5T68A

Crystal structure of syk catalytic domain in complex with a furo[3,2-d]pyrimidine
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
275
structure length
266
Chain Sequence
VYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVNEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase SYK
publication title Synthesis and optimization of furano[3,2-d]pyrimidines as selective spleen tyrosine kinase (Syk) inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 81
structure length 266
sequence length 275
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2016-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5t68A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5t68A01
4ZZNA 3OXZA 4E1ZA 2X81A 2C6KA 3RI1A 3OHTA 3VUHA 2BZHB 4AT5A 1AGWA 1MP8A 3GOPA 3RWPA 1KOBA 4YJUA 3FSKA 4AE9A 4C57A 2QURA 1FGIA 3V5QA 5KHXA 4YTCA 4RX8A 5CTPA 5I9YA 3CC6A 1YXUA 3P86A 4F9CA 5IH4A 4D4YA 2XIRA 4YJRA 4IACA 4IX4A 5IQAA 4JBQA 4TL0A 5A4EA 2E9VA 3C4WA 4YC6A 4R77A 4BC6A 4Z7HA 4JXFA 2OXDA 4FSZA 3CKWA 1YWRA 4M15A 5DEWA 5IF1A 5BVNA 5E1SA 4GVJA 2WB8A 3ZUVA 1P5EA 3GU7A 4FTAA 2WTDA 3H4JA 3RK5A 3UO5A 5GIPE 3D5WA 4LI5A 3LHJA 4O1PA 4RIWA 3JR1A 2PMLX 4J96A 4FKUA 2VTPA 5HIEA 4XG4A 2Z7LA 3H0YA 3QHRA 4EKKA 3F3VA 4YNOA 1KE6A 4HVIA 3PPJA 5JH6A 5H3QA 2EVAA 3R1SA 2VD5A 5FP5A 2B55A 4GKIA 3S4QA 1YWNA 3OF0A 3NSZA 5E91A 4PNKA 2UZOA 5E8VA 3OUKA 3FPQA 4XP3A 3QKMA 5ANOA 4YO4A 3RK9A 4TPTA 3HMPA 3U6HA 3QC9A 3WIGA 3RK7A 3DXPA 4GIIA 3FBVA 4ZSEA 3BZ3A 2FO0A 1A06A 4AA5A 2H6DA 2VWZA 2WTJA 3NLBA 4BKZA 1WBSA 2GNHA 1OKWA 5HD4A 5AX9A 3CTHA 5AR8A 5AV2A 3FEGA 2BFXA 3I4BA 3K5UA 2WIHA 2XBJA 5CEPA 2IPXA 3KRJA 3BLQA 4MD9E 4ZTNA 2W05A 3PFQA 3QRIA 4AZTA 2HZNA 4FKTA 4AF3A 5CU3A 5CSWA 5IA5A 2YIRA 3A8WA 2CCIA 2VTNA 2ZM1A 4F64A 3ODYX 4ANLA 4HZSA 5CAVA 4Q5EA 4YC3A 1KOAA 2QO9A 3PZEA 3ETAA 4H1MA 4U42A 5HG7A 5LVNA 4RJ4A 4IH8A 1K3AA 1KSWA 3HLLA 3MPAA 1M52A 4FOBA 2XUUA 4FKOA 1W84A 4YZNA 3G51A 5HCYA 3EQFA 1UWHA 5G1XA 2RKUA 4LG4A 2BROA 2R3QA 4QP4A 4YZCA 4ZZMA 3D0EA 3PPKA 4K8AA 4D5KA 3U4UA 5K0KA 1JOWB 5CQWA 1P14A 2ITQA 3C0IA 4FC0A 5B7VA 2H34A 5J5TA 3JY0A 5I4NA 5ANEA 3GB2A 3AT3A 3FKNA 2R7IA 4YJSA 4TYHB 3QTZA 1H07A 4DFUA 1YOMA 3C51A 5CSVA 4F9WA 3TNPC 4F99A 4FNZA 2LAVA 2HW7A 2R3KA 3R9OA 2R3OA 3GBZA 4JVGA 4RVTA 5CASA 4DT8A 4D1ZA 4OTRA 5AEPA 3TI1A 5LJJA 4CFUA 4YUQA 4BY9E 3Q32A 4FV3A 4W4VA 5EDPA 1FINA 5J7BA 4EWHA 3OCGA 2QG7A 4K33A 2JD5A 1WBPA 3OC1A 3LPBA 4YSJA 3ZUUA 3FQSA 3ZTXA 3R8LA 4H58A 3QC4A 2W5HA 5F94A 4GJ2A 2XK9A 3MTFA 3DBDA 3CJFA 4IWQA 5JGDA 2PZ5A 2QHMA 5DVRA 3LW0A 5HLPA 2KTYA 1UV5A 5EG3A 1U54A 4ZEGA 4A4LA 2W99B 3KCFA 2H8HA 4FIGA 4TW9A 4XUFA 2JAVA 5L2IA 2W1IA 2H96A 4ONAA 5IA4A 2J0IA 4N6YA 2W1HA 4U6RA 2YCSA 4IZYA 3TTJA 4KKHA 5HKMA 5HCXA 3LM5A 2B9IA 4AOIA 4QQTA 2QOKA 3E93A 2PVFA 1Y6BA 1JKKA 2XJ2A 3UOHA 4S33A 3MI9A 3PA5A 3N4VA 2ITNA 2YCFA 3BGZA 3VUKA 2NNWB 3ZC6A 4AA4A 4JRNA 4D4SA 2UVZA 3Q3BA 4NW6A 1XO2B 3WILA 4EBWA 4RWKA 1RDQE 3NUPA 1JSUA 2OO8X 3NYNA 3U51A 5D1JA 3DPKA 3QWKA 3PJCA 5HD7A 2XNMA 3TTIA 3VQHA 4F1TA 3PIYA 4EJNA 4X2NA 3OFMA 5EH0A 4OTGA 4UY9A 4YU2A 2R3NA 1IAHA 4AN2A 4ANNA 4RSSA 4YGAA 4FZAB 5HQ0A 5AR7A 3ALNA 3LFBA 3VF9A 5KKRB 3SA0A 3D2IA 3G90X 2C3KA 3EMGA 4DC2A 4FEQA 3FMEA 4OT6A 2CPKE 3C4CA 4K6ZA 4YZMA 3QWJA 5AP0A 1OM1A 3ANQA 4ZMFA 1M2RA 4ZS4A 1XBCA 3E8NA 4RIYA 4QMQA 1XH8A 4IIRA 4O81A 2FB8A 3ZFXA 1NXKA 5BUJA 4JR3A 3P79A 5EM6A 1PW2A 2WHBA 4C0TA 3RPSA 3UYSA 1UNLA 3TJDA 2CGVA 1YI6A 4QPMA 5BMSA 3BX5A 3Q4TA 2C3JA 4TN6A 3NPCA 4FICA 4JI9A 3G0EA 1LR4A 5ANKA 5LVLA 3UPXA 3VBXA 1W82A 4O2ZA 4ZY4A 2BDWA 3CBLA 1YXVA 3QUEA 4LL0A 3L9MA 2GNGA 3AXWA 2VX0A 3FWQA 2VU3A 3MA3A 4RZWA 4C59A 1GIIA 3MTLA 4IZ7A 4AGDA 2FYSA 2XNEA 3LAUA 4HGSA 4KIQA 3T3UA 3R8UA 2C6EA 2XYUA 2WMRA 4YLJA 2VGOA 3GFEA 4WA9A 3FQEA 5HLNA 4JDIA 3MVHA 4BTJA 2E9UA 2JIVA 3VBWA 4C58A 2QI8A 1KV2A 5JRSA 2QO2A 4D1SA 2LGCA 4OGRA 3G9LX 5IEVA 4JDKA 1M2QA 3KRWA 2G15A 3NUYA 4C61A 5DI1A 5HZNA 2JGZA 4QTBA 3FYJX 1KV1A 4FZ7A 5HX8A 4FTLA 3PG3A 2ITXA 4H3BA 4P4CA 5AP3A 2WQEA 2OJJA 1CMKE 4FT7A 3D5VA 1KE5A 5BVOA 4O7VA 2QLQA 4D0XA 1AD5A 2GMXA 3DFAA 3EJ1A 5AP4A 4FVPA 5CF8A 4DEEA 1OKZA 2VV9A 2XIZA 2XS0A 1NVQA 3FKLA 1P2AA 4RBLA 2I0VA 2CKOA 4J52A 5EI6A 1DI8A 3BHVA 4YPDA 3D94A 4Z16A 1H1RA 4G3CA 3Q9WA 5G6VA 4UXQA 3ZZWA 5LVMA 4Y73A 3FI4A 3PY0A 5AM6A 4FTUA 4TTHB 3EOCA 1JAMA 3POOA 3LFEA 3R21A 1QPDA 3FY0A 3KXGA 4FSTA 5GJDA 5FXQA 2F49A 5M51A 3DY7A 4TXCA 3BU6A 2J5FA 2VWIA 1LP4A 2R3MA 4EQCA 3I7CA 2WMVA 5CANA 1OB3A 1VEBA 5I9XA 4GU9A 2GNJA 2RG5A 4MNFA 5HNIX 4M69A 3G33A 3W1FA 4FL2A 4JG6A 1DAWA 5D7AA 4R5YA 4ZY6A 2W1FA 4ZK5A 4G9CA 3W10A 3W2RA 1I44A 4B4LA 5C01A 3C5IA 3F7ZA 3MS9A 1P4FA 5KX8A 3II5A 2BUJA 3WARA 5LWMA 2UW5A 4RT7A 2XCKA 3NYOA 4EOPA 1ZAOA 4F70A 3QA8A 3TKIA 2ZB1A 5JEBA 2YWVA 4PMSA 5JRQA 4XH6A 3ERKA 4I6FA 4ACCA 3C1XA 2QQ7A 5M53A 3V8SA 1DAYA 3W55A 4EK5A 3QGWA 5L6PA 4QP2A 3OMVA 4J1RA 3ZLYA 4D9TA 3IW4A 3M2WA 4X3FA 1YDRE 3H9RA 4YO6A 3P0MA 3CQWA 4XV2A 2ETRA 3HMIA 3PYYA 3QQFA 4IJPA 3MH3A 4JIKA 3A4OX 5I9VA 2ZOQA 5AP6A 2XM8A 4ZIMA 3UG2A 3UZTA 2CKPA 4FZFB 2WOTA 4MCVA 1AQ1A 2ZYBA 5FD2A 5CX9A 4DTAA 4NZWB 4AQCA 2CKEA 4Z3VA 4GT4A 4YJTA 2O3PA 4FNWA 3L8SA 4U3ZA 2PVMA 3PSCA 4D2WA 4YTFA 1JKSA 1H27A 2H9VA 1OL2A 4QD6A 5AFVA 4C62A 1OECA 4PL5A 4N57A 5JN2A 4HPUE 2X4ZA 4MHAA 3KU2A 3SQQA 4HZRA 1B6CB 3W8LA 2V0DA 4C3RA 4PRJA 4F1MA 1ZYDA 4FV0A 4R1YA 2B4SB 2F7EE 2OK1A 3Q4UA 4I0RA 4JDJA 5T3QA 3IQ7A 3KULB 3F5XA 2NPQA 3B8RA 1PXKA 4DEDA 3V5TA 3RPVA 3R1YA 4M66A 4I24A 4JG8A 1BMKA 4JAJA 2FA2A 2X6EA 3MY1A 4QPAA 2ACXA 2O65A 4BCMA 4HYIA 3RVGA 3KFAA 2XNGA 4YBKA 4DGNA 3PWYA 2PWLA 2WGJA 2XEZA 3QHWA 4FZ6A 3TV7A 2HIWA 4FSWA 4I5CA 4XLVA 4JQ7A 3W18A 4DG2E 2B9FA 3LFQA 2VNYA 3OWPA 2PMIA 4RIOA 2C3LA 3HV4A 2Q0BA 4MNEB 5GIOE 3UVRA 2BRBA 2OJ9A 4LM5A 1QCFA 5JK3A 1SYKA 4XJ0A 5TKDA 4M68A 2YM6A 5ANGA 1NT2A 1BYGA 3H3CA 4AZFA 5AAGA 2VX1A 2WAJA 3NEWA 4NCTA 3VBQA 3BI6A 4E20A 5JFVA 5B2MA 2O0UA 4APPA 3HAVA 4I41A 4M3QA 3EKNA 4QMZA 3T9TA 4B8LA 2VTAA 3BV3A 1PMVA 4LL5A 1XWSA 1GY3A 2VTOA 3V5WA 3KF7A 3NWWA 2PE0A 4AU8A 3NYVA 1ZZ2A 5CAOA 4CKJA 2XRUA 3WYYA 4HCTA 3UMXA 3NUAA 2PZRA 5H9BA 3TZ8A 1YHSA 3HL7A 2E9OA 5LMBA 5FGKA 3HNGA 5CZHA 2JDRA 3DLSA 3G6GA 3JUHA 4QQJA 2PVRA 3MH1A 3VIDA 2WMUA 1WBNA 2OZAB 4RC2A 4AW2A 1KE7A 5CSXA 1UU3A 4C37A 3RTPA 4BYIA 3R9DA 3TZMA 4JQEA 2C0IA 3H30A 2WMQA 2WQOA 3DKCA 3G2FA 4YZDA 4CG8A 4MBIA 2WKMA 4BDAA 3I6UA 3OWJA 3SC1A 2O64A 4OTIA 2WEVA 4GU6A 3O71A 4RA5A 4YLLA 4BDBA 4BRXA 5M4FA 4ITJA 5DLSA 4A7CA 2IZTA 4RFMA 3W8QA 4B0GA 1Q3WA 2JIUA 4NM5A 4H05A 4PPCA 5HCZA 5A3XA 4YNEA 4NIFB 4EOMA 5LARA 2HZIA 2BDFA 3CY3A 3LXPA 2W1GA 3UE4A 4AZEA 4X0MA 3QD4A 2YDJA 4IEBA 4Q2AA 4G6LA 4BWPA 3IGOA 1H0WA 3TEIA 3TT0A 4C34A 5FTGA 1CDKA 2OI4X 3BEGA 2WTKB 4K18A 2YIXA 3EFWA 4JX7A 4E5WA 4JQ8A 3COMA 3ZLXA 4HW7A 2EXEA 2DS1A 2Q0NA 3LFNA 3FLZA 3Q6WA 4H39A 2PYWA 3QYZA 4IB5A 3ZS5A 4AWIA 3SW4A 2IW6A 4FVQA 4GW8A 4RIXB 3LE6A 3F2NA 3LXNA 4RX7A 3EWHA 4XLIA 4XOZA 3TL8A 3VUIA 2UW9A 3FPMA 3R02A 5BUIA 4MBJA 2WTWA 3VBTA 1G5SA 5L2WA 1KE8A 5C26A 4FG7A 2ITVA 2R3HA 2QOCA 3UJGA 5HU9A 4MTAA 1B38A 4ZSGA 3ZO3A 4R5SA 2C69A 5E8TA 2X2MA 3Q9YA 4IDVA 2PMNX 4YHFA 1M17A 3LCSA 4GK3A 5H8EA 4F9BA 3HYHA 4EOSA 3ZSIA 2ITPA 1OKYA 4FV1A 3DKOA 3NMUF 4KIKA 3UOJA 3ATSA 2R5TA 4NSTA 5GINE 1VJYA 3LM0A 1RE8A 3WOWA 2G1TA 3DS6A 3R63A 4U44A 4CLIA 3U6JA 4RC4A 4AT4A 3QTRA 4RJ5A 5DPVA 3BKBA 3F5PA 2JLDA 3PRFA 3F2RA 1WVYA 4DEGA 4O7RA 4IJ9A 1YHWA 1JKTA 4ALUA 1E1XA 4YJOA 2JDSA 5IDPA 4H3QA 4RQKA 5KZIA 4GFGA 1A48A 3L1SA 4LV8A 2VWWA 1UNHA 4H1JA 3NS9A 4I94A 2X6DA 4MVFA 4FX3A 4CT2A 4IVBA 3OEZA 3HX4A 2X1NA 4ZJVA 2X9FA 3DFCB 3DZOA 4P5QA 4ANQA 3A61A 3GXLA 3KGAA 3DKGA 4DEIA 3SG9A 2UZDA 3KRLA 3BHTA 4I1ZA 4CQGA 4D2TA 3NX8A 2RGPA 4IW0A 5J8IA 5JZJA 4QNAA 5HOAA 2R64A 1MRVA 2PMOX 4JOAA 4QT1A 4DH5A 4G3GA 4R1VA 1XQZA 1ZZLA 4FTQA 3CPCA 4RJ6A 4BKJA 5I3RA 3UTOA 3PWDA 3ZMMA 2XZSA 4PDOA 1U46A 2BVAA 3QRUA 4KB8A 5FDXA 5LMAA 2VO7A 2C6LA 4DGOA 1PMUA 3MVMA 3HEGA 2YACA 2B9JA 2WD1A 2XNOA 2Y4IB 4C2VA 3D2KA 3FI3A 3V8TA 3L9NA 1REJA 4Z7GA 4F08A 3QCYA 4FUYA 4EH2A 5CU2A 4AN9A 4FVRA 4G6OA 3GFWA 2YCRA 3QGYA 4J98A 3LMHA 3HAMA 4QMMA 2VTHA 3IW6A 5HX6A 3LKMA 2GSFA 3UO4A 2YHVA 4BHNA 4FTRA 1S9IA 4XRLA 4RPVA 1SVGA 2WMAA 2YABA 5AX3A 5HG8A 3SV0A 3SXFA 1YI3A 3H0ZA 4BCJA 2VWYA 4PMPA 1Q24A 3AMBA 1FMOE 3F88A 4KSPA 3VHEA 4LUDA 4F65A 2OH0E 3R28A 3ITZA 5ETFA 3N4UA 3LIJA 3C4EA 3TN8A 3OW4A 4WG4A 4RQVA 1OBGA 5JT2A 3PXQA 3SRVA 2XK8A 3R8PA 4UZHA 1OL7A 4BIEA 4ERWA 3ZM4A 4FKVA 3IDCA 1HOWA 3UPZA 3PRIA 4ITIA 1Z57A 2G2HA 5FG8A 4EH5A 4O7LA 2ZMDA 5CI7A 3TNHA 3ZBXA 4CT1A 4UMPA 4ALVA 3Q9ZA 4X2GA 5CU6A 5EDQA 3AT4A 1XBAA 4AZSA 2ZV8A 3CTJA 3Q96A 4RJ3A 4ZTQA 2QOFA 3Q2MA 4IM2A 2WTVA 2UZBA 2FVDA 2Y6OA 2GPHA 1XJDA 4TWCA 5GJGA 3OY1A 1YXTA 3DOGA 3CQUA 3ORPA 1SM2A 3IDPA 3OUNB 3U87A 3WZJA 4DEAA 2G2IA 2ONLC 2W9ZB 2X2KA 2ONLA 4K9YA 3QCQA 5CYIA 2R2PA 1O9UA 3TIZA 3LZBA 5LVPA 3EYGA 4BBMA 3ANRA 4ASDA 1V0PA 2VRXA 3R9RA 2YM4A 5HG5A 2ESMA 3TACA 3FL5A 5DH3A 4AGUA 4KIPA 5LXMA 3QTUA 3MPTA 2F2UA 2XRWA 1PRYA 3FMHA 3TUCA 4HCVA 4B99A 1OUKA 3AT2A 1DS5A 1PXPA 3OEFX 3QYWA 3NRMA 3BYSA 1MQBA 4QP8A 4ANSA 5ICPA 3WBLA 5D11A 5DFPA 3HECA 3F5GA 3DAKA 3ZOSA 5HTIA 3DQWA 3KMWA 4WNKA 4U8ZA 5AJQA 1ZMWA 3R1NA 3AD4A 3VW6A 2VWBA 4S2ZA 4V0GB 4DBXA 3O0GA 3A7GA 3GU6A 1WVXA 3COKA 2BAKA 4FK6A 1UVRA 4APCA 4EZ5A 4EYMA 2GTMA 4KAOA 1URWA 3PXKA 5AR2A 4FYOA 2IO6A 1PHKA 2BAJA 3KN6A 3JS2A 4PP7A 1ZXEA 5KNJA 2W4OA 4GT3A 4QYGA 4G1WA 5E8ZA 3QF9A 4QP6A 4C2WA 2UUEA 4FGRA 3NNVA 1NW1A 5EFQA 2BHEA 3LFCA 1YRPA 5BVFA 4HYHA 4JL9A 5BMMA 4ZTSA 4IAYA 4GMYA 2VTSA 4D2RA 2WQNA 1PKDA 3FZOA 3VF8A 4S34A 3D7TB 5EHLA 4NKAA 3MY0A 4DCEA 5E92A 4EOJA 2NRYA 3U9NA 5A9UA 2VTTA 4OTWA 1JQHA 5IDNA 3L8PA 3UVPA 5CF5A 2X7FA 3F5UA 2GU8A 4NTTA 3WYXA 4M14A 2RFEA 3PVGA 4QMOA 3AG9A 2OWBA 2C0OA 4ACGA 5FDPA 2JKQA 3EN6A 3NW7A 4FIFA 3CY2A 4PQNA 5EM8A 3BQCA 4ZS0A 2CLQA 1XBBA 3DXQA 4A4XA 3CXWA 3DJ6A 3LFSA 3MH0A 4FIJA 2BR1A 4FUXA 3MFRA 3QQGA 3RAWA 5IQBA 4KA3A 4NM3A 2V7OA 4AZVA 1GZKA 5CT7A 3ZCLA 2OF4A 3FZSA 3GU4A 3WE8A 4QYEA 3DDPA 4FV6A 3VS6A 1PXLA 4EYJA 4HOKA 1P4OA 3AGMA 4MXCA 3HGKA 1Y6AA 2RF9A 1JBPE 4G31A 4JG7A 4XG2A 3A8XA 2DQ7X 4ASEA 3EZRA 3PJ2A 3GI3A 2PVKA 5ANDA 4NH1A 4FKGA 2QO7A 4QP3A 4HNFA 4FTMA 2BRNA 2YZLA 3ZFMA 3CS9A 3ZO1A 2CGXA 3E7VA 4KS7A 4KBCA 3FLYA 4PL4A 3B8QA 5KUPA 2PVHA 2WO6A 3FAAA 4FTTA 3O50A 5AP5A 3RHXA 5CU0A 3BLHA 4RLKA 2HY81 3RNIA 5HLWA 2W17A 5M4IA 4GT5A 2QOIA 1H25A 2XKFA 2JKKA 5C8NA 2WELA 5JMSA 2VX3A 3UZRA 3LLAA 4NYEA 4OW8A 4D1XA 3QKLA 4R7HA 4DT9A 1Q61A 4LV5A 1ND4A 1E1VA 2WMXA 5IQHA 4MYGA 3V8WA 3WZKA 5JQ8A 1R39A 3NW6A 4D9UA 3QQUA 4FV7A 5IU2A 4IM0A 4B9DA 1BL6A 2W9FB 4WNMA 3REPA 4OTDA 2C5VA 4FKLA 5J79A 1JPAA 3IW5A 2Z7RA 2HW6A 4RVLA 1RJBA 4AW1A 3A99A 2I1MA 3DBCA 4U41A 5JKGA 3U8WA 3L8VA 2PUPA 1OIUA 3P9JA 3UNZA 4N70A 4O7ZA 3F61A 4GG5A 2XK6A 1E9HA 2WOUA 3ORIA 3JXWA 3UC4A 3UIMA 4FEUA 3EFLA 4EH6A 4AX8A 3E88A 3DB8A 3T8OA 4EI4A 2WFYA 3D14A 4NL0A 4BDJA 5CF6A 3LQ3A 4RA4A 4N0SA 5IZFA 2RSVA 4FBXA 4AE6A 3OW3A 3OZ6A 3F3UA 1GIHA 3RPRA 4EL9A 2YAKA 4IM3A 3DNEA 1OUYA 4LMUA 3T3VA 2CMWA 4C4EA 4C8BA 4TY1A 4XV1A 2Y0AA 4IVAA 5HI2A 5FQDC 3ZLWA 4NUSA 2FSMX 4IFCA 2FUMA 3DKFA 4QYYA 2NO3A 4TYHA 2BCJA 4IB0A 4QMTA 5EYDA 2IVSA 4EWQA 5TO8A 4DGMA 3HRFA 5AA8A 3WZEA 3VN9A 3TNIA 2Y6MA 3KRRA 3OBJA 4G3DA 3VO3A 4QMVA 4OBPA 3N9XA 2W4JA 5C8KA 1H1WA 2CSNA 4LMNA 4UZDA 4Y83A 4F63A 1OKVA 5CNOA 2J5EA 2IW8A 3FC2A 1Q8UA 3LXKA 3OXIA 2J51A 1NY3A 4ZY5A 3A2CA 2GQRA 4O38A 4IB3A 5DN3A 2ZV9A 3F6XA 1UWJA 1G8AA 4FNXA 3DA6A 5K3YA 1J7LA 1Y57A 1GOLA 4ZLZA 5J5SA 2OKRA 4O7YA 3VJNA 2V22A 2YERA 4F7NA 4PDYA 5M08A 1W7HA 4RWJA 4Y5HA 4U45A 4RVMA 4NEUA 3AD5A 4IHPA 3TCPA 5HO7A 2GNLA 2VAGA 2QC6A 2UW4A 4S32A 3SOCA 5C4LA 4BTFA 2ZVAA 3F7WA 3ZEWA 2F7ZE 3HDMA 2XJ0A 3BYUA 4O0UA 3RCDA 4D2SA 4H36A 3UGCA 4L46A 3DAEA 4DH3A 3LJ1A 3ENHA 2E9NA 3IGGA 4HYUA 3HUBA 4FKSA 3UQFA 2QR7A 2OU7A 3LMGA 3EQRA 4UMTA 3RP9A 2J0LA 2CCHA 2PK9A 4UYAA 5I0BA 4ORKA 1XHAA 4F6UA 3GOKA 2BFYA 3LCTA 4E93A 1BX6A 3RAIA 2R3FA 3OY3A 4EUUA 2CN5A 4AS0A 4QTDA 4CMUA 4F7SA 5IQIA 5F95A 5CENA 2QG5A 2J2IB 3ZRLA 1CTPE 3EQGA 3E62A 3EH9A 4RZVA 3CD8A 4I21A 1CKJA 5AM7A 2O8YA 3FMJA 4YTHA 5GJFA 3U55A 3UOLA 2X39A 2P33A 4FSNA 3W2OA 5B2LA 4ANBA 4FV9A 2EXCX 3ORKA 3R8MA 3OOGA 3JPVA 3PVUA 1ZARA 1OBDA 2JDTA 3FMMA 2XBAA 4E7WA 4QQCA 3TZ9A 4KS8A 3DJ7A 5A6OA 3BYOA 4FTOA 3DXNA 5H8GA 3FL4A 4XBRA 5IEYA 4FV8A 4E6QA 5J1VA 2UW0A 5KBRA 4FTNA 5IQDA 4FE2A 4DTKA 4FSMA 1ZYCA 4BDKA 3BLRA 4FSYA 4O0XA 4PV0A 2RFNA 2RG6A 1Q62A 3OWLA 4XV9A 4Y72A 5HIDA 2XVDA 3FQHA 2A4LA 4CFNA 3DGKA 3RM6A 3ELJA 5CEOA 4ARKA 4X2FA 4GH2A 5CAUA 2C6DA 3NCGA 5EYCA 1Y8GA 2HXLA 1R78A 4RWLA 2ERZE 5CT0A 3UOKA 4RX9A 5HHWA 4WT6A 1WBVA 2Y9QA 2YM8A 3VQUA 5AA9A 1WCCA 2PUUA 2XJ1A 4WG3A 5L3AA 5JFXA 4BCFA 4CTCA 2YM3A 3KKVA 4BBEA 5H8BA 3SXRA 4D58A 3TXOA 5F20A 3UQGA 2WMWA 4FSQA 2WMTA 4QP7A 4AXAA 3BHUA 3RPOA 4GV1A 4RIYB 1PXMA 5EW3A 3MIYA 4O0RA 5KZ0A 1OIRA 3RALA 5K4JA 4B8MA 4M67A 4G9RA 4QMPA 3EQIA 5J87A 4IX6A 3KXZA 4U3YA 3L8XA 3QXOA 4B6LA 2EB3A 3LQ5A 3F3ZA 3C4FA 4TRLA 5A46A 5C1QB 2F4JA 3BYVA 3TJCA 4EH8A 4YJNA 4DFBA 4A9UA 2PTKA 3IOKA 2Z7QA 3PP1A 3MGYA 4HVHA 5IA2A 4JNWA 1J7UA 3WZUA 3HV3A 2QVSE 3R30A 4FT9A 3B2WA 2BIKB 4FIHA 4EK3A 2BAQA 5L8LA 3GCPA 3UIBA 5J9LA 3ZXZA 5LCJA 1NVSA 3S95A 2W4KA 3W16A 4PY1A 4C4IA 2UW8A 2IZSA 3CGFA 3K3JA 5EOBA 3CD3A 2UZEA 3JVRA 4J99A 3RINA 2CKQA 3KN5A 5AUYA 3L9PA 3QA0A 3DTWA 4V04A 5BYYA 3FLNC 3DU8A 4O0WA 5D41A 2XK3A 5IG1A 4M84A 5BUEA 4ZJJA 3QQHA 3QXPA 3S0OA 3R1QA 4Y5QA 5ETCA 5BVKA 2GNIA 4CNHA 4EK6A 3HV6A 4KKGA 5DRBA 3FE3A 2W96B 4DGLC 2UV2A 4N4SA 5M06A 4JBVA 4EJ7A 1KUTA 3QCSA 1SVHA 1H4LA 2AC3A 3GEQA 4CMTA 3R0TA 3FUPA 4XP0A 4BIDA 3OTUA 1K9AA 5DNRA 5FTQA 1O6LA 3KEXA 3SDJA 5I3OA 3P7BA 4GKHA 2G9XA 2DYLA 4FT3A 4RFZA 3VS2A 3C4ZA 4D4VA 4MXXA 3QLGA 5CSPA 2PUIA 4WUNA 5CVHA 1V1KA 4E4NA 1CKIA 4LOOA 3KK8A 3B2TA 4ID7A 4EK8A 4IX3A 3MFTA 4MBLA 4FKQA 3EYHA 3PPZA 4RLLA 2OXYA 4AT3A 5EQPA 5HO8A 4ANOA 2PVNA 4EZ7A 4CGAA 3KA0A 2BPMA 3LCOA 3QTSA 4I92A 5FUTA 4HGEA 2JBOA 4X6RA 3NUXA 1FMKA 4YTIA 4CYJA 4EUTA 3PXRA 5BPYA 4NFNA 5I9ZA 3KXXA 5ITAA 3O7LD 5KMNA 3BHYA 1RQQA 4M69B 4NM0A 2RFDA 4X21A 1W0XC 4BDFA 3EQPA 4UMUA 5M55A 4O21A 3W33A 3OBGA 4CRLA 4DEHA 1J1BA 2BDJA 3C50A 5CLPA 3VS0A 1Q5KA 4KABA 4NJDA 3PJ8A 3PA3A 2PE2A 4F0GA 5IH5A 4C4FA 3NVMB 4YHJA 1FBNA 4EH4A 3I60A 2GHLA 5K5XA 3GU8A 1UU7A 1Z9XA 4FTCA 5C8MA 1PMNA 4DFNA 4KRDA 4AZWA 4XBUA 4MXAA 4PTGA 2YEXA 3P5KA 4X3FB 1BI8A 2VO6A 4ACHA 4A9SA 4OAUC 4GJ3A 3S1HA 3MJ1A 3C9WA 5HESA 4YZ9A 4BBFA 1JKLA 3DLZA 2BZIB 4W9WA 4O6EA 4FL1A 1KWPA 5CU4A 2XK7A 3E5AA 2XMYA 4TNBA 4EKLA 2BRHA 3C0GA 3MB6A 4I4EA 4WG5A 5CEMA 2AUHA 2Y7JA 5HICA 5AIRA 1JNKA 4D2PA 3R04A 4O2PA 2BALA 3KVWA 1JVPP 1JLUE 2UZUE 5J9ZA 4EQMA 5FXRA 3HV7A 3AOXA 4YLKA 5DR6A 2ETKA 4QTAA 3A4PA 3CPBA 4UMQA 1YW2A 1FQ1B 3E8DA 3OCSA 4RVKA 3HDNA 4G5JA 3NW5A 4X6QC 3UVQA 4FV2A 3ULIA 2GFCA 3ROYA 3FLSA 4I6HA 4RG0A 5AUVA 4XNEA 5TR6A 4AN3A 3M42A 4XX9A 4CG9A 3PG1A 2OZOA 5C27A 3PE1A 4Z55A 2O5KA 4OTFA 4ZAUA 4KSQA 3NZ0A 4MK0A 5DIAA 4GVAA 5KMOA 4G5PA 3Q52A 3V5JA 1U4DA 3PP0A 3ZEPA 2J0MB 2PZPA 2GS6A 3AMYA 3VRYA 5F9EA 3MYGA 3V6SA 4XS2A 4PMTA 4CMOA 4QYHA 1GZNA 4OLIA 4CQEA 2JBPA 4BCGA 4FEWA 2VO0A 3EQDA 2UW3A 2OZAA 3IOPA 4MKCA 2XIYA 3R9NA 4NJ3A 2IN6A 3VBVA 3R83A 3EQCA 4ACDA 1Q3DA 4GG7A 4FEXA 4D2VA 3G5DA 3ZC5A 4YP8A 3MY5A 4A9RA 4F09A 5AP1A 4LQMA 4OAVB 5IQFA 4N6ZA 4CD0A 5JGBA 1F3MC 3KXHA 4GS6A 4GFOA 2FGIA 4CZYB 4F9AA 2OXXA 5CEQA 5AV4A 5LWNA 2C47A 1RW8A 3FV8A 3BE9A 3PJ3A 4P7EA 2C6OA 4LGHA 4XG7A 4ENXA 3QQLA 4FV4A 2JAMA 3CCNA 3H10A 4ZP5A 2JFMA 3BELA 2WMBA 4FG9A 1WBWA 2GHMA 3AC3A 5M56A 3AQVA 2WPAA 2QKWB 2XK4A 2OIBA 3C0HA 5HGIA 3W2QA 4D28A 5HNBA 4RX5A 2WTKC 4PF4A 4C38A 4CYIA 4QO9A 3GU5A 4U9AA 3DB6A 4MWIA 1LEWA 4DLJA 5IUGA 4L01A 4ZMEA 1PYXA 2A1AB 2GS2A 5EYKA 3QZGA 4WD5A 5A54A 5IQEA 3C5UA 4JBOA 3UZPA 2CGWA 5M4UA 4EH9A 3E8CA 4ACMA 4HCUA 2BKZA 4C02A 3OP5A 4CEGA 4L3PA 2DWBA 2DUVA 1OIYA 2Y4PA 2RFSA 4J95A 2OH4A 5EK7A 4DH7A 4EOIA 3TNWA 3FKOA 3WF6A 3PSBA 4DLIA 3Q04A 4MXOA 2C6TA 3GC0A 3UNJA 4QTCA 2VTIA 3ZU7A 1WVWA 2W1CA 4HVDA 3ROCA 4CFFA 5I5ZA 4O86A 4R3CA 5IA3A 5D7VA 4CKIA 5CEKA 2B52A 4M13A 2QR8A 2XNBA 3MA6A 2VTQA 5AV0A 4C35A 2KULA 4GK2A 4BCQA 3VUTA 4G17A 5TF9A 2UW6A 5FRIA 3PE2A 1Q97A 3QRKA 1BL7A 2XNNA 5HVYA 5E8SA 4IC8A 3S2PA 5KE0A 3QZFA 4F1OA 1SNXA 3K2LA 2VZ6A 3CGOA 3I79A 4PTCA 4FKPA 4A4OA 4W4WA 5EI2A 3WE4A 3F3WA 5AUZA 4EK4A 2UVXA 4DEBA 1TKIA 5JZNA 4DTBA 3THBA 4E5BA 4KIKB 4QMSA 2VTMA 5HBHA 3VNTA 4DFZE 3UBDA 4BIBA 3A7IA 2WZJA 1XH4A 4JX3A 4O27B 4I22A 5CXHA 5FBOA 3QD3A 4BWKA 4BCNA 2P2HA 2W0JA 2J90A 4BDHA 4BL1A 5CWZA 3VRZA 1STCE 3KF4A 3C13A 4BZOA 2F2CB 4CCBA 3IK3A 2C4GA 4JAIA 4WUAA 5IA1A 3U9CA 4EQUA 2YIWA 3ZLSA 3LCKA 4CCUA 1WBTA 1GAGA 2X9EA 2YN8A 2UZWE 2PULA 5HEZA 5KMLA 3A60A 3LFDA 4YJVA 3P1AA 4BDEA 5L2SA 2OIQA 4PPAA 4GYIA 3DDQA 3ZH8A 2P0CA 2JC6A 3A7JA 3PDTA 1LEZA 5CNNA 2BHHA 3IPHA 3GENA 4DBNA 4E73A 2W1DA 4I6QA 5ACBC 5BX0A 3Q53A 2UZLA 4FZDB 2OBJA 4WIHA 3E3PA 3ORMA 4YSMA 2REIA 1J91A 3KC3A 3TG1A 1MRYA 3O96A 5AR5A 2X7GA 3P7AA 2XYNA 1YDTE 2QKRA 3BYMA 3CTQA 4FKRA 4A9YA 3BWJA 4PUZA 3R2YA 1R0EA 5L2QA 5KCVA 3GCSA 5M07A 4KNBA 4BCIA 2I7QA 2JKMA 2CHLA 3OCTA 4XP2A 4CRSA 3JY9A 4EHZA 3EN9A 4ZZOA 4UWBA 5IH6A 5BVDA 3F9NA 3PIZA 2J6MA 2VWUA 3ET7A 1H01A 1Q41A 3C7QA 3FMDA 2SRCA 4EHEA 3QTIA 4IC7A 3GQIA 5B2KA 1FVRA 4UALA 2PSQA 3D83A 2Q83A 2WU7A 1F0QA 3OS3A 5AMNA 3TUDA 4DF3A 2EXMA 3KREA 2GCDA 3FI2A 2VO3A 3MH2A 4BICA 4E26A 1WBOA 3CR0A 1GJOA 3KXNA 4IWDA 4KIOA 3ODZX 4S31A 3SD0A 2HY0A 1ZYLA 4I4FA 1QMZA 2A27A 1L3RE 3V5LA 4WNPA 4OTPA 4MQ1A 3SRVB 2QCSA 4D0WA 1VYWA 3NGAA 5AADA 5A4LA 4XYFA 2OJFE 3ATTA 2QD9A 3EHAA 4QMLA 3TUBA 4ZTMA 5HORA 2HZ0A 5DT3A 3QQKA 1OPLA 3MJ2A 2CDZA 4F7JA 4WBBB 4FA2A 2ITOA 3HRCA 4UV0A 4C36A 4BZNA 1GZ8A 5IQCA 3DQXA 4BI1A 1VZOA 4KWPA 2X8EA 1OL6A 1WAKA 2VTLA 4HGTA 3T9IA 4CFMA 4JJRA 4DG3E 5CF4A 5J95A 3N51A 2I0EA 2ITZA 2WQMA 4IXPA 5CZIA 1BUHA 5CEIA 4RRVA 1OZ1A 4R8QA 1Q99A 1FOTA 1YWVA 3KMUA 3V6RA 4E4LA 2V5QA 1YXXA 5HTBA 4EHVA 2X4FA 4EH3A 3DAJA 3I81A 3A62A 1ZYJA 1ZLTA 3R9HA 5KHWA 1REKA 3VJOA 3OT8A 1PYEA 2BZKB 4C4JA 5A4CA 4FV5A 4IAFA 3COHA 5K5NA 2OFUA 4O0SA 2IJMA 4MXZA 3VHKA 2W5AA 2HYYA 2F9GA 4EHGA 5AV1A 4C4GA 4U7ZA 3MN3A 2ZB0A 3DT1A 4I23A 4O0YA 2QOQA 1BKXA 4A9TA 1H8FA 5CVFA 2IVUA 2HELA 4HNIA 1VR2A 2B1PA 3CIKA 3EL7A 4IZ5A 3V04A 4YR8A 4PTEA 4CTBA 5AAFA 4CVAA 1FVTA 1ZY5A 4EZ3A 4WOVA 5E90A 1CSNA 2B9HA 3ID6C 4WO5A 1EH4A 1W98A 2YJSA 4MF0A 4BGHA 4BWXA 4QMUA 4DAWA 3VS4A 2Z8CA 2ITTA 3KK9A 4XHKB 4XRJA 4Q5HA 3QZIA 3HP2A 1JSVA 4XEYA 4BCOA 5EW8A 4PDPA 1Y91A 2G2FA 4YPSA 3SAYA 2OICA 1O6KA 3AD6A 3KB7A 4OTQA 3LMIA 2EU9A 1M7NA 2RIOA 4R78A 3NUNA 4IB1A 3BBWA 4BKYA 1OI9A 3RAKA 3VS5A 4OBQA 3GVUA 3PVWA 2NRUA 2C3IB 2YM5A 3AC4A 3R7IA 3RJCA 4CV8A 1OIQA 2HZ4A 3O8UA 2VWXA 1APME 2YLEA 1JSTA 3HP5A 3KQ7A 4L00A 2JKOA 5IPJA 3LLTA 1ZOHA 3FXXA 3SXSA 1HCLA 1XH6A 2ZDTA 2W1ZA 3E92A 3M1SA 1J3HA 4CFXA 4G3FA 2C5NA 1YHVA 3OTVA 4JLCA 2G01A 3R01A 3D5UA 2Z02A 4KBKA 1H0VA 4BCPA 5J9YA 5KMJA 2B7AA 5M44A 3VULA 4L43A 2OFVA 1OGUA 2YIQA 4JDHA 3FZTA 4BCKA 4L67A 5HNGA 4BN1A 4DG0E 1B39A 2XKEA 3UC3A 4C4HA 4I3ZA 4LYNA 5AV3A 2XM9A 5F1ZA 5CSHA 4WHZA 3UG1A 3ZO4A 3NAYA 4ZJIA 3SW7A 2BRMA 2R3IA 1NA7A 2ITUA 2VNWA 4CFVA 3VVHA 5E7RA 4CV9A 4YJPA 4ALWA 3ULZA 4BVUA 2YAAA 4WSQA 3O23A 4DHFA 5EM7A 4USEA 4KINA 1XH9A 4L42A 2JITA 4O7NA 2R0UA 3WF7A 4JT3A 1VYZA 2VN9A 4G16A 5A4QA 2YDIA 2XIKA 3QTQA 3RGFA 2QU5A 4WKQA 1H26A 4RIWB 4BB4A 4FF8A 4NM7A 5I9WA 1LPUA 3RZFA 3HUCA 3BRBA 3V5PA 3SKCA 3E64A 3IONA 3NIEA 5DYJA 3NNXA 4I6BA 4R3PA 4TT7A 4O7SA 2JDVA 4XV3A 1IRKA 3R22A 4QRCA 1BI7A 1PMEA 4K11A 1FPUA 3ORXA 3QTXA 4RWIA 4W8DA 4DCAA 2C0TA 1ZOGA 2VGPA 2YDKA 3W32A 4ASXA 3LQ8A 5DE2A 4EH7A 4GFMA 2J7TA 4TNDA 4DFLA 4NTSA 4U80A 3GCUA 2R3RA 1YDSE 1UKHA 2C5OA 4RC3A 3RNYA 4DA5A 1H1PA 3KXMA 4PPBA 4BI2A 3RMFA 4RMZA 4BI0A 1ZMVA 3JVSA 4M12A 3OCBA 1SMHA 2R0IA 5M57A 1H1SA 5JFWA 4C33A 4L52A 2XKDA 4MEDA 5DBXA 5EHYA 3FHIA 4AW0A 5ANJA 5DR9A 3FI8A 4EOKA 4IAKA 2WEIA 4AOJA 4KUJA 2I6LA 5AUXA 2FSOX 2A0CX 2CGUA 2NP8A 2X2LA 4BTMA 4O83A 4O1OA 3OWKA 5ANIA 3GNIB 3R7OA 3NYXA 1URCA 1TQMA 1OPJA 3GC7A 3LOKA 3PZHA 4JBPA 4L9IA 4WNOA 3W2CA 3EB0A 3MPMA 5AUWA 4USDA 1A9UA 4IWOA 5IUHA 5E8UA 4PMMA 1IA8A 1WFCA 5FEQA 1U5QA 3ZM9A 2BKKA 2GS7A 3ORTA 4ZTHA 3CJGA 4W8EA 3R8ZA 5A4TA 5DR2A 5AP2A 5K0XA 2X7OA 4RJ8A 3HMOA 3UDBA 3BBTB 3IW7A 1YQJA 4LFIA 4AAAA 2ZV7A 1BLXA 3U6IA 2O63A 4MX9A 5AAEA 1JWHA 1MRUA 1KE9A 3P08A 3MSSA 4L45A 4G34A 2XCHA 2C5XA 4CXAA 4JRVA 5HVJA 2ZM4A 4NW5A 4ZLYA 3D5XA 4FTJA 4L7SA 4UWYA 3OOMA 5E9EA 1CM8A 3PXYA 4L3LA 2UVYA 4MXYA 5EQEA 4J8MA 3RCJA 2ZV2A 4ASZA 2FSLX 3IDBA 1X8BA 4IAIA 4BYJA 5CS6A 2PVYA 4YBJA 4FYNA 4HVGA 2UW7A 3ENMA 4DGGA 5A6NA 3N4TA 2F7XE 4P5ZA 5AIKA 3QRJA 2RL5A 4G6NA 2R3JA 4IADA 3R7UA 1YI4A 3LVPA 5KBQA 1OL1A 1U54B 3Q9XA 3G9NA 3MW1A 4F7LA 2PZYA 3SVVA 3R2BA 3EIDA 4M97A 2PU8A 4U81A 4W9XA 2PE1A 5T68A 4EOQA 3GC9A 5IKWA 3RKBA 3UP2A 1LUFA 4QOXA 3QFVA 5E8XA 4PX6A 5HVKA 2HCKA 4P2KA 3TKHA 1H24A 3UODA 3ZUTA 4U40A 4FK3A 4V01A 1SVEA 4RGJA 5BNJA 1YVJA 3UNKA 3NUSA 5KKRC 3FXZA 4IAAA 2OGVA 3D4QA 2CLXA 1Q8TA 3GT8A 1QPEA 3CLYA 3QD0A 5BVWA 4E3CA 4QMWA 4YJQA 3WF9A 4O0VA 4FL3A 4U97A 5CI6A 5TOZA 4Z9LA 4C3FA 3KRXA 4JIAA 3EN5A 4K77A 4KBAA 2IG7A 5GNKA 2CJMA 3IO7A 1Q8WA 3HV5A 4R7BA 2YJRA 5K9IA 3GCVA 3CE3A 5TE0A 4E6DA 5LVOA 2JDOA 3V3VA 3PY3A 4KD1A 2PVLA 4I5HA 4JR7A 4UB7A 4UEUA 4FOCA 5HU3A 4LRKA 3I0OA 4E6AA 3KY2A 3A7HA 2VTJA 2R9SA 3VS7A 3FYKX 5DOSA 4F6WA 4UXLA 5FXSA 3CP9A 3AC5A 3GQLA 3VS1A 3UYTA 4PWNA 4E6CA 3D7ZA 4TYGA 3TKUA 3S00A 1PY5A 4X7QA 2QOLA 5I9UA 5HIBA 3R00A 1UNGA 4LRJA 2ZM3A 5E4HA 4OT5A 3G15A 3PIXA 3ZFYA 3QU0A 3COIA 3AGLA 4BFMA 1T46A 3NCZA 5EM5A 2Z60A 4YZBA 2X0GA 4FIIA 4J7BA 4FEVA 5HE1A 4H3PA 4GUBA 4WRSA 4KRCA 4DITA 2HK5A 1R0PA 2BILB 4QQ5A 3MESA 3VUMA 1H08A 5M09A 3MFSA 4XG3A 4DYMA 2YISA 3ORNA 3LJ0A 3O51A 1SNUA 2W7XA 4R6VA 5DGZA 4D55A 4O84A 1IASA 3Q6UA 1MUOA 2BZJA 1PF8A 4FR4A 5AP7A 2WTCA 3NDMA 2OSCA 2E9PA 2WIPA 4NT4A 4UBAA 3DZQA 3KCKA 4NK9A 3HMNA 3VUDA 5H2UA 4FT0A 3LCDA 2IVTA 4E8AA 3C4XA 2XEYA 3VC4A 5EHOA 4BTKA 4TWOA 3GUBA 2AYPA 3UP7A 1YOLA 2QOOA 3H9OA 3BQRA 4IVDA 4I5PA 4U5JA 3S3IA 2CNQA 2X8IA 3QUPA 3IG7A 1Y8YA 5EKNA 1Q8YA 4M8TA 5D12A 5DEYA 4AUAA 3NR9A 3F3TA 4AP7A 3DNDA 4AFJA 3FJQE 1L8TA 4IFGA 3VAPA 3BGPA 3Q60A 3HRBA 3ZZEA 3UQCA 4L7FA 4BF2A 1YXSA 1H1QA 4XMOA 4ERKA 4F9YA 4TYEA 3AC8A 4UN0C 1OITA 5CAPA 2YZAA 3I5ZA 2PZIA 4KKEA 3ZRMA 1YKRA 4R7IA 4C7TA 4M0YA 3QRTA 4EC9A 4QP1A 2HWOA 3RHKA 3TDVA 3ZONA 5FLFA 4GIHA 1Q4LA 2A2AA 3QALE 4UYNA 5BYLA 5JGAA 4XG6A 3CQEA 1UU8A 3EN7A 1Q8ZA 5EQYA 4ZSJA 3OROA 2J0KA 2C1BA 1WZYA 4JS8A 4LGDA 3K54A 4MF1A 4RFYA 3FDNA 1UA2A 1FVVA 3NNUA 4WRGA 1PXNA 5D10A 4HGLA 5DA3A 4YMJA 5KMIA 2XKCA 5E8WA 1TQIA 2J9MA 4FSRA 3NIZA 3PLAE 1M7QA 2ZJWA 3F66A 3O7LB 1IR3A 2R4BA 3K3IA 4GUEA 3CKXA 4MD7E 4TWPA 4K1BA 5CY3A 4IZAA 3ZBFA 5IISA 3ACJA 5C9CA 2QLUA 5C03A 3BEAA 4HPTE 1U5RA 2OG8A 2FH9A 3O8PA 3QX2A 4DFXE 4ZTLA 5IUIA 4L8MA 5FM3A 5AUTA 1S9JA 3MVLA 5BYZA 3KMMA 3SLSA 2ZDUA 3EQBA 4M7IA 1J1CA 3TIYA 5DMZA 2JIIA 4HJOA 3P78A 3E87A 3EFJA 4O82A 4J8NA 4LOPA 2V55A 4FKWA 2YWPA 3G0FA 4X3FC 3OVVA 4YC8A 2C6MA 5L8JA 3RBWA 2IZRA 2YFXA 2P55A 2YIYA 3I0QA 5L6OA 4G3EA 4GEOA 5DWRA 3FXWA 2O2UA 3TV6A 4K2RA 5IMXA 1V0OA 5DT4A 5GZAA 2EUFB 3KULA 3O8TA 3ZRKA 3Q2JA 2EB2A 4LRMA 3QQJA 2YM7A 3OXTA 4R3RA 2FSTX 2IWIA 3BGQA 2GNFA 5ACKA 5LQFA 2QODA 3EL8A 3KVXA 3MIAA 4LOQA 5DG5A 3U54A 4DINA 3IS5A 2HENA 2P4IA 3KL8A 3OT3A 3QBNA 2Y8OA 2OJIA 3QZHA 4FGBA 5FM2A 4TYJA 4BGGA 3R7VA 2C30A 4MNEA 5EDRA 3Q4ZA 2Z7SA 4AG8A 2R3PA 4AFEA 4FSUA 1OL5A 4BHZA 3BWFA 2WNTA 3E7OA 4Y46A 4FKJA 5L4QA 2BTSA 2XP2A 3FSFA 4ZSAA 4OUCA 5J1WA 1UU9A 2B53A 1IEPA 3BE2A 3F69A 3HMMA 1OMWA 1SZMA 1U59A 4L6QA 1G8SA 4D5HA 2HOGA 3RWQA 1IA9A 1R1WA 4BCHA 4FIEA 1ZY4A 3PUPA 5FP6A 2R3LA 4QTEA 2PUNA 2QOHA 4FODA 4O7TA 3VBYA 4IMYA 2C5YA 3AC1A 4QMYA 5BQ0A 3WF8A 5LMKC 4NCTC 5EI8A 5LMKA 3E3BX 1PXJA 2EWAA 2PVJA 3GP0A 4USFA 3K5VA 3FLWA 3POZA 3ALOA 3BCEA 1CKPA 3FZPA 2ITYA 3U4WA 4F0IA 3UMWA 5HO6A 4TYIA 3ZXTA 2XF0A 3ZHPC 1XR1A 4J71A 1UKIA 4IANA 1M2PA 2WMSA 4CKRA 4CLJA 5L8KA 3ZDIA 4ZSLA 2CNVA 1ZWSA 2BTRA 2I0YA 4NIFA 4QPSA 2IW9A 4AW5A 4UMRA 5DHJA 3W2SA 1Z5MA 3Q5IA 4K0YA 2WQBA 4L3JA 2HAKA 4FTIA 4MAOA 3FMLA 4TWNA 4EC8A 2VUWA 1ZMUA 2IZUA 1HCKA 4FMQA 4I20A 4NFMA 2XH5A 3R8VA 4RIXA 5EW9A 4YHTA 4RJ7A 3ZYAA 1K2PA 3ACKA 4DFYA 4NKSA 3BU3A 1OPKA 1XKKA 2I40A 1DM2A 2CNUA 2OJGA 3FMNA 3PA4A 2GFSA 2GHGA 2ZAZA 4IE9A 3ORLA 5ETIA 4WSYA 4FG8A 4FTKA 4NU1A 3DJ5A 4Y95A 3QL8A 2GTNA 3EKKA 3QCXA 5CAQA 3FZRA 3GCQA 5EOLA 5LOHA 1WMKA 2J50A 4E5AX 5CALA 3FY2A 3OG7A 3Q5ZA 4EONA 4Y8DA 3NUUA 4LUEA 4ZTRA 3UIUA 1R3CA 4CSVA 3QAME 4X2JA 5FBNC 4AGWA 3QD2B 3BPRA 4MQ2A 3P23A 4U79A 2QOBA 3NNWA 4X3JA 1TVOA 4O7WA 2UZNA 4GRBA 4C3PA 3LXLA 4FI1A 4LGGA 5GZ9A 4BDGA 4D4RA 4XOYA 4DN5A 3QX4A 4O0TA 4OTHA 4E4XA 3LJ2A 3PLSA 3DK6A 4IBMA 5E1EA 3EFKA 1ZOEA 2Z2WA 3D9VA 4I93A 4GK4A 3OD6X 3GC8A 4L44A 4L68A 3HA8A 3V01A 1YOJA 3PY1A 1ZRZA 1O6YA 3DV3A 3IW8A 4O91A 4BGQA 4Q9SA 2QHNA 3BU5A 2P3GX 5LCKA 2YITA 1W8CA 4W4YA 3BIZA 3R71A 4NWMA 4X2KA 2OF2A 5JFSA 5HBEA 3QTWA 3IECA 5EYMA 2QNJA 5KO1A 4BDDA 1OVEA 3H9FA 3LFAA 1IAJA 4XG8A 2PY3A 4BZDA 5GHVA 2HXQA 3V51A 5AUUA 4XG9A 1GNGA 1T45A 5AR3A 3R7GA 3G6HA 4V05A 1QL6A 2Y4IC 1PJKA 2E2BA 3GGFA 3PXZA 1QPCA 3EN4A 4QNYA 3WIKA 2XNPA 3I6WA 3A7FA 4QP9A 3RAHA 1I09A 4E4MA 4AGCA 1NVRA 3FHRA 5JSMA 1ERKA 2BRGA 4FNYA 2B0QA 5HE3A 3DBQA 5CQUA 3I7BA 3VW8A 4PDSA 3RM7A 4S30A 3UO6A 3CEKA 3QLFA 3UIXA 3VS3A 4A07A 3FLQA 3QUDA 4IX5A 1V0BA 2WXVA 4I0TA 5IA0A 3F2AA 2JFLA 3ZO2A 3IKAA 2OIDA 3HZTA 5ETAA 4B7TA 1J7IA 4PP9A 3SGCA 3MBLA 3I5NA 4TZRA 2XIXA 4W4XA 3O2MA 3DK3A 4FKIA 3E63A 1W83A 2B54A 3HKOA 2I0HA 4Y85A 4L53A 4ANMA 2R3GA 2OLCA 5C4KA 5B0XA 3D15A 3I1AA 5AR4A 3R7EA 3R6XA 3F82A 4FT5A 2ZMCA 5F4NA 3ZSHA 2WTIA 3SG8A 4GSBA 3ORZA 3Q4CA 4PNIA 2PL0A 2XA4A 3DK7A 3P7CA 5IEXA 2GQSA 5IMEA 2JEDA 4GCJA 4MD8E 3PJ1A 4DH1A 4YURA 2YCQA 5A14A 5HBJA 2C1AA 4U0IA 1M14A 4IAZA 1PXIA 4IQ6A 3MVJA 2XB7A 5L6WL 3SOAA 3TZ7A 5IQGA 3WI6A 3R73A 3LFFA 3MB7A 3PTGA 1ATPE 4CFWA 4G2FA 4AA0A 3DCVA 5E8YA 3O17A 5HG9A 4HYSA 3DBEA 2ERKA 3FZ1A 2PHKA 3PVBA 4PL3A 4QYFA 3ZSGA 2VTRA 4QMNA 5JQ5A 3TM0A 3DTCA 1G3NA 4TKSA 4F6SA 4BDCA 2X8DA 3BHHA 3FMKA 5CXZA 2F57A 4J53A 2ITWA 4UWCA 3MWUA 5DRDA 2ETMA 1DI9A 3DBFA 4WBOA 3MDYA 4U43A 4XCUA 4IWPA 3TNQB 5K4IA 3RPYA 4ITHA 2BIYA 4EOOA 4V0GA 5DT0A 3HVCA 2GQGA 4I5MA 1PKGA 4II5A 3TDWA 3BV2A 4F4PA 3QKKA 4EEVA 2V62A 4MH7A 4DH8A 1PXOA 4IDTA 2P2IA 3EQHA 3L9LA 3ZDUA 2UZVA 3MV5A 5EKOA 2YLFA 4J97A 5HE0A 2J4ZA 2C68A 4I0SA 4QMXA 4EBVA 4A06A 3NAXA 5KMMA 5L2TA 5HTCA 2V7AA 3FC1X 1GIJA 2IVVA 4ZLOA 3HA6A 2W5BA 4BR3A 3VWAA 3P4KA 1QPJA 1MQ4A 2BMCA 3D7TA 5FTOA 5T6KA 2VWVA 5FWKK 4F0FA 3AC2A 4Q9ZA 3PXFA 4GYGA 3RZBA 4CZUA 5GZ8A 2GDOA 2AC5A 3E8EA 4MWHA 3SHEA 3SX9A 2OW3A 2PPQA 3W2PA 3WF5A 2J0JA 1H28A 3TWJA 5D9HA 4CZTA 4IVCA 2W1EA 1TQPA 3EZVA 3PSDA 4P90A 4ZXTA 3CSVA 3NVKI 3M11A 3AMAA 4O96A 4AACA 1GZOA 4OR5A 1FGKA 2R7BA 3TV4A 4EORA 2A19B 4M0ZA 5CVGA 1F5QA 2UZTA 4O22A 5J7HA 1ZYSA 1H00A 2C6IA 4ENYA 4O6LA 3WZDA 2HWPA 2QONA 4AOTA 4EOLA 5M4CA 3R7YA 1XH7A 5TT7A 3VUGA 2WU6A 3JYAA 1XH5A 2W06A 4BDIA 4DE4A 4OBOA 5KMKA 4UX9A 2YA9A 4HVSA 5HE2A 5AWMA 5FEDA 1IG1A 3MFUA 5FEEA 2QU6A 4ZOGA 5BVEA 2CN8A 4GL9A
chains in the Genus database with same CATH superfamily
4ZZNA 3OXZA 4E1ZA 2X81A 2C6KA 3RI1A 3OHTA 3VUHA 2BZHB 4AT5A 1AGWA 1MP8A 3GOPA 3RWPA 1KOBA 4YJUA 3FSKA 4AE9A 4C57A 2QURA 1FGIA 3V5QA 5KHXA 4YTCA 4RX8A 3AKJA 5CTPA 5I9YA 3CC6A 1YXUA 3P86A 4F9CA 5IH4A 2IEWA 2XIRA 4D4YA 4YJRA 4IACA 4IX4A 5IQAA 4JBQA 4TL0A 5A4EA 2E9VA 3C4WA 4YC6A 4R77A 4BC6A 4Z7HA 4JXFA 2OXDA 4FSZA 3CKWA 1YWRA 4M15A 5DEWA 5IF1A 5BVNA 5E1SA 4GVJA 2WB8A 3ZUVA 1P5EA 3GU7A 4FTAA 2WTDA 3H4JA 3RK5A 3UO5A 5GIPE 3D5WA 4LI5A 3LHJA 4O1PA 4RIWA 3JR1A 2PMLX 4J96A 4FKUA 2VTPA 5HIEA 4XG4A 2Z7LA 3H0YA 3QHRA 4EKKA 3F3VA 4YNOA 1KE6A 4HVIA 3PPJA 5JH6A 5H3QA 2EVAA 3R1SA 2VD5A 5FP5A 2B55A 4GKIA 3S4QA 1YWNA 3OF0A 3NSZA 5E91A 4PNKA 2UZOA 5E8VA 3OUKA 3FPQA 4XP3A 3QKMA 5ANOA 4YO4A 3RK9A 4TPTA 3HMPA 3U6HA 3QC9A 3WIGA 3RK7A 3DXPA 4GIIA 3FBVA 4ZSEA 3BZ3A 2FO0A 1A06A 4AA5A 2H6DA 2VWZA 2WTJA 3NLBA 4BKZA 1WBSA 2GNHA 1OKWA 5HD4A 5AX9A 3CTHA 5AR8A 5AV2A 3FEGA 2BFXA 3I4BA 3K5UA 2WIHA 2XBJA 5CEPA 2X0QA 2IPXA 3KRJA 3BLQA 4MD9E 4ZTNA 2W05A 3PFQA 3QRIA 4AZTA 2HZNA 4FKTA 4AF3A 5CU3A 1ST4A 5CSWA 5IA5A 2YIRA 3A8WA 2CCIA 2VTNA 2ZM1A 4F64A 3ODYX 4ANLA 4HZSA 5CAVA 4Q5EA 4YC3A 1KOAA 2QO9A 3PZEA 3ETAA 4H1MA 4U42A 5HG7A 5LVNA 4RJ4A 4IH8A 1K3AA 1KSWA 3HLLA 3MPAA 1M52A 4FOBA 2XUUA 4FKOA 1W84A 4YZNA 3G51A 5HCYA 3EQFA 1UWHA 5G1XA 2RKUA 4LG4A 2BROA 2R3QA 4QP4A 4YZCA 4ZZMA 3D0EA 3PPKA 4K8AA 4D5KA 3U4UA 5K0KA 1JOWB 5CQWA 1P14A 2ITQA 3C0IA 4FC0A 5B7VA 2H34A 5J5TA 3JY0A 5I4NA 5ANEA 3GB2A 3AT3A 3FKNA 2R7IA 4YJSA 4TYHB 3QTZA 1H07A 4DFUA 1YOMA 3C51A 5CSVA 4F9WA 3TNPC 4F99A 4FNZA 2LAVA 2HW7A 2R3KA 3R9OA 2R3OA 3GBZA 4JVGA 4RVTA 5CASA 4DT8A 4D1ZA 4OTRA 5AEPA 3TI1A 5LJJA 4CFUA 4YUQA 4BY9E 3Q32A 4FV3A 4W4VA 5EDPA 1FINA 5J7BA 4EWHA 3OCGA 2QG7A 4K33A 2JD5A 1WBPA 3OC1A 3LPBA 4YSJA 3ZUUA 3FQSA 3ZTXA 3R8LA 4H58A 3QC4A 2W5HA 5F94A 4GJ2A 2XK9A 3MTFA 3DBDA 3CJFA 4IWQA 5JGDA 2PZ5A 2QHMA 5DVRA 3LW0A 5HLPA 2KTYA 1UV5A 5EG3A 1U54A 4ZEGA 4A4LA 2W99B 3KCFA 2H8HA 4FIGA 4TW9A 4XUFA 2JAVA 5L2IA 2W1IA 2H96A 4ONAA 5IA4A 2J0IA 4N6YA 2W1HA 4U6RA 2YCSA 4IZYA 3TTJA 4KKHA 5HKMA 5HCXA 3LM5A 2B9IA 4AOIA 4QQTA 2QOKA 3E93A 2PVFA 1Y6BA 1JKKA 2XJ2A 3UOHA 4S33A 3MI9A 3PA5A 3N4VA 2ITNA 2YCFA 3BGZA 3VUKA 2NNWB 3ZC6A 4AA4A 4JRNA 4D4SA 2UVZA 3Q3BA 4NW6A 1XO2B 3WILA 4EBWA 4RWKA 1RDQE 3NUPA 1JSUA 2OO8X 3NYNA 3U51A 3UDSA 5D1JA 3DPKA 3QWKA 3PJCA 4AAYA 5HD7A 2XNMA 3TTIA 3VQHA 4F1TA 3PIYA 4EJNA 4X2NA 3OFMA 5EH0A 4OTGA 4UY9A 4YU2A 2R3NA 1IAHA 4AN2A 4ANNA 4RSSA 4YGAA 4FZAB 5HQ0A 5AR7A 3ALNA 3LFBA 3VF9A 5KKRB 3SA0A 3D2IA 3G90X 2C3KA 3EMGA 4DC2A 4FEQA 3FMEA 4OT6A 2CPKE 3C4CA 4K6ZA 4YZMA 3QWJA 5AP0A 1OM1A 3ANQA 4ZMFA 1M2RA 4ZS4A 1XBCA 3E8NA 4RIYA 4QMQA 1XH8A 4IIRA 3P5JC 4O81A 2FB8A 3ZFXA 1NXKA 5BUJA 4JR3A 3W0SA 3P79A 5EM6A 1PW2A 2WHBA 4C0TA 3RPSA 3UYSA 1UNLA 3TJDA 2CGVA 1YI6A 4QPMA 5BMSA 3BX5A 3Q4TA 2C3JA 4TN6A 3NPCA 4FICA 4JI9A 3G0EA 1LR4A 5ANKA 5LVLA 3UPXA 3VBXA 1W82A 4O2ZA 4ZY4A 2BDWA 3CBLA 1YXVA 3QUEA 4LL0A 3L9MA 2GNGA 3AXWA 2VX0A 3FWQA 2VU3A 3MA3A 4RZWA 4C59A 1GIIA 3MTLA 4IZ7A 4AGDA 2FYSA 2XNEA 3LAUA 4HGSA 4KIQA 3T3UA 3R8UA 2C6EA 2XYUA 2WMRA 4YLJA 2VGOA 3GFEA 4WA9A 3FQEA 5HLNA 4JDIA 3MVHA 4BTJA 2E9UA 2JIVA 3VBWA 4C58A 2QI8A 1KV2A 5JRSA 2QO2A 4D1SA 2LGCA 4OGRA 3G9LX 5IEVA 4JDKA 1M2QA 3KRWA 2G15A 3NUYA 4C61A 5DI1A 5HZNA 2JGZA 4QTBA 3FYJX 1KV1A 4FZ7A 5HX8A 4FTLA 3PG3A 2ITXA 4H3BA 4P4CA 5AP3A 2WQEA 2OJJA 1CMKE 4FT7A 3D5VA 1KE5A 5BVOA 4O7VA 2QLQA 4D0XA 1AD5A 2GMXA 3DFAA 3EJ1A 5AP4A 4FVPA 5CF8A 4DEEA 1OKZA 2VV9A 2XIZA 2XS0A 1NVQA 3FKLA 1P2AA 4RBLA 2I0VA 2CKOA 4J52A 5EI6A 1DI8A 3BHVA 4YPDA 3D94A 4Z16A 1H1RA 4G3CA 3Q9WA 5G6VA 4UXQA 3ZZWA 5LVMA 4Y73A 3FI4A 3PY0A 5AM6A 4FTUA 4TTHB 3EOCA 1JAMA 3POOA 3LFEA 3R21A 1QPDA 3FY0A 3KXGA 4FSTA 5GJDA 5FXQA 2F49A 5M51A 3DY7A 4TXCA 3BU6A 2J5FA 2VWIA 1LP4A 2R3MA 4EQCA 3I7CA 2WMVA 5CANA 1OB3A 1VEBA 5I9XA 4GU9A 2GNJA 2RG5A 4MNFA 5HNIX 4M69A 3G33A 3W1FA 4FL2A 4JG6A 1DAWA 5D7AA 4R5YA 4ZY6A 2W1FA 4ZK5A 4G9CA 3W10A 3W2RA 1I44A 4B4LA 5C01A 3C5IA 3F7ZA 3MS9A 1P4FA 5KX8A 3II5A 2BUJA 3WARA 5LWMA 2UW5A 4RT7A 2XCKA 3NYOA 4EOPA 1ZAOA 4F70A 3QA8A 3TKIA 2ZB1A 5JEBA 2YWVA 4PMSA 5JRQA 4XH6A 3ERKA 4I6FA 4ACCA 3C1XA 2QQ7A 5M53A 3V8SA 1DAYA 3W55A 4EK5A 3QGWA 5L6PA 4QP2A 3OMVA 4J1RA 3ZLYA 4D9TA 3IW4A 3M2WA 4X3FA 1YDRE 3H9RA 4YO6A 3P0MA 4O4FA 3CQWA 4XV2A 2ETRA 3HMIA 3PYYA 3QQFA 4IJPA 3MH3A 4JIKA 3A4OX 5I9VA 2ZOQA 5AP6A 2XM8A 4ZIMA 3UG2A 3UZTA 2CKPA 4FZFB 2WOTA 4MCVA 1AQ1A 2ZYBA 3UDZA 5FD2A 5CX9A 4DTAA 3KIOC 4NZWB 4AQCA 2CKEA 4Z3VA 4GT4A 4YJTA 2O3PA 4FNWA 3L8SA 4U3ZA 2PVMA 3PSCA 4D2WA 4YTFA 1JKSA 1H27A 2H9VA 1OL2A 4QD6A 5AFVA 4C62A 1OECA 4PL5A 4N57A 5JN2A 4HPUE 2X4ZA 4MHAA 3KU2A 3SQQA 4HZRA 1B6CB 3W8LA 2V0DA 4C3RA 4PRJA 4F1MA 1ZYDA 4FV0A 4R1YA 2B4SB 2F7EE 2OK1A 3Q4UA 4I0RA 4JDJA 5T3QA 3IQ7A 3KULB 3F5XA 2NPQA 3B8RA 1PXKA 4DEDA 3V5TA 3RPVA 3R1YA 4M66A 4I24A 4JG8A 1BMKA 4JAJA 2FA2A 2X6EA 3MY1A 4QPAA 2ACXA 2O65A 4BCMA 4HYIA 3RVGA 3KFAA 2XNGA 4YBKA 4DGNA 3PWYA 2PWLA 2WGJA 2XEZA 3QHWA 4FZ6A 3TV7A 2HIWA 4FSWA 4I5CA 4XLVA 4JQ7A 3W18A 4DG2E 2B9FA 3LFQA 2VNYA 3OWPA 2PMIA 4RIOA 2C3LA 3HV4A 2Q0BA 4MNEB 5GIOE 3UVRA 2BRBA 2OJ9A 4LM5A 1QCFA 5JK3A 1SYKA 4XJ0A 5TKDA 4M68A 2YM6A 5ANGA 1NT2A 1BYGA 3H3CA 4AZFA 5AAGA 2VX1A 2WAJA 3NEWA 4NCTA 3VBQA 3BI6A 4E20A 5JFVA 5B2MA 2O0UA 4APPA 3HAVA 4I41A 4M3QA 3EKNA 4QMZA 3T9TA 4B8LA 2VTAA 3BV3A 1PMVA 4LL5A 1XWSA 1GY3A 2VTOA 3V5WA 3KF7A 3NWWA 2PE0A 4AU8A 3NYVA 1ZZ2A 5CAOA 4CKJA 2XRUA 3WYYA 4HCTA 3UMXA 3NUAA 2PZRA 5H9BA 3TZ8A 1YHSA 3HL7A 2E9OA 5LMBA 5FGKA 3HNGA 5CZHA 2JDRA 3DLSA 3G6GA 3JUHA 4QQJA 2PVRA 3MH1A 3VIDA 2WMUA 1WBNA 2OZAB 4RC2A 4AW2A 1KE7A 5CSXA 1UU3A 4C37A 3RTPA 4BYIA 3R9DA 3TZMA 4JQEA 2C0IA 3H30A 2WMQA 2WQOA 3DKCA 3G2FA 4YZDA 4CG8A 4MBIA 2WKMA 4BDAA 3I6UA 3OWJA 3SC1A 3W0NA 2O64A 4OTIA 2WEVA 4GU6A 3O71A 4RA5A 4YLLA 4BDBA 4BRXA 5M4FA 4ITJA 5DLSA 4A7CA 2IZTA 4RFMA 3W8QA 4B0GA 1Q3WA 2JIUA 4NM5A 4H05A 4PPCA 5HCZA 5A3XA 4YNEA 4NIFB 4EOMA 5LARA 2HZIA 2BDFA 3CY3A 3LXPA 2W1GA 3UE4A 4AZEA 4X0MA 3QD4A 2YDJA 4IEBA 4Q2AA 4G6LA 4BWPA 3ML1A 3IGOA 1H0WA 3TEIA 3TT0A 4C34A 5FTGA 1CDKA 2OI4X 3BEGA 2WTKB 4K18A 2YIXA 3EFWA 4JX7A 4E5WA 4JQ8A 3COMA 3ZLXA 4HW7A 2EXEA 2DS1A 2Q0NA 3LFNA 3FLZA 3Q6WA 4H39A 2PYWA 3QYZA 4IB5A 3ZS5A 4AWIA 3SW4A 2IW6A 4FVQA 4GW8A 4RIXB 3LE6A 3F2NA 3LXNA 4RX7A 3EWHA 4XLIA 4XOZA 3TL8A 3VUIA 2UW9A 3FPMA 3R02A 5BUIA 4MBJA 2WTWA 3VBTA 1G5SA 5L2WA 1KE8A 5C26A 4FG7A 2ITVA 2R3HA 2QOCA 3UJGA 5HU9A 4MTAA 1B38A 4ZSGA 3ZO3A 4R5SA 2C69A 5E8TA 2X2MA 3Q9YA 4IDVA 2PMNX 4YHFA 1M17A 3LCSA 4GK3A 5H8EA 4F9BA 3HYHA 4EOSA 3ZSIA 2ITPA 1OKYA 4FV1A 3DKOA 3NMUF 4KIKA 3UOJA 3ATSA 2R5TA 4NSTA 5GINE 1VJYA 3LM0A 1RE8A 3WOWA 2G1TA 3DS6A 3R63A 4U44A 4CLIA 3U6JA 2XARA 4RC4A 4AT4A 3QTRA 4RJ5A 5DPVA 3BKBA 3F5PA 2JLDA 3PRFA 3F2RA 1WVYA 4DEGA 4O7RA 4IJ9A 1YHWA 4DHJA 1JKTA 4ALUA 1E1XA 4YJOA 2JDSA 5IDPA 4H3QA 4RQKA 5KZIA 4GFGA 1A48A 3L1SA 4LV8A 2VWWA 1UNHA 4H1JA 3NS9A 4I94A 2X6DA 4MVFA 3TMOA 4FX3A 3TYKA 4AXCA 4CT2A 4IVBA 3OEZA 3HX4A 2X1NA 4ZJVA 2X9FA 3DFCB 3DZOA 4P5QA 4ANQA 3A61A 3GXLA 3KGAA 3DKGA 4DEIA 3SG9A 2UZDA 3KRLA 3BHTA 4I1ZA 4CQGA 4D2TA 3NX8A 2RGPA 4IW0A 5J8IA 5JZJA 4QNAA 5HOAA 2R64A 1MRVA 2PMOX 4JOAA 4QT1A 4DH5A 4G3GA 4R1VA 1XQZA 1ZZLA 4FTQA 3CPCA 4RJ6A 4BKJA 5I3RA 3UTOA 3PWDA 3ZMMA 2XZSA 4PDOA 1U46A 2BVAA 3QRUA 4KB8A 5FDXA 5LMAA 2VO7A 2C6LA 4DGOA 1PMUA 3MVMA 3HEGA 2YACA 2B9JA 2WD1A 2XNOA 2Y4IB 4C2VA 3D2KA 3FI3A 3V8TA 3L9NA 1REJA 4Z7GA 4F08A 3QCYA 4FUYA 4EH2A 5CU2A 4AN9A 4LV7A 4FVRA 4G6OA 3GFWA 2YCRA 3QGYA 4J98A 3LMHA 3HAMA 4QMMA 2VTHA 3IW6A 5HX6A 3LKMA 2GSFA 3UO4A 3W0PA 2YHVA 4BHNA 4FTRA 1S9IA 4XRLA 4RPVA 1SVGA 2WMAA 2YABA 5AX3A 5HG8A 3SV0A 3SXFA 1YI3A 3H0ZA 4BCJA 2VWYA 4PMPA 1Q24A 3AMBA 1FMOE 3F88A 4KSPA 3VHEA 4LUDA 4F65A 2OH0E 3R28A 3ITZA 5ETFA 3N4UA 3LIJA 3C4EA 3TN8A 3OW4A 4WG4A 4RQVA 1OBGA 5JT2A 3PXQA 3SRVA 2XK8A 3R8PA 4UZHA 1OL7A 4BIEA 4ERWA 3ZM4A 4FKVA 3IDCA 1HOWA 3UPZA 3PRIA 4ITIA 1Z57A 2G2HA 5FG8A 4EH5A 4O7LA 2ZMDA 1XMLA 5CI7A 3TNHA 3ZBXA 4CT1A 4UMPA 4ALVA 3Q9ZA 4X2GA 5CU6A 5EDQA 1TZDA 3AT4A 5BV3A 1XBAA 4AZSA 2ZV8A 3CTJA 3Q96A 4RJ3A 4ZTQA 2QOFA 3Q2MA 4IM2A 2WTVA 2UZBA 2FVDA 2Y6OA 2GPHA 1XJDA 4TWCA 5GJGA 3OY1A 1YXTA 3DOGA 3CQUA 3ORPA 1SM2A 3IDPA 3OUNB 3U87A 3WZJA 4DEAA 2G2IA 2ONLC 2W9ZB 2X2KA 2ONLA 4K9YA 3QCQA 5CYIA 2R2PA 1O9UA 3TIZA 3LZBA 5LVPA 3EYGA 4BBMA 3ANRA 4ASDA 1V0PA 2VRXA 3R9RA 4AXEA 2YM4A 5HG5A 2ESMA 3TACA 3FL5A 5DH3A 4AGUA 4KIPA 5LXMA 3QTUA 3MPTA 2F2UA 2XRWA 1PRYA 3FMHA 3TUCA 4HCVA 4B99A 1OUKA 3AT2A 1DS5A 1PXPA 3OEFX 3QYWA 3NRMA 3BYSA 1MQBA 4QP8A 4ANSA 5ICPA 3WBLA 5D11A 5DFPA 3HECA 3F5GA 3DAKA 3ZOSA 3BL9A 5HTIA 3DQWA 3KMWA 4WNKA 4U8ZA 5AJQA 1ZMWA 3R1NA 3AD4A 3VW6A 2VWBA 4S2ZA 4V0GB 4DBXA 3O0GA 3A7GA 3GU6A 1WVXA 3COKA 2BAKA 4FK6A 1UVRA 4APCA 1TFFA 4EZ5A 4EYMA 2GTMA 4KAOA 1URWA 3PXKA 5AR2A 4FYOA 2IO6A 1PHKA 2BAJA 3KN6A 3JS2A 4PP7A 1ZXEA 5KNJA 2W4OA 4GT3A 4QYGA 4G1WA 5E8ZA 3QF9A 4QP6A 4C2WA 2UUEA 4FGRA 3NNVA 1NW1A 5EFQA 2BHEA 3LFCA 1YRPA 5BVFA 4HYHA 4JL9A 5BMMA 4ZTSA 4IAYA 4GMYA 2VTSA 4D2RA 2WQNA 1PKDA 3FZOA 3VF8A 4S34A 3D7TB 5EHLA 4NKAA 3MY0A 4DCEA 5E92A 4EOJA 2NRYA 3U9NA 5A9UA 2VTTA 4OTWA 1JQHA 5IDNA 3L8PA 3UVPA 5CF5A 2X7FA 3F5UA 2GU8A 4NTTA 3WYXA 4M14A 2RFEA 3PVGA 4QMOA 3AG9A 2OWBA 2C0OA 4ACGA 5FDPA 2JKQA 3EN6A 3NW7A 4FIFA 3CY2A 4PQNA 5EM8A 3BQCA 4ZS0A 2CLQA 1XBBA 3DXQA 4A4XA 3CXWA 3DJ6A 3LFSA 3MH0A 4FIJA 2BR1A 4FUXA 3MFRA 3QQGA 3RAWA 5IQBA 4KA3A 4NM3A 2V7OA 4AZVA 1GZKA 5CT7A 3ZCLA 2OF4A 3FZSA 3GU4A 3WE8A 4QYEA 3DDPA 4FV6A 3VS6A 1PXLA 4EYJA 4HOKA 1P4OA 3AGMA 4MXCA 3HGKA 1Y6AA 2RF9A 1JBPE 4G31A 4JG7A 4XG2A 3A8XA 2DQ7X 4ASEA 3EZRA 3PJ2A 3GI3A 2PVKA 5ANDA 4NH1A 4FKGA 2QO7A 4QP3A 4HNFA 4FTMA 2BRNA 2YZLA 3ZFMA 3CS9A 3ZO1A 2CGXA 3E7VA 4KS7A 4KBCA 3FLYA 4PL4A 3B8QA 5KUPA 2PVHA 2WO6A 3FAAA 4FTTA 3O50A 5AP5A 3RHXA 5CU0A 3BLHA 4RLKA 2HY81 3RNIA 5HLWA 2W17A 5M4IA 4GT5A 2QOIA 1H25A 2XKFA 2JKKA 5C8NA 2WELA 5JMSA 2VX3A 3UZRA 3LLAA 4NYEA 4OW8A 4D1XA 3QKLA 4R7HA 4DT9A 1Q61A 4LV5A 1ND4A 1E1VA 2WMXA 5IQHA 4MYGA 3V8WA 3WZKA 5JQ8A 1R39A 3NW6A 4D9UA 3QQUA 4FV7A 5IU2A 4IM0A 4BJJB 4B9DA 1BL6A 2W9FB 4WNMA 3REPA 4OTDA 2C5VA 4FKLA 5J79A 1JPAA 3IW5A 2Z7RA 2HW6A 4RVLA 1RJBA 4AW1A 3A99A 2I1MA 3DBCA 4U41A 5JKGA 3U8WA 3L8VA 2PUPA 1OIUA 3P9JA 3UNZA 4N70A 4O7ZA 3F61A 4GG5A 2XK6A 1E9HA 2WOUA 3ORIA 3JXWA 3UC4A 3UIMA 4FEUA 3EFLA 4EH6A 4AX8A 3E88A 3DB8A 3T8OA 4EI4A 2WFYA 3D14A 4NL0A 4BDJA 5CF6A 3LQ3A 4RA4A 4N0SA 5IZFA 2RSVA 4FBXA 4AE6A 3OW3A 3OZ6A 3F3UA 1GIHA 3RPRA 4EL9A 4O4CA 2YAKA 4IM3A 3DNEA 1OUYA 4LMUA 3T3VA 2CMWA 4C4EA 4C8BA 4TY1A 4XV1A 2Y0AA 4IVAA 5HI2A 5FQDC 3ZLWA 4NUSA 2FSMX 4IFCA 2FUMA 1W2DA 3DKFA 4QYYA 2NO3A 4TYHA 2BCJA 4IB0A 4QMTA 5EYDA 2IVSA 4EWQA 5TO8A 4DGMA 3HRFA 5AA8A 3WZEA 3VN9A 3TNIA 2Y6MA 3KRRA 3OBJA 4G3DA 3VO3A 4QMVA 4OBPA 3N9XA 2W4JA 5C8KA 1H1WA 2CSNA 4LMNA 4UZDA 4Y83A 3UDTA 4F63A 1OKVA 5CNOA 2J5EA 1W2FA 2IW8A 3FC2A 1Q8UA 3LXKA 3OXIA 2J51A 1NY3A 4ZY5A 3A2CA 2GQRA 4O38A 4IB3A 5DN3A 2A98A 2ZV9A 3F6XA 1UWJA 1G8AA 4FNXA 3DA6A 5K3YA 1J7LA 1Y57A 1GOLA 4ZLZA 5J5SA 2OKRA 4O7YA 3VJNA 2V22A 2YERA 4F7NA 4PDYA 5M08A 1W7HA 4RWJA 4Y5HA 4U45A 4RVMA 4NEUA 3AD5A 4IHPA 3TCPA 5HO7A 2GNLA 2VAGA 2QC6A 2UW4A 4S32A 3SOCA 1XMMA 5C4LA 4BTFA 2ZVAA 3F7WA 3ZEWA 2F7ZE 3HDMA 2XJ0A 3BYUA 4O0UA 3RCDA 4D2SA 4H36A 3UGCA 4L46A 3DAEA 4DH3A 3LJ1A 3ENHA 2E9NA 3IGGA 4HYUA 3HUBA 4FKSA 3UQFA 2QR7A 2OU7A 3LMGA 3EQRA 4UMTA 3RP9A 2J0LA 2CCHA 2PK9A 4UYAA 5I0BA 4ORKA 1XHAA 4F6UA 3GOKA 2BFYA 3LCTA 4E93A 1BX6A 3AKLA 3RAIA 2R3FA 3OY3A 4EUUA 2CN5A 4AS0A 4QTDA 4CMUA 4F7SA 5IQIA 5F95A 5CENA 2QG5A 2J2IB 3ZRLA 1CTPE 3EQGA 3E62A 3EH9A 4RZVA 3CD8A 4I21A 1CKJA 5AM7A 2O8YA 3FMJA 4YTHA 5GJFA 3U55A 3UOLA 2X39A 2P33A 4FSNA 3W2OA 5B2LA 4ANBA 4FV9A 2EXCX 3ORKA 3R8MA 3OOGA 3JPVA 3PVUA 1ZARA 1OBDA 2JDTA 3FMMA 2XBAA 4E7WA 4QQCA 3TZ9A 4KS8A 3DJ7A 5A6OA 3BYOA 4FTOA 3DXNA 5H8GA 3FL4A 4XBRA 5IEYA 4FV8A 4E6QA 5J1VA 2UW0A 5KBRA 4FTNA 2XANA 5IQDA 4FE2A 4DTKA 4FSMA 1ZYCA 4BDKA 3BLRA 4FSYA 4O0XA 4PV0A 2AEGA 2RFNA 2RG6A 1Q62A 3OWLA 4XV9A 4Y72A 5HIDA 2XVDA 3FQHA 2A4LA 4CFNA 3DGKA 3RM6A 3ELJA 5CEOA 4ARKA 4X2FA 4GH2A 5CAUA 2C6DA 3NCGA 5EYCA 1Y8GA 2HXLA 1R78A 4RWLA 2ERZE 5CT0A 3UOKA 4RX9A 5HHWA 4WT6A 1WBVA 2Y9QA 2YM8A 3VQUA 5AA9A 1WCCA 2PUUA 2XJ1A 4WG3A 5L3AA 5JFXA 4BCFA 4CTCA 2YM3A 3KKVA 4BBEA 5H8BA 3SXRA 4D58A 3TXOA 5F20A 3UQGA 2WMWA 4FSQA 2WMTA 4QP7A 4AXAA 3BHUA 3RPOA 4GV1A 4RIYB 1PXMA 5EW3A 3MIYA 4O0RA 5KZ0A 1OIRA 3RALA 5K4JA 4B8MA 4M67A 4G9RA 4QMPA 3EQIA 5J87A 3PFYA 4IX6A 3KXZA 4U3YA 3L8XA 3QXOA 4B6LA 2EB3A 3LQ5A 3F3ZA 3C4FA 4TRLA 5A46A 5C1QB 2F4JA 3BYVA 3TJCA 4EH8A 4YJNA 4DFBA 4A9UA 2PTKA 3IOKA 2Z7QA 3PP1A 3MGYA 4HVHA 5IA2A 4JNWA 1J7UA 3WZUA 3HV3A 2QVSE 3R30A 4FT9A 3B2WA 2BIKB 4FIHA 4EK3A 2BAQA 5L8LA 3GCPA 3UIBA 5J9LA 3ZXZA 5LCJA 1NVSA 3S95A 2W4KA 3W16A 4PY1A 4C4IA 2UW8A 2IZSA 3CGFA 3K3JA 5EOBA 3CD3A 2UZEA 3JVRA 4J99A 3RINA 2CKQA 3KN5A 3AKKA 5AUYA 3L9PA 3QA0A 3DTWA 4V04A 5BYYA 3FLNC 3DU8A 4O0WA 5D41A 2XK3A 5IG1A 4M84A 5BUEA 4ZJJA 3QQHA 3QXPA 3S0OA 3R1QA 4Y5QA 5ETCA 5BVKA 2GNIA 4CNHA 4EK6A 3HV6A 4KKGA 5DRBA 3FE3A 2W96B 4DGLC 2UV2A 4N4SA 5M06A 4JBVA 4EJ7A 1KUTA 3QCSA 1SVHA 1H4LA 2AC3A 3GEQA 4CMTA 3R0TA 3FUPA 4XP0A 4BIDA 4FRFA 3OTUA 1K9AA 5DNRA 5FTQA 1O6LA 3KEXA 3SDJA 5I3OA 3P7BA 4GKHA 2G9XA 2DYLA 4FT3A 4RFZA 3VS2A 3BL7A 3C4ZA 4D4VA 4MXXA 3QLGA 5CSPA 2PUIA 4WUNA 5CVHA 1V1KA 4E4NA 1CKIA 4LOOA 3KK8A 3B2TA 4ID7A 4EK8A 4IX3A 3MFTA 4MBLA 4FKQA 3EYHA 3PPZA 4RLLA 2OXYA 4AT3A 1G8KA 5HO8A 4ANOA 2PVNA 4EZ7A 5EQPA 4CGAA 3KA0A 2BPMA 3LCOA 3QTSA 4I92A 5FUTA 4HGEA 2JBOA 4X6RA 3NUXA 1FMKA 4YTIA 4CYJA 4EUTA 3PXRA 5BPYA 4NFNA 5I9ZA 3KXXA 5ITAA 3O7LD 5KMNA 3BHYA 1RQQA 4M69B 4NM0A 2RFDA 4X21A 1W0XC 4BDFA 3EQPA 4UMUA 5M55A 4O21A 3W33A 3OBGA 4CRLA 4DEHA 1J1BA 2BDJA 3C50A 5CLPA 3VS0A 1Q5KA 4KABA 4NJDA 3PJ8A 3PA3A 2PE2A 4F0GA 5IH5A 4C4FA 3NVMB 4DHIB