1A0JA

Crystal structure of a non-psychrophilic trypsin from a cold-adapted fish species.
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYECRKNSASYQASLQSGYHFCGGSLISSTWVVSAAHCYKSRIQVRLGEHNIAVNEGTEQFIDSVKVIMHPSYNSRNLDNDIMLIKLSKPASLNSYVSTVALPSSCASSGTRCLVSGWGNLSGSSSNYPDTLRCLDLPILSSSSCNSAYPGQITSNMFCAGFMEGGKDSCQGDSGGPVVCNGQLQGVVSWGYGCAQRNKPGVYTKVCNYRSWISSTMSSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Serine protease
molecule keywords TRYPSIN
publication title Structure of a non-psychrophilic trypsin from a cold-adapted fish species.
pubmed doi rcsb
total genus 56
structure length 223
sequence length 223
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1997-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1a0jA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1a0jA02
3QZQA 1C1OA 4ZKRU 3E1XB 4FUHA 1G2LA 4ABHA 7GCHG 1INCA 2XC5A 4X2WA 4IN2A 4MPWA 3SNDA 1O38A 1C2GA 1AZ8A 1DWBH 1EATA 2GT7A 1VR1H 1TRYA 3ZZBA 6ESTA 2HGTH 1QL7A 1O3PB 2IOTA 1G3EA 1HAGE 4Y6DA 2PKAA 4B2AA 2BLOA 2V6NA 3BV9B 1V2PT 2ZGXH 2FWWA 1W7GH 4MPVA 2R2WU 3DHKH 1GHVH 2Z9KA 1W0YH 3BIVH 3A7VA 1GJ4H 1BRBE 5I25A 4ZKNU 5FHTA 1O2LA 2HVXA 2A4QA 1DUEA 1BHXB 3TITA 1VITF 1YM0A 2IPHA 1P11E 1A7SA 4JZEH 3U98H 2ZGHA 2GCTC 3RXRA 2QXHA 1BBRE 2THFB 1WAYB 4E06H 4LXBH 1WQSA 3ESTA 1QTFA 2C4FH 4F4OC 1MTNC 3M3TA 1P04A 1K1LA 1AO5A 1EPTB 2B0FA 1OOKB 2OP9A 5T6DA 3T62A 4I8LA 3SNBA 1C1UH 1T8LA 5BPEA 2AH4X 5E2PA 3M5OA 4WWYA 3RXPA 3SJ9A 1HJAB 2SGPE 4ESTE 1CHGA 5J4QA 2I6SA 4R0IA 3M35A 2SGAA 3MI4A 2ZGJA 4AN7A 1PQ7A 2C90B 1E0FD 5EOKA 4DT7B 2W3IA 5JBBS 1FN8A 2QYIA 2ZC9H 1RFNA 3A86A 3GDUA 4AG1A 1TGCA 2ZCKP 4IGDA 1YCPH 3C1KA 1GCTB 4RN6A 1DS2E 4INKA 3P92A 3RLYH 2AS9A 3ODDA 2R3UA 1HAIH 3AAUA 3BG4B 2JH0D 4FUGA 2WPLS 3UFAA 4BOHA 5DK1A 2J94A 2D2DA 1Z1JA 1YP9A 3PB1E 2P8OB 1OYTH 1KXAA 3SGAE 1A0LA 2PKSC 4JYUH 2R0LA 1EAUA 1O3HA 1BBRH 1AD8H 5J4SA 1HPGA 3SI4H 1Y5AT 3ZVGA 1TNGA 1XUHA 2Z3DA 5F8TA 1EXFA 2ZDVH 1Q3XA 1AE8H 1IQKA 1NY22 2F9UA 3MWIU 2FTLE 1NFXA 1GI1A 1K9OE 3SU1A 1P9SA 1T32A 1BJUA 2FPZA 2GDDA 1B0EA 4CR5A 1O32A 1IQGA 1FJSA 2UWLA 4A7IB 4Z6AH 4CRCA 1MTVA 3SBKA 1XVMA 4CRGA 4KP0A 4NIYA 5EPYA 4DOQA 4DCDA 1SGRE 2K1QA 4JCNA 2EEKA 3K6ZA 1DITH 1SGFA 3F1SB 2Y7XA 1SLUB 1GBFA 1W2KH 1SC8U 2ZDLA 3A82A 4Y0ZE 6LPRA 1QURH 3AW1A 2CF8H 1MQ5A 2HALA 1ORFA 4YOIA 3WY8A 1KLTA 3SNAA 3ZZAA 2AGEX 2G8TA 1GHZA 3EA8A 4TPIZ 2BDHA 1UTQA 2BHGA 5C3NA 8KME2 2R9PA 4O97A 2BLWA 4GUXA 3RDZA 2V0BA 2V3OH 3H7OA 4LZ1H 5FBEA 4BANB 1GPZA 2JH5D 1QB9A 1GHAG 2J38A 7LPRA 1MUEB 1OKXA 2WPMS 2BD2A 1GJAB 1S81A 3LC3A 1ARBA 3HGNA 2GGVB 4WMEA 1SPJA 4YM9A 5LPFA 6CHAC 2F83A 1KXFA 1C5ZB 1S83A 2UWOA 4VGCB 2CV3A 4TYDA 1H9IE 3RXKA 1ZSKA 1NS3A 1YF4A 1FUJA 3MNXA 4UFEH 4DGJA 1O2QA 1UHBA 1V2QT 2F9PA 1GI5A 1ZHPA 1V2OT 1GVLA 3I29A 2G00A 1ANEA 1Z8JB 2GT8A 4X1QU 4X6NA 3SN8A 1DSUA 1HYLA 2WYJA 1BT7A 4D9QA 2STBE 4WVPE 1CA0C 3LGVA 2AMQA 4NFFA 2NU4E 4YO9A 1VCWA 5EQQA 2ZFPH 3HATH 3S7KB 3VXFH 1K28D 5AFYH 2GZ7A 1C5QA 2OBOA 2ZP0H 1HDTH 1TA6A 4FUBA 2F9OA 5JBAS 3QLPH 1YPEH 2WYGA 3PO1C 1LVYA 3EDXB 1C4U2 2QA9E 1PQAA 2H5DA 3QDZB 1O3MA 4NA7A 4DJZB 1D3PB 4AOQA 1AWFH 1D4PB 1G2MA 3BTTE 4X2YA 5GPIB 1O5AB 2G55A 2OC1A 2XC0A 5T3HA 5CHAC 1LPGB 3P70B 4GHQA 2QN5T 1JBUH 3M37A 4ZHLU 1BJVA 9ESTA 1L1GA 4GSOA 3MNCA 4O3TA 3URDA 1C2KA 3GICB 2WV4A 3ZVAA 1XKBC 1CVWH 1AWHB 1ANDA 1Y3WA 2ZU3A 2VIOA 4MNYA 4KTSA 4FUIA 3EE0B 2XBWA 1TMBH 1BRAA 2SNVA 2Z9IA 1ZTKA 4K69A 4WH6A 1O2SA 1SQAA 2AGIX 1C5UA 1C5MD 3LC5A 1RJXB 2GMTC 3A7ZA 2IJOB 2Y5FA 2BVXH 4YZUA 5T6GA 1FNIA 2Y6TA 2SNWA 2H1UA 3A87A 1SMFE 1GBLA 2Z9LA 2NWNA 3V3MA 4X8TH 1QNJA 1A0HB 3PMAB 5DGJA 4ABDA 3NPSA 1XMNB 3QWCH 2QF3A 1BCUH 1HIAB 1PYTD 1S0QA 1Z7KA 2FP7B 2VVVA 1E34B 2ZGCA 3M61U 2A4OA 3O8RA 1OWJA 5DPAA 1SOZA 1A1RA 2BY8X 1CHOG 2C8YB 3GCTG 2C3SA 1P09A 3KNXA 1Y5BT 1GI9B 1EX3A 3RXFA 5K7RA 2KAIA 1V3XA 2UUKB 4OS4A 3LJJA 2J2UA 4J1YA 3T27A 2FYRA 1O3DA 1KY9A 1GJ9B 1A2CH 1AY6H 2FOBA 3VPKA 2CJIA 2FOAA 3P17H 3VB6A 2XXLA 1O2JA 2AMDA 1Z1IA 1C2LA 2UUFB 2VGCB 1NM6A 5JB9S 3CP7A 1K1JA 3AVZA 1EJAA 1RRKA 4CH8B 1TGNA 3ZZ9A 1DPOA 1HFDA 2SGDE 1QB6A 1SQOA 2ODQA 5LPRA 2HOBA 4MVNA 1W3CA 2CXVA 4H6TA 4BNRA 1MBQA 4X2VA 3H5CB 1O34A 1GBHA 3T2NA 2FTMA 3RU4E 4MNWA 1EAIA 1YBWA 2AIQA 4J2YB 2JETC 3B23B 3FZZA 1O2KA 2BD3A 1W8BH 1JWTA 1AUJA 3QUMP 3D62A 3EQ0H 1RIWC 1QRWA 2XRCA 1SGQE 3SUGA 2RG3A 2ZG0H 4X1RU 5DP5A 5DG6A 1ELEE 1UMAH 2P94A 1SGYE 3VB5A 4E05H 1NRSH 1UVUH 5TCCA 2P3UB 2TGPZ 1TX6A 5F8ZA 2Z7FE 4O9VA 1CO7E 3D65E 2ZU1A 1OP2A 3IWMA 3TLOA 4ASHA 4NSVA 5IDKA 1J15A 3LGWA 1UTOA 3FP6E 1N8OC 1P3EA 2W7SA 3LIWA 1UK3A 1GJ8B 1TAWA 1P2IA 1AU8A 5A0AE 1AN1E 3NUMA 1LMWB 3KN2A 2XWBI 3C27B 3TH3H 1EKBB 1QB1A 3SI3H 1BIOA 4OS5A 1SL3A 4WXIA 1KIGH 3MH5A 1O2OA 4XOJA 3U9AH 2OTVA 3OYPA 1ZMJA 1FDPA 4ISHH 3HKIB 2FOMB 5GCHG 2WUCA 1DSTA 1WQVH 1GG6B 3M7QA 2BLVA 1F0TA 1IQLA 1O2PA 1SFQB 1TB6H 3SHAH 3SORA 1CQQA 1UK4A 1HUTH 3ZVBA 2GCHG 1P10A 1T8NA 3RXAA 2BDAA 1A5HA 3S9AA 1A46H 3SUEA 1T8OA 1P2MA 1AFQC 4AFSA 5T6FA 1ZOMA 1GJ5H 5EXNA 1QY6A 1ZRKA 5DP6A 4FUCA 2GDEH 3LGUA 1S82A 1RS0A 4NZLA 1VGCC 3LONA 3MU5A 7GCHF 1CA8B 3SJIA 1GI0A 1NRNH 2A2XH 2ZCLP 1YPGH 1DLEA 5F8XA 1V2WT 4UD9H 3GY3A 2F91A 1EJNA 3QN7A 4Y8XA 2Z9GA 1CGIE 1HGTH 1TQ7B 1TONA 4UFDH 4JK5A 2CN0H 1IQNA 1BZXE 1BTWA 4Y76A 1DWCH 3FZDA 2ODYB 3Q3YA 2ZHDA 6GCHG 2PW8H 1KLIH 1ETTH 2VB0A 1GI3A 4Y10E 3OY5U 5GWZA 5AF9H 2ANMH 2ANYA 1WU1A 1UCYE 4XBCA 1O3GA 3ELAH 4ISOA 1AKSA 1MCVA 1FZZA 1NTPA 1C5SA 4O03A 5EODA 3Q3XA 7ESTE 1GBDA 1EB1H 4FUFA 1UJ1A 1PPGE 1LVMA 5AFZH 1TWXB 1Z6JH 1O3CA 4NZQA 5FXLA 3T29A 3PV4A 1O33A 1YLCA 3HGPA 4AGKA 1J16A 2V35A 1K1NA 4YESB 1LKAA 1O35A 4AYYB 1GBAA 3PMBB 1G32B 1LTOA 4XFQA 3R3GB 4CH2B 1FY4A 2BD7A 1AVXA 2UWPA 2OINA 1TX8A 1O3LA 1SGPE 3A8BA 1P9UA 4HFPB 3QX5H 3KQCA 2ALPA 1KYNA 1NRRH 5GJ4B 3U1IB 1QR3E 8ESTE 4GCHG 4FUJA 3P8NA 1ZSJA 2BZAA 1W0ZU 2FI4E 3SV7A 1RGQA 4IS5A 3TGJE 1TBZH 3A8DA 2AEIH 3PTNA 1RTLA 4AYVB 4KKDA 3VXEH 2BOHB 2WPHS 1QJ6B 3TPIZ 4X6MA 2HNTC 2BMGB 3PLPA 1F7ZA 2PUXB 3GCHC 3MMGA 1FAKH 1UCYH 1AI8H 3DFJA 1O2MA 4M7GA 4XE4A 1MH0A 5EGMA 1QRXA 1LHEH 1MAXA 3F9HA 1WCZA 3M7TA 2FI5E 1IQMA 2FODA 4Y79A 3GOVB 1PQ8A 2Z6BD 1SBWA 3UR6A 1YC0A 1GBIA 1HXEH 1E35B 1O0DH 3ZYDA 1ELTA 1YKTA 1H9HE 3AW0A 1CT0E 3SU6A 1EASA 1BMLA 1OP0A 2ZZUH 2A7JA 1AKSB 3AAVA 3RXUA 5IYTA 3ZZCA 3BEIB 1JIMA 2PTNA 2QF0A 1BTYA 1PPBH 1ZHRA 1T31A 4IC5A 4ZKSU 1VITH 3TGIE 1AFEH 3GCOA 4WF8A 4A1TA 4JYVH 1XUGA 2LNCA 2CHAC 2O8LA 1THPB 1O2UA 4LZ4B 4DURA 2QXIA 1CE5A 5F6MA 2A0QB 4RKOB 1ELVA 1D9IA 1L0ZA 4DIIH 1GMHG 3U8OH 2EC9H 4HZHA 4X1PU 4U32A 2GZ8A 2A31A 5JBTA 3PROA 1MKWH 3JZ1B 1O5BB 4X8VH 2A2QH 1KDQB 2ZU4A 1BRUP 3BN9A 1GHAF 3RM2H 3B9FH 4Y7AA 4X2XA 1C4V2 4Q2KA 1FY8E 1O37A 2GCTB 4YTAA 1TNIA 5L2ZH 1TQ0B 2GKVE 1FMGA 1C1VH 1J8AA 1D6RA 3UY9A 1LHDH 3NCLA 1ZTLA 2B5TB 1LO6A 1MTNB 3U8TH 3SOSA 3GYLB 1M9UA 4DW2U 3Q3KA 4Y0YE 1O5GH 5JDUB 4ZXYH 3HK6B 3LJOA 4KELA 3MYWA 2PKAB 2SGQE 1YGCH 3TIUA 3RXIA 1S0RA 5JBCS 2QV1A 2ALVA 2A5IA 1EJMA 1GJBB 1JXPA 2J92A 2BD5A 2BXUH 2BD4A 3I77A 3F9EA 5JPMH 3BTWE 1O5FH 4CBOA 1S84A 2FESH 1BTHH 2ILNA 5A8YA 1AIXH 4DVAU 4BAMB 2O9QA 2W7UA 3NZIA 2AYWA 1C5NH 4ZH8A 2OCVB 3DT0H 4GLYA 1GHXH 3BTFE 1TGBA 1KLJH 1D3QB 1GL0E 1ZSLA 1Y3UA 2H6MA 1IHTH 1JMOH 3RXGA 2PWXA 2QAAA 2TGDA 1O3BA 1GMDG 3SNCA 3DD2H 4ZROA 5C5OA 3SUFA 3ZZ6A 1TBRH 4NGAH 2D8WA 4ZHMU 3RLWH 1OS8A 5DJ7A 2PKSB 1UO6A 3MHWU 4YOGA 2PTCE 3RU4D 3STIA 1GI7B 1O5DH 1DLKB 3QTVH 1C5PA 1S85A 3E0NB 3ZZDA 1O30A 1RXPA 3MO3A 4K60A 5SGAE 1O2ZA 1AUTC 3F68H 2HNTF 4K2YA 4OGXA 1W12U 2ZDAH 4I32A 4JK6A 5E2OA 3LKWA 5EQRA 4JYTA 1P2KA 1HAYB 2ANWA 1ABJH 1QHRB 3TNTA 4YT7H 1SHHB 1K22H 2BLQA 1LDTT 3ODFA 1TE0A 3LPRA 2F9VA 1VJ9U 5CMXH 3LH3A 5H4IB 3TU7H 1GL1A 1A0JA 3E3TA 3L3TA 5L30H 5TJXA 1C2HA 1EZXC 1ID5H 1Y3XA 1TYNA 2ZDKA 4Q80A 4XBDA 1AQ7A 1O2TA 1XVOA 4HI3A 1O2WA 3SW2B 1QQ4A 4FVDA 1LQDB 2ZKSA 4FU7A 3UIRA 3ATLA 4BAKB 1DOJA 1NZQH 3RXOA 3QK1A 1C5OH 1EOJA 2HPQH 1K1OA 1CHOF 2VIQA 3GCTF 3UTUH 1HAVA 6CHAB 1ETRH 2BXTH 3L33A 1LHCH 3SU3A 1H9LB 1DFPA 1TMTH 4BXSA 3FVFB 3NK8A 2O8WA 1HV7A 1DY8A 1HXFH 1V2RT 2QGRA 1ZPZA 1W10U 2Y5GA 1LCYA 2GX4A 1ESBA 3QTOH 3T28A 3T5FH 4UFFH 1ESAA 1F5RA 3D23A 1DWDH 2ZU2A 3TK5A 1CBWC 2Y5HA 1C5LH 1B7XB 1AZZA 1EZUC 1GBMA 1WV7H 1CA0B 2XCNA 3MOCA 4A1VA 1C2MA 1SFIA 1FIWA 2RDLA 2VVUA 3TJUA 1OYQA 2W5EA 4AORA 2CGAA 1TPOA 1K2I1 1GJDB 2FLRH 2Q6GA 3Q77A 2R0KA 1V6DA 3P6ZB 4UDWH 5FAHA 3A7YA 1PQ5A 3RXJA 3UREA 1O2VA 2Y80A 4SGAE 2DE9A 4ZMAH 3PO1B 2ZEBA 2A5KA 3VB7A 4B1TA 1TBQH 3TH2H 4NFEA 4B74A 3SQHE 3B8JA 1UK2A 1ZHMA 4D7FA 3S0NA 2J4IA 3PLKA 3RMMH 4CHAC 4AFQA 4WMFA 1IQIA 1O5CB 2ZQ2A 4K1SA 1V2ST 2BQ6B 1LQEA 2VIWA 5CHAB 3MTYA 4LK4A 1TRNA 1UHBB 1SLXB 3A7WA 3P8OA 2QXJA 2FX6A 1OWEA 2P16A 1SOTA 2ZFRH 1O3JA 1UTLM 4FXGH 5EW2H 1IHSH 1SGDE 1DXPA 2FOEA 5EU8A 1ZR0A 3W94A 5C2ZA 1DUAA 1Q31A 1BQYA 2P3TB 1HAVB 2P95A 1K1MA 1GBTA 1DDJA 2PV9B 3NXPA 1ELFA 1BRCE 1C1QA 1UVSH 2FOHA 1GWAA 5A0CA 3ZZ3A 2ZFTA 1V2LT 2GMTB 3BTQE 1TLDA 3EYDA 3R0FA 1GMCG 1A61H 4Q7YA 5DP4A 4IMQA 2Z9JA 5GCHF 3RC5A 3U1JB 1UVPA 2OQUA 4MLFB 4OGYA 2AGGX 4Z0KA 4B2CA 3KQEA 1CU1A 1ZJDA 4YOJA 1GHYH 3T26A 4I8JA 1DWEH 1GHBG 1JRSA 2GCHF 2XW9A 4X0WU 1QA0A 4OS6A 3VB4A 2IN2A 4NCYA 4R8TB 1YCPK 1TX7A 2BVRH 5DP8A 2AERH 4IW4E 3A8CA 4B71A 1GBKA 1V2NT 1C5VA 2G51A 3A89A 1TPAE 1WTHD 4FUDA 5I46H 1NFYA 2Q6DA 5LH8A 1YPMH 1ELDE 1WBGB 2FO9A 4WJG2 2W26A 4NSYA 4JZ1A 3UNRA 3H7TA 2UUJB 3MU8A 5GXPA 4KGAA 2A7HA 2ZFQH 1P05A 2VWNA 1TABE 1BBRK 2XBVA 4XSKU 1C1SA 4TWYA 4H6SB 4K1TA 4IMZA 1IOEA 2LPRA 5EPNA 1BDAA 3PLBA 5DP9A 5A8ZA 2YNBA 2PSXA 2ZTXA 2ZNKH 5EXMA 1O3EA 4U30A 2D1JA 4MTBA 1AE5A 1HNEE 2QC2A 2EI6A 1N6XA 3TJNA 5C67A 1B0FA 1J17T 3LT3A 1JIRA 2VVCA 6GCHF 1SGIB 1WYKA 1TGSZ 4I8HA 4X1SU 3S9BA 3GY8A 2BM2A 3KCGH 3UOPA 1SB1H 2XBYA 1FV9A 2XYAA 1ELCA 3LGTA 2XCFA 3PTBA 4UFGH 3UOUA 2FX4A 3MH4A 1FIZA 3RXHA 3CENA 3OSYA 2ZHQH 2Q6FA 2JETB 3V12A 1O3NA 1MKXK 2QXGA 3FFGA 5K0HA 5HGGA 1RIWB 1SVPA 2G5NA 1KXCA 2KAIB 2G52A 2A32A 1NRQH 4GAWA 1TA2A 1OWHA 4WH8A 1BOQA 3CS7A 3PWCA 1ZYOA 1RD3B 2P93A 1O2GH 1UTNA 1S5SA 5EQSA 3SV8A 2H9EH 3TNSA 2A5AA 2OC0A 2TBSA 3SO3A 2H2ZA 4ABIA 4X8UH 3BEUA 1N8OB 3VEQB 4WY3A 1GI4A 3QGNB 2RA3A 5DP7A 2BD8A 3ZVEA 5HXFA 4ABGA 3SV6A 3QZRA 2ULLA 3MNSA 3TJVA 2SFAA 2ZTYA 4GCHF 1KSNA 3KF2A 2BDCA 1C2FA 3GY6A 3PM3A 1P2OA 1C2EA 4AG2A 3ATWA 5F03A 1T4UH 3I78A 4ZKOU 2GZ9A 1ZJKA 1QGFA 1GHWH 1DVAH 1XXFA 4Y8ZA 2SGFE 1HAOH 4Q7ZA 1NU7B 2OXSA 2ZHEH 1DICA 3BTDE 3SU2A 1TALA 2B9LA 4H4FA 3U8RH 3EA7A 1DE7H 1VJAU 3UQOA 1SGFG 1T4VH 5E0HA 4OS1A 2H5CA 1P3CA 4E7NA 2W3KA 1TMUH 1OWDA 2H9TH 5EG4A 1AFQB 4I7YH 1GGDC 3LGYA 1K1PA 3MO6A 4NWKA 3SGQE 3RXDA 1T8MA 2VJ1A 1F5LA 2FS9A 1VGCB 3F6UH 1Z8GA 3M36A 1G3DA 3VB3A 5B6OA 3RXTA 4UE7H 4AZ2B 3DFLA 2DE8A 4K3JA 1FLEE 1F0SA 3ZVCA 1TPPA 2FZZA 1NN6A 2FOGA 1EP5A 4YT6H 2O8TA 4ZHAA 3UR9A 3PMHB 4CRFA 4QT8C 8LPRA 3VGCC 2ESTE 1G36A 2C8ZB 4MG3A 5DKMA 2M5TA 5A2MH 3BTEE 4U2WA 2VIDA 2Z3CA 1UVTH 4RSPA 2Z94A 5ESTE 1HB0B 1MMJN 1PPCE 1DX5M 1GMHF 3ZZ5A 8GCHG 2QY0B 2ZPSA 4A92A 5EXLA 2JH6D 2BX3A 2VNTA 4UEHH 3KGPA 3HPTB 1D3TB 1EZSC 3A80A 3OX7U 1ZRBA 4NWLA 3SV9A 3PYHA 3SGBE 1W7XH 1OWKA 1CGHA 3STJA 2R3YA 4ABFA 3VFEA 4JMYA 1C5XB 3F9FA 4X1NU 4SGBE 3FP7E 1GI8B 1EPTA 1MD8A 4K5ZA 1TGTA 4H42U 2A45B 3UUZA 4BTTB 5ABWA 2XC4A 1LKBA 2Y7ZA 1DT2A 2EI8A 2SGEE 4D7GA 9LPRA 3O8DA 1NROH 5C1UA 2AIPA 1OWIA 1C9PA 3A8AA 2NU1E 1UVOA 3W95A 1KTSB 2NU0E 3BEFB 5C1YA 1FY5A 1QFKH 2ZPQA 3O8CA 1SHYA 1NESE 2ZTZA 1GVZA 1YCPM 4TPYA 2BB4A 3HK3B 3M5NA 4CRDA 4ABBA 4JZFH 1BB0B 1SI5H 2FS8A 2F9BH 2ZI2H 4MPXA 3FAOA 3HKJB 1BMAA 3LH1A 1MAYA 3SU5A 1ANCA 1V2VT 1B5GH 1GDUA 4ISIH 3GCNA 2RA0A 2ZWLH 4E7RG 2J9NA 4BAHB 2HWLB 1P0SH 1GMDF 2AFQB 4IC6A 4FU9A 3GCHB 4ABJA 5DO4H 1Y59T 2BY5X 1FY3A 1Y3YA 4ABAA 2OD3B 1ZGIA 1EPTC 1PPEE 3RXMA 3ZYEA 2BYAX 1C1RA 3SV2H 3TK6A 2XBXA 1KXBA 2BQWB 2BDIA 1GDNA 4XBBA 4MPUA 1C5RA 4YLQH 1WSSH 3LDXH 2G81E 3UNQA 3K6YA 3KEEA 3RXEA 1HJAC 1ELBA 3P8GA 3SJOA 4AFUA 1J9CH 1NC6A 2C8WB 2WPJS 4NIWA 1XKAC 3OU0A 3P95A 4AGJA 2GD4B 3FANA 1F0UA 2WUBA 1GDQA 1HBTH 2BDBA 3RU4T 1JRTA 1GCTC 2TGTA 3GY2A 4FUEA 1H1BA 3IG6B 4FU8A 1FN6A 1RTFB 3ZVDA 1F0RA 3BG4C 1WUNH 1MU6B 4X6PA 4UONA 1L4DA 1SSXA 4BXWA 5G4BA 3A84A 2CHAB 1ESTA 2BY9X 2P8OC 2PGBB 5GDSH 3GY4A 1YPHC 1VCPA 5C1XA 1HAHH 2HNTE 1F92A 4B2BA 3E6PH 2XNIA 2OUAA 1V2UT 1NT1A 2G5VA 1ZGVA 1BTUA 1EP6A 1P2NA 2HRVA 2Z3EA 4HTCH 4BTUB 3G01A 1L1JA 3MU1A 3E8LA 1O3AA 1EQ9A 2BDYA 2YOLA 1TNLA 3OY6U 1ZPBA 2JKHA 1XX9A 2ZHFH 3A88A 1EAXA 1FPCH 1G37A 1HJ8A 5FCRA 3KIDU 1GJCB 1AGJA 1P06A 1SLVB 1ZTJA 3M5LA 5AVDA 1SGEE 3E16B 2BY7X 3QGJA 4WMDA 1KXDA 3EA9A 5L6NH 1XXDA 4NA9H 1ZPCA 4TY6A 1P2JA 4NIVA 1TNKA 3RP2A 1C2IA 1C1MA 4ZXXH 1E37B 3FP8E 3KL6A 1BTZA 3LGIA 4GPGA 1FQ3A 3SU0A 1O2RA 3ATMA 2FI3E 3V13A 2RCEA 3MU0A 1YPKH 1AHTH 2C93B 1LHFH 1RTKA 3M7UA 2ODPA 3MU4A 4A1XA 1VITG 3ATKA 2H9HA 1QL8A 2BDGA 2VWLA 3A7TA 2VWMA 3T25A 1E36B 3ATIA 2VU8E 1QQUA 2I6QA 5FPSA 2PR3A 2OBQA 1O2XA 1O5EH 1N1LA 1N6YA 2BTCE 4BAOB 4VGCC 1MZDA 1OXGA 2PFEA 1D6WA 1MKXH 3SJKA 2PGQB 3Q76A 3DA9B 4PROA 1P2QA 2OC7A 3AASA 1ZLRA 4KTCA 1OPHB 3RMLH 1EAWA 1GJ6A 1BHXF 4NG9H 4A5TS 1Z71A 3CS0A 1PPZA 2ZA5A 2ZDNA 1YPHE 1NU9A 1NO9H 1BITA 1L2EA 3A7XA 4GVUA 4I33A 1QBNA 1QBVH 1P02A 4ABEA 3BG8A 4K8YA 1G3BA 1HLTH 1SR5C 2VWOA 5A09A 1L1NA 2ZFFH 1E38B 2VIVA 3A81A 1ZMNA 1G3CA 4U01A 3SHCH 1O39A 3S9CA 2BQ7B 4AFZA 1KTTB 2GP9B 4B76A 2GVFA 3A83A 1O2YA 4Y7BA 1O2IA 1SQTA 4K8BA 1U6QA 1YPLH 4X6OA 2NU2E 1GCDA 1AB9C 4RKJB 1TPSA 1K21H 1QL9A 3KQBA 1HRTH 1HCGA 4IBLH 3A85A 4Y8YA 4K1EA 1GMCF 2O8UA 1C5WB 1TIOA 1EOLA 2TIOA 2OLGA 3IITA 1ARCA 2FLBH 1HIAA 4ISNA 3PWBA 1C1PA 1SGCA 3P8FA 2VH6A 1GBJA 1GHBF 1JOUB 4INLA 4Y11E 2ZGBH 3RXLA 2A7CA 1P57B 2J95A 1CT2E 3RXSA 1AB9B 2FM2A 1UCYK 1TNJA 1GVKB 1EZQA 4NIXA 5LGOA 3RMNH 2C8XB 3RM0H 1C4Y2 5E0GA 1MZAA 1QBOA 1O2NA 3M5MA 1VZQH 1SGNE 5GIBA 2XWAA 2R2MB 3RC6A 4ZUHA 1LPZB 1J14A 2ZO3H 1F2SE 1UTKA 2ZF0H 1G30B 3K2UA 5BRRE 4MNXA 1GBEA 4DY7B 1CBWB 1C2JA 3GISB 1NRPH 2G4TA 4INHA 1TOCB 1Y3VA 1CGJE 5HM9A 2FYQA 1S6HA 2V3HH 2BZ6H 1GI6A 1X7AC 1DY9A 1BMMH 2FOCA 1K1IA 1Y5UT 1LPKB 5PTPA 2BD9A 3N7OA 3TVJB 1W14U 1C5TA 3MFJA 1FY1A 4IN1A 2WPKS 1TNHA 4AX9H 1IQFA 4F49A 2FDAA 2F3CE 3UWIA 3BIUH 2WV5A 3LU9B 1P03A 5FX5A 5FX6A 3O8BA 4CHAB 3NWUA 2ZCHP 2UUYA 5TCAA 2QIQA 4D8NA 1V2JT 3ITIA 3SUDA 1C1TA 5JYIA 2ZPRA 4TWWA 1V2MT 1NPMA 3URCA 1MKWK 4ZAEA 2VGCC 1O3OA 1IAUA 2XTTB 3SJ8A 1V2TT 2HPPH 3E91A 1O36A 5HYOA 3RMOH 1PFXC 3BTGE 1BMNH 5FCKA 2WPIS 3MNBA 2STAE 3BTHE 2Q1JA 2VINA 2B8OH 3UQVA 1DANH 3DUXH 2BX4A 1W11U 3RXQA 3TJOA 1D3DB 1AVWA 1Z6EA 2OC8A 1C1WH 1CSOE 4CREA 2WINI 4TY7A 3NKKA 4HGCA 1FONA 1C9TA 2VH0A 2ZQ1A 3QO6A 4GHTA 3ZZ4A 4Q7XA 3V7TA 2TRMA 1C1NA 1GI2A 1O3FA 1S6FA 1ZMLA 1XUIA 1MTWA 2F9NA 5E0JA 1YLDA 2EI7A 1W13U 2YNAA 3RXBA 4XDEA 1WOFA 2DUCA 3JZ2B 3SNEA 1MCTA 4MQAA 3U69H 1MU8B 1BA8B 2EA3A 5AHGH 1PJPA 3GY5A 3SU4A 3EAJA 1HAXB 2HLCA 5C20A 3ZZ8A 1GJ7B 1Z8IB 4YLUA 2GV6A 5JB8S 1WTGH 3RXVA 3UPEA 4NA8A 2O8MA 4O3UA 2GV7A 1MD7A 3BTKE 1YYY1 3LOXA 3K9XB 1MTUA 1A4WH 2TGAA 4FVBA 4I8KA 4DG4A 1KXEA 1QA7A 4X8SH 1IQEA 2A4RA 2ZECA 2FMJA 1HAPH 2ZU5A 4D9RA 3BSQA 1UTPA 1A5IA 1H8IH 3UNSA 5A0BA 1GG6C 3RUOA 3D49H 1TOMH 3ZV9A 3MO9A 2Y82A 4CBNA 5EW1H 1A3EH 1P01A 1XUFA 3S7HB 1BUIA 2QCYA 1T7CA 1G9IE 1XM1A 3E90B 2A1DB 2GTBA 1DXWA 1H4WA 1YPJH 3GYMA 8GCHF 1FPHH 2TPIZ 2ASUB 1DM4B 3SZNA 1OSSA 5FPTA 1VCQA 3BF6H 1O2HA 1AMHA 1HAZB 2NU3E 1IQHA 1QIXB 2OQ5A 4LOYH 3TH4H 4B75A 3TGKE 1ELAA 1L4ZA 2B7DH 2ANKH 1H8DH 5E8EH 1PYTC 1P8VC 4D76A 4BAQB 4JZDH 5L2YH 1NFUA 1FAXA 3F9GA 2ZDMA 1SG8B 1TRMA 1OP8A 2FXRA 4A6LA 3UWJH 1QJ7B 1UTMA 2PHBA 1XUJA 5HMAA 4MDSA 3ZVFA 1GBBA 2BY6X 2PSYA 1ANBA 2BVSH 3E0PB 4AB9A 1MBMA 1FXYA 1Z8RA 5HM2A 4CR9A 5ESBA 3SQEE 1LHGH 3EGKH 3V0XA 5C5NA 4AB8A 4OS2A 4I31A 3MH7A 4CRAA 2BOKA 3ZV8A 1EUFA 5LPEA 1HJ9A 1ETSH 1ZZZA 2D26C 3KHVA 1LVBA 3KQDA 2PLXA 1P12E 1MTSA 7KMEH 1LVOA 4I8GA 2P59A 2ZFSA 1V2KT 1TFXA 1Y8TA 2A4GA 1THRH 4KTUA 5DP3A 3ENSB 1PPFE 2PUQH 3S69A 1SLWB 2Y81A 4JZIA 3GY7A 1THSH 1OX1A 2G4UA 1GGDB 1ABIH 1QRZA 1C5YB 5CE1A 1ACBE 1CT4E 1XUKA 1A3BH 1QJ1B 1EB2A 3PMJA 2AMPA 1IQJA 4THNH 3RC4A 3ZZ7A 4BTIB 1A5GH 2J34A 1O3IA 3M3VA 3BTME 4MNVA 1BTPA 3RXCA 1BTXA 1Q2WA 3GDSA 2CF9H 2FIRH 1O3KA 4CRBA 5FPYA 3GDVA 1PPHE 1GBCA 3Q00A 2P3FH 3VGCB 2ZIQH 4DIHH 3M3SA 1QCPA 3K65B 2FOFA 4ISLA 1C2DA 3TK9A 1F5KU 1NFWA 2ZHWH 3OTJE 1SGTA 2FEQH 1ELGA 1UTJA 3MH6A 1FI8A 2VIPA 4OS7A 2CMYA 5FBIA 1KDQA 1AVGH 5ETXA 1O31A 4Y71A 4B73A 5A8XA 1MQ6A 3L6PA 4WXVA
chains in the Genus database with same CATH superfamily
3QZQA 1C1OA 4ZKRU 3E1XB 4FUHA 1G2LA 4ABHA 7GCHG 1INCA 2XC5A 4X2WA 4IN2A 4MPWA 3SNDA 1O38A 1C2GA 1AZ8A 1DWBH 1EATA 2GT7A 1VR1H 4RI0A 1TRYA 3ZZBA 6ESTA 2HGTH 1QL7A 1O3PB 2IOTA 3H09A 1G3EA 1HAGE 4Y6DA 2PKAA 4B2AA 2BLOA 2V6NA 3BV9B 1V2PT 2ZGXH 2FWWA 1W7GH 4MPVA 2R2WU 3DHKH 1GHVH 4DT4A 2Z9KA 1W0YH 3BIVH 3A7VA 1GJ4H 1BRBE 5I25A 4ZKNU 5FHTA 1O2LA 2HVXA 2A4QA 1DUEA 1BHXB 3OTPA 1VITF 1YM0A 2IPHA 3TITA 1P11E 1A7SA 4JZEH 3U98H 2ZGHA 2GCTC 3RXRA 2QXHA 1BBRE 2THFB 1WAYB 4E06H 4LXBH 5KECA 1WQSA 3ESTA 1QTFA 2C4FH 4F4OC 1MTNC 3M3TA 1P04A 1K1LA 1AO5A 1EPTB 2B0FA 1OOKB 2OP9A 5T6DA 3T62A 4I8LA 3SNBA 1C1UH 1T8LA 5BPEA 2AH4X 5E2PA 3M5OA 4WWYA 3RXPA 3SJ9A 1HJAB 2SGPE 4ESTE 1CHGA 5J4QA 2I6SA 4R0IA 3M35A 2SGAA 3MI4A 2ZGJA 4AN7A 1PQ7A 2C90B 1E0FD 5EOKA 4DT7B 2W3IA 5JBBS 1FN8A 2QYIA 2ZC9H 1RFNA 3A86A 3GDUA 4AG1A 1TGCA 2ZCKP 4IGDA 1YCPH 3C1KA 1GCTB 4RN6A 1DS2E 4INKA 3P92A 2KFWA 3RLYH 2AS9A 3ODDA 2R3UA 1HAIH 3AAUA 3BG4B 2JH0D 4FUGA 2WPLS 3UFAA 4BOHA 5DK1A 2J94A 2D2DA 1Z1JA 1YP9A 3PB1E 2P8OB 1OYTH 2W6JD 1KXAA 3SGAE 1A0LA 2PKSC 4JYUH 2R0LA 1EAUA 1O3HA 2PP6A 1BBRH 1AD8H 5DSFA 5J4SA 1HPGA 3SI4H 1Y5AT 3ZVGA 1TNGA 1XUHA 2Z3DA 5F8TA 1EXFA 2ZDVH 1Q3XA 1AE8H 1IQKA 1NY22 2F9UA 3MWIU 2FTLE 1NFXA 1GI1A 1K9OE 3SU1A 1P9SA 1T32A 1BJUA 2FPZA 2GDDA 1B0EA 4CR5A 1O32A 1IQGA 1FJSA 2UWLA 4A7IB 4Z6AH 4CRCA 1MTVA 3SBKA 1XVMA 4CRGA 4KP0A 4NIYA 5EPYA 4DOQA 4DCDA 1SGRE 2K1QA 4JCNA 2EEKA 3K6ZA 1DITH 1SGFA 3F1SB 2Y7XA 1SLUB 2EY4C 1GBFA 1W2KH 1SC8U 2ZDLA 3A82A 4Y0ZE 6LPRA 1QURH 3AW1A 2CF8H 1MQ5A 2HALA 1ORFA 4YOIA 3WY8A 1KLTA 3SNAA 3ZZAA 2AGEX 2G8TA 1GHZA 3EA8A 4TPIZ 2BDHA 1UTQA 2BHGA 5C3NA 8KME2 2R9PA 4O97A 2BLWA 4GUXA 3RDZA 2V0BA 2V3OH 3H7OA 4LZ1H 5FBEA 4BANB 1GPZA 2JH5D 1QB9A 1GHAG 2J38A 7LPRA 4XD7D 1MUEB 1OKXA 2WPMS 2BD2A 2JIZD 1GJAB 1S81A 3LC3A 4ACAA 1ARBA 3HGNA 2GGVB 4WMEA 1SPJA 4YM9A 5CHBA 5LPFA 6CHAC 2F83A 1KXFA 1C5ZB 1S83A 2UWOA 4VGCB 2CV3A 4TYDA 4ASUD 1H9IE 3RXKA 1ZSKA 1NS3A 1YF4A 1FUJA 3MNXA 4UFEH 4DGJA 1O2QA 1UHBA 1V2QT 2F9PA 1GI5A 1ZHPA 1V2OT 1GVLA 3I29A 2G00A 1ANEA 1Z8JB 2GT8A 4X1QU 4X6NA 3SN8A 1DSUA 5B6LA 1HYLA 2WYJA 1BT7A 4D9QA 2STBE 4WVPE 1CA0C 3LGVA 2AMQA 2KCAA 4NFFA 2NU4E 4YO9A 1VCWA 5EQQA 2ZFPH 3HATH 3S7KB 3VXFH 1EFRD 4P02A 1K28D 2YMSC 5AFYH 2GZ7A 1C5QA 2OBOA 2ZP0H 1HDTH 1TA6A 4FUBA 2F9OA 5JBAS 2QF4A 1YPEH 3QLPH 2WYGA 3PO1C 1LVYA 3EDXB 1C4U2 2QA9E 1PQAA 2H5DA 3QDZB 2WHXA 1O3MA 4NA7A 4DJZB 1D3PB 4AOQA 1AWFH 1D4PB 1G2MA 3BTTE 4X2YA 5GPIB 1O5AB 2G55A 2OC1A 2XC0A 2OK5A 5T3HA 5CHAC 1LPGB 3P70B 4GHQA 2QN5T 2JJ2D 1JBUH 3M37A 4ZHLU 1BJVA 9ESTA 1L1GA 4GSOA 3MNCA 4O3TA 3URDA 1C2KA 3GICB 2WV4A 1FX0B 3ZVAA 1XKBC 2J5UA 1CVWH 1AWHB 1ANDA 4F55A 1Y3WA 2WV9A 2ZU3A 2VIOA 4MNYA 4KTSA 4FUIA 3EE0B 2XBWA 1TMBH 1BRAA 2SNVA 2Z9IA 1ZTKA 4K69A 4WH6A 1O2SA 1SQAA 2AGIX 2WZQA 1C5UA 1C5MD 3LC5A 1RJXB 2GMTC 3A7ZA 2IJOB 2Y5FA 2BVXH 4YZUA 5T6GA 1FNIA 2Y6TA 2SNWA 2H1UA 3A87A 1SMFE 1GBLA 2QE7D 2Z9LA 2NWNA 3V3MA 4X8TH 1QNJA 1A0HB 3PMAB 5DGJA 4ABDA 3NPSA 1XMNB 3QWCH 2QF3A 1BCUH 1HIAB 1PYTD 1S0QA 1Z7KA 2FP7B 2VVVA 1E34B 2ZGCA 3M61U 4P00A 2A4OA 3O8RA 1OWJA 5DPAA 1SOZA 1A1RA 2BY8X 1CHOG 2C8YB 3GCTG 2C3SA 1P09A 3KNXA 1Y5BT 1GI9B 1EX3A 3RXFA 5K7RA 2KAIA 1V3XA 2UUKB 4OS4A 3F2HA 3LJJA 2J2UA 4J1YA 3T27A 2FYRA 1MABB 1O3DA 1KY9A 1GJ9B 4Q4LA 1A2CH 1AY6H 2FOBA 3VPKA 2CJIA 2FOAA 3P17H 3VB6A 2XXLA 1O2JA 2AMDA 1Z1IA 2RDEA 4RT1A 1C2LA 2UUFB 2VGCB 1NM6A 5JB9S 3CP7A 1K1JA 3AVZA 3F0PA 1EJAA 1RRKA 4CH8B 1TGNA 3ZZ9A 1DPOA 1HFDA 2SGDE 1QB6A 1SQOA 2ODQA 5LPRA 2HOBA 4MVNA 1W3CA 2CXVA 4H6TA 4BNRA 1MBQA 4X2VA 3H5CB 1O34A 1GBHA 3T2NA 2FTMA 3RU4E 4MNWA 5C0TA 1EAIA 1YBWA 2AIQA 3DSOA 4J2YB 2JETC 3B23B 3UAIC 3FZZA 1O2KA 2BD3A 2WPDD 1W8BH 1JWTA 1AUJA 1UW7A 3D62A 3EQ0H 1RIWC 3QUMP 1QRWA 2XRCA 1SGQE 3SUGA 2RG3A 2ZG0H 4X1RU 5DP5A 5DG6A 1ELEE 1UMAH 2P94A 1SGYE 3VB5A 4E05H 1NRSH 1UVUH 5TCCA 2P3UB 2TGPZ 1TX6A 5F8ZA 2Z7FE 4O9VA 1CO7E 3D65E 2ZU1A 1OP2A 3IWMA 3TLOA 2KR7A 4ASHA 4NSVA 5IDKA 1J15A 3LGWA 1UTOA 3FP6E 1N8OC 1P3EA 2W7SA 3LIWA 1UK3A 1GJ8B 1TAWA 1P2IA 1AU8A 5A0AE 1AN1E 3NUMA 1LMWB 3KN2A 3OEHD 2XWBI 3C27B 3TH3H 5EIYA 1EKBB 1QB1A 3SI3H 1BIOA 3FOAA 4OS5A 1SL3A 4WXIA 1KIGH 3MH5A 1O2OA 4XOJA 3U9AH 2OTVA 3OYPA 1ZMJA 1FDPA 1KMHB 3HKIB 4ISHH 2FOMB 3CNRA 5GCHG 2WUCA 1DSTA 1WQVH 2KCPA 1GG6B 3M7QA 2BLVA 1F0TA 1IQLA 1O2PA 1SFQB 1TB6H 3SHAH 3SORA 1CQQA 1UK4A 1HUTH 3ZVBA 2GCHG 1P10A 4OM9A 1T8NA 3RXAA 2BDAA 1A5HA 3S9AA 1A46H 3SUEA 1T8OA 1P2MA 1AFQC 4AFSA 5T6FA 1ZOMA 3KYGA 1GJ5H 5EXNA 1QY6A 1ZRKA 5DP6A 4FUCA 2GDEH 3LGUA 1S82A 1RS0A 4NZLA 1VGCC 3LONA 3MU5A 7GCHF 1CA8B 3SJIA 1GI0A 1NRNH 2A2XH 2ZCLP 1YPGH 1DLEA 5F8XA 1V2WT 4UD9H 2KZ4A 2F91A 3GY3A 1K0HA 1EJNA 3QN7A 4Y8XA 2Z9GA 1CGIE 1HGTH 1TQ7B 1TONA 2RFKC 4UFDH 1E1QD 4JK5A 2CN0H 1IQNA 1BZXE 1BTWA 4Y76A 1DWCH 3FZDA 2ODYB 3Q3YA 2ZHDA 6GCHG 2PW8H 1KLIH 1ETTH 2VB0A 1GI3A 4Y10E 3OY5U 5GWZA 2W6ID 5AF9H 2ANMH 2ANYA 1WU1A 1UCYE 4XBCA 1O3GA 3ELAH 4ISOA 1AKSA 1MCVA 1FZZA 1NTPA 1C5SA 4O03A 5EODA 3Q3XA 4I86A 7ESTE 1GBDA 1EB1H 4FUFA 1UJ1A 1PPGE 1LVMA 5AFZH 1TWXB 1Z6JH 2J97A 1O3CA 4NZQA 5FXLA 3T29A 3PV4A 1O33A 1YLCA 3HGPA 4AGKA 1J16A 2V35A 1K1NA 4YESB 1LKAA 1O35A 4AYYB 1GBAA 3PMBB 1G32B 1LTOA 4XFQA 3R3GB 3DCLA 4CH2B 2KCOA 1FY4A 2BD7A 1AVXA 2UWPA 2OINA 1TX8A 1O3LA 1SGPE 3A8BA 1P9UA 4HFPB 3QX5H 3KQCA 2ALPA 1KYNA 1NRRH 5GJ4B 3U1IB 1QR3E 8ESTE 4GCHG 4FUJA 3P8NA 1ZSJA 2BZAA 1W0ZU 2FI4E 3SV7A 1RGQA 4IS5A 3TGJE 1TBZH 3A8DA 1WDIA 3KYFA 2AEIH 3OEED 3PTNA 1RTLA 4AYVB 4KKDA 3VXEH 2BOHB 2KCYA 2WPHS 1QJ6B 3TPIZ 4X6MA 2HNTC 2BMGB 3PLPA 1F7ZA 2PUXB 3GCHC 3MMGA 1FAKH 1UCYH 1AI8H 3DFJA 3EE7A 1O2MA 4M7GA 4XE4A 1MH0A 5EGMA 1QRXA 1LHEH 1MAXA 5KGOA 3F9HA 1WCZA 3M7TA 2FI5E 1IQMA 2FODA 4Y79A 3GOVB 1PQ8A 2Z6BD 1SBWA 2XOKD 3UR6A 1YC0A 1GBIA 1HXEH 1E35B 1O0DH 3ZYDA 1ELTA 1YKTA 1H9HE 3AW0A 1CT0E 3SU6A 1EASA 1BMLA 1OP0A 2ZZUH 2A7JA 4Z1MD 1AKSB 3AAVA 3RXUA 2KM0A 5IYTA 3ZZCA 2M2AA 3BEIB 1JIMA 2PTNA 2QF0A 5EJZA 1BTYA 1PPBH 1ZHRA 1T31A 4IC5A 4ZKSU 1VITH 3TGIE 1AFEH 3GCOA 4WF8A 4A1TA 4JYVH 1XUGA 2LNCA 2CHAC 2O8LA 1THPB 1O2UA 4LZ4B 4DURA 2QXIA 1CE5A 5F6MA 2A0QB 4RKOB 1ELVA 1D9IA 1L0ZA 4DIIH 1GMHG 3U8OH 3FO8D 2CK3D 2EC9H 4HZHA 4X1PU 4U32A 2GZ8A 2A31A 5JBTA 3PROA 1MKWH 3JZ1B 1O5BB 4X8VH 2A2QH 1KDQB 2ZU4A 1BRUP 3BN9A 1GHAF 3RM2H 3B9FH 4Y7AA 4X2XA 1C4V2 4Q2KA 1FY8E 1O37A 2GCTB 4YTAA 1TNIA 5L2ZH 1TQ0B 2GKVE 1FMGA 1C1VH 1J8AA 1D6RA 3UY9A 1LHDH 3NCLA 1ZTLA 2B5TB 1LO6A 1MTNB 3U8TH 3SOSA 3GYLB 1M9UA 4DW2U 3Q3KA 4Y0YE 1O5GH 5JDUB 4ZXYH 3HK6B 3LJOA 4KELA 4FETA 4YXWD 3MYWA 2PKAB 2SGQE 1YGCH 3TIUA 3RXIA 1S0RA 5JBCS 2QV1A 2ALVA 2A5IA 1EJMA 1GJBB 1JXPA 2J92A 2BD5A 2BXUH 2BD4A 3I77A 3F9EA 5JPMH 2K0QA 1O5FH 3BTWE 3PRDA 4CBOA 1S84A 2FESH 1BTHH 1W0KD 2ILNA 1AIXH 4DVAU 5A8YA 4BAMB 5C0UA 2O9QA 2W7UA 3NZIA 2AYWA 1C5NH 4ZH8A 2OCVB 3DT0H 4GLYA 1GHXH 3BTFE 1TGBA 1KLJH 1D3QB 1GL0E 1ZSLA 1Y3UA 2H6MA 1IHTH 1JMOH 3RXGA 2PWXA 2QAAA 2TGDA 1O3BA 3AK5A 1GMDG 3SNCA 3DD2H 4ZROA 5C5OA 3PRBA 3SUFA 3ZZ6A 1TBRH 4NGAH 2D8WA 2LP6A 4ZHMU 3RLWH 3N99A 1OS8A 5DJ7A 2PKSB 1UO6A 3MHWU 4YOGA 2PTCE 3RU4D 3STIA 1GI7B 1O5DH 1DLKB 3QTVH 1C5PA 1S85A 3E0NB 3ZZDA 1O30A 1RXPA 3MO3A 4K60A 5SGAE 1O2ZA 1AUTC 3F68H 2HNTF 4K2YA 4OGXA 1W12U 2ZDAH 4I32A 4JK6A 5E2OA 3LKWA 5EQRA 4JYTA 1P2KA 1HAYB 2ANWA 1ABJH 1QHRB 3TNTA 4YT7H 1SHHB 1K22H 2BLQA 3PV5A 1LDTT 3ODFA 1TE0A 3LPRA 2F9VA 1VJ9U 5CMXH 3LH3A 5H4IB 3TU7H 1GL1A 1A0JA 2J98A 3E3TA 3L3TA 5L30H 5TJXA 1C2HA 1EZXC 1ID5H 1Y3XA 1TYNA 2ZDKA 4Q80A 4XBDA 2F4LA 1AQ7A 1O2TA 1XVOA 4HI3A 1O2WA 3SW2B 1NBME 1QQ4A 4FVDA 1LQDB 1COWD 2ZKSA 3N7EA 4FU7A 3UIRA 3ATLA 4BAKB 1DOJA 1NZQH 3RXOA 3QK1A 1C5OH 1EOJA 2HPQH 1K1OA 1CHOF 2VIQA 3GCTF 3UTUH 1HAVA 6CHAB 1ETRH 2BXTH 3F2GA 3L33A 1LHCH 3SU3A 1H9LB 1DFPA 1TMTH 4BXSA 3FVFB 1WXRA 3NK8A 2O8WA 1HV7A 1DY8A 1HXFH 1V2RT 2QGRA 1ZPZA 1W10U 1E79D 2Y5GA 1LCYA 2GX4A 1ESBA 3QTOH 3T28A 3T5FH 4UFFH 1ESAA 1F5RA 3D23A 1DWDH 5FL7D 2ZU2A 5EJ1A 3TK5A 1CBWC 4B6FA 2Y5HA 1C5LH 1B7XB 1AZZA 1EZUC 1GBMA 1WV7H 1CA0B 2XCNA 3MOCA 4A1VA 1C2MA 1SFIA 1FIWA 2RDLA 4ACBA 2VVUA 3TJUA 1OYQA 2W5EA 4AORA 2CGAA 1TPOA 1K2I1 1GJDB 2FLRH 2Q6GA 3Q77A 5CDFE 2R0KA 1V6DA 2YMSB 3P6ZB 4UDWH 5FAHA 3A7YA 3WW7A 1PQ5A 3RXJA 3UREA 1O2VA 2Y80A 4SGAE 2DE9A 4ZMAH 3PO1B 2ZEBA 2A5KA 3VB7A 4B1TA 1TBQH 3TH2H 4NFEA 4B74A 3SQHE 3B8JA 1UK2A 1ZHMA 4D7FA 3S0NA 2J4IA 3PLKA 3RMMH 4CHAC 5HKKD 1YLNA 4AFQA 4WMFA 1IQIA 1O5CB 2ZQ2A 4K1SA 1V2ST 2BQ6B 1LQEA 2VIWA 5CHAB 3MTYA 4LK4A 1TRNA 1UHBB 1SLXB 3A7WA 3P8OA 2QXJA 2FX6A 4B6EA 1OWEA 2P16A 1SOTA 2ZFRH 1O3JA 1UTLM 4FXGH 5EW2H 1IHSH 1SGDE 1DXPA 2FOEA 3DSGA 5EU8A 1VKYA 1ZR0A 3W94A 5C2ZA 1DUAA 1Q31A 1BQYA 2P3TB 1HAVB 2P95A 1K1MA 1GBTA 1DDJA 2PV9B 3NXPA 1ELFA 1BRCE 1C1QA 1UVSH 2FOHA 1GWAA 5A0CA 3ZZ3A 2ZFTA 1V2LT 2GMTB 3BTQE 1TLDA 3EYDA 3R0FA 1GMCG 1A61H 4Q7YA 5DP4A 4IMQA 3OFND 2Z9JA 5GCHF 3RC5A 3U1JB 1UVPA 2OQUA 4MLFB 4OGYA 2AGGX 4Z0KA 4B2CA 3KQEA 1CU1A 1ZJDA 4YOJA 1GHYH 3T26A 3FKSD 4I8JA 1DWEH 1GHBG 1JRSA 2GCHF 2XW9A 4X0WU 1QA0A 4OS6A 3VB4A 2IN2A 4NCYA 4R8TB 1YCPK 1TX7A 2BVRH 5DP8A 2AERH 4IW4E 3A8CA 5KEDA 4B71A 1GBKA 1V2NT 1C5VA 2G51A 3A89A 1TPAE 1WTHD 4FUDA 5I46H 1NFYA 2Q6DA 3VG8A 5LH8A 1YPMH 1ELDE 1WBGB 2FO9A 4WJG2 2W26A 4NSYA 4JZ1A 3UNRA 3H7TA 3MQKC 2UUJB 3MU8A 5GXPA 4KGAA 2A7HA 2ZFQH 1P05A 2VWNA 1TABE 1BBRK 2XBVA 4XSKU 1C1SA 4RT0A 4TWYA 4H6SB 1YWUA 4K1TA 4IMZA 1IOEA 2LPRA 3ZIAD 5EPNA 1BDAA 3PLBA 5DP9A 5A8ZA 2YNBA 2PSXA 2ZTXA 2ZNKH 5EXMA 1O3EA 4U30A 2D1JA 4MTBA 1AE5A 1HNEE 2QC2A 2EI6A 1N6XA 3TJNA 5C67A 1B0FA 1J17T 3LT3A 5F53A 1JIRA 2VVCA 6GCHF 1S6LA 1SGIB 1WYKA 1TGSZ 4I8HA 4X1SU 3S9BA 3GY8A 2BM2A 3KCGH 3UOPA 1SB1H 2VBCA 2XBYA 1FV9A 2XYAA 1ELCA 3LGTA 2XCFA 3PTBA 4UFGH 3UOUA 2FX4A 3MH4A 1FIZA 3RXHA 3CENA 3OSYA 2ZHQH 2JDID 2Q6FA 2JETB 3V12A 1O3NA 1MKXK 2QXGA 3FFGA 5K0HA 5HGGA 1RIWB 1SVPA 2G5NA 1KXCA 2KAIB 2G52A 2A32A 4M9FA 1NRQH 4GAWA 1TA2A 3KQ5A 1OWHA 4WH8A 1BOQA 3CS7A 3PWCA 1ZYOA 1RD3B 2P93A 1O2GH 1UTNA 1S5SA 5EQSA 3SV8A 2H9EH 3TNSA 2A5AA 2OC0A 2TBSA 3SO3A 2H2ZA 4ABIA 4X8UH 3BEUA 1N8OB 3VEQB 4WY3A 1GI4A 3QGNB 2RA3A 5DP7A 3UB0A 2BD8A 3ZVEA 5HXFA 4ABGA 3SV6A 3QZRA 2ULLA 3MNSA 3TJVA 2SFAA 2ZTYA 4GCHF 1KSNA 3KF2A 2BDCA 1C2FA 3GY6A 3PM3A 1P2OA 1C2EA 4AG2A 3ATWA 5F03A 1T4UH 3I78A 4ZKOU 2GZ9A 2L74A 1ZJKA 2XNDD 1QGFA 1GHWH 1DVAH 1XXFA 4Y8ZA 2SGFE 1HAOH 4Q7ZA 1NU7B 2OXSA 2ZHEH 1DICA 3BTDE 3SU2A 5C17A 1TALA 2B9LA 4H4FA 5T1VA 3EA7A 3U8RH 1DE7H 1VJAU 3UQOA 1SGFG 1T4VH 5E0HA 4OS1A 2H5CA 1P3CA 4E7NA 2HLDD 2W3KA 1TMUH 1OWDA 2H9TH 2WSSD 5EG4A 1AFQB 4I7YH 1GGDC 3LGYA 1K1PA 3MO6A 2IJD1 4NWKA 3SGQE 3RXDA 1T8MA 3W1EA 3F2FA 2VJ1A 1F5LA 2FS9A 1VGCB 3F6UH 1Z8GA 3M36A 1G3DA 3VB3A 5B6OA 3RXTA 4UE7H 4AZ2B 3DFLA 2DE8A 4K3JA 1FLEE 1F0SA 3ZVCA 1TPPA 1SKYE 2FZZA 1NN6A 2FOGA 1EP5A 4YT6H 2O8TA 4ZHAA 3UR9A 3PMHB 4CRFA 4QT8C 8LPRA 3VGCC 2ESTE 1G36A 2C8ZB 3FN8A 4MG3A 5DKMA 2M5TA 5A2MH 3BTEE 4U2WA 2VIDA 2Z3CA 1UVTH 4RSPA 2Z94A 5ESTE 1HB0B 1MMJN 1PPCE 1DX5M 1GMHF 2AHME 3ZZ5A 8GCHG 2QY0B 2ZPSA 4A92A 5EXLA 2JH6D 3WWFA 2BX3A 2VNTA 4UEHH 3KGPA 3HPTB 1D3TB 1EZSC 3A80A 3OX7U 1ZRBA 4NWLA 2IPQX 3PYHA 3SGBE 1W7XH 1OWKA 3SV9A 1CGHA 3STJA 2R3YA 4ABFA 3VFEA 4JMYA 1C5XB 3F9FA 4X1NU 4SGBE 3FP7E 1GI8B 1EPTA 1NBMD 1MD8A 4K5ZA 1TGTA 4H42U 2A45B 3SYJA 3UUZA 4BTTB 5ABWA 2XC4A 1LKBA 2Y7ZA 1DT2A 2EI8A 2SGEE 4D7GA 9LPRA 3O8DA 1NROH 5C1UA 2AIPA 1OWIA 1C9PA 3A8AA 2NU1E 1UVOA 3W95A 1KTSB 2NU0E 3BEFB 5C1YA 1FY5A 1QFKH 2ZPQA 3O8CA 1SHYA 1NESE 2ZTZA 1GVZA 1YCPM 4TPYA 2BB4A 3HK3B 3M5NA 4CRDA 4ABBA 4JZFH 1BB0B 1SI5H 2FS8A 2F9BH 2ZI2H 4MPXA 3FAOA 3HKJB 1BMAA 3LH1A 1MAYA 2QF5A 1ANCA 1V2VT 1B5GH 1GDUA 4ISIH 3SU5A 3GCNA 2RA0A 2ZWLH 4E7RG 2J9NA 4BAHB 2HWLB 1P0SH 1GMDF 2AFQB 4IC6A 4FU9A 3GCHB 4ABJA 5DO4H 1Y59T 2BY5X 1FY3A 1Y3YA 4ABAA 2OD3B 1ZGIA 1EPTC 1PPEE 3RXMA 3ZYEA 2BYAX 1C1RA 3SV2H 3TK6A 2XBXA 1KXBA 2BQWB 2BDIA 1GDNA 4XBBA 4MPUA 1C5RA 4YLQH 1WSSH 3LDXH 2G81E 3UNQA 3K6YA 4F48B 3KEEA 3RXEA 1HJAC 1ELBA 3P8GA 3SJOA 4AFUA 2GJGA 1J9CH 1NC6A 2C8WB 2WPJS 4NIWA 1XKAC 3OU0A 1QZ8A 3P95A 4AGJA 2GD4B 3FANA 1F0UA 2WUBA 1GDQA 1HBTH 3WWBA 2BDBA 3RU4T 1JRTA 1GCTC 2TGTA 3GY2A 4FUEA 1H1BA 3IG6B 4FU8A 1FN6A 1RTFB 3ZVDA 1F0RA 3BG4C 5HIYA 1WUNH 1MU6B 4X6PA 4UONA 1L4DA 1SSXA 4BXWA 5G4BA 3A84A 2CHAB 1ESTA 2BY9X 2P8OC 2PGBB 5GDSH 3GY4A 1YPHC 1VCPA 5C1XA 2EQNA 1HAHH 2HNTE 1F92A 4B2BA 3E6PH 2XNIA 2OUAA 1V2UT 1NT1A 2G5VA 1ZGVA 1BTUA 1EP6A 1P2NA 2HRVA 2Z3EA 2YMSD 4HTCH 5EJLA 4BTUB 3G01A 1L1JA 3MU1A 3E8LA 1O3AA 1EQ9A 2BDYA 2YOLA 1TNLA 3OY6U 1ZPBA 2JKHA 1XX9A 2ZHFH 3A88A 1EAXA 1FPCH 1G37A 1HJ8A 5FCRA 1OHHD 3KIDU 1GJCB 1AGJA 1P06A 1SLVB 1ZTJA 3M5LA 5AVDA 1SGEE 3E16B 2BY7X 3QGJA 4WMDA 1KXDA 3EA9A 5L6NH 1XXDA 4NA9H 1ZPCA 4TY6A 1P2JA 4NIVA 1TNKA 3RP2A 1C2IA 1C1MA 4ZXXH 1E37B 3FP8E 3KL6A 1BTZA 3LGIA 4GPGA 1FQ3A 3SU0A 1O2RA 3ATMA 2FI3E 3V13A 2RCEA 3MU0A 3OAAD 1YPKH 1AHTH 2C93B 1LHFH 1RTKA 3M7UA 2KX4A 2ODPA 3MU4A 4A1XA 1VITG 3ATKA 4TSFD 2H9HA 1QL8A 2BDGA 2HVYB 2VWLA 3A7TA 2VWMA 3T25A 1E36B 3ATIA 3OE7D 2VU8E 1QQUA 2I6QA 5FPSA 2PR3A 2OBQA 1O2XA 1O5EH 1N1LA 1N6YA 2BTCE 4BAOB 4VGCC 1MZDA 1OXGA 2PFEA 1D6WA 1MKXH 3SJKA 2PGQB 3Q76A 3DA9B 4PROA 1P2QA 2OC7A 3AASA 1ZLRA 4KTCA 1OPHB 3RMLH 1EAWA 1GJ6A 1BHXF 4NG9H 4A5TS 1Z71A 3CS0A 1PPZA 2ZA5A 2ZDNA 1YPHE 1NU9A 1NO9H 1BITA 1L2EA 3A7XA 4GVUA 4I33A 1QBNA 1QBVH 1P02A 4ABEA 3BG8A 4K8YA 1G3BA 1HLTH 1SR5C 2VWOA 1H8HD 5A09A 1L1NA 2ZFFH 1E38B 2VIVA 3A81A 1ZMNA 5GNDA 1G3CA 4U01A 3SHCH 1O39A 3S9CA 2BQ7B 4AFZA 1KTTB 2GP9B 4B76A 2GVFA 3A83A 1O2YA 4Y7BA 1O2IA 1SQTA 4K8BA 1U6QA 1YPLH 4X6OA 2NU2E 1GCDA 1AB9C 4RKJB 1TPSA 1K21H 1QL9A 3KQBA 1HRTH 1HCGA 4IBLH 3A85A 4Y8YA 4K1EA 1GMCF 2O8UA 1C5WB 1TIOA 1EOLA 2TIOA 2OLGA 3IITA 1ARCA 2FLBH 1HIAA 4ISNA 3PWBA 1C1PA 4FOUC 1SGCA 3P8FA 2VH6A 1GBJA 1GHBF 1JOUB 4INLA 4Y11E 2ZGBH 3RXLA 2A7CA 1P57B 2J95A 1CT2E 3RXSA 1AB9B 2FM2A 1UCYK 1TNJA 1GVKB 1EZQA 4NIXA 5LGOA 3RMNH 2C8XB 3RM0H 1C4Y2 5E0GA 1MZAA 1QBOA 1O2NA 3M5MA 1VZQH 1SGNE 5GIBA 2V7QD 2XWAA 4ZCNA 2R2MB 3RC6A 4ZUHA 1LPZB 1J14A 2ZO3H 1F2SE 1UTKA 2ZF0H 1G30B 2J98B 2JJ1D 3K2UA 5BRRE 4MNXA 1GBEA 4DY7B 1CBWB 1C2JA 3GISB 1NRPH 2G4TA 4INHA 1TOCB 1Y3VA 1CGJE 5C94A 5HM9A 2FYQA 2K8IA 1S6HA 2V3HH 2BZ6H 1GI6A 1SQRA 1X7AC 1DY9A 1BMMH 2FOCA 1K1IA 1Y5UT 1LPKB 5PTPA 2BD9A 3N7OA 3TVJB 2V3MA 1W14U 1C5TA 3MFJA 1FY1A 4IN1A 2WPKS 1TNHA 4AX9H 1IQFA 4F49A 2FDAA 2F3CE 3UWIA 3BIUH 2WV5A 3LU9B 1BMFD 1P03A 5FX5A 5FX6A 3O8BA 4CHAB 3NWUA 2ZCHP 3PV2A 2UUYA 5TCAA 2QIQA 4D8NA 1V2JT 3ITIA 3SUDA 1C1TA 5JYIA 2ZPRA 4TWWA 1V2MT 3F3BA 3N7DA 1NPMA 3URCA 1MKWK 4ZAEA 2VGCC 1O3OA 1IAUA 2XTTB 3SJ8A 1V2TT 2HPPH 3E91A 1O36A 5HYOA 3RMOH 1PFXC 3BTGE 1BMNH 5FCKA 2WPIS 3MNBA 2STAE 3BTHE 2Q1JA 2VINA 2B8OH 3UQVA 1DANH 3DUXH 2BX4A 1W11U 3RXQA 3TJOA 1D3DB 1AVWA 1Z6EA 4Q63A 2OC8A 1C1WH 1CSOE 4CREA 2WINI 4TY7A 3NKKA 4HGCA 1H8ED 1FONA 1C9TA 2VH0A 2ZQ1A 3QO6A 4GHTA 3ZZ4A 4Q7XA 3V7TA 2TRMA 1C1NA 1GI2A 1O3FA 1S6FA 1ZMLA 1XUIA 1MTWA 5DN6D 2F9NA 5E0JA 1YLDA 2EI7A 1W13U 2YNAA 3RXBA 4XDEA 1WOFA 2DUCA 3JZ2B 3SNEA 1MCTA 4MQAA 3U69H 1MU8B 1BA8B 2EA3A 5AHGH 1PJPA 3GY5A 3SU4A 3EAJA 1HAXB 2HLCA 5C20A 3ZZ8A 1GJ7B 1Z8IB 4YLUA 2GV6A 5JB8S 1WTGH 3RXVA 3UPEA 4NA8A 2O8MA 4O3UA 2GV7A 1MD7A 3BTKE 1YYY1 3LOXA 3K9XB 1MTUA 1A4WH 2TGAA 4FVBA 4I8KA 4DG4A 1KXEA 1QA7A 4X8SH 1IQEA 2A4RA 2ZECA 2F43B 2FMJA 1HAPH 2ZU5A 4D9RA 3BSQA 1UTPA 4XRNA 1A5IA 1H8IH 3UNSA 5A0BA 1GG6C 3RUOA 3D49H 1TOMH 3ZV9A 3MO9A 2Y82A 4CBNA 5EW1H 1A3EH 1P01A 1XUFA 5IK2D 3S7HB 1BUIA 2QCYA 1T7CA 1G9IE 1W0JD 1XM1A 3E90B 2A1DB 2LELA 2GTBA 1DXWA 1H4WA 3F0OA 1YPJH 3GYMA 8GCHF 1FPHH 2TPIZ 2ASUB 1DM4B 3SZNA 1OSSA 5FPTA 3SZEA 1VCQA 3BF6H 1O2HA 1AMHA 1HAZB 2NU3E 1IQHA 1E1RD 1QIXB 2OQ5A 4LOYH 3TH4H 4B75A 3TGKE 1ELAA 1L4ZA 2B7DH 2ANKH 1H8DH 5E8EH 1PYTC 3U28C 1P8VC 4D76A 4BAQB 4JZDH 5L2YH 1NFUA 1FAXA 3F9GA 2ZDMA 1SG8B 1TRMA 1OP8A 2FXRA 4A6LA 3UWJH 1QJ7B 1UTMA 2PHBA 1XUJA 5HMAA 4MDSA 3ZVFA 1GBBA 2BY6X 2PSYA 1ANBA 2BVSH 3E0PB 4AB9A 1MBMA 1FXYA 1Z8RA 5HM2A 4CR9A 5ESBA 3SQEE 1LHGH 3EGKH 3V0XA 5C5NA 4AB8A 4OS2A 4I31A 3MH7A 4CRAA 2BOKA 3ZV8A 1EUFA 5LPEA 1HJ9A 1ETSH 1ZZZA 2D26C 3KHVA 1LVBA 3KQDA 2PLXA 1P12E 1MTSA 3DSPA 7KMEH 1LVOA 4I8GA 2P59A 2ZFSA 1V2KT 1TFXA 1Y8TA 2A4GA 1THRH 4KTUA 5DP3A 3ENSB 1PPFE 2PUQH 3S69A 1SLWB 2Y81A 4JZIA 3GY7A 1THSH 2L6OA 1OX1A 2G4UA 1GGDB 1ABIH 1QRZA 1C5YB 5CE1A 1ACBE 1CT4E 1XUKA 1A3BH 1QJ1B 1EB2A 3PMJA 2AMPA 1IQJA 3NRLA 4THNH 3RC4A 3ZZ7A 4BTIB 1A5GH 2J34A 1O3IA 3M3VA 3BTME 4AC9A 4MNVA 1BTPA 5HIZA 3RXCA 1BTXA 1Q2WA 3GDSA 2CF9H 2FIRH 1O3KA 4CRBA 5FPYA 3GDVA 1PPHE 1GBCA 3Q00A 2P3FH 3VGCB 2ZIQH 4DIHH 3M3SA 1QCPA 3K65B 2FOFA 4ISLA 1C2DA 3TK9A 1F5KU 1NFWA 4HG6A 2ZHWH 3OTJE 4TT3D 1SGTA 2FEQH 1ELGA 1UTJA 3MH6A 1FI8A 2VIPA 4OS7A 2CMYA 5FBIA 1KDQA 1AVGH 1YY3A 5ETXA 1O31A 4Y71A 4B73A 5A8XA 1MQ6A 3GS9A 3L6PA 4WXVA
chains in the Genus database with same CATH topology
3QZQA 1C1OA 4ZKRU 3E1XB 4FUHA 1G2LA 4ABHA 7GCHG 1INCA 2XC5A 4X2WA 4IN2A 4MPWA 3SNDA 1O38A 1C2GA 1AZ8A 1DWBH 1EATA 2GT7A 1VR1H 1TRYA 3ZZBA 6ESTA 2HGTH 1QL7A 1O3PB 2IOTA 1G3EA 1HAGE 4Y6DA 2PKAA 4B2AA 2BLOA 2V6NA 3BV9B 1V2PT 2ZGXH 2FWWA 1W7GH 4MPVA 2R2WU 3DHKH 1GHVH 2Z9KA 1W0YH 3BIVH 3A7VA 1GJ4H 1BRBE 5I25A 4ZKNU 5FHTA 1O2LA 2HVXA 2A4QA 1DUEA 1BHXB 3TITA 1VITF 1YM0A 2IPHA 1P11E 1A7SA 4JZEH 3U98H 2ZGHA 2GCTC 3RXRA 2QXHA 1BBRE 2THFB 1WAYB 4E06H 4LXBH 1WQSA 3ESTA 1QTFA 2C4FH 4F4OC 1MTNC 3M3TA 1P04A 1K1LA 1AO5A 1EPTB 2B0FA 1OOKB 2OP9A 5T6DA 3T62A 4I8LA 3SNBA 1C1UH 1T8LA 5BPEA 2AH4X 5E2PA 3M5OA 4WWYA 3RXPA 3SJ9A 1HJAB 2SGPE 4ESTE 1CHGA 5J4QA 2I6SA 4R0IA 3M35A 2SGAA 3MI4A 2ZGJA 4AN7A 1PQ7A 2C90B 1E0FD 5EOKA 4DT7B 2W3IA 5JBBS 1FN8A 2QYIA 2ZC9H 1RFNA 3A86A 3GDUA 4AG1A 1TGCA 2ZCKP 4IGDA 1YCPH 3C1KA 1GCTB 4RN6A 1DS2E 4INKA 3P92A 3RLYH 2AS9A 3ODDA 2R3UA 1HAIH 3AAUA 3BG4B 2JH0D 4FUGA 2WPLS 3UFAA 4BOHA 5DK1A 2J94A 2D2DA 1Z1JA 1YP9A 3PB1E 2P8OB 1OYTH 1KXAA 3SGAE 1A0LA 2PKSC 4JYUH 2R0LA 1EAUA 1O3HA 1BBRH 1AD8H 5J4SA 1HPGA 3SI4H 1Y5AT 3ZVGA 1TNGA 1XUHA 2Z3DA 5F8TA 1EXFA 2ZDVH 1Q3XA 1AE8H 1IQKA 1NY22 2F9UA 3MWIU 2FTLE 1NFXA 1GI1A 1K9OE 3SU1A 1P9SA 1T32A 1BJUA 2FPZA 2GDDA 1B0EA 4CR5A 1O32A 1IQGA 1FJSA 2UWLA 4A7IB 4Z6AH 4CRCA 1MTVA 3SBKA 1XVMA 4CRGA 4KP0A 4NIYA 5EPYA 4DOQA 4DCDA 1SGRE 2K1QA 4JCNA 2EEKA 3K6ZA 1DITH 1SGFA 3F1SB 2Y7XA 1SLUB 1GBFA 1W2KH 1SC8U 2ZDLA 3A82A 4Y0ZE 6LPRA 1QURH 3AW1A 2CF8H 1MQ5A 2HALA 1ORFA 4YOIA 3WY8A 1KLTA 3SNAA 3ZZAA 2AGEX 2G8TA 1GHZA 3EA8A 4TPIZ 2BDHA 1UTQA 2BHGA 5C3NA 8KME2 2R9PA 4O97A 2BLWA 4GUXA 3RDZA 2V0BA 2V3OH 3H7OA 4LZ1H 5FBEA 4BANB 1GPZA 2JH5D 1QB9A 1GHAG 2J38A 7LPRA 1MUEB 1OKXA 2WPMS 2BD2A 1GJAB 1S81A 3LC3A 1ARBA 3HGNA 2GGVB 4WMEA 1SPJA 4YM9A 5LPFA 6CHAC 2F83A 1KXFA 1C5ZB 1S83A 2UWOA 4VGCB 2CV3A 4TYDA 1H9IE 3RXKA 1ZSKA 1NS3A 1YF4A 1FUJA 3MNXA 4UFEH 4DGJA 1O2QA 1UHBA 1V2QT 2F9PA 1GI5A 1ZHPA 1V2OT 1GVLA 3I29A 2G00A 1ANEA 1Z8JB 2GT8A 4X1QU 4X6NA 3SN8A 1DSUA 1HYLA 2WYJA 1BT7A 4D9QA 2STBE 4WVPE 1CA0C 3LGVA 2AMQA 4NFFA 2NU4E 4YO9A 1VCWA 5EQQA 2ZFPH 3HATH 3S7KB 3VXFH 1K28D 5AFYH 2GZ7A 1C5QA 2OBOA 2ZP0H 1HDTH 1TA6A 4FUBA 2F9OA 5JBAS 3QLPH 1YPEH 2WYGA 3PO1C 1LVYA 3EDXB 1C4U2 2QA9E 1PQAA 2H5DA 3QDZB 1O3MA 4NA7A 4DJZB 1D3PB 4AOQA 1AWFH 1D4PB 1G2MA 3BTTE 4X2YA 5GPIB 1O5AB 2G55A 2OC1A 2XC0A 5T3HA 5CHAC 1LPGB 3P70B 4GHQA 2QN5T 1JBUH 3M37A 4ZHLU 1BJVA 9ESTA 1L1GA 4GSOA 3MNCA 4O3TA 3URDA 1C2KA 3GICB 2WV4A 3ZVAA 1XKBC 1CVWH 1AWHB 1ANDA 1Y3WA 2ZU3A 2VIOA 4MNYA 4KTSA 4FUIA 3EE0B 2XBWA 1TMBH 1BRAA 2SNVA 2Z9IA 1ZTKA 4K69A 4WH6A 1O2SA 1SQAA 2AGIX 1C5UA 1C5MD 3LC5A 1RJXB 2GMTC 3A7ZA 2IJOB 2Y5FA 2BVXH 4YZUA 5T6GA 1FNIA 2Y6TA 2SNWA 2H1UA 3A87A 1SMFE 1GBLA 2Z9LA 2NWNA 3V3MA 4X8TH 1QNJA 1A0HB 3PMAB 5DGJA 4ABDA 3NPSA 1XMNB 3QWCH 2QF3A 1BCUH 1HIAB 1PYTD 1S0QA 1Z7KA 2FP7B 2VVVA 1E34B 2ZGCA 3M61U 2A4OA 3O8RA 1OWJA 5DPAA 1SOZA 1A1RA 2BY8X 1CHOG 2C8YB 3GCTG 2C3SA 1P09A 3KNXA 1Y5BT 1GI9B 1EX3A 3RXFA 5K7RA 2KAIA 1V3XA 2UUKB 4OS4A 3LJJA 2J2UA 4J1YA 3T27A 2FYRA 1O3DA 1KY9A 1GJ9B 1A2CH 1AY6H 2FOBA 3VPKA 2CJIA 2FOAA 3P17H 3VB6A 2XXLA 1O2JA 2AMDA 1Z1IA 1C2LA 2UUFB 2VGCB 1NM6A 5JB9S 3CP7A 1K1JA 3AVZA 1EJAA 1RRKA 4CH8B 1TGNA 3ZZ9A 1DPOA 1HFDA 2SGDE 1QB6A 1SQOA 2ODQA 5LPRA 2HOBA 4MVNA 1W3CA 2CXVA 4H6TA 4BNRA 1MBQA 4X2VA 3H5CB 1O34A 1GBHA 3T2NA 2FTMA 3RU4E 4MNWA 1EAIA 1YBWA 2AIQA 4J2YB 2JETC 3B23B 3FZZA 1O2KA 2BD3A 1W8BH 1JWTA 1AUJA 3QUMP 3D62A 3EQ0H 1RIWC 1QRWA 2XRCA 1SGQE 3SUGA 2RG3A 2ZG0H 4X1RU 5DP5A 5DG6A 1ELEE 1UMAH 2P94A 1SGYE 3VB5A 4E05H 1NRSH 1UVUH 5TCCA 2P3UB 2TGPZ 1TX6A 5F8ZA 2Z7FE 4O9VA 1CO7E 3D65E 2ZU1A 1OP2A 3IWMA 3TLOA 4ASHA 4NSVA 5IDKA 1J15A 3LGWA 1UTOA 3FP6E 1N8OC 1P3EA 2W7SA 3LIWA 1UK3A 1GJ8B 1TAWA 1P2IA 1AU8A 5A0AE 1AN1E 3NUMA 1LMWB 3KN2A 2XWBI 3C27B 3TH3H 1EKBB 1QB1A 3SI3H 1BIOA 4OS5A 1SL3A 4WXIA 1KIGH 3MH5A 1O2OA 4XOJA 3U9AH 2OTVA 3OYPA 1ZMJA 1FDPA 4ISHH 3HKIB 2FOMB 5GCHG 2WUCA 1DSTA 1WQVH 1GG6B 3M7QA 2BLVA 1F0TA 1IQLA 1O2PA 1SFQB 1TB6H 3SHAH 3SORA 1CQQA 1UK4A 1HUTH 3ZVBA 2GCHG 1P10A 1T8NA 3RXAA 2BDAA 1A5HA 3S9AA 1A46H 3SUEA 1T8OA 1P2MA 1AFQC 4AFSA 5T6FA 1ZOMA 1GJ5H 5EXNA 1QY6A 1ZRKA 5DP6A 4FUCA 2GDEH 3LGUA 1S82A 1RS0A 4NZLA 1VGCC 3LONA 3MU5A 7GCHF 1CA8B 3SJIA 1GI0A 1NRNH 2A2XH 2ZCLP 1YPGH 1DLEA 5F8XA 1V2WT 4UD9H 3GY3A 2F91A 1EJNA 3QN7A 4Y8XA 2Z9GA 1CGIE 1HGTH 1TQ7B 1TONA 4UFDH 4JK5A 2CN0H 1IQNA 1BZXE 1BTWA 4Y76A 1DWCH 3FZDA 2ODYB 3Q3YA 2ZHDA 6GCHG 2PW8H 1KLIH 1ETTH 2VB0A 1GI3A 4Y10E 3OY5U 5GWZA 5AF9H 2ANMH 2ANYA 1WU1A 1UCYE 4XBCA 1O3GA 3ELAH 4ISOA 1AKSA 1MCVA 1FZZA 1NTPA 1C5SA 4O03A 5EODA 3Q3XA 7ESTE 1GBDA 1EB1H 4FUFA 1UJ1A 1PPGE 1LVMA 5AFZH 1TWXB 1Z6JH 1O3CA 4NZQA 5FXLA 3T29A 3PV4A 1O33A 1YLCA 3HGPA 4AGKA 1J16A 2V35A 1K1NA 4YESB 1LKAA 1O35A 4AYYB 1GBAA 3PMBB 1G32B 1LTOA 4XFQA 3R3GB 4CH2B 1FY4A 2BD7A 1AVXA 2UWPA 2OINA 1TX8A 1O3LA 1SGPE 3A8BA 1P9UA 4HFPB 3QX5H 3KQCA 2ALPA 1KYNA 1NRRH 5GJ4B 3U1IB 1QR3E 8ESTE 4GCHG 4FUJA 3P8NA 1ZSJA 2BZAA 1W0ZU 2FI4E 3SV7A 1RGQA 4IS5A 3TGJE 1TBZH 3A8DA 2AEIH 3PTNA 1RTLA 4AYVB 4KKDA 3VXEH 2BOHB 2WPHS 1QJ6B 3TPIZ 4X6MA 2HNTC 2BMGB 3PLPA 1F7ZA 2PUXB 3GCHC 3MMGA 1FAKH 1UCYH 1AI8H 3DFJA 1O2MA 4M7GA 4XE4A 1MH0A 5EGMA 1QRXA 1LHEH 1MAXA 3F9HA 1WCZA 3M7TA 2FI5E 1IQMA 2FODA 4Y79A 3GOVB 1PQ8A 2Z6BD 1SBWA 3UR6A 1YC0A 1GBIA 1HXEH 1E35B 1O0DH 3ZYDA 1ELTA 1YKTA 1H9HE 3AW0A 1CT0E 3SU6A 1EASA 1BMLA 1OP0A 2ZZUH 2A7JA 1AKSB 3AAVA 3RXUA 5IYTA 3ZZCA 3BEIB 1JIMA 2PTNA 2QF0A 1BTYA 1PPBH 1ZHRA 1T31A 4IC5A 4ZKSU 1VITH 3TGIE 1AFEH 3GCOA 4WF8A 4A1TA 4JYVH 1XUGA 2LNCA 2CHAC 2O8LA 1THPB 1O2UA 4LZ4B 4DURA 2QXIA 1CE5A 5F6MA 2A0QB 4RKOB 1ELVA 1D9IA 1L0ZA 4DIIH 1GMHG 3U8OH 2EC9H 4HZHA 4X1PU 4U32A 2GZ8A 2A31A 5JBTA 3PROA 1MKWH 3JZ1B 1O5BB 4X8VH 2A2QH 1KDQB 2ZU4A 1BRUP 3BN9A 1GHAF 3RM2H 3B9FH 4Y7AA 4X2XA 1C4V2 4Q2KA 1FY8E 1O37A 2GCTB 4YTAA 1TNIA 5L2ZH 1TQ0B 2GKVE 1FMGA 1C1VH 1J8AA 1D6RA 3UY9A 1LHDH 3NCLA 1ZTLA 2B5TB 1LO6A 1MTNB 3U8TH 3SOSA 3GYLB 1M9UA 4DW2U 3Q3KA 4Y0YE 1O5GH 5JDUB 4ZXYH 3HK6B 3LJOA 4KELA 3MYWA 2PKAB 2SGQE 1YGCH 3TIUA 3RXIA 1S0RA 5JBCS 2QV1A 2ALVA 2A5IA 1EJMA 1GJBB 1JXPA 2J92A 2BD5A 2BXUH 2BD4A 3I77A 3F9EA 5JPMH 3BTWE 1O5FH 4CBOA 1S84A 2FESH 1BTHH 2ILNA 5A8YA 1AIXH 4DVAU 4BAMB 2O9QA 2W7UA 3NZIA 2AYWA 1C5NH 4ZH8A 2OCVB 3DT0H 4GLYA 1GHXH 3BTFE 1TGBA 1KLJH 1D3QB 1GL0E 1ZSLA 1Y3UA 2H6MA 1IHTH 1JMOH 3RXGA 2PWXA 2QAAA 2TGDA 1O3BA 1GMDG 3SNCA 3DD2H 4ZROA 5C5OA 3SUFA 3ZZ6A 1TBRH 4NGAH 2D8WA 4ZHMU 3RLWH 1OS8A 5DJ7A 2PKSB 1UO6A 3MHWU 4YOGA 2PTCE 3RU4D 3STIA 1GI7B 1O5DH 1DLKB 3QTVH 1C5PA 1S85A 3E0NB 3ZZDA 1O30A 1RXPA 3MO3A 4K60A 5SGAE 1O2ZA 1AUTC 3F68H 2HNTF 4K2YA 4OGXA 1W12U 2ZDAH 4I32A 4JK6A 5E2OA 3LKWA 5EQRA 4JYTA 1P2KA 1HAYB 2ANWA 1ABJH 1QHRB 3TNTA 4YT7H 1SHHB 1K22H 2BLQA 1LDTT 3ODFA 1TE0A 3LPRA 2F9VA 1VJ9U 5CMXH 3LH3A 5H4IB 3TU7H 1GL1A 1A0JA 3E3TA 3L3TA 5L30H 5TJXA 1C2HA 1EZXC 1ID5H 1Y3XA 1TYNA 2ZDKA 4Q80A 4XBDA 1AQ7A 1O2TA 1XVOA 4HI3A 1O2WA 3SW2B 1QQ4A 4FVDA 1LQDB 2ZKSA 4FU7A 3UIRA 3ATLA 4BAKB 1DOJA 1NZQH 3RXOA 3QK1A 1C5OH 1EOJA 2HPQH 1K1OA 1CHOF 2VIQA 3GCTF 3UTUH 1HAVA 6CHAB 1ETRH 2BXTH 3L33A 1LHCH 3SU3A 1H9LB 1DFPA 1TMTH 4BXSA 3FVFB 3NK8A 2O8WA 1HV7A 1DY8A 1HXFH 1V2RT 2QGRA 1ZPZA 1W10U 2Y5GA 1LCYA 2GX4A 1ESBA 3QTOH 3T28A 3T5FH 4UFFH 1ESAA 1F5RA 3D23A 1DWDH 2ZU2A 3TK5A 1CBWC 2Y5HA 1C5LH 1B7XB 1AZZA 1EZUC 1GBMA 1WV7H 1CA0B 2XCNA 3MOCA 4A1VA 1C2MA 1SFIA 1FIWA 2RDLA 2VVUA 3TJUA 1OYQA 2W5EA 4AORA 2CGAA 1TPOA 1K2I1 1GJDB 2FLRH 2Q6GA 3Q77A 2R0KA 1V6DA 3P6ZB 4UDWH 5FAHA 3A7YA 1PQ5A 3RXJA 3UREA 1O2VA 2Y80A 4SGAE 2DE9A 4ZMAH 3PO1B 2ZEBA 2A5KA 3VB7A 4B1TA 1TBQH 3TH2H 4NFEA 4B74A 3SQHE 3B8JA 1UK2A 1ZHMA 4D7FA 3S0NA 2J4IA 3PLKA 3RMMH 4CHAC 4AFQA 4WMFA 1IQIA 1O5CB 2ZQ2A 4K1SA 1V2ST 2BQ6B 1LQEA 2VIWA 5CHAB 3MTYA 4LK4A 1TRNA 1UHBB 1SLXB 3A7WA 3P8OA 2QXJA 2FX6A 1OWEA 2P16A 1SOTA 2ZFRH 1O3JA 1UTLM 4FXGH 5EW2H 1IHSH 1SGDE 1DXPA 2FOEA 5EU8A 1ZR0A 3W94A 5C2ZA 1DUAA