1A0JA

Crystal structure of a non-psychrophilic trypsin from a cold-adapted fish species.
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
b'IVGGYECRKNSASYQASLQSGYHFCGGSLISSTWVVSAAHCYKSRIQVRLGEHNIAVNEGTEQFIDSVKVIMHPSYNSRNLDNDIMLIKLSKPASLNSYVSTVALPSSCASSGTRCLVSGWGNLSGSSSNYPDTLRCLDLPILSSSSCNSAYPGQITSNMFCAGFMEGGKDSCQGDSGGPVVCNGQLQGVVSWGYGCAQRNKPGVYTKVCNYRSWISSTMSSN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Structure of a non-psychrophilic trypsin from a cold-adapted fish species.
pubmed doi rcsb
molecule tags Serine protease
total genus 56
structure length 223
sequence length 223
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1997-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1a0jA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1a0jA02
2ZQ1A 1JRTA 3SNAA 3SORA 1O3HA 5DP5A 1O34A 2HLCA 2GT7A 3O8RA 4WJG2 2ZCLP 1UCYE 3ZVBA 3AVZA 1FIWA 1C5TA 1G30B 1KYNA 2Z9LA 2FTMA 3F68H 4B73A 2VIPA 2R0LA 3KF2A 1F0SA 1HFDA 2CF9H 3A85A 3V7TA 2WPHS 4BNRA 3ZZ3A 4B1TA 2G8TA 2SGDE 1SGTA 1IQNA 1NY22 1FAXA 3SU4A 2FOAA 2BDCA 4U32A 2FM2A 5E2OA 3BTQE 3E1XB 2GZ9A 3RXPA 2CHAB 1C9TA 5DP4A 4B71A 4LXBH 1PPGE 5EPNA 3LJOA 1OWEA 3KQCA 1IHSH 1G9IE 1PPHE 1TRYA 1YYY1 2VH6A 1TBZH 1Y59T 1PQ5A 1TGNA 2VB0A 3KIDU 3O8BA 1ZJKA 4ABGA 1YM0A 1SGEE 2Z3EA 1EP6A 2C4FH 2GP9B 1LVOA 1GBLA 1BITA 2GMTB 1DM4B 4NA9H 1MCVA 1BBRH 5H4IB 2PKAB 1PPEE 2AMDA 5FBEA 2AIPA 5L6NH 2UWPA 1KXDA 1D3TB 1EX3A 1CSOE 3R0FA 3RXDA 5DO4H 3KQEA 2XBXA 1LKAA 2XWAA 1GI4A 1AD8H 2OCVB 1SBWA 1HYLA 4Q7YA 1C2JA 1GBBA 4K60A 3GCTF 1FDPA 1UTPA 2TPIZ 3ZZ9A 1F0UA 1O2PA 1FY1A 5A2MH 3E0PB 1C1WH 2UUKB 1ELBA 1C5RA 1KDQA 1WQVH 1PPCE 2H5DA 1P9UA 1QRXA 2FOBA 4XDEA 5K0HA 2W3KA 3OSYA 5A0CA 4OS2A 3K65B 1PJPA 3BTTE 3SJ8A 4MVNA 2WYJA 3M35A 2CF8H 1BB0B 4Y7BA 2AGEX 1GG6C 2SGEE 1LVMA 1MTNB 1AWFH 2BD3A 2FOMB 2ZFQH 1L4DA 3AW1A 1V2WT 3ZZCA 3A89A 1SFIA 4WMDA 1V2LT 2D8WA 1WYKA 2WPIS 1MD7A 4AZ2B 1DY9A 4NG9H 3SNBA 1C4V2 2JKHA 3R3GB 5LGOA 2F9BH 2GCHG 1QRZA 3ATWA 2ZFSA 2Z9GA 4UD9H 1ZGVA 2VU8E 4E06H 3IITA 1FNIA 1EOLA 1Y3WA 3A86A 2Y5HA 2QIQA 3TJOA 4M7GA 2ZDMA 3GCHC 1VITG 3QDZB 5E2PA 2RG3A 2B8OH 1SPJA 2AYWA 1HJ8A 1O2TA 3EA8A 1BJVA 1VCPA 2BD4A 3VB7A 1SL3A 3E6PH 3V13A 3K6ZA 2FWWA 4MNVA 5EQRA 1K1LA 5A0BA 1C5VA 4JMYA 1TNLA 5K7RA 1TGSZ 1X7AC 1TRNA 1KLJH 2P95A 2VIDA 5JBBS 1DLEA 5HM2A 2C90B 1CGIE 3P8NA 1TBRH 2D1JA 2OC1A 3RXMA 4HGCA 4IN2A 2FI4E 1HAYB 1E0FD 1K2I1 1UTMA 1SFQB 1SGYE 2GCTB 3MMGA 3SNCA 1TPSA 1GHAG 5LPEA 1DUAA 1WCZA 3DHKH 1AKSA 1S0QA 4I8JA 4NFEA 1G3BA 3TPIZ 1KDQB 1LPGB 3QTVH 2VVUA 3U69H 3BSQA 1NM6A 1HCGA 1FAKH 1A5GH 5A8ZA 3FP8E 2WPLS 4I8LA 2ZU2A 1XXDA 1RRKA 2OINA 2QXGA 2XWBI 3MO3A 1G2LA 5B6OA 2BD8A 2QGRA 4HTCH 3VB4A 1EUFA 2HALA 2PTCE 4AFZA 4NIXA 2OC7A 1A0HB 1EASA 2V3HH 1V2TT 2F9OA 3QX5H 1GBAA 1P2IA 2FEQH 2HPPH 1TOMH 3HK3B 3ATLA 3GY3A 1V2QT 3BTHE 3M3SA 1AWHB 1IQGA 2ZDAH 1TX6A 2BX4A 3F6UH 1ETTH 1ZPCA 2A5AA 2Z6BD 5FXLA 1XKBC 3P92A 2G4UA 1JRSA 1QB1A 4MDSA 2HRVA 1RJXB 3B8JA 3ATKA 2TGTA 1HJ9A 2BY8X 1LHCH 3ATIA 4ZKOU 1V2VT 2C93B 3PMBB 4MQAA 3UQVA 3TH2H 3RXVA 2ESTE 4MPUA 1RGQA 1FUJA 3RC4A 2BDAA 2UUFB 2XBVA 3E3TA 3MU0A 4BXSA 2ZKSA 1WOFA 1G3CA 2BD5A 4WXVA 1GHXH 5T6DA 2YOLA 3M7UA 1YPKH 4XBCA 2AIQA 3UWJH 1NFWA 5EPYA 3ZZ8A 1W2KH 3PWCA 1DUEA 1O2UA 4MG3A 3E8LA 2V0BA 1Q3XA 2GX4A 3E90B 1TE0A 2CHAC 4R8TB 2ZU4A 1ANCA 2PV9B 1QTFA 3MU4A 5EQSA 1O5DH 1C4U2 4KTSA 4AORA 3NZIA 2FX4A 2PKSC 1F0TA 3UWIA 1T32A 3U1JB 1C1RA 1UHBB 1XX9A 2ZTZA 1AKSB 1UTKA 1GHZA 4H6SB 1OOKB 1YP9A 1KXAA 2PSXA 3A8BA 3UNRA 4ABJA 1BTZA 2BLQA 1ID5H 5EXLA 2G52A 1KSNA 3MI4A 4FUCA 2W7SA 1IQFA 4XE4A 1TX8A 2J2UA 2PFEA 5DP7A 3BTKE 1GMCG 4I33A 1C5OH 2ZO3H 3STIA 1EXFA 2ZGJA 4A5TS 3PV4A 1MBQA 1YPEH 1UO6A 1AVGH 2H5CA 3PM3A 3A7WA 3D23A 1AQ7A 4FUFA 5FAHA 3A80A 2ODPA 5GJ4B 1DT2A 2AMPA 3Q3XA 1BRAA 1SI5H 2BQ6B 3TU7H 3NWUA 1D3DB 2XXLA 1O3DA 1TQ7B 4CHAB 3M61U 5G4BA 3MNSA 1V2OT 1W3CA 1YLDA 1ZYOA 2SGFE 3RDZA 1ORFA 2OLGA 2YNBA 1ZSKA 1TBQH 3KHVA 3A88A 5FX6A 1C2IA 3F9EA 3UNQA 1JBUH 2P94A 4NZQA 3SUDA 2EC9H 1T7CA 1Z1IA 1O5AB 3RXAA 1TRMA 1O38A 3S7HB 1TA2A 3LGVA 3M7TA 2DE9A 3EAJA 1C5PA 4IC6A 1O3FA 1L1JA 4U2WA 2Y7XA 2FTLE 2TRMA 1DITH 5EGMA 3UOUA 1LTOA 3RXJA 1LHFH 2PTNA 1PQ7A 4YLUA 2G55A 4MNXA 1D6WA 4ESTE 3BEFB 2PGBB 3HK6B 3UFAA 2NU3E 1BHXF 1P3EA 1O2QA 3SV6A 1GDUA 4ZXXH 4AFQA 1BMMH 2ZHEH 3SU0A 1LHDH 1O2XA 1QY6A 3PLPA 2BY7X 1TMTH 3ZZ7A 4JCNA 2BLOA 5I25A 1H4WA 4OGXA 1VCWA 2Z3DA 1PFXC 1GI2A 1BBRE 1T8OA 1YPLH 1O2ZA 1BRUP 1GI1A 4CR9A 2ZDVH 4K8BA 4X6MA 1GL0E 4ZHAA 1OPHB 1UTNA 1NFUA 5C1UA 1YPHE 1TMBH 1EB2A 1CGHA 5GIBA 2ZZUH 2GCTC 3LKWA 3QN7A 1Z6EA 1NRNH 4TWYA 1JXPA 2Q6FA 2BZAA 3B23B 3SUEA 4ZROA 1O37A 2BDYA 2DUCA 1OP8A 3F9GA 1LQDB 4Y71A 1ZLRA 5F8XA 4R0IA 4FUIA 5FBIA 4TPIZ 4X6PA 3OYPA 1PPZA 3FZDA 1NFYA 4MNWA 1NU9A 1NO9H 4WMFA 1FONA 4JYUH 1XMNB 3L3TA 1C1QA 1O2VA 4X8TH 1SGQE 1N8OC 2J38A 3VXFH 2YNAA 3LGIA 4FVBA 2ZPSA 3VPKA 4I8HA 1C2EA 1CVWH 2OD3B 1EPTA 1C4Y2 1OP2A 3A84A 8LPRA 4OS4A 2QAAA 1A3EH 2OC8A 2H9TH 4UFFH 1W8BH 3D62A 1RTKA 1AY6H 4INHA 4MLFB 1CHOF 1C2FA 1EB1H 2Z9JA 1XVMA 2NU2E 1HXEH 3MNBA 1OP0A 3P95A 1GBFA 1K1PA 2TGDA 2FX6A 4GAWA 3GDUA 1C2LA 1UK2A 3RXIA 4GUXA 1ANBA 3ZVEA 2FI3E 4ABEA 1FPCH 4NCYA 1GVZA 4D9QA 2A0QB 1AMHA 5AFYH 2WUBA 1IHTH 3PO1C 1HGTH 1GWAA 4FUJA 1GCTC 2GDEH 3DA9B 2HPQH 1J8AA 3S0NA 3E91A 1C5SA 1AVXA 4CRAA 4CRCA 4ABBA 1ZSJA 5A09A 5EXNA 3C27B 1QL8A 3MNXA 1TNKA 2HNTC 3AW0A 1FI8A 1GBTA 1QA0A 4U01A 3MHWU 2A2QH 3LH3A 3ZZDA 3A82A 1C1VH 1GHBF 3VEQB 4AG1A 3HGPA 4GHQA 1UTQA 2FZZA 1K9OE 1D3QB 1K21H 1OWDA 2H6MA 3W94A 3AAUA 2PUXB 1Y3UA 2ZU5A 2JH6D 2P8OB 1N6XA 1PYTD 1MTSA 2ZGCA 1P9SA 1G3DA 3ZVGA 4ZAEA 3BIUH 3QUMP 3SBKA 4K1EA 1BTHH 1QNJA 1GL1A 3P17H 2PKAA 4I8KA 1HAIH 1QRWA 1C1UH 5EODA 2LPRA 3A8AA 3SNDA 5PTPA 2PUQH 3KQDA 1S6HA 3M5OA 3A81A 3NPSA 4O3TA 8ESTE 2A4QA 1V2RT 3RXEA 4NIYA 1BTPA 5ETXA 1C5NH 1DS2E 1RTFB 4D7GA 1PPBH 4XFQA 4B76A 1EPTB 2PWXA 1FY5A 1O3BA 2IN2A 1TGBA 2OP9A 5GCHG 4UFGH 2BDIA 5C1XA 2GTBA 2I6SA 2DE8A 3SV8A 2BQWB 1DWBH 5E0JA 1BMAA 2HVXA 2ASUB 1IAUA 1KXEA 3EQ0H 2AH4X 1O30A 1FN6A 1BDAA 1A46H 1YF4A 1BOQA 3ODDA 4AFSA 3ZVDA 3A7YA 3GY7A 4CRGA 2P16A 4F4OC 4SGBE 3D49H 3GCOA 3BTFE 2BLWA 6LPRA 3KQBA 4X0WU 1IQMA 4DGJA 2VIQA 1GMHF 1SGCA 4K8YA 3IWMA 1CHGA 1BHXB 5LH8A 1W14U 1FJSA 3QGNB 4HZHA 1V2MT 3F9HA 1PPFE 1GI6A 5E0HA 2BM2A 4JZDH 1VGCC 1B0EA 1SOZA 1MTUA 1RS0A 1V2ST 2ZFFH 2AERH 1GI0A 2ZFTA 1MU8B 1RIWB 2ZCHP 3VB6A 1CA8B 4UE7H 1QBNA 4OS6A 1WTHD 1HBTH 2OXSA 3ZV8A 1MKXK 2HOBA 4UFEH 5FCKA 4AG2A 3BG4C 1C2KA 2BLVA 2BOHB 3V0XA 4BXWA 4UONA 5JBTA 1O2GH 2XNIA 5SGAE 1O2NA 1A0LA 1Z7KA 1BJUA 4BOHA 5DKMA 1O5EH 1K22H 1UVUH 4DVAU 4RKJB 3RXGA 5F8TA 1EZQA 2ODQA 2BYAX 2ZECA 7GCHF 3MH5A 2ZI2H 2RA3A 1A0JA 4X8UH 3MFJA 1EZUC 3RP2A 1A5IA 3RXQA 1KTSB 1O39A 1DOJA 3TK9A 1EZSC 4INKA 1CA0C 1O32A 4XBDA 3RXBA 1DLKB 2GZ7A 2XW9A 1CT0E 1MKXH 9ESTA 1E36B 2XBWA 1ZGIA 4YTAA 1DFPA 5F8ZA 5JYIA 1O2RA 3FP7E 2ZGBH 1DE7H 3PTBA 4D9RA 1SQTA 5DP6A 1SQAA 1TNJA 4ISHH 4OGYA 4CRBA 1WQSA 4JYVH 1Z1JA 3LGYA 2FS8A 3VGCC 1YBWA 1EAUA 1EJNA 2FODA 1HJAB 1P03A 3B9FH 4ASHA 1QB6A 3M36A 3RXUA 1B7XB 1Y5UT 2V35A 3RXRA 4IMZA 3P8OA 1GJBB 4JZFH 2R2MB 4AGKA 3V3MA 4INLA 4K5ZA 1D3PB 5DGJA 1G3EA 4J1YA 4VGCB 1Z8JB 6GCHF 2TIOA 3QZQA 5ESBA 3KNXA 5LPFA 4TWWA 1QBVH 1O3KA 1S85A 1FY4A 1V2JT 2R9PA 1FXYA 1LPZB 4NA7A 7KMEH 2AGGX 1ZZZA 1F5RA 3SU6A 3SJ9A 1GVKB 3A7ZA 4ISIH 2J4IA 2UUJB 1GJ4H 1DSUA 4SGAE 4K2YA 2LNCA 1LVYA 3D65E 4GVUA 1SLVB 4YLQH 1LQEA 1HUTH 3NCLA 3RXTA 5JB8S 3BN9A 3TK6A 4WMEA 1W12U 1DANH 1GMDF 4AB8A 4D7FA 2ZA5A 1AFQB 2ILNA 2A4OA 1V2NT 1ZPZA 2OBQA 3MO6A 4Y0ZE 4CRDA 4Y79A 2BVXH 1MBMA 5AFZH 1L4ZA 3ZV9A 3EA9A 1UHBA 3SUFA 3LH1A 2XYAA 4A92A 2A31A 1SMFE 2FOCA 1SHYA 2JH5D 3HGNA 4NWKA 4ABAA 4UDWH 2ALVA 4WWYA 1DXPA 2O8UA 1WSSH 1LMWB 3LGWA 1F0RA 1SGDE 3TNTA 1EAIA 4A1XA 1NRQH 1AB9C 1W0YH 1YPMH 1GBCA 1J9CH 5ABWA 1KTTB 3MH4A 2VGCC 2FOHA 1NT1A 4YT6H 1XUIA 3KEEA 5GXPA 1TALA 3ODFA 3U8RH 3LT3A 2JETB 4BTUB 4ABHA 4RKOB 1GJ8B 3Q3KA 4X8SH 4CREA 1P10A 2B0FA 4ABIA 3DD2H 1C1NA 1QR3E 1O3GA 2ZTXA 3H7OA 3E16B 1NC6A 4IN1A 5EW2H 4Y10E 1V2PT 4XOJA 1O2MA 4GHTA 2A5IA 1A5HA 2BXUH 1TGCA 3K6YA 2VH0A 4IGDA 2Y7ZA 1DWDH 3BTEE 2R3YA 4I31A 1XVOA 2G51A 1F7ZA 2G4TA 3UNSA 1UCYK 1P05A 4O9VA 5T6GA 4AX9H 1G2MA 1WBGB 2FXRA 3RMMH 1GHYH 1JWTA 3RXOA 4YOIA 1NRSH 1SSXA 4DCDA 3GY2A 3U8OH 1W7GH 4H42U 3RM0H 4MTBA 2VJ1A 1S82A 1QCPA 1TPOA 1BCUH 2AS9A 1HAGE 4OS5A 1ETRH 1UTOA 2O8TA 1NTPA 1EOJA 1GDNA 1AU8A 1C5WB 2V6NA 1TQ0B 4Q2KA 3MU1A 2P59A 1BA8B 1RTLA 4DOQA 1OWKA 2ZEBA 3TGIE 4JZIA 1SLUB 5F6MA 3FANA 2GD4B 3O8DA 1SGIB 3PLBA 1AHTH 3GCNA 1HAPH 4DIHH 2WV5A 4UFDH 1T4VH 2UWOA 5EQQA 4FXGH 2FOEA 1S0RA 1VZQH 1DPOA 3ZVFA 3BTME 1O2YA 5IDKA 4GCHF 2GMTC 3RXFA 3MWIU 2PR3A 1NRPH 3SU2A 2RA0A 7LPRA 2A1DB 2EI8A 4JZ1A 4FUBA 1SGFA 4YZUA 5JBCS 1MD8A 4I8GA 1ELFA 1GHWH 5DP8A 2WINI 1H8IH 3SU5A 1ZMNA 5HYOA 1WV7H 2OUAA 4I7YH 2ZHWH 3S69A 3K2UA 1QQUA 3UOPA 1OKXA 4DG4A 1ARCA 1KXBA 1KXCA 1MKWK 1TONA 4MPVA 2M5TA 2FI5E 5F03A 1C5QA 1OWJA 2G5VA 2NU1E 3RC5A 5C2ZA 1GJAB 1P2OA 1ANEA 1C5ZB 2ZG0H 1ZMJA 3GY4A 2Z7FE 1GJ7B 3HKIB 3P70B 3ZZ6A 3TITA 5C5NA 2ZGHA 1WAYB 3RMOH 1HJAC 1GBKA 1FMGA 1VJ9U 4E7RG 1MTNC 4X8VH 1H9IE 1MTWA 2ZHDA 3TK5A 1P2MA 1TNIA 3QWCH 4TY7A 2BOKA 1MCTA 2SGAA 2C8WB 1MKWH 1IQIA 5ESTE 1UK3A 5I46H 1O3IA 3FP6E 2BVSH 2KAIB 1BTXA 3RXLA 4VGCC 1QHRB 1BTYA 5HM9A 2AMQA 1GCDA 2WPJS 2OC0A 3SJKA 1Y3YA 1TX7A 2BX3A 5L2ZH 2ODYB 2SFAA 3F9FA 4CBOA 2GDDA 2HGTH 1AUTC 2FOGA 2XC0A 4I32A 1MTVA 4THNH 5A8XA 1S5SA 1D6RA 4KGAA 5EOKA 3SJOA 5IYTA 3LIWA 4IBLH 1C1MA 3NKKA 1LDTT 4ZHLU 5C5OA 2A32A 2A7JA 1G37A 1YC0A 6CHAB 1Y3XA 2CXVA 3FVFB 1EZXC 4Z0KA 2OTVA 3LGUA 1VITF 4Q7XA 1DWEH 5CE1A 3N7OA 3RU4E 1GHVH 3RM2H 4Y8YA 3SV9A 3A8CA 2UWLA 5CHAB 4X1SU 1G36A 1S83A 4Q80A 4NWLA 2BB4A 3M5MA 1WTGH 1O2SA 3GCTG 1O2WA 1JOUB 1PQ8A 3T26A 1AZ8A 2CJIA 1EQ9A 2FPZA 1XM1A 1ELVA 1AIXH 3T2NA 5L2YH 1IQKA 2IJOB 3UY9A 2H1UA 5TJXA 1ZTJA 1CU1A 1D9IA 2QA9E 1OS8A 2TBSA 3S7KB 4LZ4B 1GGDB 4AYVB 1L1GA 2QF3A 3P8FA 8GCHF 3RXSA 1IQJA 3M37A 4IS5A 4Z6AH 1O3EA 4BAHB 4WVPE 1LHGH 4YOJA 2XBYA 1AGJA 1YCPK 1ZR0A 1V6DA 1GBMA 1V2UT 1LO6A 3FFGA 3PROA 1QJ1B 4AFUA 4KTUA 1ELTA 2PLXA 6GCHG 3RU4D 4B2CA 1TIOA 2F83A 4D8NA 1O35A 1KXFA 4TPYA 3BV9B 2WV4A 2FS9A 5DPAA 3RMLH 2FLBH 1QL7A 1DICA 1QQ4A 4A7IB 3URDA 1P06A 1ELDE 5EG4A 2R0KA 1JIMA 1GBHA 1GBEA 1L1NA 3SW2B 5JPMH 1MH0A 4X6OA 1FQ3A 1YCPH 3DFJA 4AGJA 3GYLB 5EW1H 4Y7AA 4MPWA 2Y82A 4AOQA 2IPHA 1GDQA 1Y5BT 2AFQB 5DJ7A 2P93A 2WYGA 3T5FH 3GCHB 4YT7H 2WPKS 1B0FA 3RLYH 1C2DA 1P0SH 3NK8A 4IC5A 1RD3B 1ZMLA 4CH8B 3BEUA 1FV9A 1IQEA 4K69A 1KLIH 2Z3CA 1C5UA 1QIXB 1YPJH 1GI8B 3LJJA 5GPIB 3TJNA 4ZH8A 4FU7A 1YKTA 2Z9IA 4WF8A 1ESAA 5AF9H 2PGQB 1INCA 1MU6B 1TOCB 1DVAH 1LPKB 1SGFG 3ZZBA 3NXPA 2XCNA 4KKDA 3V12A 1A1RA 3VXEH 2VWNA 2ANWA 3GICB 1GPZA 3KL6A 2BZ6H 2Q1JA 3TLOA 4MNYA 4BTTB 1HNEE 5GWZA 1EJMA 3UTUH 3LGTA 1K1MA 3EE0B 5DP3A 1YGCH 1C5XB 3Q76A 2ANMH 4K3JA 3E0NB 1O5FH 1GMCF 3ZZ4A 3CP7A 3SO3A 1T8NA 4TYDA 1CT4E 1UTJA 2J94A 4CHAC 3LPRA 1H9LB 2C8YB 4MPXA 1OXGA 4J2YB 1O0DH 1W0ZU 1YLCA 2OQ5A 1N1LA 1U6QA 1HIAA 1VCQA 4X1QU 1ABJH 4NSYA 4ZXYH 1OX1A 2Q6DA 3SGQE 2ZFRH 2THFB 4B2BA 1S81A 5TCCA 2BD7A 4E7NA 1O3JA 1BMLA 1UTLM 2FYQA 4ABDA 8KME2 3IG6B 4NIVA 2V3OH 2Y5FA 4HI3A 3TIUA 2QXJA 3ATMA 4WH6A 1K1JA 1C5MD 1P09A 4B75A 3U1IB 1O2LA 1UVSH 3JZ2B 1TMUH 2GT8A 4O03A 1TAWA 1UVTH 4JK6A 3FAOA 3T62A 1P2NA 4HFPB 4A1VA 2A45B 1GJ6A 3BTWE 4KP0A 2I6QA 2GV6A 1O3OA 1G32B 3MTYA 1HB0B 1SGRE 2SGPE 1E37B 1UK4A 3SV7A 1BBRK 3ZYDA 1H1BA 6CHAC 1PQAA 2HWLB 3BIVH 2FMJA 1GBDA 2ZU3A 3C1KA 5C20A 3PYHA 3LU9B 1AO5A 4GCHG 2BVRH 2ZU1A 1BRBE 2HNTF 3H7TA 3SGBE 3OX7U 2PKSB 2AGIX 3P6ZB 1IQHA 1EATA 1O31A 1KLTA 1YPHC 4FUEA 2G81E 3KGPA 5CHAC 3QLPH 1ZSLA 3SQEE 1AN1E 3SHAH 2BY5X 1EAWA 1CO7E 2OBOA 2AEIH 1S6FA 2ZNKH 2CV3A 3U8TH 1TYNA 2FDAA 1NPMA 1HLTH 3T27A 1CGJE 4DT7B 1P3CA 1SLXB 2XRCA 2XTTB 1XUHA 3MU8A 2BHGA 5EU8A 5A8YA 4ISOA 2VWOA 2J34A 3T28A 1GI7B 1O3MA 1HIAB 3VB5A 4DJZB 1MUEB 2C8XB 5HXFA 1AE8H 1MAYA 4LK4A 1D4PB 3URCA 1LVBA 3CS7A 5HGGA 1SHHB 1FY8E 5E0GA 1O5CB 3GISB 2QN5T 1BT7A 1GJ5H 2EI7A 3LOXA 2PSYA 3OTJE 3OY6U 3O8CA 1J15A 1GGDC 5FCRA 1FY3A 3OY5U 1PYTC 3L6PA 1ZRBA 3UR6A 1C1SA 1MAXA 2C3SA 4ISLA 4D76A 3ZZAA 1FN8A 2ZFPH 2FIRH 2BQ7B 2O8LA 2RCEA 2BXTH 1SC8U 2PW8H 4ZKNU 4IW4E 1O3PB 2QCYA 4WY3A 3MYWA 3MH6A 1O2IA 2B5TB 2ZCKP 2H9HA 1ZTLA 2Q6GA 4K1TA 1O2KA 5FHTA 2ZGXH 4X1PU 4Y11E 1SG8B 3A87A 3A83A 5DK1A 2VWLA 1HAVA 1N6YA 1BUIA 3PMJA 4WXIA 3SHCH 1TNHA 3TJVA 9LPRA 1DDJA 2FYRA 1ZHRA 1CBWB 5LPRA 5C1YA 2SNWA 3RXHA 2O9QA 1AFEH 2R3UA 1BIOA 1TFXA 1EP5A 1ELEE 1A61H 1HDTH 1O2OA 3TGKE 1GI3A 1Q2WA 3GY6A 1THPB 4NGAH 4Y8XA 1P57B 3TGJE 2ZC9H 2UUYA 3GYMA 1MMJN 1BZXE 4AN7A 1P11E 2P8OC 1MZDA 2ZPRA 1DSTA 1C5YB 1P04A 2FP7B 2GGVB 3I78A 3ZVCA 1T4UH 1CQQA 2QYIA 4GPGA 1SB1H 1O2HA 4X2YA 3TH3H 4Y0YE 2D2DA 1ANDA 4Q7ZA 1DX5M 1NS3A 4O97A 3ZVAA 2W26A 4NZLA 1BRCE 1GI9B 1K1NA 1THRH 2FO9A 2P3UB 4E05H 1Z8IB 3S9BA 4KTCA 3CS0A 3RU4T 3A8DA 1GVLA 1QJ7B 1GBJA 1F5LA 2FESH 3LC3A 1EPTC 2A4GA 3Q3YA 1Q31A 2A4RA 4XSKU 8GCHG 1RFNA 3KCGH 2EEKA 1J16A 5CMXH 4X1RU 1P2JA 1NFXA 2ZDKA 3DT0H 2H2ZA 1T31A 2F3CE 1N8OB 2ZDLA 5GCHF 3SZNA 3PMHB 1CHOG 1CT2E 1JIRA 4X6NA 2QY0B 3BTDE 1HAVB 1ACBE 5JB9S 4NA8A 1AZZA 4DY7B 1WUNH 1BTUA 1TWXB 2B9LA 3K9XB 4F49A 1QGFA 1P2QA 3SJIA 2A2XH 4LOYH 4X2VA 3BF6H 2QV1A 1T8MA 2ALPA 1CE5A 1L2EA 2KAIA 2ZQ2A 1QBOA 1T8LA 2XC5A 2NWNA 3PLKA 1QB9A 3A7TA 2W5EA 2F91A 2ULLA 1UCYH 4KELA 4DURA 4H4FA 3RLWH 1C2GA 3TVJB 3HKJB 4DW2U 3ZZ5A 3PO1B 3SOSA 1RIWC 1W11U 4X1NU 1XUJA 1GCTB 1GHBG 1O3CA 2R2WU 3AAVA 2ZDNA 2TGPZ 4GLYA 1VITH 3KN2A 5FPYA 2VWMA 4TY6A 4FVDA 3LC5A 5E8EH 4YO9A 1HV7A 1QL9A 4BAOB 2HNTE 1DWCH 1C5LH 3SI4H 4A1TA 1O2JA 1FZZA 7ESTE 1ESBA 4FUHA 4BAMB 1AI8H 3GY5A 3STJA 3MNCA 2BMGB 3SU1A 1NU7B 2GV7A 1V2KT 3PTNA 3MH7A 5A0AE 3W95A 1GJDB 2G5NA 3AASA 4A6LA 1XUKA 1O5GH 1HPGA 3G01A 4DIIH 2C8ZB 1TPAE 3RXKA 4K1SA 3P8GA 4Y76A 1SVPA 3VFEA 2ZP0H 1BTWA 3UQOA 2EI6A 3ZYEA 3DUXH 2CGAA 2STBE 4WH8A 5GDSH 2ZIQH 2BDHA 4RN6A 1Y5AT 1E35B 3LDXH 3VB3A 1H8DH 3T29A 1O3NA 1FLEE 3GDVA 1IOEA 4QT8C 3SN8A 2O8MA 4LZ1H 1QA7A 1P12E 1M9UA 1UVPA 1YPGH 1C1PA 1J17T 1NRRH 1DXWA 1TABE 2VVCA 4NFFA 2P3TB 1K1OA 3UR9A 1Y3VA 3RC6A 2J9NA 2Z9KA 1ETSH 1AVWA 3A7XA 4ZKSU 1VR1H 1BQYA 1OWIA 1HAXB 2NU4E 4ZKRU 3F1SB 4GSOA 4NSVA 3S9AA 4BANB 2BY9X 1A3BH 1NN6A 3EYDA 4B2AA 3EA7A 1QURH 1W13U 1O36A 2QC2A 1ELAA 1TGTA 4B74A 4AYYB 1GMHG 2SNVA 3M5LA 1LKBA 4CR5A 5AHGH 3JZ1B 3S9CA 1EAXA 1Z8GA 1MQ5A 4ABFA 3DFLA 2ZTYA 1Z71A 4CH2B 2GCHF 2A7CA 4ZUHA 1ARBA 3OU0A 2ZHQH 1C1OA 1P8VC 1SOTA 2EA3A 1MZAA 1O3AA 2STAE 2BDBA 1F92A 2NU0E 1CBWC 1B5GH 5DG6A 1TA6A 1VGCB 1EJAA 1QFKH 4CRFA 5JBAS 1DY8A 3H5CB 1KY9A 1F5KU 1MQ6A 2BD2A 3SNEA 1HAZB 2VNTA 4ISNA 4JK5A 2VINA 4RSPA 1ZOMA 4OS7A 4Y6DA 2H9EH 2ZF0H 1E38B 1L0ZA 1GJ9B 5FPTA 2BTCE 1KIGH 7GCHG 2B7DH 1AFQC 3BG4B 2W7UA 2G00A 1TNGA 2SGQE 3ITIA 2QXIA 1XUFA 4ZMAH 1GI5A 5TCAA 2ZWLH 4XBBA 3I77A 3U9AH 2OQUA 1XUGA 1OWHA 1E34B 2F9PA 1A7SA 2XC4A 4OS1A 1AUJA 1UMAH 2D26C 2Y5GA 1CA0B 1GHAF 3UUZA 1EKBB 4BAQB 3HATH 3QK1A 1W10U 2FOFA 2F9UA 2A7HA 2O8WA 3Q00A 1IQLA 1O33A 2VIVA 3BEIB 5HMAA 1GBIA 1QJ6B 1S84A 1TB6H 2JETC 3QTOH 5JDUB 2ZPQA 3M5NA 2Z94A 3BTGE 5L30H 2PHBA 1HAHH 2ZHFH 4ZHMU 3U98H 3TH4H 4FU9A 2F9NA 4BAKB 1ZHPA 3UIRA 4YESB 1ZJDA 1V3XA 1A2CH 3UPEA 3VGCB 3FZZA 1XKAC 1GG6B 3PWBA 1UVOA 1H9HE 1OYTH 1HRTH 3QGJA 5C67A 1J14A 1ELGA 4X2WA 1OSSA 1RXPA 3I29A 1ESTA 1C2HA 4JYTA 1W7XH 2Y6TA 1WU1A 1P02A 2WPMS 5T3HA 2Y81A 1AE5A 5J4SA 1VJAU 4IMQA 3A7VA 1BMNH 1XXFA 2P3FH 2K1QA 1FPHH 3SU3A 3ENSB 4YOGA 3WY8A 4JZEH 2J92A 2VIWA 3M3VA 4U30A 5FPSA 4Y8ZA 5EXMA 1C9PA 2GKVE 6ESTA 3RUOA 1JMOH 2ANYA 2BY6X 3Q77A 1ZTKA 4AB9A 5BRRE 3MU5A 1O5BB 5BPEA 1GJCB 2CMYA 1K1IA 1ELCA 1THSH 4CBNA 1GMDG 3GY8A 2GZ8A 3BG8A 3MO9A 3GDSA 1C2MA 2VIOA 1Y8TA 4YM9A 4O3UA 5AVDA 1LCYA 3CENA 3RXCA 1C1TA 3M7QA 1ABIH 3SQHE 1K28D 1SGNE 2W3IA 2CN0H 4BTIB 4FUDA 3SUGA 2VVVA 2XCFA 1TLDA 1HAOH 1A4WH 1YCPM 2BDGA 2JH0D 4FUGA 1Z6JH 1OYQA 3M3TA 1LHEH 3EGKH 1FIZA 1TPPA 4UEHH 1NROH 2GVFA 5T6FA 5FX5A 1P2KA 1ZRKA 2BD9A 1UJ1A 1P01A 3QZRA 1ZPBA 3QO6A 4PROA 2J95A 1AB9B 1O3LA 5DP9A 1NESE 1SGPE 3L33A 3PB1E 2ANKH 2VGCB 2TGAA 3EDXB 2QF0A 3HPTB 4FU8A 5C3NA 1NZQH 3NUMA 1HXFH 2FLRH 2WUCA 2F9VA 1SR5C 3TNSA 2A5KA 2QXHA 3GOVB 3ELAH 3MOCA 1F2SE 1SLWB 3RMNH 4X2XA 5J4QA 4H6TA 3PMAB 3T25A 4NIWA 1Z8RA 2Y80A 3LONA 3SGAE 1SQOA 1ZHMA 3TJUA 3UREA 2RDLA 3ESTA 3SV2H 2IOTA 3SI3H
chains in the Genus database with same CATH superfamily
2ZQ1A 1JRTA 3SNAA 3SORA 1O3HA 5DP5A 1O34A 2HLCA 2GT7A 3O8RA 4WJG2 2ZCLP 1UCYE 3ZVBA 3AVZA 1FIWA 1C5TA 1G30B 1KYNA 2Z9LA 2FTMA 3F68H 4B73A 2VIPA 2R0LA 3KF2A 1F0SA 1HFDA 2CF9H 3A85A 3V7TA 2WPHS 4BNRA 3ZZ3A 4B1TA 2G8TA 2SGDE 1SGTA 1IQNA 1NY22 1FAXA 3SU4A 2FOAA 2BDCA 4U32A 2FM2A 5E2OA 3BTQE 3E1XB 2GZ9A 3RXPA 2CHAB 1C9TA 5DP4A 4B71A 4LXBH 1PPGE 5EPNA 3LJOA 1OWEA 3KQCA 1IHSH 1G9IE 1PPHE 1TRYA 1YYY1 2VH6A 1TBZH 1Y59T 1PQ5A 1TGNA 2VB0A 3KIDU 3O8BA 1ZJKA 4ABGA 1YM0A 1SGEE 2Z3EA 1EP6A 2C4FH 2GP9B 1LVOA 1GBLA 1BITA 2GMTB 1DM4B 4NA9H 1MCVA 1BBRH 5H4IB 2PKAB 1PPEE 2AMDA 5FBEA 2AIPA 5L6NH 2UWPA 1KXDA 1D3TB 1EX3A 3F2HA 1CSOE 3R0FA 3RXDA 5DO4H 3KQEA 5CDFE 2XBXA 1LKAA 2XWAA 1GI4A 1AD8H 2OCVB 1SBWA 1HYLA 4Q7YA 1C2JA 1GBBA 4K60A 2J97A 3GCTF 1FDPA 1UTPA 2TPIZ 3ZZ9A 1F0UA 1O2PA 1FY1A 5A2MH 3E0PB 1C1WH 2UUKB 1ELBA 1C5RA 1KDQA 1WQVH 3OFND 1PPCE 2H5DA 1P9UA 1QRXA 2FOBA 4XDEA 5K0HA 2W3KA 3OSYA 5A0CA 2GJGA 4OS2A 3K65B 1PJPA 3BTTE 3SJ8A 4MVNA 2WYJA 3M35A 2CF8H 1BB0B 2YMSC 4Y7BA 2AGEX 1GG6C 2SGEE 1LVMA 1MTNB 5HKKD 1AWFH 2BD3A 2FOMB 2ZFQH 1L4DA 3AW1A 1V2WT 1WDIA 3A89A 3ZZCA 1SFIA 4WMDA 1V2LT 2D8WA 1WYKA 2WPIS 1MD7A 4AZ2B 1DY9A 4NG9H 3SNBA 1C4V2 2JKHA 3R3GB 5LGOA 2F9BH 2GCHG 1QRZA 3ATWA 2ZFSA 2Z9GA 4UD9H 1ZGVA 2VU8E 4E06H 1BMFD 3IITA 1FNIA 1EOLA 1Y3WA 3A86A 2Y5HA 2QIQA 3TJOA 4M7GA 2ZDMA 3GCHC 1VITG 3QDZB 2KCYA 5E2PA 2RG3A 2B8OH 1SPJA 2AYWA 1HJ8A 1O2TA 3EA8A 1OHHD 1BJVA 1VCPA 2BD4A 3VB7A 4B6EA 1SL3A 3E6PH 3V13A 3K6ZA 2FWWA 4MNVA 5EQRA 1K1LA 5A0BA 1C5VA 4DT4A 4JMYA 1TNLA 5K7RA 3FKSD 1TGSZ 1X7AC 1TRNA 1KLJH 2P95A 2VIDA 5JBBS 1DLEA 5HM2A 2C90B 1CGIE 3P8NA 1TBRH 2D1JA 3OEHD 4B6FA 2OC1A 2KCAA 3RXMA 4HGCA 4IN2A 2FI4E 1HAYB 1E0FD 1K2I1 1UTMA 1SFQB 1SGYE 2GCTB 3MMGA 2JJ2D 3SNCA 1TPSA 1GHAG 5LPEA 1DUAA 1WCZA 3DHKH 1AKSA 1S0QA 4I8JA 4NFEA 1G3BA 3TPIZ 1KDQB 1LPGB 3QTVH 2VVUA 3U69H 3BSQA 1NM6A 1HCGA 1FAKH 1A5GH 5A8ZA 3FP8E 1COWD 1WXRA 2WPLS 4I8LA 2WV9A 2ZU2A 1XXDA 1RRKA 2OINA 2QXGA 2XWBI 1E1QD 3MO3A 1G2LA 5B6OA 2BD8A 2QGRA 4HTCH 3VB4A 1EUFA 2HALA 2PTCE 4AFZA 4NIXA 2OC7A 1A0HB 1EASA 2V3HH 1V2TT 2F9OA 3QX5H 1GBAA 1E79D 1P2IA 2FEQH 2HPPH 2F43B 1TOMH 3HK3B 3ATLA 3GY3A 1V2QT 3BTHE 3M3SA 1AWHB 1IQGA 2ZDAH 1TX6A 2BX4A 3F6UH 1ETTH 1ZPCA 2A5AA 2Z6BD 5FXLA 1XKBC 3P92A 2G4UA 3UB0A 1JRSA 1QB1A 4MDSA 2HRVA 1RJXB 3B8JA 3ATKA 2TGTA 1HJ9A 2BY8X 1LHCH 3ATIA 4ZKOU 1V2VT 2C93B 3PMBB 4MQAA 3UQVA 3TH2H 3RXVA 2ESTE 4MPUA 1RGQA 1FUJA 3RC4A 2BDAA 2UUFB 2XBVA 3E3TA 3MU0A 4BXSA 2ZKSA 1WOFA 1G3CA 2BD5A 4WXVA 1GHXH 5T6DA 2YOLA 3M7UA 1YPKH 5C17A 4XBCA 2AIQA 3UWJH 1NFWA 5EPYA 3ZZ8A 1W2KH 3PWCA 1DUEA 1O2UA 4MG3A 3E8LA 2V0BA 3CNRA 1Q3XA 2GX4A 3E90B 1TE0A 2CHAC 4R8TB 2ZU4A 1ANCA 2PV9B 1QTFA 3MU4A 5EQSA 1O5DH 1C4U2 4KTSA 4AORA 3NZIA 2FX4A 2PKSC 1F0TA 3UWIA 1T32A 3U1JB 1C1RA 1UHBB 1XX9A 2ZTZA 1AKSB 1UTKA 1GHZA 4H6SB 1OOKB 1YP9A 1KXAA 2PSXA 3A8BA 3UNRA 4ABJA 1BTZA 2BLQA 1ID5H 5EXLA 2G52A 1KSNA 3MI4A 4FUCA 2W7SA 5DN6D 1IQFA 4XE4A 1TX8A 2J2UA 2PFEA 5DP7A 3BTKE 1GMCG 4I33A 1C5OH 2ZO3H 3STIA 1EXFA 2ZGJA 4A5TS 3PV4A 1MBQA 1YPEH 1UO6A 1AVGH 2H5CA 3PM3A 3A7WA 3D23A 1AQ7A 4FUFA 5FAHA 3A80A 2ODPA 5GJ4B 5HIZA 1DT2A 2AMPA 3Q3XA 1BRAA 1SI5H 2BQ6B 3TU7H 3NWUA 1D3DB 2XXLA 1O3DA 5EJZA 1TQ7B 4CHAB 3M61U 5G4BA 3MNSA 1V2OT 1W3CA 1YLDA 1ZYOA 2SGFE 3RDZA 1ORFA 2OLGA 2YNBA 1ZSKA 1TBQH 3KHVA 4ZCNA 1VKYA 3A88A 5FX6A 1C2IA 3F9EA 3UNQA 1JBUH 2P94A 4NZQA 3SUDA 2EC9H 1T7CA 1Z1IA 1O5AB 3RXAA 1TRMA 5IK2D 1O38A 3S7HB 1TA2A 4Q4LA 3LGVA 3M7TA 2DE9A 3EAJA 1C5PA 4IC6A 1O3FA 1L1JA 4U2WA 4ACAA 2Y7XA 2FTLE 2TRMA 1DITH 5EGMA 3UOUA 1LTOA 3RXJA 1LHFH 2PTNA 1PQ7A 4YLUA 2G55A 4MNXA 1D6WA 4ESTE 3BEFB 2PGBB 3HK6B 3UFAA 2NU3E 1BHXF 1P3EA 1O2QA 3SV6A 1GDUA 4ZXXH 4AFQA 1BMMH 2ZHEH 3SU0A 1LHDH 1O2XA 1QY6A 3PLPA 2BY7X 1TMTH 3ZZ7A 4JCNA 3SZEA 2BLOA 5I25A 1H4WA 4OGXA 1VCWA 2Z3DA 1PFXC 1GI2A 1BBRE 1T8OA 1YPLH 1O2ZA 2WSSD 1BRUP 1GI1A 4CR9A 2ZDVH 4K8BA 4X6MA 1SKYE 1GL0E 3N99A 4ZHAA 3KQ5A 1OPHB 1UTNA 1NFUA 1KMHB 5C1UA 1YPHE 1TMBH 1EB2A 1CGHA 5GIBA 2ZZUH 2GCTC 3LKWA 3QN7A 1Z6EA 1NRNH 4OM9A 4TWYA 1JXPA 1QZ8A 2Q6FA 2BZAA 3B23B 3SUEA 4ZROA 1O37A 2BDYA 2DUCA 1OP8A 3F9GA 1LQDB 4Y71A 1ZLRA 5F8XA 4R0IA 4FUIA 5FBIA 4TPIZ 4X6PA 3OYPA 1PPZA 3FZDA 1NFYA 4MNWA 1NU9A 1NO9H 4WMFA 1FONA 4JYUH 3OTPA 1XMNB 3L3TA 1C1QA 1O2VA 4X8TH 1SGQE 1N8OC 2J38A 3VXFH 2YNAA 3LGIA 4FVBA 2ZPSA 3VPKA 4I8HA 1C2EA 1CVWH 2OD3B 1EPTA 1C4Y2 1OP2A 3A84A 8LPRA 2V7QD 4OS4A 2QAAA 1A3EH 2OC8A 2H9TH 2V3MA 4UFFH 1W8BH 3D62A 1RTKA 1AY6H 4INHA 4MLFB 1CHOF 1C2FA 1EB1H 2Z9JA 1XVMA 2NU2E 1HXEH 3MNBA 1OP0A 3P95A 1GBFA 1K1PA 2TGDA 2FX6A 4GAWA 3GDUA 1C2LA 1UK2A 3RXIA 4GUXA 1ANBA 3ZVEA 2FI3E 1H8HD 4ABEA 3FO8D 1FPCH 4NCYA 1GVZA 2JJ1D 4D9QA 2A0QB 1AMHA 5AFYH 2WUBA 1IHTH 3PO1C 1HGTH 1GWAA 4FUJA 1GCTC 2GDEH 3DA9B 2HPQH 1J8AA 3S0NA 3E91A 1C5SA 1AVXA 4CRAA 4CRCA 4ABBA 1ZSJA 5A09A 5EXNA 3C27B 1QL8A 3MNXA 1TNKA 2HNTC 3AW0A 1FI8A 1GBTA 1QA0A 4U01A 3MHWU 2A2QH 3LH3A 3ZZDA 3A82A 1C1VH 1GHBF 2J5UA 3VEQB 4AG1A 3HGPA 4GHQA 4YXWD 1UTQA 2FZZA 1K9OE 1D3QB 1K21H 1OWDA 2H6MA 3W94A 3AAUA 2PUXB 1Y3UA 2ZU5A 2JH6D 2P8OB 3MQKC 1N6XA 1PYTD 1MTSA 2ZGCA 1P9SA 1G3DA 3ZVGA 4ZAEA 3BIUH 3QUMP 3SBKA 4K1EA 1BTHH 1QNJA 1GL1A 3P17H 2PKAA 4I8KA 1HAIH 1QRWA 1C1UH 5EODA 2LPRA 3A8AA 3SNDA 5PTPA 2PUQH 3KQDA 1S6HA 3M5OA 3A81A 3NPSA 4O3TA 8ESTE 2A4QA 1V2RT 3RXEA 4NIYA 1BTPA 5ETXA 1C5NH 1DS2E 1RTFB 1YWUA 4D7GA 1PPBH 4XFQA 4B76A 1EPTB 2PWXA 1FY5A 1O3BA 2IN2A 1TGBA 2OP9A 5GCHG 4UFGH 2BDIA 5C1XA 2GTBA 2I6SA 2DE8A 3SV8A 2BQWB 1DWBH 4FOUC 5E0JA 1BMAA 2HVXA 2ASUB 1IAUA 1KXEA 3EQ0H 2AH4X 1O30A 1FN6A 1BDAA 1A46H 1YF4A 1BOQA 3ODDA 4AFSA 3ZVDA 3A7YA 3GY7A 4CRGA 2P16A 4F4OC 4SGBE 3D49H 3GCOA 3BTFE 2BLWA 6LPRA 3KQBA 4X0WU 1IQMA 4DGJA 2VIQA 1GMHF 1SGCA 4K8YA 3IWMA 1CHGA 1BHXB 5LH8A 1W14U 1FJSA 3QGNB 4HZHA 1V2MT 3F9HA 1PPFE 2QF5A 1GI6A 5E0HA 2BM2A 1W0JD 4JZDH 1VGCC 1B0EA 1SOZA 1MTUA 1RS0A 1V2ST 2ZFFH 2AERH 4HG6A 1GI0A 2ZFTA 1MU8B 1RIWB 2ZCHP 3VB6A 1CA8B 4UE7H 1QBNA 4OS6A 1WTHD 3KYFA 1HBTH 2OXSA 3ZV8A 1MKXK 2HOBA 4UFEH 5FCKA 4AG2A 3BG4C 1C2KA 2BLVA 1SQRA 2BOHB 3V0XA 4BXWA 4UONA 5JBTA 1O2GH 2XNIA 5SGAE 1O2NA 1A0LA 1Z7KA 1BJUA 4BOHA 5DKMA 1O5EH 1K22H 1UVUH 2LELA 4DVAU 1E1RD 4RKJB 3RXGA 5F8TA 1EZQA 2ODQA 2BYAX 2ZECA 7GCHF 3MH5A 2ZI2H 2RA3A 1A0JA 4X8UH 3MFJA 1EZUC 3RP2A 1A5IA 3RXQA 1KTSB 1O39A 1DOJA 3TK9A 1EZSC 4INKA 1CA0C 1O32A 3KYGA 2KM0A 4XBDA 3RXBA 1DLKB 2GZ7A 2XW9A 1CT0E 1MKXH 9ESTA 1E36B 2XBWA 1ZGIA 4YTAA 1DFPA 5F8ZA 5JYIA 1O2RA 3FP7E 3PV5A 2ZGBH 1DE7H 3PTBA 4D9RA 1SQTA 5DP6A 1SQAA 2XNDD 1TNJA 4ISHH 4OGYA 4CRBA 2KR7A 1WQSA 4JYVH 1Z1JA 3LGYA 2FS8A 3VGCC 1YBWA 1EAUA 1EJNA 2FODA 1HJAB 1P03A 3B9FH 4ASHA 1QB6A 3M36A 3RXUA 1B7XB 1Y5UT 2V35A 3RXRA 4IMZA 3P8OA 1GJBB 2M2AA 2R2MB 4JZFH 5EJLA 4AGKA 3V3MA 4INLA 4K5ZA 5DSFA 1D3PB 5DGJA 1G3EA 4J1YA 4VGCB 1Z8JB 6GCHF 2TIOA 3QZQA 5ESBA 3KNXA 5LPFA 4TWWA 1QBVH 1O3KA 1S85A 1FY4A 2KFWA 1V2JT 2R9PA 1FXYA 1LPZB 4NA7A 7KMEH 2AGGX 1ZZZA 1F5RA 3SU6A 3SJ9A 1GVKB 3A7ZA 4ISIH 2J4IA 2UUJB 1GJ4H 1DSUA 4SGAE 4K2YA 1UW7A 2LNCA 4F55A 1LVYA 3D65E 4GVUA 1SLVB 4YLQH 1LQEA 1HUTH 1MABB 3NCLA 3RXTA 5JB8S 3BN9A 3TK6A 4WMEA 1W12U 1DANH 1GMDF 4AB8A 4D7FA 2ZA5A 1AFQB 2ILNA 2A4OA 1V2NT 1ZPZA 2OBQA 3MO6A 4Y0ZE 4CRDA 4Y79A 2BVXH 1MBMA 2IJD1 5AFZH 1L4ZA 3ZV9A 3EA9A 5KEDA 1UHBA 3SUFA 3LH1A 2XYAA 4A92A 2A31A 1SMFE 2FOCA 1SHYA 2JH5D 3HGNA 3N7DA 4NWKA 4UDWH 2ALVA 4ABAA 4WWYA 1DXPA 2O8UA 1WSSH 1LMWB 3LGWA 1F0RA 1SGDE 3TNTA 1EAIA 4A1XA 1NRQH 1AB9C 1W0YH 1YPMH 1GBCA 1J9CH 5ABWA 1KTTB 3MH4A 2VGCC 2FOHA 1NT1A 4YT6H 1XUIA 3KEEA 5GXPA 1TALA 3ODFA 3U8RH 3LT3A 2JETB 4BTUB 4ABHA 4RKOB 1GJ8B 3Q3KA 4X8SH 4CREA 1P10A 2B0FA 4ABIA 3DD2H 1C1NA 1QR3E 1O3GA 2ZTXA 3H7OA 3E16B 1NC6A 4IN1A 5EW2H 4Y10E 1V2PT 4XOJA 1O2MA 4GHTA 2A5IA 1A5HA 2BXUH 1TGCA 3K6YA 2VH0A 4IGDA 2Y7ZA 1DWDH 3BTEE 2R3YA 4I31A 1XVOA 2G51A 1F7ZA 2G4TA 3OEED 3UNSA 1UCYK 1P05A 4O9VA 5T6GA 4AX9H 1G2MA 1WBGB 2FXRA 3RMMH 1GHYH 1JWTA 3RXOA 4YOIA 1NRSH 1SSXA 4DCDA 3GY2A 3U8OH 1W7GH 4H42U 3RM0H 4MTBA 2VJ1A 1S82A 1QCPA 1TPOA 1BCUH 2AS9A 1HAGE 4OS5A 1ETRH 1UTOA 2O8TA 1NTPA 2JIZD 1EOJA 1GDNA 1AU8A 5C0TA 1C5WB 2V6NA 1TQ0B 4Q2KA 3MU1A 2P59A 1BA8B 1RTLA 4DOQA 1OWKA 2ZEBA 3TGIE 4JZIA 1SLUB 5F6MA 3FANA 2GD4B 3O8DA 1SGIB 3PLBA 1AHTH 1H8ED 3GCNA 1HAPH 4DIHH 2WV5A 3F0PA 4UFDH 1T4VH 2UWOA 5EQQA 4FXGH 2FOEA 1S0RA 1VZQH 1DPOA 3ZVFA 3BTME 1O2YA 5IDKA 4GCHF 2GMTC 4TSFD 3RXFA 3MWIU 2PR3A 1NRPH 3SU2A 2RA0A 7LPRA 2A1DB 2EI8A 4JZ1A 4FUBA 1SGFA 4YZUA 5JBCS 1MD8A 4I8GA 1ELFA 1GHWH 5DP8A 2WINI 1H8IH 3SU5A 1ZMNA 5HYOA 1WV7H 2OUAA 4I7YH 2ZHWH 3S69A 3K2UA 1QQUA 3UOPA 1OKXA 4DG4A 1ARCA 1KXBA 1KXCA 1MKWK 1TONA 4MPVA 2M5TA 2FI5E 5F03A 1C5QA 2QF4A 1OWJA 2G5VA 2NU1E 3RC5A 5C2ZA 1GJAB 1P2OA 1ANEA 1C5ZB 2ZG0H 1ZMJA 3GY4A 2Z7FE 1GJ7B 3HKIB 3P70B 3ZZ6A 3TITA 5C5NA 2ZGHA 1WAYB 3RMOH 1HJAC 1GBKA 1FMGA 1VJ9U 4E7RG 1MTNC 4X8VH 1H9IE 1MTWA 2ZHDA 3TK5A 1P2MA 1TNIA 3QWCH 4TY7A 2BOKA 1MCTA 2L74A 2SGAA 2C8WB 1MKWH 1IQIA 5ESTE 1UK3A 5I46H 1O3IA 3FP6E 2BVSH 2KAIB 1BTXA 3RXLA 4VGCC 1QHRB 5EJ1A 1BTYA 5HM9A 2AMQA 1GCDA 2WPJS 2OC0A 3SJKA 1Y3YA 1TX7A 4FETA 2BX3A 5L2ZH 2ODYB 2SFAA 3F9FA 4CBOA 2GDDA 2HGTH 1AUTC 2FOGA 2XC0A 4I32A 1MTVA 4THNH 5A8XA 1S5SA 1D6RA 4KGAA 5EOKA 3SJOA 2HVYB 5IYTA 3LIWA 4IBLH 1C1MA 3NKKA 1LDTT 4ZHLU 5C5OA 2A32A 2A7JA 1G37A 5HIYA 1YC0A 6CHAB 3NRLA 1Y3XA 2CXVA 3FVFB 1EZXC 4Z0KA 2OTVA 3LGUA 1VITF 4Q7XA 1DWEH 5CE1A 3N7OA 3RU4E 1GHVH 3RM2H 4Y8YA 3SV9A 3A8CA 4AC9A 2UWLA 4TT3D 5CHAB 4X1SU 1G36A 1S83A 4Q80A 4NWLA 2BB4A 3M5MA 1WTGH 1O2SA 3DSOA 3GCTG 1O2WA 1JOUB 1PQ8A 3T26A 1AZ8A 2CJIA 1EQ9A 2FPZA 1XM1A 2K8IA 1ELVA 1AIXH 3T2NA 5L2YH 1IQKA 2IJOB 3UY9A 2H1UA 5TJXA 1ZTJA 1CU1A 1D9IA 2QA9E 1YLNA 1OS8A 2TBSA 3S7KB 4LZ4B 1GGDB 4AYVB 1L1GA 2QF3A 3P8FA 8GCHF 3RXSA 1IQJA 3M37A 4IS5A 4Z6AH 1O3EA 4BAHB 4WVPE 1LHGH 4YOJA 4ASUD 2XBYA 1AGJA 1YCPK 1ZR0A 1V6DA 1GBMA 1V2UT 1LO6A 3FFGA 3PROA 1QJ1B 4AFUA 4KTUA 1ELTA 2PLXA 3DSPA 6GCHG 3RU4D 4B2CA 1TIOA 1K0HA 2F83A 4D8NA 1O35A 1KXFA 4TPYA 3BV9B 2WV4A 2FS9A 5DPAA 2WPDD 3RMLH 2FLBH 1QL7A 1DICA 1QQ4A 4A7IB 2IPQX 3URDA 1P06A 1ELDE 5EG4A 2R0KA 1JIMA 1GBHA 1GBEA 1L1NA 3SW2B 5JPMH 1MH0A 3PRBA 4X6OA 1FQ3A 1YCPH 3DFJA 4AGJA 3GYLB 5EW1H 4Y7AA 4MPWA 2Y82A 4AOQA 2IPHA 1GDQA 1Y5BT 2AFQB 5DJ7A 2P93A 2WYGA 3T5FH 4P02A 3GCHB 4YT7H 2WPKS 1B0FA 3RLYH 1C2DA 1P0SH 3NK8A 4IC5A 1RD3B 1ZMLA 4CH8B 3BEUA 1FV9A 4F48B 1IQEA 4K69A 1KLIH 2Z3CA 1C5UA 1QIXB 1YPJH 1GI8B 2KX4A 3LJJA 5GPIB 3TJNA 4ZH8A 4FU7A 1YKTA 2Z9IA 4WF8A 1ESAA 5AF9H 2J98A 1INCA 2PGQB 1MU6B 1TOCB 1DVAH 1LPKB 1SGFG 3ZZBA 3NXPA 2XCNA 3ZIAD 4KKDA 3V12A 1A1RA 3VXEH 2VWNA 3U28C 2ANWA 3GICB 5F53A 1GPZA 3KL6A 2BZ6H 3FN8A 2Q1JA 3TLOA 4MNYA 4BTTB 1HNEE 5GWZA 1EJMA 3UTUH 3LGTA 1K1MA 3EE0B 5DP3A 1YGCH 1C5XB 3Q76A 2ANMH 4K3JA 3E0NB 1O5FH 1GMCF 3ZZ4A 3CP7A 3SO3A 1T8NA 3DSGA 4TYDA 1CT4E 1UTJA 2J94A 4CHAC 3LPRA 1H9LB 2C8YB 4RI0A 4MPXA 1OXGA 4J2YB 1O0DH 1W0ZU 2CK3D 1YLCA 2OQ5A 1N1LA 3WWBA 1U6QA 1HIAA 1VCQA 4X1QU 1ABJH 4NSYA 4ZXYH 1OX1A 2Q6DA 3SGQE 2ZFRH 2THFB 4B2BA 1S81A 5TCCA 2BD7A 4E7NA 1O3JA 1BMLA 1UTLM 2FYQA 4ABDA 8KME2 3IG6B 4NIVA 5KGOA 2V3OH 2Y5FA 4HI3A 3TIUA 2QXJA 3ATMA 4WH6A 1K1JA 1C5MD 1P09A 4B75A 3U1IB 1O2LA 1UVSH 3JZ2B 1TMUH 2GT8A 4O03A 1TAWA 1UVTH 4JK6A 3FAOA 4XD7D 3T62A 1P2NA 4HFPB 4A1VA 2A45B 1GJ6A 3BTWE 4KP0A 2I6QA 2GV6A 1O3OA 1G32B 3MTYA 1HB0B 1SGRE 2SGPE 2J98B 1E37B 2F4LA 1UK4A 3SV7A 1BBRK 3ZYDA 1H1BA 6CHAC 1PQAA 2HWLB 3BIVH 1NBME 2FMJA 1GBDA 2ZU3A 3C1KA 5C20A 3PYHA 3DCLA 3LU9B 1AO5A 4GCHG 2BVRH 2ZU1A 1BRBE 2HNTF 3H7TA 2W6ID 3SGBE 3OX7U 2PKSB 2AGIX 3P6ZB 2JDID 1IQHA 1EATA 1O31A 1KLTA 1YPHC 4FUEA 2G81E 3H09A 3KGPA 5CHAC 3QLPH 1ZSLA 3SQEE 1AN1E 3SHAH 2BY5X 1EAWA 1CO7E 3OE7D 4P00A 3VG8A 2OBOA 2AEIH 1S6FA 2ZNKH 2CV3A 3U8TH 1TYNA 2FDAA 1NPMA 1HLTH 3T27A 1CGJE 4DT7B 1P3CA 1SLXB 2XRCA 2XTTB 1XUHA 3MU8A 2BHGA 5EU8A 5A8YA 4ISOA 2VWOA 2J34A 3T28A 1GI7B 1O3MA 1HIAB 3VB5A 4DJZB 1MUEB 2C8XB 5HXFA 1AE8H 1MAYA 4LK4A 1D4PB 3URCA 1LVBA 3CS7A 5HGGA 1SHHB 1YY3A 1FY8E 5E0GA 1O5CB 3GISB 2QN5T 1BT7A 1GJ5H 2EI7A 3LOXA 2PSYA 3OTJE 3OY6U 3O8CA 1J15A 1GGDC 5FCRA 1FY3A 3OY5U 1PYTC 3L6PA 3F2FA 1ZRBA 3UR6A 1C1SA 1MAXA 2C3SA 4ISLA 4D76A 3ZZAA 1FN8A 2ZFPH 2FIRH 2BQ7B 2O8LA 3W1EA 2RCEA 2BXTH 1SC8U 2PW8H 1NBMD 4ZKNU 4IW4E 1O3PB 2QCYA 4WY3A 3MYWA 3MH6A 1O2IA 2B5TB 2ZCKP 2H9HA 1ZTLA 2Q6GA 4K1TA 1O2KA 5FHTA 3SYJA 2ZGXH 4X1PU 4Y11E 1SG8B 3A87A 3A83A 5DK1A 2VWLA 1HAVA 1N6YA 1BUIA 3PMJA 4WXIA 3SHCH 1TNHA 3TJVA 9LPRA 1DDJA 2KZ4A 2FYRA 1ZHRA 1CBWB 5LPRA 5C1YA 2SNWA 3RXHA 2O9QA 1AFEH 2R3UA 1BIOA 1TFXA 1EP5A 1ELEE 1A61H 1HDTH 1O2OA 3TGKE 1GI3A 1Q2WA 3GY6A 1THPB 4NGAH 4Y8XA 1P57B 3TGJE 2ZC9H 1FX0B 2UUYA 3GYMA 5CHBA 5EIYA 1MMJN 1BZXE 4AN7A 1P11E 2P8OC 1MZDA 2ZPRA 1DSTA 2WHXA 1C5YB 1P04A 2FP7B 2GGVB 3I78A 3ZVCA 1T4UH 1CQQA 2QYIA 4GPGA 1SB1H 1O2HA 4X2YA 3TH3H 4Y0YE 2D2DA 1ANDA 4Q7ZA 1DX5M 1NS3A 4O97A 3ZVAA 2W26A 4NZLA 1BRCE 1GI9B 2FO9A 1K1NA 1THRH 2P3UB 4E05H 1Z8IB 3S9BA 4KTCA 3CS0A 3RU4T 3A8DA 1GVLA 1QJ7B 4XRNA 1GBJA 1F5LA 2FESH 3LC3A 1EPTC 2A4GA 3Q3YA 1Q31A 2A4RA 4XSKU 8GCHG 1RFNA 3KCGH 2EEKA 1J16A 5CMXH 4X1RU 1P2JA 1NFXA 2ZDKA 3DT0H 2H2ZA 3UAIC 1T31A 2F3CE 1N8OB 2ZDLA 5GCHF 3SZNA 3PMHB 1CHOG 1CT2E 1JIRA 4X6NA 2VBCA 2QY0B 3BTDE 1HAVB 1ACBE 5JB9S 4NA8A 1AZZA 4DY7B 1WUNH 2AHME 1BTUA 1TWXB 2B9LA 3K9XB 4F49A 1QGFA 1P2QA 3SJIA 2PP6A 2A2XH 4LOYH 4X2VA 3BF6H 2QV1A 1T8MA 2ALPA 1CE5A 1L2EA 2KAIA 2ZQ2A 1QBOA 1T8LA 5GNDA 2XC5A 2NWNA 3PLKA 1QB9A 3A7TA 2W5EA 2F91A 2ULLA 1UCYH 4KELA 3WW7A 4DURA 4H4FA 3RLWH 1C2GA 3TVJB 3HKJB 4DW2U 3PV2A 3ZZ5A 3PO1B 3SOSA 1RIWC 1W11U 2KCOA 4X1NU 1XUJA 1GCTB 1GHBG 2W6JD 1O3CA 2R2WU 3AAVA 2ZDNA 3OAAD 3AK5A 2TGPZ 4GLYA 1VITH 3KN2A 5FPYA 2VWMA 4TY6A 4FVDA 3LC5A 5E8EH 4YO9A 1HV7A 1QL9A 4BAOB 2HNTE 1DWCH 1C5LH 3SI4H 4A1TA 1O2JA 1FZZA 7ESTE 1ESBA 4FUHA 4BAMB 1AI8H 3GY5A 3STJA 3MNCA 2OK5A 2BMGB 3SU1A 1NU7B 2GV7A 1V2KT 3PTNA 3MH7A 5A0AE 3W95A 1GJDB 2G5NA 3AASA 4A6LA 1XUKA 4Q63A 1O5GH 1HPGA 3G01A 5C94A 4DIIH 2C8ZB 1TPAE 3RXKA 4K1SA 3P8GA 4Y76A 1SVPA 3VFEA 2ZP0H 1BTWA 3UQOA 2EI6A 3ZYEA 3DUXH 2CGAA 2STBE 4WH8A 5GDSH 2ZIQH 2BDHA 4RN6A 1Y5AT 1E35B 3LDXH 3VB3A 1H8DH 3T29A 1O3NA 1FLEE 3GDVA 1IOEA 4QT8C 3SN8A 2O8MA 4LZ1H 1QA7A 1P12E 1M9UA 1UVPA 1YPGH 4Z1MD 1C1PA 1J17T 1NRRH 1DXWA 1TABE 2VVCA 4NFFA 2P3TB 1K1OA 3UR9A 2WZQA 1Y3VA 3F0OA 3RC6A 2J9NA 2Z9KA 1ETSH 1AVWA 3A7XA 4ZKSU 1VR1H 1BQYA 1OWIA 1HAXB 2NU4E 4ZKRU 3F1SB 4GSOA 4NSVA 3S9AA 4BANB 2BY9X 1A3BH 1NN6A 3EYDA 3GS9A 4B2AA 3EA7A 1QURH 1W13U 1O36A 2QC2A 1ELAA 1TGTA 4B74A 4AYYB 1GMHG 2SNVA 3M5LA 3N7EA 1LKBA 4CR5A 5T1VA 5AHGH 3JZ1B 3S9CA 1EAXA 1Z8GA 1MQ5A 4ABFA 3DFLA 4RT1A 1EFRD 2ZTYA 1Z71A 4CH2B 2GCHF 2A7CA 4ZUHA 1ARBA 3OU0A 2ZHQH 1C1OA 4RT0A 1P8VC 2KCPA 1SOTA 2EA3A 1MZAA 1O3AA 2STAE 2BDBA 1F92A 2NU0E 1CBWC 1B5GH 5DG6A 1TA6A 1VGCB 1EJAA 1QFKH 4CRFA 5JBAS 1DY8A 3H5CB 1KY9A 3F3BA 1F5KU 1MQ6A 2BD2A 3SNEA 1HAZB 2VNTA 4ISNA 4JK5A 2VINA 4RSPA 1ZOMA 4OS7A 4Y6DA 2H9EH 2ZF0H 1E38B 1L0ZA 1GJ9B 5FPTA 2BTCE 1KIGH 7GCHG 2B7DH 1AFQC 3BG4B 2W7UA 2G00A 1TNGA 2SGQE 3ITIA 2QXIA 1XUFA 4ZMAH 2EQNA 1GI5A 5TCAA 2ZWLH 4XBBA 3I77A 3U9AH 2OQUA 5FL7D 3WWFA 1XUGA 1OWHA 3PRDA 1E34B 2F9PA 1A7SA 2XC4A 4OS1A 1AUJA 1UMAH 2D26C 2Y5GA 1CA0B 1GHAF 3UUZA 1EKBB 4BAQB 3HATH 3QK1A 1W10U 2FOFA 2F9UA 2A7HA 2O8WA 3Q00A 1IQLA 1O33A 2VIVA 3BEIB 5HMAA 2EY4C 1GBIA 1QJ6B 1S84A 1TB6H 2JETC 3QTOH 5JDUB 2ZPQA 3M5NA 2Z94A 3BTGE 5B6LA 5L30H 2PHBA 1HAHH 2L6OA 2ZHFH 4ZHMU 3U98H 3TH4H 4FU9A 2K0QA 2F9NA 4BAKB 1ZHPA 3UIRA 2HLDD 1ZJDA 1V3XA 4YESB 1A2CH 3UPEA 3VGCB 2YMSB 3FZZA 1XKAC 1GG6B 3PWBA 1UVOA 1H9HE 1OYTH 1HRTH 3QGJA 5C67A 1J14A 1ELGA 4X2WA 1OSSA 1RXPA 3I29A 1ESTA 2QE7D 1C2HA 4JYTA 5C0UA 1W7XH 2Y6TA 1WU1A 1P02A 2WPMS 5T3HA 2Y81A 1AE5A 5J4SA 1VJAU 4IMQA 3A7VA 1BMNH 1XXFA 2P3FH 2K1QA 1FPHH 3SU3A 3ENSB 4YOGA 3WY8A 4JZEH 1S6LA 2J92A 2VIWA 3M3VA 4U30A 3EE7A 5FPSA 3FOAA 4Y8ZA 5EXMA 1C9PA 2GKVE 6ESTA 3RUOA 1JMOH 2ANYA 2BY6X 3Q77A 4M9FA 1ZTKA 2XOKD 4AB9A 5BRRE 3MU5A 1O5BB 5BPEA 1GJCB 2CMYA 1K1IA 1ELCA 1THSH 4CBNA 1GMDG 3GY8A 2GZ8A 3BG8A 3MO9A 2RDEA 3GDSA 1C2MA 2VIOA 2RFKC 1Y8TA 4YM9A 4O3UA 5AVDA 1LCYA 3CENA 3RXCA 1C1TA 3M7QA 1ABIH 3SQHE 1K28D 1SGNE 2W3IA 2CN0H 4BTIB 4FUDA 3SUGA 2VVVA 2XCFA 2YMSD 1TLDA 1HAOH 1A4WH 1YCPM 2BDGA 2JH0D 4FUGA 2LP6A 1Z6JH 1OYQA 3M3TA 1LHEH 3EGKH 1FIZA 1TPPA 4UEHH 1NROH 5KECA 2GVFA 1W0KD 5T6FA 5FX5A 1P2KA 1ZRKA 2BD9A 1UJ1A 1P01A 3QZRA 1ZPBA 3QO6A 4PROA 2J95A 1AB9B 3F2GA 1O3LA 5DP9A 1NESE 1SGPE 3L33A 3PB1E 2ANKH 2VGCB 2TGAA 3EDXB 2QF0A 3HPTB 4FU8A 5C3NA 1NZQH 3NUMA 1HXFH 2FLRH 2WUCA 2F9VA 1SR5C 3TNSA 2A5KA 2QXHA 3GOVB 3ELAH 3MOCA 1F2SE 1SLWB 4I86A 3RMNH 4X2XA 5J4QA 4H6TA 3PMAB 3T25A 4NIWA 1Z8RA 2Y80A 3LONA 3SGAE 1SQOA 1ZHMA 3TJUA 3UREA 2RDLA 3ESTA 3SV2H 2IOTA 3SI3H 4ACBA
chains in the Genus database with same CATH topology
2ZQ1A 1JRTA 3SNAA 3SORA 1O3HA 5DP5A 1O34A 2HLCA 2GT7A 3O8RA 4WJG2 2ZCLP 1UCYE 3ZVBA 3AVZA 1FIWA 1C5TA 1G30B 1KYNA 2Z9LA 2FTMA 3F68H 4B73A 2VIPA 2R0LA 3KF2A 1F0SA 1HFDA 2CF9H 3A85A 3V7TA 2WPHS 4BNRA 3ZZ3A 4B1TA 2G8TA 2SGDE 1SGTA 1IQNA 1NY22 1FAXA 3SU4A 2FOAA 2BDCA 4U32A 2FM2A 5E2OA 3BTQE 3E1XB 2GZ9A 3RXPA 2CHAB 1C9TA 5DP4A 4B71A 4LXBH 1PPGE 5EPNA 3LJOA 1OWEA 3KQCA 1IHSH 1G9IE 1PPHE 1TRYA 1YYY1 2VH6A 1TBZH 1Y59T 1PQ5A 1TGNA 2VB0A 3KIDU 3O8BA 1ZJKA 4ABGA 1YM0A 1SGEE 2Z3EA 1EP6A 2C4FH 2GP9B 1LVOA 1GBLA 1BITA 2GMTB 1DM4B 4NA9H 1MCVA 1BBRH 5H4IB 2PKAB 1PPEE 2AMDA 5FBEA 2AIPA 5L6NH 2UWPA 1KXDA 1D3TB 1EX3A 1CSOE 3R0FA 3RXDA 5DO4H 3KQEA 2XBXA 1LKAA 2XWAA 1GI4A 1AD8H 2OCVB 1SBWA 1HYLA 4Q7YA 1C2JA 1GBBA 4K60A 3GCTF 1FDPA 1UTPA 2TPIZ 3ZZ9A 1F0UA 1O2PA 1FY1A 5A2MH 3E0PB 1C1WH 2UUKB 1ELBA 1C5RA 1KDQA 1WQVH 1PPCE 2H5DA 1P9UA 1QRXA 2FOBA 4XDEA 5K0HA 2W3KA 3OSYA 5A0CA 4OS2A 3K65B 1PJPA 3BTTE 3SJ8A 4MVNA 2WYJA 3M35A 2CF8H 1BB0B 4Y7BA 2AGEX 1GG6C 2SGEE 1LVMA 1MTNB 1AWFH 2BD3A 2FOMB 2ZFQH 1L4DA 3AW1A 1V2WT 3ZZCA 3A89A 1SFIA 4WMDA 1V2LT 2D8WA 1WYKA 2WPIS 1MD7A 4AZ2B 1DY9A 4NG9H 3SNBA 1C4V2 2JKHA 3R3GB 5LGOA 2F9BH 2GCHG 1QRZA 3ATWA 2ZFSA 2Z9GA 4UD9H 1ZGVA 2VU8E 4E06H 3IITA 1FNIA 1EOLA 1Y3WA 3A86A 2Y5HA 2QIQA 3TJOA 4M7GA 2ZDMA 3GCHC 1VITG 3QDZB 5E2PA 2RG3A 2B8OH 1SPJA 2AYWA 1HJ8A 1O2TA 3EA8A 1BJVA 1VCPA 2BD4A 3VB7A 1SL3A 3E6PH 3V13A 3K6ZA 2FWWA 4MNVA 5EQRA 1K1LA 5A0BA 1C5VA 4JMYA 1TNLA 5K7RA 1TGSZ 1X7AC 1TRNA 1KLJH 2P95A 2VIDA 5JBBS 1DLEA 5HM2A 2C90B 1CGIE 3P8NA 1TBRH 2D1JA 2OC1A 3RXMA 4HGCA 4IN2A 2FI4E 1HAYB 1E0FD 1K2I1 1UTMA 1SFQB 1SGYE 2GCTB 3MMGA 3SNCA 1TPSA 1GHAG 5LPEA 1DUAA 1WCZA 3DHKH 1AKSA 1S0QA 4I8JA 4NFEA 1G3BA 3TPIZ 1KDQB 1LPGB 3QTVH 2VVUA 3U69H 3BSQA 1NM6A 1HCGA 1FAKH 1A5GH 5A8ZA 3FP8E 2WPLS 4I8LA 2ZU2A 1XXDA 1RRKA 2OINA 2QXGA 2XWBI 3MO3A 1G2LA 5B6OA 2BD8A 2QGRA 4HTCH 3VB4A 1EUFA 2HALA 2PTCE 4AFZA 4NIXA 2OC7A 1A0HB 1EASA 2V3HH 1V2TT 2F9OA 3QX5H 1GBAA 1P2IA 2FEQH 2HPPH 1TOMH 3HK3B 3ATLA 3GY3A 1V2QT 3BTHE 3M3SA 1AWHB 1IQGA 2ZDAH 1TX6A 2BX4A 3F6UH 1ETTH 1ZPCA 2A5AA 2Z6BD 5FXLA 1XKBC 3P92A 2G4UA 1JRSA 1QB1A 4MDSA 2HRVA 1RJXB 3B8JA 3ATKA 2TGTA 1HJ9A 2BY8X 1LHCH 3ATIA 4ZKOU 1V2VT 2C93B 3PMBB 4MQAA 3UQVA 3TH2H 3RXVA 2ESTE 4MPUA 1RGQA 1FUJA 3RC4A 2BDAA 2UUFB 2XBVA 3E3TA 3MU0A 4BXSA 2ZKSA 1WOFA 1G3CA 2BD5A 4WXVA 1GHXH 5T6DA 2YOLA 3M7UA 1YPKH 4XBCA 2AIQA 3UWJH 1NFWA 5EPYA 3ZZ8A 1W2KH 3PWCA 1DUEA 1O2UA 4MG3A 3E8LA 2V0BA 1Q3XA 2GX4A 3E90B 1TE0A 2CHAC 4R8TB 2ZU4A 1ANCA 2PV9B 1QTFA 3MU4A 5EQSA 1O5DH 1C4U2 4KTSA 4AORA 3NZIA 2FX4A 2PKSC 1F0TA 3UWIA 1T32A 3U1JB 1C1RA 1UHBB 1XX9A 2ZTZA 1AKSB 1UTKA 1GHZA 4H6SB 1OOKB 1YP9A 1KXAA 2PSXA 3A8BA 3UNRA 4ABJA 1BTZA 2BLQA 1ID5H 5EXLA 2G52A 1KSNA 3MI4A 4FUCA 2W7SA 1IQFA 4XE4A 1TX8A 2J2UA 2PFEA 5DP7A 3BTKE 1GMCG 4I33A 1C5OH 2ZO3H 3STIA 1EXFA 2ZGJA 4A5TS 3PV4A 1MBQA 1YPEH 1UO6A 1AVGH 2H5CA 3PM3A 3A7WA 3D23A 1AQ7A 4FUFA 5FAHA 3A80A 2ODPA 5GJ4B 1DT2A 2AMPA 3Q3XA 1BRAA 1SI5H 2BQ6B 3TU7H 3NWUA 1D3DB 2XXLA 1O3DA 1TQ7B 4CHAB 3M61U 5G4BA 3MNSA 1V2OT 1W3CA 1YLDA 1ZYOA 2SGFE 3RDZA 1ORFA 2OLGA 2YNBA 1ZSKA 1TBQH 3KHVA 3A88A 5FX6A 1C2IA 3F9EA 3UNQA 1JBUH 2P94A 4NZQA 3SUDA 2EC9H 1T7CA 1Z1IA 1O5AB 3RXAA 1TRMA 1O38A 3S7HB 1TA2A 3LGVA 3M7TA 2DE9A 3EAJA 1C5PA 4IC6A 1O3FA 1L1JA 4U2WA 2Y7XA 2FTLE 2TRMA 1DITH 5EGMA 3UOUA 1LTOA 3RXJA 1LHFH 2PTNA 1PQ7A 4YLUA 2G55A 4MNXA 1D6WA 4ESTE 3BEFB 2PGBB 3HK6B 3UFAA 2NU3E 1BHXF 1P3EA 1O2QA 3SV6A 1GDUA 4ZXXH 4AFQA 1BMMH 2ZHEH 3SU0A 1LHDH 1O2XA 1QY6A 3PLPA 2BY7X 1TMTH 3ZZ7A 4JCNA 2BLOA 5I25A 1H4WA 4OGXA 1VCWA 2Z3DA 1PFXC 1GI2A 1BBRE 1T8OA 1YPLH 1O2ZA 1BRUP 1GI1A 4CR9A 2ZDVH 4K8BA 4X6MA 1GL0E 4ZHAA 1OPHB 1UTNA 1NFUA 5C1UA 1YPHE 1TMBH 1EB2A 1CGHA 5GIBA 2ZZUH 2GCTC 3LKWA 3QN7A 1Z6EA 1NRNH 4TWYA 1JXPA 2Q6FA 2BZAA 3B23B 3SUEA 4ZROA 1O37A 2BDYA 2DUCA 1OP8A 3F9GA 1LQDB 4Y71A 1ZLRA 5F8XA 4R0IA 4FUIA 5FBIA 4TPIZ 4X6PA 3OYPA 1PPZA 3FZDA 1NFYA 4MNWA 1NU9A 1NO9H 4WMFA 1FONA 4JYUH 1XMNB 3L3TA 1C1QA 1O2VA 4X8TH 1SGQE 1N8OC 2J38A 3VXFH 2YNAA 3LGIA 4FVBA 2ZPSA 3VPKA 4I8HA 1C2EA 1CVWH 2OD3B 1EPTA 1C4Y2 1OP2A 3A84A 8LPRA 4OS4A 2QAAA 1A3EH 2OC8A 2H9TH 4UFFH 1W8BH 3D62A 1RTKA 1AY6H 4INHA 4MLFB 1CHOF 1C2FA 1EB1H 2Z9JA 1XVMA 2NU2E 1HXEH 3MNBA 1OP0A 3P95A 1GBFA 1K1PA 2TGDA 2FX6A 4GAWA 3GDUA 1C2LA 1UK2A 3RXIA 4GUXA 1ANBA 3ZVEA 2FI3E 4ABEA 1FPCH 4NCYA 1GVZA 4D9QA 2A0QB 1AMHA 5AFYH 2WUBA 1IHTH 3PO1C 1HGTH 1GWAA 4FUJA 1GCTC 2GDEH 3DA9B 2HPQH 1J8AA 3S0NA 3E91A 1C5SA 1AVXA 4CRAA 4CRCA 4ABBA 1ZSJA 5A09A 5EXNA 3C27B 1QL8A 3MNXA 1TNKA 2HNTC 3AW0A 1FI8A 1GBTA 1QA0A 4U01A 3MHWU 2A2QH 3LH3A 3ZZDA 3A82A 1C1VH 1GHBF 3VEQB 4AG1A 3HGPA 4GHQA 1UTQA 2FZZA 1K9OE 1D3QB 1K21H 1OWDA 2H6MA 3W94A 3AAUA 2PUXB 1Y3UA 2ZU5A 2JH6D 2P8OB 1N6XA 1PYTD 1MTSA 2ZGCA 1P9SA 1G3DA 3ZVGA 4ZAEA 3BIUH 3QUMP 3SBKA 4K1EA 1BTHH 1QNJA 1GL1A 3P17H 2PKAA 4I8KA 1HAIH 1QRWA 1C1UH 5EODA 2LPRA 3A8AA 3SNDA 5PTPA 2PUQH 3KQDA 1S6HA 3M5OA 3A81A 3NPSA 4O3TA 8ESTE 2A4QA 1V2RT 3RXEA 4NIYA 1BTPA 5ETXA 1C5NH 1DS2E 1RTFB 4D7GA 1PPBH 4XFQA 4B76A 1EPTB 2PWXA 1FY5A 1O3BA 2IN2A 1TGBA 2OP9A 5GCHG 4UFGH 2BDIA 5C1XA 2GTBA 2I6SA 2DE8A 3SV8A 2BQWB 1DWBH 5E0JA 1BMAA 2HVXA 2ASUB 1IAUA 1KXEA 3EQ0H 2AH4X 1O30A 1FN6A 1BDAA 1A46H 1YF4A 1BOQA 3ODDA 4AFSA 3ZVDA 3A7YA 3GY7A 4CRGA 2P16A 4F4OC 4SGBE 3D49H 3GCOA 3BTFE 2BLWA 6LPRA 3KQBA 4X0WU 1IQMA 4DGJA 2VIQA 1GMHF 1SGCA 4K8YA 3IWMA 1CHGA 1BHXB 5LH8A 1W14U 1FJSA 3QGNB 4HZHA 1V2MT 3F9HA 1PPFE 1GI6A 5E0HA 2BM2A 4JZDH 1VGCC 1B0EA 1SOZA 1MTUA 1RS0A 1V2ST 2ZFFH 2AERH 1GI0A 2ZFTA 1MU8B 1RIWB 2ZCHP 3VB6A 1CA8B 4UE7H 1QBNA 4OS6A 1WTHD 1HBTH 2OXSA 3ZV8A 1MKXK 2HOBA 4UFEH 5FCKA 4AG2A 3BG4C 1C2KA 2BLVA 2BOHB 3V0XA 4BXWA 4UONA 5JBTA 1O2GH 2XNIA 5SGAE 1O2NA 1A0LA 1Z7KA 1BJUA 4BOHA 5DKMA 1O5EH 1K22H 1UVUH 4DVAU 4RKJB 3RXGA 5F8TA 1EZQA 2ODQA 2BYAX 2ZECA 7GCHF 3MH5A 2ZI2H 2RA3A 1A0JA 4X8UH 3MFJA 1EZUC 3RP2A 1A5IA 3RXQA 1KTSB 1O39A 1DOJA 3TK9A 1EZSC 4INKA 1CA0C 1O32A 4XBDA 3RXBA 1DLKB 2GZ7A 2XW9A 1CT0E 1MKXH 9ESTA 1E36B 2XBWA 1ZGIA 4YTAA 1DFPA 5F8ZA 5JYIA 1O2RA 3FP7E 2ZGBH 1DE7H 3PTBA 4D9RA 1SQTA 5DP6A 1SQAA 1TNJA 4ISHH 4OGYA 4CRBA 1WQSA 4JYVH 1Z1JA 3LGYA 2FS8A 3VGCC 1YBWA 1EAUA 1EJNA 2FODA 1HJAB 1P03A 3B9FH 4ASHA 1QB6A 3M36A 3RXUA 1B7XB 1Y5UT 2V35A 3RXRA 4IMZA 3P8OA 1GJBB 4JZFH 2R2MB 4AGKA 3V3MA 4INLA 4K5ZA 1D3PB 5DGJA 1G3EA 4J1YA 4VGCB 1Z8JB 6GCHF 2TIOA 3QZQA 5ESBA 3KNXA 5LPFA 4TWWA 1QBVH 1O3KA 1S85A 1FY4A 1V2JT 2R9PA 1FXYA 1LPZB 4NA7A 7KMEH 2AGGX 1ZZZA 1F5RA 3SU6A 3SJ9A 1GVKB 3A7ZA 4ISIH 2J4IA 2UUJB 1GJ4H 1DSUA 4SGAE 4K2YA 2LNCA 1LVYA 3D65E 4GVUA 1SLVB 4YLQH 1LQEA 1HUTH 3NCLA 3RXTA 5JB8S 3BN9A 3TK6A 4WMEA 1W12U 1DANH 1GMDF 4AB8A 4D7FA 2ZA5A 1AFQB 2ILNA 2A4OA 1V2NT 1ZPZA 2OBQA 3MO6A 4Y0ZE 4CRDA 4Y79A 2BVXH 1MBMA 5AFZH 1L4ZA 3ZV9A 3EA9A 1UHBA 3SUFA 3LH1A 2XYAA 4A92A 2A31A 1SMFE 2FOCA 1SHYA 2JH5D 3HGNA 4NWKA 4ABAA 4UDWH 2ALVA 4WWYA 1DXPA 2O8UA 1WSSH 1LMWB 3LGWA 1F0RA 1SGDE 3TNTA 1EAIA 4A1XA 1NRQH 1AB9C 1W0YH 1YPMH 1GBCA 1J9CH 5ABWA 1KTTB 3MH4A 2VGCC 2FOHA 1NT1A 4YT6H 1XUIA 3KEEA 5GXPA 1TALA 3ODFA 3U8RH 3LT3A 2JETB 4BTUB 4ABHA 4RKOB 1GJ8B 3Q3KA 4X8SH 4CREA 1P10A 2B0FA 4ABIA 3DD2H 1C1NA 1QR3E 1O3GA 2ZTXA 3H7OA 3E16B 1NC6A 4IN1A 5EW2H 4Y10E 1V2PT 4XOJA 1O2MA 4GHTA 2A5IA 1A5HA 2BXUH 1TGCA 3K6YA 2VH0A 4IGDA 2Y7ZA 1DWDH 3BTEE 2R3YA 4I31A 1XVOA 2G51A 1F7ZA 2G4TA 3UNSA 1UCYK 1P05A 4O9VA 5T6GA 4AX9H 1G2MA 1WBGB 2FXRA 3RMMH 1GHYH 1JWTA 3RXOA 4YOIA 1NRSH 1SSXA 4DCDA 3GY2A 3U8OH 1W7GH 4H42U 3RM0H 4MTBA 2VJ1A 1S82A 1QCPA 1TPOA 1BCUH 2AS9A 1HAGE 4OS5A 1ETRH 1UTOA 2O8TA 1NTPA 1EOJA 1GDNA 1AU8A 1C5WB 2V6NA 1TQ0B 4Q2KA 3MU1A 2P59A 1BA8B 1RTLA 4DOQA 1OWKA 2ZEBA 3TGIE 4JZIA 1SLUB 5F6MA 3FANA 2GD4B 3O8DA 1SGIB 3PLBA 1AHTH 3GCNA 1HAPH 4DIHH 2WV5A 4UFDH 1T4VH 2UWOA 5EQQA 4FXGH 2FOEA 1S0RA 1VZQH 1DPOA 3ZVFA 3BTME 1O2YA 5IDKA 4GCHF 2GMTC 3RXFA 3MWIU 2PR3A 1NRPH 3SU2A 2RA0A 7LPRA 2A1DB 2EI8A 4JZ1A 4FUBA 1SGFA 4YZUA