1YDSE

Structure of camp-dependent protein kinase, alpha-catalytic subunit in complex with h8 protein kinase inhibitor [n-(2-methylamino)ethyl]-5-isoquinolinesulfonamide
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
336
structure length
334
Chain Sequence
VKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKDGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of catalytic subunit of cAMP-dependent protein kinase in complex with isoquinolinesulfonyl protein kinase inhibitors H7, H8, and H89. Structural implications for selectivity.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase/transferase inhibitor
molecule keywords C-AMP-DEPENDENT PROTEIN KINASE
total genus 109
structure length 334
sequence length 336
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 1996-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1ydsE01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1ydsE02
5K3YA 4C58A 4E6AA 4ERWA 1GAGA 2B53A 4DG0E 2BHHA 2WKMA 4CG8A 3GC0A 3OEZA 3SGCA 4BDCA 2O64A 4MNEA 4IW0A 5FEEA 1GZNA 5DR2A 3VF9A 1CDKA 4TWOA 2X8DA 3WOWA 5HGIA 4WG4A 5EFQA 3LXNA 1P5EA 2XNPA 4JIAA 2X9EA 3ANRA 3BV3A 4HNFA 3A7IA 5DA3A 2GNFA 1ATPE 3FSFA 4CV9A 4J7BA 3LLTA 3PG1A 2X1NA 4FV5A 2Q83A 4FV1A 4A06A 3GU6A 4RA4A 2VTHA 1WFCA 3P7BA 5LMKA 3FKOA 2ITNA 2YDJA 4A4LA 3M42A 4XS2A 2OIQA 2W1CA 3FXWA 3OEFX 3QZHA 4PDSA 2WMWA 4JRNA 2WTVA 4WG5A 3WZUA 3LCSA 3SX9A 1LP4A 3G90X 4CT1A 3G51A 4XV2A 3QTQA 2XK6A 4C62A 4R5SA 3WZKA 5DPVA 5AR7A 3NR9A 2Z7QA 2PMNX 4WRGA 1PHKA 5JK3A 2BFYA 4F9WA 5E7RA 4MAOA 2VTSA 4X21A 2BFXA 2C5OA 4D28A 2QLQA 4WA9A 4AN3A 2VTOA 4ANMA 1SVEA 3RWQA 3L8VA 4BZNA 1Y8YA 4QMXA 5E8XA 4E5WA 3GCPA 4MD8E 2QOHA 4MH7A 5IDNA 2PUNA 5HVYA 2CCHA 3QYWA 5HE3A 4FGRA 3IQ7A 2XK7A 4IZAA 2NNWB 3HKOA 3IS5A 3AD4A 5IISA 4QPSA 1WCCA 2XKFA 2PVRA 2BKZA 2JGZA 3KMUA 2OK1A 1KE5A 3NWWA 4EH3A 1ZMVA 3AG9A 3NNXA 2VNWA 2B9HA 3MA6A 2Z7SA 2Z7RA 2RFEA 3MTFA 2X8EA 2JD5A 3BYUA 4FKRA 4C36A 4AS0A 4XLIA 5HE0A 2QU6A 3QYZA 4FSZA 3OY1A 2HXLA 1PMVA 4J71A 4JBQA 3QX2A 5FBOA 2XK3A 4MXYA 4D1XA 2V62A 5IPJA 3UQFA 1JKLA 3CXWA 3B2TA 5A54A 4DAWA 2HELA 5DNRA 5GINE 4GL9A 5CEOA 4YTFA 4FIEA 3F88A 4LOOA 4CXAA 3DXPA 4IZYA 1Q41A 1XH8A 2JIIA 4PV0A 5TKDA 2UZBA 3GNIB 4R3RA 3N4TA 4D4VA 5AX3A 4D5KA 2ITOA 5J87A 2YA9A 3EL7A 4NJ3A 2CLQA 4U7ZA 2ETRA 1OL6A 2V0DA 2BALA 4D0WA 2I1MA 2OICA 3C0GA 5AUWA 2JLDA 3TKIA 4CLJA 4FICA 4L46A 3FLSA 3THBA 3W1FA 1J7IA 3LQ3A 5GNKA 3HDMA 3RPRA 3TACA 5HNBA 3VULA 4L53A 3EJ1A 4XBRA 4E93A 1FVRA 4PX6A 2VTLA 1VZOA 3BU6A 4D58A 3U8WA 4BBEA 1B39A 3TJDA 3C4FA 4F6WA 2BTSA 4XP2A 1NA7A 4GYGA 2A27A 3P7AA 3RCJA 4FG8A 1IA9A 2B52A 3LCTA 4IFCA 3O0GA 4J98A 3IPHA 1PXLA 3R7YA 2OLCA 3G15A 3F2NA 3V5LA 3ZLWA 3O8PA 4TNBA 4IAFA 2GFCA 4AG8A 3GXLA 1YOJA 2G2HA 3PXFA 4EOOA 3PSDA 4BDFA 2A2AA 3NUSA 3GGFA 3T9TA 3ZEPA 5AP7A 2CKOA 3BRBA 5HTIA 2PY3A 3AT2A 3PFQA 3FC1X 3N51A 4B8MA 5IA2A 4S34A 1OUYA 5K0KA 1ZY4A 2F2CB 4ITHA 4I4FA 3RPVA 4GG5A 5HOAA 4PPBA 3LCOA 5A46A 4ID7A 2HY81 1IASA 2YACA 2HYYA 3ZMMA 3PWDA 3HGKA 5GJGA 2ITZA 2JAMA 3G33A 2WMUA 4ZZNA 1KOAA 3HP2A 5IEYA 5HBHA 2AC5A 1OITA 3DBDA 4UMTA 2E9OA 3DPKA 3UZPA 1IAHA 5AP1A 3AT4A 3H30A 4YJQA 2C0IA 4D2VA 5FTOA 5LVMA 4KABA 2RG6A 3G9LX 1STCE 5IUGA 4FTUA 3UYSA 4HJOA 5GJFA 3GCSA 3QTRA 4FEWA 3QRIA 2FSTX 1P4OA 3E3BX 4EOQA 3CGOA 5HU3A 3C4XA 2C69A 3A60A 5J79A 3COIA 5HBJA 4D1ZA 2WIPA 3O8TA 4U5JA 1WBOA 3TWJA 5JGBA 3T8OA 3QA0A 3MA3A 3R01A 5IA5A 4DLIA 1GIJA 2W5AA 4GK4A 1E1VA 3ZO1A 4ANBA 4C8BA 1PXKA 2DQ7X 3NYVA 4Q5EA 5HG5A 3ZC5A 4AW0A 3OD6X 4EOIA 5D1JA 5LVNA 5LJJA 1PXOA 4FKUA 2ITXA 3TIZA 3FKLA 4A07A 4O7TA 3A7JA 1YI6A 4FSNA 2YCSA 4RFZA 4USDA 1R0EA 2YERA 5CEQA 4C4FA 3DK3A 4EH2A 2HY0A 1OKYA 2JAVA 2NPQA 5CQUA 4Z55A 2UZWE 4M67A 4U45A 2IN6A 3BKBA 5IH6A 5HG9A 2WPAA 3WZDA 1SNUA 2OWBA 3ZSGA 3KULB 3PE1A 1HCKA 1Q99A 5IQEA 4ZOGA 4DFYA 3BE2A 4UZDA 5HZNA 2GCDA 2XK8A 2YJRA 5EW8A 3CBLA 4CMOA 2OFVA 4B9DA 4PP9A 2GHGA 3PSBA 4YJSA 4IVAA 4S30A 3JVRA 3QCXA 4NM5A 2XEZA 1PW2A 2H6DA 4YJRA 3NS9A 4PNIA 4BCGA 4DTAA 5HIDA 3SLSA 2QOOA 3GU8A 4FKPA 5TF9A 2QC6A 2X39A 3ZXZA 4I5PA 2C5VA 3FZTA 1DM2A 2JKKA 3BGQA 4M8TA 5IZFA 3WE4A 3SG9A 2XNGA 3DBEA 4MX9A 3UMWA 2VO0A 2X6EA 4F63A 3FI4A 5DT3A 3PJ1A 4HCTA 4PUZA 3FPQA 2OH4A 3H9FA 3HRFA 4BB4A 2C6EA 4LMUA 2XB7A 4NM0A 4E4NA 3R9HA 4X2NA 3I81A 2B4SB 2R3KA 2J51A 3DK7A 1RDQE 1XKKA 1PKDA 4L3JA 3NNWA 2C5YA 2G15A 5DN3A 4ALUA 3C50A 2Q0BA 4GV1A 1T46A 1J7UA 3ZDIA 4I41A 4G9CA 1PXJA 2XKEA 3GQLA 2VRXA 4D9UA 3ZUUA 3O96A 2WD1A 1JLUE 4LOQA 5LWNA 3QCYA 5JFXA 4MKCA 2WMVA 4AA5A 4RQVA 4CKIA 3KCKA 3QLGA 3LJ2A 3CTQA 2WTKB 3OP5A 3VS4A 4C0TA 4EZ3A 1FVTA 2W4JA 1Y6AA 3R7EA 2JFLA 3SAYA 4OTDA 4Y5HA 4YJPA 4USFA 2GS7A 4OAVB 1XBAA 2B55A 3C0IA 4NK9A 4ZTLA 3RK5A 3RM6A 3WZJA 3R9OA 2PE2A 5EM6A 4IC7A 1O6YA 3BHHA 2I0HA 1CSNA 3F2RA 3SHEA 4M12A 5AR8A 1F0QA 4F1MA 4BN1A 2GNHA 3QRUA 1OL1A 3QXOA 4R5YA 2OSCA 4PMMA 1XJDA 3VC4A 2WOUA 4A9SA 2NRUA 1XH6A 3RK7A 4AE9A 2OU7A 3CCNA 5BUEA 3RAHA 5AEPA 4EONA 3Q6WA 3HUCA 4QQTA 4U3YA 2YDKA 1GIIA 2XCHA 4YJNA 3QL8A 5CI7A 3BWJA 3OCGA 4MQ2A 4N6ZA 1WBSA 5EDRA 2QR8A 2R3QA 4IM0A 4I22A 3U9CA 2Y7JA 1UWHA 3I0QA 3W2QA 2OXXA 1UKIA 4FODA 3DV3A 1ZMUA 2XNOA 3MIAA 3AXWA 2OJFE 3GP0A 4NTTA 5A3XA 5IQBA 4BRXA 3MY1A 5F4NA 3DKOA 5AWMA 4XG4A 5AIKA 4ZTQA 4C7TA 3DZOA 4FVPA 1M7QA 4Q9ZA 3TNQB 1M17A 1BL7A 5AA8A 2BAKA 5L2WA 1GJOA 2H8HA 2WAJA 4GW8A 4G2FA 4CD0A 4E4MA 1BUHA 2IW6A 4BCOA 3CKXA 4JDHA 3EFWA 1ZMWA 4EOPA 4U8ZA 3QTZA 3V3VA 5EYKA 2HOGA 2OW3A 4F0GA 4ZAUA 4ZEGA 3NCZA 2J2IB 2PVLA 3E8CA 4O27B 5IU2A 2PMOX 2RL5A 5DYJA 4J99A 4QMPA 3OY3A 3M11A 2YM4A 4JDIA 3ACKA 4C3RA 5J7BA 4RIOA 3AMBA 1V0PA 3EKKA 2ITVA 4GJ3A 1YI3A 3EFLA 2JBPA 2X6DA 4JS8A 5FDPA 1OIUA 2PU8A 3TTIA 2VGOA 4XG9A 2PVJA 2G01A 5FEDA 5TR6A 4R8QA 4RZVA 4UWBA 2OXYA 4CFWA 4CFVA 3SXFA 4QMTA 4FKIA 4DGMA 3R1YA 4M97A 4XG3A 2UZOA 3HA8A 1H08A 4BYJA 3LXKA 5KBQA 2PL0A 4JG6A 3UODA 4PMTA 2GHLA 3BGZA 2B9FA 4OUCA 4JL9A 3D5XA 4O7ZA 2BZIB 3WE8A 5L2TA 4XG8A 5AP3A 5CYIA 4RX8A 3RP9A 2ONLC 4JI9A 3PVGA 4U42A 2WMRA 4ZSLA 3RKBA 3A99A 4U44A 4QMSA 4XYFA 5BQ0A 3KRJA 4PL5A 2QOFA 4GYIA 3HX4A 3LFCA 5L8LA 3TUBA 2J0KA 3G6GA 5B0XA 1OKZA 5B7VA 4N57A 3RNYA 1WVXA 4O84A 3C5IA 4DFBA 3CR0A 4EHGA 4CTCA 5DIAA 3UNJA 3AC5A 3GT8A 4XX9A 5J5SA 4KKGA 4CRLA 3MB6A 4YPSA 4MTAA 4EK6A 2UW7A 3HLLA 2Z8CA 3BU5A 2BZKB 1K2PA 1QPJA 1XR1A 3AC2A 4JQ7A 4H1JA 3SXRA 1ZWSA 3OTVA 3HRCA 4FV0A 3G0EA 3RZFA 3D9VA 3KULA 3HUBA 5J5TA 2GU8A 3R9DA 4E1ZA 3HECA 2WQOA 4WBOA 1H0WA 4OT5A 4RWLA 4U81A 4X2FA 5H3QA 4CSVA 3AMYA 3HMMA 3FY2A 4MEDA 1RE8A 2G9XA 5M08A 2FGIA 2ZAZA 1J1BA 2VZ6A 2PVMA 5LXMA 2XMYA 3ZZEA 4YMJA 2RG5A 4GKHA 4GT4A 3R7UA 2RFDA 3BE9A 3OHTA 4I0RA 5HORA 2Y4IC 2J5EA 3AD6A 2VWYA 2YITA 3G9NA 3R2BA 4DEEA 5CXZA 3TNPC 2QHMA 1M7NA 1Q61A 5CALA 4PL3A 4WG3A 3QXPA 2I6LA 3QQHA 5AV2A 4EUUA 3PIXA 5L3AA 3CJGA 5HQ0A 5JSMA 3QA8A 4YZCA 2QHNA 5CWZA 3VRZA 2QODA 1FBNA 4BDAA 4IDVA 2PE1A 4CGAA 1S9IA 4UALA 5LQFA 4BF2A 5L2SA 5H8EA 3SV0A 5IA4A 3BQCA 3DFAA 4U80A 4PTCA 3PXQA 4MK0A 4RVMA 4OTGA 2PZ5A 4DEDA 2DS1A 4BKJA 1F3MC 3CC6A 4ANNA 3KRXA 3QGWA 5IUHA 1J1CA 1ZY5A 4IACA 2YIXA 4PL4A 5KZ0A 3DZQA 3WARA 4FKWA 5CT7A 1IAJA 2CNQA 4FTMA 1OM1A 4I5HA 4K11A 3ORIA 2HK5A 4FIFA 3UDBA 3MSSA 3TEIA 4CFUA 3AC4A 2X9FA 4BTJA 2C6MA 4EORA 4C57A 1G8AA 4M66A 3ZRLA 2IVSA 1NW1A 4BTKA 1W83A 3EQDA 1MP8A 5DEWA 4GJ2A 4A9TA 2QI8A 4XUFA 4EL9A 4EYJA 2IG7A 3GC8A 4D55A 2B9IA 4FNXA 4L44A 5HCXA 4IFGA 3RHXA 4C37A 4BWPA 3SOAA 5ETCA 2O5KA 3CKWA 3VIDA 3IW5A 4Y72A 4C4GA 2F7XE 1WVWA 3LZBA 4FSMA 5ANJA 1R0PA 5EKOA 2VWBA 4ITIA 2WTJA 4P90A 2FSMX 4HYIA 4BYIA 4CT2A 4KINA 4F1TA 4I3ZA 2WNTA 2C6IA 1H26A 2HZIA 4QNAA 3ROCA 3R30A 1RW8A 3QC4A 2ZMCA 3NSZA 3WF9A 2R3GA 4ZY4A 2R7BA 3W32A 3EN6A 3VUDA 2PSQA 2CSNA 4U0IA 5EH0A 3U87A 3QRTA 4G3DA 1YWRA 4X6RA 2O8YA 4EBVA 4YJTA 2Y8OA 3B8RA 3H9RA 2W96B 4NSTA 4ASEA 4C3FA 4CYJA 2W1FA 4YTCA 4R7HA 1OIRA 3VO3A 3DBFA 4GKIA 3TN8A 2QONA 3H10A 3K54A 3ETAA 1ZARA 1FPUA 1J7LA 2QOCA 4GU9A 4FKTA 4IZ7A 2V55A 3V01A 4ZXTA 3WIGA 4QTEA 4HGSA 3MYGA 4Z7HA 4FSQA 2R5TA 3VBQA 5E8ZA 5AUXA 5ANIA 4D2WA 5HTCA 3OCBA 1ZLTA 4M7IA 4IWPA 3PIYA 5M56A 3ZSHA 5F94A 2IVTA 1WAKA 2YFXA 4R1VA 4TTHB 5DHJA 3UZTA 2C6OA 5HI2A 5CTPA 4D2SA 3NUUA 5IH5A 2PMIA 3FLWA 2F2UA 3QTUA 4KNBA 4F9CA 4G9RA 1YDSE 5CAQA 2WMTA 3QALE 1IRKA 4RA5A 5GHVA 2WQNA 4D2RA 4ZMEA 4O0YA 2WGJA 3PA3A 3FZ1A 3BHVA 3BHYA 1OKWA 2C3JA 3TDVA 4EOLA 5B2LA 4UYAA 3PZEA 3UBDA 4EK3A 2QURA 3WZEA 5C8MA 2WTWA 4LRJA 5CU3A 3MVJA 4J97A 3R71A 3U6IA 2NRYA 5I9VA 1I44A 2ITTA 1YXXA 3CQEA 4FSUA 4L67A 1Y8GA 2OZOA 4ANLA 1M52A 1Q4LA 3W55A 3ZU7A 5CVGA 2VD5A 3QTSA 4NH1A 1JAMA 2WMXA 4QMQA 1SNXA 2VTJA 4FTOA 4FTQA 4EH5A 2I0VA 5IMEA 4CLIA 5FXSA 2CN5A 3BLRA 4I24A 4ALVA 3M1SA 5HE1A 3LFEA 3OWPA 1BX6A 3OBJA 4RIXB 4O7VA 3FE3A 5FP5A 3ZSIA 5HU9A 3RBWA 4LYNA 3L8SA 3TUDA 2XM8A 5HNGA 3ZXTA 4FZAB 2QVSE 2ONLA 4TWNA 2YAKA 3I7BA 4YNOA 3ORTA 4I21A 4YLKA 2IZUA 4PF4A 4LUEA 3GUBA 4CZUA 4XG6A 3OOMA 1QPEA 1YDTE 3FHIA 3II5A 5TE0A 4CCUA 4IVCA 2AUHA 3OXIA 5IA0A 3EQCA 4RFMA 4ZY5A 1NXKA 4ERKA 3SRVB 4DN5A 3RNIA 4I4EA 3I6UA 4RJ4A 5E91A 4J8MA 4PNKA 3RTPA 2UW3A 2WOTA 5DEYA 3H4JA 4KIKA 4BHZA 3BLHA 2C0OA 3U54A 2V5QA 4NIFA 4G5JA 3DAKA 3KRRA 2EU9A 2FYSA 3AC1A 3DB8A 3OXZA 3D15A 4DH5A 3F5PA 4F09A 5I9ZA 4G17A 4DHFA 3HV5A 2I7QA 1FMKA 2F7EE 4FEXA 4C3PA 3B8QA 2Y6OA 4ZLZA 3FV8A 3ORZA 1Y6BA 2X7OA 3KU2A 4HPUE 4EH7A 5A14A 4S31A 1MRVA 4FSYA 4APPA 1OMWA 5I0BA 3GFWA 3CJFA 3MVHA 3AMAA 5ANKA 4MVFA 2GNGA 2HWOA 3RAKA 4EOSA 5E8VA 1LPUA 4LRKA 4WUNA 3NUAA 4WRSA 2OIBA 2VWIA 5JGAA 2CGXA 3LW0A 4XP0A 2ZB1A 3LMGA 3TUCA 3IGOA 4DEHA 3CY3A 4CQGA 4ZTRA 4CFMA 3MH2A 4DEBA 4FTKA 3MS9A 4IAZA 4OTPA 4C38A 3VUKA 2C3IB 2IZRA 1ZAOA 3NEWA 4I0SA 5E90A 4TRLA 3RVGA 5B2MA 4IADA 3BU3A 4AA4A 2CDZA 4O1PA 1GIHA 3HEGA 3KMWA 3NNUA 5FBNC 4V0GB 1SZMA 2EVAA 3F9NA 2GNLA 3HP5A 4FTJA 3DAJA 1Q24A 3EB0A 3MI9A 4P7EA 3ELJA 3V5PA 4BVUA 4F99A 1VEBA 3FMEA 1XH4A 4D1SA 4GSBA 2ERKA 5T3QA 4HVGA 3N9XA 5A6NA 4DCAA 3QGYA 4F6SA 3CTJA 2BR1A 2YABA 4FV2A 3JPVA 5M09A 4DT8A 4UWCA 4MCVA 4QOXA 4USEA 4KSQA 4QMNA 2QO7A 2ZOQA 2RF9A 3ORKA 3ZM4A 3AC8A 3LFAA 5L2IA 1PMNA 2J0IA 5DH3A 5EM5A 5TOZA 5HVKA 4I23A 2PK9A 4BCHA 4YZDA 3QKMA 3PJ8A 4XLVA 3MJ1A 1R3CA 1XH7A 4IMYA 2A0CX 3DB6A 4F9YA 5FM3A 2YWVA 2CNUA 1TVOA 5CENA 4MWHA 4JBPA 4AZFA 3DY7A 2GS2A 4G1WA 2UZVA 2YLEA 3E63A 4NT4A 4EJNA 5AR4A 3IO7A 4OT6A 3E87A 3ZEWA 1DS5A 1B6CB 4CV8A 4F9BA 4BCIA 1R78A 4LQMA 1OB3A 2W4KA 3FY0A 1PMEA 4LI5A 2RFSA 2V7AA 4F7NA 4QMZA 4AP7A 4O7SA 4W4VA 3D0EA 5HO6A 5EOLA 1IR3A 2GTNA 2J0MB 1YKRA 3VS6A 3O8UA 3PXZA 2J6MA 4E4LA 4EWHA 5LWMA 2VWWA 4FK6A 2FSLX 5LCJA 5F20A 3R04A 4PRJA 3R8MA 3UC4A 1VR2A 2JDRA 3PY1A 5J1VA 4O83A 1REKA 3R6XA 1MRUA 2QNJA 3OCSA 5AP4A 5FEQA 2Y4PA 3SW4A 2HXQA 5BUJA 3FQHA 1GZKA 3EH9A 2BDFA 3MPTA 3R2YA 2CGVA 2W99B 4M3QA 4WNKA 3RPYA 2GSFA 3JXWA 4AAAA 1DAYA 2OI4X 2VWVA 3CS9A 3NYOA 3FMKA 4IM3A 4V05A 3ZOSA 3WYXA 3PUPA 5IG1A 1GNGA 2JKMA 1DI8A 1H4LA 1OL5A 2HZ0A 5IQFA 4BZOA 4NCTA 4Y46A 1ZYJA 2JKQA 3PIZA 3PP1A 1ZRZA 3QAME 4XEYA 2QR7A 3IW4A 3PJ2A 3NW7A 4G3FA 1YWNA 2VTTA 5A4TA 2QD9A 3SVVA 3QQLA 2C30A 3UQCA 5FLFA 3K5UA 2WB8A 4AOTA 1SMHA 1NVRA 1AD5A 2QO2A 3TNIA 5L6PA 2ZM1A 3BYMA 5M53A 2RIOA 1LUFA 3KB7A 4X0MA 3P0MA 3TV7A 1KV1A 2OZAB 1PYXA 3HMOA 3LFFA 3PY3A 4O0VA 3SG8A 4GRBA 2HZNA 5AV3A 4BZDA 2IPXA 4RIWB 4P4CA 4RJ3A 2XRUA 5J8IA 1A48A 1UA2A 4PDPA 4EC8A 4EWQA 4ZMFA 4QPAA 4GFMA 5BNJA 4FUYA 4ZLYA 3HV4A 3JYAA 2J7TA 3DKGA 4FYNA 3VQHA 1KE7A 4LG4A 4EK8A 1ZOHA 3C13A 4H3QA 4YU2A 3KXHA 1UNHA 1MUOA 2H9VA 4TT7A 4OW8A 4QMLA 4S33A 4TL0A 2GFSA 4GT3A 3FSKA 3MIYA 4EH4A 5ANOA 2BRNA 3WF6A 4M84A 4WNPA 4K8AA 1UVRA 4O38A 4AW5A 2WTKC 4FTNA 4FV3A 2GNIA 4XMOA 4LM5A 5C27A 4QMWA 5IMXA 3EQRA 3L9MA 2GQSA 3OBGA 4O2ZA 4XHKB 3A61A 4RWJA 4RBLA 5J7HA 3QHRA 4NUSA 3UVPA 2PVYA 1A9UA 2OFUA 2P4IA 3EQIA 4I92A 4YO6A 3QD4A 4MD7E 4BR3A 1F5QA 1H1WA 2GTMA 2JDSA 2C1BA 1URWA 2R3IA 4QQ5A 5AIRA 5J1WA 3L8PA 5E1EA 5EI6A 2VWXA 4JLCA 3UYTA 3NIZA 3R02A 4DGNA 2B0QA 2UZNA 4O0XA 4G16A 3ALNA 3F7WA 3VBTA 4OBQA 4F70A 5HLWA 3R9NA 3UO4A 1M2QA 1APME 4R3PA 4AT5A 1ZXEA 4BCKA 4CYIA 5FTGA 3V6SA 2R3JA 4DH7A 5C01A 4EQCA 3UNZA 4I0TA 4DH8A 4JR3A 4E8AA 4E3CA 5KMMA 1IEPA 2P2IA 1UWJA 2CNVA 4EJ7A 2ZV8A 1L8TA 3R7GA 1ZOEA 5CAVA 4KSPA 3A4OX 5F1ZA 1YW2A 2OBJA 3FMNA 3KEXA 2IW8A 3UOHA 3L9NA 4AWIA 4HW7A 3QQKA 5JT2A 3TG1A 3COMA 2YISA 4IVBA 1YXVA 4FKOA 2GDOA 4JIKA 5D9HA 3F7ZA 3FZSA 3ZDUA 2XF0A 2ZDUA 4ACDA 2PZRA 5ACBC 4GS6A 3DU8A 3Q3BA 5LMBA 4V0GA 4IB3A 5DI1A 1TQPA 4BICA 3PA4A 3F61A 5LVOA 3NMUF 2FH9A 4FKLA 5KNJA 4AZVA 5CSPA 1OPJA 3BHTA 4JXFA 5L4QA 4U9AA 3ODZX 4C61A 1YXUA 4K1BA 4YZMA 4H05A 5C1QB 4B8LA 3B2WA 4TYJA 3HL7A 2UVXA 3NAYA 2XNBA 4FSWA 4HVDA 4QPMA 3DBQA 4H58A 1BKXA 4JRVA 3R7OA 4JDKA 3IDCA 4MXAA 4ZZOA 4MYGA 5AFVA 2GMXA 2ZV2A 4HYUA 4FZFB 3PDTA 4FIJA 2OJ9A 5L8KA 3U4WA 4F0IA 3C0HA 4Y85A 1V0OA 1VYZA 3FXXA 3FMHA 3GC9A 4MXZA 3S3IA 3T9IA 3KXNA 4IXPA 1DI9A 4MXOA 3JVSA 1Q8ZA 1U54A 4DG3E 4Y73A 3SQQA 5EKNA 1Z57A 2J9MA 2XJ0A 3PLAE 5JN2A 4BY9E 2YJSA 1G8SA 4NZWB 4AFJA 3TKHA 3DJ7A 3ZBXA 3ORLA 1MQ4A 2Z60A 4AX8A 2XYNA 3F66A 4F1OA 1QPDA 2EB2A 1SVGA 4XRLA 5FRIA 4YUQA 5KMIA 2JDVA 4O21A 4FSRA 5FP6A 3TT0A 3DT1A 1YDRE 3D14A 4CNHA 5BMMA 4EH8A 5BX0A 5DOSA 4QYGA 5DVRA 4FOBA 2UVYA 2BILB 3ZLXA 3LMIA 3MB7A 4E6CA 4O2PA 2R3OA 1TQIA 5ANGA 4EHEA 2PMLX 5CVFA 2C3KA 1VJYA 2PTKA 2BRHA 3MPMA 4G6OA 3A7FA 1WBVA 2WTIA 4ACMA 4OTIA 2OJGA 3UNKA 2X0GA 4DTBA 5AR5A 3RAIA 1PXIA 1K3AA 5HKMA 4GFOA 1PY5A 2JKOA 2R3NA 4BWXA 3IONA 4FX3A 4OAUC 3W2OA 3MVMA 2VTQA 3FMMA 1Q5KA 3NW5A 3ORMA 3QRJA 2F9GA 3VUGA 2R3FA 1WZYA 4GUEA 3PYYA 3R1NA 4QYFA 3EMGA 1JBPE 5HD7A 3RWPA 3ZLYA 5EK7A 2SRCA 3O51A 5I3OA 4IX5A 5DE2A 3RM7A 2QCSA 4L8MA 5D12A 4E5BA 3S1HA 4I5MA 3VS5A 3OG7A 4IWQA 4JG7A 3Q60A 4R6VA 3BEGA 2GQRA 4YHFA 3CE3A 4DA5A 4BI1A 3L8XA 4ASXA 4BBFA 5JQ5A 3KC3A 3HNGA 1JKSA 1YHWA 2PZIA 3LHJA 3P1AA 3NNVA 3Q32A 5AP0A 4A4OA 5LVPA 4M0ZA 3DLSA 1H28A 4FKSA 5CI6A 3E8DA 1RQQA 2OZAA 4BCPA 1LEWA 5D7AA 3LE6A 5AADA 3RMFA 4LL5A 2WQEA 3OCTA 3PXKA 2FA2A 2UW4A 5IQHA 4O0UA 4G31A 3HDNA 5IQIA 4O0SA 4QYYA 4RIWA 4ZLOA 4G34A 4QP6A 2CGWA 3P78A 3F82A 4DEAA 5CXHA 4O0WA 4QMYA 3ORNA 1FINA 4BCJA 2B7AA 4EKLA 3PP0A 4FTTA 4B99A 3I6WA 3BX5A 1NVQA 3CLYA 3PSCA 3C4CA 3DA6A 3PY0A 4FI1A 3PJ3A 4NW5A 3ZZWA 4ASDA 3IDBA 5M51A 1GOLA 4QYHA 2XUUA 3Q9YA 2UZUE 4AZSA 4CEGA 1ERKA 2PULA 4GT5A 1KWPA 2W1HA 3ROYA 4Y83A 4AGWA 4E5AX 2R3HA 2YN8A 1Q8UA 3DFCB 4XH6A 3DCVA 3KMMA 3NYXA 5HTBA 3F6XA 3G5DA 4BIEA 4RX5A 2XJ1A 2C1AA 5TO8A 3S4QA 3LMHA 3P23A 4HCVA 3TL8A 3V8SA 4DBXA 2XEYA 2DUVA 5DMZA 3SW7A 3IK3A 3LQ8A 5M07A 4ACGA 3Q9WA 2AYPA 4QD6A 2BPMA 2BZHB 2ZDTA 1OIYA 4LV8A 2WEVA 4AE6A 5H2UA 2R0UA 1DAWA 4X3FC 2YIWA 3Q53A 4XV9A 5DGZA 4Z3VA 3JY0A 4IANA 4J52A 3ODYX 2W1EA 4X3FA 2XJ2A 3DXNA 4YC6A 5HD4A 3K5VA 4FL2A 3ZO3A 3G0FA 4ACHA 3N4VA 1H1SA 4FIIA 3KA0A 5A4QA 2WZJA 3HV6A 4YJUA 4QMUA 5ITAA 1OL7A 4FV6A 2C4GA 1Y91A 5CQWA 5CEPA 3KGAA 2J0JA 4I20A 5AJQA 5EHLA 2BAQA 2J0LA 4GK2A 3RPOA 2X8IA 5ETAA 2BIYA 3FPMA 3FMDA 3A7GA 4UXQA 3EOCA 2VN9A 3EYHA 3FDNA 3R8ZA 1FVVA 4O96A 4RFYA 2R4BA 4AZTA 4BHNA 4LGDA 4GK3A 3VN9A 4AT4A 4ZSJA 5FUTA 1BYGA 5AA9A 1LEZA 3ORPA 4GG7A 4FEQA 5HLNA 4JAIA 2F49A 5K9IA 4K2RA 2O2UA 3OFMA 4ZSGA 4CFFA 3U6JA 2PPQA 4IAAA 1MQBA 4GVAA 1JQHA 2FB8A 4BIDA 4HYSA 4I94A 5K5NA 2XBAA 2IZTA 2HW6A 1BL6A 2XP2A 4EZ5A 4NM7A 3LKMA 4KA3A 4JT3A 4FT0A 5EYCA 3WI6A 1OBDA 3OXTA 3CSVA 1PMUA 4OGRA 2BDJA 4HNIA 3EYGA 4ENYA 4PMPA 5C26A 3JR1A 3RALA 1Q8WA 2YDIA 4IC8A 4RSSA 5ANDA 3PLSA 1XH5A 2ITQA 2WTCA 3DK6A 3AGMA 5BVEA 5L8JA 4YZ9A 1NY3A 4D5HA 4NJDA 2QOBA 3CQUA 4V01A 3P9JA 5D11A 4F64A 1SM2A 3U9NA 5KKRB 3AC3A 1U54B 3DTWA 4OTFA 4ZZMA 4RG0A 2C6KA 3VUIA 3ZO2A 4BTFA 1JSVA 3KF4A 3COKA 2JBOA 3FL4A 2ERZE 4J95A 3ANQA 3FMJA 5KBRA 1KSWA 3FEGA 2WQMA 4FA2A 2XRWA 2YCFA 3MH1A 4KIOA 5CX9A 5L2QA 3SXSA 3UG2A 4KS7A 5DR9A 4IM2A 2Y0AA 4UB7A 4GFGA 3BV2A 1KE9A 3C51A 3I7CA 1YHVA 2OF2A 4BCFA 3A7HA 3FWQA 3HMPA 3Q52A 5BVNA 1XHAA 4M14A 1PKGA 1H00A 3OMVA 4TYIA 3S0OA 4O7RA 1B38A 4K33A 2F7ZE 5AV1A 4C4IA 5IEVA 2JIUA 3DNEA 4ZP5A 4FIGA 4WD5A 3MFSA 3GQIA 4YBKA 4F65A 4U79A 4HYHA 4IX6A 2C6DA 1UU3A 3K3JA 3M2WA 4C34A 4LGHA 4MBIA 4M69A 1ZYSA 4QQJA 5I9XA 5A6OA 5TT7A 2YM3A 4QMVA 4BKYA 2YM6A 4W4XA 4NL0A 4QP3A 1RJBA 2WU7A 2ITPA 3OF0A 3QZGA 5AUYA 4D2PA 4C02A 3GFEA 5AP2A 3Q5ZA 1WVYA 4BGQA 3EQPA 5E8TA 3A62A 3HMIA 3UO5A 5CEKA 3LXPA 3A4PA 4A4XA 4EH6A 5DT4A 2Y6MA 1H1PA 4RT7A 3ENHA 3VW6A 4K77A 4RGJA 3ZC6A 1UV5A 4UV0A 4J53A 2VTRA 3CPCA 1M2RA 3BCEA 4G3CA 3DXQA 2XKCA 2UVZA 4BDEA 4F9AA 2R64A 5KMNA 3WF5A 4F0FA 5I5ZA 3K3IA 4XNEA 3F3TA 3BELA 3MY5A 2J50A 4GH2A 4Z7GA 3FZRA 2VO3A 4FZDB 2GNJA 4RLKA 4TWPA 3NIEA 4FT7A 4WO5A 5CS6A 5EQPA 4DFZE 4M15A 4XRJA 3AQVA 4GVJA 4MXCA 3BYVA 3BYOA 1OVEA 2R9SA 5BVDA 3Q4TA 5M57A 4AGUA 2VTNA 4BFMA 2BTRA 3BYSA 3HV7A 4D2TA 4RX7A 3F5UA 4L45A 5HNIX 1CMKE 2WTDA 4OTQA 3D5WA 3H9OA 2WU6A 2H34A 3QTIA 4WBBB 3RHKA 4L7SA 4DH3A 3MH3A 4F7LA 4FT5A 4DINA 3AOXA 3NPCA 4FL1A 4O7NA 2RFNA 1O6KA 2OIDA 2R3LA 2XKDA 1UU8A 3MESA 1OUKA 3VS3A 3WF7A 3UOJA 3VBXA 2QG7A 3ATSA 4ZSAA 2GQGA 2UW9A 2ZJWA 3UQGA 4PPAA 4JQ8A 3A8WA 5KMLA 1XBBA 3DKFA 4Y8DA 3RAWA 5IF1A 2HW7A 4L3LA 3DJ6A 5GZAA 2C47A 5IA3A 3JY9A 3Q96A 1Y57A 4ZSEA 4AZEA 2EB3A 4BI0A 2HAKA 1PRYA 3VUTA 5BYLA 3MVLA 4Y95A 1X8BA 5LMAA 4ZJVA 5JMSA 4YC3A 4U3ZA 4EHZA 1CKJA 3PVUA 4Z9LA 2UZEA 3LM5A 4QTDA 3E92A 5DR6A 4IAYA 2E9PA 3MBLA 4LL0A 4XP3A 3QUDA 4O0RA 4AT3A 3ENMA 4YZBA 3D83A 5CU4A 5C4LA 5K5XA 1BLXA 3QUPA 4BCQA 4AUAA 3FLNC 5IDPA 1KOBA 3D5UA 5DRDA 1W84A 2UZTA 3QUEA 4NCTC 4A9YA 3LFQA 3E93A 3QCQA 1ZYCA 4FT3A 2OKRA 4WIHA 3ZFMA 3ZRMA 3SKCA 4HVIA 3W16A 4AF3A 1YVJA 2W0JA 5AUUA 3ULIA 2R3MA 4OTRA 1H1RA 3OVVA 3UTOA 3OROA 5LMKC 3BPRA 5JH6A 2YIYA 2UW5A 2VUWA 3E8EA 5JQ8A 4FV9A 2R0IA 4L00A 5EHYA 4RWKA 5KE0A 5C03A 2QKRA 4F7JA 2ESMA 1H27A 4IWDA 4O91A 1PXPA 4TYGA 4BC6A 1G3NA 3O2MA 4EBWA 3HA6A 3W10A 1V0BA 1WBTA 2C5NA 4IX4A 4XG2A 3BEAA 3R22A 3MTLA 4L42A 3ZUVA 1SYKA 4WUAA 3U4UA 3MFUA 4KS8A 4W4YA 1WBWA 2H96A 3G6HA 3W2RA 4C2WA 4WHZA 4C4HA 4KRDA 3VVHA 3ACJA 4TZRA 4EUTA 4EEVA 5E8WA 4XOYA 4U97A 3Q9XA 1HCLA 1W7HA 2ITYA 2OO8X 3FQEA 3QD0A 2CKEA 5I9UA 1OZ1A 3QCSA 3FHRA 3FC2A 1KV2A 2YLFA 4I6FA 3GI3A 4KIPA 4KBKA 4BDHA 3ATTA 5BYYA 1YHSA 2PUPA 3POOA 3D5VA 2YAAA 3R1QA 4HGEA 4X6QC 3ZO4A 4BDIA 5CSWA 4YTHA 3NX8A 3VQUA 4JOAA 5I4NA 5IEXA 4HZSA 3GCQA 3P7CA 4WNMA 4R78A 4ZTSA 4RIXA 3ZRKA 3MY0A 3KK8A 2B1PA 3DGKA 3A2CA 2VTIA 4XV1A 2OJIA 4AW1A 4IJPA 2CCIA 4BTMA 3MFTA 3P5KA 3RJCA 4LFIA 1QL6A 3CEKA 4RLLA 2CKPA 2G2IA 2C0TA 5E92A 3BHUA 4XOZA 2VV9A 4CZYB 5E9EA 2XCKA 1R1WA 2HENA 2PVHA 3JS2A 4E26A 2PZPA 4G3GA 2X7FA 5EM8A 3TI1A 5I9YA 5KUPA 5M06A 5EYMA 3SRVA 2VWZA 3WILA 3NZ0A 3F69A 5HHWA 3F5XA 4JX7A 5CASA 2GHMA 3QZIA 3TXOA 2WMSA 4TYHA 4EK4A 4YJOA 4UMPA 2PVNA 4JBVA 2XVDA 3PVWA 3TZ8A 4NIFB 3R28A 3EQHA 3EZVA 4RC3A 3D7ZA 2W7XA 3QRKA 4MHAA 3TJCA 5I9WA 3C5UA 4BI2A 2XK4A 5EW9A 3VBWA 3LIJA 1YQJA 3GB2A 5HIEA 2XZSA 4QRCA 5CSXA 4GMYA 3UP7A 3TNWA 1Q3DA 4IHPA 4O7LA 4ANOA 3ORXA 4NFNA 4L43A 1OL2A 5AAEA 2R3PA 4DG2E 5CU0A 2XM9A 4JG8A 4M69B 3FLQA 1YOLA 4BDJA 3OW3A 3VJOA 5GZ8A 2EWAA 2JC6A 2OF4A 3Q4ZA 4ITJA 4L7FA 4QYEA 2PUIA 4UXLA 5K4IA 4AACA 3R8UA 4LV5A 3LLAA 2ZV9A 3ZH8A 4IAKA 3BWFA 4O82A 2WHBA 1JSTA 2C6TA 3CY2A 1UU7A 3LJ0A 4NTSA 2J5FA 4FEUA 3R73A 3F2AA 3H0YA 2V22A 1FMOE 4DFLA 4MD9E 5M55A 4GEOA 2P0CA 3PRIA 2XNNA 4OBPA 5C9CA 2BMCA 3Q4UA 2KTYA 4CKRA 2ITWA 5HEZA 1OPKA 4HCUA 4J8NA 4MQ1A 5M44A 3W2PA 3GCUA 1R39A 2CLXA 2WXVA 2UZLA 3KXXA 4OLIA 1G5SA 3FI3A 2WMBA 3MH0A 4C33A 4ANSA 5BYZA 3EL8A 4WSQA 1P2AA 3IOKA 4XG7A 5AMNA 4A7CA 3A8XA 2IW9A 2XNEA 4RQKA 3Q9ZA 4NW6A 3R00A 3EQBA 5JFVA 3HAMA 4CMUA 3QZFA 1U59A 5EG3A 5KKRC 5LCKA 4V04A 5FD2A 1KE6A 3P79A 4RJ6A 3E5AA 3R8VA 3DNDA 1S9JA 5CLPA 4FKGA 4O1OA 5C4KA 4RPVA 5FQDC 3OUKA 3FLZA 3UPZA 2EUFB 4R7BA 3GC7A 5IQDA 4G5PA 4W4WA 5CEIA 4AOJA 4QP2A 4IB1A 1WBPA 5D10A 1PYEA 3KREA 5EHOA 4FKJA 4YURA 1Z9XA 4GIIA 4KBAA 3R21A 4O86A 4IQ6A 4PQNA 3LCKA 2W9FB 4JR7A 3UVRA 4C2VA 2QQ7A 1VYWA 5M4IA 1W98A 2DYLA 2JFMA 5BUIA 4NWMA 3FQSA 2X4ZA 3NRMA 3AT3A 1TQMA 4UX9A 3TCPA 3NLBA 3IECA 4DFUA 3V5JA 4XCUA 1XQZA 5CZIA 3QLFA 1J91A 2BUJA 5DRBA 3H3CA 1JKKA 3EN4A 1PF8A 4AXAA 1AQ1A 5C8NA 4FV4A 2A1AB 5DFPA 5EYDA 4EOJA 2BIKB 1JOWB 2UZDA 2A19B 3S95A 3V5WA 4QP9A 3I79A 4IAIA 3V5QA 4FG7A 3QC9A 4TXCA 4FBXA 3FZOA 4GIHA 4KWPA 4C4EA 3QQGA 4TKSA 4RVKA 3LFNA 4RC2A 3F3WA 2NO3A 2QO9A 3BQRA 4M0YA 1U5RA 3R9RA 5GIPE 4X2GA 3NVMB 5AR3A 2R7IA 2WQBA 4ZS0A 1ZYLA 1WMKA 4BWKA 4A9UA 2ZYBA 3KL8A 4ZY6A 5IUIA 4H36A 4R77A 4UMQA 4Z16A 4X3JA 3EWHA 3C4WA 3PXYA 1YWVA 4FYOA 4FF8A 2W4OA 5AUZA 3E3PA 4HVHA 4O7YA 4ALWA 1JPAA 4OBOA 4YSMA 3NUNA 4I5CA 5J95A 1CTPE 1BI8A 5CANA 4FEVA 3HV3A 4FL3A 5AM7A 4I6BA 1UKHA 5AV4A 3W8QA 3RPSA 2F4JA 4BGGA 4PDYA 3L9LA 4E20A 3R8LA 3D7TB 4NU1A 4Q5HA 4B6LA 1PXNA 3R0TA 3P08A 1PXMA 3GOPA 4GU6A 4RC4A 2WO6A 2QOLA 4PPCA 5CSHA 4H1MA 5KHWA 1JVPP 3HYHA 4FNWA 3R83A 2V7OA 2XA4A 5EI2A 3QTWA 2ETKA 3O17A 2KULA 3PWYA 2VU3A 3S2PA 2G1TA 3Q2JA 4YZNA 4DEGA 3P4KA 3QF9A 4YO4A 1ND4A 3VHEA 4TNDA 5AP5A 5HG7A 2PE0A 4DFNA 4UN0C 4ZIMA 5E4HA 5HICA 5KMJA 4YLLA 1KE8A 4IIRA 4YPDA 3TKUA 4FMQA 4WT6A 2IO6A 4WSYA 2VNYA 3I5NA 5KZIA 4G3EA 1BMKA 4UMRA 2YWPA 2OGVA 2CGUA 4P5QA 1JKTA 3PPJA 4B0GA 5HG8A 4KB8A 2C6LA 5FDXA 4AQCA 2YCRA 2O65A 3R8PA 3TZ9A 2W1GA 2VX1A 1Q62A 4FTAA 3KFAA 4AU8A 3F5GA 4LUDA 5KCVA 3VUHA 5IQCA 2XIKA 3U6HA 4EH9A 5BVOA 3KXZA 1YRPA 3MV5A 4TYHB 3C9WA 1CKPA 4EC9A 2J90A 4BDGA 5IQGA 4B4LA 2W1DA 1GZOA 1V1KA 4EK5A 5HCYA 4HVSA 4D4RA 3OWLA 4FTRA 4I6HA 1SVHA 3IG7A 3UPXA 3UOLA 2QOIA 3RK9A 2OH0E 2ZB0A 3VRYA 1M2PA 4C59A 5JGDA 1ZOGA 3PJCA 3DJ5A 5FTQA 4B7TA 3PVBA 4QT1A 2X7GA 4W9WA 2QOQA 4RJ8A 5AV0A 4RJ7A 3ERKA 2XK9A 2PWLA 5L6WL 4BIBA 3VS0A 2VO7A 2VWUA 4YNEA 4QP4A 3TZMA 4CRSA 5EW3A 4FE2A 5A9UA 4G6NA 5EM7A 4OR5A 1H8FA 4N6YA 4YSJA 3MJ2A 4ACCA 3Q6UA 5CEMA 2JDTA 3PG3A 4KAOA 4CCBA 1E9HA 5FGKA 3I60A 4AN9A 5HE2A 4FG9A 3OT3A 2P33A 4L52A 4E6QA 2AC3A 1XBCA 2BRBA 2BRGA 1Z5MA 2YIRA 5ETIA 3QHWA 3O50A 4CG9A 4KBCA 1YI4A 3C1XA 3NW6A 5EDPA 3U51A 5AM6A 3I1AA 2P3GX 4NFMA 4P2KA 4D9TA 1I09A 3BGPA 3E62A 3DTCA 3MFRA 5G6VA 5T68A 2YM7A 2UV2A 3W2CA 4TWCA 4BDDA 4DT9A 2PVKA 3IW8A 5EQYA 3HAVA 4JJRA 4FVQA 4C4JA 5J9ZA 1JSUA 5BVWA 4U6RA 4W8DA 3OOGA 3LXLA 4O22A 3LVPA 2ZM3A 4IZ5A 4APCA 4WNOA 2E9VA 3DBCA 4IWOA 5ETFA 3GEQA 1GZ8A 4L3PA 3E7VA 3UVQA 3VS1A 2YZAA 3DS6A 3HRBA 4BL1A 2Z02A 5E8YA 5EDQA 3IW7A 3DDPA 2HZ4A 3QTXA 4QTBA 5BVFA 4RX9A 2VTMA 4U41A 3BBTB 2E2BA 4UWYA 5KMOA 2G2FA 3PTGA 3UMXA 1OIQA 5FM2A 5CU6A 2OJJA 4ZJJA 5CAPA 5JFSA 4O0TA 5IA1A 3KF7A 5L6OA 5LOHA 3KXMA 3PA5A 1UNGA 4N70A 3D2KA 3GCVA 4XV3A 2J4ZA 2P55A 3RCDA 4WOVA 5DBXA 1Q8YA 4DLJA 2WELA 3GU5A 4KUJA 2EXMA 5H8GA 5LVLA 2BKKA 3ZS5A 4TW9A 4TN6A 5AUTA 3KCFA 4JX3A 5HO7A 2X2KA 1ZYDA 3GOKA 4DITA 3CP9A 4R7IA 1NVSA 5CY3A 5IKWA 5DT0A 4D4SA 4FT9A 4FR4A 3FL5A 3I0OA 4FUXA 2X4FA 2YEXA 4QMMA 3CD8A 4QTAA 5DWRA 4CKJA 3T3UA 1ZZLA 1L3RE 4JNWA 3UZRA 3NUPA 3GBZA 4MWIA 3V5TA 2PHKA 3CPBA 2VGPA 3EKNA 4N4SA 1CM8A 2YM8A 3FMLA 3DOGA 4E7WA 5HVJA 1GY3A 2Z7LA 3VBYA 3ZYAA 3RZBA 4ASZA 3VS2A 5HX6A 3KN5A 3F3ZA 1H07A 3MWUA 4YTIA 2I0EA 4YBJA 2YCQA 4IEBA 4YLJA 5M4FA 5CF8A 5H8BA 2B54A 4TYEA 3LFBA 3EQFA 3ET7A 4AW2A 1MRYA 2Q0NA 4NEUA 3MW1A 4TPTA 3QBNA 2UW6A 3NAXA 2BROA 2HCKA 2OG8A 1H24A 3O7LB 4JAJA 3VS7A 3LFSA 3WIKA 3C4EA 3AGLA 3VJNA 2FUMA 3E88A 3IOPA 4NKAA 4PWNA 1UU9A 5K0XA 4H3BA 5CZHA 5HESA 1EH4A 5KO1A 3UGCA 1HOWA 4JVGA 3LCDA 5CAUA 2OXDA 3D7TA 3LPBA 1W8CA 2GS6A 3LFDA 4IBMA 3HVCA 5JEBA 2W17A 4O6EA 4FV8A 2I40A 2QU5A 4MF1A 1E1XA 2ZV7A 4P5ZA 3TIYA 3UIBA 3VWAA 2Y9QA 2R2PA 2ZMDA 5CU2A 1P14A 2HWPA 3CD3A 4Y5QA 5M4CA 2IVVA 1IA8A 1JWHA 2CN8A 1K9AA 2BVAA 4AZWA 4QO9A 4E4XA 3DDQA 2O0UA 2QKWB 4HGTA 3VBVA 1Q8TA 4FVRA 3G2FA 3QU0A 5HLPA 3EFJA 4YJVA 3UIXA 4NM3A 5JKGA 4M68A 1TKIA 1O6LA 4RVLA 4KKEA 4DE4A 5A4LA 3E8NA 1W0XC 3WBLA 2LGCA 5CAOA 4E73A 4PDOA 2EXCX 5E1SA 3O23A 2ITUA 3NCGA 2CJMA 2IWIA 4UMUA 3P86A 1XH9A 2BHEA 1YOMA 3I5ZA 3C7QA 1Q3WA 4UZHA 3KN6A 4R1YA 3UP2A 4I1ZA 1U5QA 2RSVA 3I4BA 3U55A 4OTHA 4PTGA 1QCFA 3F3VA 4EKKA 3TTJA 2XS0A 2I0YA 3R7VA 2DWBA 4RIYB 4IVDA 3W33A 2PYWA 4X3FB 3VAPA 5F9EA 4G6LA 1OI9A 4X2JA 2BCJA 3BLQA 2A4LA 3NYNA 3TZ7A 4PP7A 3DQWA 4QMOA 5FXRA 4ANQA 3S00A 4CTBA 2W9ZB 4EYMA 4D0XA 2VAGA 4A9RA 3BI6A 5D41A 3ZFXA 1OGUA 3SC1A 1AGWA 2O3PA 4I93A 4WKQA 3QD2B 3RI1A 5GJDA 3ZBFA 3PPZA 2O63A 3FLYA 4J1RA 3OS3A 4RRVA 4F4PA 4PMSA 3ULZA 3TDWA 3R63A 5A4EA 2C68A 4AGCA 4GCJA 3BZ3A 3OT8A 3PPKA 1QPCA 3MPAA 4W8EA 4TY1A 3NUXA 4UBAA 5AP6A 3L1SA 3MDYA 4J96A 3V8TA 4ZTMA 2JDOA 3NUYA 4YGAA 3ZLSA 3ZTXA 4ZS4A 4KIQA 3KVXA 5E8UA 4YP8A 2HIWA 3OZ6A 3VNTA 4II5A 3R7IA 2W5HA 2YHVA 2WIHA 3FXZA 4OTWA 3ZCLA 5G1XA 3V6RA 4BCNA 3OWJA 4FZ6A 1U4DA 4QQCA 2ZVAA 3LJ1A 2JIVA 4O6LA 3O71A 2XIZA 4QNYA 4ZK5A 5B2KA 1T45A 2ZM4A 4CFNA 4MNEB 3REPA 3HMNA 1W82A 4LGGA 4IB0A 5CNNA 3SD0A 5CF5A 4I6QA 4S32A 3UO6A 3VW8A 4ARKA 3KK9A 4EHVA 3Q2MA 5CT0A 5AX9A 4XJ0A 4FKQA 2CKQA 4BDKA 4O7WA 3CQWA 2Z2WA 3MN3A 4HPTE 4ZJIA 3ZFYA 1FGKA 2BAJA 3W8LA 4DC2A 4U40A 3EFKA 4L68A 5CSVA 5IH4A 3KKVA 1OBGA 5CF4A 4DEIA 3D2IA 4JBOA 4CMTA 1FGIA 4Q2AA 5M4UA 1LR4A 4DCEA 3EQGA 2PVFA 2X2MA 3RGFA 4CFXA 5A4CA 3QQJA 5FXQA 3ZONA 5JZJA 1FOTA 4K9YA 3KQ7A 4MBJA 3TNHA 3TM0A 4FSTA 1CKIA 4PTEA 4IE9A 4LMNA 4EZ7A 5I3RA 3QD3A 4KD1A 4AOIA 3IDPA 2ACXA 4BKZA 4RZWA 4F7SA 2BDWA 3CTHA 4KRCA 4ORKA 3COHA 3LOKA 5AAFA 4CQEA 3PXRA 3V8WA 3UE4A 2WMQA 2QG5A 4LOPA 3UIUA 3VUMA 4EOKA 2F57A 4FTCA 4RVTA 5FWKK 5KMKA 3QFVA 3FZPA 2XNMA 3FBVA 1XO2B 3Q5IA 4M13A 4IB5A 3QQUA 2VO6A 4KKHA 4S2ZA 3LQ5A 4C35A 4DH1A 3FI2A 5HX8A 4EI4A 2XIRA 3D4QA 3LAUA 3EHAA 3SOCA 3Q04A 2W5BA 3K2LA 2REIA 3DQXA 4YC8A 3ZHPC 4AN2A 4ZTNA 4BDBA 4ENXA 4FC0A 2UW8A 4FV7A 2JEDA 3OTUA 3ID6C 1U46A 2YIQA 3QQFA 3BIZA 4CZTA 4UEUA 5C8KA 4R3CA 4K18A 3UJGA 2W05A 4FOCA 2C5XA 2P2HA 4Q9SA 2GPHA 1YXSA 3PZHA 5AR2A 3TV4A 3UG1A 4X7QA 1WBNA 4CVAA 3F3UA 2RGPA 2W1ZA 3R1SA 4BBMA 3KRWA 3V04A 4DFXE 3GVUA 3UOKA 1P4FA 3LM0A 4DGOA 1H01A 3OUNB 5JRQA 2FO0A 4IH8A 3IKAA 2NP8A 1IG1A 2R3RA 3DAEA 4MF0A 4QP7A 3V51A 3OC1A 1J3HA 3EN5A 3W2SA 4DF3A 4DBNA 1H0VA 1QMZA 3ZM9A 3KXGA 3OW4A 1OECA 3FI8A 3GENA 5F95A 5GIOE 2XYUA 4FGBA 1YXTA 4H39A 4N0SA 5ICPA 2CHLA 2VTPA 4X2KA 3UC3A 4E6DA 3KRLA 4FTIA 5CNOA 3QWKA 3RINA 5EOBA 4K6ZA 4MBLA 5K4JA 2XH5A 3MGYA 2E9UA 2IZSA 5J9YA 5GZ9A 4U43A 3WYYA 4QTCA 2Y4IB 4O81A 4L01A 3VF8A 3PRFA 2W06A 4PY1A 2C3LA 2UW0A 4BCMA 5AUVA 3TV6A 3ZUTA 3KY2A 4W9XA 2X81A 3L9PA 1KUTA 3ALOA 2QLUA 5JFWA 1BI7A 1H1QA 3EN7A 3N4UA 4EQUA 5BMSA 3EN9A 2UUEA 3E7OA 3QWJA 2WEIA 3CGFA 4NKSA 4QP1A 5T6KA 5FG8A 4EOMA 5H9BA 5CF6A 3POZA 3QKKA 2VX0A 3VHKA 4KIKB 4MXXA 4FNZA 3NGAA 5EQEA 4L6QA 3SA0A 3GU4A 3NVKI 3H0ZA 3DKCA 4FKVA 2IJMA 4ONAA 4YHJA 5HCZA 2YZLA 3FKNA 1JNKA 4RMZA 3GU7A 1FQ1B 1REJA 2RKUA 1O9UA 2EXEA 5DG5A 4YR8A 3FYKX 5AAGA 4JQEA 3C4ZA 4FNYA 4GUBA 4IJ9A 5EI8A 2BZJA 2WMAA 5HIBA 3O7LD 5HO8A 4DTKA 1URCA 4QP8A 3KVWA 4FTLA 4D4YA 4AGDA 1Q97A 4FK3A 5E8SA 2JITA 4RIYA 1A06A 2XBJA 3FUPA 3SDJA 5IQAA 2PUUA 2X2LA 4HZRA 4HOKA 4NYEA 5JRSA 3WF8A 3E64A 3EZRA 1ZZ2A 2LAVA 4JDJA 3IGGA 4UY9A 3FJQE 4H3PA 1NT2A 2VTAA 2FVDA 2E9NA 2PZYA 1UNLA 2QOKA 4XBUA 4L9IA 4ZTHA 3NDMA 5HBEA 5JZNA 3W18A 4DYMA 5KHXA 5KX8A 1PJKA 4AA0A 4FZ7A 3T3VA 4FIHA 5ACKA 4YHTA 4F6UA 5BPYA 1H25A 4RJ5A 2VX3A 3IW6A 3QX4A 4LRMA 3UIMA 1M14A 4MNFA 4DGLC 4HGLA 1OKVA 2BRMA 2WFYA 5J9LA 3FYJX 4IX3A 4IDTA 2XIYA 4K0YA 3HZTA 2FSOX 3DLZA 4DGGA 3OWKA 5BVKA 4EQMA 1OPLA 3CIKA 2ETMA 3BBWA 3JUHA 2CMWA 3Q4CA 5LARA 4RWIA 3QKLA 5DLSA 5CVHA 3EIDA 2W1IA 2YM5A 1XWSA 3ITZA 2IVUA 4UYNA 2B9JA 3D94A 4AFEA 3FAAA 2CPKE 3AD5A 3PE2A 5D7VA 5ANEA 4F08A 4BGHA 2XIXA
chains in the Genus database with same CATH superfamily
5K3YA 1XMLA 4C58A 4E6AA 4ERWA 1GAGA 2B53A 4DG0E 2BHHA 2WKMA 4AAYA 4CG8A 3GC0A 3OEZA 3SGCA 4BDCA 2O64A 4MNEA 4IW0A 5FEEA 1GZNA 5DR2A 3VF9A 1CDKA 4TWOA 2X8DA 3WOWA 5HGIA 4WG4A 5EFQA 3LXNA 1P5EA 2XNPA 4JIAA 2X9EA 3ANRA 3BV3A 4HNFA 3A7IA 5DA3A 2GNFA 1ATPE 3FSFA 4CV9A 4J7BA 3UDZA 3LLTA 3PG1A 2X1NA 4FV5A 2Q83A 4FV1A 4A06A 3GU6A 4RA4A 2VTHA 1WFCA 3P7BA 5LMKA 3FKOA 2ITNA 2YDJA 4A4LA 3M42A 4XS2A 2OIQA 2W1CA 3FXWA 3OEFX 3QZHA 4PDSA 2WMWA 4JRNA 2WTVA 4WG5A 3WZUA 3LCSA 3SX9A 1LP4A 3G90X 4CT1A 3G51A 4XV2A 3QTQA 2XK6A 4C62A 4R5SA 3WZKA 5DPVA 5AR7A 3NR9A 2Z7QA 2PMNX 4WRGA 1PHKA 5JK3A 2BFYA 4F9WA 5E7RA 4MAOA 2VTSA 4X21A 2BFXA 2C5OA 4D28A 2QLQA 4WA9A 4AN3A 2VTOA 4ANMA 1SVEA 3RWQA 3L8VA 4BZNA 1Y8YA 4QMXA 5E8XA 4E5WA 3GCPA 4DDGA 4MD8E 2QOHA 4MH7A 5IDNA 2PUNA 5HVYA 2CCHA 3QYWA 5HE3A 4FGRA 3IQ7A 2XK7A 4IZAA 2NNWB 3HKOA 3IS5A 3AD4A 5IISA 4QPSA 1WCCA 2XKFA 2PVRA 2BKZA 2JGZA 3KMUA 2OK1A 1KE5A 3NWWA 4EH3A 1ZMVA 3AG9A 3NNXA 2VNWA 2B9HA 2IEWA 3MA6A 2Z7SA 2Z7RA 2RFEA 3MTFA 2X8EA 2JD5A 3BYUA 4FKRA 4C36A 4AS0A 4XLIA 5HE0A 2QU6A 3QYZA 4FSZA 3OY1A 2HXLA 1PMVA 4J71A 4JBQA 3QX2A 5FBOA 2XK3A 4MXYA 4D1XA 2V62A 5IPJA 3UQFA 1JKLA 3CXWA 3B2TA 5A54A 4DAWA 2HELA 5DNRA 5GINE 4GL9A 5CEOA 4YTFA 4FIEA 3F88A 4LOOA 4CXAA 3DXPA 4IZYA 3AKJA 1Q41A 1XH8A 2JIIA 4PV0A 5TKDA 2UZBA 3GNIB 4R3RA 3N4TA 4D4VA 5AX3A 4D5KA 2ITOA 5J87A 2YA9A 4AXFA 3EL7A 4NJ3A 2CLQA 4U7ZA 2ETRA 1OL6A 2V0DA 2BALA 4D0WA 2I1MA 2OICA 3C0GA 5AUWA 2JLDA 3TKIA 4CLJA 4FICA 4L46A 3FLSA 3THBA 3W1FA 1J7IA 3LQ3A 5GNKA 3HDMA 3RPRA 3TACA 5HNBA 3VULA 4L53A 3EJ1A 4XBRA 4E93A 1FVRA 4PX6A 2VTLA 1VZOA 3BU6A 4D58A 3U8WA 4BBEA 1B39A 3TJDA 3C4FA 4F6WA 2BTSA 4XP2A 1NA7A 4GYGA 2A27A 3P7AA 3RCJA 4FG8A 1IA9A 2B52A 3LCTA 4IFCA 3O0GA 4J98A 3IPHA 1PXLA 3R7YA 2OLCA 3G15A 3F2NA 3V5LA 3ZLWA 3O8PA 4TNBA 4IAFA 2GFCA 4AG8A 3GXLA 1YOJA 2G2HA 3PXFA 4EOOA 3PSDA 4BDFA 2A2AA 3NUSA 3GGFA 3T9TA 3ZEPA 5AP7A 2CKOA 3BRBA 5HTIA 2PY3A 3AT2A 3PFQA 3FC1X 3N51A 4B8MA 5IA2A 4S34A 1OUYA 5K0KA 1ZY4A 2F2CB 4QDVA 4ITHA 4I4FA 3RPVA 4GG5A 5HOAA 4PPBA 3LCOA 5A46A 4ID7A 2HY81 1IASA 2YACA 2HYYA 3ZMMA 3PWDA 3HGKA 5GJGA 2ITZA 2JAMA 3G33A 2WMUA 4ZZNA 1KOAA 3HP2A 5IEYA 5HBHA 2AC5A 1OITA 3DBDA 4UMTA 2E9OA 3DPKA 3UZPA 1IAHA 3W0QA 5AP1A 3AT4A 3H30A 4YJQA 2C0IA 4D2VA 5FTOA 5LVMA 4KABA 4MUQA 2RG6A 3G9LX 1STCE 5IUGA 4FTUA 3UYSA 4HJOA 5GJFA 3GCSA 3QTRA 4FEWA 3QRIA 2FSTX 1P4OA 3E3BX 4EOQA 3CGOA 5HU3A 3C4XA 2C69A 3A60A 5J79A 3COIA 5HBJA 4D1ZA 4O4EA 2WIPA 3O8TA 4U5JA 1WBOA 3TWJA 5JGBA 3T8OA 3QA0A 3MA3A 3R01A 5IA5A 4DLIA 1GIJA 2W5AA 4GK4A 1E1VA 3ZO1A 4ANBA 4C8BA 1PXKA 2DQ7X 3NYVA 4Q5EA 5HG5A 3ZC5A 4AW0A 3OD6X 4EOIA 5D1JA 5LVNA 5LJJA 1PXOA 4FKUA 2ITXA 3TIZA 3FKLA 4A07A 4O7TA 3A7JA 1YI6A 4FSNA 2YCSA 4RFZA 4USDA 1R0EA 2YERA 5CEQA 4C4FA 3DK3A 4EH2A 2HY0A 1OKYA 2JAVA 2NPQA 5CQUA 4Z55A 2UZWE 4M67A 4U45A 2IN6A 3BKBA 5IH6A 5HG9A 2WPAA 3WZDA 1SNUA 2OWBA 3ZSGA 3KULB 3PE1A 1HCKA 1Q99A 5IQEA 4ZOGA 4DFYA 3BE2A 4UZDA 5HZNA 2GCDA 2XK8A 2YJRA 5EW8A 3CBLA 4CMOA 2OFVA 4B9DA 4PP9A 2GHGA 3PSBA 4YJSA 4IVAA 4S30A 3JVRA 3QCXA 4NM5A 2XEZA 1PW2A 2H6DA 4YJRA 3NS9A 4PNIA 4BCGA 4DTAA 5HIDA 3SLSA 2QOOA 3GU8A 4FKPA 5TF9A 2QC6A 2X39A 3ZXZA 4I5PA 2C5VA 3FZTA 1DM2A 2JKKA 3BGQA 4M8TA 5IZFA 3WE4A 3SG9A 2XNGA 3DBEA 4MX9A 3UMWA 2VO0A 2X6EA 4F63A 3FI4A 5DT3A 3PJ1A 4HCTA 4PUZA 3FPQA 2OH4A 3H9FA 3HRFA 4BB4A 2C6EA 4LMUA 2XB7A 4NM0A 4E4NA 3R9HA 5BV3A 4X2NA 3I81A 2B4SB 2R3KA 2J51A 3DK7A 1RDQE 1XKKA 1PKDA 4L3JA 3NNWA 2C5YA 2G15A 5DN3A 4ALUA 3C50A 2Q0BA 4GV1A 1T46A 1J7UA 3ZDIA 4I41A 4G9CA 1PXJA 2XKEA 3GQLA 2VRXA 4D9UA 3ZUUA 3O96A 2WD1A 1JLUE 4LOQA 5LWNA 3QCYA 5JFXA 4MKCA 2WMVA 4AA5A 4RQVA 4CKIA 3KCKA 3QLGA 3LJ2A 3CTQA 2WTKB 3OP5A 3VS4A 4C0TA 4EZ3A 1FVTA 2W4JA 1Y6AA 3R7EA 2JFLA 3SAYA 4OTDA 4Y5HA 4YJPA 4USFA 2GS7A 4OAVB 1XBAA 2B55A 3C0IA 4NK9A 4ZTLA 3RK5A 3RM6A 3WZJA 3R9OA 2PE2A 5EM6A 4IC7A 1O6YA 3BHHA 2I0HA 1CSNA 3F2RA 3SHEA 4M12A 5AR8A 1F0QA 4F1MA 4BN1A 2GNHA 3QRUA 1OL1A 3QXOA 4R5YA 1G8KA 2OSCA 4PMMA 1XJDA 3VC4A 2WOUA 4A9SA 2NRUA 1XH6A 3RK7A 4AE9A 2OU7A 3CCNA 5BUEA 3RAHA 5AEPA 4EONA 3Q6WA 3HUCA 4QQTA 4U3YA 2YDKA 1GIIA 2XCHA 4YJNA 3QL8A 5CI7A 3BWJA 3OCGA 4MQ2A 4N6ZA 1WBSA 5EDRA 2QR8A 2R3QA 4IM0A 4I22A 3U9CA 2Y7JA 1UWHA 3I0QA 3W2QA 2OXXA 1UKIA 4FODA 3DV3A 1ZMUA 2XNOA 3MIAA 3AXWA 2OJFE 3GP0A 4NTTA 5A3XA 5IQBA 4BRXA 3MY1A 5F4NA 3DKOA 5AWMA 4XG4A 5AIKA 4ZTQA 4C7TA 3DZOA 4FVPA 1M7QA 4Q9ZA 3TNQB 1M17A 1BL7A 5AA8A 2BAKA 5L2WA 1GJOA 2H8HA 2WAJA 4GW8A 4G2FA 4CD0A 4E4MA 1BUHA 2IW6A 4BCOA 3CKXA 4JDHA 3O5AA 3EFWA 1ZMWA 4EOPA 4U8ZA 3QTZA 3V3VA 5EYKA 2HOGA 2OW3A 4F0GA 4ZAUA 4ZEGA 3NCZA 2J2IB 2PVLA 3E8CA 4O27B 5IU2A 2PMOX 2RL5A 5DYJA 4J99A 4QMPA 3OY3A 3M11A 2YM4A 4JDIA 3ACKA 4C3RA 5J7BA 4RIOA 3AMBA 1V0PA 3EKKA 2ITVA 4GJ3A 1YI3A 3EFLA 2JBPA 2X6DA 4JS8A 5FDPA 1OIUA 2PU8A 3TTIA 2VGOA 4XG9A 2PVJA 2G01A 5FEDA 5TR6A 4R8QA 4RZVA 4UWBA 2OXYA 4CFWA 4CFVA 3SXFA 4QMTA 4FKIA 4DGMA 3R1YA 4M97A 4XG3A 2UZOA 3HA8A 1H08A 4BYJA 3LXKA 5KBQA 2PL0A 4JG6A 3UODA 4PMTA 2GHLA 3BGZA 2B9FA 4OUCA 4JL9A 3D5XA 4O7ZA 2BZIB 3WE8A 5L2TA 4XG8A 5AP3A 5CYIA 4RX8A 3RP9A 2ONLC 4JI9A 3PVGA 4U42A 2WMRA 4ZSLA 3RKBA 3A99A 4U44A 4QMSA 4XYFA 5BQ0A 3KRJA 4PL5A 2QOFA 4GYIA 3HX4A 3LFCA 5L8LA 3TUBA 2J0KA 3G6GA 5B0XA 1OKZA 5B7VA 4N57A 3RNYA 1WVXA 4O84A 3C5IA 4DFBA 3CR0A 4EHGA 4CTCA 5DIAA 3UNJA 3AC5A 3GT8A 4XX9A 5J5SA 4KKGA 4CRLA 3MB6A 4YPSA 4MTAA 4EK6A 2UW7A 3HLLA 2Z8CA 3BU5A 2BZKB 1K2PA 1QPJA 1XR1A 3AC2A 4JQ7A 4H1JA 3SXRA 1ZWSA 3OTVA 3HRCA 4FV0A 3G0EA 3RZFA 3D9VA 3KULA 3HUBA 2X0QA 2GU8A 3R9DA 4E1ZA 5J5TA 3HECA 2WQOA 4WBOA 1H0WA 4OT5A 4RWLA 4U81A 4X2FA 5H3QA 4CSVA 3AMYA 3HMMA 3FY2A 4MEDA 1RE8A 2G9XA 5M08A 2FGIA 2ZAZA 1J1BA 2VZ6A 2PVMA 5LXMA 1W2CA 2XMYA 3ZZEA 4YMJA 2RG5A 4GKHA 4GT4A 3R7UA 2RFDA 3BE9A 3OHTA 4I0RA 5HORA 2Y4IC 2J5EA 3AD6A 2VWYA 2YITA 3G9NA 3R2BA 2NYAA 4DEEA 5CXZA 3TNPC 2QHMA 1M7NA 1Q61A 5CALA 4PL3A 4WG3A 3QXPA 2I6LA 3QQHA 5AV2A 4EUUA 3PIXA 5L3AA 3CJGA 5HQ0A 5JSMA 3QA8A 4YZCA 2QHNA 5CWZA 3VRZA 2QODA 1FBNA 4BDAA 4IDVA 2PE1A 4CGAA 1S9IA 4UALA 5LQFA 4BF2A 5L2SA 5H8EA 3SV0A 5IA4A 3BQCA 3DFAA 4U80A 4PTCA 3PXQA 4MK0A 4RVMA 4OTGA 2PZ5A 4DEDA 2DS1A 4BKJA 1F3MC 3CC6A 4ANNA 3KRXA 3QGWA 5IUHA 1J1CA 1ZY5A 4IACA 2YIXA 4PL4A 5KZ0A 3DZQA 3WARA 4FKWA 5CT7A 1IAJA 2CNQA 4FTMA 1OM1A 4I5HA 4K11A 3ORIA 2HK5A 4FIFA 3UDBA 3MSSA 3TEIA 4CFUA 3AC4A 2X9FA 4BTJA 2C6MA 4EORA 4C57A 1G8AA 4M66A 3ZRLA 2IVSA 1NW1A 4BTKA 1W83A 3EQDA 1MP8A 5DEWA 4GJ2A 4A9TA 2QI8A 4XUFA 4EL9A 4EYJA 2IG7A 3GC8A 4D55A 2B9IA 4FNXA 4L44A 5HCXA 4IFGA 3RHXA 4C37A 4BWPA 3SOAA 5ETCA 2O5KA 3CKWA 3VIDA 3IW5A 4Y72A 4C4GA 2F7XE 1WVWA 3LZBA 4FSMA 5ANJA 1R0PA 5EKOA 2VWBA 4ITIA 2WTJA 4P90A 2FSMX 4HYIA 4BYIA 4CT2A 4KINA 4F1TA 4I3ZA 2WNTA 2C6IA 1H26A 2HZIA 4QNAA 3ROCA 3R30A 1RW8A 3QC4A 2ZMCA 3NSZA 3UOHA 2R3GA 3WF9A 4ZY4A 2R7BA 3W32A 3EN6A 3VUDA 2PSQA 2CSNA 4U0IA 5EH0A 3U87A 3QRTA 4G3DA 1YWRA 4X6RA 2O8YA 4EBVA 4YJTA 2Y8OA 3B8RA 3H9RA 2W96B 4NSTA 4ASEA 4C3FA 4CYJA 2W1FA 4YTCA 4R7HA 1OIRA 3VO3A 3DBFA 4GKIA 3TN8A 2QONA 3H10A 3K54A 3ETAA 1ZARA 1FPUA 1J7LA 2QOCA 4GU9A 4FKTA 4IZ7A 2V55A 3V01A 4ZXTA 3WIGA 4QTEA 4HGSA 3MYGA 4Z7HA 4FSQA 2R5TA 3VBQA 5E8ZA 5AUXA 5ANIA 4D2WA 5HTCA 3OCBA 1ZLTA 4M7IA 4IWPA 3PIYA 5M56A 3ZSHA 5F94A 2IVTA 1WAKA 2YFXA 4R1VA 4TTHB 5DHJA 3UZTA 2C6OA 5HI2A 5CTPA 4D2SA 3NUUA 5IH5A 2PMIA 3FLWA 2F2UA 3QTUA 4KNBA 4F9CA 4G9RA 1YDSE 5CAQA 2WMTA 3QALE 1IRKA 4RA5A 5GHVA 2WQNA 4D2RA 3W0NA 4ZMEA 4O0YA 2WGJA 3PA3A 3FZ1A 3BHVA 3BHYA 1OKWA 2C3JA 3TDVA 4EOLA 5B2LA 4UYAA 3PZEA 3UBDA 4EK3A 2QURA 3WZEA 5C8MA 2WTWA 4LRJA 5CU3A 3MVJA 4J97A 3R71A 3U6IA 2NRYA 5I9VA 4DHIB 1I44A 2ITTA 1YXXA 3CQEA 4FSUA 4L67A 1Y8GA 2OZOA 4ANLA 1XMMA 1M52A 1Q4LA 3W55A 3ZU7A 5CVGA 2VD5A 3QTSA 4NH1A 1JAMA 2WMXA 4QMQA 1SNXA 2VTJA 4FTOA 4FTQA 4EH5A 2I0VA 5IMEA 4CLIA 5FXSA 2CN5A 3BLRA 4I24A 4ALVA 3M1SA 5HE1A 3LFEA 3OWPA 1BX6A 3OBJA 4RIXB 4O7VA 3FE3A 5FP5A 3ZSIA 5HU9A 3RBWA 4LYNA 3L8SA 3TUDA 2XM8A 5HNGA 3ZXTA 4FZAB 2QVSE 2ONLA 4TWNA 2YAKA 3I7BA 4YNOA 3ORTA 4I21A 4YLKA 2IZUA 4PF4A 4LUEA 3GUBA 4CZUA 4XG6A 3OOMA 1QPEA 1YDTE 3FHIA 3II5A 5TE0A 4CCUA 4IVCA 2AUHA 3OXIA 5IA0A 3EQCA 4RFMA 4ZY5A 1NXKA 4ERKA 3SRVB 4DN5A 3RNIA 4I4EA 3I6UA 4RJ4A 5E91A 4J8MA 4PNKA 3RTPA 2UW3A 2WOTA 5DEYA 3H4JA 4KIKA 4BHZA 3BLHA 2C0OA 3U54A 2V5QA 4NIFA 4G5JA 3DAKA 3KRRA 2EU9A 2FYSA 3AC1A 3DB8A 3OXZA 3D15A 4DH5A 3F5PA 4F09A 3BL7A 5I9ZA 4G17A 4DHFA 3HV5A 2I7QA 1FMKA 2F7EE 4FEXA 4C3PA 3B8QA 2Y6OA 4ZLZA 3FV8A 3ORZA 1Y6BA 2X7OA 3KU2A 4HPUE 4EH7A 5A14A 4S31A 1MRVA 4FSYA 4APPA 1OMWA 5I0BA 3GFWA 3CJFA 3MVHA 3AMAA 5ANKA 4MVFA 2GNGA 2HWOA 3RAKA 4EOSA 5E8VA 1LPUA 4LRKA 4WUNA 3NUAA 4WRSA 2OIBA 2VWIA 5JGAA 2CGXA 3LW0A 4XP0A 2ZB1A 3LMGA 3TUCA 3IGOA 4DEHA 3CY3A 4CQGA 4QEBA 4ZTRA 4CFMA 3MH2A 4DEBA 4FTKA 3MS9A 4IAZA 4OTPA 4C38A 3VUKA 2C3IB 2IZRA 1ZAOA 3NEWA 4I0SA 5E90A 4TRLA 3RVGA 5B2MA 4IADA 3BU3A 4AA4A 2CDZA 4O1PA 1GIHA 3HEGA 3KMWA 3NNUA 5FBNC 3TYKA 4V0GB 1SZMA 2EVAA 3F9NA 2GNLA 3HP5A 4FTJA 1ST0A 3DAJA 1Q24A 3EB0A 3MI9A 4P7EA 3ELJA 3V5PA 4O4BB 4BVUA 4F99A 1VEBA 3FMEA 1XH4A 4D1SA 4GSBA 2ERKA 5T3QA 4HVGA 3N9XA 5A6NA 4DCAA 3QGYA 4F6SA 3CTJA 2BR1A 2YABA 4FV2A 3JPVA 5M09A 3W0PA 4DT8A 4UWCA 4MCVA 4QOXA 4USEA 4KSQA 4QMNA 2QO7A 2ZOQA 2RF9A 3ORKA 3ZM4A 3AC8A 3LFAA 5L2IA 1PMNA 2J0IA 5DH3A 5EM5A 5TOZA 5HVKA 4I23A 2PK9A 4BCHA 4O4DA 4YZDA 3QKMA 3PJ8A 4XLVA 3MJ1A 1R3CA 1XH7A 4IMYA 2A0CX 3DB6A 4F9YA 5FM3A 2YWVA 2CNUA 1TVOA 5CENA 4MWHA 4JBPA 4AZFA 3DY7A 2GS2A 4G1WA 2UZVA 2YLEA 3E63A 4NT4A 4EJNA 5AR4A 3IO7A 4OT6A 3E87A 3ZEWA 1DS5A 1B6CB 4CV8A 4F9BA 4BCIA 1R78A 4LQMA 1OB3A 2W4KA 3FY0A 1PMEA 4LI5A 2RFSA 2V7AA 4F7NA 4QMZA 4AP7A 4O7SA 4W4VA 3D0EA 5HO6A 5EOLA 1IR3A 2GTNA 2J0MB 1YKRA 3VS6A 3O8UA 3PXZA 2J6MA 4E4LA 4EWHA 5LWMA 2VWWA 4FK6A 2FSLX 5LCJA 5F20A 3R04A 4DHZA 4PRJA 3R8MA 3UC4A 1VR2A 2JDRA 3PY1A 5J1VA 4O83A 1REKA 3R6XA 1MRUA 2QNJA 3OCSA 5AP4A 5FEQA 2Y4PA 3SW4A 2HXQA 5BUJA 3FQHA 1GZKA 3EH9A 2BDFA 3MPTA 3R2YA 2CGVA 2W99B 4M3QA 4WNKA 3RPYA 2GSFA 3JXWA 4AAAA 1DAYA 2OI4X 2VWVA 3CS9A 3NYOA 3FMKA 4IM3A 4V05A 3ZOSA 3WYXA 3PUPA 5IG1A 1GNGA 2JKMA 1DI8A 1H4LA 1OL5A 2HZ0A 5IQFA 4BZOA 4NCTA 4Y46A 1ZYJA 2JKQA 3PIZA 3PP1A 1ZRZA 3QAME 4XEYA 2QR7A 3IW4A 3PJ2A 3NW7A 4G3FA 1YWNA 2VTTA 5A4TA 2QD9A 3SVVA 3W0MA 3QQLA 2C30A 3UQCA 5FLFA 3K5UA 2WB8A 4AOTA 1SMHA 1NVRA 1AD5A 2QO2A 3TNIA 5L6PA 2ZM1A 3BYMA 5M53A 2RIOA 1LUFA 3KB7A 4X0MA 3P0MA 3TV7A 1KV1A 2OZAB 1PYXA 3HMOA 3LFFA 3PY3A 4O0VA 3SG8A 4GRBA 2HZNA 5AV3A 4BZDA 2IPXA 4RIWB 4P4CA 4RJ3A 2XRUA 5J8IA 1A48A 1UA2A 4PDPA 4EC8A 4EWQA 4ZMFA 4QPAA 4GFMA 4O4FA 5BNJA 4FUYA 4ZLYA 3HV4A 3JYAA 2J7TA 3DKGA 4FYNA 3VQHA 1KE7A 4LG4A 3UDTA 4EK8A 1ZOHA 3C13A 4H3QA 4YU2A 3KXHA 1UNHA 3VONA 1MUOA 2H9VA 3AKKA 4TT7A 4OW8A 4QMLA 4S33A 4TL0A 2GFSA 4GT3A 3FSKA 3MIYA 4EH4A 5ANOA 2BRNA 3WF6A 4M84A 4WNPA 4K8AA 3KIOC 1UVRA 4O38A 4AW5A 2WTKC 4FTNA 4FV3A 2GNIA 4XMOA 4LM5A 5C27A 4QMWA 5IMXA 3EQRA 3L9MA 2GQSA 3OBGA 4O2ZA 4XHKB 3A61A 4RWJA 4RBLA 5J7HA 3QHRA 4NUSA 3UVPA 2PVYA 1A9UA 2OFUA 2P4IA 3EQIA 4I92A 4YO6A 3QD4A 2XAOA 4MD7E 4BR3A 1F5QA 1H1WA 2GTMA 2JDSA 2C1BA 1URWA 2R3IA 4QQ5A 5AIRA 5J1WA 3AKLA 3L8PA 5E1EA 5EI6A 2VWXA 4JLCA 3UYTA 3NIZA 3R02A 4DGNA 2B0QA 2UZNA 4O0XA 4G16A 3ALNA 3F7WA 3VBTA 4OBQA 4F70A 5HLWA 3R9NA 3UO4A 1M2QA 1APME 4R3PA 4AT5A 1ZXEA 4BCKA 4CYIA 5FTGA 3V6SA 2R3JA 4DH7A 5C01A 4EQCA 3UNZA 4I0TA 4DH8A 4JR3A 4E8AA 4E3CA 5KMMA 1IEPA 2P2IA 1UWJA 2CNVA 4EJ7A 2ZV8A 1L8TA 3R7GA 1ZOEA 5CAVA 4KSPA 3A4OX 5F1ZA 1YW2A 2OBJA 3FMNA 3KEXA 4O4CA 2IW8A 3L9NA 4AWIA 4HW7A 3QQKA 5JT2A 3TG1A 3COMA 2YISA 4IVBA 1YXVA 4FKOA 2GDOA 4JIKA 5D9HA 3F7ZA 3FZSA 3ZDUA 2XF0A 2ZDUA 4ACDA 2PZRA 3W0RA 5ACBC 4GS6A 3DU8A 3Q3BA 5LMBA 4V0GA 4IB3A 5DI1A 1TQPA 4BICA 3PA4A 3F61A 5LVOA 3NMUF 2FH9A 4FKLA 5KNJA 4AZVA 5CSPA 1OPJA 3BHTA 4JXFA 5L4QA 4U9AA 3ODZX 4C61A 1YXUA 4K1BA 4YZMA 4H05A 5C1QB 4B8LA 3B2WA 2A98A 4TYJA 3HL7A 2UVXA 3NAYA 2XNBA 4FSWA 4HVDA 4QPMA 3DBQA 4H58A 1BKXA 4JRVA 3R7OA 4JDKA 3IDCA 4MXAA 4ZZOA 4MYGA 5AFVA 2GMXA 2ZV2A 4HYUA 4FZFB 3PDTA 4FIJA 2OJ9A 5L8KA 3PFYA 3U4WA 4F0IA 3C0HA 4Y85A 1V0OA 1VYZA 3FXXA 3FMHA 3GC9A 4MXZA 3S3IA 3T9IA 3KXNA 4IXPA 1DI9A 4MXOA 3JVSA 1Q8ZA 1U54A 4DG3E 4Y73A 3SQQA 5EKNA 1Z57A 2J9MA 2XJ0A 3PLAE 5JN2A 4BY9E 2YJSA 1G8SA 4NZWB 4AFJA 3TKHA 3DJ7A 4FRFA 3ZBXA 3ORLA 1MQ4A 2Z60A 4AX8A 2XYNA 3F66A 4F1OA 1QPDA 2EB2A 1SVGA 4XRLA 5FRIA 4YUQA 5KMIA 2JDVA 4O21A 4FSRA 5FP6A 3TT0A 3DT1A 1YDRE 3D14A 4CNHA 5BMMA 4EH8A 5BX0A 5DOSA 2X0OA 4QYGA 4FOBA 2UVYA 2BILB 5DVRA 3ZLXA 3MB7A 3LMIA 4E6CA 4O2PA 2R3OA 1TQIA 5ANGA 4EHEA 1OGYA 2PMLX 5CVFA 2C3KA 1VJYA 2PTKA 2BRHA 3MPMA 4G6OA 3A7FA 1WBVA 2WTIA 4ACMA 4OTIA 2OJGA 3UNKA 2X0GA 4DTBA 5AR5A 3RAIA 1PXIA 1K3AA 5HKMA 4GFOA 1PY5A 3NFFB 2JKOA 2R3NA 4BWXA 3IONA 4FX3A 4OAUC 3W2OA 3MVMA 2VTQA 4FJVA 3FMMA 1Q5KA 3NW5A 3ORMA 3QRJA 2F9GA 3VUGA 2R3FA 1WZYA 4GUEA 3PYYA 3R1NA 4QYFA 3EMGA 1JBPE 5HD7A 3RWPA 3ZLYA 5EK7A 2SRCA 3O51A 5I3OA 4IX5A 5DE2A 3RM7A 2QCSA 4L8MA 5D12A 4E5BA 3S1HA 4I5MA 3VS5A 3OG7A 4IWQA 4JG7A 3Q60A 4R6VA 3BEGA 2GQRA 4YHFA 3CE3A 4DA5A 4BI1A 3L8XA 4ASXA 4BBFA 5JQ5A 3KC3A 3HNGA 1JKSA 1YHWA 2PZIA 3LHJA 3P1AA 3NNVA 3Q32A 5AP0A 4A4OA 5LVPA 4M0ZA 3DLSA 1H28A 4FKSA 5CI6A 3E8DA 1RQQA 2OZAA 4BCPA 1LEWA 5D7AA 3LE6A 5AADA 2XALA 3RMFA 4LL5A 2WQEA 3OCTA 3PXKA 2FA2A 2UW4A 5IQHA 4O0UA 4G31A 3HDNA 5IQIA 4O0SA 4QYYA 4RIWA 4ZLOA 4G34A 4QP6A 2CGWA 3P78A 3F82A 4DEAA 5CXHA 4O0WA 4QMYA 3ORNA 1FINA 4BCJA 2B7AA 4EKLA 3PP0A 4FTTA 4B99A 3I6WA 3BX5A 1NVQA 3CLYA 3PSCA 3C4CA 3DA6A 3PY0A 4FI1A 3PJ3A 4NW5A 3ZZWA 4ASDA 3IDBA 5M51A 1GOLA 4QYHA 2XUUA 3Q9YA 2UZUE 4AZSA 4CEGA 1ERKA 2PULA 4GT5A 1KWPA 2W1HA 3ROYA 4Y83A 4AGWA 4E5AX 2R3HA 2YN8A 1Q8UA 3DFCB 4XH6A 3DCVA 3KMMA 3NYXA 5HTBA 3F6XA 3G5DA 4BIEA 4RX5A 2XJ1A 2C1AA 5TO8A