5T68A

Crystal structure of syk catalytic domain in complex with a furo[3,2-d]pyrimidine
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
275
structure length
266
Chain Sequence
VYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVNEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase SYK
publication title Synthesis and optimization of furano[3,2-d]pyrimidines as selective spleen tyrosine kinase (Syk) inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 81
structure length 266
sequence length 275
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2016-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5t68A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5t68A01
3Q4CA 2XK7A 1PXKA 4C36A 1KE9A 5HORA 3QAME 3T9IA 5M4IA 3L8SA 5C03A 2OZOA 4WG3A 3ZRKA 2R3FA 3D7TB 3R04A 2PMIA 2JEDA 3LFDA 3U6JA 3WF5A 1FQ1B 2BVAA 3R1NA 4P4CA 3Q2JA 3SGCA 4M12A 4NYEA 3BYSA 4EKKA 2XYUA 4QRCA 1ZZ2A 4FVQA 3I60A 4PP7A 4KNBA 2ETKA 5DEYA 2C6OA 3SAYA 4FZAB 3MW1A 4NT4A 3T9TA 3M2WA 3QQGA 5M56A 4UN0C 2ITQA 3PXYA 5AUUA 5LVOA 4UWYA 2YFXA 3OY3A 4EC8A 3COKA 4O7NA 4IW0A 4CD0A 1AGWA 3FC1X 3EMGA 3G5DA 2J7TA 3WARA 4LI5A 4EC9A 4F9YA 2XP2A 3IK3A 5DNRA 5JSMA 2WD1A 3F88A 3DAEA 3DDPA 3AC8A 3ATSA 4G6LA 5J1VA 3BYOA 2BZIB 1JSVA 1PKGA 5CU6A 2JDSA 4A9YA 1Z9XA 2XUUA 3IW8A 4YGAA 4XYFA 2O2UA 2QR7A 2QCSA 3PSDA 3R7IA 1Q3DA 5AAFA 3VBYA 4G5PA 3P78A 4QMUA 4BDBA 2UVXA 5HQ0A 1TVOA 2P3GX 2IWIA 3HAVA 4BF2A 2W1ZA 4CEGA 2JD5A 2YACA 2OLCA 4FKVA 2E9NA 3BYVA 5CU2A 2JAMA 2IZRA 2C5NA 3ELJA 4BCIA 5C8KA 3PY1A 5HOAA 3TV6A 4J52A 4FSTA 3GBZA 5FDPA 5E4HA 3LVPA 4H36A 3QUEA 3OROA 2YWPA 3EFWA 3VUDA 3U55A 1PMEA 2RG5A 4JL9A 4QYFA 3BHVA 4FL2A 3ROCA 1XQZA 2ZYBA 5JT2A 1JSUA 4OT5A 4F7JA 2O65A 3CEKA 4ZK5A 1XH8A 3E88A 4GIIA 4O7WA 2YAKA 4FUXA 3UOKA 4AT5A 4HNIA 4K18A 4AZTA 2FB8A 1IG1A 1GIIA 2CDZA 2RL5A 5IA2A 2GTNA 3F5UA 4ANMA 3JXWA 4C59A 3SA0A 3VHKA 3RK7A 1FINA 4V04A 4XG6A 2HWOA 4IVBA 4BGQA 4I5MA 3RK5A 4E73A 5BX0A 4C3FA 3DB8A 5FD2A 4CMTA 1ZYLA 4JI9A 4JIKA 4FBXA 4OTIA 5DR6A 3OWLA 4IVDA 5HZNA 3IKAA 3R1SA 2OG8A 2PVJA 3LLTA 2XK3A 4R7BA 4IWQA 5HIEA 3W18A 3NZ0A 2ITOA 3QLGA 3EQFA 3EB0A 3V8WA 3R2YA 4A4XA 2O63A 3VW8A 3QYZA 5IQEA 1SZMA 2WIHA 3R21A 4BTMA 3Q2MA 3EYHA 1Y6BA 1YXTA 4MHAA 4GFMA 1HCLA 3R01A 3SG9A 3IOPA 4JRNA 1OB3A 4RIOA 3SXSA 1H27A 1E1XA 4BDEA 4QQ5A 2VRXA 3K54A 5EYKA 2R3PA 2GDOA 3MS9A 4O21A 2X8EA 4QPAA 4X2KA 4MWHA 3UNKA 1H08A 3Q32A 3UZTA 3DBEA 4LOQA 4MD8E 3OTVA 5HD7A 4NSTA 2X4ZA 5A4TA 3NCZA 4A06A 3R7GA 3LFQA 5I3OA 4BDKA 4FC0A 4FT5A 4MBLA 4EZ3A 3HP2A 1J7UA 3GC9A 2F7EE 2PUIA 4DAWA 4DH1A 2Z7LA 4RIXA 4H3PA 2YM7A 2WMBA 4IX5A 3FQHA 4M68A 3A99A 3DNEA 4R8QA 4I0RA 2R4BA 2WMTA 3QA0A 2YJSA 2CPKE 4F4PA 3FE3A 4EHGA 4K33A 5AP2A 3OZ6A 4J98A 1OL2A 5JRSA 2PVFA 3PFQA 4IHPA 4RIXB 4DEGA 4YHTA 4FIJA 2IO6A 1ZXEA 4P2KA 4FZ6A 4EK3A 5M53A 2XKCA 3DLZA 4HYIA 1A06A 3KXXA 3DZQA 2BIYA 2C6LA 2BFXA 4WNKA 3UJGA 2OFUA 3VQHA 2ZV2A 2AUHA 2XKFA 4CV9A 1PMUA 4PDOA 4TWNA 3Q4TA 1SNUA 4RVKA 4TY1A 4OBPA 5BVWA 5FM2A 2YM6A 3ZMMA 4BGGA 1MUOA 2BDJA 4CT2A 3P7CA 3QWJA 3NLBA 4IZYA 4PDSA 4GYGA 4QP4A 5IZFA 1GIJA 5FTOA 4D5HA 5D41A 3CR0A 2J9MA 4BYIA 5KX8A 5ANJA 4XG9A 3E8EA 3R1QA 5LMAA 1J1CA 3KU2A 3V3VA 2WOTA 4BL1A 3A7IA 3LXKA 3SC1A 3IECA 2V22A 5EI6A 3MESA 2PWLA 3QC4A 5AX3A 2ACXA 2PZ5A 2W1EA 5HU3A 5J1WA 5CI6A 1JKKA 3I6UA 2X9EA 3MPMA 4AOTA 3HV7A 1B39A 2BMCA 2UW7A 2I0EA 3FZTA 3Q5IA 5DI1A 4GKHA 4BR3A 1ZYJA 3Q04A 5HU9A 4FSNA 3TTIA 4JR7A 2Y7JA 3E64A 4BC6A 2C6KA 3EN6A 3FZ1A 2OXXA 5GJDA 1V0OA 3PTGA 2W05A 5A14A 5IUHA 2GCDA 2EXCX 4YO4A 3P7AA 4FKJA 3DZOA 4EL9A 1PYEA 4X2FA 1APME 4JIAA 3R7YA 1JQHA 2BR1A 1UU8A 3HMOA 1ND4A 2GNLA 2Y8OA 3TIZA 5K5XA 3MFUA 3ZBFA 3FMKA 1XO2B 3GCQA 2YCQA 3DS6A 4L7SA 4ACHA 4JQ8A 3TDWA 4FV2A 4FTRA 4FNZA 1H01A 3FLQA 2JKMA 3R7UA 3C4ZA 3S0OA 1OBDA 5JFSA 3A7FA 4BI0A 4O6LA 2QO9A 3OEFX 5CSWA 3WI6A 4DCEA 4GVJA 5CU3A 3IW6A 2W96B 4U6RA 2Y4IB 3KRRA 1JAMA 1H1PA 5IA5A 3RAKA 3DXQA 5HBJA 4AW2A 4FSQA 2X7FA 3UODA 4M84A 1YDSE 3EZVA 3O7LB 1OUYA 2XNBA 3MFSA 3NUPA 5CQWA 5AUVA 3UNJA 3DGKA 3LCKA 4XLVA 4BCQA 4YU2A 4GJ2A 2VWBA 4FTUA 3TNQB 2CMWA 2WTCA 3FDNA 3CTHA 4I4FA 4FA2A 3GP0A 5A4QA 3KMUA 3JVRA 3QQJA 1OMWA 4TPTA 3PIXA 3ODYX 5HIDA 3Q60A 2UZTA 4FOCA 4BDGA 4ORKA 4MVFA 4BTJA 2UVYA 5L6PA 5ICPA 4M0ZA 4RLKA 2BIKB 2WEVA 1PMNA 3KVXA 5E8SA 5I9UA 4ASDA 4YZMA 4RJ4A 4XX9A 5KKRC 3MGYA 1OKWA 4XHKB 5KMNA 5GIPE 2GS7A 3VBVA 3KXNA 3VC4A 1OIYA 1U46A 2ITYA 3TL8A 4ZJVA 1SM2A 2P2IA 3VWAA 3W2RA 4LM5A 2QU6A 4DFLA 4MX9A 2JGZA 3S3IA 4TKSA 4MXYA 4UBAA 5BVOA 3W2OA 3POOA 4B8MA 3ORPA 4U3ZA 2R0UA 3LM5A 3PPJA 4MCVA 5E1SA 4DFBA 4RT7A 3KL8A 1G8SA 1REJA 1UVRA 2B54A 2R0IA 2X7GA 1URWA 5KMMA 1H8FA 4KIQA 2BTRA 1P4FA 3IW4A 3EQCA 3N51A 4W4VA 2C0TA 3VUGA 4MK0A 4CFMA 3D5VA 3I81A 4F0GA 1SVGA 2OJGA 1SYKA 2ZV7A 3BLHA 4XV3A 3AMYA 3OCGA 3W2QA 5TKDA 3F5XA 5LVNA 4IADA 3UPXA 3W10A 5CSVA 5FP5A 4B6LA 4E6DA 4RWJA 4J99A 5HLPA 3SVVA 1FVVA 2JFLA 3NDMA 4MKCA 2W1DA 4M8TA 4DEBA 1SVEA 4PTCA 4O84A 3CLYA 4I5PA 3P5KA 5HG7A 2B52A 1ZRZA 2B1PA 2W4OA 4ZTSA 3LFSA 3SRVA 4U9AA 5D1JA 1Q8ZA 4U97A 5IH6A 5M4FA 4K6ZA 3QZGA 4WSQA 3UP7A 4D2RA 3E7OA 3QQUA 2WMUA 4P5QA 3EJ1A 2VTSA 3TKIA 3DLSA 4I6QA 4AN2A 2EB2A 4FVRA 1NVSA 2J6MA 2XNEA 4FV1A 2GQRA 2V55A 3O50A 4NFNA 4AQCA 4C4JA 4XOZA 3SRVB 2YAAA 2PMLX 4CKRA 3BQCA 3B8RA 3KK8A 3FYJX 2YLFA 2VUWA 4DC2A 4XRJA 2NPQA 4ZTMA 4NTTA 4RJ8A 3SHEA 4BB4A 2X4FA 3L8XA 5DT4A 4FKWA 2QLQA 4D2PA 4PX6A 3WZEA 3TJCA 1CSNA 5FTQA 5IQAA 4KS8A 3OC1A 5M4CA 2YM3A 4KINA 3I7BA 4X7QA 5D10A 3RPRA 3LMIA 4ZTHA 1Q62A 5M51A 4PWNA 3LQ8A 5A54A 3K5VA 3LQ3A 1GNGA 2FO0A 3DCVA 2QKRA 4WO5A 4B0GA 4FTTA 4YTHA 4ITJA 5IQHA 1QPJA 5CALA 3SG8A 4BDDA 4R77A 2QD9A 4F64A 5FG8A 5IUIA 4CZUA 4QMWA 4ARKA 4FEVA 2C4GA 3P08A 2G1TA 5GINE 3IDBA 5E8XA 3A7HA 3Q96A 5IG1A 3FHIA 3LCOA 1M2QA 5IMEA 5E8UA 4IZAA 3SOCA 2H34A 3P0MA 4L9IA 1OPLA 4FV5A 1FVRA 1F0QA 3CY3A 1ZLTA 2JDVA 1OIQA 5J9YA 4RX8A 4RX7A 4XBUA 4IAYA 4AA4A 4IX4A 2O5KA 4P7EA 4W4YA 5IMXA 5KHXA 4QOXA 3VS3A 5JQ8A 3VS0A 2JKKA 3MH0A 2QOCA 4JQ7A 3DU8A 1Z57A 3U9NA 3IG7A 3PPZA 4AW0A 3QL8A 1XBCA 4YLKA 3C4XA 5HO7A 2XJ0A 5CAOA 1UWJA 3LFBA 4ENYA 4EHEA 3KB7A 5JFWA 3QGYA 1DAYA 2UZOA 3W2PA 3ID6C 4NJ3A 4YHJA 3ORXA 4U3YA 4L01A 4ZS0A 5AUYA 4BCOA 5HE3A 1NA7A 2RG6A 5DPVA 2OF2A 4CQEA 3RPYA 4C61A 1DI9A 4FIFA 3WYYA 2HYYA 5CNOA 3T3UA 4QP6A 3VS6A 4AW1A 2WEIA 4BZDA 3MDYA 4ZXTA 4X21A 3TDVA 2O3PA 3EFJA 5C8NA 1ZAOA 2EB3A 3R8VA 3V5TA 4DTBA 2PSQA 4ZSAA 4QMMA 3ZUVA 3HUBA 4L43A 3BEAA 4O2PA 3RM6A 4RIWA 2IW9A 3OD6X 4FGBA 3WZKA 5DMZA 4YMJA 1XKKA 2XIYA 2QI8A 5HCZA 3QUDA 4XMOA 4DA5A 3ZXTA 2C0OA 4K77A 4OW8A 5CANA 5GIOE 5CEMA 4O7RA 5CQUA 4KRCA 4EJ7A 3I6WA 4D4SA 3FC2A 4J53A 4QMYA 5LVLA 3MIAA 2QO7A 3VVHA 3ZO4A 4RIWB 3NW6A 3AT3A 2ONLC 4S30A 3D2KA 4GW8A 4YZBA 2DUVA 2PE0A 2EU9A 3DFCB 5I9WA 1HCKA 5BVEA 2I40A 3UIBA 3ZONA 4ERWA 4U44A 1JBPE 5CSXA 4WA9A 4BIEA 4GK4A 4JBOA 2J0IA 1UV5A 5AR3A 4YZDA 2WU7A 2RIOA 4E4MA 4E5AX 3A2CA 2C0IA 5G6VA 4FEWA 4F65A 2FUMA 4CFFA 3BGZA 3DK7A 4D55A 3UBDA 4FGRA 3ZHPC 3D83A 3DQXA 3EN4A 2I6LA 2Q0BA 3A8XA 3C4CA 3VW6A 4JG7A 3TZ8A 3H3CA 5IA0A 1W84A 3B8QA 3F69A 3GU5A 3R0TA 4OLIA 3VF9A 4EOLA 2W1CA 3OWPA 3PSBA 4FIIA 1OZ1A 1OUKA 3CIKA 1E9HA 2A4LA 3WYXA 4YC6A 5A3XA 5CEPA 3F5GA 1DAWA 2C3JA 5EQYA 2WNTA 2WQBA 3RKBA 4AFEA 5HX8A 5ITAA 3MA3A 2QURA 1M7NA 2YZLA 5KMKA 4PTGA 1YI6A 2QHNA 4YJPA 4KUJA 4ZP5A 3RZFA 5M55A 1PXIA 2OH4A 3KRLA 4DINA 1WFCA 4W4XA 5E8WA 3PA4A 3ULZA 3PJCA 4DGOA 4M0YA 1CKJA 3FLSA 3KRJA 1VR2A 5TT7A 2BILB 5TR6A 4R3RA 4XCUA 3ZFMA 1F3MC 2C47A 4KRDA 4EHZA 4EOOA 3CBLA 4ZSLA 3MJ1A 4FMQA 3JVSA 2GS2A 4QPMA 1QPDA 4GRBA 1ZY5A 4FIHA 3RMFA 3W2SA 4ENXA 3DXNA 3GUBA 5L6WL 4FIGA 3NAXA 4OBQA 5A4CA 1UU7A 4B7TA 3BV3A 5IQFA 4BBFA 2QC6A 1YHSA 4YR8A 5BMSA 1YVJA 1RDQE 3FMEA 3RCJA 1NVRA 2OXYA 4HGLA 2OJIA 3HLLA 5DRBA 2PVHA 3BHYA 3SKCA 3PYYA 4RX5A 3U87A 3ZS5A 3E8CA 4DHFA 1TKIA 3V01A 2ERZE 1YWRA 1B6CB 3DNDA 5ANIA 4RLLA 3RHXA 4EWQA 3NYNA 1IR3A 5EW8A 3EL8A 3R63A 5C27A 2Y4IC 1XH4A 3ZM9A 5TF9A 4DEEA 3EQDA 4BFMA 2H8HA 3EYGA 3PP0A 3BKBA 3LFAA 1ZMUA 2PVLA 2FSLX 4WRGA 3VQUA 3U54A 4JRVA 4W4WA 4YNEA 2YN8A 3VS2A 5BVNA 4ZSGA 3QLFA 3HMNA 5HG5A 4AOIA 3KXGA 3UOLA 4ZY5A 1BL7A 4KABA 3FLWA 3QGWA 3A8WA 5AIKA 4C33A 5KO1A 2UZEA 2BALA 4EH3A 3LPBA 5B2LA 2VTHA 3DBCA 2BCJA 3D94A 4BWPA 3E8NA 4EI4A 1QPEA 2ETRA 1KE6A 3AC1A 3TKHA 4QTDA 3HAMA 3IO7A 2RKUA 4E20A 2OI4X 2WTDA 2R3LA 4AZEA 5IUGA 3LFCA 4AG8A 2IVVA 2YM8A 3NUSA 4FL1A 3ZUTA 3A7JA 4I41A 4YZNA 3HL7A 4J95A 5CYIA 5HE2A 3BGQA 5EI2A 3BU6A 4HVDA 2C30A 2UZDA 3EH9A 4Q5HA 4G6OA 3RCDA 3SXRA 3ORKA 2J5EA 2NO3A 4FTLA 3UO4A 1Q8TA 5KCVA 1A48A 3RAHA 4FL3A 3UGCA 3BIZA 5I5ZA 5TO8A 5BPYA 2OJJA 5LARA 4APCA 4Y72A 3DKCA 3EN9A 3NW7A 2C69A 3TWJA 1GY3A 2WTKB 4Q9ZA 4D5KA 5LQFA 2UZUE 5BUJA 2CNQA 2J0LA 5ANOA 2UUEA 2XVDA 3LE6A 3ZH8A 1EH4A 4NTSA 4YJQA 3NUAA 4DGNA 1DS5A 3D0EA 3QC9A 5I3RA 2CGVA 3MFTA 3NR9A 3RPSA 3B2WA 1Q5KA 5A4EA 1WVWA 1XH7A 3QQKA 3CGOA 4AGWA 4D1SA 2EXEA 3L1SA 2PE1A 4IAAA 4IDVA 1WBWA 1ERKA 2YCFA 3AC4A 3E3PA 2ZV9A 4FYOA 2P33A 3UIXA 4D2SA 4USEA 5LMKA 3FXWA 3BE9A 4E1ZA 3VUKA 2FGIA 4EH6A 4EH4A 3BU3A 2BKKA 4TYHA 1H28A 4MXCA 5CENA 4MAOA 3JY0A 3Q52A 5GJGA 4LGDA 3R83A 3FJQE 4AE6A 5M08A 3QBNA 1Q4LA 3PLAE 3QYWA 2VO7A 3ENMA 3KQ7A 5M57A 1S9IA 2GMXA 3OOGA 3Q53A 3MYGA 3O8TA 3HZTA 4GT5A 4BICA 4MXOA 2WMVA 3H9FA 3K2LA 2DS1A 2XH5A 3LFNA 3HEGA 3PJ2A 2WKMA 5E8ZA 3PXZA 3MBLA 2Z02A 2FH9A 3CY2A 4FF8A 1PKDA 4G9CA 3FYKX 1CMKE 3I5NA 4PL5A 1YHVA 5K5NA 4O82A 2A2AA 3OHTA 2VTAA 4QTBA 3ITZA 2WMXA 3MPAA 3GU7A 4ZY4A 3U9CA 3OEZA 4CCBA 5CWZA 4X3FC 3CXWA 3O71A 3HRCA 2A0CX 4PMTA 2X2LA 1YI3A 3R1YA 4D4YA 4IB3A 2J0MB 5KZ0A 4ANOA 4O0XA 2CKQA 4IJPA 3QRUA 2XB7A 4GFOA 4S34A 4V0GA 3GT8A 2IVSA 3HRBA 4YJSA 2WOUA 3QHWA 4RX9A 2F57A 2G01A 3ZFYA 4IM2A 4C0TA 3CQWA 2IZSA 3ZLYA 1TQMA 2YIQA 4H58A 3W2CA 4X2GA 5CVHA 5CAVA 1WVYA 4ZMFA 3I0OA 1VZOA 3CGFA 3F82A 2HENA 5AV4A 3QKLA 4FKGA 2C6MA 3ROYA 4L42A 4YPDA 4YBKA 3OOMA 3R9OA 4V0GB 3L8VA 3FZPA 2Y0AA 1TQIA 4G3EA 4GL9A 1M2RA 3FWQA 1JVPP 3IDPA 3VUHA 4O1PA 4W8DA 5JZNA 4L6QA 2C6IA 1JSTA 2X39A 3RPVA 2WTJA 2C6TA 5EW9A 3PRFA 4RWKA 4CXAA 2C68A 3T8OA 4H39A 4PMPA 4RA5A 4LL0A 4GT4A 5AV3A 2CKEA 4C4IA 4CMOA 4UB7A 1Y8YA 4RRVA 1R1WA 4H05A 4M7IA 5IEYA 2XK9A 2HY81 3LCDA 4BCFA 1QMZA 5EYDA 1AD5A 3R9RA 5DFPA 3ZZWA 4DCAA 2PVRA 2PULA 3OT8A 4WNOA 4YSMA 5HBEA 2J4ZA 4IWOA 1H4LA 3QTQA 3ANRA 4MNFA 3UYSA 4FV3A 2PPQA 1JLUE 2IG7A 3HA6A 3E87A 5DGZA 5JH6A 3GOKA 4A9UA 4D2TA 4I0SA 3E3BX 5D7VA 4DYMA 4I94A 2VU3A 1W83A 2BKZA 4PY1A 3ZC6A 1URCA 3NUYA 2WU6A 4KWPA 4OTPA 1ZMVA 3UIMA 4H3BA 5A6OA 4IVCA 2A19B 3F5PA 4C3RA 4L3PA 3R9HA 1PXJA 2R3NA 5E92A 5EFQA 3F3ZA 4J8MA 3UVPA 4F99A 4XRLA 1FGKA 4MWIA 4E5WA 4ZS4A 4YUQA 2IJMA 1H1WA 3GU6A 4C4GA 4JLCA 3R73A 4L00A 4BI2A 3UO6A 1YXSA 5AP5A 3EIDA 3G6HA 4HGEA 4CLJA 3KCFA 3CP9A 2ITXA 2XBJA 3OCBA 3EOCA 5T68A 1PXNA 2GNGA 2ZB0A 1YOMA 1HOWA 3JS2A 4OTRA 5JRQA 4I5CA 1QL6A 4BCKA 1ZARA 4QMSA 1Q41A 5AM6A 4YJVA 1R0EA 2BHHA 3DK6A 3EQIA 5HD4A 4YBJA 3AOXA 3OT3A 3WBLA 5J5TA 1ZYDA 2QOFA 3CTJA 3WIKA 3D2IA 4ZY6A 3R9DA 4ASEA 4N4SA 2QKWB 3HV5A 3P4KA 2HIWA 2XCKA 4IIRA 5FXRA 4RVMA 4O0VA 2WMRA 2QONA 4BKJA 3V5WA 4II5A 2WQMA 4PMMA 4XG2A 2E9OA 4GYIA 1OL5A 1XH6A 4MH7A 4N6ZA 2J2IB 4ACDA 4JX3A 3FLNC 2BRNA 3AQVA 5CVGA 3QZIA 2OJ9A 1H07A 3W32A 2X6EA 4CFNA 2YDKA 4BCMA 1K2PA 3TZ7A 3BLQA 5DIAA 4MXXA 1LP4A 4UEUA 5AR2A 3LXLA 4U79A 4QMPA 2JKOA 3GCVA 1H25A 4BRXA 1BI7A 3UOJA 4HCUA 4OAVB 1FOTA 1FMOE 4FNWA 3NNVA 3UO5A 5J79A 4GMYA 4F08A 2P55A 4RA4A 1U54A 3C50A 4M66A 4YC8A 3NSZA 5CY3A 2BUJA 3BE2A 5DHJA 4OTWA 4TWOA 5EHLA 3T3VA 4LMNA 3D7ZA 3HMPA 4FG8A 5HCYA 3HECA 3MPTA 3TM0A 2QHMA 3I0QA 4JQEA 1OIRA 4JBPA 2ITNA 4LUEA 2WELA 4NKSA 4X0MA 1KE7A 4QMOA 4WSYA 3MN3A 4U81A 2O0UA 3PSCA 2GQGA 2BFYA 3O7LD 1U54B 3OBGA 4GH2A 3UC4A 5L6OA 1U59A 2VWZA 4CNHA 4Z7GA 3EQRA 4O2ZA 4WNPA 1VEBA 2OBJA 2VWXA 3QTIA 3WF7A 4OBOA 5DH3A 5DLSA 5AV2A 5HCXA 4EJNA 4F0IA 2XCHA 2QOKA 3R8PA 4BHZA 4KIOA 4FV7A 2RSVA 4J8NA 4F1OA 3V8SA 4MXAA 4FTCA 4UWBA 3WZUA 3LJ0A 5A6NA 5ANEA 5HVJA 2OF4A 4GJ3A 4MNEA 3EN7A 2HXLA 2ZM3A 2W4KA 4EOIA 2QOBA 3QD2B 4F9BA 4RQVA 4EK4A 5BMMA 5CF4A 2JBOA 1FMKA 4EOSA 2R3IA 3TNWA 4M15A 4M67A 1KSWA 2CNVA 3VBTA 3QTXA 4D2VA 2NRYA 3JPVA 5EDPA 3UPZA 3LMHA 3DAKA 2VNYA 3HDNA 3PDTA 3FMDA 4MNEB 3FPMA 5K4JA 3MVLA 4DLJA 4UMUA 3KN6A 4BWKA 5J9LA 3ORMA 3AG9A 4IANA 4F63A 1BMKA 2VTNA 4Y46A 4R78A 1YKRA 3QRKA 4U43A 3VN9A 4AN9A 4R5SA 4O0UA 4PF4A 5K0XA 4H1JA 4RWLA 4TYGA 5EYCA 4GG5A 4CFXA 2YDIA 4IAFA 1WBVA 3VS1A 4ZSJA 2XF0A 4C7TA 4RC2A 5LCJA 2XKEA 5IQDA 1L3RE 3PG3A 1TQPA 3UMXA 1KUTA 3BYMA 3M1SA 4JNWA 5D11A 2XKDA 3IGOA 4LV8A 2OIQA 1JKTA 4NJDA 3NNXA 4AAAA 5FTGA 3BPRA 4E26A 1GZ8A 3UYTA 4E8AA 4UY9A 4ZZNA 4OTGA 3CJFA 3DV3A 4XOYA 3CC6A 3S1HA 1P5EA 3MH3A 3VBQA 4I1ZA 3NYXA 2OK1A 3GFEA 1H0WA 2H6DA 3CJGA 4ONAA 3VO3A 4IMYA 1XWSA 2R3OA 3LW0A 1BKXA 3ZO3A 3C4FA 3CTQA 1GIHA 5KZIA 4AA5A 4FYNA 4RZVA 4DH5A 5A9UA 4CG8A 4BDCA 3N4TA 2YDJA 3BRBA 4ALUA 4DLIA 2UW3A 4ITIA 4KB8A 4JVGA 1H00A 3H0ZA 2RGPA 4RFYA 4I93A 1VYWA 3OW4A 1OVEA 5J5SA 1XHAA 4YTIA 4C38A 4CKJA 3FI3A 3H4JA 3GQLA 2WO6A 2YABA 5AADA 4LMUA 3QD4A 4Q5EA 5CF6A 2Q0NA 3GC8A 5J7BA 3ORIA 4MD7E 5IDNA 3BU5A 4CT1A 1OBGA 4UXLA 3A7GA 2VX0A 4UMTA 5HVKA 4HW7A 4J97A 5EM8A 5GZAA 4NM3A 5IEXA 4R1VA 1OL1A 3MJ2A 5EHOA 5H8BA 5CLPA 5HLNA 4G1WA 5BUIA 4DGLC 5ETFA 4S2ZA 4TYEA 1UKHA 3EL7A 2X2KA 4MD9E 5HESA 3PUPA 3RM7A 2R64A 5CXZA 4D0XA 4E4NA 1XH5A 3C4WA 4FKRA 4IDTA 5HX6A 2WFYA 3MB7A 3QF9A 4LOPA 3ULIA 1E1VA 1OI9A 3OY1A 4MBJA 5AP6A 4EH8A 1RE8A 2GHMA 2YEXA 3DB6A 2RFSA 3TTJA 4Y83A 1J3HA 2YIXA 3JY9A 4ERKA 4NK9A 4FG7A 4PMSA 2XEYA 4RFZA 5B2MA 4YJNA 2X9FA 2B55A 4QYYA 3I1AA 4LG4A 4O38A 3QWKA 4M13A 2G15A 5L8LA 1YWVA 4IFCA 2WQOA 4F6WA 1W0XC 1JPAA 3K5UA 4BI1A 1KV2A 4EK6A 4F7LA 1WCCA 4BHNA 4U41A 4HVHA 1Q97A 2C3LA 5HTIA 2GSFA 1JWHA 4DG2E 4DF3A 2R3MA 1BUHA 3GFWA 2FA2A 4FSUA 4F1MA 4A9TA 3ACJA 1Q61A 2UW6A 4C4EA 1IAHA 1MRYA 3V5LA 1M52A 5CU4A 3KF7A 3HDMA 3LXPA 5AP7A 2BTSA 4M97A 2JIIA 4FV6A 4G3CA 1LUFA 2B53A 3K3JA 2PMOX 2C3KA 4TNDA 4U80A 4D9UA 4Z3VA 4GU9A 4FNXA 3U4WA 3AT4A 2Z7SA 3AD4A 4N0SA 3FUPA 4K8AA 5FGKA 2X81A 3C0HA 1DM2A 2VX3A 2ITPA 3PA5A 2UW8A 4L45A 3TACA 3U8WA 3IDCA 3P86A 3BWJA 3HX4A 5FWKK 4QT1A 1ZOGA 3FL4A 4B99A 1KWPA 3Q9WA 3PZHA 4A07A 1ZY4A 2BZJA 4F09A 3GEQA 4AGCA 1JKSA 1M7QA 2YIRA 4QTCA 4G6NA 4F0FA 2CCIA 3D15A 2CGWA 2GTMA 3OCSA 2CLQA 3AD5A 4OTHA 2ZB1A 3FQEA 3FPQA 4CFWA 1YWNA 1W98A 2QG5A 4KAOA 5J87A 3PY0A 3E92A 4O0WA 4NKAA 2DQ7X 4EH9A 2UW0A 5IQBA 3A62A 2WAJA 4ZJIA 4FSRA 1UNHA 2JIUA 4CKIA 4DTKA 4EOQA 4BBEA 4DITA 5I4NA 3PZEA 2C1BA 3Q5ZA 2FSOX 5F94A 1K9AA 3V04A 5AR5A 4BN1A 2BRHA 2QO2A 5CZHA 1NVQA 2JFMA 2AC3A 2JDRA 2OGVA 3PVWA 3COHA 3V6RA 3TUDA 2A1AB 3CPCA 2C3IB 1BI8A 3ET7A 4C4HA 2VTRA 4I5HA 5EW3A 1DI8A 3OG7A 3SD0A 4CYJA 4EH2A 4RPVA 3AD6A 5BYYA 3U6HA 4G34A 3W33A 1P2AA 1I09A 4C4FA 4BVUA 4O7YA 4KKEA 4EBVA 3C0GA 4L53A 4IZ5A 1UU9A 3S95A 4BDJA 4EH7A 3KULA 5LWNA 3TUBA 4ID7A 4EOPA 1IEPA 1WVXA 3LQ5A 3NUNA 4IFGA 3QD3A 2DWBA 5AMNA 5IQGA 4DH3A 5LWMA 5DN3A 3HV3A 4PUZA 3PWYA 2JDOA 4O91A 4NL0A 4AGUA 5HICA 1UA2A 5FBOA 5CASA 2EXMA 2C5VA 2P0CA 3G9NA 4RVTA 3NVMB 4TYIA 3WE4A 2BAJA 1PXMA 3C51A 3KULB 3FAAA 3GOPA 5AAGA 4E6QA 3TT0A 3MTFA 2PUPA 4O7ZA 3S00A 3LAUA 4IM0A 4K0YA 5A46A 2WMSA 5CSPA 3V8TA 3BELA 3U51A 4AUAA 4E93A 3KKVA 1OKZA 4Z55A 1GZNA 3QCYA 5G1XA 4CVAA 5AUXA 4L8MA 4TW9A 5F20A 4PRJA 4ALVA 3LMGA 5I9ZA 4D4VA 2Y6OA 3R00A 3LOKA 3H0YA 5E90A 2UV2A 2PY3A 4LOOA 4BCPA 5EM7A 4ZAUA 3P9JA 2X8DA 2A27A 3QCXA 3F61A 4DT8A 4YURA 5CEIA 3TUCA 3DTCA 3R2BA 4XBRA 2G9XA 4ACMA 1PXPA 4C37A 1XH9A 3E62A 4MF1A 5F95A 1OECA 4ANBA 5H9BA 5K4IA 4PP9A 3O96A 2PMNX 3QTZA 3PJ8A 4YLLA 2NP8A 5IF1A 5FBNC 3IS5A 4WD5A 2XNPA 5I9VA 2C5OA 1PY5A 2R7BA 4R7HA 4F7NA 3ZSHA 4BDAA 5EHYA 3FMLA 3R28A 3REPA 1PMVA 4LRMA 2NRUA 3F2NA 3ZO1A 3D5UA 1V1KA 3OUNB 5EM6A 2EWAA 5T6KA 4DG0E 3QXPA 2XIZA 4MYGA 3A4PA 3F66A 4FKLA 2XRWA 1BLXA 3SX9A 3AC5A 5HE1A 3EZRA 3MY0A 4IC7A 4BDFA 4EONA 2YM4A 1FGIA 4QP7A 3DJ7A 3R8LA 3C5UA 5ACBC 3RNIA 4I92A 3QD0A 2CKPA 4FKIA 2GFCA 5JFVA 5JGAA 2WQNA 1LEWA 4Y95A 5TOZA 4ZTRA 3NYOA 5HNBA 1CM8A 3UVQA 2R9SA 3GU4A 2ZM1A 5EOLA 3CD3A 4R5YA 4AT3A 3UG1A 4RJ7A 4KSQA 4U0IA 4L44A 2PZYA 4UWCA 1OIUA 4NM5A 4N6YA 2LAVA 3C13A 3C4EA 4DEIA 3C1XA 4HVSA 1CKPA 3FV8A 2V7AA 4O0YA 4A9SA 1OPKA 3R7VA 4UYNA 2QNJA 5AR7A 3PPKA 4O7VA 3V6SA 3VUTA 3ALNA 4I23A 1UNGA 4J71A 4YJTA 3WF8A 5CAQA 4AE9A 1KE8A 2R3RA 3QRJA 4L7FA 3RP9A 3ETAA 4CSVA 2OH0E 4D0WA 2XIXA 4FK3A 3N4UA 3Q6WA 2O8YA 5HG9A 5L8JA 2QODA 4FOBA 4BYJA 2PVNA 5AEPA 4XG7A 3U4UA 5JZJA 1FPUA 4AN3A 4TN6A 5KMLA 1IA8A 3G51A 3I4BA 3UQFA 3H10A 2R3GA 4C2WA 4X6QC 4L3JA 3FMNA 3G15A 4CLIA 2YJRA 3QQLA 2E2BA 2XEZA 3KFAA 4LGHA 3HGKA 2XM9A 4H1MA 2JIVA 2R3HA 3F3TA 4QP1A 2VO3A 5DWRA 3WZDA 1M2PA 3AMBA 4L67A 4MTAA 2Q83A 3TCPA 3TG1A 4KIPA 5HTBA 1Y57A 2W1GA 5J8IA 1PHKA 4HCTA 4R3CA 5AA9A 4AZWA 2G2FA 4A9RA 5D9HA 3PWDA 4XP3A 4NU1A 2ITZA 3R71A 4FNYA 5DA3A 3THBA 3KK9A 2CCHA 4IAIA 5DOSA 2PYWA 2I0VA 4FZ7A 3EKKA 4IC8A 1H1QA 3K3IA 4KIKA 4G9RA 3Q4ZA 4OT6A 4WHZA 3QZHA 1A9UA 4CFUA 5IQIA 2GS6A 3TNIA 5LJJA 1OITA 2VTJA 2QOIA 4GK3A 4XP2A 3VIDA 3W55A 4C02A 3IOKA 5IEVA 3GI3A 4W9XA 3R30A 4L52A 4CQGA 3PE1A 4KIKB 4XG4A 2W9ZB 4NUSA 2HCKA 2WTVA 1Y8GA 3ALOA 4JAJA 3E5AA 4QNYA 3NCGA 4EBWA 2QR8A 4KS7A 4DG3E 3OS3A 4TZRA 5E7RA 4FEXA 4HYUA 1GAGA 3GC7A 2JKQA 5AR4A 3IONA 3NGAA 3AMAA 3L9LA 4WT6A 3KN5A 5F4NA 4JR3A 1G5SA 4RGJA 4X2NA 5AR8A 5AUTA 4DBNA 5CAUA 3II5A 2R3QA 2R3JA 3CQUA 1F5QA 5DR9A 1R0PA 3W1FA 2VX1A 3PVBA 4C35A 1YI4A 3ZSGA 3F2RA 4ZZOA 5JGDA 1ZWSA 5H2UA 3BHUA 4AW5A 2PZIA 4Q2AA 4TWCA 4I24A 3RVGA 3HVCA 5C01A 4IB0A 4O0TA 1H26A 4XG3A 3UIUA 2XBAA 3HA8A 2JLDA 1J91A 4IE9A 4FX3A 3FZOA 2R2PA 3CKXA 1ZYCA 3MH2A 3BX5A 1OL6A 4XLIA 4CTCA 4WBBB 5BQ0A 4O0RA 4HYHA 3GVUA 3EFLA 3PE2A 3QA8A 2B4SB 2PL0A 4K2RA 3MTLA 4Y5HA 2C6DA 5C4LA 3O8UA 5GHVA 4IAKA 3C0IA 4LRKA 5HI2A 4OTDA 4QP3A 4IQ6A 2BROA 4MBIA 4EK5A 1NY3A 4WG4A 5CTPA 5F9EA 2BAKA 3E93A 3SOAA 4ASXA 4IZ7A 4PDPA 5KKRB 4C2VA 4TYHB 3QU0A 5AV0A 4XJ0A 4F7SA 2XK8A 5C1QB 3FBVA 2WXVA 2VTMA 1WMKA 1GZKA 1G3NA 2BRBA 3IGGA 2JAVA 4FG9A 4JG6A 4FEQA 1Q8WA 4FODA 2BDFA 3A60A 4AZVA 3ANQA 5K3YA 5HHWA 5DEWA 3QRIA 4BWXA 4O6EA 2F2CB 4YC3A 1PRYA 4O83A 3EFKA 5JMSA 5GZ9A 2DYLA 3P79A 5A4LA 1Q8YA 2IZTA 5FQDC 5HO6A 4JDHA 2HXQA 4BDIA 4EH5A 3RI1A 2W1FA 4FIEA 2ITVA 3DPKA 4CZYB 4JS8A 3ZRMA 4O1OA 2UZVA 4J1RA 4LYNA 1UNLA 4A4LA 3PY3A 4GCJA 4TWPA 5HTCA 5M4UA 4PL3A 3PXQA 4AF3A 3R7OA 2REIA 1ZOEA 2X2MA 3C5IA 2OSCA 4WNMA 3QTUA 4Y5QA 3CS9A 4X2JA 4UX9A 2JBPA 3Q9ZA 3FXZA 3VUIA 3JYAA 4LV5A 3QX4A 4JOAA 4B4LA 5HLWA 4YJRA 3M11A 3W8QA 3O17A 4UZHA 4RJ5A 5DYJA 4WOVA 1WZYA 1JOWB 4D2WA 2HZ4A 4FK6A 4RMZA 4G16A 2J50A 3ORLA 4ZZMA 4Z9LA 3CCNA 4IB5A 1WBSA 2RFDA 2W5BA 3LJ2A 4GFGA 3FZSA 4E3CA 4Z16A 4H3QA 3RTPA 5L2TA 3BCEA 5AFVA 3ZSIA 3OVVA 2B0QA 2I0HA 3RBWA 2IVUA 3FLYA 5L2SA 2BAQA 4EZ5A 5LVPA 3ZRLA 4E6AA 1SVHA 3FMHA 5AA8A 3VUMA 3QTWA 3M42A 3O23A 4NM7A 4RWIA 2ZJWA 4S31A 1UU3A 4QYGA 4DN5A 4IWDA 2PU8A 3LM0A 3R6XA 4FKSA 4QP9A 1SNXA 2UZBA 3VS7A 4CFVA 4U40A 4QYEA 3ZDIA 2HZNA 2C6EA 3LXNA 3PJ3A 3QKKA 3BHTA 5FLFA 5HO8A 4EUTA 1R39A 2GNJA 4PV0A 4G5JA 2GNFA 4EEVA 3O8PA 5FP6A 1O6LA 2PTKA 3ZU7A 4DH8A 4IWPA 3BWFA 2P2HA 1Q8UA 3Q3BA 1NT2A 3IW5A 5EQPA 4D58A 5KMJA 3ORTA 2EUFB 4FV0A 3UQGA 4Y85A 3R8ZA 1STCE 3N4VA 3PA3A 2YLEA 2OW3A 2PVKA 5FDXA 4EYMA 5I9YA 2V0DA 4QQCA 4XG8A 4ZEGA 2IPXA 1Z5MA 3EHAA 3OUKA 2WZJA 5KBRA 4JDKA 1G8AA 4O27B 1V0PA 3NPCA 4U42A 5AAEA 5BVDA 3QQHA 5FRIA 4O7SA 3OP5A 1KOBA 3KREA 3CD8A 4Y73A 2B9JA 4EQCA 2X8IA 1H24A 3D9VA 3NNWA 3PVUA 4HNFA 4GVAA 3O0GA 3WOWA 4DFXE 4G17A 5CEOA 5AP4A 3I79A 2ITWA 2XM8A 4D4RA 4I22A 3G6GA 3DBDA 5C9CA 4HZSA 4QNAA 1I44A 2VGPA 5EG3A 5FUTA 1XBAA 3MIYA 5C4KA 3NW5A 2YITA 3PJ1A 4MQ1A 3VS5A 2VTLA 1OKVA 2CJMA 3NX8A 4IEBA 3TXOA 5DVRA 2ZMCA 3UNZA 4EKLA 4BZNA 4E5BA 5KNJA 2GQSA 1RQQA 4O7TA 3TKUA 3CPBA 5T3QA 3UG2A 4DGGA 4S33A 2WIPA 1MQBA 2WMWA 3DDQA 5CNNA 3E7VA 4BKZA 3GC0A 4BIBA 5BUEA 3MWUA 1PXLA 3NRMA 2PZRA 4RG0A 4IBMA 4KKGA 4ZIMA 2W5AA 2ZOQA 5IH4A 4CRSA 4USFA 3UDBA 4G3GA 2FSMX 2ONLA 3ORZA 4JDIA 5L8KA 3NNUA 4FV4A 2CGXA 1YOLA 1VJYA 4NW6A 2GFSA 1X8BA 4NEUA 5J9ZA 2Z7RA 3V5JA 4EWHA 2B9HA 4GG7A 1K3AA 2ITUA 2VWUA 3MB6A 2BZKB 4O96A 3MSSA 4TTHB 4ANNA 5IKWA 2QOHA 3AT2A 3ZEPA 4UYAA 4ZSEA 1Q99A 2VTOA 4RBLA 4EHVA 1PW2A 5CF5A 3BHHA 3G0EA 5M07A 5EQEA 4BTFA 2R3KA 4ZLYA 4FTAA 4FUYA 2VTPA 5B0XA 2B9FA 4C34A 3WF9A 4ZLZA 4AZFA 1LR4A 1PF8A 4IJ9A 4Y8DA 5CVFA 1WBOA 5LCKA 3DK3A 3EQGA 2UW9A 4JBQA 1VYZA 1J7LA 2HW6A 2XS0A 3QALE 4PPCA 2WTWA 4OGRA 4BCJA 5AV1A 2YCSA 3LCTA 4NCTA 3R8MA 4HPUE 4I6HA 2KTYA 3ZXZA 4AFJA 4AWIA 4J96A 5E9EA 1Y6AA 4JT3A 4RIYA 5D7AA 4LRJA 5ANGA 4TXCA 2XNOA 3OXIA 3D14A 3SW4A 1M17A 4DH7A 4PL4A 4CGAA 2PVYA 5FEEA 3MVHA 3L9NA 3SLSA 4QMLA 4QMQA 4RQKA 1O6KA 2QOOA 4UMPA 2OO8X 1NXKA 1IRKA 2B9IA 3AGMA 4Z7HA 4HZRA 4KSPA 5TE0A 3FMJA 4P90A 3PIZA 4RIYB 4XV2A 2CHLA 2J51A 4ANSA 3VF8A 2VTQA 4ASZA 3BBWA 3R22A 4ACCA 1XR1A 2C5XA 3FXXA 3O2MA 4FV8A 4G3DA 4ITHA 1YDRE 3VULA 4EZ7A 5GZ8A 3D5XA 4YZ9A 1IASA 5CU0A 4PQNA 4USDA 4BY9E 4OTFA 4FTOA 5H8EA 1P14A 1PYXA 2GHGA 3LCSA 3F7WA 3NYVA 3TJDA 1V0BA 5HEZA 4DEHA 4L3LA 5AUWA 2OIDA 2W9FB 5KMIA 1CDKA 3HKOA 2VV9A 4UMRA 2Z8CA 1MQ4A 4F9AA 1Q3WA 3DXPA 4RZWA 3RPOA 3L9PA 5CT0A 3S4QA 5C26A 3F9NA 2O64A 3NUXA 5L2WA 5BYZA 1QCFA 4BZOA 2QG7A 4MEDA 5KBQA 3QUPA 4BKYA 3FMMA 1T45A 5IISA 1W8CA 5JKGA 2XA4A 2F9GA 3H9RA 2UW5A 2YCRA 4I6BA 3ZTXA 1WAKA 2UZNA 2Y4PA 3FL5A 2QQ7A 2XRUA 4GS6A 3RHKA 4FICA 2Y9QA 5AP1A 3HRFA 5K0KA 2E9VA 3ZO2A 3V5QA 5IA1A 4FI1A 2WTKC 3ERKA 4C8BA 2V62A 2YZAA 4YNOA 4QP2A 5DG5A 4YHFA 3DKGA 4UZDA 3E63A 3F6XA 3IW7A 2W4JA 1H1RA 3KEXA 4FTJA 4JJRA 4TNBA 4B8LA 3COMA 4RC3A 4XH6A 2J90A 2UZWE 1JNKA 5DRDA 5E8YA 5EDRA 1W82A 2ZDTA 5JFXA 2NNWB 4K11A 3QRTA 3SXFA 5D12A 1XBBA 3HNGA 2V5QA 4NWMA 3QFVA 2F2UA 5M44A 4DBXA 1OGUA 4PTEA 4YZCA 5JK3A 2XJ1A 2GNHA 3OXTA 3QXOA 5EK7A 3KXHA 5ANKA 3Q9YA 4IB1A 3KA0A 4K1BA 5CT7A 5CZIA 5FEDA 4R1YA 3ODZX 2HOGA 4CTBA 3DY7A 3OFMA 4OUCA 3EQBA 4GUBA 4IH8A 2W0JA 4PNIA 4TRLA 3W8LA 3ZBXA 3MVJA 2OWBA 3PIYA 3RINA 4AX8A 3BLRA 5IH5A 3VJOA 3KXMA 3NVKI 5M09A 1R3CA 3FZRA 4RFMA 4WUAA 3ZDUA 5ETAA 2PUNA 3ACKA 3H9OA 1OL7A 5LMKC 3DKOA 2VNWA 4QMTA 5J95A 4WG5A 4YLJA 5EKOA 3VBWA 4QMNA 4TT7A 3PVGA 3DBFA 3MVMA 2H9VA 5KUPA 4QMXA 2IW6A 2XMYA 3RWPA 4F70A 4CG9A 4QQJA 4ZMEA 2XNMA 4I20A 4G2FA 2I1MA 3BV2A 2XJ2A 4G3FA 2R5TA 2ZMDA 3UOHA 4YJUA 4KKHA 5EH0A 4P5ZA 4EK8A 4XNEA 4M14A 3F3WA 2W1HA 1P4OA 4I21A 3NIEA 4EOJA 4C3PA 1RJBA 1ATPE 2GPHA 4I6FA 1MRVA 4EYJA 2X6DA 2UVZA 3LKMA 4AXAA 2BZHB 3A4OX 4FV9A 4FT3A 1MRUA 3I5ZA 4BCGA 3GCUA 4GT3A 4HCVA 4M69A 3WE8A 2VO0A 5CI7A 4F6UA 4AP7A 3G33A 4QMZA 3OXZA 4XS2A 4O86A 1YQJA 2VN9A 3FQSA 3KMMA 4IVAA 1H1SA 2VGOA 2X7OA 4FT9A 2RFNA 3RZBA 4DFNA 2VTIA 3E8DA 2F4JA 1H0VA 2QU5A 3F2AA 3PP1A 5EYMA 1BX6A 5ETCA 4AA0A 4DEDA 3NEWA 4M69B 3QCSA 3FSKA 3DT1A 1YDTE 2JC6A 5LOHA 4KBKA 5LXMA 1KV1A 3DBQA 5AJQA 1REKA 4D9TA 5HG8A 1PJKA 4UMQA 1IAJA 4HVGA 4WIHA 4ANQA 4FTQA 3WF6A 4U7ZA 1NW1A 3VRYA 2IZUA 2YA9A 4QP8A 2PVMA 4X3FA 4YJOA 3TI1A 3KCKA 3BYUA 4QO9A 2XNNA 3GENA 4X3JA 3TNHA 3NWWA 3TV4A 4FTMA 3RGFA 3I7CA 4CZTA 5BNJA 3HV6A 3MA6A 1O6YA 4BTKA 2XK6A 3GNIB 5AUZA 1ZOHA 3OWJA 4O0SA 4YO6A 5AWMA 4CYIA 2HZ0A 3UZRA 3DQWA 4FSYA 2XZSA 2OKRA 4GEOA 3Q9XA 2WPAA 4GV1A 2XIRA 2VWWA 4X3FB 5KHWA 4HJOA 4M3QA 4WBOA 4A4OA 4I3ZA 5EI8A 4NZWB 3SV0A 3UE4A 2ERKA 4U8ZA 4S32A 3ZCLA 3ZLSA 2J5FA 2F7XE 4QTEA 4ANLA 2ETMA 2PHKA 3FY2A 5H3QA 2PUUA 2P4IA 2EVAA 3C7QA 4ZTQA 2Z2WA 3OWKA 3DFAA 2CSNA 4GK2A 3BI6A 3R8UA 4OAUC 5E1EA 4MQ2A 3RK9A 4NM0A 2VO6A 4X6RA 2GU8A 1RW8A 3HUCA 4MXZA 4TL0A 4ZJJA 3TN8A 3ZEWA 3POZA 5GJFA 2XYNA 3NUUA 5L2IA 5DE2A 2HY0A 4GUEA 3MI9A 5HKMA 1BYGA 3FEGA 4FZFB 1WBNA 4WUNA 1YXXA 3C9WA 4EUUA 2BHEA 3EQHA 3HYHA 4JAIA 2OIBA 2H96A 3G9LX 2WTIA 3KRWA 3WZJA 1JKLA 5DT0A 1YHWA 4E4XA 4EQUA 1UKIA 3NAYA 3PRIA 4FVPA 3DJ6A 4AGDA 4FEUA 4LQMA 2PZPA 2YIWA 4YTCA 3ZC5A 4N57A 5AIRA 4L68A 1LPUA 2GHLA 3TZ9A 4ZTLA 2CLXA 3D4QA 3FKLA 3Q6UA 3KMWA 4AZSA 3F7ZA 4KBAA 3FI8A 4W9WA 5E8TA 4R6VA 4DEAA 1GOLA 1S9JA 5JEBA 5HVYA 2VWIA 1FVTA 5LMBA 4BCHA 4AU8A 1U5RA 2OU7A 3DOGA 3GB2A 4AOJA 5CF8A 5IPJA 2W17A 3B2TA 2PK9A 4YP8A 4RVLA 4AACA 1WBPA 3RWQA 1OPJA 3G90X 3G2FA 1LEZA 3BZ3A 3ZLXA 2B7AA 5HIBA 4FKUA 1YXUA 4AT4A 4D1XA 2BPMA 1L8TA 3A61A 3PXKA 4EQMA 4IXPA 5ANDA 2JDTA 3SQQA 3RNYA 3ZOSA 5JN2A 4XP0A 4DFYA 4DE4A 1M14A 3U6IA 4IAZA 3LLAA 2WGJA 2YWVA 2OJFE 4D1ZA 1YXVA 4FTKA 1WBTA 2YM5A 4CRLA 5HE0A 2UW4A 3VHEA 1B38A 2LGCA 1UWHA 2G2IA 3VJNA 3KRXA 2J0KA 3NS9A 1BL6A 2ZAZA 3QTSA 1ZZLA 2VAGA 3DAJA 3TZMA 1ZYSA 4IACA 1PXOA 3QZFA 3OW3A 4LUDA 5AP0A 3FHRA 4FT7A 4B9DA 5I9XA 3P23A 4FSZA 3HV4A 1CKIA 2Y6MA 2WHBA 4F9WA 4ZLOA 4FKPA 3LJ1A 2XIKA 4A7CA 3CSVA 5BVKA 5I0BA 2I0YA 3EQPA 3O51A 3DA6A 2YHVA 5AX9A 3LFFA 2HWPA 2VD5A 4WKQA 4MF0A 4YSJA 2E9UA 3GQIA 4NW5A 3FY0A 3SW7A 5CX9A 2C1AA 4V01A 4OR5A 1T46A 2UZLA 4PDYA 1Q24A 4IX6A 3CKWA 2RFEA 3UVRA 5DR2A 1SMHA 1YW2A 4HGSA 4E7WA 3P1AA 4QMVA 3GXLA 3TNPC 4FE2A 4R3PA 4FTNA 3BEGA 2F7ZE 1IA9A 3DTWA 2IN6A 4O22A 3S2PA 3ZLWA 1YOJA 2IVTA 4NCTC 3MFRA 2PE2A 4U45A 5FXQA 5L3AA 3R9NA 2OXDA 5E91A 3EKNA 4XEYA 2YERA 3OF0A 5CSHA 4ALWA 5HNIX 5M06A 5AP3A 4E4LA 4O7LA 3LHJA 3IQ7A 2HZIA 2VZ6A 3COIA 3NIZA 3WIGA 5H8GA 2I7QA 5KE0A 4APPA 3JR1A 2HELA 4J7BA 4FKQA 5HNGA 3HMMA 4W8EA 1U4DA 2HAKA 4GU6A 2OICA 3UMWA 2CGUA 3UC3A 4DT9A 4WRSA 5KMOA 5IA3A 2FVDA 4JG8A 2KULA 4KA3A 5CS6A 2HK5A 4NIFA 5HGIA 4GIHA 2W7XA 2RF9A 5IA4A 4UV0A 3D5WA 2YISA 3RAWA 3TIYA 4LFIA 3UZPA 5JQ5A 3WILA 2VWYA 3PG1A 4FZDB 4O81A 3DKFA 2IW8A 4I4EA 1OM1A 4HOKA 3GU8A 2W06A 4NIFB 5L2QA 4BGHA 3ZUUA 5EKNA 4DGMA 3OMVA 3QKMA 4NH1A 4Q9SA 2OFVA 4BCNA 4QD6A 3V5PA 3VBXA 4C58A 4YTFA 2W99B 2Z60A 3PXFA 3FKNA 2X1NA 3F3VA 4V05A 5GNKA 3RALA 1CTPE 3CE3A 4XV1A 5IDPA 1J1BA 4HYSA 5HBHA 2WQEA 3OBJA 5EM5A 3ATTA 2CKOA 1XJDA 4JDJA 4QYHA 2ZVAA 5CEKA 2YIYA 3GCPA 2ZDUA 4G31A 2QVSE 4DFUA 4C62A 2G2HA 1KE5A 2F49A 5LVMA 2GNIA 3VRZA 4ACGA 2FSTX 2W1IA 1R78A 3KF4A 3KXZA 3H30A 4PNKA 5J7HA 2Z7QA 3R7EA 4EOKA 5L4QA 5IQCA 4F1TA 4JBVA 5F1ZA 2AYPA 3QX2A 3QCQA 4JXFA 4GSBA 4AS0A 3CQEA 3HMIA 3P7BA 2BRGA 2CNUA 2HW7A 1J7IA 2AC5A 1MP8A 1O9UA 4I0TA 4XUFA 2ZM4A 3W16A 2WB8A 4BDHA 4GKIA 2JITA 4U5JA 4UXQA 2X0GA 3RAIA 4FKTA 2SRCA 5ETIA 5DT3A 3TEIA 3VS4A 4KD1A 5BYLA 3L8PA 3EWHA 4OTQA 4CCUA 3HP5A 4FSWA 4HPTE 5B2KA 4UALA 3BQRA 2XNGA 4FKOA 3FKOA 4QTAA 4CMUA 1QPCA 3FLZA 2QOLA 5FEQA 5B7VA 4HVIA 3DJ5A 2V7OA 4PPBA 5EOBA 4IX3A 5FXSA 3ENHA 5K9IA 2ITTA 5E8VA 2OZAA 3NMUF 1GJOA 3FSFA 3RJCA 1GZOA 3AGLA 3ZM4A 3UTOA 3JUHA 4D28A 2VTTA 3ORNA 1KOAA 2WMQA 3MV5A 4YPSA 3TV7A 4NFMA 5CAPA 2CN5A 3QHRA 3N9XA 2FYSA 3BBTB 3BGPA 1U5QA 2QLUA 4FTIA 4QQTA 4R7IA 4HGTA 2OZAB 3FI4A 3G0FA 4KBCA 1W7HA 2W5HA 4BIDA 3GGFA 3MH1A 4JX7A 5CXHA 3LIJA 4C57A 4E6CA 3GCSA 2CN8A 3PLSA 4TYJA 3LFEA 5C8MA 4K9YA 2BDWA 4ZOGA 5CEQA 3KY2A 3AC3A 3IPHA 5IU2A 2ZV8A 5AM7A 3ZZEA 4FSMA 2VWVA 3KVWA 1AQ1A 2ESMA 3VAPA 4PPAA 2E9PA 2WMAA 1OKYA 3L9MA 1ZMWA 3QQFA 3OCTA 4F6SA 5FM3A 3UP2A 4CV8A 4F9CA 3KC3A 5DBXA 4RC4A 3EN5A 4XV9A 3ZYAA 3Q4UA 4RSSA 4EOMA 2C5YA 5BVFA 4ZTNA 2BRMA 4LGGA 4LL5A 1YRPA 3R02A 3V51A 3KGAA 5JGBA 3VNTA 4L46A 3MY5A 1Y91A 3OTUA 1FBNA 4FT0A 4N70A 3AXWA 3UQCA 3FI2A 4FR4A 2R7IA 4DTAA 4RJ3A 3LZBA 2J0JA 3MY1A 3PXRA 3AC2A 3QTRA 4QPSA 2XK4A 3D7TA 4DFZE 3SDJA 3F3UA 4RJ6A 5EDQA 2QOQA 4EORA 5ACKA 3ZFXA 4IM3A 4BBMA
chains in the Genus database with same CATH superfamily
3Q4CA 2XK7A 1PXKA 4C36A 1KE9A 5HORA 3QAME 3T9IA 5M4IA 3L8SA 5C03A 2OZOA 4WG3A 3ZRKA 2R3FA 3D7TB 3R04A 2PMIA 2JEDA 3LFDA 3U6JA 3WF5A 1FQ1B 2BVAA 3R1NA 4P4CA 3Q2JA 3SGCA 4M12A 4NYEA 3BYSA 4EKKA 2XYUA 4QRCA 1ZZ2A 4FVQA 3I60A 4PP7A 1W2DA 4KNBA 2ETKA 5DEYA 2C6OA 3SAYA 4FZAB 3MW1A 4NT4A 3T9TA 3M2WA 3QQGA 5M56A 4UN0C 2ITQA 3PXYA 5AUUA 5LVOA 4UWYA 2YFXA 3OY3A 4EC8A 3COKA 4O7NA 4IW0A 4CD0A 4DHJA 1AGWA 3FC1X 3EMGA 3G5DA 4QDEA 2J7TA 3WARA 4LI5A 4EC9A 4F9YA 2XP2A 3IK3A 5DNRA 5JSMA 2WD1A 3F88A 3DAEA 4AQKA 3DDPA 3AC8A 3ATSA 4G6LA 5J1VA 3BYOA 2BZIB 1JSVA 1PKGA 5CU6A 2JDSA 4A9YA 1Z9XA 2XUUA 3IW8A 4YGAA 4XYFA 2O2UA 2QR7A 2QCSA 3PSDA 3R7IA 1Q3DA 5AAFA 3VBYA 4G5PA 3P78A 4QMUA 4BDBA 2UVXA 5HQ0A 1TVOA 2P3GX 2IWIA 3HAVA 4BF2A 2W1ZA 4CEGA 2JD5A 2YACA 2OLCA 4FKVA 2E9NA 3BYVA 5CU2A 2JAMA 2IZRA 2C5NA 3ELJA 4BCIA 5C8KA 3PY1A 5HOAA 3TV6A 4J52A 4FSTA 3GBZA 5FDPA 5E4HA 2NYAA 3LVPA 4H36A 3QUEA 3OROA 2YWPA 3EFWA 3VUDA 3U55A 1PMEA 2RG5A 4JL9A 4QYFA 3BHVA 4FL2A 3ROCA 1XQZA 2ZYBA 5JT2A 1JSUA 4OT5A 4F7JA 2O65A 3CEKA 4ZK5A 1XH8A 3E88A 4GIIA 4O7WA 2YAKA 4FUXA 3UOKA 4AT5A 4HNIA 4K18A 4AZTA 2FB8A 1IG1A 1GIIA 2CDZA 2RL5A 5IA2A 2GTNA 3F5UA 4ANMA 3JXWA 4C59A 3SA0A 3VHKA 3RK7A 1FINA 4V04A 4XG6A 2HWOA 4IVBA 4BGQA 4I5MA 3RK5A 4E73A 5BX0A 4C3FA 3DB8A 5FD2A 4CMTA 1ZYLA 4JI9A 4JIKA 4FBXA 4OTIA 2ZFYA 5DR6A 3OWLA 4IVDA 5HZNA 3IKAA 3R1SA 2OG8A 2PVJA 3LLTA 2XK3A 4R7BA 4IWQA 5HIEA 3W18A 3NZ0A 2ITOA 3QLGA 3EQFA 3EB0A 3V8WA 3R2YA 4A4XA 2O63A 3VW8A 4LDTA 3QYZA 5IQEA 1SZMA 2WIHA 3R21A 4BTMA 3Q2MA 3EYHA 1Y6BA 1YXTA 4MHAA 4GFMA 1W2CA 1HCLA 3R01A 3SG9A 3IOPA 4JRNA 1OB3A 4RIOA 3SXSA 1H27A 1E1XA 4BDEA 3PFYA 4QQ5A 2VRXA 3K54A 5EYKA 2R3PA 2GDOA 3MS9A 4O21A 2X8EA 4QPAA 4X2KA 4MWHA 3UNKA 1H08A 3Q32A 3UZTA 3DBEA 4LOQA 4MD8E 3OTVA 5HD7A 4NSTA 2X4ZA 5A4TA 3NCZA 4A06A 3R7GA 3LFQA 5I3OA 4BDKA 4FC0A 4FT5A 4MBLA 4EZ3A 3HP2A 1J7UA 3GC9A 2F7EE 2PUIA 4DAWA 4DH1A 2Z7LA 4RIXA 4H3PA 2YM7A 2WMBA 4IX5A 3FQHA 4M68A 3A99A 3DNEA 4R8QA 4I0RA 2R4BA 2WMTA 3QA0A 2YJSA 2CPKE 4F4PA 3FE3A 4EHGA 4K33A 5AP2A 3OZ6A 4J98A 1OL2A 5JRSA 2PVFA 3PFQA 4IHPA 4RIXB 4DEGA 4YHTA 4FIJA 2IO6A 1ZXEA 4P2KA 4FZ6A 1XMMA 4EK3A 5M53A 2XKCA 3DLZA 4HYIA 1A06A 3KXXA 3DZQA 2BIYA 2C6LA 2BFXA 4WNKA 3UJGA 2OFUA 3VQHA 2ZV2A 2AUHA 2XKFA 4CV9A 1PMUA 4PDOA 4TWNA 3Q4TA 1SNUA 4RVKA 4TY1A 4OBPA 5BVWA 5FM2A 2YM6A 3ZMMA 4BGGA 1MUOA 2BDJA 4CT2A 3P7CA 3QWJA 3NLBA 4IZYA 4PDSA 4GYGA 4QP4A 5IZFA 1GIJA 5FTOA 4D5HA 5D41A 3CR0A 2J9MA 4BYIA 5KX8A 5ANJA 4XG9A 3E8EA 3R1QA 5LMAA 1J1CA 3KU2A 3V3VA 2WOTA 4BL1A 3A7IA 3LXKA 3SC1A 3IECA 2V22A 5EI6A 3MESA 2PWLA 3QC4A 5AX3A 2ACXA 2PZ5A 2W1EA 5HU3A 5J1WA 5CI6A 1JKKA 3I6UA 2X9EA 3MPMA 4AOTA 3HV7A 1B39A 2BMCA 2UW7A 2I0EA 3FZTA 3Q5IA 5DI1A 4GKHA 4BR3A 1ZYJA 3Q04A 5HU9A 4FSNA 3TTIA 4JR7A 2Y7JA 3E64A 4BC6A 2C6KA 3EN6A 3FZ1A 2OXXA 5GJDA 1V0OA 3PTGA 2W05A 5A14A 5IUHA 2GCDA 2EXCX 4YO4A 3P7AA 4FKJA 3DZOA 4EL9A 1PYEA 4X2FA 1APME 4JIAA 3R7YA 1JQHA 2BR1A 1UU8A 3HMOA 1ND4A 2GNLA 2Y8OA 3TIZA 5K5XA 3MFUA 3ZBFA 3FMKA 1XO2B 3GCQA 2YCQA 3DS6A 4L7SA 4ACHA 4JQ8A 3TDWA 4FV2A 4FTRA 4FNZA 1H01A 3FLQA 2JKMA 3R7UA 3C4ZA 3S0OA 1OBDA 5JFSA 3W0RA 3A7FA 4BI0A 4O6LA 2QO9A 3OEFX 5CSWA 3WI6A 4DCEA 4GVJA 5CU3A 3IW6A 2W96B 4U6RA 2Y4IB 3KRRA 1JAMA 1H1PA 5IA5A 3RAKA 3DXQA 5HBJA 4AW2A 4FSQA 2X7FA 3UODA 4M84A 1YDSE 3EZVA 3O7LB 1OUYA 2XNBA 3MFSA 3NUPA 5CQWA 5AUVA 3UNJA 3DGKA 3LCKA 4XLVA 4BCQA 4YU2A 4GJ2A 2VWBA 4FTUA 3TNQB 2CMWA 2WTCA 3FDNA 3CTHA 4I4FA 4FA2A 3GP0A 5A4QA 3KMUA 4AXDA 3JVRA 3QQJA 1OMWA 4TPTA 3PIXA 3ODYX 5HIDA 3Q60A 2UZTA 4FOCA 4BDGA 4ORKA 4MVFA 4BTJA 2UVYA 5L6PA 5ICPA 4M0ZA 4RLKA 2BIKB 2WEVA 1PMNA 3KVXA 5E8SA 5I9UA 4ASDA 4YZMA 4RJ4A 4XX9A 5KKRC 3MGYA 1OKWA 4XHKB 5KMNA 5GIPE 2GS7A 3VBVA 3KXNA 3VC4A 1OIYA 1U46A 2ITYA 3TL8A 4ZJVA 1SM2A 2P2IA 3VWAA 3W2RA 4LM5A 2QU6A 4DFLA 4MX9A 2JGZA 3S3IA 4TKSA 4MXYA 4UBAA 5BVOA 3W2OA 3POOA 4B8MA 3ORPA 4U3ZA 2R0UA 3LM5A 3PPJA 4MCVA 5E1SA 4DFBA 4RT7A 3KL8A 1G8SA 1REJA 1UVRA 2B54A 2R0IA 2X7GA 1URWA 5KMMA 1H8FA 4KIQA 2BTRA 1P4FA 3IW4A 3EQCA 3N51A 4W4VA 2C0TA 3VUGA 4MK0A 4CFMA 3D5VA 3I81A 4F0GA 1SVGA 2OJGA 1SYKA 2ZV7A 3BLHA 4XV3A 3AMYA 3OCGA 3W2QA 5TKDA 3F5XA 5LVNA 4IADA 3UPXA 3W10A 5CSVA 5FP5A 4B6LA 4E6DA 4RWJA 4J99A 5HLPA 3SVVA 1FVVA 2JFLA 3NDMA 4MKCA 2W1DA 4M8TA 4DEBA 1SVEA 4PTCA 4O84A 3CLYA 4I5PA 3P5KA 5HG7A 2B52A 1ZRZA 2B1PA 2W4OA 4ZTSA 3LFSA 3SRVA 4U9AA 5D1JA 1Q8ZA 4U97A 5IH6A 5M4FA 4K6ZA 3QZGA 4WSQA 3UP7A 4D2RA 3E7OA 3QQUA 2WMUA 4P5QA 3EJ1A 2VTSA 3TKIA 3DLSA 4I6QA 4AN2A 4MUQA 2EB2A 4FVRA 1NVSA 2J6MA 2XNEA 4FV1A 2GQRA 2V55A 3O50A 4NFNA 4FJVA 4AQCA 4C4JA 4XOZA 3SRVB 2YAAA 2PMLX 4CKRA 3BQCA 3B8RA 3KK8A 3FYJX 2YLFA 4O4DA 2VUWA 4DC2A 4XRJA 2NPQA 4ZTMA 4NTTA 2X0PA 4RJ8A 3SHEA 4BB4A 2X4FA 3L8XA 5DT4A 4FKWA 2QLQA 4D2PA 4PX6A 3WZEA 3TJCA 1CSNA 5FTQA 5IQAA 4KS8A 3OC1A 5M4CA 2YM3A 4KINA 3I7BA 4X7QA 5D10A 4BJJA 3RPRA 3LMIA 4ZTHA 1Q62A 5M51A 4PWNA 3LQ8A 5A54A 3K5VA 3LQ3A 1GNGA 2FO0A 3DCVA 2QKRA 4WO5A 4B0GA 4FTTA 4YTHA 4ITJA 5IQHA 1QPJA 5CALA 3SG8A 4BDDA 4R77A 2QD9A 4F64A 5FG8A 5IUIA 4CZUA 4QMWA 4ARKA 4FEVA 2C4GA 3P08A 2G1TA 4BJJB 5GINE 3IDBA 4DDIA 5E8XA 3A7HA 3Q96A 5IG1A 3FHIA 3LCOA 1M2QA 5IMEA 5E8UA 4IZAA 3SOCA 2H34A 3P0MA 4L9IA 1OPLA 4FV5A 1FVRA 1F0QA 3CY3A 1ZLTA 2JDVA 1OIQA 5J9YA 4RX8A 4RX7A 4XBUA 4IAYA 4AA4A 4IX4A 2O5KA 4P7EA 4W4YA 5IMXA 5KHXA 4QOXA 3VS3A 5JQ8A 3VS0A 2JKKA 3MH0A 2QOCA 4JQ7A 3DU8A 1Z57A 3U9NA 3IG7A 3PPZA 4AW0A 3QL8A 1XBCA 4YLKA 3C4XA 5HO7A 2XJ0A 5CAOA 1UWJA 3LFBA 4ENYA 4EHEA 3KB7A 5JFWA 3QGYA 1DAYA 2UZOA 3W2PA 3ID6C 4NJ3A 4YHJA 3ORXA 4U3YA 4L01A 4ZS0A 5AUYA 4BCOA 3AKLA 5HE3A 1NA7A 2RG6A 5DPVA 2OF2A 4CQEA 3RPYA 4C61A 1DI9A 4FIFA 3WYYA 2HYYA 5CNOA 3PUFC 3T3UA 4QP6A 3VS6A 4AW1A 2WEIA 4BZDA 3MDYA 4ZXTA 4X21A 3TDVA 2O3PA 3EFJA 5C8NA 3W0PA 1ZAOA 2EB3A 3R8VA 3V5TA 4DTBA 2PSQA 4ZSAA 4QMMA 3ZUVA 3HUBA 4L43A 3BEAA 4O2PA 3RM6A 4RIWA 2IW9A 3OD6X 4FGBA 3WZKA 5DMZA 4YMJA 1XKKA 2XIYA 2QI8A 5HCZA 3QUDA 4XMOA 4DA5A 3ZXTA 2C0OA 4K77A 4OW8A 5CANA 5GIOE 5CEMA 4O7RA 5CQUA 4KRCA 4EJ7A 3I6WA 4D4SA 3FC2A 4J53A 4QMYA 5LVLA 3MIAA 2QO7A 3VVHA 3ZO4A 4RIWB 3NW6A 3AT3A 2ONLC 4S30A 3D2KA 4GW8A 4YZBA 2DUVA 2PE0A 2EU9A 3DFCB 5I9WA 1HCKA 5BVEA 2I40A 3UIBA 3ZONA 4ERWA 4U44A 1JBPE 5CSXA 4WA9A 4BIEA 4GK4A 4JBOA 2J0IA 1ST4A 1UV5A 5AR3A 4YZDA 2WU7A 2RIOA 4E4MA 4E5AX 3A2CA 2C0IA 5G6VA 4FEWA 4F65A 2FUMA 4CFFA 3BGZA 3DK7A 4D55A 3UBDA 4FGRA 3ZHPC 3D83A 3DQXA 3EN4A 2I6LA 2Q0BA 3A8XA 3C4CA 3VW6A 4JG7A 3TZ8A 3H3CA 5IA0A 1W84A 3B8QA 3F69A 3GU5A 3R0TA 4OLIA 3VF9A 4EOLA 2W1CA 3OWPA 3PSBA 4FIIA 1OZ1A 1OUKA 3CIKA 1E9HA 2A4LA 3WYXA 4YC6A 5A3XA 5CEPA 3F5GA 1DAWA 2C3JA 5EQYA 2WNTA 2WQBA 3RKBA 4AFEA 5HX8A 5ITAA 3MA3A 2QURA 1M7NA 2YZLA 5KMKA 4PTGA 1YI6A 2QHNA 4YJPA 4KUJA 4ZP5A 3RZFA 5M55A 1PXIA 2OH4A 3KRLA 4DINA 1WFCA 4W4XA 5E8WA 3PA4A 2XAMA 3ULZA 3PJCA 4DGOA 4M0YA 1CKJA 3FLSA 3KRJA 1VR2A 5TT7A 2BILB 5TR6A 4R3RA 4XCUA 3ZFMA 1F3MC 2C47A 4KRDA 4EHZA 4EOOA 3CBLA 4ZSLA 3MJ1A 4FMQA 3JVSA 2GS2A 4QPMA 1QPDA 4GRBA 1ZY5A 4FIHA 3RMFA 3W2SA 4ENXA 3DXNA 3GUBA 5L6WL 4FIGA 3NAXA 4OBQA 5A4CA 1UU7A 4B7TA 3BV3A 4O4BB 5IQFA 4BBFA 2QC6A 1YHSA 4YR8A 5BMSA 1YVJA 1RDQE 3FMEA 3RCJA 1NVRA 2OXYA 4HGLA 2OJIA 3HLLA 5DRBA 2PVHA 3BHYA 3SKCA 3PYYA 4RX5A 3U87A 3ZS5A 3E8CA 4DHFA 1TKIA 3V01A 2ERZE 1YWRA 1B6CB 3DNDA 5ANIA 4RLLA 3RHXA 4EWQA 3NYNA 1IR3A 5EW8A 3EL8A 3R63A 5C27A 2Y4IC 1XH4A 3ZM9A 5TF9A 4DEEA 3EQDA 4BFMA 2H8HA 3EYGA 3PP0A 3BKBA 3LFAA 1ZMUA 2PVLA 2FSLX 4WRGA 3VQUA 3U54A 4JRVA 4W4WA 4YNEA 2YN8A 3VS2A 5BVNA 4ZSGA 3QLFA 3HMNA 5HG5A 4AOIA 3KXGA 3UOLA 4ZY5A 1BL7A 4KABA 3FLWA 3QGWA 3A8WA 5AIKA 4C33A 5KO1A 2UZEA 2BALA 4EH3A 3LPBA 5B2LA 2VTHA 3DBCA 2BCJA 3D94A 4BWPA 3E8NA 4EI4A 1QPEA 2ETRA 1KE6A 3AC1A 3TKHA 4QTDA 3HAMA 3IO7A 3TYKA 2RKUA 4E20A 2OI4X 2WTDA 2R3LA 4AZEA 5IUGA 3LFCA 4AG8A 2IVVA 2YM8A 3NUSA 4FL1A 3ZUTA 3A7JA 4I41A 4YZNA 3HL7A 4J95A 5CYIA 5HE2A 3BGQA 5EI2A 3BU6A 4HVDA 2C30A 2UZDA 3EH9A 4Q5HA 4G6OA 3RCDA 3SXRA 3ORKA 2J5EA 2NO3A 4FTLA 3UO4A 1Q8TA 5KCVA 1A48A 3RAHA 4FL3A 3UGCA 3BIZA 5I5ZA 5TO8A 5BPYA 2OJJA 5LARA 2XALA 4APCA 4Y72A 3DKCA 3EN9A 3NW7A 2C69A 3TWJA 1GY3A 2WTKB 4Q9ZA 4D5KA 5LQFA 2UZUE 5BUJA 2CNQA 2J0LA 5ANOA 2UUEA 2XVDA 3LE6A 3ZH8A 1EH4A 4NTSA 4YJQA 3NUAA 4DGNA 1DS5A 3D0EA 3QC9A 5I3RA 2CGVA 3MFTA 3NR9A 3RPSA 3B2WA 1Q5KA 4DDGA 5A4EA 1WVWA 1XH7A 3QQKA 3CGOA 4AGWA 4D1SA 2EXEA 3L1SA 2PE1A 4IAAA 4IDVA 1WBWA 1ERKA 2YCFA 3AC4A 3E3PA 2ZV9A 4FYOA 2P33A 3UIXA 4D2SA 4USEA 5LMKA 3FXWA 3BE9A 4E1ZA 3VUKA 2FGIA 4EH6A 4EH4A 3BU3A 2BKKA 4TYHA 1H28A 4MXCA 5CENA 4MAOA 3JY0A 3Q52A 5GJGA 4LGDA 3R83A 3FJQE 4AE6A 5M08A 3QBNA 1Q4LA 3PLAE 3QYWA 2VO7A 3ENMA 3KQ7A 5M57A 1S9IA 2GMXA 3OOGA 3Q53A 3MYGA 3O8TA 3HZTA 4GT5A 4BICA 4MXOA 2WMVA 3H9FA 3K2LA 2DS1A 2XH5A 3LFNA 3HEGA 3PJ2A 2WKMA 5E8ZA 3PXZA 3MBLA 2Z02A 2FH9A 3CY2A 4FF8A 1PKDA 4G9CA 3FYKX 1CMKE 3I5NA 4PL5A 1YHVA 5K5NA 4O82A 2A2AA 3OHTA 2VTAA 4QTBA 3ITZA 2WMXA 3MPAA 3GU7A 4ZY4A 3U9CA 3OEZA 4CCBA 5CWZA 4X3FC 3CXWA 3O71A 3HRCA 2A0CX 4PMTA 2X2LA 1YI3A 3R1YA 4D4YA 4IB3A 2J0MB 5KZ0A 4ANOA 4O0XA 2CKQA 4IJPA 3QRUA 2XB7A 4GFOA 4S34A 4V0GA 3GT8A 2IVSA 3HRBA 4YJSA 2WOUA 3QHWA 4RX9A 2F57A 2G01A 3ZFYA 4IM2A 4C0TA 3CQWA 2IZSA 3ZLYA 1TQMA 2YIQA 4H58A 3W2CA 4X2GA 5CVHA 5CAVA 1WVYA 4LV7A 3I0OA 3KIOC 1VZOA 3CGFA 3F82A 4ZMFA 2HENA 5AV4A 3QKLA 4FKGA 2C6MA 3ROYA 4L42A 4YPDA 4YBKA 3OOMA 3R9OA 4V0GB 3L8VA 3FZPA 2Y0AA 1TQIA 4G3EA 4GL9A 1M2RA 3FWQA 1JVPP 3IDPA 3VUHA 4O1PA 4W8DA 5JZNA 1XMLA 4L6QA 2C6IA 1JSTA 2X39A 3RPVA 2WTJA 2C6TA 5EW9A 3PRFA 4RWKA 4CXAA 2C68A 3T8OA 3UDTA 4H39A 4PMPA 4RA5A 4LL0A 4GT4A 5AV3A 2CKEA 4C4IA 4CMOA 4UB7A 1Y8YA 4RRVA 1R1WA 4H05A 4M7IA 5IEYA 2XK9A 2HY81 3LCDA 4BCFA 1QMZA 5EYDA 1AD5A 3R9RA 5DFPA 3ZZWA 4DCAA 2PVRA 2PULA 3OT8A 4WNOA 4YSMA 5HBEA 2J4ZA 4IWOA 1H4LA 3QTQA 3ANRA 4MNFA 3UYSA 4FV3A 2PPQA 1JLUE 2IG7A 3HA6A 3E87A 5DGZA 5JH6A 3GOKA 4A9UA 4D2TA 4I0SA 3E3BX 5D7VA 4DYMA 4I94A 2VU3A 1W83A 2BKZA 4PY1A 3ZC6A 1URCA 3NUYA 2WU6A 4KWPA 4OTPA 1ZMVA 3UIMA 4H3BA 5A6OA 4IVCA 2A19B 3F5PA 4C3RA 4L3PA 3R9HA 1PXJA 2R3NA 5E92A 5EFQA 3F3ZA 4J8MA 3UVPA 4F99A 4XRLA 2XARA 1FGKA 1G8KA 4MWIA 4E5WA 4ZS4A 4YUQA 2IJMA 1H1WA 3GU6A 4C4GA 4JLCA 3R73A 4L00A 4BI2A 3UO6A 1YXSA 5AP5A 3EIDA 3G6HA 4HGEA 4CLJA 3KCFA 3CP9A 2ITXA 2XBJA 3OCBA 3EOCA 5T68A 1PXNA 2GNGA 2ZB0A 1YOMA 1HOWA 3JS2A 4OTRA 5JRQA 4I5CA 1QL6A 4BCKA 1ZARA 4QMSA 1Q41A 5AM6A 4YJVA 1R0EA 2BHHA 3DK6A 3EQIA 5HD4A 3W0SA 4YBJA 3AOXA 3OT3A 3WBLA 5J5TA 1ZYDA 2QOFA 3CTJA 3WIKA 3D2IA 4ZY6A 3R9DA 4ASEA 4N4SA 2QKWB 3HV5A 3P4KA 3TMOA 2HIWA 2XCKA 4IIRA 5FXRA 4RVMA 4O0VA 2WMRA 2QONA 4BKJA 3V5WA 4II5A 2WQMA 4PMMA 4XG2A 2E9OA 4GYIA 1OL5A 1XH6A 4MH7A 4N6ZA 2J2IB 4ACDA 4JX3A 4AXCA 2X0OA 3FLNC 2BRNA 3AQVA 5CVGA 3QZIA 2OJ9A 1H07A 3W32A 2X6EA 4CFNA 2YDKA 4BCMA 1K2PA 3TZ7A 3BLQA 5DIAA 4MXXA 1LP4A 4UEUA 5AR2A 3LXLA 4U79A 4QMPA 2JKOA 3GCVA 1H25A 4BRXA 1BI7A 3UOJA 4HCUA 4OAVB 1FOTA 1FMOE 4FNWA 3NNVA 3UO5A 5J79A 4GMYA 4F08A 2P55A 4RA4A 1U54A 3C50A 4M66A 4O4FA 4YC8A 3NSZA 5CY3A 2BUJA 3BE2A 5DHJA 4OTWA 4TWOA 5EHLA 3T3VA 4LMNA 3D7ZA 3HMPA 4FG8A 5HCYA 3HECA 3MPTA 3TM0A 2QHMA 3I0QA 4JQEA 1OIRA 4JBPA 2ITNA 4LUEA 2WELA 4NKSA 4X0MA 1KE7A 4QMOA 4WSYA 4AXFA 3MN3A 4U81A 2O0UA 3PSCA 2GQGA 2BFYA 3O7LD 1U54B 3OBGA 4GH2A 3UC4A 5L6OA 1U59A 2VWZA 4CNHA 4Z7GA 3EQRA 4O2ZA 4WNPA 1VEBA 2OBJA 2VWXA 3QTIA 3WF7A 4OBOA 5DH3A 5DLSA 5AV2A 5HCXA 4EJNA 4F0IA 2XCHA 2QOKA 3R8PA 4BHZA 4KIOA 4FV7A 2RSVA 4J8NA 4F1OA 3V8SA 4MXAA 4FTCA 4UWBA 3WZUA 3LJ0A 5A6NA 5ANEA 5HVJA 2OF4A 4GJ3A 4MNEA 3EN7A 2HXLA 2ZM3A 2W4KA 4EOIA 2QOBA 3QD2B 4F9BA 4RQVA 4EK4A 5BMMA 5CF4A 2JBOA 1FMKA 4EOSA 2R3IA 3TNWA 4M15A 4M67A 1KSWA 2CNVA 3VBTA 3QTXA 4D2VA 2NRYA 3JPVA 5EDPA 3UPZA 3LMHA 3DAKA 2VNYA 3HDNA 3PDTA 3FMDA 4MNEB 3FPMA 5K4JA 3MVLA 4DLJA 4UMUA 3KN6A 4BWKA 5J9LA 2A98A 3ORMA 3AG9A 4IANA 4F63A 1BMKA 2VTNA 4Y46A 4R78A 1YKRA 3QRKA 4U43A 3VN9A 4AN9A 4R5SA 4O0UA 4PF4A 5K0XA 4H1JA 4RWLA 4TYGA 5EYCA 4GG5A 4CFXA 2YDIA 4IAFA 1WBVA 3VS1A 4ZSJA 2XF0A 4C7TA 4RC2A 5LCJA 2XKEA 5IQDA 1L3RE 3PG3A 1TQPA 3UMXA 1KUTA 3BYMA 3M1SA 4JNWA 5D11A 2XKDA 3IGOA 4LV8A 2OIQA 4O4CA 3P5JC 1JKTA 4NJDA 3NNXA 4AAAA 5FTGA 3BPRA 4E26A 1GZ8A 1W2FA 3UYTA 4E8AA 4UY9A 4ZZNA 4OTGA 3CJFA 3DV3A 4XOYA 3CC6A 3S1HA 1P5EA 3MH3A 3BLAA 3VBQA 4I1ZA 3NYXA 2OK1A 3GFEA 1H0WA 2H6DA 3CJGA 4ONAA 3VO3A 4IMYA 1XWSA 2R3OA 3LW0A 1BKXA 3ZO3A 3C4FA 3CTQA 1GIHA 5KZIA 4AA5A 4FYNA 4RZVA 4DH5A 5A9UA 4CG8A 4BDCA 3N4TA 2YDJA 3BRBA 4ALUA 4DLIA 2UW3A 4ITIA 4KB8A 4JVGA 1H00A 3H0ZA 2RGPA 4RFYA 4I93A 1VYWA 3OW4A 1OVEA 5J5SA 1XHAA 4YTIA 4C38A 4CKJA 3FI3A 3H4JA 3GQLA 2AEGA 2WO6A 2YABA 5AADA 4LMUA 3QD4A 4Q5EA 5CF6A 2Q0NA 3GC8A 5J7BA 3ORIA 4MD7E 5IDNA 3BU5A 4CT1A 1OBGA 4UXLA 3A7GA 2VX0A 4UMTA 5HVKA 4HW7A 4J97A 5EM8A 5GZAA 4NM3A 5IEXA 4R1VA 1OL1A 3MJ2A 5EHOA 5H8BA 5CLPA 5HLNA 4G1WA 5BUIA 4DGLC 5ETFA 4S2ZA 4TYEA 1UKHA 3EL7A 2X2KA 4MD9E 5HESA 3PUPA 3RM7A 2R64A 5CXZA 4D0XA 4E4NA 1XH5A 3C4WA 4FKRA 4IDTA 5HX6A 2WFYA 3MB7A 3QF9A 4LOPA 3ULIA 1E1VA 1OI9A 3OY1A 4MBJA 5AP6A 4EH8A 1RE8A 2GHMA 2YEXA 3DB6A 2RFSA 3TTJA 4Y83A 1J3HA 2YIXA 3JY9A 4ERKA 4NK9A 4FG7A 4PMSA 2XEYA 4RFZA 5B2MA 4YJNA 2X9FA 2B55A 4QYYA 3I1AA 4LG4A 4O38A 3QWKA 4M13A 2G15A 5L8LA 1YWVA 4IFCA 2WQOA 4F6WA 1W0XC 1JPAA 3K5UA 4BI1A 1KV2A 4EK6A 4F7LA 1WCCA 4BHNA 4U41A 4HVHA 1Q97A 2C3LA 5HTIA 2GSFA 1JWHA 4DG2E 4DF3A 2R3MA 1BUHA 3GFWA 2FA2A 4FSUA 4F1MA 4A9TA 3ACJA 1Q61A 2UW6A 4C4EA 1IAHA 1MRYA 3V5LA 1M52A 5CU4A 3KF7A 3HDMA 3LXPA 5AP7A 2BTSA 4M97A 2JIIA 4FV6A 4G3CA 1LUFA 2B53A 3K3JA 2PMOX 2C3KA 4TNDA 4U80A 4D9UA 4Z3VA 4GU9A 4FNXA 3U4WA 3AT4A 2Z7SA 3AD4A 4N0SA 3FUPA 4K8AA 5FGKA 2X81A 3C0HA 1DM2A 2VX3A 2ITPA 3PA5A 2UW8A 4L45A 3TACA 3U8WA 3IDCA 3P86A 3BWJA 3HX4A 5FWKK 4QT1A 1ZOGA 3FL4A 4B99A 1KWPA 1ST0A 3Q9WA 3PZHA 4A07A 1ZY4A 2BZJA 4F09A 3GEQA 4AGCA 1JKSA 1M7QA 2YIRA 4QTCA 4G6NA