2D26C

Active site distortion is sufficient for proteinase inhibit second crystal structure of covalent serpin-proteinase complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
236
structure length
223
Chain Sequence
TEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-1-antitrypsin
publication title Active Site Distortion Is Sufficient for Proteinase Inhibition by Serpins: Structure of the covalent complex of alpha 1-proteinase inhibitor with porcine pancreatic elastase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 32
structure length 223
sequence length 236
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2005-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2d26C02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2d26C01
1ANEA 4LZ4B 1F5KU 1QIXB 2BXUH 2G4UA 1QRXA 2A5KA 3S7HB 2J38A 1YP9A 3A86A 3A8BA 4BTUB 5DP5A 1TBRH 2VIPA 2P94A 5A8YA 3TH2H 3SV6A 4K1TA 2H2ZA 3LGTA 3NCLA 1HNEE 1VCWA 1LVOA 2G5NA 3E8LA 1C1SA 1O38A 1TRMA 1TRNA 2VVCA 1OWKA 4B76A 1MBMA 2VWOA 2P3TB 3A89A 3FP8E 5F8ZA 1AVXA 1ZLRA 2HRVA 2I6QA 3ZZCA 3MO9A 3ZZ6A 2P3UB 3P6ZB 1GHBG 1KDQA 3TNTA 4BAHB 4THNH 2ZHEH 1ANCA 1V2KT 4QT8C 1GG6C 4BAOB 1SGTA 3VGCB 4B2BA 1C4Y2 1X7AC 2C90B 1LPZB 3GCTG 1P2OA 1RTLA 3RXLA 1O3NA 2Z6BD 1GPZA 1TFXA 4H6SB 1UJ1A 3TVJB 4AYYB 2V0BA 4X2VA 4X2XA 4AX9H 1N8OC 3E16B 1K28D 1HAYB 2EI6A 5CHAC 2J34A 4UDWH 1TBZH 1DE7H 3PTNA 4Y79A 4OGXA 1P04A 1CE5A 3A81A 2SGEE 4E7RG 1XX9A 2WPMS 2ZIQH 2C3SA 1EUFA 2UUFB 3GCOA 1SLWB 2HNTF 1YPMH 5EXLA 3SQHE 3BG4B 5DO4H 4A1VA 1Z8IB 3ITIA 2AYWA 2CV3A 4X8VH 3T5FH 4NSVA 1A4WH 1UK3A 8KME2 4X1QU 1BRUP 1KXFA 2WV5A 4DIIH 1S83A 4IN2A 3TIUA 1EKBB 1VJ9U 2GDDA 1NZQH 5IDKA 2LPRA 2C93B 1KDQB 2BX3A 1GBIA 3E6PH 4IBLH 2Z9JA 1TNGA 2OBQA 1E37B 1SGCA 1BTPA 2D1JA 3VEQB 2F9PA 3NXPA 3RXEA 1FY1A 4TWYA 1ZTLA 1DITH 1CQQA 3DUXH 4I31A 4ZKNU 1V2ST 1C5NH 2Y80A 4Q7YA 1IQHA 3QLPH 1TRYA 2R9PA 3FANA 1S82A 3NKKA 5DK1A 2ZDVH 5EODA 1ZHMA 4ABFA 3TK6A 4Y76A 1WAYB 3QTOH 5C67A 4GCHG 1MCVA 5I46H 3SU2A 4LZ1H 3U8OH 2O8MA 4I32A 1O0DH 1AVWA 2FO9A 4XBBA 1FY4A 3D62A 2VNTA 1GHXH 4JK6A 2VIOA 2SNVA 2Y5HA 3TITA 1EATA 1AD8H 1H8DH 3SJ8A 3ZVDA 1O2VA 1C2FA 1UTNA 5T6GA 4Y0YE 2WYJA 3VXEH 4ZKOU 1EP5A 5EXNA 2ZDAH 2PLXA 5FAHA 2ZTXA 2WPHS 3F68H 3QUMP 4ZH8A 2AERH 2Y82A 4ABEA 1S0QA 1BB0B 1ZMNA 1NFWA 3MU5A 2QXHA 1YCPH 3MU1A 2HPQH 3OX7U 4FUIA 1O2MA 1C9PA 1BMAA 2XW9A 1GG6B 3SOSA 1NROH 3R0FA 1BJVA 4XBDA 2H9TH 1GBLA 1O39A 1KXAA 1K1LA 3UQVA 2ESTE 4F4OC 1RD3B 5HM2A 4K8YA 2H5CA 1RIWC 1YPLH 4WMFA 4NA8A 2AS9A 3A84A 1OXGA 5F6MA 1EZXC 5DPAA 3TK5A 3SNBA 2AMPA 1GJBB 1Y5AT 1HAPH 2ZECA 1TGCA 5CHAB 1GI2A 3RMOH 1G9IE 1P3EA 3PLKA 2B0FA 2PTNA 4XSKU 2RA0A 2ZFTA 2VVUA 1MUEB 2ZU1A 1RGQA 2QXJA 3T62A 1ZSLA 3BEIB 1P03A 3F9EA 1J15A 1EXFA 3KGPA 3QK1A 1NESE 1O2QA 1C5LH 3VFEA 1ELTA 5FX6A 1SL3A 3EE0B 1ABJH 1WQSA 5TCAA 1AVGH 4Y11E 3IITA 5SGAE 1UVPA 4RKOB 1AUTC 3RMLH 1QL7A 1HFDA 1GHVH 2ZNKH 1SI5H 4Y8XA 2ODQA 1HXFH 1HB0B 2OC7A 4H4FA 2J4IA 4HFPB 2TGPZ 1LMWB 1S81A 3P8GA 2SNWA 3TK9A 2Y7ZA 2VIQA 4K60A 1GBHA 3KN2A 2SGDE 1Z1IA 4O9VA 5DP7A 5IYTA 1ESBA 1CSOE 2F9BH 1HV7A 3ZVBA 2TPIZ 3SU4A 4H6TA 1KYNA 2JH5D 1O3BA 4I8LA 3AW0A 2OINA 3LGWA 1G3DA 2ZDMA 3M5MA 4IN1A 1CGJE 1QFKH 2P8OC 2ZTZA 2Y5FA 5GWZA 1P2MA 1EZQA 1TOMH 1ZMLA 1O5FH 5A0BA 1HJAC 1A0JA 2B7DH 4NA7A 5GCHF 2Q1JA 1EJMA 1C5XB 2EI8A 1W11U 4AOQA 1FUJA 1GJ9B 5JBBS 4K69A 1C2EA 2FX4A 1AGJA 1O2SA 4AFZA 4GPGA 3RLWH 3RUOA 4Y71A 3ELAH 1P3CA 4CR9A 3TNSA 1AWHB 1C1TA 3URCA 5PTPA 1UTOA 3V3MA 3OY5U 4WH8A 1B0EA 4NZQA 3SUEA 4WY3A 1E38B 1JRTA 2ZFRH 2JETC 3E90B 3QZQA 1C2KA 5H4IB 1O34A 3SNAA 4A92A 4K5ZA 4ZKSU 2QV1A 3QO6A 2QCYA 1RIWB 1O3LA 2EA3A 4ZAEA 3PWCA 2AEIH 1HDTH 2W3IA 5T6DA 3EA9A 1N6YA 1YM0A 1ZOMA 2OQ5A 1O3PB 1L1JA 1ZRBA 1J8AA 4FUJA 5HYOA 1EB2A 1AWFH 4X6OA 3KQBA 1BITA 4FU8A 1C2HA 5JB9S 3AASA 1AY6H 2VH6A 4JMYA 2HNTC 4A1TA 2ANYA 1TYNA 4NGAH 1C2GA 1NTPA 4B74A 3IG6B 1RS0A 1EX3A 2ZGCA 1GBDA 2A5IA 3EGKH 1SG8B 2G8TA 2STAE 1QJ1B 4MNVA 3EYDA 1Y3XA 1BMLA 2H5DA 1ZJDA 3A80A 4KELA 3RXAA 4Q2KA 1ELVA 3M5LA 3MO3A 1Z6JH 2FTLE 4MPXA 1GL0E 4UFDH 2AFQB 2YNBA 1G36A 1E0FD 1ESTA 4ISNA 3ZZ4A 1VGCC 3ODDA 1XXFA 1GBCA 2FESH 3OU0A 4FVBA 1GHBF 2AIPA 2AMDA 3LU9B 3EA8A 3M7QA 1LVBA 1GJAB 1NRPH 4OS2A 1GHWH 3SUGA 1UCYK 1JIRA 5TCCA 3GCTF 5AVDA 1GBBA 2GV7A 7KMEH 1WQVH 1AFQC 1QR3E 2A4OA 3ESTA 5DP4A 3QGNB 2ALVA 1P01A 2XBVA 2NU0E 1W12U 3PMHB 2FOEA 3GISB 5FCKA 1GBTA 3V13A 1BJUA 1IQFA 2TIOA 3O8RA 4I8HA 2J2UA 1A2CH 1GCDA 1L1NA 1GGDC 1SHYA 1C5UA 4Y7AA 3E0PB 3FZDA 1BTZA 1IAUA 2BDGA 1BBRK 7ESTE 1K2I1 1VITG 1P2IA 1A0LA 1GHAG 2ZP0H 1BTXA 1ETSH 2JETB 2PKAA 2XXLA 4CRFA 3O8DA 3E1XB 1NY22 6LPRA 4ZHAA 1O2XA 1W14U 2SGFE 4CHAC 1KIGH 2Z9GA 1Y8TA 3GYLB 2Z3EA 3MWIU 5FPSA 1L2EA 3KQDA 1V2MT 1VR1H 1ZRKA 1HJ9A 1AE5A 1GVKB 4K8BA 4D9RA 3AW1A 1OKXA 2AIQA 1H9IE 4TY7A 2FWWA 2XC0A 3TJOA 3MTYA 3P70B 1GJ8B 3FVFB 4XBCA 3SU6A 1O30A 1TGNA 2DE8A 4K2YA 2UWLA 1QB9A 2KAIB 4CH2B 5EPNA 2A0QB 3UTUH 1SFIA 4Z6AH 3EQ0H 3MMGA 3S9AA 1BTYA 4GCHF 5F8XA 4ABDA 4WMDA 4MPUA 2LNCA 2QC2A 3OY6U 4DT7B 1F0UA 1UVSH 1YPHE 1QTFA 1XUFA 3RXHA 2BY6X 3PO1C 4JZ1A 1CHOG 1KXBA 2CF9H 3EAJA 1GVZA 4K1SA 1QBOA 1FY8E 3RXTA 4WXIA 1TAWA 4MPWA 4D7FA 2PKAB 3T25A 1BTUA 3STJA 2RA3A 2PSYA 3NUMA 3SJIA 1P0SH 2IN2A 4CBNA 1O37A 4WH6A 1H4WA 1KXCA 1BTHH 1OPHB 2A5AA 1MZAA 2UWPA 3BV9B 3UREA 1DWCH 2WPLS 3SU5A 1A7SA 1Z7KA 1O2TA 1TONA 2R2WU 4JZDH 2JKHA 2O8LA 1FN6A 5EGMA 1MKXH 1SGFA 3U9AH 5DP9A 3GOVB 2R2MB 2RDLA 3A88A 1C2LA 1HAZB 4CRAA 1XMNB 1HIAA 1GVLA 1V2PT 2FOCA 2Z94A 3BTDE 3L3TA 1LKBA 4JYUH 4CR5A 1ELBA 1LHEH 3RC6A 1A5HA 4CRBA 3U98H 4X8UH 1WCZA 1AO5A 1H1BA 3JZ1B 1T32A 1AI8H 3KHVA 5ESTE 2R0KA 4X8TH 1GHZA 3SV7A 2IPHA 4NIWA 2ZF0H 4XDEA 1TMUH 3RM2H 3RMMH 1F92A 1V2RT 1PPFE 1O3HA 2XBYA 3GYMA 1MKWH 4AGKA 1OWDA 1NRNH 1QY6A 1U6QA 3SNDA 1RTKA 3KQCA 2B9LA 2PSXA 4X6MA 4B71A 2OD3B 1KXDA 4VGCC 3RXGA 2THFB 1SGDE 1DY8A 2OC1A 4D8NA 1LDTT 3ZZ8A 3M7UA 3FZZA 5B6OA 3WY8A 1V2QT 1UTMA 2VWNA 4ZXYH 2PGBB 2QY0B 1CGIE 4JZEH 1YGCH 2XCNA 5AHGH 4UFGH 4DOQA 1GI0A 1B7XB 2CMYA 1OP8A 1P2KA 3LGIA 4AFQA 1O3GA 1DDJA 1O2KA 2ZDKA 1C5VA 1PYTD 5DG6A 1BRAA 1V2TT 1HIAB 2R3YA 3LIWA 1ZHPA 1DY9A 1YPHC 4F49A 5A09A 3BTTE 1GDNA 1ARBA 1O5BB 1CT2E 2WPIS 1P11E 3URDA 1GDUA 3BTME 3HK3B 2TBSA 1SOTA 1TNIA 4DG4A 1XVOA 2C8ZB 3UR9A 3M61U 1GBEA 2A7CA 2ZFSA 3PO1B 2FPZA 3M3SA 2O8TA 1BQYA 2ODPA 2WV4A 3PROA 1MTSA 1UTPA 3GY5A 3ZZ7A 3E3TA 1NO9H 3Q3YA 4MLFB 5FX5A 4DW2U 4ABJA 4K1EA 1PYTC 1Y3YA 3BTFE 4KGAA 3U8TH 2F9UA 4NFFA 1YLDA 2PR3A 4AORA 2W7SA 5JBTA 2ZCHP 3FP6E 3A7TA 3LJOA 1IQIA 1TX7A 2GX4A 1TX6A 2GT7A 5ABWA 3ZYEA 3ATMA 1O2YA 2VGCC 2FM2A 2VH0A 1CT0E 1Y5UT 1QBNA 4AB9A 4YLQH 1UK2A 4GAWA 4BOHA 2BOHB 1VCPA 3GY7A 1F5LA 5EXMA 1QQ4A 4JYVH 4DY7B 5GXPA 3HGNA 3MYWA 3ZZDA 5L6NH 3A7ZA 5E0HA 1YCPK 2XRCA 4SGBE 4NA9H 2VWMA 1INCA 1GI5A 5HMAA 7LPRA 2VB0A 2BD3A 1O5EH 1D9IA 3GCHC 5A8XA 2CGAA 1P02A 2GP9B 1YF4A 1DICA 3ATLA 3ZZ5A 1OWHA 3VB3A 3QGJA 1O3IA 1M9UA 2FS9A 2A2XH 4B2AA 1IQEA 1MTVA 1ZSJA 2BYAX 3TH4H 2YNAA 1ORFA 1WV7H 1O2OA 1G3EA 1HAHH 3ZVGA 4D9QA 2FOGA 3GY8A 3MH4A 3S7KB 2P95A 2W26A 7GCHF 1TMTH 1BMMH 3ZYDA 1MMJN 1O35A 2HOBA 1FJSA 4U32A 3M3TA 1AZZA 1C4U2 2BDYA 1E34B 1H9LB 5L2ZH 4IC5A 2AMQA 1WYKA 5GIBA 1UK4A 2ZGXH 1S85A 1EZSC 2FYQA 2ZU4A 3VXFH 2O8UA 2VIVA 4ZROA 5DGJA 1Q2WA 1IQMA 3IWMA 1WUNH 2BHGA 4BANB 5LPFA 3CS7A 3M7TA 1C2DA 2VIDA 2G52A 1SGQE 1DSUA 3G01A 3UOUA 1PPHE 2ZQ1A 1THSH 3FP7E 1AB9C 4Y0ZE 3RU4T 2TGTA 3M36A 1TNJA 1B5GH 2VU8E 3ZZ3A 1LHGH 2OC8A 3A7WA 1OYQA 1DWEH 4FUEA 1C1UH 1TNHA 3RM0H 1JOUB 5A8ZA 5JB8S 2TGAA 2Z9KA 2NU3E 3MH6A 2TGDA 1BRBE 2AGIX 1TALA 1VITF 1W7GH 1Z8JB 3L6PA 3DA9B 1FQ3A 1GHAF 1WBGB 1AE8H 3U8RH 4MG3A 1K1PA 1RFNA 1N8OB 2VGCB 4AB8A 1LPKB 3P95A 1ZYOA 5J4SA 2A4RA 1D3DB 1SLXB 1V2OT 2V3HH 5JYIA 1TPPA 1F0TA 5AFYH 3K2UA 3LH1A 3TGJE 1HUTH 2D8WA 2ZI2H 1GBJA 4BXSA 2FOHA 1DPOA 1DLEA 5FHTA 1DWBH 1KY9A 1MU8B 3GCNA 4HGCA 3OTJE 3V7TA 1FY3A 1FAXA 3LGVA 3SU3A 3SNCA 4Y10E 3GCHB 4J1YA 3SGAE 2BZAA 5ESBA 4MVNA 1YLCA 4UFEH 2WUBA 2XC5A 3NPSA 5EQSA 2C8XB 5C3NA 4XE4A 4MNYA 1SSXA 1ETTH 4MQAA 1P2QA 3SBKA 1MTUA 1CHOF 4INHA 1IQLA 3HGPA 3KEEA 1C5SA 5DP3A 1J14A 4X6PA 2BD8A 3U1JB 3KQEA 1F7ZA 2PUQH 4Y6DA 9ESTA 1FNIA 4OS4A 1H9HE 1MQ6A 3A7XA 2ZGJA 1KLTA 1NFUA 3T28A 4ZHLU 1O2PA 2G5VA 1YKTA 2GVFA 3T2NA 2G81E 6ESTA 3RC5A 1C2IA 1GMCG 1FI8A 4GSOA 1D3QB 2BOKA 3RXIA 4JZIA 4DIHH 1FZZA 5G4BA 1TNKA 1C5WB 2ZWLH 1ESAA 5BPEA 1LCYA 2BLVA 1MD7A 2XWBI 4B73A 3C27B 4NSYA 4D7GA 1JXPA 2ZG0H 1CVWH 1V2WT 4ABAA 2CHAC 3VB7A 2BMGB 1P57B 2ZGHA 1L1GA 2I6SA 2EEKA 5C1YA 3ATKA 4DURA 1DM4B 1AB9B 3SV2H 3ZZAA 4FVDA 3SV8A 3F9FA 3KIDU 4GHQA 2XYAA 4NFEA 1F0SA 4HZHA 4UEHH 1GCTC 4INKA 3DFJA 2GDEH 1PPGE 4ZKRU 1C1RA 3GICB 3E91A 3TGIE 1P10A 2A1DB 4AG2A 3RXSA 3BEUA 2GZ7A 1D3TB 1DUEA 1PPZA 4TWWA 1GJ5H 1Z71A 1KSNA 3H5CB 2BDHA 2BB4A 1GI3A 1ELCA 1GMDG 1O3JA 3RXKA 1HXEH 2SFAA 1EQ9A 2GCTC 3ZV9A 1BIOA 1JRSA 4Q7ZA 5E2PA 5GDSH 2C8WB 1HAGE 2FMJA 1FMGA 4UONA 2PUXB 4R8TB 1O2GH 1ELAA 3LH3A 1C4V2 4M7GA 4Q80A 1MBQA 1ZMJA 1OWIA 4NG9H 4X8SH 2FXRA 3I78A 5A2MH 2BDAA 1EOLA 4FXGH 4X1RU 3FAOA 1V3XA 1L0ZA 2H9HA 1T8OA 1RTFB 1CHGA 5E0JA 4Z0KA 1YPEH 4LK4A 3M5OA 1LHDH 3HKIB 1SGIB 3STIA 3BSQA 1O2WA 3GDUA 1BMNH 4UE7H 1O32A 6CHAC 2QXIA 4AG1A 3PWBA 2GCHG 1AUJA 2A32A 2D26C 2ANKH 1PPBH 1P9SA 4IC6A 2P8OB 3VB5A 1QGFA 1V2LT 4ZMAH 1CBWC 1YPJH 2GMTC 1HJAB 4UD9H 1MAXA 1ELDE 1GJ7B 5DP6A 1S6HA 1EZUC 1V2VT 1O3DA 1P8VC 3O8CA 1HAXB 1W7XH 4MPVA 4NIYA 1QL8A 4A5TS 2QN5T 2RCEA 2OTVA 5EW2H 1PQ5A 3UWIA 2CHAB 4OS1A 5FXLA 2FI5E 3PMBB 5BRRE 3LKWA 3ZVAA 3AAUA 2HWLB 1HJ8A 4A6LA 2ZGBH 1TGSZ 8ESTE 2ZZUH 3HATH 3UY9A 1GCTB 5FPYA 1P05A 3T26A 1XUHA 5C1XA 2GV6A 2Z3DA 1SMFE 3UFAA 4BAQB 5AFZH 2UUJB 3DD2H 3S9CA 1Z8RA 2B8OH 1K1OA 4MDSA 4CBOA 1C5QA 2BDIA 3RXOA 3HK6B 3QN7A 2BY5X 2QAAA 2OLGA 1UO6A 2F83A 1ZJKA 1HBTH 3DT0H 2ALPA 2J92A 1RRKA 2GCTB 4O97A 3SHAH 1WU1A 2BLOA 1OWEA 2FEQH 1A46H 1TA2A 1O2NA 4FUBA 2V3OH 4WMEA 3KNXA 1LHCH 2IOTA 5EQQA 2YOLA 1LQEA 3LC3A 1FIZA 5EG4A 5EOKA 2OXSA 3EDXB 1AKSA 1BHXF 1TOCB 4Q7XA 1GBAA 3BTQE 4BXWA 4KTCA 3VB6A 1TA6A 4Y8YA 3RXMA 1NRQH 3BIUH 1NS3A 3RXFA 1SOZA 1TPOA 2VJ1A 2GTBA 2ZKSA 2RG3A 2FOMB 2FODA 2CJIA 3O8BA 2BD2A 1KLJH 1K1NA 1UCYH 2W5EA 1FPCH 1P2NA 2NU1E 3MHWU 1K21H 4I33A 4YOJA 1ZZZA 5EU8A 1O3CA 1K1IA 6CHAB 1C5ZB 2WPKS 1VGCB 3A7VA 4A1XA 1O2RA 1FPHH 2PHBA 1A61H 4ZXXH 2R3UA 1DS2E 1Q31A 3UQOA 4K3JA 1TGBA 1N6XA 1O31A 2H1UA 2ZCLP 4YM9A 1OYTH 1Z6EA 1CBWB 2ZPQA 3LOXA 3SORA 3GY4A 2VWLA 2H6MA 3LC5A 1LHFH 1AFQB 1VZQH 3RMNH 1BBRH 4OS6A 1F0RA 1GJ6A 3BTWE 1GI9B 1P2JA 2BX4A 1MU6B 3SUDA 1AKSB 4TYDA 4CRGA 1RJXB 1NRRH 1EB1H 1G32B 3P8FA 1O33A 3CP7A 2ZTYA 4BNRA 1PJPA 1TNLA 1QHRB 3VB4A 1GGDB 1P09A 1SLUB 1PQ7A 1BDAA 2ZHDA 2Z9IA 1ZHRA 1DX5M 3B9FH 1H8IH 3UPEA 1EAIA 4KKDA 3BG4C 1QL9A 1UVOA 3MOCA 2NU2E 3H7OA 1SGEE 4MNWA 1GMHG 4CHAB 2EC9H 1XM1A 1LVMA 3TJUA 3S0NA 2WUCA 2EI7A 3BTKE 1PQ8A 2ZHFH 4X2YA 2UUKB 3T29A 3UNQA 1C5MD 3ZV8A 1GI6A 1TGTA 3SI4H 1Z1JA 4X1NU 4XOJA 2J9NA 2HGTH 3P92A 2GZ8A 2BLQA 4YOIA 2BDBA 4DJZB 3SN8A 5LH8A 2Q6FA 1MCTA 3SJOA 1O2HA 3QTVH 2AGGX 3M3VA 2ODYB 4ESTE 3DFLA 1EAUA 1S5SA 2FZZA 1A1RA 1BT7A 1BOQA 4RN6A 3M37A 1LTOA 2FLBH 1A5GH 4TPYA 1GBMA 1QJ6B 2F9OA 5C2ZA 2DUCA 1A5IA 1GI8B 1Y3UA 2ZU3A 1O3MA 1SPJA 5FCRA 1GMCF 1UTQA 4J2YB 2OQUA 4AZ2B 1AU8A 5C20A 5HGGA 2BTCE 4FUFA 3SW2B 5HM9A 1GWAA 2BZ6H 3L33A 2BVXH 1CU1A 3SU0A 4AFSA 2OCVB 3K65B 3NZIA 1T31A 1FIWA 3RXPA 3SJ9A 1UTJA 3TGKE 1MAYA 3SGBE 3SO3A 3Q00A 1ZPZA 1C1VH 1DXPA 3RXQA 1XUGA 1QJ7B 2FDAA 4RKJB 1VCQA 4ZUHA 2FIRH 3BN9A 3UWJH 2PW8H 3LGYA 4GVUA 1T7CA 2BDCA 2ZC9H 5T3HA 2C8YB 3MH7A 3MNSA 5LPRA 1EASA 2SGAA 4UFFH 3DHKH 2CF8H 5J4QA 4NWLA 2FOBA 2J95A 1DT2A 8GCHG 3LDXH 1PQAA 4MTBA 2A45B 3BG8A 1IQJA 4IGDA 3ZVEA 1O5GH 1SQAA 1DANH 3MNBA 1GMDF 1UTLM 3RU4E 1HRTH 2ZHWH 1QB6A 1FAKH 3PB1E 3B23B 2BY9X 3PLBA 3GY2A 3HPTB 4MNXA 1ELEE 1O2IA 1V2UT 2IJOB 1Z8GA 2UWOA 2QF0A 1UHBA 1W3CA 1ANBA 1Y59T 9LPRA 4YTAA 2SGQE 2DE9A 2O9QA 3BEFB 3MU8A 4H42U 3AAVA 4VGCB 1W0ZU 2F3CE 4B1TA 1UVTH 1LPGB 3A8AA 3PM3A 1TQ7B 2QIQA 2XBWA 1ARCA 3W94A 1MD8A 1NU7B 1Y3VA 1XUKA 1FDPA 1EAWA 3SZNA 1O3KA 5F03A 1NFXA 1GJ4H 6GCHG 1G3CA 1BA8B 1ZPBA 2WPJS 3K6YA 2BLWA 1Q3XA 2GGVB 1C1QA 2BM2A 3SUFA 1NT1A 3ATWA 5JBAS 5T6FA 3RXBA 2G51A 2GCHF 3RP2A 1K22H 3P8NA 2BY8X 1HAOH 1HYLA 1ZPCA 2ZHQH 1GI4A 1B0FA 1SQOA 1BCUH 4D76A 3D23A 1P12E 2TRMA 5C5NA 2P59A 3FFGA 3F9GA 1J17T 2A31A 3SU1A 3H7TA 4GHTA 1WOFA 3RU4D 2OUAA 2Z9LA 3Q77A 1WTHD 1UHBB 1QA7A 2Q6DA 4X1SU 1XKBC 3BTEE 3MI4A 1O2UA 3GY3A 4X6NA 1SHHB 2XWAA 1FY5A 1T8LA 5EW1H 5L30H 2ZDNA 1UVUH 1XUJA 1V2JT 1QBVH 3MU4A 4NIXA 3UNRA 3MO6A 4BAMB 1S84A 2VINA 4KP0A 1MTWA 4WXVA 1EJNA 1O2JA 1GBKA 3Q3XA 3EA7A 1O5CB 1V2NT 3F6UH 2GKVE 1ID5H 4YLUA 1A3BH 5K7RA 3RXCA 2XC4A 1ZTJA 5LGOA 3SNEA 1ETRH 2QXGA 5A0AE 1CA0C 2QF3A 2ZFQH 5FBIA 4ISHH 2NWNA 1SVPA 1SGYE 2BQ7B 1DWDH 5E2OA 4TPIZ 1EAXA 2A4GA 1DVAH 5DP8A 2BY7X 2FTMA 1V6DA 3U1IB 1OP2A 2PWXA 3ZZ9A 2ULLA 3I29A 4B2CA 1O5DH 2FOAA 2Y81A 4WJG2 4DVAU 1L4ZA 2STBE 4FUCA 5K0HA 2FI3E 4NZLA 3MH5A 3TU7H 4SGAE 4AYVB 3P17H 4HTCH 2FP7B 1W0YH 5GPIB 4YESB 1JWTA 3P8OA 1OSSA 2CN0H 1GHYH 4PROA 1SFQB 2HVXA 2P16A 1OWJA 1C5PA 1C9TA 3PMJA 3R3GB 5CE1A 4YT6H 4I8JA 4E06H 1JMOH 1KTTB 1NRSH 4BTTB 1J9CH 3A7YA 4B75A 2HNTE 5C1UA 3NK8A 2BD5A 1Y3WA 4O03A 4U01A 3MNCA 5HXFA 1T8NA 3PMAB 1UTKA 3UOPA 2B5TB 3SJKA 4BAKB 2ZDLA 4IMQA 4FUHA 3UNSA 4E7NA 1ACBE 4FU9A 1O5AB 1JIMA 3TLOA 1ZSKA 2P3FH 1E35B 3C1KA 1TLDA 4OS7A 4YO9A 4DCDA 1NM6A 2ZPRA 1HCGA 1WSSH 1YPKH 4JK5A 1BHXB 1FXYA 3K6ZA 1AHTH 5C5OA 3HKJB 1JBUH 3K9XB 3ENSB 1C1NA 2P93A 3B8JA 5CMXH 1YC0A 4JCNA 3QZRA 3CS0A 1EOJA 5GJ4B 3W95A 2BQWB 1QCPA 4I8GA 2ZFPH 2ANMH 4Y7BA 3TJVA 3RC4A 1NC6A 1BTWA 1HAIH 1OOKB 1VITH 4KTSA 4WWYA 3PYHA 2XTTB 1MQ5A 3SQEE 2ASUB 3V12A 1BUIA 4GLYA 2WYGA 1O2LA 1WTGH 1EP6A 3LPRA 2BD9A 4DGJA 1FONA 4WVPE 2ZU5A 2XNIA 2Z3CA 3SGQE 3UUZA 1W10U 3RXUA 2G00A 2Y6TA 1SGRE 3GY6A 1GMHF 5I25A 1CO7E 5E8EH 5ETXA 1XXDA 1CA0B 1PPEE 3TH3H 1SGNE 4IS5A 4KTUA 4OS5A 4R0IA 1BRCE 4AN7A 1SQTA 3PTBA 5EQRA 4CRCA 3GDVA 2M5TA 1KLIH 2WINI 3A87A 2PTCE 2BVSH 2VVVA 1GJCB 1T4UH 1W2KH 2W3KA 4GUXA 1LKAA 4ABHA 1MH0A 1D6RA 4I7YH 1SBWA 1IOEA 1O2ZA 2C4FH 1TX8A 4AFUA 1P06A 5AF9H 4FUDA 2FX6A 2HPPH 2A7JA 2BD7A 4X2WA 1A3EH 1ELFA 4INLA 1QB1A 1PFXC 2K1QA 1YCPM 1OS8A 8LPRA 1G37A 2W7UA 3RDZA 1FV9A 2UUYA 1SLVB 7GCHG 5FBEA 1DOJA 2AGEX 4LXBH 3KL6A 1C1WH 2SGPE 3MNXA 1SB1H 3OSYA 2ZO3H 3TPIZ 1N1LA 1PPCE 1F2SE 3NWUA 2QGRA 2G55A 1MTNC 1AFEH 3PV4A 1FLEE 4BTIB 1W8BH 3RLYH 1AQ7A 2A4QA 3Q3KA 3ZZBA 4CREA 3A82A 2GZ9A 1QNJA 8GCHF 4ISOA 1G2MA 3F1SB 4JZFH 5F8TA 3RXVA 3BIVH 4ZHMU 1G2LA 4HI3A 4LOYH 2V35A 4FUGA 4NWKA 1DFPA 1DLKB 2Y7XA 1G3BA 1ELGA 1ANDA 3D49H 1J16A 1EPTC 1HLTH 4A7IB 3UR6A 1YYY1 1TE0A 2KAIA 1W13U 1IQGA 1QURH 3V0XA 4JYTA 1IQNA 5E0GA 1RXPA 3MU0A 4YZUA 2JH6D 2XCFA 2ILNA 2QA9E 2FLRH 1MKXK 3S69A 3ATIA 1C5TA 4OGYA 1QRWA 2HALA 1LVYA 1HGTH 1DSTA 3JZ2B 2R0LA 3KCGH 3LONA 2XBXA 4ISIH 1GI7B 3N7OA 3QWCH 1YBWA 2ZFFH 3UIRA 2F91A 1S6FA 2PKSC 3BF6H 1O3OA 3AVZA 1BZXE 2FYRA 1XUIA 5A0CA 6GCHF 2ZA5A 1O3AA 3D65E 1SGFG 2FS8A 2PFEA 4X1PU 1TIOA 5JPMH 5JDUB 4E05H 2V6NA 1MZDA 2A2QH 3A8CA 2ANWA 3ZVFA 1MKWK 1ZTKA 3MFJA 4IMZA 5JBCS 1AMHA 2O8WA 4ABIA 4O3UA 1ABIH 5DJ7A 4X0WU 1C2MA 1LO6A 1Y5BT 2ZCKP 1KTSB 1CGHA 1O3EA 4YOGA 5L2YH 1C5RA 1C5YB 3KF2A 3OYPA 1T8MA 1D6WA 1IQKA 1K1JA 1K9OE 1NFYA 4WF8A 3BTGE 3A83A 1TQ0B 1EPTA 1C2JA 2Y5GA 5DKMA 4ASHA 1ZGIA 1T4VH 1P9UA 3ODFA 1S0RA 3QDZB 3RXJA 1O36A 4RSPA 3I77A 4I8KA 1C1OA 2FOFA 2HLCA 2NU4E 5EPYA 4AGJA 1UMAH 1TABE 3Q76A 1IHSH 1VJAU 2J94A 1GJDB 3ZVCA 5FPTA 4FU7A 1DXWA 1HAVA 4YT7H 1QA0A 1QRZA 3A85A 4TY6A 1E36B 1TBQH 2GMTB 1D3PB 3SI3H 1AIXH 2OBOA 3LJJA 2Q6GA 2A7HA 3VGCC 2GD4B 1MTNB 1TMBH 2F9VA 3TJNA 1GDQA 3RXDA 1G30B 1SGPE 1OX1A 4CRDA 1CA8B 4ISLA 1EJAA 5GCHG 1IHTH 1XVMA 1C1PA 3F9HA 4Y8ZA 2AH4X 2BD4A 3BTHE 5LPEA 1GL1A 1TWXB 3SV9A 2QYIA 1ZGVA 1UCYE 3CENA 2BXTH 1XKAC 4ABGA 4ABBA 2BQ6B 4NIVA 1AZ8A 1NPMA 3PLPA 1SC8U 2CXVA 1AN1E 1EPTB 1DUAA 1KXEA 2G4TA 1C5OH 1O3FA 1QQUA 1ZR0A 2JH0D 2PGQB 1F5RA 1TPSA 1NU9A 1GI1A 2VIWA 3E0NB 2ZEBA 3GDSA 5TJXA 2OP9A 3LT3A 3T27A 3RXRA 1YPGH 1THPB 2F9NA 2PV9B 3LGUA 1HAVB 3SHCH 3S9BA 4O3TA 4CH8B 1BBRE 1K1MA 1OP0A 2PKSB 3QX5H 1FN8A 1A0HB 3M5NA 4NCYA 1TB6H 3U69H 2ZQ2A 1L4DA 1HPGA 4XFQA 1SR5C 2FI4E 3VPKA 1LQDB 1CT4E 4IW4E 2ZPSA 3A8DA 4U2WA 1D4PB 2OC0A 4U30A 2ZU2A 2H9EH 2BVRH 1THRH 1GBFA 1TPAE 2Z7FE 2D2DA 3M35A 1C1MA 2GT8A 1NN6A
chains in the Genus database with same CATH superfamily
1ANEA 4LZ4B 1F5KU 1QIXB 2BXUH 2G4UA 1NBME 1QRXA 2A5KA 2V3MA 3S7HB 2J38A 1YP9A 3A86A 3A8BA 4BTUB 5DP5A 1TBRH 2VIPA 1BMFD 2P94A 5A8YA 3TH2H 3SV6A 4K1TA 2H2ZA 3LGTA 3NCLA 1HNEE 1VCWA 1LVOA 2G5NA 3E8LA 1C1SA 1O38A 1TRMA 1TRNA 2VVCA 1OWKA 4B76A 1MBMA 2VWOA 2P3TB 3A89A 3FP8E 5F8ZA 1AVXA 1ZLRA 2HRVA 2I6QA 3ZZCA 3MO9A 3ZZ6A 2P3UB 3P6ZB 1GHBG 1KDQA 3TNTA 4BAHB 4THNH 2ZHEH 1ANCA 1V2KT 4QT8C 1GG6C 4BAOB 1SGTA 3VGCB 4FOUC 4B2BA 1C4Y2 1X7AC 2C90B 1LPZB 3GCTG 1P2OA 1RTLA 3RXLA 1O3NA 2Z6BD 1GPZA 1TFXA 4H6SB 1UJ1A 3TVJB 4AYYB 2V0BA 4X2VA 4X2XA 4AX9H 1N8OC 3E16B 1K28D 1HAYB 2EI6A 5CHAC 2J34A 4UDWH 1TBZH 1DE7H 3PTNA 4Y79A 4OGXA 1P04A 1CE5A 3A81A 2SGEE 4E7RG 1XX9A 2WPMS 2ZIQH 2C3SA 1EUFA 2UUFB 3GCOA 1SLWB 2HNTF 1YPMH 5EXLA 3SQHE 3BG4B 5DO4H 4A1VA 3H09A 1Z8IB 3ITIA 1SKYE 2AYWA 2CV3A 4X8VH 3T5FH 4NSVA 1A4WH 1UK3A 8KME2 4X1QU 1BRUP 1KXFA 2WV5A 4DIIH 1S83A 4IN2A 3TIUA 1EKBB 1VJ9U 2GDDA 1NZQH 5IDKA 2LPRA 2C93B 1KDQB 3W1EA 2BX3A 4ZCNA 1GBIA 3E6PH 4IBLH 2Z9JA 1TNGA 2OBQA 1E37B 1SGCA 1BTPA 2D1JA 3VEQB 2F9PA 3NXPA 3RXEA 1FY1A 4TWYA 1ZTLA 1DITH 1CQQA 3DUXH 4I31A 4ZKNU 1V2ST 1C5NH 2Y80A 4Q7YA 1IQHA 3QLPH 1TRYA 2R9PA 3FANA 1S82A 3NKKA 5DK1A 2ZDVH 5EODA 1ZHMA 4ABFA 3TK6A 4Y76A 1WAYB 3QTOH 5C67A 4GCHG 1MCVA 2WV9A 3SU2A 5I46H 4LZ1H 3U8OH 2O8MA 4I32A 1O0DH 1AVWA 2FO9A 4XBBA 1FY4A 3D62A 2VNTA 1GHXH 4JK6A 4XRNA 2VIOA 3F2GA 2SNVA 2Y5HA 2KX4A 1EATA 1AD8H 1H8DH 3SJ8A 3TITA 3ZVDA 1O2VA 1C2FA 1UTNA 5T6GA 4Y0YE 2WYJA 3VXEH 4ZKOU 1EP5A 5EXNA 2ZDAH 2PLXA 5FAHA 2ZTXA 2WPHS 3F68H 3QUMP 4ZH8A 2AERH 2Y82A 4ABEA 1S0QA 1BB0B 1ZMNA 1NFWA 3MU5A 2QXHA 1YCPH 3MU1A 2HPQH 1S6LA 3OX7U 4FUIA 1O2MA 1C9PA 1BMAA 2XW9A 3F2HA 5KECA 1GG6B 3SOSA 1NROH 3R0FA 1BJVA 4XBDA 3KYGA 2H9TH 1GBLA 1O39A 1KXAA 1K1LA 3UQVA 2ESTE 4F4OC 1RD3B 5HM2A 4K8YA 2H5CA 1RIWC 1QZ8A 1YPLH 4WMFA 4NA8A 2AS9A 3A84A 1OXGA 5F6MA 2J97A 1EZXC 5DPAA 3TK5A 3SNBA 2AMPA 1GJBB 1Y5AT 1HAPH 2ZECA 1TGCA 5CHAB 1GI2A 3RMOH 1G9IE 1P3EA 3PLKA 2B0FA 2PTNA 4XSKU 2RA0A 2ZFTA 2VVUA 1MUEB 2ZU1A 1RGQA 2QXJA 3T62A 1ZSLA 5HKKD 3BEIB 1P03A 3F9EA 1J15A 1EXFA 3KGPA 3QK1A 1NESE 1O2QA 1C5LH 3VFEA 1ELTA 5FX6A 1SL3A 2VBCA 3EE0B 1ABJH 1WQSA 5TCAA 1AVGH 4Y11E 3IITA 5SGAE 1UVPA 4RKOB 1AUTC 3RMLH 1QL7A 1HFDA 1GHVH 2ZNKH 3F3BA 1SI5H 4Y8XA 2ODQA 1HXFH 1HB0B 2OC7A 5B6LA 4H4FA 2J4IA 4HFPB 2TGPZ 4DT4A 1LMWB 1S81A 3P8GA 2SNWA 3TK9A 2Y7ZA 2VIQA 4K60A 1GBHA 5C0UA 3KN2A 2SGDE 1Z1IA 4O9VA 5DP7A 5IYTA 1ESBA 1CSOE 2F9BH 1HV7A 3ZVBA 2TPIZ 3SU4A 4H6TA 1KYNA 2JH5D 1O3BA 4I8LA 3AW0A 2OINA 3LGWA 2JDID 1G3DA 2ZDMA 3M5MA 4IN1A 1CGJE 1QFKH 2P8OC 2ZTZA 2Y5FA 5GWZA 1P2MA 1EZQA 1TOMH 1ZMLA 1O5FH 5A0BA 1HJAC 1A0JA 2B7DH 4NA7A 5GCHF 2Q1JA 1H8HD 1EJMA 1C5XB 2EI8A 1W11U 4AOQA 4M9FA 1FUJA 1GJ9B 5JBBS 4K69A 1C2EA 2FX4A 1AGJA 1O2SA 4AFZA 1MABB 4GPGA 3RLWH 3RUOA 4Y71A 3ELAH 1P3CA 4CR9A 3TNSA 1AWHB 1C1TA 3URCA 5PTPA 1UTOA 3V3MA 3OY5U 4WH8A 1B0EA 4NZQA 3SUEA 1YY3A 4WY3A 1E38B 1JRTA 2ZFRH 2JETC 3E90B 3QZQA 1C2KA 5H4IB 1O34A 3SNAA 4A92A 4K5ZA 4ZKSU 2QV1A 3QO6A 2OK5A 2QCYA 1RIWB 1O3LA 2EA3A 4ZAEA 3PWCA 2AEIH 1HDTH 2W3IA 5T6DA 3EA9A 1N6YA 1YM0A 1ZOMA 2OQ5A 1O3PB 1L1JA 5IK2D 1ZRBA 3UAIC 1J8AA 4FUJA 3KQ5A 5HYOA 1EB2A 1AWFH 4X6OA 3KQBA 1BITA 4FU8A 1C2HA 5JB9S 3AASA 1AY6H 2VH6A 4JMYA 2HNTC 4A1TA 2ANYA 2RDEA 1TYNA 4NGAH 1C2GA 1NTPA 4B74A 3IG6B 1RS0A 1EX3A 2ZGCA 1GBDA 2A5IA 3EGKH 1SG8B 2G8TA 2STAE 1QJ1B 4MNVA 3EYDA 1Y3XA 1BMLA 2V7QD 2H5DA 1ZJDA 3A80A 4KELA 3RXAA 4Q2KA 1ELVA 3M5LA 3MO3A 1Z6JH 2KZ4A 2FTLE 4MPXA 1GL0E 4UFDH 2AFQB 2YNBA 1G36A 1E0FD 1ESTA 4ISNA 3ZZ4A 1VGCC 3ODDA 1XXFA 1GBCA 2FESH 3OU0A 4FVBA 1GHBF 2AIPA 2AMDA 3LU9B 3EA8A 3M7QA 1LVBA 1GJAB 1WXRA 1NRPH 4OS2A 1GHWH 3SUGA 1UCYK 1JIRA 5TCCA 3GCTF 5AVDA 1GBBA 2GV7A 7KMEH 1WQVH 1AFQC 1QR3E 2A4OA 3ESTA 5DP4A 3QGNB 2ALVA 1P01A 2XBVA 2NU0E 1W12U 3PMHB 2FOEA 3GISB 5FCKA 1GBTA 3V13A 1BJUA 1IQFA 2TIOA 3O8RA 4I8HA 2J2UA 1A2CH 1GCDA 1L1NA 1GGDC 1SHYA 1C5UA 4Y7AA 3E0PB 3FZDA 1BTZA 1IAUA 3U28C 2BDGA 1BBRK 7ESTE 1K2I1 1VITG 1P2IA 1A0LA 1GHAG 2ZP0H 1BTXA 1ETSH 2JETB 2PKAA 2XXLA 4CRFA 3O8DA 3E1XB 1NY22 2EQNA 6LPRA 4ZHAA 1O2XA 1W14U 2SGFE 4CHAC 1KIGH 2Z9GA 4B6EA 1Y8TA 3GYLB 2Z3EA 3MWIU 5FPSA 5CHBA 1L2EA 3KQDA 1V2MT 1VR1H 1ZRKA 1HJ9A 1AE5A 1GVKB 4K8BA 4D9RA 3AW1A 1OKXA 2AIQA 1H9IE 4TY7A 2FWWA 2XC0A 3TJOA 3MTYA 3P70B 1GJ8B 3FVFB 2J5UA 4XBCA 3SU6A 1O30A 1TGNA 2DE8A 4K2YA 2UWLA 1QB9A 2KAIB 4HG6A 4CH2B 5EPNA 2A0QB 3UTUH 3OE7D 1SFIA 4Z6AH 3EQ0H 3MMGA 3S9AA 1BTYA 4GCHF 5F8XA 4ABDA 4WMDA 4MPUA 2LNCA 2QC2A 3OY6U 4DT7B 3FOAA 1F0UA 1UVSH 1YPHE 1QTFA 1XUFA 3RXHA 2BY6X 3PO1C 4JZ1A 5EJLA 1CHOG 1KXBA 2CF9H 3EAJA 1GVZA 4K1SA 1QBOA 1FY8E 3RXTA 4WXIA 1TAWA 4MPWA 4D7FA 2PKAB 3T25A 1BTUA 3STJA 2RA3A 2PSYA 3NUMA 3SJIA 1P0SH 2IN2A 4CBNA 1O37A 4WH6A 1H4WA 1KXCA 1BTHH 1OPHB 2A5AA 1MZAA 2UWPA 5EJZA 3BV9B 4F55A 3UREA 3F0PA 1DWCH 2WPLS 3SU5A 1A7SA 1Z7KA 1O2TA 1TONA 2R2WU 4JZDH 2JKHA 2O8LA 1FN6A 5EGMA 1MKXH 1SGFA 3U9AH 5DP9A 3GOVB 2R2MB 3DSPA 3OAAD 2RDLA 3A88A 1C2LA 1HAZB 4CRAA 1XMNB 1HIAA 1GVLA 1V2PT 2FOCA 2Z94A 3BTDE 3L3TA 1LKBA 4JYUH 4CR5A 1ELBA 1LHEH 3RC6A 1A5HA 4CRBA 3U98H 4X8UH 1WCZA 1AO5A 1H1BA 3JZ1B 1T32A 1AI8H 3KHVA 5ESTE 2R0KA 4X8TH 1GHZA 3SV7A 2LELA 2IPHA 4NIWA 2ZF0H 4XDEA 1TMUH 3RM2H 3RMMH 1F92A 1V2RT 1PPFE 1O3HA 2XBYA 3GYMA 1MKWH 4AGKA 1OWDA 1NRNH 1QY6A 1U6QA 3SNDA 1RTKA 3KQCA 2B9LA 2PSXA 4X6MA 4B71A 2OD3B 1KXDA 4VGCC 3RXGA 2THFB 1SGDE 1DY8A 2OC1A 4D8NA 1LDTT 3ZZ8A 3M7UA 3FZZA 5B6OA 3WY8A 1V2QT 1UTMA 2VWNA 3OEED 4B6FA 4ZXYH 2PGBB 2QY0B 1CGIE 4JZEH 1YGCH 2XCNA 5AHGH 4UFGH 4DOQA 1GI0A 1B7XB 2CMYA 1H8ED 1OP8A 1P2KA 3LGIA 4AFQA 1O3GA 1DDJA 1O2KA 2ZDKA 1C5VA 1PYTD 5DG6A 1BRAA 1V2TT 1HIAB 2R3YA 3LIWA 2IJD1 1ZHPA 1DY9A 1YPHC 4F49A 5A09A 3BTTE 1GDNA 1ARBA 1O5BB 1CT2E 2WPIS 1P11E 3URDA 1GDUA 3BTME 3HK3B 2TBSA 1SOTA 1TNIA 4DG4A 1XVOA 2C8ZB 3UR9A 3M61U 1GBEA 2A7CA 2ZFSA 3FN8A 1W0KD 2FPZA 3PO1B 3M3SA 2O8TA 1BQYA 2ODPA 2WV4A 3PROA 1MTSA 1UTPA 3GY5A 3ZZ7A 3E3TA 1NO9H 3Q3YA 4MLFB 5FX5A 4DW2U 4ABJA 4K1EA 1PYTC 1Y3YA 3BTFE 4KGAA 3U8TH 2F9UA 4NFFA 1KMHB 1YLDA 2PR3A 4AORA 2W7SA 5JBTA 2ZCHP 3FP6E 3A7TA 3LJOA 1IQIA 1TX7A 2GX4A 1TX6A 1UW7A 2GT7A 5ABWA 3ZYEA 3ATMA 1O2YA 2VGCC 2FM2A 2VH0A 1CT0E 1Y5UT 1QBNA 4AB9A 4YLQH 1UK2A 4GAWA 4BOHA 2BOHB 1VCPA 3GY7A 1F5LA 5EXMA 1QQ4A 4JYVH 4DY7B 5GXPA 3HGNA 3MYWA 3ZZDA 5L6NH 3A7ZA 5E0HA 1YCPK 2XRCA 4SGBE 4NA9H 2VWMA 1INCA 1GI5A 5HMAA 7LPRA 2VB0A 1NBMD 2BD3A 1O5EH 1D9IA 3GCHC 5A8XA 2CGAA 3PV5A 1P02A 2GP9B 1YF4A 1DICA 5C17A 3ATLA 3ZZ5A 1OWHA 3VB3A 3QGJA 1O3IA 2K8IA 1M9UA 2FS9A 2A2XH 4B2AA 1IQEA 1MTVA 1ZSJA 2BYAX 3TH4H 5KEDA 2YNAA 1ORFA 1WV7H 1O2OA 1G3EA 1HAHH 3ZVGA 2J98A 4D9QA 2FOGA 3GY8A 3MH4A 3S7KB 2P95A 2W26A 7GCHF 1TMTH 1BMMH 3ZYDA 1MMJN 1O35A 2HOBA 1FJSA 4U32A 3M3TA 1AZZA 1C4U2 2BDYA 1E34B 1H9LB 5L2ZH 4IC5A 2AMQA 1WYKA 5GIBA 1UK4A 2ZGXH 1S85A 1EZSC 2FYQA 2ZU4A 3VXFH 2O8UA 2VIVA 4ZROA 5DGJA 1Q2WA 1IQMA 3IWMA 2RFKC 1WUNH 4Q4LA 2BHGA 2WHXA 4BANB 5LPFA 3CS7A 3M7TA 1C2DA 2VIDA 2G52A 1SGQE 1DSUA 3G01A 3UOUA 1PPHE 2ZQ1A 1THSH 2HVYB 3FP7E 1AB9C 2LP6A 4Y0ZE 3UB0A 2JIZD 3RU4T 2TGTA 3M36A 1TNJA 1B5GH 2VU8E 3ZZ3A 2WZQA 1LHGH 5DSFA 2OC8A 2J98B 3A7WA 1OYQA 1DWEH 4FUEA 1C1UH 1TNHA 3RM0H 1JOUB 5A8ZA 5JB8S 2TGAA 2Z9KA 2NU3E 3MH6A 2TGDA 1BRBE 2AGIX 1TALA 1VITF 1W7GH 1Z8JB 3L6PA 3DA9B 1FQ3A 1GHAF 1WBGB 1AE8H 3U8RH 4MG3A 1K1PA 1RFNA 1N8OB 2VGCB 4AB8A 1LPKB 3P95A 1ZYOA 5J4SA 2A4RA 1D3DB 1SLXB 1V2OT 2V3HH 5JYIA 1TPPA 1F0TA 5AFYH 3K2UA 3LH1A 3TGJE 4ACAA 2D8WA 2ZI2H 1HUTH 1GBJA 4BXSA 2FOHA 1DPOA 1DLEA 5FHTA 1DWBH 1KY9A 1MU8B 3GCNA 3N7DA 3OTJE 4HGCA 1FY3A 1FAXA 3V7TA 3LGVA 3SU3A 3SNCA 4Y10E 3GCHB 4J1YA 3SGAE 2BZAA 5ESBA 4MVNA 1YLCA 4UFEH 2WUBA 2XC5A 3NPSA 5EQSA 2C8XB 5C3NA 4XE4A 4MNYA 1SSXA 1ETTH 4MQAA 1P2QA 3SBKA 1MTUA 1CHOF 4INHA 1IQLA 3HGPA 3KEEA 1C5SA 5DP3A 1J14A 4X6PA 2BD8A 3U1JB 3KQEA 1F7ZA 5HIZA 2PUQH 4Y6DA 9ESTA 1FNIA 4OS4A 1H9HE 1MQ6A 3A7XA 2ZGJA 1KLTA 1NFUA 3T28A 2KFWA 4ZHLU 1O2PA 2G5VA 1YKTA 2GVFA 3T2NA 2G81E 6ESTA 2JJ1D 3RC5A 1C2IA 1GMCG 1FI8A 4GSOA 1D3QB 2BOKA 3RXIA 4JZIA 4DIHH 1FZZA 5G4BA 1TNKA 1C5WB 2ZWLH 1ESAA 5BPEA 3GS9A 1LCYA 2BLVA 2L74A 1MD7A 2XWBI 4B73A 3C27B 4NSYA 4D7GA 1JXPA 2ZG0H 1CVWH 1V2WT 5FL7D 4ABAA 2CHAC 3VB7A 2BMGB 1P57B 2ZGHA 1L1GA 2I6SA 2EEKA 5C1YA 3ATKA 4DURA 1DM4B 1AB9B 3SV2H 3ZZAA 1YWUA 4FVDA 3SV8A 3F9FA 3KIDU 4GHQA 2XYAA 4NFEA 1F0SA 4HZHA 4UEHH 1GCTC 4INKA 3DFJA 2GDEH 1PPGE 4ZKRU 1C1RA 3GICB 3E91A 3TGIE 1P10A 2A1DB 4AG2A 3RXSA 2EY4C 3BEUA 2GZ7A 1D3TB 1DUEA 1PPZA 4TWWA 1GJ5H 1Z71A 1KSNA 3H5CB 2BDHA 2BB4A 1GI3A 1ELCA 1GMDG 1O3JA 3RXKA 1HXEH 2SFAA 1EQ9A 2GCTC 3ZV9A 1BIOA 1JRSA 4Q7ZA 5E2PA 5GDSH 3OFND 2C8WB 1HAGE 2FMJA 1FMGA 4UONA 2PUXB 4R8TB 1O2GH 1ELAA 3LH3A 5EIYA 1C4V2 4M7GA 4Q80A 1MBQA 1ZMJA 1OWIA 4NG9H 4X8SH 2FXRA 3I78A 5A2MH 2BDAA 1EOLA 4FXGH 4X1RU 3FAOA 1V3XA 1L0ZA 2H9HA 1T8OA 1RTFB 1CHGA 5E0JA 3CNRA 4Z0KA 1YPEH 4LK4A 3M5OA 1LHDH 3HKIB 1SGIB 3STIA 2QE7D 3BSQA 1O2WA 3GDUA 1BMNH 4UE7H 2AHME 1O32A 4RT1A 4P02A 6CHAC 2QXIA 4AG1A 3PWBA 2GCHG 2PP6A 3PRDA 1AUJA 2A32A 2D26C 2ANKH 1PPBH 1P9SA 4IC6A 1OHHD 2P8OB 3VB5A 1QGFA 1V2LT 4FETA 4ZMAH 1CBWC 1YPJH 2GMTC 1HJAB 4UD9H 1MAXA 1ELDE 1GJ7B 5DP6A 1S6HA 1EZUC 1V2VT 1O3DA 1P8VC 3O8CA 1HAXB 3N99A 1W7XH 3WWBA 4MPVA 4NIYA 1QL8A 4A5TS 2QN5T 2RCEA 2OTVA 5EW2H 1PQ5A 3UWIA 2CHAB 4OS1A 5FXLA 2FI5E 2IPQX 3PMBB 5BRRE 3LKWA 4ASUD 3ZVAA 3AAUA 2HWLB 1HJ8A 4A6LA 2ZGBH 1TGSZ 8ESTE 5C0TA 2ZZUH 3HATH 3UY9A 4P00A 1GCTB 5FPYA 1P05A 3T26A 1XUHA 5C1XA 2GV6A 3WW7A 2Z3DA 1SMFE 3UFAA 4BAQB 5AFZH 2UUJB 3DD2H 3S9CA 1Z8RA 2B8OH 1K1OA 4MDSA 4CBOA 1C5QA 2BDIA 3RXOA 3SZEA 3HK6B 3QN7A 2BY5X 2QAAA 2KCYA 2OLGA 1UO6A 2F83A 1ZJKA 1HBTH 3DT0H 2ALPA 2J92A 1RRKA 2GCTB 4O97A 3SHAH 1WU1A 2BLOA 1OWEA 2FEQH 1A46H 1TA2A 1O2NA 4FUBA 2V3OH 4WMEA 3KNXA 1LHCH 2IOTA 5EQQA 2YOLA 1LQEA 3LC3A 1FIZA 5EG4A 5EOKA 2OXSA 3EDXB 1AKSA 1BHXF 1TOCB 4Q7XA 1GBAA 3BTQE 4BXWA 4KTCA 3VB6A 1TA6A 4Y8YA 3RXMA 1NRQH 3BIUH 1NS3A 3RXFA 1SOZA 1TPOA 2VJ1A 2GTBA 2ZKSA 2RG3A 2FOMB 2FODA 2CJIA 3O8BA 2BD2A 1KLJH 1K1NA 1UCYH 2W5EA 1FPCH 1P2NA 2NU1E 3MHWU 1K21H 4I33A 4YOJA 1ZZZA 5EU8A 1O3CA 1K1IA 6CHAB 1C5ZB 2WPKS 1VGCB 3NRLA 3A7VA 4A1XA 2W6JD 1O2RA 1FPHH 2PHBA 1A61H 4ZXXH 2R3UA 1DS2E 1Q31A 3UQOA 3PRBA 4K3JA 1TGBA 1N6XA 1O31A 2H1UA 2ZCLP 4YM9A 1E79D 1OYTH 1Z6EA 1CBWB 2ZPQA 3LOXA 3SORA 3GY4A 2VWLA 1W0JD 2H6MA 1E1RD 3LC5A 1LHFH 1AFQB 1VZQH 3RMNH 1BBRH 4OS6A 1F0RA 1GJ6A 3BTWE 1GI9B 1P2JA 2BX4A 1MU6B 3SUDA 1AKSB 4TYDA 3SYJA 4CRGA 1RJXB 1NRRH 1EB1H 1G32B 3P8FA 1O33A 3CP7A 2ZTYA 3WWFA 4BNRA 1PJPA 1TNLA 1QHRB 3VB4A 1GGDB 1P09A 1SLUB 1PQ7A 1BDAA 2ZHDA 2Z9IA 1ZHRA 1DX5M 3B9FH 1H8IH 3UPEA 1EAIA 4KKDA 4TT3D 1E1QD 1EFRD 3BG4C 1QL9A 1UVOA 3MOCA 2NU2E 3H7OA 1SGEE 4MNWA 1GMHG 4CHAB 2EC9H 1XM1A 1LVMA 3TJUA 3S0NA 2WUCA 2EI7A 3BTKE 1PQ8A 2ZHFH 4X2YA 2UUKB 3T29A 3UNQA 1C5MD 3ZV8A 1GI6A 1TGTA 3SI4H 1Z1JA 4X1NU 4XOJA 2J9NA 2HGTH 3P92A 2GZ8A 2BLQA 4YOIA 2BDBA 4DJZB 3SN8A 5LH8A 2Q6FA 1MCTA 3SJOA 1O2HA 3QTVH 2AGGX 3M3VA 2ODYB 4ESTE 3DFLA 1EAUA 1S5SA 2FZZA 1A1RA 1BT7A 1BOQA 4RN6A 3M37A 1LTOA 2FLBH 1A5GH 4TPYA 1GBMA 1QJ6B 2F9OA 5C2ZA 2DUCA 1A5IA 2L6OA 1GI8B 4ACBA 1Y3UA 2ZU3A 1O3MA 1SPJA 5FCRA 1GMCF 1UTQA 4J2YB 2OQUA 4AZ2B 1AU8A 5C20A 5HGGA 2BTCE 4FUFA 3SW2B 5HM9A 1K0HA 1GWAA 2BZ6H 3L33A 5EJ1A 2BVXH 1CU1A 3SU0A 4AFSA 2OCVB 4RT0A 3K65B 3NZIA 1T31A 1FIWA 3RXPA 3SJ9A 1UTJA 3TGKE 1MAYA 3SGBE 3SO3A 3F2FA 3Q00A 1ZPZA 1C1VH 1DXPA 3RXQA 1XUGA 1QJ7B 2FDAA 4RKJB 1VCQA 2JJ2D 4ZUHA 2FIRH 3BN9A 3UWJH 2PW8H 3LGYA 4GVUA 1T7CA 5HIYA 4I86A 2BDCA 2ZC9H 5T3HA 2C8YB 1VKYA 3N7EA 3MH7A 3MNSA 5LPRA 1EASA 2SGAA 3DSGA 4UFFH 3DHKH 2KCPA 2CF8H 5J4QA 4NWLA 2FOBA 2J95A 1DT2A 8GCHG 3LDXH 1PQAA 4MTBA 2A45B 3BG8A 1IQJA 4IGDA 3ZVEA 1O5GH 1SQAA 1DANH 3MNBA 1GMDF 1UTLM 3RU4E 1HRTH 2ZHWH 1QB6A 5T1VA 1FAKH 3PB1E 3B23B 2BY9X 3PLBA 3GY2A 3HPTB 4MNXA 1ELEE 1O2IA 1V2UT 2IJOB 4RI0A 2CK3D 1Z8GA 2UWOA 2QF0A 4TSFD 1UHBA 1W3CA 1ANBA 1Y59T 9LPRA 4XD7D 4YTAA 2SGQE 2DE9A 2O9QA 3BEFB 3MU8A 4H42U 3AAVA 4VGCB 1W0ZU 2F3CE 4B1TA 1UVTH 1LPGB 3A8AA 3PM3A 1TQ7B 2QIQA 2XBWA 1ARCA 3W94A 1MD8A 2F4LA 1NU7B 1Y3VA 1XUKA 1FDPA 1EAWA 3SZNA 1O3KA 5F03A 1NFXA 1GJ4H 6GCHG 1G3CA 1BA8B 1ZPBA 2WPJS 3K6YA 2BLWA 1Q3XA 2GGVB 1C1QA 2BM2A 3SUFA 1NT1A 3ATWA 5JBAS 4AC9A 5T6FA 3RXBA 2G51A 2GCHF 3RP2A 1K22H 3P8NA 2BY8X 1YLNA 1HAOH 1HYLA 1ZPCA 2ZHQH 1GI4A 1B0FA 1SQOA 1BCUH 4D76A 2KM0A 1P12E 2TRMA 3D23A 5C5NA 2P59A 5CDFE 3FFGA 3F9GA 1J17T 2A31A 3SU1A 3H7TA 4GHTA 1WOFA 3RU4D 2OUAA 2Z9LA 3Q77A 1WTHD 1UHBB 1QA7A 2XNDD 2Q6DA 4X1SU 1XKBC 3BTEE 3EE7A 3MI4A 1O2UA 3GY3A 4X6NA 1SHHB 2XWAA 1FY5A 1T8LA 5EW1H 5L30H 2ZDNA 1UVUH 1XUJA 1V2JT 1QBVH 3MU4A 4NIXA 3UNRA 3MO6A 4BAMB 1S84A 2VINA 4KP0A 1MTWA 4WXVA 1EJNA 1O2JA 1GBKA 3Q3XA 3EA7A 1O5CB 1V2NT 3F6UH 2GKVE 1ID5H 4YLUA 1A3BH 5K7RA 3RXCA 2XC4A 1ZTJA 5LGOA 3SNEA 1ETRH 2QXGA 5A0AE 1CA0C 2QF3A 2ZFQH 5FBIA 4ISHH 2NWNA 1SVPA 1SGYE 2BQ7B 1DWDH 5E2OA 4TPIZ 1EAXA 4OM9A 2A4GA 1DVAH 5DP8A 1FX0B 3F0OA 2BY7X 2FTMA 1V6DA 3U1IB 1OP2A 2PWXA 3ZZ9A 2ULLA 3I29A 4B2CA 1O5DH 2FOAA 2Y81A 4WJG2 4DVAU 1L4ZA 2STBE 4FUCA 5K0HA 2FI3E 4NZLA 3MH5A 3TU7H 4SGAE 4AYVB 3P17H 4HTCH 2FP7B 1W0YH 5GPIB 4YESB 1JWTA 3P8OA 1OSSA 2CN0H 1GHYH 4PROA 1SFQB 2HVXA 2P16A 1OWJA 1C5PA 1C9TA 3PMJA 3R3GB 5CE1A 4YT6H 4I8JA 4E06H 2QF4A 1JMOH 1KTTB 1NRSH 3OEHD 4YXWD 4BTTB 1J9CH 3A7YA 4B75A 2HNTE 5C1UA 3NK8A 2BD5A 1Y3WA 4O03A 4U01A 3MNCA 5HXFA 1T8NA 3PMAB 1UTKA 3UOPA 2B5TB 3SJKA 1COWD 4BAKB 2ZDLA 4IMQA 2QF5A 4FUHA 3UNSA 2YMSD 4E7NA 1ACBE 4FU9A 1O5AB 1JIMA 3TLOA 1ZSKA 2P3FH 1E35B 3C1KA 1TLDA 4OS7A 4YO9A 4DCDA 1NM6A 2ZPRA 1HCGA 1WSSH 1YPKH 4JK5A 1BHXB 1FXYA 3K6ZA 1AHTH 5C5OA 3HKJB 1JBUH 5KGOA 3K9XB 3ENSB 1C1NA 2P93A 3B8JA 5CMXH 1YC0A 4JCNA 3QZRA 3CS0A 1EOJA 5GJ4B 3W95A 2BQWB 1QCPA 2YMSC 2ZFPH 2ANMH 3FO8D 4I8GA 4Y7BA 3TJVA 3RC4A 3DCLA 1NC6A 2GJGA 1BTWA 1HAIH 1OOKB 1VITH 4KTSA 4WWYA 3PYHA 2XTTB 1MQ5A 3SQEE 2ASUB 3V12A 1BUIA 1WDIA 4GLYA 2WYGA 1O2LA 1WTGH 1EP6A 3LPRA 2BD9A 4DGJA 1FONA 4WVPE 2ZU5A 2XNIA 2Z3CA 3SGQE 3UUZA 1W10U 3RXUA 2G00A 2Y6TA 1SGRE 3GY6A 1GMHF 4Z1MD 5I25A 1CO7E 5E8EH 5ETXA 3FKSD 1XXDA 1CA0B 1PPEE 3TH3H 1SGNE 4IS5A 4KTUA 4OS5A 4R0IA 1BRCE 4AN7A 3ZIAD 1SQTA 3PTBA 5EQRA 4CRCA 3GDVA 2M5TA 1KLIH 2WINI 3A87A 2PTCE 2BVSH 2VVVA 1GJCB 1T4UH 1W2KH 2W3KA 4GUXA 1LKAA 4ABHA 1MH0A 1D6RA 4I7YH 1SBWA 1IOEA 2M2AA 1O2ZA 3KYFA 3OTPA 3MQKC 2C4FH 1TX8A 4AFUA 1P06A 5AF9H 4FUDA 2FX6A 2HPPH 2A7JA 2BD7A 4X2WA 3VG8A 1A3EH 1ELFA 4INLA 1QB1A 1PFXC 2K1QA 1YCPM 1OS8A 8LPRA 1G37A 2W7UA 3RDZA 1FV9A 2UUYA 1SLVB 7GCHG 5FBEA 1DOJA 2AGEX 4LXBH 3KL6A 1C1WH 2SGPE 3MNXA 1SB1H 3OSYA 2ZO3H 3TPIZ 1N1LA 1PPCE 1F2SE 3NWUA 2QGRA 2G55A 1MTNC 1AFEH 3PV4A 1FLEE 4BTIB 1W8BH 3RLYH 1AQ7A 2A4QA 3Q3KA 3ZZBA 3DSOA 4CREA 3A82A 2GZ9A 1QNJA 8GCHF 4ISOA 1G2MA 3F1SB 4JZFH 5F8TA 3RXVA 3BIVH 4ZHMU 1G2LA 4HI3A 4LOYH 2V35A 4FUGA 4NWKA 1DFPA 1DLKB 2Y7XA 1G3BA 1ELGA 1ANDA 2KR7A 2YMSB 3D49H 1J16A 1EPTC 1HLTH 4A7IB 3UR6A 1YYY1 1TE0A 2KAIA 1W13U 2KCOA 1IQGA 1QURH 3V0XA 4JYTA 1IQNA 5E0GA 1RXPA 3MU0A 4YZUA 2JH6D 2XCFA 2ILNA 2QA9E 2FLRH 1MKXK 3S69A 3ATIA 1C5TA 4OGYA 1QRWA 2HALA 1LVYA 1HGTH 1DSTA 3JZ2B 2R0LA 3KCGH 3LONA 2XBXA 4ISIH 1GI7B 3N7OA 3QWCH 1YBWA 2ZFFH 3UIRA 2F91A 1S6FA 2PKSC 3BF6H 1O3OA 3AVZA 1BZXE 2FYRA 1XUIA 5A0CA 6GCHF 2ZA5A 1O3AA 3D65E 1SGFG 2FS8A 2PFEA 4X1PU 1TIOA 5JPMH 5JDUB 4E05H 2V6NA 1MZDA 2A2QH 3A8CA 2ANWA 3ZVFA 1MKWK 1ZTKA 3MFJA 4IMZA 5F53A 5JBCS 1AMHA 2O8WA 4ABIA 4O3UA 1ABIH 5DJ7A 4X0WU 1C2MA 1LO6A 1Y5BT 2ZCKP 1KTSB 1CGHA 1O3EA 4YOGA 5L2YH 1C5RA 1C5YB 3KF2A 3OYPA 1T8MA 1D6WA 1IQKA 1K1JA 1K9OE 1NFYA 4WF8A 3BTGE 3A83A 1TQ0B 1EPTA 1C2JA 2Y5GA 5DKMA 4ASHA 1ZGIA 1T4VH 1P9UA 3ODFA 1S0RA 3QDZB 3RXJA 1O36A 4RSPA 3I77A 4I8KA 1C1OA 2FOFA 2HLCA 2NU4E 5EPYA 4AGJA 1UMAH 1TABE 3Q76A 1IHSH 1VJAU 2J94A 1GJDB 3ZVCA 5FPTA 4FU7A 1DXWA 1HAVA 4YT7H 2HLDD 1QA0A 1QRZA 3A85A 4TY6A 1E36B 1TBQH 2F43B 2KCAA 2GMTB 1D3PB 3SI3H 1AIXH 2OBOA 3LJJA 2Q6GA 2A7HA 3VGCC 2GD4B 1MTNB 1TMBH 2F9VA 3TJNA 1GDQA 3RXDA 1G30B 1SGPE 1OX1A 4CRDA 1CA8B 4ISLA 1EJAA 5GCHG 1IHTH 1XVMA 3PV2A 1C1PA 3F9HA 4Y8ZA 2AH4X 2BD4A 3BTHE 5LPEA 1GL1A 1TWXB 3SV9A 2QYIA 1ZGVA 1UCYE 3CENA 2BXTH 1XKAC 4ABGA 4ABBA 2BQ6B 4NIVA 1AZ8A 3AK5A 1NPMA 3PLPA 2WPDD 1SC8U 2CXVA 1AN1E 1EPTB 1DUAA 1KXEA 2WSSD 2G4TA 2K0QA 1C5OH 1O3FA 2XOKD 1QQUA 1ZR0A 2JH0D 2PGQB 5GNDA 1F5RA 1TPSA 1NU9A 1GI1A 2VIWA 3E0NB 2ZEBA 3GDSA 5TJXA 2OP9A 3LT3A 3T27A 3RXRA 1YPGH 1THPB 2F9NA 2PV9B 3LGUA 1HAVB 3SHCH 3S9BA 4O3TA 4CH8B 1BBRE 1K1MA 5DN6D 1OP0A 2PKSB 3QX5H 1FN8A 1A0HB 3M5NA 4NCYA 1TB6H 3U69H 2ZQ2A 1L4DA 4F48B 1HPGA 4XFQA 1SR5C 2FI4E 3VPKA 1LQDB 4Q63A 1CT4E 4IW4E 2ZPSA 3A8DA 4U2WA 1D4PB 2OC0A 4U30A 2ZU2A 2H9EH 2BVRH 1THRH 1GBFA 1TPAE 2Z7FE 2D2DA 5C94A 3M35A 1C1MA 2W6ID 1SQRA 2GT8A 1NN6A
chains in the Genus database with same CATH topology
1ANEA 4LZ4B 1F5KU 1QIXB 2BXUH 2G4UA 1QRXA 2A5KA 3S7HB 2J38A 1YP9A 3A86A 3A8BA 4BTUB 5DP5A 1TBRH 2VIPA 2P94A 5A8YA 3TH2H 3SV6A 4K1TA 2H2ZA 3LGTA 3NCLA 1HNEE 1VCWA 1LVOA 2G5NA 3E8LA 1C1SA 1O38A 1TRMA 1TRNA 2VVCA 1OWKA 4B76A 1MBMA 2VWOA 2P3TB 3A89A 3FP8E 5F8ZA 1AVXA 1ZLRA 2HRVA 2I6QA 3ZZCA 3MO9A 3ZZ6A 2P3UB 3P6ZB 1GHBG 1KDQA 3TNTA 4BAHB 4THNH 2ZHEH 1ANCA 1V2KT 4QT8C 1GG6C 4BAOB 1SGTA 3VGCB 4B2BA 1C4Y2 1X7AC 2C90B 1LPZB 3GCTG 1P2OA 1RTLA 3RXLA 1O3NA 2Z6BD 1GPZA 1TFXA 4H6SB 1UJ1A 3TVJB 4AYYB 2V0BA 4X2VA 4X2XA 4AX9H 1N8OC 3E16B 1K28D 1HAYB 2EI6A 5CHAC 2J34A 4UDWH 1TBZH 1DE7H 3PTNA 4Y79A 4OGXA 1P04A 1CE5A 3A81A 2SGEE 4E7RG 1XX9A 2WPMS 2ZIQH 2C3SA 1EUFA 2UUFB 3GCOA 1SLWB 2HNTF 1YPMH 5EXLA 3SQHE 3BG4B 5DO4H 4A1VA 1Z8IB 3ITIA 2AYWA 2CV3A 4X8VH 3T5FH 4NSVA 1A4WH 1UK3A 8KME2 4X1QU 1BRUP 1KXFA 2WV5A 4DIIH 1S83A 4IN2A 3TIUA 1EKBB 1VJ9U 2GDDA 1NZQH 5IDKA 2LPRA 2C93B 1KDQB 2BX3A 1GBIA 3E6PH 4IBLH 2Z9JA 1TNGA 2OBQA 1E37B 1SGCA 1BTPA 2D1JA 3VEQB 2F9PA 3NXPA 3RXEA 1FY1A 4TWYA 1ZTLA 1DITH 1CQQA 3DUXH 4I31A 4ZKNU 1V2ST 1C5NH 2Y80A 4Q7YA 1IQHA 3QLPH 1TRYA 2R9PA 3FANA 1S82A 3NKKA 5DK1A 2ZDVH 5EODA 1ZHMA 4ABFA 3TK6A 4Y76A 1WAYB 3QTOH 5C67A 4GCHG 1MCVA 5I46H 3SU2A 4LZ1H 3U8OH 2O8MA 4I32A 1O0DH 1AVWA 2FO9A 4XBBA 1FY4A 3D62A 2VNTA 1GHXH 4JK6A 2VIOA 2SNVA 2Y5HA 3TITA 1EATA 1AD8H 1H8DH 3SJ8A 3ZVDA 1O2VA 1C2FA 1UTNA 5T6GA 4Y0YE 2WYJA 3VXEH 4ZKOU 1EP5A 5EXNA 2ZDAH 2PLXA 5FAHA 2ZTXA 2WPHS 3F68H 3QUMP 4ZH8A 2AERH 2Y82A 4ABEA 1S0QA 1BB0B 1ZMNA 1NFWA 3MU5A 2QXHA 1YCPH 3MU1A 2HPQH 3OX7U 4FUIA 1O2MA 1C9PA 1BMAA 2XW9A 1GG6B 3SOSA 1NROH 3R0FA 1BJVA 4XBDA 2H9TH 1GBLA 1O39A 1KXAA 1K1LA 3UQVA 2ESTE 4F4OC 1RD3B 5HM2A 4K8YA 2H5CA 1RIWC 1YPLH 4WMFA 4NA8A 2AS9A 3A84A 1OXGA 5F6MA 1EZXC 5DPAA 3TK5A 3SNBA 2AMPA 1GJBB 1Y5AT 1HAPH 2ZECA 1TGCA 5CHAB 1GI2A 3RMOH 1G9IE 1P3EA 3PLKA 2B0FA 2PTNA 4XSKU 2RA0A 2ZFTA 2VVUA 1MUEB 2ZU1A 1RGQA 2QXJA 3T62A 1ZSLA 3BEIB 1P03A 3F9EA 1J15A 1EXFA 3KGPA 3QK1A 1NESE 1O2QA 1C5LH 3VFEA 1ELTA 5FX6A 1SL3A 3EE0B 1ABJH 1WQSA 5TCAA 1AVGH 4Y11E 3IITA 5SGAE 1UVPA 4RKOB 1AUTC 3RMLH 1QL7A 1HFDA 1GHVH 2ZNKH 1SI5H 4Y8XA 2ODQA 1HXFH 1HB0B 2OC7A 4H4FA 2J4IA 4HFPB 2TGPZ 1LMWB 1S81A 3P8GA 2SNWA 3TK9A 2Y7ZA 2VIQA 4K60A 1GBHA 3KN2A 2SGDE 1Z1IA 4O9VA 5DP7A 5IYTA 1ESBA 1CSOE 2F9BH 1HV7A 3ZVBA 2TPIZ 3SU4A 4H6TA 1KYNA 2JH5D 1O3BA 4I8LA 3AW0A 2OINA 3LGWA 1G3DA 2ZDMA 3M5MA 4IN1A 1CGJE 1QFKH 2P8OC 2ZTZA 2Y5FA 5GWZA 1P2MA 1EZQA 1TOMH 1ZMLA 1O5FH 5A0BA 1HJAC 1A0JA 2B7DH 4NA7A 5GCHF 2Q1JA 1EJMA 1C5XB 2EI8A 1W11U 4AOQA 1FUJA 1GJ9B 5JBBS 4K69A 1C2EA 2FX4A 1AGJA 1O2SA 4AFZA 4GPGA 3RLWH 3RUOA 4Y71A 3ELAH 1P3CA 4CR9A 3TNSA 1AWHB 1C1TA 3URCA 5PTPA 1UTOA 3V3MA 3OY5U 4WH8A 1B0EA 4NZQA 3SUEA 4WY3A 1E38B 1JRTA 2ZFRH 2JETC 3E90B 3QZQA 1C2KA 5H4IB 1O34A 3SNAA 4A92A 4K5ZA 4ZKSU 2QV1A 3QO6A 2QCYA 1RIWB 1O3LA 2EA3A 4ZAEA 3PWCA 2AEIH 1HDTH 2W3IA 5T6DA 3EA9A 1N6YA 1YM0A 1ZOMA 2OQ5A 1O3PB 1L1JA 1ZRBA 1J8AA 4FUJA 5HYOA 1EB2A 1AWFH 4X6OA 3KQBA 1BITA 4FU8A 1C2HA 5JB9S 3AASA 1AY6H 2VH6A 4JMYA 2HNTC 4A1TA 2ANYA 1TYNA 4NGAH 1C2GA 1NTPA 4B74A 3IG6B 1RS0A 1EX3A 2ZGCA 1GBDA 2A5IA 3EGKH 1SG8B 2G8TA 2STAE 1QJ1B 4MNVA 3EYDA 1Y3XA 1BMLA 2H5DA 1ZJDA 3A80A 4KELA 3RXAA 4Q2KA 1ELVA 3M5LA 3MO3A 1Z6JH 2FTLE 4MPXA 1GL0E 4UFDH 2AFQB 2YNBA 1G36A 1E0FD 1ESTA 4ISNA 3ZZ4A 1VGCC 3ODDA 1XXFA 1GBCA 2FESH 3OU0A 4FVBA 1GHBF 2AIPA 2AMDA 3LU9B 3EA8A 3M7QA 1LVBA 1GJAB 1NRPH 4OS2A 1GHWH 3SUGA 1UCYK 1JIRA 5TCCA 3GCTF 5AVDA 1GBBA 2GV7A 7KMEH 1WQVH 1AFQC 1QR3E 2A4OA 3ESTA 5DP4A 3QGNB 2ALVA 1P01A 2XBVA 2NU0E 1W12U 3PMHB 2FOEA 3GISB 5FCKA 1GBTA 3V13A 1BJUA 1IQFA 2TIOA 3O8RA 4I8HA 2J2UA 1A2CH 1GCDA 1L1NA 1GGDC 1SHYA 1C5UA 4Y7AA 3E0PB 3FZDA 1BTZA 1IAUA 2BDGA 1BBRK 7ESTE 1K2I1 1VITG 1P2IA 1A0LA 1GHAG 2ZP0H 1BTXA 1ETSH 2JETB 2PKAA 2XXLA 4CRFA 3O8DA 3E1XB 1NY22 6LPRA 4ZHAA 1O2XA 1W14U 2SGFE 4CHAC 1KIGH 2Z9GA 1Y8TA 3GYLB 2Z3EA 3MWIU 5FPSA 1L2EA 3KQDA 1V2MT 1VR1H 1ZRKA 1HJ9A 1AE5A 1GVKB 4K8BA 4D9RA 3AW1A 1OKXA 2AIQA 1H9IE 4TY7A 2FWWA 2XC0A 3TJOA 3MTYA 3P70B 1GJ8B 3FVFB 4XBCA 3SU6A 1O30A 1TGNA 2DE8A 4K2YA 2UWLA 1QB9A 2KAIB 4CH2B 5EPNA 2A0QB 3UTUH 1SFIA 4Z6AH 3EQ0H 3MMGA 3S9AA 1BTYA 4GCHF 5F8XA 4ABDA 4WMDA 4MPUA 2LNCA 2QC2A 3OY6U 4DT7B 1F0UA 1UVSH 1YPHE 1QTFA 1XUFA 3RXHA 2BY6X 3PO1C 4JZ1A 1CHOG 1KXBA 2CF9H 3EAJA 1GVZA 4K1SA 1QBOA 1FY8E 3RXTA 4WXIA 1TAWA 4MPWA 4D7FA 2PKAB 3T25A 1BTUA 3STJA 2RA3A 2PSYA 3NUMA 3SJIA 1P0SH 2IN2A 4CBNA 1O37A 4WH6A 1H4WA 1KXCA 1BTHH 1OPHB 2A5AA 1MZAA 2UWPA 3BV9B 3UREA 1DWCH 2WPLS 3SU5A 1A7SA 1Z7KA 1O2TA 1TONA 2R2WU 4JZDH 2JKHA 2O8LA 1FN6A 5EGMA 1MKXH 1SGFA 3U9AH 5DP9A 3GOVB 2R2MB 2RDLA 3A88A 1C2LA 1HAZB 4CRAA 1XMNB 1HIAA 1GVLA 1V2PT 2FOCA 2Z94A 3BTDE 3L3TA 1LKBA 4JYUH 4CR5A 1ELBA 1LHEH 3RC6A 1A5HA 4CRBA 3U98H 4X8UH 1WCZA 1AO5A 1H1BA 3JZ1B 1T32A 1AI8H 3KHVA 5ESTE 2R0KA 4X8TH 1GHZA 3SV7A 2IPHA 4NIWA 2ZF0H 4XDEA 1TMUH 3RM2H 3RMMH 1F92A 1V2RT 1PPFE 1O3HA 2XBYA 3GYMA 1MKWH 4AGKA 1OWDA 1NRNH 1QY6A 1U6QA 3SNDA 1RTKA 3KQCA 2B9LA 2PSXA 4X6MA 4B71A 2OD3B 1KXDA 4VGCC 3RXGA 2THFB 1SGDE 1DY8A 2OC1A 4D8NA 1LDTT 3ZZ8A 3M7UA 3FZZA 5B6OA 3WY8A 1V2QT 1UTMA 2VWNA 4ZXYH 2PGBB 2QY0B 1CGIE 4JZEH 1YGCH 2XCNA 5AHGH 4UFGH 4DOQA 1GI0A 1B7XB 2CMYA 1OP8A 1P2KA 3LGIA 4AFQA 1O3GA 1DDJA 1O2KA 2ZDKA 1C5VA 1PYTD 5DG6A 1BRAA 1V2TT 1HIAB 2R3YA 3LIWA 1ZHPA 1DY9A 1YPHC 4F49A 5A09A 3BTTE 1GDNA 1ARBA 1O5BB 1CT2E 2WPIS 1P11E 3URDA 1GDUA 3BTME 3HK3B 2TBSA 1SOTA 1TNIA 4DG4A 1XVOA 2C8ZB 3UR9A 3M61U 1GBEA 2A7CA 2ZFSA 3PO1B 2FPZA 3M3SA 2O8TA 1BQYA 2ODPA 2WV4A 3PROA 1MTSA 1UTPA 3GY5A 3ZZ7A 3E3TA 1NO9H 3Q3YA 4MLFB 5FX5A 4DW2U 4ABJA 4K1EA 1PYTC 1Y3YA 3BTFE 4KGAA 3U8TH 2F9UA 4NFFA 1YLDA 2PR3A 4AORA 2W7SA 5JBTA 2ZCHP 3FP6E 3A7TA 3LJOA 1IQIA 1TX7A 2GX4A 1TX6A 2GT7A 5ABWA 3ZYEA 3ATMA 1O2YA 2VGCC 2FM2A 2VH0A 1CT0E 1Y5UT 1QBNA 4AB9A 4YLQH 1UK2A 4GAWA 4BOHA 2BOHB 1VCPA 3GY7A 1F5LA 5EXMA 1QQ4A 4JYVH 4DY7B 5GXPA 3HGNA 3MYWA 3ZZDA 5L6NH 3A7ZA 5E0HA 1YCPK 2XRCA 4SGBE 4NA9H 2VWMA 1INCA 1GI5A 5HMAA 7LPRA 2VB0A 2BD3A 1O5EH 1D9IA 3GCHC 5A8XA 2CGAA 1P02A 2GP9B 1YF4A 1DICA 3ATLA 3ZZ5A 1OWHA 3VB3A 3QGJA 1O3IA 1M9UA 2FS9A 2A2XH 4B2AA 1IQEA 1MTVA 1ZSJA 2BYAX 3TH4H 2YNAA 1ORFA 1WV7H 1O2OA 1G3EA 1HAHH 3ZVGA 4D9QA 2FOGA 3GY8A 3MH4A 3S7KB 2P95A 2W26A 7GCHF 1TMTH 1BMMH 3ZYDA 1MMJN 1O35A 2HOBA 1FJSA 4U32A 3M3TA 1AZZA 1C4U2 2BDYA 1E34B 1H9LB 5L2ZH 4IC5A 2AMQA 1WYKA 5GIBA 1UK4A 2ZGXH 1S85A 1EZSC 2FYQA 2ZU4A 3VXFH 2O8UA 2VIVA 4ZROA 5DGJA 1Q2WA 1IQMA 3IWMA 1WUNH 2BHGA 4BANB 5LPFA 3CS7A 3M7TA 1C2DA 2VIDA 2G52A 1SGQE 1DSUA 3G01A 3UOUA 1PPHE 2ZQ1A 1THSH 3FP7E 1AB9C 4Y0ZE 3RU4T 2TGTA 3M36A 1TNJA 1B5GH 2VU8E 3ZZ3A 1LHGH 2OC8A 3A7WA 1OYQA 1DWEH 4FUEA 1C1UH 1TNHA 3RM0H 1JOUB 5A8ZA 5JB8S 2TGAA 2Z9KA 2NU3E 3MH6A 2TGDA 1BRBE 2AGIX 1TALA 1VITF 1W7GH 1Z8JB 3L6PA 3DA9B 1FQ3A 1GHAF 1WBGB 1AE8H 3U8RH 4MG3A 1K1PA 1RFNA 1N8OB 2VGCB 4AB8A 1LPKB 3P95A 1ZYOA 5J4SA 2A4RA 1D3DB 1SLXB 1V2OT 2V3HH 5JYIA 1TPPA 1F0TA 5AFYH 3K2UA 3LH1A 3TGJE 1HUTH 2D8WA 2ZI2H 1GBJA 4BXSA 2FOHA 1DPOA 1DLEA 5FHTA 1DWBH 1KY9A 1MU8B 3GCNA 4HGCA 3OTJE 3V7TA 1FY3A 1FAXA 3LGVA 3SU3A 3SNCA 4Y10E 3GCHB 4J1YA 3SGAE 2BZAA 5ESBA 4MVNA 1YLCA 4UFEH 2WUBA 2XC5A 3NPSA 5EQSA 2C8XB 5C3NA 4XE4A 4MNYA 1SSXA 1ETTH 4MQAA 1P2QA 3SBKA 1MTUA 1CHOF 4INHA 1IQLA 3HGPA 3KEEA 1C5SA 5DP3A 1J14A 4X6PA 2BD8A 3U1JB 3KQEA 1F7ZA 2PUQH 4Y6DA 9ESTA 1FNIA 4OS4A 1H9HE 1MQ6A 3A7XA 2ZGJA 1KLTA 1NFUA 3T28A 4ZHLU 1O2PA 2G5VA 1YKTA 2GVFA 3T2NA 2G81E 6ESTA 3RC5A 1C2IA 1GMCG 1FI8A 4GSOA 1D3QB 2BOKA 3RXIA 4JZIA 4DIHH 1FZZA 5G4BA 1TNKA 1C5WB 2ZWLH 1ESAA 5BPEA 1LCYA 2BLVA 1MD7A 2XWBI 4B73A 3C27B 4NSYA 4D7GA 1JXPA 2ZG0H 1CVWH 1V2WT 4ABAA 2CHAC 3VB7A 2BMGB 1P57B 2ZGHA 1L1GA 2I6SA 2EEKA 5C1YA 3ATKA 4DURA 1DM4B 1AB9B 3SV2H 3ZZAA 4FVDA 3SV8A 3F9FA 3KIDU 4GHQA 2XYAA 4NFEA 1F0SA 4HZHA 4UEHH 1GCTC 4INKA 3DFJA 2GDEH 1PPGE 4ZKRU 1C1RA 3GICB 3E91A 3TGIE 1P10A 2A1DB 4AG2A 3RXSA 3BEUA 2GZ7A 1D3TB 1DUEA 1PPZA 4TWWA<