 3NYOA 5L6OA 2R2PA 4S31A 3VS1A 3NAYA 3JUHA 3ZBXA 4FSMA 3ZO4A 5C26A 4G9RA 4QYHA 1JKTA 4O7ZA 2KULA 4HCUA 3EQPA 3W2PA 5HU3A 2IWIA 3HV3A 4FUXA 1Q8ZA 5J7HA 5DNRA 4J53A 4KNBA 4QP8A 4QMZA 4XJ0A 2YZAA 3KB7A 4M69B 5CASA 4F09A 4ZP5A 5CTPA 3V3VA 4PPAA 4Z7HA 4HNFA 4QP6A 3BYVA 4DG3E 3LE6A 4AN3A 3GP0A 4FEVA 4UMUA 1Q5KA 4USFA 3CKXA 2VTMA 3N4UA 1Z9XA 4BRXA 4FGRA 2V55A 2B1PA 2DWBA 3PWDA 4ACGA 3QRUA 4PMPA 4WSQA 1WBSA 4JI9A 3MTFA 3NLBA 4PDOA 4E5AX 4L7FA 3DNDA 3HA8A 1GZ8A 1PYXA 5AR2A 4EOMA 5F4NA 4MXCA 2C3KA 1JAMA 2G9XA 1F0QA 3IDCA 3OP5A 4X6RA 2G01A 2XK9A 5F95A 5DBXA 3SRVB 3PSBA 4AGCA 3NW6A 1NA7A 3F2NA 5EDPA 5C1QB 3DAJA 5HD7A 5FGKA 2BDJA 4JBVA 3D83A 2QR8A 4C33A 2VTOA 2ITOA 3R1SA 4YJQA 4LM5A 4EOJA 1IA8A 1OUYA 4K33A 5KX8A 4BI1A 2REIA 5C4LA 3ORIA 2IN6A 4RIXA 5CSXA 5CAOA 4R7BA 3UOLA 4MNEA 4BKZA 3RNIA 4FA2A 3D5VA 1SYKA 3CGFA 4EOIA 3BI6A 4I5MA 2B0QA 4KSQA 4XEYA 2F4JA 4BB4A 5AIRA 4AG8A 4PMMA 3KA0A 4QD6A 4MAOA 1J91A 3F9NA 4TKSA 5K9IA 4CLIA 1FGKA 4FV7A 3ULIA 2XIYA 1YHVA 1WVWA 4MCVA 2EXEA 4YTIA 4D5HA 3P0MA 3FQEA 3A8WA 4PQNA 3BBTB 3UG1A 3UPZA 4L52A 1PXIA 1YQJA 3WZJA 4HJOA 3IW5A 5E8TA 3ZRLA 5CF6A 5EHLA 3UMXA 2UZVA 4TNBA 3VIDA 2UW0A 3OS3A 1WAKA 5HNBA 1O6YA 1M2PA 4OTWA 4AFEA 1S9JA 2UZTA 4YO4A 5JRQA 4PP9A 3MFRA 3AC8A 5HG5A 5HIBA 2C3LA 1U5RA 3VUKA 4E6DA 2C3IB 2V5QA 4HVIA 1AQ1A 1TQMA 3PA3A 4JG6A 2E9OA 2O65A 2OJ9A 4ZZMA 5LWMA 3V5QA 4U81A 2YWPA 3AC3A 3VHKA 1VR2A 3W33A 4GVAA 5HLWA 2QI8A 3R7GA 4E93A 2LAVA 1UWJA 5KZ0A 1XH5A 3NUNA 3ZRMA 4CYJA 3ZUVA 2HWPA 2X1NA 1OIYA 4FSWA 4XNEA 3PRIA 3IQ7A 1OIUA 2YIWA 4MEDA 4DH8A 5CNOA 4I6QA 3P79A 1VEBA 3IKAA 5DRBA 1KE7A 4MD8E 1H07A 3VJNA 2XBAA 3ZCLA 3CPBA 4I92A 3P7BA 1UA2A 2XNMA 5EI8A 3WZUA 1UKHA 3PJCA 2PVKA 1WFCA 3C4XA 4ZSAA 3UE4A 2VWYA 3C4FA 4I6HA 2BRHA 4KBKA 3OD6X 4D1ZA 2R0IA 5LMKC 3H3CA 5ETFA 3ZFYA 3OROA 1M2RA 3GU6A 4FICA 4PWNA 3GC8A 3KGAA 4H36A 5E90A 2ITXA 1XBCA 2OKRA 2ZMDA 3RPRA 4EK8A 1YHWA 5LVMA 1UWHA 3POZA 4UXLA 4FTCA 1QMZA 4BF2A 4NJDA 1WBTA 1REKA 5A9UA 5I9YA 5K5XA 2YA9A 4JG8A 2CKQA 5IF1A 4E3CA 4KKEA 1MUOA 3Q60A 3UC3A 4BCOA 4EK3A 3U6IA 4UYNA 3OTVA 2IPXA 3IW8A 3Q5IA 4RIWB 4BCGA 4ZLYA 4NT4A 4YZBA 3VBYA 3ZSHA 2UZLA 1V0BA 4AFJA 3TIYA 3GCUA 5J9ZA 5AIKA 4IVDA 4AGWA 3ALOA 3MS9A 5CT0A 2VTNA 2XZSA 4N57A 1F5QA 2Z7LA 2WHBA 1GZOA 1I44A 2BAJA 2GQGA 3OWPA 3EZVA 4C02A 3QFVA 3VAPA 2WMQA 3GBZA 3T9TA 5KMOA 2J7TA 1Q62A 2WMSA 3R8VA 1OB3A 4G3FA 4Q5EA 3IW4A 2ITUA 4ZXTA 2QOBA 2VX3A 2EWAA 5EYMA 5AUVA 3K3IA 4EQMA 4FVQA 2W1HA 2O0UA 3BHUA 4KUJA 5IA3A 3DBEA 4XV9A 1M14A 3Q2JA 3F5GA 3ZYAA 4X2FA 2QOIA 3FQSA 3HEGA 3HRBA 3K54A 2R3OA 3ORMA 2C6OA 2W17A 4FKUA 4IE9A 3C5UA 2QU6A 3KRLA 2C5YA 5BVEA 4Q5HA 4EORA 4FL2A 1WBVA 1YVJA 3V6SA 4ID7A 2YERA 2ONLC 5FTOA 3FPMA 4F0IA 3FHRA 1YHSA 2BAQA 1O9UA 1J1BA 2XCKA 2VU3A 3A2CA 2UW9A 4AGUA 2HZ4A 2JGZA 3H9OA 4FKIA 4JIAA 3PJ8A 4NCTA 4AGDA 4WOVA 1GZKA 3I6WA 2Y0AA 4LYNA 4NUSA 5J8IA 5HBHA 4YMJA 3I5NA 1P14A 3QLGA 4NU1A 3GQLA 4G5JA 2Q0BA 3ET7A 4XG3A 5HI2A 4Z55A 5IKWA 3UNZA 5AR5A 4MD9E 2C6LA 5TT7A 4MNFA 2GNIA 3A4OX 3BIZA 4O0YA 3P4KA 5C8NA 5JFVA 2ITNA 4PL3A 2WNTA 3ZC6A 1GIIA 1LP4A 3L8SA 3ZLXA 4CLJA 3GENA 1OECA 3BYMA 3HRFA 2QOQA 4P5ZA 2B52A 4BCMA 2BVAA 4RZVA 1MQ4A 5B0XA 3DKGA 3RK5A 1DS5A 2QOCA 4N6YA 2FYSA 2C6IA 3DLSA 3QD4A 3FXZA 5E8XA 2VO0A 4B9DA 4TZRA 4FV8A 2X8IA 4QTBA 3DBQA 4QMQA 2V7AA 5C9CA 4BCNA 2UW4A 4NK9A 1H0WA 2JLDA 2QVSE 5D12A 3BEAA 4RX8A 5IEVA 3L8VA 3PJ1A 5E8WA 1KV2A 5FBNC 4RLLA 2PE2A 5GJFA 2CN8A 2F7XE 3IPHA 4C4JA 3MVMA 5EDRA 2V7OA 3QX2A 2G2IA 2R3MA 2Y9QA
chains in the Genus database with same CATH superfamily
3W10A 4W9XA 3AQVA 4KBCA 1H25A 3EYHA 4DITA 3W2SA 3DA6A 5JMSA 3W0OA 4E26A 1OKYA 3SA0A 4M14A 1PXKA 3HMNA 3QUPA 4JL9A 5AADA 4OBOA 4UZDA 1VJYA 2YM4A 3LFSA 3MVJA 4NH1A 4F7NA 2YHVA 2WAJA 3GC0A 2Z8CA 2Y6OA 1YXVA 4OTDA 4FYOA 3R7IA 3TWJA 2AUHA 3F3UA 3KMUA 4IC7A 4TWPA 3ZM4A 1YKRA 4EZ3A 1OL5A 4ANLA 4WUAA 2JC6A 2PUUA 4OT5A 4X2NA 4FC0A 5G1XA 2WTDA 4PPBA 3T8OA 4KIKA 5I3RA 4U3YA 2IZTA 3OWKA 2P2HA 2QOFA 2W1GA 3E62A 3AT3A 4IACA 3PUFC 2F9GA 2VTTA 3BE2A 4R5SA 4XCUA 2RSVA 4O21A 2C6EA 3OWLA 4MKCA 2WMVA 3B8RA 4O38A 4ZY6A 3RAHA 4C34A 1DAYA 3A60A 5GZAA 3D9VA 1AGWA 3WF9A 3WYYA 2PL0A 1M7QA 3VHEA 3UDBA 5A6OA 2WOUA 3VUGA 4GCJA 3Q4CA 4X2JA 4MWIA 5HIDA 3KMMA 5AR7A 4HPUE 4ZEGA 3PIZA 4Y73A 3WBLA 2A19B 4OTGA 4AE9A 1W0XC 3Q9YA 2O64A 2XNBA 3E7VA 2X4ZA 4XG2A 4BWPA 3N51A 5FXRA 5ANGA 2J9MA 5HQ0A 1OGYA 4JLCA 3U9NA 2VGPA 3LHJA 2A0CX 3FLZA 2X2MA 5B2MA 4WNKA 3AC1A 1IR3A 2P4IA 4HVDA 5L2TA 5HCYA 5L2WA 1ST0A 2OICA 3U9CA 5HE0A 3E88A 5CU2A 3WF6A 4W4WA 3FZPA 5FWKK 5TO8A 3NFFB 3QTZA 3CE3A 4FNWA 3C5IA 1ZAOA 4KINA 1YOMA 3PVBA 4IEBA 2W1IA 3Q5ZA 5ETAA 3NGAA 5AUTA 4DGMA 4Q9SA 5FUTA 4HGLA 4YP8A 3WILA 3G6GA 4UMQA 3MPMA 5AUXA 4DGNA 4K18A 2P0CA 2AQXA 3AC5A 2BRGA 4D4YA 3VBWA 5IISA 2BAKA 4NFNA 4CTBA 2O3PA 2Z7QA 4QYFA 4XP0A 3RPYA 3CTJA 1ZMVA 3ZXZA 5EQYA 3WE8A 5E8ZA 2BDWA 1B6CB 4IQ6A 5EKOA 3ACKA 3WF5A 3TDVA 3PZHA 5F94A 4FV5A 5M4IA 3VS3A 5TKDA 4DDGA 2OH4A 2W5BA 4RZWA 3HMPA 3L9NA 3QD2B 4CT2A 4DGLC 3M11A 4FNXA 4XLVA 5EW8A 3MESA 2C0IA 1UU7A 4GFOA 4O6EA 4BBFA 4QTEA 4AW2A 3TYKA 2CSNA 2YITA 2XM9A 2DUVA 3U51A 2BZJA 5EK7A 2X8DA 4U5JA 1YOLA 2JIIA 3SQQA 3UODA 4YTCA 2ZM3A 4CKIA 2R0UA 4DT9A 1PYEA 3CBLA 4ZTMA 2PULA 3PPZA 4Y5QA 4NTSA 4O0SA 3KRJA 4QT1A 4TWNA 3C0GA 3O50A 2YJSA 3ZLWA 3HAMA 2J0IA 2OK1A 3EQDA 2FSOX 3KEXA 5DG5A 3OUKA 3QL8A 3QD3A 3GC7A 3HV5A 4IH8A 4O4FA 2FH9A 3JYAA 3RCJA 4E6AA 4RIYB 5ETIA 3ZDIA 3BZ3A 4IX4A 5L8JA 2EXMA 3FBVA 3BV3A 2OI4X 2VTLA 3JR1A 3R30A 2Y8OA 2C30A 2XNPA 3H9RA 3NNVA 4RGJA 3RALA 4BN1A 4F63A 3AT2A 2IF8A 3JVRA 3A62A 3DFAA 3NUSA 5HICA 3VVHA 5M07A 2FSLX 4JRVA 4ZK5A 3ORKA 4YZ9A 3EQHA 2EUFB 4J8MA 1G8KA 4ZTNA 1T45A 4FTKA 2E9PA 3FYJX 4OLIA 4APCA 3BCEA 5A54A 3NVMB 4FKTA 3AOXA 3QWKA 3HP2A 4II5A 2WKMA 3I60A 1DI8A 5L8KA 1Q4LA 2X0GA 2W9FB 4FZAB 3UG2A 3FAAA 4AOIA 4E7WA 2JAMA 3S2PA 5A4EA 1QL6A 2WO6A 1RE8A 4H39A 3SG9A 4DBXA 3HVCA 2CKPA 3AXWA 3H0YA 3IDPA 1FVTA 1SMHA 4W4XA 2PTKA 4C4HA 1STCE 3Q9WA 3G0EA 4KS8A 5AP4A 4P90A 5FLFA 1XR1A 2OGVA 4I94A 5HHWA 3ZXTA 4CTCA 4CV9A 2GQRA 4I6LA 3N4TA 2Y4IB 3DK6A 1KOBA 1YXUA 5AP3A 3UIBA 4QDEA 2R3QA 3W0PA 2X39A 5DR2A 2XMYA 4RT7A 3D7TA 4JT3A 5FM3A 3QALE 4EJNA 4BL1A 5BVOA 2UVZA 5FTGA 3QRTA 4J71A 1H24A 5AV1A 2GNFA 5TF9A 1XH9A 3R8PA 5JKGA 5CXZA 4GEOA 4JBPA 4TL0A 4MBJA 2UW7A 2AC3A 3EOCA 4EOQA 2UVYA 3UDSA 4PRJA 3TV4A 4XG4A 1GY3A 1Y8YA 5IA4A 4C4EA 3FDNA 4CQEA 4ORKA 3O8TA 2X6EA 4ALUA 4BJJA 3FZSA 3R9DA 4FR4A 2YISA 3QCSA 3V5TA 4A9RA 3MDYA 4BDIA 1O6LA 4BKJA 4F1OA 4R78A 5HE1A 1XH7A 4FZ7A 4EHZA 4BKYA 4RC2A 4NIFA 2ZV9A 4AQKA 3B8QA 5JN2A 4X2KA 3QC4A 3D2KA 4TNDA 5D7VA 2PK9A 4U41A 3RK7A 1FVVA 3ODZX 3HP5A 1CSNA 4L44A 4QMYA 5LOHA 4R1YA 5HU9A 3MFUA 5K4IA 2NYAA 4I5HA 2ZB1A 3SHEA 4PNIA 4DHJA 2X7FA 2ZYBA 3R2BA 5HCZA 4K1BA 3G9LX 4RMZA 3TTIA 5CVGA 5J87A 3GVUA 1R78A 4YZCA 4QMUA 3UVQA 2GS7A 4ERKA 5AV3A 4DEGA 5HORA 4BIEA 4LOPA 4ONAA 3UP2A 2E9NA 2QD9A 5J7BA 2YIQA 4GV1A 5AP7A 5CAUA 4RWIA 2QQ7A 2Z7RA 2YFXA 3PE1A 3QTSA 4YSMA 3G6HA 3CY2A 4AA5A 5KBQA 4DH7A 3EN5A 3L9LA 2XK7A 4AXFA 4LV8A 5M57A 2BRNA 3Q4ZA 1ZLTA 4YBJA 4ASZA 2FVDA 4DEAA 2BMCA 5AUUA 5BYZA 3P5JC 3UIUA 4IM3A 3H10A 5DE2A 2QONA 2QO7A 4CMOA 5JEBA 4BGQA 2UVXA 1UNHA 3DS6A 2IVVA 3LCDA 4HGTA 2O5KA 3GOKA 3ZONA 3LMIA 4FTRA 2B9FA 2OW3A 2J0MB 4I0SA 1Q24A 4EKKA 3TUCA 4WBOA 2W1FA 4XV2A 1UNLA 4H3PA 1UV5A 3WARA 5AV2A 3PLSA 3A4PA 4BCJA 5FP5A 4KIPA 4UV0A 2BROA 1WVXA 2XF0A 4BDAA 4GK4A 4Y83A 1BKXA 3BHVA 5TR6A 1OBDA 3SXRA 2IZRA 4QP3A 5LMBA 3QBNA 4W8DA 5EM6A 4Z7GA 2I0EA 2PYWA 5AP1A 2UZUE 3GU8A 4BCQA 3C9WA 5DLSA 2ZV7A 5E8YA 4FEXA 3BKBA 3KXMA 2JKKA 3R02A 3V6RA 3QA0A 2PMLX 3EQGA 3HNGA 5CQWA 4DFYA 5CSVA 3OBJA 3IDBA 3R1NA 3HGKA 4F64A 3NCZA 1KWPA 3LIJA 5EW3A 4HGEA 2ITWA 3KY2A 3ITZA 2VNYA 4I23A 4HZSA 4D0WA 4O84A 3R9NA 3M2WA 4M0YA 4O7SA 4GH2A 1PXPA 4TN6A 5HKMA 4FT9A 4AAAA 4U80A 2JIVA 2WQMA 1FGIA 4TYGA 3U4WA 2C1AA 1U54A 3MY5A 3RM7A 5CSPA 2J51A 3PWYA 4UEUA 3NUXA 5J1WA 5I0BA 3K5VA 2DQ7X 1OM1A 1RQQA 4TYJA 4FIHA 4G3EA 4L7SA 5A4CA 1JKLA 4MQ1A 2OXYA 5EYDA 1JSTA 4QTAA 3RINA 3EWHA 2YLEA 5FRIA 4H1MA 4BZDA 3FMKA 3VO3A 5IEYA 3Q96A 2ITTA 4O0XA 1VYWA 2VWWA 3R21A 2WQEA 3UOHA 4HVHA 5CAQA 2X0PA 3PLAE 3BV2A 4PTGA 5ANKA 3QQHA 4LG4A 4ITJA 4YTHA 4QTCA 3EKKA 2PZ5A 4JDIA 4EUUA 3W2QA 1PXMA 2VNWA 4OT6A 2ZDUA 4FT5A 3MA3A 4XV1A 1OL7A 2IVTA 2RG5A 3FSFA 3R8MA 3FE3A 4D28A 3UYSA 4PP7A 3S1HA 2OWBA 2RF9A 4GW8A 3CKWA 4IB1A 4ZJIA 3NZ0A 4UMTA 3BU6A 3PY0A 1K9AA 1BL6A 4IBMA 4QMPA 3GI3A 3R1QA 2Z7SA 1IEPA 4GUEA 5HVJA 5HCXA 3D7ZA 3E7OA 4BC6A 3RAIA 4M8TA 5IUHA 2PVNA 4QTDA 3W55A 3R9RA 4HYIA 3WF8A 2WTJA 4GT4A 3FC2A 4RJ8A 1PXNA 4RQKA 2Y4IC 5LVPA 1BI8A 4NEUA 5CU0A 5L3AA 3MA6A 3FUPA 1YDRE 2QO2A 4FGBA 3OCTA 3TN8A 2NNWB 3R9OA 3QGWA 3VF8A 2UZOA 3MVLA 2W1EA 3EQIA 1H08A 4HCTA 3BE9A 2C5VA 3HUCA 4PY1A 3GNIB 3NCGA 2I0YA 3AMAA 4FIEA 4RLKA 3PG3A 3DXQA 2QLQA 1ZOGA 2WTCA 5EDQA 4M13A 4BDEA 2XYNA 5EFQA 3PXYA 1UKIA 4QMMA 4UB7A 4A06A 4IDVA 5CALA 4BDBA 4I21A 2F7EE 3NYXA 4FKPA 2ITQA 1BLXA 1PF8A 3LFQA 3QRJA 4ENYA 3BQCA 1PXOA 5E7RA 3ORXA 3EH9A 2VWIA 4QMOA 3PXQA 5JGAA 3S0OA 4TY1A 4IHPA 1PXLA 4NFMA 4B8LA 4BCFA 4EWHA 5FM2A 1W2FA 4CFMA 2YEXA 3C1XA 4NZWB 3F3ZA 4E6QA 5KMJA 2VZ6A 4EHVA 4F0FA 2PE0A 1SVEA 1B38A 3DU8A 4FTJA 5DEWA 4K2RA 4U44A 4ZSJA 4I20A 4RIXB 3F6XA 3PIXA 2X8EA 4BYJA 2V0DA 2O63A 3R22A 4RJ3A 3QTQA 3PXZA 5HVYA 2J6MA 4TYHA 5EOBA 3V51A 2C5NA 5GIPE 4IAYA 2W4OA 3LXNA 1G3NA 4E8AA 3ZZEA 4FOCA 1FVRA 5J9YA 5IQFA 2XEZA 4RA4A 5KZIA 3QTXA 2HW6A 3K3JA 2R3GA 2FUMA 2YCSA 5LARA 3VQUA 3QRKA 3AKKA 3CTHA 4L53A 3BGQA 3HRCA 1DAWA 2RL5A 3COHA 2C68A 3VS5A 1MP8A 4OAVB 5T6KA 4EI4A 3NFGB 3LJ0A 5AM7A 4FIJA 4YURA 2WMUA 3FYKX 3P7CA 4HNIA 2OZAA 3PDTA 2BRBA 3MFSA 2G2FA 2BFXA 2BTSA 2PZPA 3FMHA 4GK2A 4V05A 3HLLA 4NKAA 3FMDA 4XG7A 3RZFA 3KF7A 4G3DA 3NSZA 4IVBA 2X2KA 3CQEA 3HYHA 2XA4A 3MSSA 1ZMUA 2VTAA 4TTHB 5M51A 4F65A 1RJBA 4D1SA 4WRGA 4X3FC 2Y4PA 5TE0A 2RG6A 3FMMA 1TVOA 3W2OA 1OITA 3HA6A 2PMIA 5DFPA 3PE2A 4QDVA 4KBAA 3F69A 3VBQA 5JGDA 3CJGA 3QZGA 3RGFA 5AP0A 4O7VA 4NWMA 3FLQA 4ZLOA 3GFEA 4GFGA 4O0TA 5CZHA 2UZDA 2ACXA 3TZ8A 1J7LA 5I4NA 2OF4A 3NVKI 3HMMA 4AXAA 4DN5A 3A7GA 4CSVA 1SNXA 5E8SA 1CTPE 2HYYA 3HDNA 4ACDA 4YUQA 4O4DA 4QP9A 3NMUF 1UVRA 4APPA 3FZRA 3UNKA 1BL7A 2QOLA 4WNMA 2PMNX 4AA4A 2J50A 4ANOA 4L01A 4DGOA 4ZIMA 4D9UA 5I9WA 2YIYA 4OTIA 4J99A 5DN3A 1WMKA 2PZYA 1ZWSA 3LPBA 4ZMFA 2Z02A 4A4OA 2IVUA 4YR8A 1OKVA 1YI6A 3ENMA 3MN3A 3REPA 4B6LA 2DS1A 3S4QA 3RNYA 2QNJA 4JIKA 3DKCA 3PA5A 4E6CA 2R7BA 4GVJA 2EB2A 5DR6A 4RVLA 3ATSA 4L45A 5AR4A 2YWVA 4KKGA 3DJ5A 1JVPP 3VC4A 2I40A 3GFWA 5AJQA 3QZFA 3S95A 3IW6A 4BBEA 2XB7A 3DAEA 4YJTA 4CFWA 5M4CA 2R3FA 5ETCA 4GT3A 3BL9A 4E1ZA 3TMOA 5IQCA 2PUNA 3TNPC 2B55A 5CVHA 4YLLA 4ZJJA 1KV1A 2X9EA 2XK3A 2G2HA 4XP2A 4X0MA 5AAFA 1XKKA 4O27B 1W2CA 3BELA 5GHVA 2ZDTA 3LCTA 3QHWA 4U97A 5HESA 5M53A 2WGJA 3OC1A 3I0QA 4AT5A 3ZH8A 2OJGA 1HCLA 3ZEWA 1PRYA 3TM0A 3SAYA 1ZYJA 3Q4UA 5KMIA 4NL0A 4RJ4A 2F2CB 2JDOA 4LUEA 4QMWA 4QOXA 4EOOA 3NDMA 2HZ0A 3KRWA 3KCFA 2VRXA 4XP3A 2XP2A 4D2WA 4TRLA 4RSSA 4DEDA 4RFMA 4FBXA 1NXKA 1ATPE 4W4YA 4XV3A 4E73A 3B2TA 4GRBA 3FL5A 3GU4A 4NM0A 1H1PA 3OWJA 4D0XA 3DQWA 1SVHA 4FYNA 1U4DA 2QHNA 1OPLA 3L1SA 4R3PA 5DT0A 3W8QA 5H8GA 4EC8A 1MRYA 2WMBA 4PL5A 1ZYDA 1KE9A 2WTIA 3EL7A 1Q8WA 5FTQA 3TDWA 5HG9A 2OIBA 4D1XA 5JGBA 1QPEA 2GHMA 1E1XA 3R2YA 1ZYCA 4MXZA 5CVFA 4EK6A 4EH6A 5CEOA 5IQAA 2WB8A 3F3VA 4YSJA 4C8BA 2PVJA 3C13A 3R73A 4AZWA 3RCDA 4NTTA 2WELA 2BKZA 5DVRA 3ANQA 4IWQA 4OTHA 4QMVA 3LOKA 2XANA 5IU2A 4C35A 4KIQA 3UQCA 3DZQA 3V8SA 4ZSGA 3QTIA 3UO5A 2JIUA 2PZIA 4IX5A 2OXDA 4FTUA 4AXDA 2R3NA 2XYUA 4S33A 5I9ZA 2OJIA 3PPJA 2IZUA 3HV4A 1NVSA 2VV9A 3DK7A 3EQRA 5LJJA 3TV7A 3G5DA 5KCVA 2XH5A 2VWBA 2YM7A 1J3HA 1JSVA 2PVRA 4MXOA 5I9UA 2JDVA 3LFBA 4XHKB 3ULZA 1XO2B 1LR4A 4DH5A 4MHAA 5K5NA 1PMEA 4NM7A 4O4EA 4CV8A 4ERWA 2WZJA 3ALNA 1V0OA 3QQJA 3GC9A 2W5HA 4FKGA 5AAEA 3VUMA 3QX4A 1YDTE 2I1MA 2RKUA 2AC5A 3LCKA 3SC1A 5IDNA 3RJCA 3QXOA 4PF4A 4Y8DA 3H4JA 4U43A 4YTFA 4EZ7A 4FTIA 2CGXA 4M66A 2HIWA 2Z60A 3F3TA 3OCGA 3FMNA 4WRSA 3O23A 4JQEA 1LEWA 3UYTA 3EL8A 4EYMA 5A4LA 3THBA 4O2ZA 4RVTA 4C38A 3CSVA 5CX9A 4BI0A 2WEIA 4OBPA 3Q3BA 4PTEA 3VBVA 5IEXA 3ZUUA 3BGZA 3R8LA 2C3JA 3BBWA 3DTCA 4TPTA 4DH3A 1H01A 3DV3A 4IXPA 3W1FA 5IMXA 3HX4A 2J0LA 3PIYA 4PUZA 3F5PA 4QMLA 3KQ7A 4FKVA 5HX6A 4FSZA 1KE5A 3MW1A 4YJVA 5CF4A 2PVYA 4PNKA 1YXTA 3A7IA 3VS0A 4FZDB 2KTYA 1BX6A 1ZOEA 5FEEA 5AUZA 4J96A 5IQGA 4FX3A 2JEDA 4JBOA 3FZ1A 2B9HA 3CLYA 4CMTA 1OL2A 2VTPA 3QTWA 5DR9A 4B99A 2C6DA 4PX6A 2OIQA 4FOBA 3EKNA 4B0GA 2YIXA 4DH1A 3GCSA 3FY0A 5CXHA 4AX8A 5HTCA 4QPMA 3F7ZA 2BIKB 5A46A 5EKNA 5KO1A 4X6QC 2ETRA 4KIKB 2YABA 3D94A 2VWXA 2A27A 3ACJA 4J7BA 2OU7A 5DEYA 4FT3A 4QP2A 4HW7A 3IGGA 1YDSE 3R7VA 3VW6A 3OUNB 4IWDA 4F0GA 4AACA 1PHKA 3QXPA 3NUUA 5C8KA 3DJ7A 5BVFA 3QF9A 3R00A 2WMRA 5D11A 1UU9A 2VD5A 4I0TA 4IB3A 2C47A 4R8QA 5T68A 2P3GX 5CEMA 2WMTA 3MH3A 4NW6A 1R0PA 1URWA 4BI2A 2W96B 4AS0A 5LQFA 5L4QA 2GNGA 4FV3A 3FLWA 3CQWA 3I1AA 3P9JA 2HZIA 4AZFA 2XAOA 5CF5A 3ZC5A 2WU7A 4BWKA 3QA8A 3IECA 5HX8A 4ASDA 5IA5A 2GS2A 4D4SA 1ST4A 3RWPA 4MX9A 3PYYA 4RVMA 2BCJA 2JAVA 4FG7A 2C5XA 4C4IA 3KIOC 4Q9ZA 3LQ3A 4HPTE 3MPTA 1JNKA 3MIAA 5IUGA 5IQEA 1FMKA 2XUUA 1U46A 4IMYA 5BYYA 5HVKA 2PU8A 2GQSA 5L8LA 4DEBA 1LPUA 4O96A 1Q8YA 1Q97A 2P33A 4MTAA 1FMOE 3R8UA 1ZZ2A 1W8CA 2WPAA 1H27A 4UY9A 2B54A 4YHTA 3LMHA 4FODA 3GUBA 3OOGA 3LXKA 5J79A 4RWLA 4KABA 3MPAA 4JG7A 4C4GA 4K9YA 4ZAUA 4RJ7A 4RWJA 2X0QA 4OTQA 5BUIA 4FIGA 3BLHA 3TKIA 4YJNA 5IH4A 3LLAA 3GT8A 3AG9A 5M55A 5CI6A 2JKOA 3PSDA 2ITVA 4M84A 4PMTA 5AV0A 3UDTA 4G34A 1OKZA 1OZ1A 3ROYA 4IZ5A 3TTJA 4F1TA 2ZMCA 4TWOA 2P55A 3WZEA 2R3KA 5EI6A 4Y95A 4D2PA 3DZOA 4TW9A 2XALA 1GNGA 3HUBA 2H9VA 4Y85A 3NNUA 4BWXA 3E3BX 5BPYA 4L8MA 2IW9A 3DDQA 3KN6A 3VRYA 2ZOQA 4EH4A 3UJGA 3O96A 4L46A 1BMKA 4KAOA 4C3RA 2FSTX 4EH7A 5FEQA 5EM8A 4ITIA 4RPVA 3POOA 5L6WL 2C5OA 4XUFA 2X6DA 2UZWE 3VF9A 3FEGA 1URCA 2BALA 3FKNA 4U79A 3EMGA 3MBLA 4ZS0A 4CCBA 4O7TA 3O71A 4FG8A 4UMRA 3A7HA 3LFEA 4J97A 4EYJA 5H9BA 5CENA 2X7GA 4ANNA 2JITA 3CQUA 4OUCA 4XOZA 4AT4A 3F7WA 5CWZA 4O7YA 5F1ZA 4BR3A 4EH3A 3EYGA 1XH8A 3CIKA 4N70A 5D7AA 4BDHA 1W84A 4C61A 3NW7A 4F9CA 3EN6A 3O51A 4DFZE 4L00A 5F9EA 3FMEA 5LCJA 3I79A 1A06A 3C0HA 5DPVA 2HOGA 4GSBA 5EYCA 4Z3VA 2XK8A 4ZSLA 5J5SA 4CG9A 4LL0A 4BTKA 2PHKA 5KBRA 5BUEA 2ETMA 5E91A 4DLJA 1OBGA 1Y6AA 4E5BA 3CS9A 2ZVAA 4FNZA 4MQ2A 4FKSA 4MBIA 3WZKA 3P86A 4FT0A 3TIZA 4MXAA 4E5WA 3AD6A 1T46A 4NW5A 5H2UA 5AUWA 4BTMA 2XNGA 5E1EA 3VS6A 4CRSA 5L2IA 2QKRA 4QYYA 3QCYA 3C4WA 5CSHA 4O7NA 1DM2A 2IO6A 5JH6A 2BFYA 3E92A 3QLFA 4CZUA 3RHXA 4XRLA 3HMOA 1XHAA 4D55A 2PVHA 4B4LA 3F82A 1OIRA 2H8HA 5IA2A 4PDYA 1U59A 2NP8A 2WIPA 3MB6A 5FD2A 3VS7A 3ATTA 5K4JA 4AZTA 1ZOHA 3JY9A 2YLFA 4ZSEA 3C4EA 3GGFA 3LJ2A 1PJKA 1KE8A 4FV4A 4YNOA 2PUIA 5CF8A 3Q53A 2GNLA 3QKKA 3B2WA 4RIYA 3FLNC 2JFMA 2I0HA 2OF2A 3BPRA 4MH7A 2UW6A 3PXFA 5LVNA 3CGOA 4G5PA 4IAZA 3NUPA 2WTWA 4JDKA 4TYEA 3PA4A 3VNTA 3L9MA 5CYIA 2C0TA 3BLRA 4XBUA 5E8UA 4BJJB 3K5UA 5FXQA 3TKHA 2BZIB 3FSKA 2VWVA 2QCSA 4WG3A 3W0MA 5GZ8A 4JAJA 4S2ZA 1ZRZA 3G90X 4XMOA 3BGPA 4OW8A 4NIFB 5E8VA 3JY0A 1NVRA 4X7QA 4AWIA 3UGCA 1Q8UA 4NYEA 2J0KA 3MB7A 5B2KA 2XIKA 4U3ZA 4ZTRA 3KXHA 4JR3A 3DBFA 4AU8A 2VN9A 2GFCA 4C2VA 2PSQA 3UNJA 3UOKA 4IX6A 3NIEA 4BZNA 4I5CA 4MK0A 1ZZLA 2QR7A 2HY81 2W4KA 2XIZA 3G33A 3MTLA 3QQKA 2WMAA 3O7LB 4HCVA 1XH4A 4LMNA 5JSMA 3SW4A 4JX3A 4YZMA 4JS8A 2ETKA 1ZMWA 4OTRA 4QNYA 2JDRA 2OO8X 2XKEA 3PRFA 4MBLA 3VQHA 5HIEA 5ICPA 3NUAA 4RWKA 1ZYSA 1R0EA 5DT3A 1ZARA 4G6OA 4L3LA 1H0VA 4U8ZA 5BNJA 3SXSA 4A7CA 4FIFA 1LEZA 4F08A 4Z9LA 4RVKA 4E4LA 4I6FA 4YBKA 3EFKA 1JKSA 2QHMA 4O1OA 5BMMA 2BILB 1K3AA 3MH1A 4EQCA 5KMLA 4GMYA 4JOAA 2CJMA 2UZNA 5AV4A 4GG7A 3Q9ZA 2NPQA 3DCVA 1Y57A 2R9SA 5C03A 3OT8A 3HAVA 1OMWA 2OJFE 3CY3A 4BVUA 3PVUA 5AWMA 4UMPA 3Q4TA 3PPKA 1KUTA 1OL1A 4M0ZA 5CEKA 4LL5A 2XARA 2V22A 4FKRA 1Q3DA 3OW3A 3UQFA 3MH0A 4BFMA 3DBCA 5IG1A 4FV1A 1WBWA 4EOKA 1P4OA 3MGYA 4FF8A 4U45A 2X81A 2CGWA 4BIDA 5CNNA 4BTJA 2XRWA 3QC9A 5HE3A 5ITAA 2HW7A 4RFZA 4UWYA 3FKOA 4IW0A 1V0PA 2CNQA 1ZYLA 4EOLA 3Q32A 4BGHA 4ZTLA 2VUWA 3S3IA 1FINA 2C6MA 1H26A 2GMXA 3KRXA 3QWJA 2ZV8A 4A9SA 1J7IA 1QPCA 4EZ5A 2BTRA 3H30A 3Q9XA 5D41A 5JQ5A 4PL4A 3BEGA 5AFVA 4JAIA 5HO6A 3ORPA 2V62A 3BYOA 4ITHA 3FI3A 1Z57A 5E92A 4ZZOA 3I81A 4F9BA 4IDTA 3COIA 2BZKB 2JDSA 2CCIA 3FXWA 4DG0E 1Z5MA 3ZEPA 1A48A 4G2FA 2VO7A 3V5LA 3MH2A 4C3PA 4YU2A 5EQEA 3M1SA 2QO9A 3NAXA 2WFYA 4KS7A 1SZMA 3ERKA 3NNWA 4GT5A 4U0IA 5DGZA 4ASXA 4AZSA 4QQJA 2B53A 1GAGA 2GNJA 4EH8A 3VJOA 3SX9A 4EBWA 1U54B 4O81A 1PKDA 5EW9A 3CC6A 2GNHA 4H58A 4CMUA 4FSQA 3HECA 4J98A 1Y91A 2ZM1A 3ORTA 3CXWA 3FPQA 3KF4A 1CMKE 1OIQA 2RFDA 4FV2A 2PWLA 5EQPA 3KULA 4FKJA 2UW5A 2BHEA 3C7QA 4X3FA 2GFSA 4LQMA 5L6PA 1Y6BA 3QYZA 4PPCA 4CZYB 3E8EA 3ZO1A 2OIDA 4DG2E 3WE4A 1P4FA 3JS2A 2XBJA 3NS9A 1PY5A 5CLPA 3U8WA 5A4QA 4CFUA 4QO9A 2PVMA 3H0ZA 5M08A 4GJ2A 4IJ9A 5HD4A 2E2BA 3IOPA 3PUPA 4WUNA 3QRIA 4FTTA 5LMAA 3BYSA 4CVAA 2ITYA 3RAKA 4XS2A 5CEQA 2X0OA 2JFLA 3LCSA 4DTBA 1GIHA 4MWHA 2QKWB 4EONA 1TFFA 5L2QA 1YW2A 4KSPA 4F9YA 4IM2A 2XJ2A 5JK3A 4D4VA 3NYVA 3RI1A 2BIYA 3CP9A 4IZ7A 2CHLA 3I4BA 4V0GA 4O86A 4CYIA 4DFNA 2HAKA 3DBDA 5CANA 2R5TA 2VX0A 3FI2A 3DOGA 1QCFA 5CQUA 2XJ0A 4O4BB 5LVLA 1R1WA 4NM3A 5AAGA 1MRUA 5CY3A 4QYGA 3ORZA 2IW8A 2CCHA 2OFUA 4BDGA