1A0JA

Crystal structure of a non-psychrophilic trypsin from a cold-adapted fish species.
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYECRKNSASYQASLQSGYHFCGGSLISSTWVVSAAHCYKSRIQVRLGEHNIAVNEGTEQFIDSVKVIMHPSYNSRNLDNDIMLIKLSKPASLNSYVSTVALPSSCASSGTRCLVSGWGNLSGSSSNYPDTLRCLDLPILSSSSCNSAYPGQITSNMFCAGFMEGGKDSCQGDSGGPVVCNGQLQGVVSWGYGCAQRNKPGVYTKVCNYRSWISSTMSSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Structure of a non-psychrophilic trypsin from a cold-adapted fish species.
pubmed doi rcsb
molecule tags Serine protease
total genus 56
structure length 223
sequence length 223
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1997-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1a0jA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1a0jA02
1EXFA 1EB1H 1GJAB 4NG9H 1KY9A 1F92A 4WMEA 3EA8A 1XMNB 8LPRA 1AZZA 1P09A 1TRYA 3VGCC 1NU9A 5C67A 1C1QA 3DUXH 1C1VH 2QA9E 4BAHB 3M5MA 4LZ4B 3BV9B 2C93B 4GCHG 3KNXA 3LGTA 1K9OE 5C2ZA 4DCDA 1TNJA 2PW8H 2BDIA 1AFEH 3GY6A 2ZGCA 3SGBE 3TH2H 3NCLA 2A7CA 1V2LT 1G36A 1GBFA 4ZHLU 4BOHA 1CBWC 1P57B 1LHCH 2NU3E 2PR3A 2QF3A 3AASA 2H5DA 1C2EA 5A8ZA 2GV6A 2TBSA 4AN7A 1SGYE 1NO9H 1BT7A 1DICA 2XBXA 5FAHA 3TNSA 1QB1A 4WVPE 1QA0A 2O8TA 4U32A 1KLTA 4Y7BA 1ZOMA 1O2PA 1Y5BT 3LT3A 3U8OH 1BRCE 1BBRE 3PLKA 1ZLRA 5AFZH 1G3BA 3V0XA 1SGIB 4WF8A 2GV7A 1OWJA 1TGTA 2FZZA 4A6LA 3FZDA 1TA6A 2XC4A 1GDNA 4XE4A 2QY0B 2P94A 2F9NA 1XXDA 1AKSA 1TLDA 2A7JA 3DD2H 1P3CA 1O2RA 3BTHE 1XM1A 1SSXA 1Z8GA 3A7YA 4K2YA 1HAZB 2TGTA 4CRBA 2ZF0H 3SU2A 3E3TA 4DY7B 1A0LA 3K9XB 4ISIH 4CR5A 1TPOA 3GDUA 3LC3A 1GJCB 1FONA 2GTBA 1AU8A 3DFLA 3R0FA 1GMHG 1NM6A 1S5SA 3MU1A 1TBQH 1GBIA 4KP0A 1O2YA 1O3HA 2PKAB 2TGAA 1HJ8A 2J34A 1TNKA 3SW2B 1TONA 3PO1B 1BTUA 1GI9B 5ESBA 3A8DA 1Q3XA 1O37A 1OWHA 2XNIA 3RMMH 4E7NA 4I7YH 4K1TA 1ELFA 3M5OA 1F2SE 3MO3A 4YO9A 4ABAA 4GHTA 4TWWA 3BG8A 2ZHEH 1TOCB 3U1JB 3TJNA 2NU0E 5DKMA 1TWXB 2ZTYA 3UNRA 2BDGA 4XOJA 2QF0A 1NZQH 4JYUH 1B0FA 2SNVA 2BDAA 5EU8A 3KQDA 1C1MA 1H9IE 1HCGA 1B5GH 3SQHE 2BD8A 1QL8A 2OBQA 2BM2A 1MTUA 2AH4X 1DDJA 4O97A 3RXTA 2ZO3H 1AI8H 1V2TT 1HJ9A 1HNEE 1P9SA 3ATLA 1TGBA 8GCHF 1WBGB 3BEUA 4U30A 1DM4B 3MWIU 5HMAA 1DWEH 2BLWA 1L4DA 3ZZAA 1VITF 3FFGA 2ZHWH 3FAOA 1F0SA 1IQLA 2FMJA 1CGJE 4GHQA 3RXHA 2OINA 1IQEA 1NFYA 4DT7B 2UWOA 1IQMA 3TK6A 3BTFE 4B76A 3BTGE 1GBBA 1THRH 3E16B 2FOBA 1K28D 3STIA 2ASUB 1QB6A 3QTVH 2VWOA 3ELAH 5EW1H 3TH4H 1SQOA 2TGPZ 1EATA 3B8JA 1S81A 4XBDA 2VJ1A 5C1XA 4NZQA 1P8VC 2WUBA 3Q3YA 3ZZ9A 1QCPA 2DUCA 3GCHC 1T8NA 2EC9H 1LKAA 2NU2E 1BUIA 2ZA5A 3SJOA 1GJ9B 3RXPA 5BRRE 1C1UH 2XWBI 4X6NA 3PM3A 1ARBA 2FI5E 1MTNB 3AW0A 1GCTC 1A7SA 1CSOE 5AHGH 1CVWH 2GCTB 5FBEA 1LQDB 1AUJA 1HAVB 4AGKA 2AERH 2GDDA 1LVOA 3LGUA 2BXUH 2BLOA 1W14U 1P2OA 2QXHA 4MDSA 1O2JA 4UFDH 5FCRA 4ABBA 2GX4A 1SGRE 1MMJN 1P2JA 3F68H 2ZPRA 4NWKA 4JZ1A 1MKXH 2BY9X 1O2TA 3F9FA 3RMLH 1VR1H 4UFEH 3RXLA 1P02A 1QIXB 1GWAA 1OYTH 1EAIA 3A83A 3A7XA 1ZR0A 2AYWA 3QGNB 1S0QA 2GZ7A 4A1TA 1QQUA 2YNAA 2ZDMA 3CENA 4YESB 3A7WA 2ZZUH 4PROA 3UOUA 1LHEH 3PLBA 2QXIA 2VWMA 2STBE 1LPGB 3A82A 1EZSC 3M5LA 1O2HA 1RD3B 1T7CA 5EPYA 1O3FA 2F9VA 1T32A 1DVAH 5E0HA 3SHAH 3BG4C 4OS2A 1TPSA 2P95A 1C2IA 5G4BA 3RXFA 3TJUA 3MO6A 1GHWH 3D62A 3T62A 4NIVA 4X8VH 1TRNA 2A4QA 2VVCA 4LXBH 1DWCH 1TAWA 3MO9A 3P8OA 1BBRH 1GBJA 4GAWA 1O3OA 3UOPA 1ETTH 4I8JA 3IITA 1PPGE 3RXKA 1D6WA 1OS8A 2GT8A 3URCA 2Y7XA 4NFEA 3M3VA 2GZ9A 3UNQA 1XVOA 2XTTB 1TMUH 1PQAA 2JETC 1AHTH 4Y76A 1LVMA 1YM0A 2GMTC 1JIMA 1XUIA 1O2ZA 1GI0A 1GJ6A 2BD4A 4FVDA 1FIZA 3MOCA 4XBBA 1V2WT 1HFDA 1D3QB 1ZSKA 4GCHF 1ACBE 3ZVEA 2QYIA 2C3SA 1CE5A 3TVJB 2BD5A 3OU0A 4E06H 2Z9KA 2O8MA 1JMOH 4Y0ZE 1C5ZB 1ZMLA 1KXAA 2ZKSA 1IQHA 1F7ZA 1Z1IA 4MPVA 4KGAA 1V6DA 4CHAB 1GVZA 1SGPE 3IWMA 4D76A 2BX4A 4XFQA 3P17H 5A2MH 4MQAA 2J92A 1BBRK 3H7OA 1YKTA 2AMDA 4MNXA 1IAUA 1OP8A 5A0AE 1QHRB 5FX5A 4DJZB 4Y71A 1F5RA 1F0TA 1O2OA 1C1SA 1N8OC 1O3BA 2Z3DA 1FJSA 1GMDF 3L6PA 1BRBE 3ATIA 3RXSA 4DVAU 1TQ7B 4R0IA 1A46H 2D26C 1P2NA 1F5KU 2C8ZB 2JKHA 4X1SU 5C5NA 1KDQA 4RN6A 4ZUHA 2ZFTA 5F6MA 4Z0KA 3F1SB 3ODDA 1YPHC 2OTVA 1YPLH 1WQVH 1O3JA 1S85A 3M36A 5ABWA 2P16A 1T8OA 3MU4A 3SN8A 1TNLA 4H42U 4OGXA 5EODA 1NN6A 5DP5A 3BTEE 3LPRA 3E0PB 3F9GA 1YLCA 2WPLS 5DP9A 4CRCA 1DE7H 3T2NA 1TNGA 3H7TA 1GI4A 1KXDA 1C5QA 4X6PA 1Y3VA 1LKBA 1GMHF 3UQOA 3VB3A 1LDTT 2D8WA 2A7HA 3ZVBA 3U8TH 1BZXE 1NU7B 1LPZB 3SV6A 1Z8IB 3M37A 2I6SA 4UFGH 1UCYH 2ZI2H 3A84A 1TNHA 1TX6A 3HGPA 1O2UA 2ZHDA 2OP9A 1C5PA 5JBTA 1TBRH 3UUZA 1K1JA 1GDUA 3LH1A 1AY6H 4TWYA 3GY2A 1SOZA 2ZCLP 3RMNH 1B0EA 2ZCKP 4B73A 3SORA 2FTLE 1N6XA 2XBWA 1BTHH 2ZFQH 4TY7A 3RMOH 1L0ZA 1CA0B 1FZZA 1Z8JB 3QK1A 3VPKA 4ASHA 1DXWA 3HATH 2ODPA 4JMYA 1BMAA 3OSYA 3PV4A 1VITH 3MFJA 7LPRA 1BIOA 1SLXB 1ZTKA 6GCHG 2P3TB 4Q2KA 2ZHFH 2F9PA 3KGPA 4MNWA 2HGTH 1GHZA 1ZJDA 2TPIZ 4VGCC 2BD9A 2OD3B 1S6FA 3FZZA 2J9NA 1MKWH 1CHOF 3A88A 2OQ5A 1RJXB 2DE8A 4KELA 3PB1E 4THNH 3ENSB 3RC5A 2B0FA 1CT2E 3VEQB 1C5SA 1FLEE 4CRDA 2TRMA 2P59A 2PUXB 4X2XA 2OQUA 4JZEH 2RDLA 1WAYB 2BVSH 1S82A 3KQEA 1XUFA 1O3DA 3A7VA 3NK8A 1ABIH 1O2SA 2EEKA 3AW1A 2G51A 3ZZ4A 4D9RA 1Y3XA 2ANYA 1RTLA 2ZQ2A 3ZV9A 1O5GH 1VCWA 3GISB 4JZDH 1HLTH 2BD3A 4FUBA 5GJ4B 2A4OA 2HNTE 1MD8A 2W7SA 1ELGA 3EA9A 3U1IB 1QURH 3A7TA 2BYAX 4Y8XA 1BJVA 1BTXA 5C1YA 3GOVB 1BOQA 1QA7A 1ZSLA 5GCHG 4AGJA 3PWBA 4FUFA 2ANMH 4YZUA 4BAKB 1TFXA 2CN0H 3GDVA 1O5EH 4O3TA 1QRXA 3GY8A 3LGIA 4K3JA 4X0WU 1F0RA 1ZRKA 3UQVA 1E0FD 1BHXB 3LGVA 3SUDA 1EP5A 1CHGA 2BX3A 3ZYDA 1K1OA 1RIWB 3JZ1B 1FPCH 4B1TA 4K60A 1GHXH 1SB1H 2FP7B 2FPZA 3BTDE 4A1VA 4INLA 1C5YB 1SOTA 1P2KA 2W5EA 4AB8A 1L1NA 1EPTB 1GHAG 1SG8B 3LIWA 4QT8C 1NFWA 1SGTA 5E2PA 3E6PH 1K1PA 4FXGH 2ALPA 3RXDA 1T4VH 5F8XA 4J2YB 1C1TA 4A92A 1TIOA 2G4TA 2ZDAH 4JYTA 1JOUB 1SLVB 2FXRA 2FOEA 2WPKS 2CF8H 2ZGHA 1BJUA 4NFFA 1MTSA 5EGMA 3K6YA 4NGAH 1O31A 1SQAA 2SNWA 2VIPA 3H5CB 5DP6A 1BA8B 2EA3A 2JH0D 2UWLA 3V3MA 1BRUP 1G3EA 2B9LA 2G8TA 1TPPA 1SLUB 3TK9A 1Z71A 1QBNA 1HXFH 4JK6A 1SPJA 1GJ7B 4J1YA 2VH0A 1QJ1B 2FDAA 3FP7E 1P2QA 1O3LA 2F83A 3L33A 2IJOB 2A2QH 1QGFA 1EASA 1GHBG 1O2LA 1SGQE 5EG4A 3UTUH 1SGDE 2Z9JA 3BEFB 1UK4A 1AB9C 2R0LA 3IG6B 5DP3A 3MYWA 1S6HA 2ZC9H 4R8TB 3PYHA 1XUKA 3LKWA 2ZU5A 1XUGA 4ISOA 4AFUA 3QLPH 3SZNA 3BIUH 3BTQE 4Y10E 1KLIH 4CH8B 5JDUB 1TALA 5FPYA 1MTVA 1O32A 6CHAB 1V2PT 3ATKA 3A80A 1DX5M 1MUEB 1NFUA 1HDTH 1QJ7B 2XW9A 3F9HA 3V13A 2GKVE 2ULLA 1A61H 3A85A 3B23B 3PO1C 1OYQA 2VIDA 6LPRA 2VGCB 2G55A 4IW4E 1Z6JH 4YM9A 1SVPA 2F3CE 2BZ6H 1C2MA 3WY8A 4NA7A 4I32A 1AFQC 3GCTG 1MD7A 1OXGA 3PLPA 2Y81A 4UE7H 2H9TH 1C5OH 3RLWH 2PKAA 1C4Y2 3TIUA 1Z6EA 1GBAA 1DPOA 5DGJA 3MU0A 1QJ6B 9LPRA 4FUCA 1NC6A 5I25A 3PTNA 1XVMA 5FPTA 2EI7A 4DOQA 5CE1A 4CRFA 1DANH 3VGCB 2BDBA 1YLDA 1HPGA 3VXEH 1SR5C 2PTNA 1O2MA 5TCCA 1G9IE 1O38A 4MVNA 4ZXYH 2CXVA 1P9UA 3BF6H 3RXVA 4I8LA 1YP9A 1WYKA 1TMBH 1HIAB 3ZYEA 1O5CB 2H6MA 5F03A 4UONA 4DIHH 1X7AC 1HYLA 2P8OB 1FY1A 1FAXA 4BNRA 1O3IA 4X8UH 1G3DA 1M9UA 1NRPH 1UTKA 3I29A 4RSPA 1ESTA 1YBWA 2BY8X 1GDQA 3C1KA 3BTWE 2CJIA 1IQJA 1IHTH 1AGJA 4OS7A 1O2XA 1BCUH 1YPHE 2QAAA 3ATMA 2ZQ1A 1V2VT 1GG6C 4GUXA 1DLKB 2A31A 1GBHA 2BY5X 1K1NA 4BANB 2BZAA 2R2MB 4X8SH 3PTBA 1QB9A 2G5VA 1P2IA 5FBIA 5E0GA 5DO4H 1V2UT 4INKA 1Y3UA 4WY3A 2BD7A 1SHHB 1W13U 3RLYH 3D65E 3TITA 2ZDVH 2Z3CA 3UR6A 1YCPH 2FO9A 4WMDA 4JZIA 1KTSB 1GJ4H 4FVBA 1K22H 2UWPA 1G37A 3E0NB 1G2LA 2QV1A 3G01A 3N7OA 4HGCA 2XXLA 4SGBE 3BTME 3RM0H 3SU0A 2FI4E 3UREA 4E7RG 3K2UA 4AG2A 4ABGA 3QO6A 3ITIA 1UTMA 3U69H 1F0UA 1UVTH 1UCYE 1PJPA 5DP8A 1HAVA 2I6QA 3E90B 1TX7A 1VZQH 3F9EA 2Z6BD 5LPRA 1W7XH 4OS6A 1N1LA 2R0KA 1P06A 1GGDC 2QXJA 1C5XB 2SGEE 3EYDA 1W0ZU 2NWNA 1XKAC 1CT0E 2FOAA 3Q00A 3SV2H 2VWNA 2ESTE 2OBOA 2FOFA 1GJBB 1DOJA 3VB7A 2BOHB 2KAIB 4X1QU 4A7IB 2XC5A 2R3UA 3D23A 1GBLA 4IBLH 1O3KA 2A1DB 4WXIA 2Y5GA 1THSH 1HJAC 1Q2WA 1QTFA 4TPIZ 4RKOB 2OC8A 5LPEA 3D49H 1ELAA 1A1RA 1KIGH 1GMCF 3VXFH 2WYGA 2Q1JA 1HAHH 1C1NA 1C9PA 4KTUA 1BTWA 1LCYA 4JZFH 1QFKH 2BQ7B 1EJNA 1DUAA 3JZ2B 4BAMB 1E36B 3A87A 1A5GH 1D6RA 4AFSA 4I8GA 3V12A 3C27B 2SGAA 4KTCA 1YF4A 1V2RT 5PTPA 3RUOA 2GZ8A 3PWCA 2IPHA 2A2XH 1LQEA 5EOKA 3LJJA 4MTBA 1H4WA 1O3PB 5TCAA 2GGVB 3HPTB 2WPHS 3SV8A 5TJXA 1E37B 3SNCA 4U2WA 3ZZ6A 5J4SA 4ZKOU 1P01A 1A4WH 1MQ5A 4IGDA 1QQ4A 4CHAC 1P2MA 2XRCA 1P11E 1TOMH 1MCTA 1W3CA 3GCHB 5AF9H 3LDXH 2EI6A 4A5TS 4BXWA 2QCYA 4K5ZA 3M61U 1PYTC 3U8RH 4B2AA 1MKXK 4JCNA 3SGQE 1JRSA 1JBUH 1OWIA 3UPEA 2SFAA 1V2OT 1GJ8B 1ZHRA 2D1JA 4JK5A 3TJVA 2P3FH 1OWDA 1GPZA 4DG4A 3ZZ8A 1GI6A 2ZGBH 3P70B 3M5NA 2CHAB 3RC4A 4D8NA 1ANCA 3S9BA 2F91A 1MBQA 2FYRA 3LC5A 3DT0H 3TJOA 1AIXH 1MBMA 2ZU1A 2BB4A 2FESH 5GWZA 1GHYH 2TGDA 1UTOA 2FM2A 4WH8A 4ZH8A 2XC0A 1GHBF 1HGTH 2O8LA 1K1LA 1KXFA 2PGBB 1EJAA 1L2EA 4TY6A 1HAPH 1UHBB 1O3EA 4O03A 1KTTB 5GDSH 1UTJA 4MLFB 4X6OA 5FXLA 4K1SA 2BVRH 3QZQA 2GT7A 2AFQB 1ELEE 2ZGJA 1ZHPA 2A5KA 3EA7A 1MTWA 5EW2H 2GVFA 1RS0A 7KMEH 1FIWA 1W2KH 1IQFA 2F9OA 3GCOA 1HAOH 1GHVH 1MCVA 3AAUA 1S84A 2UUFB 1INCA 3M35A 4IMQA 3T25A 3R3GB 1VJ9U 4HI3A 2F9BH 3SBKA 4ZMAH 4FU8A 1MU6B 2WUCA 1OP0A 2PKSB 4ABDA 1RFNA 2Y5HA 2LPRA 1H8IH 2W3KA 1PQ7A 3LU9B 5IYTA 4ABIA 4Y6DA 2ZIQH 4I31A 1O2QA 4WXVA 1DUEA 4MNYA 5FCKA 1YC0A 2OXSA 1FY4A 5DPAA 1VJAU 1V2KT 1Y8TA 4NA9H 1KSNA 1D3TB 1PPZA 3MI4A 3VB6A 1HRTH 2WV4A 3ZVDA 1FUJA 2FOCA 2VNTA 1N6YA 2XWAA 1PPHE 5JB9S 2GMTB 5HYOA 2XBYA 1BDAA 3TGJE 1V2JT 1C5NH 1K21H 1C5WB 1FAKH 1L1GA 3A7ZA 1AO5A 5HGGA 3SV9A 3QUMP 1T8MA 1O5AB 3RXRA 3BN9A 1OWEA 3ZZDA 4UD9H 1W8BH 3NKKA 1T8LA 3KN2A 5EQSA 4WJG2 2PUQH 2FLRH 2FX6A 5JB8S 1O2WA 3GY3A 1NROH 3L3TA 2OUAA 1CA8B 1E35B 4MNVA 1EQ9A 3VB5A 5ETXA 2ILNA 5DP7A 1SI5H 3RXIA 3PMHB 3MNCA 4MPWA 3ODFA 4X2WA 5L2ZH 1L4ZA 3SI4H 4K69A 3NXPA 1N8OB 1EP6A 2A4RA 1WU1A 8GCHG 4GPGA 1BMLA 4FUGA 4FUEA 4NCYA 1VITG 4X2YA 3QZRA 1QBVH 1OX1A 1ZGVA 3TLOA 2FODA 2QN5T 4AG1A 1ORFA 1AE5A 2HPPH 4BXSA 5HM2A 1GBTA 2J38A 4GLYA 1TA2A 5CMXH 1EOLA 3W94A 3SJ8A 4YLUA 4IN1A 3BTTE 3HKIB 2HVXA 1LMWB 2J4IA 3NWUA 4B2CA 1YYY1 2ZU2A 2W3IA 4TYDA 1VGCC 1OPHB 1UCYK 4ZXXH 4XSKU 4O9VA 4AX9H 4D7FA 3PROA 3LH3A 1IOEA 1RIWC 1RTKA 1S83A 1O30A 4OGYA 4GVUA 1EJMA 4MG3A 2AGIX 2PSYA 1ZZZA 5EXNA 1G3CA 3RC6A 2BY6X 1EZQA 1W12U 3PMBB 1GI2A 1LHGH 1YPMH 2BOKA 2ZFRH 2OC1A 4K1EA 2CV3A 1QL7A 3FVFB 2G81E 1TGNA 1WQSA 2GCHG 1NRRH 4ISLA 4A1XA 1Z7KA 1AWFH 1MZAA 1J16A 1WCZA 4BAQB 4DURA 3QWCH 2YNBA 1EPTA 2BTCE 1P0SH 1O35A 5K0HA 3LGWA 2ZPSA 2SGFE 1Y3YA 1DFPA 4NSVA 1BTZA 2ZU4A 3GYLB 1MKWK 1GL1A 6ESTA 3RXCA 2C8WB 1PFXC 1G30B 1UTLM 3SJ9A 2M5TA 2VWLA 3TU7H 1C1WH 5FHTA 4WWYA 1H1BA 4AYVB 1IQGA 3VFEA 2YOLA 2Q6FA 3EE0B 1SQTA 2ANKH 5A09A 4CREA 1A0JA 1GVLA 5DG6A 3TPIZ 4YOGA 1EZUC 1YPJH 4X1PU 1S0RA 3RP2A 3S0NA 3P95A 6CHAC 1GBKA 1KXBA 3KQCA 4H6TA 3T27A 3T29A 1UVUH 2Z9LA 4Y7AA 1TYNA 3SNBA 4XBCA 2FEQH 1BMNH 1V2MT 1BTPA 4DIIH 5L30H 1JIRA 1BTYA 2PTCE 2VGCC 3MMGA 3SO3A 1QNJA 1JRTA 3SU1A 3I78A 5JYIA 1DS2E 5K7RA 1IHSH 2Z9IA 1A0HB 1E34B 2UUYA 1A5HA 3ZVGA 1TRMA 2ODYB 1CT4E 1Y59T 3FP6E 1FY8E 3SJKA 3SU6A 3ZV8A 1PPBH 3KIDU 1LVYA 3B9FH 2HRVA 1XXFA 2Z9GA 5J4QA 3HK3B 2R2WU 4HFPB 1HB0B 2ZTZA 1O2NA 1AWHB 1MAXA 1MZDA 4B71A 2ZCHP 1GI3A 1C2LA 1Z1JA 3KHVA 2UUKB 4CH2B 3E91A 3U9AH 3A86A 3Q3KA 1C2DA 2VVVA 4TPYA 1FN6A 2VB0A 1UMAH 2QXGA 1CU1A 1AVGH 1GBEA 4UFFH 1IQNA 1YGCH 2FTMA 3A8CA 3T26A 3MU5A 1VCQA 1FPHH 4D7GA 3OTJE 3SNAA 2P8OC 1O2GH 1WSSH 5CHAB 1K1IA 8KME2 3Q77A 3O8CA 1BQYA 2C8YB 4FUDA 2C4FH 1JWTA 1J9CH 2SGQE 3MHWU 2HPQH 2J2UA 3P8FA 1HIAA 1FMGA 1DLEA 1NFXA 5JBBS 1WTGH 3PMAB 4YT6H 2AEIH 3ZZ5A 4AORA 1C2JA 1Z8RA 1GMDG 1ARCA 1RXPA 1SGNE 1GBMA 1EOJA 2VH6A 3S9AA 1DY8A 4IMZA 1T4UH 4YT7H 1C2GA 3RXJA 1G32B 4Y8YA 1FDPA 1QR3E 2RA3A 3BSQA 1FNIA 2Z3EA 1Q31A 5EXLA 3MTYA 3STJA 1GI5A 1ZPCA 3AVZA 3P92A 5GPIB 3T28A 3MH6A 4K8BA 3SJIA 2B5TB 1WOFA 4Y0YE 1AB9B 2IN2A 1QL9A 2ZECA 2PLXA 3SI3H 2G00A 4ZAEA 1LTOA 4NA8A 2Y6TA 3MNXA 1RGQA 1J14A 4FU9A 1CBWB 1KXCA 3HGNA 2QIQA 3RM2H 4BAOB 1A5IA 1P3EA 1EAUA 2CF9H 2G52A 4NSYA 5BPEA 3F6UH 1NT1A 4ABFA 1EUFA 1SFIA 3S9CA 1XUJA 4H4FA 1PQ8A 1O39A 3LOXA 2P3UB 3M3SA 1HXEH 4K8YA 1PYTD 3HKJB 2AS9A 1SLWB 1O3AA 1C4V2 1AKSB 7ESTE 1DXPA 1O2KA 1YCPM 1QBOA 1QY6A 3KL6A 4Y79A 1DSTA 1D9IA 3ZVFA 1AFQB 1ANBA 1T31A 3SU5A 7GCHG 1AZ8A 3RXOA 3QDZB 2K1QA 1O5DH 1HAGE 3QN7A 2NU1E 2XYAA 3MNSA 5T3HA 4ABJA 4FUHA 1MTNC 2O8WA 2OC0A 1O2IA 1W7GH 1W0YH 2P93A 3GCNA 1BHXF 1C5TA 5C20A 2ZEBA 2Y5FA 1QRZA 2BDCA 2GCTC 3EGKH 4NIXA 5A0BA 4ABHA 1V3XA 2AIPA 2HALA 1ELVA 2VU8E 4YTAA 3FP8E 3AAVA 4M7GA 2QGRA 1SGCA 1C2FA 1ZSJA 2HOBA 3RU4E 1CHOG 4ZHAA 2PGQB 2Z94A 4X1RU 1P03A 2KAIA 3OY6U 4FU7A 4KTSA 6GCHF 3A89A 3BIVH 3OX7U 3DFJA 4NWLA 1HAYB 2BD2A 1C9TA 3BEIB 4MPUA 1Y5UT 2AIQA 4ISNA 1UTQA 1CO7E 1PPCE 1A3BH 1E38B 1KXEA 1C5MD 4U01A 2FX4A 4I8KA 2SGPE 5L6NH 3E1XB 5HM9A 2H9EH 2FOMB 2FI3E 1A3EH 1GG6B 1YCPK 1J15A 1TGSZ 2RCEA 4OS1A 4OS4A 2HNTC 2FYQA 2Y80A 1NRQH 4LOYH 1SGFG 2ZU3A 4UDWH 4ABEA 3RXQA 2PWXA 3P8NA 4B75A 4WMFA 1HBTH 3RXAA 3M7TA 1TB6H 5GXPA 3RXEA 1OKXA 1HAIH 1IQKA 1MQ6A 3VB4A 3CS7A 1ANDA 3P6ZB 1QRWA 3OYPA 2Q6GA 2O9QA 3NUMA 2HWLB 2HLCA 2Q6DA 1NTPA 3UWIA 2G4UA 1AMHA 3TH3H 3SGAE 3UR9A 3ZZ3A 5JPMH 2GCHF 1GBCA 2ALVA 3KF2A 2VIVA 1K1MA 3MH4A 1YPKH 5ESTE 1J17T 4E05H 1BB0B 5SGAE 1TBZH 9ESTA 3A81A 1NY22 1ZMNA 3FANA 1AVWA 3TGKE 3A8AA 4SGAE 2CHAC 5GCHF 2ZFFH 1BITA 2B8OH 3SUFA 2FOHA 2WYJA 5DJ7A 4H6SB 1O33A 1UK2A 2A32A 1ID5H 4UEHH 1C1OA 2D2DA 1O5FH 2ZDNA 2VIQA 2Y7ZA 4LZ1H 1EAXA 1DWDH 3KCGH 5H4IB 1W10U 2OC7A 2H1UA 3UIRA 5A8YA 1EZXC 3UNSA 1G2MA 2J94A 1ANEA 2V35A 3A8BA 3BTKE 3RU4D 4ISHH 1D3PB 3M3TA 2V3OH 4CBNA 1XUHA 1SGFA 2BMGB 4LK4A 2QC2A 3MU8A 3Q3XA 1GHAF 3GICB 3UWJH 1YPGH 3SHCH 1O2VA 1GGDB 1NRNH 4X6MA 1ETRH 1NRSH 3ZVCA 1LPKB 2ZNKH 1LO6A 1D3DB 1AE8H 1UHBA 1ZPBA 4X8TH 1BRAA 2RG3A 1FI8A 4O3UA 3LJOA 1O34A 3TGIE 2AMPA 5E8EH 1KLJH 2WPJS 1LHFH 1O0DH 1ZHMA 2BVXH 1GCTB 2PKSC 1K2I1 2STAE 3URDA 1JXPA 4ESTE 4BTIB 3ESTA 3HK6B 2A45B 5L2YH 1HJAB 1NPMA 3EQ0H 8ESTE 1PPEE 1TX8A 1PPFE 3I77A 2SGDE 1RTFB 4MPXA 4DW2U 1Y3WA 3SOSA 4ZKRU 2AGEX 3GDSA 2BDHA 3LGYA 1CQQA 1AQ7A 2ODQA 5LGOA 4NZLA 3LONA 3T5FH 1P05A 1O3CA 2F9UA 4JYVH 2FOGA 3MH5A 1TABE 2THFB 4HZHA 4AYYB 4KKDA 2AGGX 5T6FA 4GSOA 2C90B 2VVUA 1H9HE 1ZMJA 2AMQA 2ZFSA 1UVOA 2NU4E 3QTOH 5AFYH 4INHA 2UUJB 2ZWLH 2BXTH 3OY5U 3Q76A 4RKJB 3KEEA 2TIOA 1IQIA 2BQWB 4Z6AH 2VINA 3O8BA 1UJ1A 2Z7FE 2PHBA 3BG4B 1GL0E 2R3YA 2H9HA 2W7UA 3ZZ7A 1SMFE 4ZROA 2OLGA 3SU4A 2ZTXA 1GJ5H 3DA9B 5DP4A 2XCFA 5DK1A 3GCTF 1ETSH 2ZP0H 5FX6A 1CA0C 3S69A 3GY4A 4YOJA 4Q7XA 4AOQA 1O3GA 4DGJA 1UK3A 2V6NA 3UY9A 2A5IA 4D9QA 1XX9A 5GIBA 5IDKA 3E8LA 1C2KA 1HV7A 2JETB 3V7TA 1GI1A 2PV9B 1P04A 3P8GA 1P10A 1DITH 1FY5A 1ZTJA 2OCVB 5C3NA 1C5VA 1TMTH 3UFAA 2BDYA 1D4PB 2ZPQA 2WPIS 3DHKH 2O8UA 1VCPA 2WV5A 2G5NA 2XCNA 2A5AA 3SU3A 1OP2A 5C5OA 2JH6D 3NZIA 1THPB 2ZDLA 2XBVA 1PQ5A 4AB9A 3RXMA 1P12E 2VIWA 4CR9A 2Y82A 1AVXA 1SFQB 2W26A 1V2ST 1GJDB 1OWKA 1W11U 2ZG0H 1SC8U 2FS8A 5C1UA 2V3HH 2H5CA 5B6OA 1FQ3A 1HUTH 1WUNH 4F4OC 5EQRA 2FS9A 4B74A 2FLBH 2JH5D 1GCDA 1ABJH 1J8AA 1KDQB 3GY5A 4ZKNU 3TK5A 5A8XA 1C5UA 2R9PA 2GDEH 4BTUB 4OS5A 1C1RA 5A0CA 1OSSA 1EKBB 3K6ZA 3NPSA 4HTCH 2ZGXH 1EAWA 5AVDA 2V0BA 4Q7YA 5FPSA 4ZKSU 3CP7A 3M7QA 1H9LB 7GCHF 2LNCA 1TNIA 2ANWA 1UTPA 4FUIA 4IC6A 5T6DA 5LPFA 3SQEE 4F49A 5HXFA 1ZGIA 2B7DH 1LHDH 1MU8B 1O36A 4Q7ZA 4ZHMU 3QX5H 1A2CH 1GBDA 2HNTF 1SBWA 1ELTA 2GP9B 1FY3A 4FUJA 1TE0A 5EQQA 4X2VA 4WH6A 1ELBA 4CBOA 3GY7A 2ZHQH 3K65B 3GYMA 4NIYA 5F8ZA 5JBAS 1NS3A 3CS0A 4CRAA 3SUGA 1CGIE 4IC5A 2H2ZA 4B2BA 2WPMS 1ELDE 1V2QT 3EDXB 1C1PA 1EPTC 1TPAE 1C5RA 2BQ6B 5E0JA 1UVPA 4I8HA 1WV7H 1AD8H 1DT2A 1ZRBA 3MNBA 1ZPZA 5LH8A 1SGEE 1ZJKA 3S7HB 1AN1E 3ZZBA 4IN2A 3RDZA 2ZDKA 1V2NT 3SNDA 2PSXA 4XDEA 2FWWA 3ATWA 1TGCA 1FN8A 2BHGA 1C2HA 4AFZA 3ZVAA 1GI8B 3PMJA 1RRKA 3M7UA 1GI7B 2DE9A 1C5LH 1MAYA 3MH7A 1Y5AT 1B7XB 3EAJA 2BLQA 5I46H 1OOKB 3TNTA 1DY9A 1ZYOA 4Q80A 4YLQH 1GMCG 2BLVA 4Y8ZA 4AFQA 1L1JA 2CGAA 1DWBH 1UVSH 4IS5A 1KYNA 4YOIA 1ESBA 1LVBA 1GVKB 4BTTB 1O3NA 1XKBC 1FXYA 3KQBA 1O5BB 3U98H 2BY7X 3W95A 1BMMH 1SL3A 3O8RA 3SNEA 3RXUA 1UO6A 1UTNA 1ZTLA 4VGCB 3RXBA 1EB2A 1O3MA 2A0QB 1FV9A 3RU4T 4CRGA 2RA0A 1WTHD 1AUTC 4X1NU 1VGCB 4AZ2B 2EI8A 2FIRH 1CGHA 2CMYA 3SV7A 2C8XB 2PFEA 5CHAC 3RXGA 5EXMA 4NIWA 1SHYA 1ELCA 5F8TA 4I33A 2WINI 5T6GA 5E2OA 3S7KB 1YPEH 2A4GA 1NESE 2VIOA 5JBCS 1H8DH 2IOTA 2GD4B 1EX3A 1TQ0B 5EPNA 4Y11E 2ZFPH 3QGJA 1C4U2 3SUEA 1F5LA 1HAXB 1U6QA 1DSUA 1ESAA 1MH0A 3O8DA 3ZZCA 2J95A
chains in the Genus database with same CATH superfamily
1EXFA 3GS9A 1EB1H 1GJAB 4NG9H 1KY9A 1F92A 4WMEA 3EA8A 1XMNB 8LPRA 1AZZA 1P09A 1TRYA 3VGCC 1NU9A 5C67A 1C1QA 3DUXH 1C1VH 2QA9E 4BAHB 3M5MA 4LZ4B 3BV9B 2C93B 4GCHG 3KNXA 3LGTA 1K9OE 5DN6D 5C2ZA 1H8HD 4DCDA 1TNJA 2PW8H 2BDIA 1AFEH 3GY6A 2W6ID 2ZGCA 3SGBE 3TH2H 3NCLA 2A7CA 1V2LT 4FOUC 1G36A 1GBFA 4ZHLU 4BOHA 1CBWC 1P57B 1LHCH 2NU3E 2PR3A 2QF3A 3AASA 2H5DA 1C2EA 5A8ZA 2GV6A 2TBSA 4AN7A 1SGYE 1NO9H 1BT7A 1DICA 2XBXA 5FAHA 5C17A 3TNSA 1QB1A 4WVPE 1QA0A 2O8TA 4U32A 1KLTA 4Y7BA 1ZOMA 1O2PA 1Y5BT 3LT3A 3U8OH 1BRCE 1BBRE 3PLKA 4OM9A 1ZLRA 5AFZH 1G3BA 3V0XA 1SGIB 4WF8A 2GV7A 1OWJA 1TGTA 2FZZA 4A6LA 3FZDA 1TA6A 2XC4A 1GDNA 4XE4A 2QY0B 1MABB 2P94A 2F9NA 5KEDA 1XXDA 2F43B 1AKSA 1TLDA 2A7JA 3DD2H 1P3CA 1O2RA 3BTHE 1XM1A 1SSXA 1Z8GA 3A7YA 3OE7D 4K2YA 1HAZB 2TGTA 4CRBA 2ZF0H 3SU2A 3E3TA 1K0HA 4DY7B 1A0LA 3K9XB 4ISIH 4CR5A 1TPOA 3GDUA 3LC3A 1GJCB 1FONA 2GTBA 1AU8A 3DFLA 3R0FA 1GMHG 1NM6A 1S5SA 3MU1A 1TBQH 1GBIA 4KP0A 1O2YA 1O3HA 2PKAB 2TGAA 1HJ8A 2J34A 1TNKA 3SW2B 1TONA 3PO1B 1BTUA 4AC9A 1GI9B 5ESBA 3A8DA 5B6LA 1Q3XA 1O37A 1OWHA 2XNIA 3RMMH 4TSFD 4E7NA 4K1TA 4I7YH 1ELFA 3M5OA 1F2SE 3MO3A 4YO9A 4ABAA 4GHTA 4TWWA 3BG8A 2ZHEH 1TOCB 3PV5A 3U1JB 3TJNA 2NU0E 5DKMA 1TWXB 2ZTYA 3UNRA 2BDGA 4XOJA 2QF0A 1NZQH 3OFND 4JYUH 1B0FA 2SNVA 2BDAA 5EU8A 3KQDA 1C1MA 1H9IE 1HCGA 1B5GH 2QE7D 3SQHE 2BD8A 1QL8A 2OBQA 2BM2A 1MTUA 2AH4X 2YMSD 1DDJA 4O97A 3RXTA 2ZO3H 1AI8H 1V2TT 1HJ9A 1HNEE 1P9SA 3ATLA 1TGBA 8GCHF 1WBGB 3BEUA 4U30A 1DM4B 3MWIU 5HMAA 1DWEH 2BLWA 1L4DA 3ZZAA 1VITF 3FFGA 2ZHWH 3FAOA 1F0SA 1IQLA 2FMJA 1CGJE 4GHQA 3RXHA 2OINA 1IQEA 1NFYA 4DT7B 2UWOA 2JIZD 1IQMA 3TK6A 3BTFE 4ASUD 4B76A 3BTGE 1GBBA 4RT1A 1THRH 3E16B 2FOBA 1K28D 3STIA 2ASUB 1QB6A 5EJLA 3QTVH 2VWOA 3ELAH 5EW1H 3F0PA 3TH4H 1SQOA 2TGPZ 1EATA 3B8JA 1S81A 4XBDA 2VJ1A 5C1XA 4NZQA 1P8VC 2WUBA 3Q3YA 3ZZ9A 1QCPA 2DUCA 3GCHC 1T8NA 2EC9H 1LKAA 2NU2E 1BUIA 2ZA5A 3SJOA 1GJ9B 3RXPA 5BRRE 1C1UH 2XWBI 4X6NA 3PM3A 1ARBA 2FI5E 1MTNB 3AW0A 2WSSD 1GCTC 1A7SA 1QZ8A 1CSOE 5AHGH 1CVWH 2GCTB 5FBEA 1LQDB 1AUJA 1HAVB 4AGKA 2AERH 2GDDA 3F3BA 1LVOA 3LGUA 2BXUH 2BLOA 1W14U 1P2OA 2QXHA 4MDSA 1O2JA 4UFDH 5FCRA 4ABBA 2GX4A 1SGRE 1MMJN 1P2JA 3F68H 2ZPRA 4B6EA 4NWKA 4JZ1A 1MKXH 2BY9X 1O2TA 3F9FA 3RMLH 1VR1H 4UFEH 3RXLA 1P02A 1QIXB 1GWAA 1OYTH 1EAIA 3A83A 3A7XA 1ZR0A 2AYWA 3QGNB 1S0QA 2GZ7A 4A1TA 1QQUA 1E1QD 2YNAA 2ZDMA 3CENA 4YESB 3A7WA 2ZZUH 4PROA 3UOUA 1LHEH 3PLBA 2QXIA 2VWMA 2STBE 1LPGB 3A82A 1EZSC 3M5LA 1O2HA 1RD3B 1T7CA 5EPYA 1O3FA 2F9VA 1T32A 1DVAH 5E0HA 3SHAH 3BG4C 4OS2A 1TPSA 2P95A 1C2IA 5G4BA 3RXFA 3TJUA 3MO6A 1GHWH 3D62A 3T62A 4NIVA 4X8VH 1TRNA 2A4QA 2VVCA 4LXBH 1DWCH 1TAWA 3MO9A 3P8OA 1BBRH 1GBJA 4GAWA 1O3OA 3DSOA 3UOPA 2HLDD 1ETTH 4I8JA 3IITA 1PPGE 3RXKA 1D6WA 1OS8A 2GT8A 3URCA 2Y7XA 4NFEA 3M3VA 2GZ9A 3UNQA 1XVOA 2XTTB 3SZEA 2OK5A 1TMUH 1PQAA 2JETC 1AHTH 4Y76A 1LVMA 1YM0A 2GMTC 1JIMA 1XUIA 1O2ZA 1GI0A 1GJ6A 2BD4A 4FVDA 1FIZA 3MOCA 4XBBA 1V2WT 1HFDA 1D3QB 1ZSKA 4GCHF 2AHME 1ACBE 3ZVEA 2QYIA 2C3SA 1CE5A 3TVJB 2BD5A 3OU0A 4E06H 2Z9KA 2O8MA 1JMOH 4Y0ZE 1C5ZB 1ZMLA 3DSPA 1KXAA 2ZKSA 1IQHA 1F7ZA 1Z1IA 4MPVA 1E79D 4KGAA 1V6DA 4CHAB 2K0QA 1GVZA 1SGPE 3IWMA 4D76A 2BX4A 4XFQA 3P17H 5A2MH 4MQAA 2J92A 1BBRK 3H7OA 1YKTA 2AMDA 4MNXA 1IAUA 1OP8A 5A0AE 1QHRB 5FX5A 4DJZB 4Y71A 1F5RA 3KYGA 1F0TA 1O2OA 2GJGA 1C1SA 1N8OC 1O3BA 2Z3DA 1FJSA 1GMDF 3L6PA 1BRBE 3ATIA 3RXSA 4DVAU 1TQ7B 4R0IA 2EY4C 1A46H 2D26C 2RFKC 1P2NA 1F5KU 2C8ZB 2JKHA 4X1SU 5C5NA 1KDQA 4RN6A 3VG8A 4ZUHA 2ZFTA 5F6MA 4Z0KA 3F1SB 3ODDA 1YPHC 2OTVA 1YPLH 1WQVH 1O3JA 1S85A 3M36A 5ABWA 2P16A 1T8OA 3MU4A 3SN8A 1TNLA 4H42U 4OGXA 5EODA 1NN6A 5DP5A 2IPQX 2YMSB 3BTEE 3LPRA 3E0PB 3F9GA 1YLCA 2WPLS 5DP9A 4CRCA 1DE7H 3T2NA 1TNGA 3H7TA 3WW7A 1GI4A 3PRDA 1KXDA 1C5QA 4YXWD 4X6PA 1Y3VA 1LKBA 1GMHF 3UQOA 3VB3A 1LDTT 5EJ1A 3DSGA 2D8WA 2A7HA 3ZVBA 5FL7D 3U8TH 3NRLA 1BZXE 1NU7B 1LPZB 3SV6A 1Z8IB 3M37A 4XD7D 2I6SA 4UFGH 1UCYH 2ZI2H 3A84A 1TNHA 1TX6A 3HGPA 1O2UA 2ZHDA 2OP9A 1C5PA 5JBTA 1TBRH 3UUZA 1K1JA 1GDUA 3LH1A 1AY6H 4TWYA 3GY2A 1SOZA 2ZCLP 3RMNH 1B0EA 2ZCKP 4B73A 3SORA 3H09A 2FTLE 1N6XA 2XBWA 1BTHH 2ZFQH 4TY7A 3RMOH 1L0ZA 1CA0B 1FZZA 1Z8JB 3QK1A 5HIZA 3VPKA 4ASHA 1DXWA 3HATH 2ODPA 4JMYA 1BMAA 3OSYA 3PV4A 1VITH 3MFJA 7LPRA 1BIOA 1SLXB 1ZTKA 6GCHG 2P3TB 4Q2KA 2ZHFH 4Q63A 2F9PA 3KGPA 4MNWA 2HGTH 1GHZA 1ZJDA 2TPIZ 4VGCC 2BD9A 2OD3B 1S6FA 3FZZA 2J9NA 1MKWH 1CHOF 3A88A 2OQ5A 1RJXB 2DE8A 1YLNA 4KELA 3PB1E 4THNH 3ENSB 3RC5A 2B0FA 1CT2E 3VEQB 1C5SA 1FLEE 4CRDA 2KM0A 2TRMA 2P59A 2PUXB 4X2XA 2OQUA 4JZEH 2RDLA 1WAYB 2BVSH 1S82A 3KQEA 1XUFA 1O3DA 3A7VA 3NK8A 1ABIH 1O2SA 2EEKA 3AW1A 2G51A 3ZZ4A 4D9RA 1Y3XA 2ANYA 1RTLA 2ZQ2A 3ZV9A 1O5GH 1VCWA 3GISB 4JZDH 4RT0A 1HLTH 2BD3A 4FUBA 5GJ4B 2A4OA 3FKSD 3FN8A 2HNTE 1MD8A 2W7SA 1ELGA 2QF4A 3EA9A 3U1IB 5F53A 1QURH 3A7TA 2BYAX 4Y8XA 1BJVA 1BTXA 5C1YA 3GOVB 1BOQA 1QA7A 1ZSLA 5GCHG 4AGJA 3PWBA 4FUFA 2ANMH 5KECA 4YZUA 4BAKB 1TFXA 2CN0H 3GDVA 1O5EH 4O3TA 1QRXA 3GY8A 3LGIA 4K3JA 4X0WU 5HKKD 1F0RA 1ZRKA 3UQVA 1E0FD 1BHXB 3LGVA 3SUDA 1EP5A 1CHGA 2BX3A 3ZYDA 1K1OA 1RIWB 3JZ1B 1FPCH 4B1TA 4K60A 1GHXH 1SB1H 2FP7B 2FPZA 2L74A 5C94A 3BTDE 4A1VA 4INLA 1C5YB 1SOTA 1P2KA 2W5EA 4AB8A 1L1NA 1EPTB 1GHAG 1SG8B 2KCAA 3LIWA 4QT8C 1NFWA 1SGTA 4F48B 5E2PA 3E6PH 1K1PA 4FXGH 2ALPA 3RXDA 1T4VH 5F8XA 4J2YB 1C1TA 4A92A 1TIOA 2G4TA 2ZDAH 4JYTA 1JOUB 1SLVB 2FXRA 2FOEA 2WPKS 2CF8H 2ZGHA 1BJUA 4NFFA 1MTSA 5EGMA 3K6YA 1W0JD 4NGAH 1O31A 1SQAA 2SNWA 2VIPA 3H5CB 5DP6A 1BA8B 2EA3A 2F4LA 2JH0D 2UWLA 3V3MA 3DCLA 1BRUP 1G3EA 2B9LA 2G8TA 1TPPA 1SLUB 3TK9A 1Z71A 1QBNA 1HXFH 3OAAD 4JK6A 1SPJA 1GJ7B 4J1YA 2VH0A 1QJ1B 2FDAA 3FP7E 1P2QA 1O3LA 2F83A 3L33A 2IJOB 2A2QH 1QGFA 1EASA 1GHBG 1O2LA 1SGQE 5EG4A 3UTUH 1SGDE 2Z9JA 3BEFB 1UK4A 1AB9C 2R0LA 3IG6B 5DP3A 3MYWA 1S6HA 2ZC9H 4R8TB 3PYHA 1XUKA 3LKWA 2ZU5A 1XUGA 4ISOA 4AFUA 3QLPH 3SZNA 3BIUH 3BTQE 4Y10E 1KLIH 4CH8B 5JDUB 1TALA 5FPYA 1MTVA 1O32A 6CHAB 1V2PT 3ATKA 3A80A 1DX5M 1MUEB 1NFUA 1HDTH 1QJ7B 2XW9A 3F9HA 3V13A 1VKYA 2GKVE 2ULLA 1A61H 3A85A 3B23B 3PO1C 1OYQA 2VIDA 6LPRA 2VGCB 2G55A 4IW4E 1Z6JH 4YM9A 1SVPA 2F3CE 2BZ6H 1C2MA 3WY8A 4NA7A 4I32A 1AFQC 3GCTG 1MD7A 1OXGA 3PLPA 2Y81A 4UE7H 2H9TH 1C5OH 3RLWH 2PKAA 1C4Y2 3TIUA 1Z6EA 1GBAA 1DPOA 5DGJA 3MU0A 1QJ6B 9LPRA 2WZQA 4FUCA 1NC6A 5I25A 3PTNA 1XVMA 5FPTA 2EI7A 4DOQA 5CE1A 4CRFA 2LELA 1DANH 1FX0B 3VGCB 4Q4LA 2BDBA 1YLDA 1HPGA 3VXEH 1SR5C 2PTNA 1O2MA 5TCCA 1G9IE 1O38A 4MVNA 4ZXYH 2CXVA 1P9UA 3BF6H 3RXVA 4I8LA 1YP9A 1WYKA 1TMBH 1HIAB 3ZYEA 1O5CB 2H6MA 5DSFA 5F03A 4UONA 4DIHH 1X7AC 1HYLA 2P8OB 1FY1A 1FAXA 4BNRA 1O3IA 4X8UH 1G3DA 1M9UA 1NRPH 1UTKA 3I29A 4RSPA 1S6LA 1ESTA 1YBWA 2BY8X 1GDQA 3C1KA 3BTWE 2CJIA 1IQJA 1IHTH 1AGJA 3N7DA 1O2XA 1BCUH 1YPHE 4OS7A 2QAAA 3ATMA 2ZQ1A 1V2VT 1GG6C 4GUXA 1DLKB 2A31A 1GBHA 3F2HA 2BY5X 1K1NA 4BANB 2BZAA 2R2MB 1NBME 4X8SH 3PTBA 1QB9A 2G5VA 1P2IA 5FBIA 5E0GA 5DO4H 1V2UT 4INKA 1Y3UA 4WY3A 2BD7A 1SHHB 1W13U 3RLYH 3D65E 3TITA 2ZDVH 2Z3CA 3UR6A 1YCPH 2FO9A 4WMDA 4JZIA 1KTSB 1GJ4H 4FVBA 1K22H 2UWPA 1G37A 3E0NB 1G2LA 2QV1A 3G01A 3N7OA 4HGCA 2XXLA 4SGBE 3BTME 2LP6A 3RM0H 3SU0A 2FI4E 3UREA 4E7RG 3K2UA 4AG2A 4ABGA 3QO6A 3ITIA 3WWFA 1UTMA 3U69H 1BMFD 1F0UA 1UVTH 1UCYE 1PJPA 4HG6A 5DP8A 1HAVA 2I6QA 3E90B 1TX7A 2W6JD 1VZQH 3F9EA 2Z6BD 5LPRA 1W7XH 4OS6A 1N1LA 2R0KA 1P06A 1GGDC 2QXJA 1C5XB 2SGEE 3EYDA 1W0ZU 2NWNA 1XKAC 1CT0E 2FOAA 3F0OA 3Q00A 3SV2H 2VWNA 2ESTE 2OBOA 2FOFA 1GJBB 2KZ4A 1DOJA 3VB7A 2BOHB 2KAIB 4X1QU 4A7IB 2XC5A 2R3UA 3D23A 1GBLA 4IBLH 1O3KA 2A1DB 4WXIA 2Y5GA 2CK3D 1THSH 1HJAC 1Q2WA 1QTFA 4TPIZ 4RKOB 2OC8A 5LPEA 3D49H 1ELAA 1A1RA 1KIGH 1GMCF 3VXFH 2WYGA 2Q1JA 1HAHH 1C1NA 1NBMD 1C9PA 4KTUA 1BTWA 1LCYA 4JZFH 1QFKH 2BQ7B 5EJZA 1EJNA 1DUAA 3JZ2B 4BAMB 1E36B 3A87A 1A5GH 1D6RA 3OEHD 4AFSA 1H8ED 4I8GA 3V12A 2XNDD 3C27B 2SGAA 4KTCA 1YF4A 1V2RT 5PTPA 3RUOA 2GZ8A 3PWCA 2IPHA 2A2XH 1LQEA 5EOKA 3LJJA 4MTBA 1H4WA 1O3PB 5TCAA 3PRBA 2GGVB 3HPTB 2WPHS 3SV8A 5TJXA 1E37B 2XOKD 3SNCA 4U2WA 3ZZ6A 5J4SA 4ZKOU 1P01A 1A4WH 1MQ5A 2IJD1 1QQ4A 4IGDA 4CHAC 1P2MA 2XRCA 1P11E 1TOMH 1MCTA 1W3CA 3GCHB 5AF9H 3LDXH 2EI6A 4A5TS 4BXWA 2QCYA 4K5ZA 3M61U 1PYTC 3U8RH 4B2AA 1MKXK 4JCNA 3SGQE 3UB0A 1JRSA 1JBUH 1OWIA 3UPEA 2SFAA 1V2OT 1GJ8B 1ZHRA 2D1JA 4JK5A 3TJVA 2P3FH 1OWDA 1GPZA 4DG4A 3ZZ8A 1GI6A 2ZGBH 3P70B 3M5NA 2CHAB 3RC4A 4D8NA 1ANCA 3S9BA 2F91A 1MBQA 2FYRA 3LC5A 3DT0H 3TJOA 1AIXH 1MBMA 2ZU1A 2BB4A 2FESH 5GWZA 1GHYH 2TGDA 1UTOA 2FM2A 4WH8A 4ZH8A 2XC0A 1GHBF 1HGTH 2O8LA 1K1LA 1KXFA 1OHHD 2PGBB 1EJAA 1L2EA 4TY6A 1HAPH 1UHBB 1O3EA 4O03A 1KTTB 5GDSH 1UTJA 4MLFB 4X6OA 5FXLA 4K1SA 2BVRH 3QZQA 2GT7A 2AFQB 1ELEE 2ZGJA 1ZHPA 1UW7A 2A5KA 3EA7A 1MTWA 5EW2H 2GVFA 1RS0A 7KMEH 1FIWA 1W2KH 1IQFA 2F9OA 3F2GA 3GCOA 1HAOH 1GHVH 1MCVA 3AAUA 1S84A 2UUFB 1INCA 3M35A 4IMQA 3T25A 3R3GB 1VJ9U 4HI3A 2F9BH 3SBKA 5KGOA 4FU8A 4ZMAH 1MU6B 2WUCA 1OP0A 2PKSB 4ABDA 1RFNA 2QF5A 2Y5HA 2LPRA 1H8IH 2W3KA 1PQ7A 3LU9B 5IYTA 4ABIA 4Y6DA 2ZIQH 4I31A 1O2QA 4WXVA 1DUEA 4MNYA 5FCKA 1YC0A 1YY3A 1FY4A 2OXSA 5DPAA 1VJAU 1V2KT 1Y8TA 4NA9H 1KSNA 1D3TB 1PPZA 3MI4A 3VB6A 1HRTH 2WV4A 3ZVDA 1FUJA 2FOCA 2VNTA 1N6YA 2XWAA 1PPHE 5JB9S 2GMTB 5HYOA 2XBYA 1BDAA 2KCPA 3TGJE 1V2JT 1C5NH 1K21H 1C5WB 1FAKH 1L1GA 3A7ZA 1AO5A 5HGGA 3SV9A 3QUMP 1T8MA 1O5AB 3RXRA 3BN9A 1OWEA 3OTPA 3ZZDA 4UD9H 1W8BH 3NKKA 1T8LA 3KN2A 5EQSA 4WJG2 2PUQH 2FLRH 2FX6A 5JB8S 1O2WA 3GY3A 1NROH 3L3TA 2OUAA 1CA8B 1E35B 4MNVA 5C0UA 1EQ9A 3VB5A 5ETXA 2ILNA 5DP7A 1SI5H 3RXIA 3PMHB 3MNCA 4MPWA 3ODFA 4X2WA 5L2ZH 1L4ZA 3SI4H 4K69A 2KR7A 3NXPA 1N8OB 1EP6A 2A4RA 1WU1A 8GCHG 1WDIA 4GPGA 1BMLA 4FUGA 4FUEA 4NCYA 1VITG 4X2YA 3QZRA 1QBVH 1OX1A 1ZGVA 3TLOA 2FODA 2QN5T 4AG1A 1ORFA 1AE5A 2HPPH 4BXSA 4ACAA 5HM2A 1GBTA 2J38A 2J97A 4GLYA 1TA2A 5CMXH 1EOLA 3W94A 3SJ8A 4YLUA 4IN1A 3BTTE 3HKIB 2HVXA 1LMWB 2J4IA 3NWUA 4B2CA 1YYY1 2ZU2A 2W3IA 4TYDA 1SQRA 1VGCC 1OPHB 1UCYK 4ZXXH 4XSKU 4O9VA 4AX9H 4D7FA 3PROA 3LH3A 1IOEA 1RIWC 1RTKA 1S83A 1O30A 4OGYA 4GVUA 1EJMA 4MG3A 2AGIX 2PSYA 1ZZZA 5EXNA 1G3CA 3RC6A 2BY6X 1EZQA 3W1EA 1W12U 3PMBB 1GI2A 1LHGH 1YPMH 2BOKA 2ZFRH 2OC1A 4K1EA 2CV3A 1QL7A 3FVFB 2G81E 1TGNA 3SYJA 1WQSA 2GCHG 1NRRH 4ISLA 4A1XA 1Z7KA 1AWFH 1MZAA 1J16A 1WCZA 4BAQB 4DURA 3QWCH 2YNBA 1EPTA 2BTCE 1P0SH 1O35A 5K0HA 3LGWA 2ZPSA 2SGFE 1Y3YA 1DFPA 4NSVA 1BTZA 2ZU4A 3GYLB 1MKWK 1GL1A 6ESTA 3RXCA 2C8WB 1PFXC 1G30B 1UTLM 3UAIC 3SJ9A 2JDID 2M5TA 2VWLA 3TU7H 1C1WH 5FHTA 4WWYA 1H1BA 4AYVB 2M2AA 1IQGA 3VFEA 2YOLA 4M9FA 2Q6FA 3EE0B 1SQTA 2ANKH 5A09A 4CREA 1A0JA 1GVLA 5DG6A 3TPIZ 4YOGA 1EZUC 1YPJH 4X1PU 1S0RA 3RP2A 3S0NA 3P95A 6CHAC 1GBKA 1KXBA 3KQCA 4H6TA 3T27A 3T29A 1UVUH 2Z9LA 4Y7AA 1TYNA 3SNBA 4XBCA 2FEQH 1BMNH 1V2MT 1BTPA 4DIIH 5L30H 1JIRA 1BTYA 2PTCE 2VGCC 3MMGA 3SO3A 1QNJA 1JRTA 3SU1A 3I78A 5JYIA 1DS2E 5K7RA 1IHSH 2Z9IA 1A0HB 1E34B 2UUYA 1A5HA 3ZVGA 1TRMA 2ODYB 1CT4E 1Y59T 3FP6E 1FY8E 3SJKA 3SU6A 3ZV8A 1PPBH 3KIDU 1LVYA 3B9FH 2HRVA 1XXFA 2Z9GA 5HIYA 5J4QA 3HK3B 2R2WU 4HFPB 1HB0B 3MQKC 2ZTZA 1O2NA 1AWHB 5GNDA 1MAXA 1MZDA 4B71A 2ZCHP 1GI3A 1C2LA 1Z1JA 3KHVA 2UUKB 4CH2B 4DT4A 3E91A 3U9AH 3A86A 3Q3KA 1C2DA 2VVVA 4TPYA 1FN6A 2VB0A 1UMAH 2QXGA 1CU1A 1AVGH 1GBEA 4UFFH 1IQNA 1YGCH 2HVYB 2J98B 1COWD 2FTMA 3A8CA 3T26A 3MU5A 1VCQA 1FPHH 4D7GA 3OTJE 3SNAA 2P8OC 1O2GH 1WSSH 5CHAB 1K1IA 8KME2 5T1VA 3Q77A 3O8CA 1BQYA 3CNRA 2C8YB 2PP6A 4FUDA 2C4FH 1JWTA 1J9CH 2SGQE 3MHWU 2HPQH 2J2UA 3P8FA 1HIAA 1FMGA 1DLEA 1NFXA 5JBBS 1WTGH 3PMAB 2VBCA 4YT6H 4RI0A 2AEIH 3ZZ5A 4AORA 1C2JA 1Z8RA 1GMDG 1ARCA 1RXPA 1SGNE 1KMHB 1GBMA 1EOJA 2VH6A 3S9AA 1DY8A 4IMZA 1T4UH 4YT7H 1C2GA 3RXJA 1G32B 4Y8YA 1FDPA 1QR3E 2RA3A 3BSQA 3KQ5A 1FNIA 2Z3EA 1Q31A 5EXLA 3MTYA 3STJA 1WXRA 1GI5A 1ZPCA 3AVZA 3N7EA 3P92A 5GPIB 3AK5A 3T28A 3MH6A 4K8BA 3SJIA 3FOAA 2B5TB 1WOFA 4Y0YE 1AB9B 2IN2A 1QL9A 2ZECA 2PLXA 3SI3H 2G00A 4ZAEA 1LTOA 4NA8A 2Y6TA 3MNXA 1RGQA 1J14A 4FU9A 1CBWB 1KXCA 3HGNA 2QIQA 3RM2H 4BAOB 1A5IA 1P3EA 1EAUA 2CF9H 2G52A 4ACBA 4NSYA 5BPEA 3F6UH 1NT1A 4ABFA 1EUFA 1SFIA 3S9CA 1XUJA 4H4FA 1PQ8A 1O39A 3LOXA 2P3UB 3M3SA 1HXEH 4K8YA 1PYTD 3ZIAD 3HKJB 2AS9A 1SLWB 1O3AA 1C4V2 1AKSB 7ESTE 5C0TA 1DXPA 1O2KA 1YCPM 1QBOA 1QY6A 4P00A 3KL6A 3N99A 4Y79A 1DSTA 1D9IA 3ZVFA 1AFQB 2WV9A 1ANBA 1T31A 3SU5A 7GCHG 1AZ8A 3RXOA 3QDZB 2K1QA 1O5DH 1HAGE 3QN7A 2NU1E 2XYAA 3MNSA 5T3HA 4ABJA 4FUHA 1MTNC 2O8WA 2OC0A 1O2IA 1W7GH 1W0YH 4F55A 2P93A 3GCNA 1BHXF 1C5TA 5C20A 2ZEBA 2Y5FA 3KYFA 1QRZA 2BDCA 2GCTC 3EGKH 4NIXA 5A0BA 4ABHA 1V3XA 2AIPA 2HALA 1ELVA 2VU8E 4YTAA 3FP8E 3OEED 3AAVA 4M7GA 2QGRA 1SGCA 1C2FA 1ZSJA 2HOBA 3RU4E 1CHOG 4ZHAA 2PGQB 2Z94A 4X1RU 1P03A 2KAIA 3OY6U 4FU7A 4KTSA 6GCHF 3A89A 3BIVH 3OX7U 3DFJA 4NWLA 1HAYB 2BD2A 1C9TA 3BEIB 4MPUA 1Y5UT 2AIQA 2JJ1D 4ISNA 1UTQA 1CO7E 1PPCE 1A3BH 1E38B 1KXEA 1C5MD 4U01A 2FX4A 4I8KA 2SGPE 5L6NH 3E1XB 5HM9A 2H9EH 2FOMB 2FI3E 1A3EH 1GG6B 1YCPK 1J15A 1TGSZ 2RCEA 4OS1A 4OS4A 2HNTC 2FYQA 2Y80A 1NRQH 4LOYH 1SGFG 2ZU3A 4UDWH 4ABEA 3RXQA 2PWXA 3P8NA 4B75A 4WMFA 1HBTH 3RXAA 3M7TA 1TB6H 5GXPA 3RXEA 1OKXA 1HAIH 1IQKA 1MQ6A 3VB4A 3CS7A 2EQNA 1ANDA 3P6ZB 1QRWA 3OYPA 2Q6GA 2O9QA 3NUMA 2HWLB 2HLCA 2Q6DA 1NTPA 3UWIA 2G4UA 1AMHA 3TH3H 3SGAE 3UR9A 3ZZ3A 5JPMH 2GCHF 1GBCA 2ALVA 3KF2A 2VIVA 1K1MA 3MH4A 1YPKH 5ESTE 1J17T 3EE7A 4E05H 1BB0B 5SGAE 1TBZH 9ESTA 3A81A 1NY22 1ZMNA 3FANA 3WWBA 1AVWA 3TGKE 3A8AA 4SGAE 2CHAC 5GCHF 2ZFFH 1BITA 2B8OH 3SUFA 2FOHA 2WYJA 5DJ7A 4H6SB 1E1RD 1O33A 1UK2A 2A32A 1ID5H 4UEHH 1C1OA 2D2DA 1O5FH 2ZDNA 2VIQA 2Y7ZA 4LZ1H 1EAXA 1DWDH 3KCGH 5H4IB 1W10U 2OC7A 2H1UA 3UIRA 5A8YA 1EZXC 3UNSA 1G2MA 2J94A 1ANEA 2V35A 3A8BA 3BTKE 3RU4D 4ISHH 1D3PB 3M3TA 2V3OH 4CBNA 1XUHA 1SGFA 2BMGB 4LK4A 2QC2A 3MU8A 3Q3XA 1GHAF 3GICB 3UWJH 1YPGH 3SHCH 1O2VA 1GGDB 1NRNH 4X6MA 1EFRD 1ETRH 2KCOA 1NRSH 3ZVCA 1LPKB 2ZNKH 1LO6A 3FO8D 1D3DB 1AE8H 1UHBA 1ZPBA 4X8TH 1BRAA 2RG3A 1FI8A 2JJ2D 3LJOA 4O3UA 1O34A 3TGIE 2AMPA 5E8EH 1KLJH 2WPJS 1LHFH 1O0DH 1ZHMA 2BVXH 4FETA 1GCTB 2RDEA 2PKSC 1K2I1 2STAE 3URDA 1JXPA 4ESTE 5IK2D 4BTIB 3ESTA 3HK6B 2A45B 5L2YH 1HJAB 1NPMA 3EQ0H 8ESTE 1PPEE 2KFWA 1TX8A 2V7QD 1PPFE 3I77A 2SGDE 1RTFB 4MPXA 4DW2U 1Y3WA 3SOSA 4ZKRU 2AGEX 3GDSA 2BDHA 2KX4A 3LGYA 1CQQA 1AQ7A 2ODQA 5LGOA 4NZLA 3LONA 3T5FH 5EIYA 1P05A 2YMSC 1O3CA 2F9UA 4JYVH 2FOGA 3MH5A 1TABE 2THFB 4HZHA 4AYYB 4KKDA 2AGGX 5T6FA 4GSOA 2C90B 2VVUA 1H9HE 1ZMJA 2AMQA 2ZFSA 1UVOA 2NU4E 3QTOH 5AFYH 4INHA 2UUJB 2ZWLH 2BXTH 3OY5U 3Q76A 4RKJB 4TT3D 3KEEA 2TIOA 1IQIA 2BQWB 2K8IA 4Z6AH 2VINA 3O8BA 1UJ1A 2Z7FE 2J5UA 2PHBA 3BG4B 1GL0E 2R3YA 2H9HA 2W7UA 3ZZ7A 1SMFE 4ZROA 2OLGA 3SU4A 2ZTXA 1GJ5H 3DA9B 5DP4A 2XCFA 5DK1A 3GCTF 1ETSH 2ZP0H 5FX6A 1CA0C 3S69A 3F2FA 3GY4A 4YOJA 1W0KD 4Q7XA 4AOQA 1O3GA 4DGJA 1UK3A 2V6NA 3UY9A 2A5IA 4D9QA 1XX9A 5GIBA 5IDKA 3E8LA 1C2KA 1HV7A 1SKYE 2JETB 4Z1MD 3V7TA 1GI1A 2PV9B 1P04A 3P8GA 2WPDD 1P10A 1DITH 1FY5A 1ZTJA 2OCVB 5C3NA 1C5VA 1TMTH 5CDFE 3UFAA 2BDYA 1D4PB 2ZPQA 2WPIS 3DHKH 2O8UA 1VCPA 2WV5A 2G5NA 2XCNA 2A5AA 3SU3A 1OP2A 5C5OA 2JH6D 3NZIA 1THPB 2ZDLA 4ZCNA 2XBVA 1PQ5A 4AB9A 3RXMA 1P12E 2VIWA 4CR9A 2Y82A 1AVXA 1SFQB 2W26A 1V2ST 1GJDB 1OWKA 1W11U 5CHBA 2ZG0H 1SC8U 2FS8A 5C1UA 2V3HH 2H5CA 5B6OA 1FQ3A 1HUTH 1WUNH 4F4OC 5EQRA 2FS9A 4B74A 2FLBH 2JH5D 1GCDA 1ABJH 1J8AA 1KDQB 3GY5A 4ZKNU 3TK5A 5A8XA 1C5UA 2R9PA 2GDEH 4BTUB 4OS5A 1C1RA 5A0CA 1OSSA 1EKBB 3K6ZA 3NPSA 4HTCH 2ZGXH 1EAWA 4XRNA 4I86A 3PV2A 5AVDA 2V0BA 4Q7YA 5FPSA 4ZKSU 3CP7A 3M7QA 1H9LB 7GCHF 2LNCA 1TNIA 2ANWA 1UTPA 4FUIA 4IC6A 5T6DA 5LPFA 3SQEE 4F49A 5HXFA 1ZGIA 2B7DH 1LHDH 4B6FA 1MU8B 1O36A 4Q7ZA 4ZHMU 3QX5H 1A2CH 1GBDA 2HNTF 1SBWA 1ELTA 2GP9B 1FY3A 4FUJA 1TE0A 5EQQA 4X2VA 4WH6A 1ELBA 4CBOA 3GY7A 2ZHQH 3K65B 3GYMA 4NIYA 5F8ZA 5JBAS 1NS3A 3CS0A 4CRAA 3SUGA 1CGIE 4IC5A 2H2ZA 4B2BA 2WPMS 1ELDE 1V2QT 3EDXB 1C1PA 1EPTC 1TPAE 1C5RA 2BQ6B 5E0JA 4P02A 1UVPA 4I8HA 1WV7H 1AD8H 1DT2A 1ZRBA 3MNBA 2L6OA 1ZPZA 5LH8A 1SGEE 1ZJKA 3S7HB 1AN1E 3ZZBA 4IN2A 3RDZA 2ZDKA 1V2NT 3SNDA 2PSXA 4XDEA 2FWWA 3ATWA 1TGCA 1FN8A 2BHGA 1C2HA 4AFZA 3ZVAA 1GI8B 3PMJA 1RRKA 3M7UA 1GI7B 2DE9A 1C5LH 1MAYA 3MH7A 1Y5AT 1B7XB 3EAJA 2BLQA 5I46H 1OOKB 3TNTA 1DY9A 1ZYOA 4Q80A 4YLQH 1GMCG 2BLVA 4Y8ZA 4AFQA 2WHXA 1L1JA 2CGAA 1DWBH 1UVSH 4IS5A 1KYNA 4YOIA 1ESBA 2KCYA 1LVBA 1GVKB 4BTTB 1O3NA 1XKBC 1FXYA 3KQBA 1O5BB 3U98H 2BY7X 3W95A 1BMMH 1SL3A 3O8RA 3SNEA 3RXUA 1UO6A 1UTNA 1ZTLA 4VGCB 3RXBA 1EB2A 1O3MA 2A0QB 1FV9A 3RU4T 4CRGA 2RA0A 3U28C 1WTHD 1AUTC 4X1NU 1VGCB 4AZ2B 2EI8A 2FIRH 1CGHA 2CMYA 3SV7A 2C8XB 2PFEA 5CHAC 3RXGA 5EXMA 4NIWA 1SHYA 1ELCA 5F8TA 4I33A 2WINI 5T6GA 5E2OA 3S7KB 1YPEH 2A4GA 1YWUA 1NESE 2J98A 2VIOA 5JBCS 1H8DH 2IOTA 2GD4B 1EX3A 1TQ0B 5EPNA 4Y11E 2ZFPH 3QGJA 1C4U2 3SUEA 1F5LA 1HAXB 1U6QA 1DSUA 1ESAA 2V3MA 1MH0A 3O8DA 3ZZCA 2J95A
chains in the Genus database with same CATH topology
1EXFA 1EB1H 1GJAB 4NG9H 1KY9A 1F92A 4WMEA 3EA8A 1XMNB 8LPRA 1AZZA 1P09A 1TRYA 3VGCC 1NU9A 5C67A 1C1QA 3DUXH 1C1VH 2QA9E 4BAHB 3M5MA 4LZ4B 3BV9B 2C93B 4GCHG 3KNXA 3LGTA 1K9OE 5C2ZA 4DCDA 1TNJA 2PW8H 2BDIA 1AFEH 3GY6A 2ZGCA 3SGBE 3TH2H 3NCLA 2A7CA 1V2LT 1G36A 1GBFA 4ZHLU 4BOHA 1CBWC 1P57B 1LHCH 2NU3E 2PR3A 2QF3A 3AASA 2H5DA 1C2EA 5A8ZA 2GV6A 2TBSA 4AN7A 1SGYE 1NO9H 1BT7A 1DICA 2XBXA 5FAHA 3TNSA 1QB1A 4WVPE 1QA0A 2O8TA 4U32A 1KLTA 4Y7BA 1ZOMA 1O2PA 1Y5BT 3LT3A 3U8OH 1BRCE 1BBRE 3PLKA 1ZLRA 5AFZH 1G3BA 3V0XA 1SGIB 4WF8A 2GV7A 1OWJA 1TGTA 2FZZA 4A6LA 3FZDA 1TA6A 2XC4A 1GDNA 4XE4A 2QY0B 2P94A 2F9NA 1XXDA 1AKSA 1TLDA 2A7JA 3DD2H 1P3CA 1O2RA 3BTHE 1XM1A 1SSXA 1Z8GA 3A7YA 4K2YA 1HAZB 2TGTA 4CRBA 2ZF0H 3SU2A 3E3TA 4DY7B 1A0LA 3K9XB 4ISIH 4CR5A 1TPOA 3GDUA 3LC3A 1GJCB 1FONA 2GTBA 1AU8A 3DFLA 3R0FA 1GMHG 1NM6A 1S5SA 3MU1A 1TBQH 1GBIA 4KP0A 1O2YA 1O3HA 2PKAB 2TGAA 1HJ8A 2J34A 1TNKA 3SW2B 1TONA 3PO1B 1BTUA 1GI9B 5ESBA 3A8DA 1Q3XA 1O37A 1OWHA 2XNIA 3RMMH 4E7NA 4I7YH 4K1TA 1ELFA 3M5OA 1F2SE 3MO3A 4YO9A 4ABAA 4GHTA 4TWWA 3BG8A 2ZHEH 1TOCB 3U1JB 3TJNA 2NU0E 5DKMA 1TWXB 2ZTYA 3UNRA 2BDGA 4XOJA 2QF0A 1NZQH 4JYUH 1B0FA 2SNVA 2BDAA 5EU8A 3KQDA 1C1MA 1H9IE 1HCGA 1B5GH 3SQHE 2BD8A 1QL8A 2OBQA 2BM2A 1MTUA 2AH4X 1DDJA 4O97A 3RXTA 2ZO3H 1AI8H 1V2TT 1HJ9A 1HNEE 1P9SA 3ATLA 1TGBA 8GCHF 1WBGB 3BEUA 4U30A 1DM4B 3MWIU 5HMAA 1DWEH 2BLWA 1L4DA 3ZZAA 1VITF 3FFGA 2ZHWH 3FAOA 1F0SA 1IQLA 2FMJA 1CGJE 4GHQA 3RXHA 2OINA 1IQEA 1NFYA 4DT7B 2UWOA 1IQMA 3TK6A 3BTFE 4B76A 3BTGE 1GBBA 1THRH 3E16B 2FOBA 1K28D 3STIA 2ASUB 1QB6A 3QTVH 2VWOA 3ELAH 5EW1H 3TH4H 1SQOA 2TGPZ 1EATA 3B8JA 1S81A 4XBDA 2VJ1A 5C1XA 4NZQA 1P8VC 2WUBA 3Q3YA 3ZZ9A 1QCPA 2DUCA 3GCHC 1T8NA 2EC9H 1LKAA 2NU2E 1BUIA 2ZA5A 3SJOA 1GJ9B 3RXPA 5BRRE 1C1UH 2XWBI 4X6NA 3PM3A 1ARBA 2FI5E 1MTNB 3AW0A 1GCTC 1A7SA 1CSOE 5AHGH 1CVWH 2GCTB 5FBEA 1LQDB 1AUJA 1HAVB 4AGKA 2AERH 2GDDA 1LVOA 3LGUA 2BXUH 2BLOA 1W14U 1P2OA 2QXHA 4MDSA 1O2JA 4UFDH 5FCRA 4ABBA 2GX4A 1SGRE 1MMJN 1P2JA 3F68H 2ZPRA 4NWKA 4JZ1A 1MKXH 2BY9X 1O2TA 3F9FA 3RMLH 1VR1H 4UFEH 3RXLA 1P02A 1QIXB 1GWAA 1OYTH 1EAIA 3A83A 3A7XA 1ZR0A 2AYWA 3QGNB 1S0QA 2GZ7A 4A1TA 1QQUA 2YNAA 2ZDMA 3CENA 4YESB 3A7WA 2ZZUH 4PROA 3UOUA 1LHEH 3PLBA 2QXIA 2VWMA 2STBE 1LPGB 3A82A 1EZSC 3M5LA 1O2HA 1RD3B 1T7CA 5EPYA 1O3FA 2F9VA 1T32A 1DVAH 5E0HA 3SHAH 3BG4C 4OS2A 1TPSA 2P95A 1C2IA 5G4BA 3RXFA 3TJUA 3MO6A 1GHWH 3D62A 3T62A 4NIVA 4X8VH 1TRNA 2A4QA 2VVCA 4LXBH 1DWCH 1TAWA 3MO9A 3P8OA 1BBRH 1GBJA 4GAWA 1O3OA 3UOPA 1ETTH 4I8JA 3IITA 1PPGE 3RXKA 1D6WA 1OS8A 2GT8A 3URCA 2Y7XA 4NFEA 3M3VA 2GZ9A 3UNQA 1XVOA 2XTTB 1TMUH 1PQAA 2JETC 1AHTH 4Y76A 1LVMA 1YM0A 2GMTC 1JIMA 1XUIA 1O2ZA 1GI0A 1GJ6A 2BD4A 4FVDA 1FIZA 3MOCA 4XBBA 1V2WT 1HFDA 1D3QB 1ZSKA 4GCHF 1ACBE 3ZVEA 2QYIA 2C3SA 1CE5A 3TVJB 2BD5A 3OU0A 4E06H 2Z9KA 2O8MA 1JMOH 4Y0ZE 1C5ZB 1ZMLA 1KXAA 2ZKSA 1IQHA 1F7ZA 1Z1IA 4MPVA 4KGAA 1V6DA 4CHAB 1GVZA 1SGPE 3IWMA 4D76A 2BX4A 4XFQA 3P17H 5A2MH 4MQAA 2J92A 1BBRK 3H7OA 1YKTA 2AMDA 4MNXA 1IAUA 1OP8A 5A0AE 1QHRB 5FX5A 4DJZB 4Y71A 1F5RA 1F0TA 1O2OA 1C1SA 1N8OC 1O3BA 2Z3DA 1FJSA 1GMDF 3L6PA 1BRBE 3ATIA 3RXSA 4DVAU 1TQ7B 4R0IA 1A46H 2D26C 1P2NA 1F5KU 2C8ZB 2JKHA 4X1SU 5C5NA 1KDQA 4RN6A 4ZUHA 2ZFTA 5F6MA 4Z0KA 3F1SB 3ODDA 1YPHC 2OTVA 1YPLH 1WQVH 1O3JA 1S85A 3M36A 5ABWA 2P16A 1T8OA 3MU4A 3SN8A 1TNLA 4H42U 4OGXA 5EODA 1NN6A 5DP5A 3BTEE 3LPRA 3E0PB 3F9GA 1YLCA 2WPLS 5DP9A 4CRCA 1DE7H 3T2NA 1TNGA 3H7TA 1GI4A 1KXDA 1C5QA 4X6PA 1Y3VA 1LKBA 1GMHF 3UQOA 3VB3A 1LDTT 2D8WA 2A7HA 3ZVBA 3U8TH 1BZXE 1NU7B 1LPZB 3SV6A 1Z8IB 3M37A 2I6SA 4UFGH 1UCYH 2ZI2H 3A84A 1TNHA 1TX6A 3HGPA 1O2UA 2ZHDA 2OP9A 1C5PA 5JBTA 1TBRH 3UUZA 1K1JA 1GDUA 3LH1A 1AY6H 4TWYA 3GY2A 1SOZA 2ZCLP 3RMNH 1B0EA 2ZCKP 4B73A 3SORA 2FTLE 1N6XA 2XBWA 1BTHH 2ZFQH 4TY7A 3RMOH 1L0ZA 1CA0B 1FZZA 1Z8JB 3QK1A 3VPKA 4ASHA 1DXWA 3HATH 2ODPA 4JMYA 1BMAA 3OSYA 3PV4A 1VITH 3MFJA 7LPRA 1BIOA 1SLXB 1ZTKA 6GCHG 2P3TB 4Q2KA 2ZHFH 2F9PA 3KGPA 4MNWA 2HGTH 1GHZA 1ZJDA 2TPIZ 4VGCC 2BD9A 2OD3B 1S6FA 3FZZA 2J9NA 1MKWH 1CHOF 3A88A 2OQ5A 1RJXB 2DE8A 4KELA 3PB1E 4THNH 3ENSB 3RC5A 2B0FA 1CT2E 3VEQB 1C5SA 1FLEE 4CRDA 2TRMA 2P59A 2PUXB 4X2XA 2OQUA 4JZEH 2RDLA 1WAYB 2BVSH 1S82A 3KQEA 1XUFA 1O3DA 3A7VA 3NK8A 1ABIH 1O2SA 2EEKA 3AW1A 2G51A 3ZZ4A 4D9RA 1Y3XA 2ANYA 1RTLA 2ZQ2A 3ZV9A 1O5GH 1VCWA 3GISB 4JZDH 1HLTH 2BD3A 4FUBA 5GJ4B 2A4OA 2HNTE 1MD8A 2W7SA 1ELGA 3EA9A 3U1IB 1QURH 3A7TA 2BYAX 4Y8XA 1BJVA 1BTXA 5C1YA 3GOVB 1BOQA 1QA7A 1ZSLA 5GCHG 4AGJA 3PWBA 4FUFA 2ANMH 4YZUA 4BAKB 1TFXA 2CN0H 3GDVA 1O5EH 4O3TA 1QRXA 3GY8A 3LGIA 4K3JA 4X0WU 1F0RA 1ZRKA 3UQVA 1E0FD 1BHXB 3LGVA 3SUDA 1EP5A 1CHGA 2BX3A 3ZYDA 1K1OA 1RIWB 3JZ1B 1FPCH 4B1TA 4K60A 1GHXH 1SB1H 2FP7B 2FPZA 3BTDE 4A1VA 4INLA 1C5YB 1SOTA 1P2KA 2W5EA 4AB8A 1L1NA 1EPTB 1GHAG 1SG8B 3LIWA 4QT8C 1NFWA 1SGTA 5E2PA 3E6PH 1K1PA 4FXGH 2ALPA 3RXDA 1T4VH 5F8XA 4J2YB 1C1TA 4A92A 1TIOA 2G4TA 2ZDAH 4JYTA 1JOUB 1SLVB 2FXRA 2FOEA 2WPKS 2CF8H 2ZGHA 1BJUA 4NFFA 1MTSA 5EGMA 3K6YA 4NGAH 1O31A 1SQAA 2SNWA 2VIPA 3H5CB 5DP6A 1BA8B 2EA3A 2JH0D 2UWLA 3V3MA 1BRUP 1G3EA 2B9LA 2G8TA 1TPPA 1SLUB 3TK9A 1Z71A 1QBNA 1HXFH 4JK6A 1SPJA 1GJ7B 4J1YA 2VH0A 1QJ1B 2FDAA 3FP7E 1P2QA 1O3LA 2F83A 3L33A 2IJOB 2A2QH 1QGFA 1EASA 1GHBG 1O2LA 1SGQE 5EG4A 3UTUH 1SGDE 2Z9JA 3BEFB 1UK4A 1AB9C 2R0LA 3IG6B 5DP3A 3MYWA 1S6HA 2ZC9H 4R8TB 3PYHA 1XUKA 3LKWA 2ZU5A 1XUGA 4ISOA 4AFUA 3QLPH 3SZNA 3BIUH 3BTQE 4Y10E 1KLIH 4CH8B 5JDUB 1TALA 5FPYA 1MTVA 1O32A 6CHAB 1V2PT 3ATKA 3A80A 1DX5M 1MUEB 1NFUA 1HDTH 1QJ7B 2XW9A 3F9HA 3V13A 2GKVE 2ULLA 1A61H 3A85A 3B23B 3PO1C 1OYQA 2VIDA 6LPRA 2VGCB 2G55A 4IW4E 1Z6JH 4YM9A 1SVPA 2F3CE 2BZ6H 1C2MA 3WY8A 4NA7A 4I32A 1AFQC 3GCTG 1MD7A 1OXGA 3PLPA 2Y81A 4UE7H 2H9TH 1C5OH 3RLWH 2PKAA 1C4Y2 3TIUA 1Z6EA 1GBAA 1DPOA 5DGJA 3MU0A 1QJ6B 9LPRA 4FUCA 1NC6A 5I25A 3PTNA 1XVMA 5FPTA 2EI7A 4DOQA 5CE1A 4CRFA 1DANH 3VGCB 2BDBA 1YLDA 1HPGA 3VXEH 1SR5C 2PTNA 1O2MA 5TCCA 1G9IE 1O38A 4MVNA 4ZXYH 2CXVA 1P9UA 3BF6H 3RXVA 4I8LA 1YP9A 1WYKA 1TMBH 1HIAB 3ZYEA 1O5CB 2H6MA 5F03A 4UONA 4DIHH 1X7AC 1HYLA 2P8OB 1FY1A 1FAXA 4BNRA 1O3IA 4X8UH 1G3DA 1M9UA 1NRPH 1UTKA 3I29A 4RSPA 1ESTA 1YBWA 2BY8X 1GDQA 3C1KA 3BTWE 2CJIA 1IQJA 1IHTH 1AGJA 4OS7A 1O2XA 1BCUH 1YPHE 2QAAA 3ATMA 2ZQ1A 1V2VT 1GG6C 4GUXA 1DLKB 2A31A 1GBHA 2BY5X 1K1NA 4BANB 2BZAA 2R2MB 4X8SH 3PTBA 1QB9A 2G5VA 1P2IA 5FBIA 5E0GA 5DO4H 1V2UT 4INKA 1Y3UA 4WY3A 2BD7A 1SHHB 1W13U 3RLYH 3D65E 3TITA 2ZDVH 2Z3CA 3UR6A 1YCPH 2FO9A 4WMDA 4JZIA 1KTSB 1GJ4H 4FVBA 1K22H 2UWPA 1G37A 3E0NB 1G2LA 2QV1A 3G01A 3N7OA 4HGCA 2XXLA 4SGBE 3BTME 3RM0H 3SU0A 2FI4E 3UREA 4E7RG 3K2UA 4AG2A 4ABGA 3QO6A 3ITIA 1UTMA 3U69H 1F0UA 1UVTH 1UCYE 1PJPA 5DP8A 1HAVA 2I6QA 3E90B 1TX7A 1VZQH 3F9EA 2Z6BD 5LPRA 1W7XH 4OS6A 1N1LA 2R0KA 1P06A 1GGDC 2QXJA 1C5XB 2SGEE 3EYDA 1W0ZU 2NWNA 1XKAC 1CT0E 2FOAA 3Q00A 3SV2H 2VWNA 2ESTE 2OBOA 2FOFA 1GJBB 1DOJA 3VB7A 2BOHB 2KAIB 4X1QU 4A7IB 2XC5A 2R3UA 3D23A 1GBLA 4IBLH 1O3KA 2A1DB 4WXIA 2Y5GA 1THSH 1HJAC 1Q2WA 1QTFA 4TPIZ 4RKOB 2OC8A 5LPEA 3D49H 1ELAA 1A1RA 1KIGH 1GMCF 3VXFH 2WYGA 2Q1JA 1HAHH 1C1NA 1C9PA 4KTUA 1BTWA 1LCYA 4JZFH 1QFKH 2BQ7B 1EJNA 1DUAA 3JZ2B 4BAMB 1E36B 3A87A 1A5GH 1D6RA 4AFSA 4I8GA 3V12A 3C27B 2SGAA 4KTCA 1YF4A 1V2RT 5PTPA 3RUOA 2GZ8A 3PWCA 2IPHA 2A2XH 1LQEA 5EOKA 3LJJA 4MTBA 1H4WA 1O3PB 5TCAA 2GGVB 3HPTB 2WPHS 3SV8A 5TJXA 1E37B 3SNCA 4U2WA 3ZZ6A 5J4SA 4ZKOU 1P01A 1A4WH 1MQ5A 4IGDA 1QQ4A 4CHAC 1P2MA 2XRCA 1P11E 1TOMH 1MCTA 1W3CA 3GCHB 5AF9H 3LDXH 2EI6A 4A5TS 4BXWA 2QCYA 4K5ZA 3M61U 1PYTC 3U8RH 4B2AA 1MKXK 4JCNA 3SGQE 1JRSA 1JBUH 1OWIA 3UPEA 2SFAA 1V2OT 1GJ8B 1ZHRA 2D1JA 4JK5A 3TJVA 2P3FH 1OWDA 1GPZA 4DG4A 3ZZ8A 1GI6A 2ZGBH 3P70B 3M5NA 2CHAB 3RC4A 4D8NA 1ANCA 3S9BA 2F91A 1MBQA 2FYRA 3LC5A 3DT0H 3TJOA 1AIXH 1MBMA 2ZU1A 2BB4A 2FESH 5GWZA 1GHYH 2TGDA 1UTOA 2FM2A 4WH8A 4ZH8A 2XC0A 1GHBF 1HGTH 2O8LA 1K1LA 1KXFA 2PGBB 1EJAA 1L2EA 4TY6A 1HAPH 1UHBB 1O3EA 4O03A