2D26C

Active site distortion is sufficient for proteinase inhibit second crystal structure of covalent serpin-proteinase complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
236
structure length
223
Chain Sequence
TEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Alpha-1-antitrypsin
publication title Active Site Distortion Is Sufficient for Proteinase Inhibition by Serpins: Structure of the covalent complex of alpha 1-proteinase inhibitor with porcine pancreatic elastase
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 223
sequence length 236
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2005-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2d26C02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2d26C01
2ZC9H 1P9UA 2OC8A 3RM0H 3NXPA 3KQEA 4B71A 1O3IA 1A61H 1N6XA 2K1QA 1O33A 4K2YA 1PQ8A 1BA8B 1GHVH 3A82A 5T6FA 2GP9B 5JDUB 3RXQA 1ELTA 1T8MA 8ESTE 4K1TA 1MBMA 3RXOA 2P3TB 4NA7A 2ZQ1A 4NIVA 1O5EH 5ESBA 5FPSA 1V2UT 1BZXE 3SJKA 7GCHF 1FAXA 1MQ5A 2XRCA 2FWWA 3KGPA 2Q6GA 5IYTA 5LPEA 1SI5H 4E7NA 1P2OA 3PWCA 1PQAA 1QA7A 3KQDA 3U8RH 1A0LA 1TGNA 1FPHH 1A5IA 3FP7E 1ELFA 5LPFA 2ODPA 2Z3DA 2ZG0H 5GWZA 1OX1A 3LOXA 1HAGE 4BTTB 2Y5HA 1Y3UA 5JBCS 3RLYH 1ZHMA 1NY22 5FCRA 5EXNA 1IHSH 4K3JA 1HAIH 2BMGB 2GGVB 1SL3A 4I31A 4JZ1A 2BZAA 4IS5A 1CBWB 1LQDB 1A0HB 1QRXA 1GJ8B 1TNLA 1GHWH 1WSSH 1EJMA 2A4GA 5C3NA 1UTKA 5FHTA 4J1YA 3RM2H 1QGFA 1C2FA 1DWEH 2F3CE 1LHGH 2Z3EA 1SPJA 3BIUH 1YBWA 2VGCB 3VEQB 2ANYA 5C2ZA 1O2VA 4AFZA 2P94A 4A1TA 2OINA 1J17T 2NU1E 3EDXB 1TIOA 3ZZ3A 4LXBH 4Y10E 4MVNA 1NRQH 1KXAA 3GDVA 1DSUA 3LJOA 4ZROA 4AN7A 4Y0ZE 5DGJA 5T6GA 3UOUA 5J4QA 1ARCA 1GI3A 1B0EA 1GWAA 1GBLA 5A8ZA 1TNHA 4Y71A 2TRMA 1ETTH 1CA8B 1GHBF 1VGCC 2BDCA 1LPKB 3TJOA 1YPHE 4WY3A 1OWDA 1UK3A 2WINI 3A87A 1ZTKA 2C3SA 1K2I1 1FY8E 1JOUB 1NPMA 5EXLA 1TX8A 3I29A 2YOLA 6LPRA 2XC0A 4U32A 5T3HA 1W7XH 2HALA 1W13U 1HJAB 1MKWK 2BX3A 2GTBA 2FOMB 3ENSB 1TX6A 1GMHF 1K1NA 1TNGA 3MYWA 2BY5X 3M35A 1S84A 1T8NA 2AMQA 3TH3H 1BTHH 4ISNA 1FAKH 1BTYA 1FQ3A 5JPMH 1ACBE 1GHBG 2QC2A 3BEUA 1VZQH 4B2BA 1AFQC 3PYHA 2PW8H 2C8ZB 1XVMA 1EXFA 2BY9X 9LPRA 3RU4E 3HKJB 1RS0A 2BDIA 3DHKH 3FZDA 3MH6A 3SN8A 1TB6H 3MO3A 2H9EH 2XCNA 5J4SA 4YESB 3M7UA 1O2ZA 1ZSJA 1TNIA 1OWEA 5C5NA 3VB5A 4PROA 5GIBA 2PSXA 1THRH 5LGOA 1EUFA 3A8AA 1LO6A 2WPLS 5BPEA 2ESTE 4Y11E 2CN0H 1DXPA 3BEFB 3SU2A 3MWIU 1GL1A 3AAVA 2ZF0H 1DY8A 2ZQ2A 2VH6A 1DWDH 4ZMAH 5JBTA 1UVTH 4KGAA 3VB6A 1ANDA 4YOGA 1OWJA 1TFXA 2YNBA 2BLVA 1PPHE 3UNSA 1TPSA 2C90B 1P0SH 1F0RA 1TA2A 1O5GH 1SFQB 5ABWA 4B74A 1UTLM 1EOLA 3Q00A 4CHAB 1ZJDA 1NFUA 2A45B 9ESTA 1O3JA 1LHFH 1KDQA 3W94A 1BBRE 2GMTB 5EQRA 2ZU2A 3GCHC 1XUFA 3BV9B 1EPTB 1Z8IB 1VJ9U 2XTTB 1GDNA 2OC7A 1G3DA 1C1RA 1KYNA 2FP7B 5FBEA 2A4RA 4NIYA 5FBIA 1XUJA 3G01A 2XBVA 5EOKA 1ZHPA 2VWMA 1QURH 3P8OA 4MNWA 3ATKA 3OY6U 2JETB 2ZGJA 1YPJH 1BITA 2ZWLH 5HGGA 3E90B 4UDWH 1TAWA 3Q77A 3GICB 3T2NA 1HJ9A 3OYPA 3RXDA 1EJNA 2RCEA 3SBKA 3A7YA 5F8TA 1ZMNA 3SI3H 1TGBA 1WQVH 2SGEE 4ZHLU 1AFQB 2ZP0H 4O97A 2Q6DA 4AFUA 3LGUA 3UREA 2HNTC 2ZHQH 2VVCA 3EAJA 3SV8A 1QHRB 1E38B 2ALPA 4QT8C 1NRNH 1AY6H 2WUCA 3B9FH 3BTGE 2AGGX 3ZZBA 2ZZUH 3MOCA 2BLQA 3VB4A 1SGEE 1DS2E 3EA7A 4CBOA 2B5TB 4U2WA 3PROA 4YLQH 1FMGA 5CHAC 2OQ5A 3QK1A 4UFEH 5JB8S 4OS2A 1TQ0B 2VNTA 1ZMJA 2CV3A 2J2UA 1HDTH 4FUDA 3OY5U 5L2YH 1S0RA 1GBDA 4I7YH 1MH0A 1O3KA 1AI8H 1TE0A 2PFEA 1V2LT 2QIQA 4Y6DA 5ETXA 1Z6JH 4VGCC 4A1XA 3UQVA 3I78A 2BOKA 2J34A 2A7HA 3D23A 1YC0A 4O9VA 1C1PA 4LK4A 1BRUP 3STIA 3SGQE 2PKSC 1UTPA 3URCA 2A4QA 4MNXA 3RXFA 1GBCA 2TPIZ 1ARBA 4XDEA 3QTOH 3ZYEA 1CT0E 2VWOA 3TIUA 2PTCE 4OS6A 5A0AE 2ZFFH 1N8OC 1JBUH 1AVGH 1MAYA 4OGYA 3LC5A 4I32A 1RTKA 2A1DB 3M7QA 3P6ZB 4YZUA 1MKXH 4H4FA 2EA3A 2OXSA 4WMEA 3BTFE 1T4UH 1AFEH 2HWLB 3CENA 2SFAA 2ZIQH 1K1OA 3MO9A 1B7XB 1YLDA 1Y5AT 4ABDA 3U8OH 4K8YA 3TGIE 2B9LA 1MBQA 3HPTB 3MU4A 3P8NA 4XBDA 4Y8YA 1DICA 2ZGXH 3ZZ8A 1NTPA 1O3OA 1A5HA 3RU4T 3RXAA 1SG8B 3RXSA 4CH8B 1ZPBA 1A46H 1O2QA 1WTHD 1AUJA 1C5XB 1P11E 2GT8A 4XBBA 4ABGA 1DLKB 1DVAH 1YPKH 1S6FA 3PO1C 1C1UH 5HM9A 2ZCLP 1P12E 1H9LB 2KAIB 1ZHRA 1TALA 1YPLH 2FZZA 5E2PA 1ESTA 2NU0E 1UTJA 3C1KA 1TPOA 1W7GH 2VINA 3R3GB 3QLPH 1FPCH 1GJ7B 2Z9IA 4WH6A 1XM1A 5GXPA 2W26A 1BHXB 2W5EA 4A5TS 1H9IE 1C5QA 2F9OA 3RXEA 4INKA 3S0NA 3UR6A 1F0SA 4FUJA 2QF3A 1C1WH 4GHQA 1DDJA 3BTKE 4BNRA 2C8XB 3R0FA 5FCKA 3SNCA 1WV7H 2Z9LA 3WY8A 1A7SA 1SOTA 2UUKB 1TRNA 2ZPSA 3UR9A 1O3GA 1TGCA 1LVYA 4DOQA 1BRBE 1GGDC 3E0NB 2AMDA 2ODQA 1L1GA 2R0KA 1SMFE 2PV9B 2QGRA 1YPEH 3TJUA 4FXGH 3Q3KA 2BD2A 2WPHS 2O8LA 4MLFB 3UFAA 2Z94A 4H6TA 1V2JT 1AB9C 3NUMA 1O3BA 1ELCA 1C5NH 2J95A 2GV7A 1O32A 3K9XB 4FU9A 1Q3XA 2IOTA 2OBQA 1TNJA 3NWUA 4B2AA 4OGXA 4X8TH 1C5OH 1OYQA 1T4VH 3ZZAA 1P8VC 1HAZB 2JH5D 1IQLA 4Y0YE 1SFIA 3RC5A 1IQFA 1GI6A 1YLCA 3AW1A 3ATWA 4OS5A 2ZDNA 3BEIB 4GHTA 3BTDE 2C4FH 1UCYE 1O34A 3O8BA 5DKMA 4BAOB 1MZDA 1LMWB 2A5IA 1CE5A 2H9TH 3RXKA 1P10A 1XUIA 4X6PA 2V3OH 1VCWA 2GZ8A 4KTSA 1MTSA 1C2KA 3K6ZA 4UD9H 3UIRA 4E05H 3EA9A 1F5LA 3V7TA 4B75A 2HNTF 1ELGA 5A09A 1V2MT 3MH7A 1XXFA 1FIZA 4BOHA 3ATMA 1O2RA 5DPAA 3QWCH 3E8LA 3RXVA 2ZDKA 1AZ8A 1JMOH 1ZRBA 2ZI2H 2BDYA 1TWXB 3SNEA 3ZVBA 4RKJB 1NROH 4JCNA 3IWMA 5LH8A 1U6QA 1ANCA 2Y6TA 1GBHA 3P92A 1MAXA 1YF4A 3UY9A 1QBNA 2R2MB 5FX5A 1ZJKA 4BAHB 1EKBB 5SGAE 3K2UA 2GDEH 5EW2H 5I46H 1JIMA 1GL0E 1IQKA 3LDXH 3NPSA 1CBWC 1MTUA 1AKSA 1DFPA 4SGAE 3SU0A 5HYOA 4DGJA 3ZZ6A 2TGAA 3ZZ5A 2G55A 2ZCHP 1MTNB 1O30A 1IAUA 1QRZA 1RJXB 1MZAA 2FI4E 2Z6BD 3DUXH 1BTXA 2P93A 2HNTE 2PSYA 1D9IA 3ZZCA 3LGTA 1Y3VA 4K5ZA 3T26A 4BAMB 3P70B 1NT1A 2BTCE 1SQAA 2XYAA 1QIXB 1OPHB 3BN9A 2STAE 3LGWA 4UFGH 1P2KA 1QQ4A 1SQOA 5DK1A 3ZZ4A 5DJ7A 5DG6A 1MCVA 3KEEA 4ABFA 4KELA 4M7GA 4CRFA 1AZZA 1EJAA 1GHXH 4ZAEA 3TVJB 3ZVCA 1F0UA 1W10U 4JYTA 3A80A 1NU9A 1BIOA 4AYYB 1V2KT 3Q76A 4D7GA 1QJ6B 2ZU5A 3RXGA 4FUBA 1HJAC 1HIAA 1YYY1 1SC8U 2OD3B 3MMGA 1P03A 3K6YA 3S69A 3LC3A 1HXEH 5CE1A 1IQJA 1UO6A 4NA9H 3TJVA 1V2OT 3SOSA 4ZXXH 4ZKNU 2ZFPH 2G52A 5DP4A 2OTVA 1O2LA 2FOBA 3A7ZA 3AVZA 1Z7KA 1UVOA 1O39A 1AO5A 2BM2A 1O2WA 2FOCA 1L1NA 3SJ8A 2J4IA 2R0LA 4JK5A 7ESTE 1DT2A 5GCHF 3ZZDA 1Y3YA 3ZZ7A 1HRTH 3M3SA 2BOHB 3BSQA 3FZZA 1NFXA 2KAIA 4H6SB 2D2DA 1EAWA 1EB2A 3M5MA 1EZXC 1OWIA 3UNRA 3CS7A 2AIQA 4YOJA 3B23B 3HATH 1BRAA 1NZQH 3LONA 1GCTC 4DURA 2XC5A 2ZDMA 7LPRA 2H9HA 2UWPA 2Z9KA 1ETSH 1KY9A 3MU1A 3U9AH 1PPFE 1PPCE 2FOFA 1DXWA 2AGEX 4XOJA 1A3EH 2ZTXA 2D1JA 4X2YA 2AERH 2Y5GA 4MPUA 2THFB 1C5VA 1ELBA 1QL8A 1SGPE 1SLUB 3GCTF 3M36A 4AGKA 4BANB 2H6MA 4CRCA 1DPOA 1NESE 4D7FA 1UVPA 1P3CA 5GCHG 5EPNA 2A7CA 4ZUHA 3RDZA 4CHAC 2ZA5A 2QN5T 4MPVA 2XBWA 1O3DA 1KXDA 3BTWE 1EAUA 4GCHF 3GDSA 1VCPA 1AIXH 1TPPA 4DY7B 2GMTC 2SGQE 2BQWB 5ESTE 1BOQA 1EPTC 1C2LA 3RXBA 5C5OA 1GI1A 4ABAA 4DJZB 1IQIA 2VIOA 3BIVH 3U98H 3F9HA 3SU5A 1O2GH 1F5KU 1WTGH 1S6HA 1DE7H 1Y3WA 2JETC 2ZFRH 1FY1A 1YGCH 4NGAH 3GCTG 2FX6A 1OYTH 3V3MA 1GHYH 2BD4A 4AG2A 4GSOA 1UVUH 5F8ZA 3VPKA 3ZVFA 4ASHA 1CSOE 8LPRA 4WH8A 2AMPA 1MMJN 4GCHG 1WAYB 4ABEA 4K69A 3D62A 1VITH 2QY0B 1DM4B 4IBLH 2O8TA 4Y8XA 3RMLH 3P95A 4Y76A 1XUKA 4H42U 3F6UH 2BX4A 3MI4A 3SNDA 3MU5A 1GPZA 4XSKU 1ZZZA 1G37A 6GCHF 1N6YA 2ZDLA 4YTAA 1P2MA 1KTTB 1IQMA 3D65E 4IN1A 3LGYA 2CXVA 4IC5A 1C5PA 1UHBB 1X7AC 1GCTB 1LKAA 2B8OH 4ISIH 2TIOA 1A1RA 3PWBA 4ZKOU 1VJAU 1V2ST 1O31A 1K28D 1GBEA 2O9QA 1JRSA 1LHDH 2GKVE 3GDUA 1BUIA 1GI0A 1Y3XA 2ZEBA 3SNAA 1Y8TA 2RDLA 3SUDA 5EPYA 1GJDB 4B1TA 3RXIA 2WYJA 5E0HA 5HMAA 1P02A 4ABBA 2HLCA 1KTSB 3SUEA 4CRAA 2O8UA 3A89A 1GI4A 1UK4A 3MU0A 4Q7ZA 1GJ6A 1FN6A 4XBCA 4ZKSU 2OLGA 4CR5A 6GCHG 1E36B 2BD3A 3VB7A 3M3VA 2ZHEH 1G2LA 1Z8GA 3QZRA 4JZFH 2FI3E 5FXLA 4K1SA 2JH0D 3GYMA 1DANH 1O2HA 1ZTLA 2ASUB 1XUHA 1EP5A 3GCOA 3EGKH 1AUTC 1FN8A 2H5DA 4ZHMU 4WVPE 1Z8JB 4DT7B 1D3PB 4AOQA 1T8LA 1TRYA 4Z6AH 2PR3A 2XC4A 4Q80A 1FI8A 1GBJA 4UEHH 1FLEE 3UTUH 2ZNKH 1ABJH 3GY5A 3H7TA 3MTYA 1TNKA 2ZU4A 4X6NA 3TK5A 2G51A 1RGQA 2ZGBH 1SHYA 4AGJA 1C5ZB 3K65B 4NSYA 1RD3B 4AYVB 1GI5A 1F5RA 1DWBH 4D9QA 2P95A 2F9NA 1Z1JA 3TU7H 1C1TA 1TYNA 3RMOH 3ZV8A 2BDBA 3A8CA 5L30H 2ANMH 3FFGA 4YLUA 1THPB 1GBBA 4D9RA 3KQCA 3S9CA 2V35A 5DP6A 1XUGA 2NU2E 3RXTA 1SGQE 2QXIA 5LPRA 4TY7A 3E1XB 1O5CB 1EQ9A 2ILNA 1C4V2 1O3PB 2DE8A 2VWLA 1EAXA 2YNAA 1HNEE 2Z9JA 1Q2WA 3A81A 3A84A 1C1SA 1YCPM 2VU8E 2EI7A 1HAXB 1HYLA 1OSSA 1THSH 3SV7A 4X6OA 1J16A 4O03A 1W0ZU 1ZMLA 2F9UA 1C2MA 5C1YA 3RMNH 2Z7FE 3SJIA 4A7IB 5DP8A 2WV5A 2GVFA 2Y5FA 1MQ6A 1ELVA 1CU1A 4ABJA 1FZZA 3KIDU 2QYIA 1ABIH 1IQHA 1Z1IA 2FLBH 2BZ6H 1MKXK 2G81E 1O3AA 3S9BA 1XVOA 3MNSA 4RN6A 1O3HA 2BQ7B 2FO9A 3MHWU 5TJXA 2FOAA 3GY3A 2PGBB 1C2EA 1S83A 1OXGA 1UJ1A 3E6PH 2QAAA 5JBBS 1G9IE 3JZ1B 5FAHA 1D3QB 1S5SA 4ZKRU 3PMHB 3HKIB 2BLWA 1EOJA 5A8YA 3T25A 5JYIA 4I8KA 3LIWA 4JZEH 3VXFH 4NWLA 1QBVH 3A7TA 2ZU1A 2BVSH 3LT3A 1O0DH 1HAOH 1MD7A 1L2EA 1O2MA 3GY8A 1CGIE 2GCHG 4ZHAA 1P01A 2BVXH 2EEKA 2HRVA 3LH3A 1EB1H 3A7WA 3BG8A 4FU8A 2OQUA 3UWJH 2FLRH 3UOPA 1OS8A 5GDSH 3ZVDA 1SGFG 2FI5E 5F03A 3SQEE 2FEQH 3TNSA 2WYGA 1GVZA 2A4OA 1PYTC 2VIPA 5DO4H 4X1QU 1BTZA 1V2PT 1ZSLA 1E37B 3SQHE 4JYUH 2G4TA 1QA0A 1UTOA 1CT4E 2ANWA 3OU0A 1AU8A 3F9FA 4LOYH 3SI4H 3H5CB 3P8GA 2R2WU 1HAPH 1IQGA 1AMHA 4AB8A 2FIRH 3E3TA 3SUFA 3URDA 1EAIA 3QDZB 3SNBA 2ZFQH 1GHAG 1AWHB 4FVBA 5AHGH 4KP0A 1AVWA 1NO9H 3TH4H 1NFWA 1PPEE 3TK6A 3FP6E 3MU8A 4NWKA 1QTFA 2GV6A 2P8OB 2FMJA 3T27A 4GVUA 4INLA 5BRRE 2V6NA 3AASA 2P59A 5K0HA 2NWNA 1H1BA 1W11U 1XXDA 2FYRA 2VIWA 3V12A 2A32A 1UTQA 2BDHA 3M5NA 3KNXA 2UUJB 4YO9A 3ESTA 4O3UA 2HPPH 1D4PB 2IJOB 3QO6A 3QUMP 1O5AB 1MTVA 2Y7XA 1C5SA 5E0JA 1O2NA 1SGFA 1WOFA 3U8TH 3RLWH 2FS9A 1TOMH 1PQ7A 1FIWA 4K8BA 1ZGVA 2ZKSA 4Y7AA 3TK9A 3ODDA 4F49A 8KME2 1NS3A 1VCQA 2OUAA 2J92A 1BDAA 2ANKH 2OBOA 3MNXA 1AWFH 1P57B 2XCFA 4RSPA 1BBRH 2A5AA 5T6DA 1BMMH 1UHBA 3SU6A 1HLTH 2Y80A 1CHGA 3DD2H 1C5RA 1DOJA 1O2OA 1ELDE 2Z3CA 1QB9A 3I77A 2WPJS 4YT6H 1HGTH 2WUBA 2WPKS 1IQNA 1YM0A 1SLXB 1JWTA 1MTNC 4Y8ZA 2BDAA 1BRCE 4KTCA 2ULLA 1MU8B 3BG4B 1O2UA 1ANBA 1W2KH 1FY3A 4CR9A 2STBE 2UWOA 3VXEH 5EW1H 1KLJH 3LH1A 3A7VA 4TPYA 2LNCA 3RXPA 1AD8H 4UE7H 4HZHA 5L2ZH 2VIVA 2UWLA 4I8LA 1SR5C 1EPTA 1AHTH 1HV7A 1NN6A 1C4Y2 2FOEA 1V2TT 4X6MA 1W12U 2C93B 1GDQA 2SNVA 1HB0B 1MU6B 1EZQA 1HAVB 2ALVA 3MFJA 4X8UH 4WMFA 4E7RG 1D6WA 3PB1E 1LVBA 5EQQA 4JK6A 1TBZH 2SGFE 3GCNA 2BVRH 4ISOA 1PQ5A 2O8MA 4U01A 2FTLE 1QJ1B 3P8FA 1T31A 1TGTA 3OX7U 5FPTA 3SO3A 1Z6EA 2ZGHA 1GMCF 3FAOA 1SLVB 3DT0H 1QCPA 3ODFA 1K1IA 4IC6A 1HAHH 3C27B 1T32A 1W14U 2A2QH 1D6RA 2UUYA 1DX5M 3EYDA 1P05A 1K22H 1LPZB 2FPZA 4FUEA 2ZHDA 5EGMA 2F9PA 1BCUH 3LGVA 1C1MA 2DUCA 1C2JA 2SGDE 2ZTYA 4THNH 2VVVA 3MH4A 1OKXA 4Y7BA 4CH2B 5GPIB 2GT7A 3BTTE 1O3MA 1LDTT 2GZ7A 4ISLA 4GLYA 1GI2A 2BXTH 2PLXA 1PJPA 1QNJA 1AQ7A 1GMCG 2NU4E 3PLPA 4ZH8A 1GMDF 3EA8A 1GBFA 2EI6A 3KL6A 1BHXF 4O3TA 2ZDAH 2M5TA 2CF9H 4MPWA 1KDQB 1DY9A 3BTHE 3N7OA 1BMLA 5HXFA 1ZSKA 3CP7A 4NG9H 1S85A 1E34B 2VB0A 1O2JA 3HGNA 3TGKE 3QGJA 3F9GA 4U30A 1CQQA 2XBXA 3ZVGA 1ZLRA 2F83A 2AGIX 1LHCH 2AFQB 4OS4A 4FUFA 1ZGIA 1C5YB 3BTME 1YPMH 4MPXA 1P04A 2AYWA 1O3NA 1V3XA 2ZECA 1CVWH 1ELAA 2H1UA 2C8YB 3IG6B 4X0WU 1DLEA 2TGDA 4FUGA 3KN2A 1GMDG 2BQ6B 1NRRH 1O5DH 4RKOB 1W8BH 4Q7XA 1O35A 4AZ2B 4CBNA 1C1OA 8GCHG 1O2TA 2VIDA 4FVDA 1S81A 3D49H 4JZDH 2CMYA 2ZFTA 1G32B 1QB6A 1ELEE 1H9HE 2Y81A 4INHA 4BTIB 4AORA 2WPMS 2GDDA 1SGIB 2SGAA 1K1JA 1TABE 3MH5A 5G4BA 2PHBA 1CT2E 1MD8A 1AVXA 4NSVA 2QF0A 3PTNA 1ID5H 4BXSA 4DIHH 2G5VA 4BAKB 1RFNA 2Q6FA 2ZO3H 1ORFA 1J14A 1NC6A 3VGCC 2GZ9A 2PGQB 2FXRA 2D8WA 1DITH 1N1LA 1CHOG 2J38A 3MO6A 1OP8A 2CGAA 1GJAB 2A0QB 4MNYA 1GCDA 1FV9A 6ESTA 1K9OE 3EQ0H 4BAQB 1A5GH 1C5UA 1UCYK 1BTUA 4MNVA 3NKKA 1ZTJA 1P3EA 1WBGB 1BJVA 2Y82A 3OSYA 1EASA 4AB9A 1W0YH 2FOGA 4HTCH 3T62A 4YM9A 1INCA 1SB1H 1H8DH 4I8GA 1C2GA 2FS8A 2BD5A 2BY6X 2ZHWH 1A2CH 1E35B 7GCHG 1SSXA 4X8SH 1O2SA 3ITIA 1C9TA 1LVOA 1A4WH 1IOEA 1OP2A 1LVMA 2A2XH 3A88A 3U69H 3NZIA 5AFZH 2ZFSA 4ZXYH 1XMNB 3HK3B 1C2HA 4FUIA 3RXHA 1YPGH 3KQBA 2FOHA 4AFSA 1HFDA 2V3HH 1V2VT 3RXMA 4NFFA 1UCYH 1SGDE 1AN1E 2FX4A 4MDSA 2QXJA 2QA9E 1GI8B 5DP7A 3SV2H 2AH4X 4WJG2 1W3CA 5EG4A 1KSNA 2XNIA 1JIRA 1OWKA 1TX7A 2HGTH 1Q31A 3MNCA 2R3UA 1S82A 4B2CA 3ZYDA 6CHAC 4HGCA 3ZVAA 1KXEA 1GJ9B 4X2WA 3GOVB 1HBTH 1BQYA 2BXUH 4TWYA 2F91A 4GUXA 4LZ4B 1AGJA 2EC9H 4JYVH 2A31A 2XXLA 2ZGCA 1EATA 2RG3A 1NRSH 3PTBA 1C9PA 1AE5A 4DVAU 3PMAB 5I25A 1L1JA 1QR3E 2P3FH 3M5OA 3S7HB 5PTPA 2QCYA 1EP6A 2BD9A 1HAVA 3TLOA 3VGCB 1IQEA 1O38A 1LCYA 1KXBA 1ZYOA 3SZNA 1NRPH 2FTMA 3AAUA 1TBRH 1CO7E 1DUAA 5HM2A 2OC1A 1DUEA 2LPRA 1OOKB 4I8JA 5K7RA 1GI9B 3SHCH 1NFYA 3F9EA 1O5FH 4IMQA 3IITA 4XFQA 3VFEA 1TQ7B 1QQUA 2ZU3A 1RTFB 1XKAC 1O3CA 5E0GA 2FDAA 3E16B 2CHAC 3A7XA 3SUGA 4GAWA 1MKWH 4KKDA 5TCAA 2AIPA 1C5WB 1GDUA 1TRMA 3ATLA 1L4ZA 3KF2A 4TY6A 3RC6A 1GMHG 1P2JA 4D8NA 4DG4A 4IMZA 2PTNA 1O3LA 2D26C 2I6SA 3ZVEA 3SU3A 4AFQA 1G36A 1EZSC 5C1XA 1WU1A 3M37A 2FYQA 4X1RU 3SV9A 4X1NU 2CJIA 4OS1A 1UTNA 7KMEH 1G2MA 5IDKA 2J9NA 3PM3A 3QZQA 4IN2A 4NFEA 4Q2KA 3S7KB 4WWYA 4XE4A 1J15A 1F0TA 2G8TA 4CREA 2VIQA 4X2VA 3KCGH 2W7UA 1GBMA 2GCTC 5H4IB 2O8WA 1VGCB 1B0FA 5B6OA 1C1VH 2ZDVH 4DCDA 2XW9A 2JH6D 4R8TB 3M3TA 3V13A 3SU1A 1GJ5H 1TBQH 3F1SB 3TITA 1RIWC 1CGHA 6CHAB 1ANEA 2PWXA 2TGPZ 1BT7A 1V2QT 2FM2A 3B8JA 4JMYA 1FUJA 1SGRE 2UUFB 2QXHA 1TLDA 5EQSA 3A83A 2BLOA 5JBAS 3KHVA 4AG1A 4ABHA 2SNWA 5TCCA 4ESTE 1QB1A 5A0CA 3E91A 2TGTA 5AVDA 2BY7X 3LGIA 1FY4A 2HOBA 1P2NA 4CRDA 1ESAA 3GYLB 3O8DA 1O3EA 4D76A 4SGBE 1QY6A 4CRGA 2CF8H 5F6MA 2R9PA 5EXMA 4DW2U 1L4DA 1O2XA 1V6DA 1YKTA 3UWIA 3RXLA 3Q3YA 1FJSA 1F7ZA 3GY4A 2P8OC 2PKAB 4HFPB 2JKHA 1GJCB 4FUHA 4F4OC 2CHAB 4J2YB 4E06H 1HCGA 3QTVH 3RC4A 2W3KA 1TMBH 2GCHF 2BHGA 1V2WT 1G30B 2VWNA 3U1JB 4JZIA 4TYDA 5EODA 1P09A 1TGSZ 4TPIZ 3H7OA 1RTLA 3UNQA 2P3UB 4B76A 5A2MH 4OS7A 2BY8X 2G5NA 3SV6A 1SGCA 1UTMA 5C67A 3LU9B 1SVPA 1LPGB 1BTPA 1GVLA 1QRWA 4DIIH 2J94A 1YCPK 3P17H 1ZR0A 1AKSB 4MTBA 4Q7YA 1ETRH 3UUZA 1GI7B 5E8EH 2ZPRA 3A85A 3SORA 2B0FA 3FP8E 3L33A 3T5FH 1KLIH 3NK8A 1D3TB 1PPZA 3RUOA 3SW2B 5EU8A 2GCTB 1O2PA 3T29A 3CS0A 1GHAF 1QFKH 2RA0A 3GY2A 1BJUA 2C8WB 5FX6A 1GG6C 1JRTA 4X1PU 3GCHB 1WUNH 1RIWB 2BD7A 3UPEA 1DSTA 1TMTH 3GY7A 3SJOA 1QL9A 2TBSA 2ZCKP 3BG4C 1GHZA 1YCPH 4LZ1H 2ZHFH 1SHHB 1H8IH 1O2IA 2A5KA 1CA0C 1D3DB 5DP5A 4BTUB 3L6PA 3UQOA 3OTJE 1Y59T 4X2XA 1P06A 2ODYB 5E2OA 3A8BA 4B73A 4A6LA 2VH0A 1Z8RA 1C2DA 1NU7B 4R0IA 4Y79A 1BB0B 1SBWA 2XWBI 1HIAB 2R3YA 2BB4A 3RXRA 3TJNA 2PUQH 3ELAH 5DP3A 1L0ZA 1UK2A 2IPHA 2OP9A 1P2IA 1ZPZA 5FPYA 5A8XA 1RXPA 3LPRA 1HJ8A 1NM6A 3TPIZ 1HAYB 1J8AA 1V2NT 1BBRK 4ABIA 1EZUC 3M61U 1G3EA 3EE0B 1S0QA 1B5GH 4ISHH 1F92A 1XX9A 3PMJA 2I6QA 4WXIA 3RP2A 2F9VA 5GJ4B 3STJA 1GBAA 3V0XA 1YPHC 5DP9A 5CHAB 2V0BA 1FY5A 4FU7A 1ZRKA 3SHAH 1SOZA 3JZ2B 2ZPQA 4HI3A 1WYKA 4NZLA 1QL7A 1TPAE 2EI8A 3PLBA 2RA3A 1G3BA 3PMBB 2GX4A 4A1VA 4VGCB 3A86A 3BF6H 3F68H 4X8VH 4Z0KA 3SU4A 2BDGA 2BD8A 3BTQE 2H2ZA 3M5LA 1M9UA 2W7SA 5AF9H 1FXYA 1KXFA 1PPGE 2QXGA 3E0PB 1TA6A 4NCYA 1PFXC 1O2YA 3TH2H 2PKSB 4KTUA 3HK6B 1GG6B 3FVFB 1A3BH 1FNIA 3A8DA 1PPBH 1EX3A 4UONA 2Q1JA 1ESBA 1T8OA 4NIXA 2IN2A 3DFJA 1P9SA 1K1LA 1MCTA 1N8OB 1XKBC 1GVKB 4NA8A 2DE9A 3S9AA 2XBYA 1J9CH 1C2IA 1A0JA 1CA0B 1DWCH 2G00A 3RMMH 1RRKA 2P16A 1OP0A 2QV1A 1BMAA 2VVUA 4UFFH 1O2KA 1MTWA 4AX9H 1GJBB 1ZOMA 1LHEH 1SGTA 3PLKA 1MUEB 1GBTA 1WQSA 1BTWA 4I8HA 1LKBA 1TOCB 5C1UA 1O3FA 4I33A 5C20A 1VITF 1E0FD 2HPQH 1C1QA 3QGNB 5AFYH 1WCZA 2WV4A 3RXUA 1IHTH 1Y5BT 1Z71A 3U1IB 1PYTD 3SGAE 3T28A 1GBKA 1O5BB 1BMNH 4GPGA 1Y5UT 4K1EA 2A7JA 3SGBE 1SLWB 2W3IA 1SGYE 2XWAA 2BYAX 3PO1B 3TNTA 1P2QA 1FDPA 3NCLA 4NIWA 3VB3A 1C5TA 2G4UA 1GJ4H 1K1MA 2HVXA 1SQTA 1F2SE 1FONA 1UMAH 4IW4E 3LKWA 3QX5H 3MNBA 2AS9A 2H5CA 1T7CA 3O8CA 2NU3E 1G3CA 3GISB 3RXCA 4CRBA 1VITG 2FODA 5L6NH 3DA9B 3Q3XA 3DFLA 2Z9GA 1VR1H 4MG3A 4WF8A 2PKAA 1O36A 1UVSH 1TMUH 3ZV9A 5A0BA 1KLTA 5CMXH 1HXFH 4A92A 4X1SU 3LJJA 4YT7H 1K1PA 2B7DH 1KIGH 4YOIA 4FUCA 1GGDB 1OWHA 3PV4A 2GD4B 2OC0A 4NZQA 8GCHF 1HPGA 3L3TA 1KXCA 3SJ9A 4WMDA 2SGPE 1C1NA 4K60A 1JXPA 1LQEA 2FESH 2F9BH 1C5MD 3M7TA 1HUTH 2OCVB 1AB9B 2AEIH 2VGCC 1TONA 1K21H 3ZZ9A 1CGJE 5F8XA 3TGJE 5JB9S 3GY6A 1LTOA 1AE8H 2VJ1A 4TWWA 1H4WA 1O37A 1V2RT 1C5LH 3QN7A 3RXJA 3ATIA 3O8RA 1QJ7B 4MQAA 3FANA 3AW0A 2WPIS 2PUXB 1ZPCA 1YP9A 4IGDA 2Y7ZA 4WXVA 4UFDH 3BTEE 3RU4D 1CHOF 3HGPA 1SGNE 1C4U2 3W95A 4BXWA 1QBOA 1GBIA 2ZTZA
chains in the Genus database with same CATH superfamily
2ZC9H 1P9UA 2OC8A 3RM0H 3NXPA 3KQEA 4B71A 1O3IA 1A61H 3WWBA 1N6XA 2K1QA 1O33A 4K2YA 1PQ8A 1BA8B 1GHVH 3A82A 5T6FA 2GP9B 5JDUB 3RXQA 1ELTA 1T8MA 8ESTE 4K1TA 1MBMA 3RXOA 2P3TB 4NA7A 2ZQ1A 4NIVA 1O5EH 5ESBA 5FPSA 1V2UT 1BZXE 1KMHB 4RT1A 3SJKA 7GCHF 1FAXA 1MQ5A 2XRCA 2FWWA 3KGPA 2Q6GA 5IYTA 5LPEA 1SI5H 4E7NA 1P2OA 3PWCA 1PQAA 1QA7A 3KQDA 3U8RH 1A0LA 1TGNA 4TSFD 4ZCNA 1FPHH 1A5IA 3FP7E 1ELFA 5LPFA 2ODPA 2Z3DA 2ZG0H 5GWZA 1OX1A 3LOXA 1HAGE 4BTTB 2Y5HA 1Y3UA 5JBCS 3RLYH 1ZHMA 1NY22 5FCRA 5EXNA 1IHSH 4K3JA 1HAIH 2BMGB 2GGVB 1SL3A 4I31A 4JZ1A 2BZAA 4IS5A 3F2GA 1CBWB 1LQDB 1A0HB 1QRXA 1GJ8B 1TNLA 1GHWH 1WSSH 1EJMA 2A4GA 5C3NA 1UTKA 5FHTA 4J1YA 3RM2H 1QGFA 1C2FA 1DWEH 2F3CE 1LHGH 2Z3EA 1SPJA 3BIUH 4ACBA 1YBWA 2VGCB 3VEQB 2ANYA 5C2ZA 1O2VA 4AFZA 2P94A 4A1TA 2OINA 1J17T 2NU1E 4YXWD 3EDXB 1TIOA 3ZZ3A 4LXBH 2YMSB 4Y10E 4MVNA 1NRQH 1KXAA 3GDVA 1DSUA 3LJOA 4ZROA 4AN7A 4Y0ZE 5DGJA 5T6GA 3UOUA 5J4QA 1ARCA 1GI3A 1B0EA 1GWAA 5DSFA 5FL7D 1GBLA 5A8ZA 1TNHA 4Y71A 2K0QA 2TRMA 1ETTH 1CA8B 1GHBF 1VGCC 2BDCA 1LPKB 3TJOA 1YPHE 2V7QD 4WY3A 1OWDA 2EY4C 2KM0A 1UK3A 2WINI 3A87A 1ZTKA 2C3SA 1K2I1 1FY8E 1JOUB 4Q63A 1NPMA 5EXLA 1TX8A 3I29A 2YOLA 6LPRA 2XC0A 4U32A 5T3HA 1W7XH 2HALA 1W13U 1HJAB 1MKWK 2BX3A 2GTBA 2FOMB 3ENSB 1TX6A 1GMHF 1K1NA 1TNGA 3MYWA 2BY5X 3M35A 1S84A 1T8NA 2AMQA 2K8IA 1BTHH 3TH3H 4ISNA 1FAKH 1BTYA 1FQ3A 4HG6A 5JPMH 1ACBE 1GHBG 2QC2A 3BEUA 1VZQH 3OE7D 4B2BA 1AFQC 3WWFA 3PYHA 2PW8H 2C8ZB 1XVMA 1EXFA 2BY9X 9LPRA 5EJLA 3RU4E 3HKJB 1RS0A 2BDIA 3DHKH 3FZDA 3MH6A 3SN8A 1TB6H 4RT0A 3MO3A 2H9EH 2XCNA 5J4SA 3FOAA 4YESB 3M7UA 1O2ZA 1ZSJA 1TNIA 1OWEA 5C5NA 3VB5A 4PROA 5GIBA 2PSXA 1THRH 3WW7A 1EUFA 5LGOA 3A8AA 2XOKD 1LO6A 2WPLS 5BPEA 2ESTE 4Y11E 2CN0H 1DXPA 3BEFB 3SU2A 3MWIU 1K0HA 1GL1A 3AAVA 2ZF0H 1DY8A 2ZQ2A 3F3BA 2VH6A 1DWDH 4ZMAH 5JBTA 1UVTH 4FETA 4KGAA 3VB6A 1ANDA 4YOGA 1OWJA 1TFXA 2YNBA 2BLVA 1PPHE 3UNSA 1TPSA 2C90B 1P0SH 1F0RA 1TA2A 1O5GH 1SFQB 3H09A 4B74A 5ABWA 1UTLM 1EOLA 3Q00A 4CHAB 1ZJDA 1NFUA 2A45B 9ESTA 1O3JA 1LHFH 1KDQA 3W94A 1BBRE 2GMTB 5EQRA 2ZU2A 5EJ1A 3GCHC 1WDIA 1XUFA 3BV9B 1EPTB 1Z8IB 1VJ9U 2XTTB 1GDNA 2OC7A 1G3DA 1C1RA 1KYNA 1W0JD 2FP7B 3F2HA 5FBEA 2A4RA 4NIYA 5FBIA 1XUJA 3G01A 2XBVA 5EOKA 1ZHPA 2VWMA 1QURH 3P8OA 4MNWA 3ATKA 3OY6U 2JETB 2ZGJA 1YPJH 1BITA 2ZWLH 5HGGA 3E90B 4UDWH 1TAWA 3Q77A 3GICB 3T2NA 1HJ9A 3OYPA 3F0OA 3RXDA 1EJNA 2RCEA 3SBKA 3A7YA 5F8TA 1ZMNA 3SI3H 1TGBA 1WQVH 2SGEE 4ZHLU 1AFQB 2ZP0H 4O97A 2Q6DA 4AFUA 3LGUA 5DN6D 3UREA 2HNTC 2ZHQH 2VVCA 3EAJA 3SV8A 1QHRB 1E38B 2ALPA 4QT8C 1NRNH 1AY6H 2WUCA 3B9FH 3BTGE 2AGGX 3ZZBA 2ZZUH 3FO8D 3MOCA 2BLQA 3VB4A 1SGEE 1DS2E 3EA7A 4CBOA 2B5TB 4U2WA 3PROA 4YLQH 1FMGA 2KCAA 5CHAC 2OQ5A 3QK1A 4UFEH 5JB8S 4OS2A 1TQ0B 2VNTA 4ACAA 1ZMJA 2CV3A 2J2UA 1HDTH 4FUDA 3OY5U 5L2YH 1S0RA 1GBDA 4I7YH 1MH0A 1O3KA 2KR7A 1AI8H 1TE0A 2PFEA 1V2LT 2QIQA 4Y6DA 5ETXA 1Z6JH 4VGCC 4A1XA 3UQVA 3I78A 2BOKA 2J34A 2A7HA 3D23A 1YC0A 4O9VA 1C1PA 4LK4A 1BRUP 3STIA 3SGQE 2PKSC 1UTPA 3URCA 2A4QA 4MNXA 3RXFA 1GBCA 2TPIZ 1ARBA 4XDEA 3QTOH 3ZYEA 1CT0E 2VWOA 3TIUA 2PTCE 4OS6A 2JIZD 5A0AE 2ZFFH 1N8OC 3F0PA 3PRDA 1JBUH 1WXRA 1AVGH 1MAYA 4OGYA 3LC5A 4I32A 1RTKA 2A1DB 3M7QA 3P6ZB 4YZUA 1MKXH 4H4FA 2EA3A 2OXSA 4WMEA 3KQ5A 3BTFE 1T4UH 1AFEH 2HWLB 4Z1MD 3CENA 2SFAA 2ZIQH 1K1OA 3MO9A 3UAIC 4OM9A 1B7XB 1YLDA 1Y5AT 4ABDA 3AK5A 3U8OH 4K8YA 3TGIE 2B9LA 1MBQA 3HPTB 3MU4A 3P8NA 4XBDA 4Y8YA 1DICA 2ZGXH 3ZZ8A 1NTPA 1O3OA 1A5HA 3RU4T 3RXAA 1SG8B 3RXSA 4CH8B 1ZPBA 1A46H 1O2QA 1WTHD 1AUJA 1C5XB 1P11E 2GT8A 4XBBA 4ABGA 1DLKB 1DVAH 1YPKH 2F43B 1S6FA 3PO1C 1C1UH 5HM9A 2ZCLP 1P12E 1H9LB 2KAIB 1ZHRA 1TALA 1YPLH 2FZZA 5E2PA 1ESTA 2NU0E 1UTJA 3C1KA 1TPOA 1W7GH 2VINA 3R3GB 3QLPH 2XNDD 1FPCH 1GJ7B 2Z9IA 4WH6A 1XM1A 5GXPA 2W26A 1BHXB 2W5EA 4A5TS 1H9IE 1C5QA 2F9OA 3RXEA 4INKA 3S0NA 3UR6A 1F0SA 4FUJA 2QF3A 1C1WH 4GHQA 1DDJA 3BTKE 4BNRA 2C8XB 3R0FA 5FCKA 3SNCA 1WV7H 2Z9LA 3KYGA 3WY8A 2GJGA 1A7SA 1SOTA 2UUKB 1TRNA 2ZPSA 3UR9A 1O3GA 1TGCA 1LVYA 4DOQA 1BRBE 1GGDC 3E0NB 2AMDA 2ODQA 1L1GA 2R0KA 3PV5A 1SMFE 2PV9B 2QGRA 1YPEH 3TJUA 4FXGH 5EJZA 3Q3KA 2BD2A 2WPHS 2O8LA 4MLFB 3UFAA 2Z94A 4H6TA 1V2JT 1AB9C 3NUMA 1O3BA 1ELCA 1C5NH 2J95A 2GV7A 1O32A 3K9XB 4FU9A 1Q3XA 2IOTA 2OBQA 1TNJA 3NWUA 4B2AA 4OGXA 4X8TH 1C5OH 1OYQA 1T4VH 3ZZAA 1P8VC 1HAZB 2JH5D 1IQLA 4Y0YE 1SFIA 3RC5A 1IQFA 1GI6A 1YLCA 3AW1A 3ATWA 4OS5A 2ZDNA 3BEIB 4GHTA 3BTDE 2C4FH 1UCYE 1O34A 3O8BA 5DKMA 4BAOB 1MZDA 1LMWB 2A5IA 1CE5A 2H9TH 3RXKA 1P10A 1XUIA 4X6PA 2V3OH 1VCWA 2GZ8A 4KTSA 1MTSA 1C2KA 3K6ZA 1UW7A 4UD9H 3UIRA 4E05H 3EA9A 1F5LA 3V7TA 4B75A 2HNTF 3OEED 1ELGA 5A09A 1V2MT 3MH7A 1XXFA 1FIZA 4BOHA 3ATMA 1O2RA 5DPAA 3QWCH 3E8LA 3RXVA 5C0UA 2ZDKA 1AZ8A 1JMOH 1ZRBA 2ZI2H 2BDYA 1TWXB 3SNEA 3ZVBA 4RKJB 1NROH 4JCNA 2CK3D 3IWMA 5LH8A 1U6QA 1ANCA 3ZIAD 2Y6TA 1GBHA 3P92A 1MAXA 1YF4A 3UY9A 1QBNA 2VBCA 2R2MB 5FX5A 1ZJKA 4BAHB 1EKBB 5SGAE 3K2UA 2GDEH 5EW2H 5I46H 1JIMA 1GL0E 1IQKA 3LDXH 3NPSA 1CBWC 1MTUA 1AKSA 1DFPA 4SGAE 3SU0A 5HYOA 4DGJA 3ZZ6A 2TGAA 3ZZ5A 2G55A 2ZCHP 1MTNB 1O30A 3UB0A 2FI4E 1IAUA 1QRZA 1MZAA 1QZ8A 1RJXB 2Z6BD 3DUXH 4F48B 1BTXA 2P93A 2HNTE 2PSYA 1D9IA 3ZZCA 3LGTA 1Y3VA 2YMSC 4K5ZA 3T26A 4BAMB 3P70B 1NT1A 2BTCE 1SQAA 2XYAA 1QIXB 1OPHB 3BN9A 2STAE 3LGWA 4UFGH 1P2KA 1QQ4A 1SQOA 5DK1A 3ZZ4A 5DJ7A 5DG6A 1MCVA 2LELA 3KEEA 4ABFA 4KELA 4M7GA 4CRFA 1AZZA 1EJAA 2WV9A 1GHXH 4ZAEA 3TVJB 3ZVCA 1F0UA 1W10U 4JYTA 3A80A 1NU9A 1BIOA 4AYYB 1V2KT 3Q76A 4D7GA 1QJ6B 2ZU5A 3RXGA 4FUBA 1HJAC 1HIAA 1YYY1 1SC8U 2OD3B 3MMGA 1P03A 3K6YA 3S69A 3LC3A 1HXEH 5CE1A 1IQJA 1UO6A 4NA9H 3TJVA 1V2OT 3SOSA 4ZXXH 3PRBA 4ZKNU 2ZFPH 2G52A 2KZ4A 5DP4A 2OTVA 1O2LA 2FOBA 3A7ZA 3AVZA 1Z7KA 1UVOA 3MQKC 1O39A 1AO5A 2BM2A 1O2WA 2FOCA 4M9FA 1L1NA 3SJ8A 2J4IA 2R0LA 4JK5A 7ESTE 1DT2A 5GCHF 3ZZDA 1Y3YA 4ASUD 3ZZ7A 1HRTH 3M3SA 2BOHB 3BSQA 3FZZA 1NFXA 2KAIA 4H6SB 2D2DA 1EAWA 1EB2A 3M5MA 1EZXC 1OWIA 3UNRA 3CS7A 2AIQA 4YOJA 3B23B 3HATH 1BRAA 5KEDA 2W6ID 1NZQH 3LONA 1GCTC 4DURA 2XC5A 2ZDMA 7LPRA 2H9HA 2UWPA 2Z9KA 1ETSH 1KY9A 3MU1A 3U9AH 1PPFE 1PPCE 2FOFA 3N99A 1DXWA 2AGEX 4XOJA 3DSGA 1A3EH 2ZTXA 2D1JA 4X2YA 2AERH 2Y5GA 4MPUA 2THFB 1C5VA 1ELBA 1QL8A 1SGPE 1SLUB 3GCTF 3M36A 4AGKA 4BANB 2H6MA 4CRCA 1DPOA 1NESE 4D7FA 1UVPA 1P3CA 5GCHG 5GNDA 5EPNA 2A7CA 4ZUHA 3RDZA 4CHAC 2ZA5A 2QN5T 4MPVA 2XBWA 1O3DA 1KXDA 3BTWE 1EAUA 4GCHF 3GDSA 1VCPA 1AIXH 1TPPA 4DY7B 2GMTC 2SGQE 2BQWB 5ESTE 1BOQA 1EPTC 1C2LA 3RXBA 5C5OA 1GI1A 4ABAA 4DJZB 1IQIA 2VIOA 3BIVH 3U98H 3F9HA 3SU5A 1O2GH 3UWJH 1F5KU 1WTGH 1S6HA 1DE7H 1Y3WA 2JETC 2ZFRH 1FY1A 1YGCH 4NGAH 3GCTG 2FX6A 1OYTH 5IK2D 2JJ2D 3V3MA 1GHYH 2BD4A 4AG2A 4GSOA 1E79D 1UVUH 5F8ZA 3VPKA 3ZVFA 4ASHA 2LP6A 1CSOE 8LPRA 4WH8A 2AMPA 1MMJN 3W1EA 4GCHG 1WAYB 4ABEA 4K69A 3D62A 1VITH 2QY0B 5C94A 1DM4B 4IBLH 2O8TA 4Y8XA 3RMLH 3P95A 4Y76A 1XUKA 4H42U 3F6UH 2BX4A 3MI4A 3SNDA 3MU5A 1GPZA 4XSKU 1ZZZA 1G37A 6GCHF 1N6YA 2ZDLA 4YTAA 1P2MA 1KTTB 1IQMA 3D65E 4IN1A 3LGYA 2CXVA 4IC5A 5CHBA 1C5PA 1UHBB 1X7AC 1GCTB 1LKAA 2B8OH 1YWUA 4ISIH 2TIOA 1A1RA 3PWBA 4ZKOU 3PV2A 1W0KD 1VJAU 1V2ST 1O31A 1K28D 1GBEA 2O9QA 1JRSA 1LHDH 2GKVE 3GDUA 1BUIA 1GI0A 1Y3XA 2ZEBA 1NBMD 3SNAA 1Y8TA 5KGOA 2RDLA 3SUDA 5EPYA 1GJDB 4B1TA 3RXIA 2WYJA 5E0HA 5HMAA 1P02A 4ABBA 2HLCA 1KTSB 3SUEA 4CRAA 2O8UA 3A89A 1GI4A 1UK4A 3MU0A 4Q7ZA 1GJ6A 1FN6A 4XBCA 4ZKSU 2OLGA 4CR5A 6GCHG 1E36B 2BD3A 3VB7A 3M3VA 4P00A 2ZHEH 1G2LA 1Z8GA 3QZRA 4JZFH 2FI3E 5FXLA 4K1SA 2JH0D 1YY3A 3GYMA 1DANH 1O2HA 1ZTLA 2ASUB 1XUHA 1EP5A 3GCOA 3EGKH 1AUTC 1FN8A 2H5DA 4ZHMU 4WVPE 3KYFA 1Z8JB 4DT7B 1D3PB 4AOQA 1T8LA 1TRYA 4Z6AH 2PR3A 2XC4A 4Q80A 1FI8A 1GBJA 4UEHH 1FLEE 3UTUH 2ZNKH 1ABJH 3GY5A 3H7TA 3MTYA 1TNKA 2ZU4A 4X6NA 3TK5A 5HIYA 2G51A 1RGQA 2ZGBH 1SHYA 4AGJA 1C5ZB 3K65B 4NSYA 1RD3B 4AYVB 3F2FA 1GI5A 1F5RA 5T1VA 1DWBH 4D9QA 2P95A 2F9NA 1Z1JA 3TU7H 1C1TA 1TYNA 3RMOH 3ZV8A 2BDBA 3A8CA 5L30H 2ANMH 3FFGA 4YLUA 1THPB 1GBBA 4D9RA 3KQCA 3S9CA 2V35A 5DP6A 1XUGA 2NU2E 3RXTA 1SGQE 2QXIA 5LPRA 4TY7A 3E1XB 1O5CB 1EQ9A 2ILNA 1C4V2 1O3PB 2DE8A 2VWLA 1EAXA 2YNAA 1HNEE 2Z9JA 1Q2WA 3A81A 3A84A 1C1SA 1YCPM 2VU8E 2EI7A 1HAXB 1HYLA 1OSSA 1THSH 3SV7A 4X6OA 1J16A 4O03A 1W0ZU 1ZMLA 2F9UA 1C2MA 3EE7A 5C1YA 3RMNH 2Z7FE 3SJIA 4A7IB 5DP8A 2WV5A 2GVFA 2Y5FA 1MQ6A 1ELVA 1CU1A 4ABJA 1FZZA 3KIDU 2QYIA 1ABIH 1IQHA 1Z1IA 2FLBH 2BZ6H 1MKXK 2G81E 1O3AA 3S9BA 4TT3D 1XVOA 2HLDD 3MNSA 4RN6A 1O3HA 2BQ7B 2FO9A 3MHWU 5TJXA 2FOAA 3GY3A 2PGBB 1C2EA 1S83A 1OXGA 1UJ1A 3E6PH 2QAAA 5JBBS 1G9IE 3JZ1B 5FAHA 1D3QB 1S5SA 4ZKRU 3PMHB 3HKIB 2BLWA 1EOJA 5A8YA 3T25A 5JYIA 4I8KA 3LIWA 1SQRA 4JZEH 2J97A 4NWLA 3VXFH 1QBVH 3A7TA 2ZU1A 2BVSH 3LT3A 1O0DH 1HAOH 1MD7A 1L2EA 1O2MA 3GY8A 1CGIE 2GCHG 4ZHAA 1P01A 2BVXH 3N7EA 2EEKA 2HRVA 3LH3A 1EB1H 2KCYA 3A7WA 3BG8A 2OQUA 4FU8A 2FLRH 3UOPA 1OS8A 5GDSH 3ZVDA 1SGFG 2FI5E 5F03A 3SQEE 2FEQH 3TNSA 1NBME 2WYGA 1GVZA 2A4OA 1PYTC 2VIPA 5DO4H 4X1QU 1BTZA 1V2PT 1ZSLA 1E37B 3SQHE 4JYUH 2G4TA 1QA0A 1UTOA 1CT4E 2ANWA 3OU0A 1AU8A 3F9FA 4LOYH 3SI4H 2WSSD 3H5CB 3P8GA 1H8ED 2R2WU 1HAPH 1IQGA 1AMHA 4AB8A 2FIRH 3E3TA 3SUFA 2RDEA 3URDA 1EAIA 3QDZB 3SNBA 1BMFD 2ZFQH 1GHAG 1AWHB 4FVBA 5AHGH 4KP0A 1AVWA 1NO9H 3TH4H 1NFWA 1PPEE 3TK6A 3FP6E 3MU8A 2OK5A 4NWKA 1QTFA 2GV6A 2P8OB 2FMJA 3T27A 4GVUA 4INLA 5BRRE 2V6NA 3AASA 2P59A 5K0HA 2NWNA 2W6JD 1H1BA 1W11U 5CDFE 1XXDA 2FYRA 2VIWA 3V12A 2A32A 1UTQA 2BDHA 3M5NA 3KNXA 2UUJB 4YO9A 3ESTA 4O3UA 2HPPH 1D4PB 2IJOB 3QO6A 3QUMP 1O5AB 1MTVA 2Y7XA 1C5SA 5E0JA 1O2NA 1SGFA 1WOFA 3U8TH 3RLWH 2FS9A 1TOMH 1PQ7A 3DSPA 1FIWA 2KCPA 1ZGVA 2ZKSA 4K8BA 4Y7AA 3TK9A 3ODDA 4F49A 8KME2 1NS3A 1VCQA 2OUAA 2J92A 1BDAA 2ANKH 2OBOA 4I86A 3MNXA 1AWFH 1P57B 2XCFA 4RSPA 1BBRH 2A5AA 5T6DA 1BMMH 1UHBA 3SU6A 1HLTH 2Y80A 1CHGA 3DD2H 1C5RA 1DOJA 1O2OA 1ELDE 2Z3CA 1QB9A 3I77A 2WPJS 4YT6H 1HGTH 2WUBA 2WPKS 1IQNA 1YM0A 1SLXB 1JWTA 1MTNC 4Y8ZA 2BDAA 1BRCE 4KTCA 2ULLA 1MU8B 3BG4B 1O2UA 1ANBA 2L74A 1W2KH 1FY3A 4CR9A 2STBE 2UWOA 3VXEH 5EW1H 1KLJH 3LH1A 3A7VA 4TPYA 2LNCA 3RXPA 1AD8H 4UE7H 4HZHA 5L2ZH 2VIVA 2UWLA 4I8LA 1SR5C 1EPTA 1AHTH 1HV7A 1NN6A 1C4Y2 2FOEA 1H8HD 1V2TT 4X6MA 1W12U 2C93B 1GDQA 2SNVA 1HB0B 1MU6B 1EZQA 1HAVB 2ALVA 3MFJA 4X8UH 3N7DA 4WMFA 4E7RG 1D6WA 3PB1E 1LVBA 5EQQA 4JK6A 1TBZH 2SGFE 3GCNA 2BVRH 4ISOA 1PQ5A 2O8MA 4U01A 2FTLE 1QJ1B 3P8FA 1T31A 1TGTA 3OX7U 5FPTA 3SO3A 1Z6EA 2ZGHA 1GMCF 3FAOA 1SLVB 3DT0H 1QCPA 3ODFA 1K1IA 4IC6A 1HAHH 3C27B 1T32A 1W14U 2A2QH 1D6RA 2UUYA 1DX5M 3EYDA 1P05A 1K22H 1LPZB 2FPZA 4FUEA 2ZHDA 5EGMA 2F9PA 1BCUH 1S6LA 3LGVA 3OFND 1C1MA 1SKYE 2DUCA 1C2JA 2SGDE 2ZTYA 4THNH 2VVVA 3MH4A 1OKXA 4Y7BA 4CH2B 5GPIB 2GT7A 3BTTE 1O3MA 1LDTT 2GZ7A 4ISLA 4GLYA 1GI2A 2BXTH 2PLXA 3SZEA 1PJPA 1QNJA 1AQ7A 1GMCG 2NU4E 3PLPA 4ZH8A 4Q4LA 1GMDF 3EA8A 1GBFA 2EI6A 3KL6A 1BHXF 4O3TA 2WHXA 2ZDAH 2M5TA 2CF9H 4MPWA 1KDQB 1DY9A 3BTHE 3N7OA 1BMLA 2F4LA 2M2AA 5HXFA 1ZSKA 3CP7A 4NG9H 1S85A 1E34B 2VB0A 1O2JA 3HGNA 3TGKE 3QGJA 3F9GA 4U30A 1CQQA 2XBXA 3ZVGA 1ZLRA 2F83A 2AGIX 1LHCH 2AFQB 4OS4A 4FUFA 1ZGIA 1C5YB 3BTME 1YPMH 4MPXA 1P04A 2AYWA 1O3NA 1V3XA 2ZECA 1CVWH 1ELAA 2H1UA 2C8YB 3IG6B 3CNRA 4X0WU 1DLEA 2TGDA 4FUGA 3KN2A 1GMDG 2BQ6B 1NRRH 1O5DH 4RKOB 1W8BH 4Q7XA 1O35A 4AZ2B 4CBNA 1C1OA 8GCHG 1O2TA 2VIDA 4FVDA 1S81A 3D49H 4JZDH 5B6LA 2CMYA 2ZFTA 1G32B 1QB6A 1ELEE 1H9HE 2Y81A 4INHA 4BTIB 4AORA 2WPMS 2GDDA 1SGIB 2SGAA 1K1JA 1TABE 2AHME 3MH5A 5G4BA 2PHBA 1CT2E 1MD8A 1AVXA 4NSVA 2QF0A 3PTNA 1ID5H 4BXSA 4DIHH 2G5VA 4BAKB 1RFNA 2Q6FA 1E1QD 2ZO3H 1ORFA 1J14A 1NC6A 3VGCC 2GZ9A 2PGQB 1EFRD 2D8WA 2FXRA 1DITH 1N1LA 1CHOG 2J38A 3MO6A 1OP8A 2CGAA 5KECA 1GJAB 2A0QB 4MNYA 1GCDA 1FV9A 6ESTA 2HVYB 1K9OE 3EQ0H 4BAQB 1A5GH 1C5UA 1UCYK 1BTUA 4MNVA 3NKKA 1ZTJA 1P3EA 1WBGB 1BJVA 2Y82A 3OSYA 1EASA 4AB9A 1W0YH 2FOGA 4HTCH 3T62A 4YM9A 1INCA 1SB1H 1H8DH 4I8GA 1C2GA 2FS8A 2BD5A 2BY6X 2ZHWH 1A2CH 1E35B 7GCHG 2KCOA 1SSXA 4X8SH 1O2SA 3ITIA 1C9TA 1LVOA 1A4WH 1IOEA 1OP2A 1LVMA 3DCLA 2A2XH 3A88A 3U69H 3NZIA 5AFZH 2ZFSA 4ZXYH 1XMNB 3HK3B 1C2HA 4FUIA 3RXHA 1YPGH 3KQBA 2FOHA 4AFSA 2PP6A 1HFDA 2V3HH 1V2VT 3RXMA 4NFFA 1UCYH 1SGDE 1AN1E 2FX4A 4MDSA 2QXJA 5EIYA 2QA9E 1GI8B 5DP7A 3SV2H 2AH4X 2YMSD 4WJG2 1W3CA 5EG4A 1KSNA 2XNIA 1JIRA 1OWKA 1TX7A 2HGTH 1Q31A 3MNCA 2R3UA 1S82A 4B2CA 3ZYDA 6CHAC 4HGCA 3ZVAA 1KXEA 1GJ9B 4X2WA 3GOVB 1HBTH 1BQYA 2BXUH 4TWYA 2F91A 4GUXA 4LZ4B 1AGJA 2EC9H 4JYVH 2A31A 2XXLA 2ZGCA 1EATA 2RG3A 1NRSH 3PTBA 1C9PA 1AE5A 4DVAU 3PMAB 5I25A 2QF4A 1L1JA 1QR3E 2P3FH 3M5OA 3S7HB 5PTPA 2QCYA 1EP6A 1MABB 2BD9A 1HAVA 3TLOA 3VGCB 1IQEA 1O38A 1LCYA 1KXBA 1ZYOA 3SZNA 1NRPH 2FTMA 3AAUA 2WPDD 1TBRH 1CO7E 1DUAA 5HM2A 2OC1A 1DUEA 2QE7D 2IPQX 1OOKB 2LPRA 4I8JA 1GI9B 3SHCH 5K7RA 1NFYA 3F9EA 1O5FH 4IMQA 3IITA 4XFQA 3VFEA 1TQ7B 1QQUA 2WZQA 2ZU3A 1RTFB 1XKAC 1O3CA 5E0GA 2FDAA 3E16B 2CHAC 3A7XA 3SUGA 4GAWA 1MKWH 4KKDA 5TCAA 4B6FA 2AIPA 1C5WB 4DT4A 1GDUA 1TRMA 3ATLA 1L4ZA 3KF2A 4TY6A 3RC6A 4B6EA 4F55A 1GMHG 1P2JA 4D8NA 4DG4A 4IMZA 2PTNA 1O3LA 2D26C 2I6SA 3ZVEA 3SU3A 4AFQA 4FOUC 1G36A 1EZSC 5C1XA 1WU1A 3M37A 2FYQA 4X1RU 3SV9A 4X1NU 2CJIA 4OS1A 1UTNA 7KMEH 1G2MA 5IDKA 2J9NA 3PM3A 3QZQA 2EQNA 4IN2A 4NFEA 4Q2KA 3S7KB 3U28C 4WWYA 4XE4A 1J15A 1F0TA 2G8TA 4CREA 2VIQA 4X2VA 1COWD 3KCGH 2W7UA 1GBMA 2GCTC 5H4IB 2O8WA 1VGCB 1B0FA 5B6OA 1C1VH 2ZDVH 4DCDA 2XW9A 2JH6D 4R8TB 3M3TA 3V13A 3SU1A 1GJ5H 1TBQH 3F1SB 3TITA 1RIWC 1CGHA 6CHAB 1ANEA 2PWXA 2TGPZ 1BT7A 1V2QT 2FM2A 3B8JA 4JMYA 1FUJA 2JJ1D 1SGRE 2UUFB 4XD7D 2QXHA 1TLDA 5EQSA 3A83A 2BLOA 5JBAS 1OHHD 3KHVA 4AG1A 4ABHA 2SNWA 5TCCA 4ESTE 1QB1A 5A0CA 3E91A 2TGTA 5AVDA 2BY7X 3LGIA 1FY4A 2HOBA 1P2NA 4CRDA 1ESAA 3GYLB 3O8DA 1O3EA 4D76A 4SGBE 1QY6A 4CRGA 2CF8H 5F6MA 2R9PA 5EXMA 2J98B 4DW2U 1L4DA 1O2XA 1V6DA 1YKTA 3UWIA 3RXLA 3Q3YA 1FJSA 1F7ZA 3GY4A 3GS9A 2P8OC 2PKAB 4HFPB 2JKHA 1GJCB 4FUHA 4F4OC 2CHAB 4J2YB 4E06H 1HCGA 3QTVH 3RC4A 2W3KA 1TMBH 2GCHF 2BHGA 1V2WT 1G30B 2VWNA 3U1JB 4JZIA 4TYDA 5EODA 1P09A 1TGSZ 4TPIZ 3OTPA 3H7OA 1RTLA 3UNQA 2P3UB 4B76A 5A2MH 4OS7A 2BY8X 2G5NA 3SV6A 1SGCA 1UTMA 5C67A 3LU9B 1SVPA 1LPGB 1BTPA 1GVLA 1QRWA 4DIIH 2J94A 5C0TA 1YCPK 3P17H 1ZR0A 2L6OA 1AKSB 4MTBA 4Q7YA 3SYJA 1ETRH 2KX4A 3UUZA 1GI7B 5E8EH 2ZPRA 3A85A 3SORA 2B0FA 3FP8E 3L33A 3T5FH 1KLIH 2RFKC 3NK8A 1D3TB 1PPZA 3RUOA 3SW2B 5EU8A 2GCTB 1O2PA 3T29A 3CS0A 1GHAF 1QFKH 2RA0A 3GY2A 1BJUA 2C8WB 5FX6A 1GG6C 1JRTA 4X1PU 3OEHD 3GCHB 1WUNH 1RIWB 2BD7A 3UPEA 1DSTA 1TMTH 3GY7A 3SJOA 2J5UA 1QL9A 2TBSA 2ZCKP 3BG4C 1GHZA 1YCPH 4LZ1H 2ZHFH 1SHHB 1H8IH 1O2IA 2A5KA 1CA0C 1D3DB 5DP5A 4BTUB 3L6PA 3UQOA 3OTJE 1Y59T 4X2XA 1P06A 2ODYB 5E2OA 3A8BA 4B73A 1FX0B 4A6LA 2VH0A 1Z8RA 1C2DA 1NU7B 4R0IA 4Y79A 1BB0B 1SBWA 2XWBI 1HIAB 3FN8A 2QF5A 2R3YA 2BB4A 3RXRA 3TJNA 2PUQH 3ELAH 5DP3A 1L0ZA 1UK2A 2IPHA 2OP9A 1P2IA 1ZPZA 5FPYA 5A8XA 1RXPA 3LPRA 1HJ8A 1NM6A 3TPIZ 1HAYB 1J8AA 1V2NT 1BBRK 4ABIA 1EZUC 3M61U 1G3EA 3EE0B 1S0QA 1B5GH 4ISHH 1F92A 1XX9A 3PMJA 2I6QA 4WXIA 3RP2A 3NRLA 2F9VA 5GJ4B 3STJA 1GBAA 3V0XA 3VG8A 1YPHC 5DP9A 5CHAB 2V0BA 1FY5A 4FU7A 1ZRKA 3SHAH 1SOZA 3JZ2B 2ZPQA 4RI0A 4HI3A 1WYKA 4NZLA 1QL7A 1TPAE 2EI8A 3PLBA 2RA3A 1G3BA 3PMBB 2GX4A 4A1VA 4VGCB 3A86A 3BF6H 3F68H 4X8VH 4Z0KA 3SU4A 1YLNA 2BDGA 2BD8A 3BTQE 2H2ZA 3M5LA 1M9UA 2W7SA 5AF9H 1FXYA 1KXFA 1PPGE 2QXGA 3E0PB 1TA6A 4NCYA 1PFXC 1O2YA 3TH2H 2PKSB 4KTUA 3HK6B 4P02A 1GG6B 3FVFB 1A3BH 1FNIA 3A8DA 1PPBH 1EX3A 4UONA 2Q1JA 1ESBA 1T8OA 4NIXA 4AC9A 2IN2A 3DFJA 1P9SA 3DSOA 1K1LA 1MCTA 1N8OB 1XKBC 1GVKB 4NA8A 2DE9A 3S9AA 2XBYA 1J9CH 1C2IA 1A0JA 1CA0B 1DWCH 2G00A 3RMMH 1RRKA 2P16A 1OP0A 1VKYA 2QV1A 1BMAA 2VVUA 4UFFH 1O2KA 1MTWA 4AX9H 1GJBB 1ZOMA 1LHEH 1SGTA 3PLKA 1MUEB 1GBTA 1WQSA 1BTWA 4I8HA 1LKBA 1TOCB 5C1UA 1O3FA 4I33A 5C20A 1VITF 1E0FD 2HPQH 1C1QA 3QGNB 5AFYH 1WCZA 2WV4A 3RXUA 1IHTH 1Y5BT 1Z71A 3U1IB 1PYTD 1E1RD 3SGAE 3T28A 5F53A 1GBKA 1O5BB 1BMNH 2IJD1 4GPGA 3FKSD 1Y5UT 4K1EA 2A7JA 3SGBE 1SLWB 2W3IA 1SGYE 2XWAA 2BYAX 3PO1B 3TNTA 1P2QA 1FDPA 3NCLA 4NIWA 3VB3A 1C5TA 2G4UA 1GJ4H 1K1MA 2HVXA 1SQTA 1F2SE 1FONA 1UMAH 4IW4E 3LKWA 3QX5H 3MNBA 2AS9A 2H5CA 1T7CA 3O8CA 2NU3E 1G3CA 3GISB 3RXCA 5HKKD 4CRBA 1VITG 2FODA 5L6NH 3DA9B 2J98A 3Q3XA 3DFLA 2Z9GA 1VR1H 5C17A 4MG3A 4WF8A 2PKAA 1O36A 1UVSH 1TMUH 3ZV9A 5A0BA 1KLTA 5CMXH 1HXFH 4A92A 4X1SU 3LJJA 4YT7H 1K1PA 2B7DH 1KIGH 4YOIA 4FUCA 1GGDB 1OWHA 3PV4A 2KFWA 2GD4B 2OC0A 4NZQA 8GCHF 1HPGA 3L3TA 1KXCA 2JDID 3SJ9A 4WMDA 2SGPE 1C1NA 4K60A 1JXPA 1LQEA 2FESH 2F9BH 1C5MD 3M7TA 1HUTH 2OCVB 1AB9B 2AEIH 2VGCC 1TONA 1K21H 3ZZ9A 1CGJE 5F8XA 3TGJE 5JB9S 3GY6A 1LTOA 2V3MA 1AE8H 2VJ1A 4TWWA 1H4WA 1O37A 1V2RT 1C5LH 3QN7A 3RXJA 3ATIA 3O8RA 1QJ7B 4MQAA 3FANA 3AW0A 2WPIS 2PUXB 1ZPCA 1YP9A 4IGDA 2Y7ZA 4WXVA 3OAAD 4UFDH 3BTEE 3RU4D 5HIZA 1CHOF 3HGPA 1SGNE 1C4U2 3W95A 4BXWA 1QBOA 1GBIA 4XRNA 2ZTZA
chains in the Genus database with same CATH topology
2ZC9H 1P9UA 2OC8A 3RM0H 3NXPA 3KQEA 4B71A 1O3IA 1A61H 1N6XA 2K1QA 1O33A 4K2YA 1PQ8A 1BA8B 1GHVH 3A82A 5T6FA 2GP9B 5JDUB 3RXQA 1ELTA 1T8MA 8ESTE 4K1TA 1MBMA 3RXOA 2P3TB 4NA7A 2ZQ1A 4NIVA 1O5EH 5ESBA 5FPSA 1V2UT 1BZXE 3SJKA 7GCHF 1FAXA 1MQ5A 2XRCA 2FWWA 3KGPA 2Q6GA 5IYTA 5LPEA 1SI5H 4E7NA 1P2OA 3PWCA 1PQAA 1QA7A 3KQDA 3U8RH 1A0LA 1TGNA 1FPHH 1A5IA 3FP7E 1ELFA 5LPFA 2ODPA 2Z3DA 2ZG0H 5GWZA 1OX1A 3LOXA 1HAGE 4BTTB 2Y5HA 1Y3UA 5JBCS 3RLYH 1ZHMA 1NY22 5FCRA 5EXNA 1IHSH 4K3JA 1HAIH 2BMGB 2GGVB 1SL3A 4I31A 4JZ1A 2BZAA 4IS5A 1CBWB 1LQDB 1A0HB 1QRXA 1GJ8B 1TNLA 1GHWH 1WSSH 1EJMA 2A4GA 5C3NA 1UTKA 5FHTA 4J1YA 3RM2H 1QGFA 1C2FA 1DWEH 2F3CE 1LHGH 2Z3EA 1SPJA 3BIUH 1YBWA 2VGCB 3VEQB 2ANYA 5C2ZA 1O2VA 4AFZA 2P94A 4A1TA 2OINA 1J17T 2NU1E 3EDXB 1TIOA 3ZZ3A 4LXBH 4Y10E 4MVNA 1NRQH 1KXAA 3GDVA 1DSUA 3LJOA 4ZROA 4AN7A 4Y0ZE 5DGJA 5T6GA 3UOUA 5J4QA 1ARCA 1GI3A 1B0EA 1GWAA 1GBLA 5A8ZA 1TNHA 4Y71A 2TRMA 1ETTH 1CA8B 1GHBF 1VGCC 2BDCA 1LPKB 3TJOA 1YPHE 4WY3A 1OWDA 1UK3A 2WINI 3A87A 1ZTKA 2C3SA 1K2I1 1FY8E 1JOUB 1NPMA 5EXLA 1TX8A 3I29A 2YOLA 6LPRA 2XC0A 4U32A 5T3HA 1W7XH 2HALA 1W13U 1HJAB 1MKWK 2BX3A 2GTBA 2FOMB 3ENSB 1TX6A 1GMHF 1K1NA 1TNGA 3MYWA 2BY5X 3M35A 1S84A 1T8NA 2AMQA 3TH3H 1BTHH 4ISNA 1FAKH 1BTYA 1FQ3A 5JPMH 1ACBE 1GHBG 2QC2A 3BEUA 1VZQH 4B2BA 1AFQC 3PYHA 2PW8H 2C8ZB 1XVMA 1EXFA 2BY9X 9LPRA 3RU4E 3HKJB 1RS0A 2BDIA 3DHKH 3FZDA 3MH6A 3SN8A 1TB6H 3MO3A 2H9EH 2XCNA 5J4SA 4YESB 3M7UA 1O2ZA 1ZSJA 1TNIA 1OWEA 5C5NA 3VB5A 4PROA 5GIBA 2PSXA 1THRH 5LGOA 1EUFA 3A8AA 1LO6A 2WPLS 5BPEA 2ESTE 4Y11E 2CN0H 1DXPA 3BEFB 3SU2A 3MWIU 1GL1A 3AAVA 2ZF0H 1DY8A 2ZQ2A 2VH6A 1DWDH 4ZMAH 5JBTA 1UVTH 4KGAA 3VB6A 1ANDA 4YOGA 1OWJA 1TFXA 2YNBA 2BLVA 1PPHE 3UNSA 1TPSA 2C90B 1P0SH 1F0RA 1TA2A 1O5GH 1SFQB 5ABWA 4B74A 1UTLM 1EOLA 3Q00A 4CHAB 1ZJDA 1NFUA 2A45B 9ESTA 1O3JA 1LHFH 1KDQA 3W94A 1BBRE 2GMTB 5EQRA 2ZU2A 3GCHC 1XUFA 3BV9B 1EPTB 1Z8IB 1VJ9U 2XTTB 1GDNA 2OC7A 1G3DA 1C1RA 1KYNA 2FP7B 5FBEA 2A4RA 4NIYA 5FBIA 1XUJA 3G01A 2XBVA 5EOKA 1ZHPA 2VWMA 1QURH 3P8OA 4MNWA 3ATKA 3OY6U 2JETB 2ZGJA 1YPJH 1BITA 2ZWLH 5HGGA 3E90B 4UDWH 1TAWA 3Q77A 3GICB 3T2NA 1HJ9A 3OYPA 3RXDA 1EJNA 2RCEA 3SBKA 3A7YA 5F8TA 1ZMNA 3SI3H 1TGBA 1WQVH 2SGEE 4ZHLU 1AFQB 2ZP0H 4O97A 2Q6DA 4AFUA 3LGUA 3UREA 2HNTC 2ZHQH 2VVCA 3EAJA 3SV8A 1QHRB 1E38B 2ALPA 4QT8C 1NRNH 1AY6H 2WUCA 3B9FH 3BTGE 2AGGX 3ZZBA 2ZZUH 3MOCA 2BLQA 3VB4A 1SGEE 1DS2E 3EA7A 4CBOA 2B5TB 4U2WA 3PROA 4YLQH 1FMGA 5CHAC 2OQ5A 3QK1A 4UFEH 5JB8S 4OS2A 1TQ0B 2VNTA 1ZMJA 2CV3A 2J2UA 1HDTH 4FUDA 3OY5U 5L2YH 1S0RA 1GBDA 4I7YH 1MH0A 1O3KA 1AI8H 1TE0A 2PFEA 1V2LT 2QIQA 4Y6DA 5ETXA 1Z6JH 4VGCC 4A1XA 3UQVA 3I78A 2BOKA 2J34A 2A7HA 3D23A 1YC0A 4O9VA 1C1PA 4LK4A 1BRUP 3STIA 3SGQE 2PKSC 1UTPA 3URCA 2A4QA 4MNXA 3RXFA 1GBCA 2TPIZ 1ARBA 4XDEA 3QTOH 3ZYEA 1CT0E 2VWOA 3TIUA 2PTCE 4OS6A 5A0AE 2ZFFH 1N8OC 1JBUH 1AVGH 1MAYA 4OGYA 3LC5A 4I32A 1RTKA 2A1DB 3M7QA 3P6ZB 4YZUA 1MKXH 4H4FA 2EA3A 2OXSA 4WMEA 3BTFE 1T4UH 1AFEH 2HWLB 3CENA 2SFAA 2ZIQH 1K1OA 3MO9A 1B7XB 1YLDA 1Y5AT 4ABDA 3U8OH 4K8YA 3TGIE 2B9LA 1MBQA 3HPTB 3MU4A 3P8NA 4XBDA 4Y8YA 1DICA 2ZGXH 3ZZ8A 1NTPA 1O3OA 1A5HA 3RU4T 3RXAA 1SG8B 3RXSA 4CH8B 1ZPBA 1A46H 1O2QA 1WTHD 1AUJA 1C5XB 1P11E 2GT8A 4XBBA 4ABGA 1DLKB 1DVAH 1YPKH 1S6FA 3PO1C 1C1UH 5HM9A 2ZCLP 1P12E 1H9LB 2KAIB 1ZHRA 1TALA 1YPLH 2FZZA 5E2PA 1ESTA 2NU0E 1UTJA 3C1KA 1TPOA 1W7GH 2VINA 3R3GB 3QLPH 1FPCH 1GJ7B 2Z9IA 4WH6A 1XM1A 5GXPA 2W26A 1BHXB 2W5EA 4A5TS 1H9IE 1C5QA 2F9OA 3RXEA 4INKA 3S0NA 3UR6A 1F0SA 4FUJA 2QF3A 1C1WH 4GHQA 1DDJA 3BTKE 4BNRA 2C8XB 3R0FA 5FCKA 3SNCA 1WV7H 2Z9LA 3WY8A 1A7SA 1SOTA 2UUKB 1TRNA 2ZPSA 3UR9A 1O3GA 1TGCA 1LVYA 4DOQA 1BRBE 1GGDC 3E0NB 2AMDA 2ODQA 1L1GA 2R0KA 1SMFE 2PV9B 2QGRA 1YPEH 3TJUA 4FXGH 3Q3KA 2BD2A 2WPHS 2O8LA 4MLFB 3UFAA 2Z94A 4H6TA 1V2JT 1AB9C 3NUMA 1O3BA 1ELCA 1C5NH 2J95A 2GV7A 1O32A 3K9XB 4FU9A 1Q3XA 2IOTA 2OBQA 1TNJA 3NWUA 4B2AA 4OGXA 4X8TH 1C5OH 1OYQA 1T4VH 3ZZAA 1P8VC 1HAZB 2JH5D 1IQLA 4Y0YE 1SFIA 3RC5A 1IQFA 1GI6A 1YLCA 3AW1A 3ATWA 4OS5A 2ZDNA 3BEIB 4GHTA 3BTDE 2C4FH 1UCYE 1O34A 3O8BA 5DKMA 4BAOB 1MZDA 1LMWB 2A5IA 1CE5A 2H9TH 3RXKA 1P10A 1XUIA 4X6PA 2V3OH 1VCWA 2GZ8A 4KTSA 1MTSA 1C2KA 3K6ZA 4UD9H 3UIRA 4E05H 3EA9A 1F5LA 3V7TA 4B75A 2HNTF 1ELGA 5A09A 1V2MT 3MH7A 1XXFA 1FIZA 4BOHA 3ATMA 1O2RA 5DPAA 3QWCH 3E8LA 3RXVA 2ZDKA 1AZ8A 1JMOH 1ZRBA 2ZI2H 2BDYA 1TWXB 3SNEA 3ZVBA 4RKJB 1NROH 4JCNA 3IWMA 5LH8A 1U6QA 1ANCA 2Y6TA 1GBHA 3P92A 1MAXA 1YF4A 3UY9A 1QBNA 2R2MB 5FX5A 1ZJKA 4BAHB 1EKBB 5SGAE 3K2UA 2GDEH 5EW2H 5I46H 1JIMA 1GL0E 1IQKA 3LDXH 3NPSA 1CBWC 1MTUA 1AKSA 1DFPA 4SGAE 3SU0A 5HYOA 4DGJA 3ZZ6A 2TGAA 3ZZ5A 2G55A 2ZCHP 1MTNB 1O30A 1IAUA 1QRZA 1RJXB 1MZAA 2FI4E 2Z6BD 3DUXH 1BTXA 2P93A 2HNTE 2PSYA 1D9IA 3ZZCA 3LGTA 1Y3VA 4K5ZA 3T26A 4BAMB 3P70B 1NT1A 2BTCE 1SQAA 2XYAA 1QIXB 1OPHB 3BN9A 2STAE 3LGWA 4UFGH 1P2KA 1QQ4A 1SQOA 5DK1A 3ZZ4A 5DJ7A 5DG6A 1MCVA 3KEEA 4ABFA 4KELA 4M7GA 4CRFA 1AZZA 1EJAA 1GHXH 4ZAEA 3TVJB 3ZVCA 1F0UA 1W10U 4JYTA 3A80A 1NU9A 1BIOA 4AYYB 1V2KT 3Q76A 4D7GA 1QJ6B 2ZU5A 3RXGA 4FUBA 1HJAC 1HIAA 1YYY1 1SC8U 2OD3B 3MMGA 1P03A 3K6YA 3S69A 3LC3A 1HXEH 5CE1A 1IQJA 1UO6A 4NA9H 3TJVA 1V2OT 3SOSA 4ZXXH 4ZKNU 2ZFPH 2G52A 5DP4A 2OTVA 1O2LA 2FOBA 3A7ZA 3AVZA 1Z7KA 1UVOA 1O39A 1AO5A 2BM2A 1O2WA 2FOCA 1L1NA 3SJ8A 2J4IA 2R0LA 4JK5A 7ESTE 1DT2A 5GCHF 3ZZDA 1Y3YA 3ZZ7A 1HRTH 3M3SA 2BOHB 3BSQA 3FZZA 1NFXA 2KAIA 4H6SB 2D2DA 1EAWA 1EB2A 3M5MA 1EZXC 1OWIA 3UNRA 3CS7A 2AIQA 4YOJA 3B23B 3HATH 1BRAA 1NZQH 3LONA 1GCTC 4DURA 2XC5A 2ZDMA 7LPRA 2H9HA 2UWPA 2Z9KA 1ETSH 1KY9A 3MU1A 3U9AH 1PPFE 1PPCE 2FOFA 1DXWA 2AGEX 4XOJA 1A3EH 2ZTXA 2D1JA 4X2YA 2AERH 2Y5GA 4MPUA 2THFB 1C5VA 1ELBA 1QL8A 1SGPE 1SLUB 3GCTF 3M36A 4AGKA 4BANB 2H6MA 4CRCA 1DPOA 1NESE 4D7FA 1UVPA 1P3CA 5GCHG 5EPNA 2A7CA 4ZUHA 3RDZA 4CHAC 2ZA5A 2QN5T 4MPVA 2XBWA 1O3DA 1KXDA 3BTWE 1EAUA 4GCHF 3GDSA 1VCPA 1AIXH 1TPPA 4DY7B 2GMTC 2SGQE 2BQWB 5ESTE 1BOQA 1EPTC 1C2LA 3RXBA 5C5OA 1GI1A 4ABAA 4DJZB 1IQIA 2VIOA 3BIVH 3U98H 3F9HA 3SU5A 1O2GH 1F5KU 1WTGH 1S6HA 1DE7H 1Y3WA 2JETC 2ZFRH 1FY1A 1YGCH 4NGAH 3GCTG 2FX6A 1OYTH 3V3MA 1GHYH 2BD4A 4AG2A 4GSOA 1UVUH 5F8ZA 3VPKA 3ZVFA 4ASHA 1CSOE 8LPRA 4WH8A 2AMPA 1MMJN 4GCHG 1WAYB 4ABEA 4K69A 3D62A 1VITH 2QY0B 1DM4B 4IBLH 2O8TA 4Y8XA 3RMLH 3P95A 4Y76A 1XUKA 4H42U 3F6UH 2BX4A 3MI4A 3SNDA 3MU5A 1GPZA 4XSKU 1ZZZA 1G37A 6GCHF 1N6YA 2ZDLA 4YTAA 1P2MA 1KTTB 1IQMA 3D65E 4IN1A 3LGYA 2CXVA 4IC5A 1C5PA 1UHBB 1X7AC 1GCTB 1LKAA 2B8OH 4ISIH 2TIOA 1A1RA 3PWBA 4ZKOU 1VJAU 1V2ST 1O31A 1K28D 1GBEA 2O9QA 1JRSA 1LHDH 2GKVE 3GDUA 1BUIA 1GI0A 1Y3XA 2ZEBA 3SNAA 1Y8TA 2RDLA 3SUDA 5EPYA 1GJDB 4B1TA 3RXIA 2WYJA 5E0HA 5HMAA 1P02A 4ABBA 2HLCA 1KTSB 3SUEA 4CRAA 2O8UA 3A89A 1GI4A 1UK4A 3MU0A 4Q7ZA 1GJ6A 1FN6A 4XBCA 4ZKSU 2OLGA 4CR5A 6GCHG 1E36B 2BD3A 3VB7A 3M3VA 2ZHEH 1G2LA 1Z8GA 3QZRA 4JZFH 2FI3E 5FXLA 4K1SA 2JH0D 3GYMA 1DANH 1O2HA 1ZTLA 2ASUB 1XUHA 1EP5A 3GCOA 3EGKH 1AUTC 1FN8A 2H5DA 4ZHMU 4WVPE 1Z8JB 4DT7B 1D3PB 4AOQA 1T8LA 1TRYA 4Z6AH 2PR3A 2XC4A 4Q80A 1FI8A 1GBJA 4UEHH 1FLEE 3UTUH 2ZNKH 1ABJH 3GY5A 3H7TA 3MTYA 1TNKA 2ZU4A 4X6NA 3TK5A 2G51A 1RGQA 2ZGBH 1SHYA 4AGJA 1C5ZB 3K65B 4NSYA 1RD3B 4AYVB 1GI5A 1F5RA 1DWBH 4D9QA 2P95A 2F9NA 1Z1JA 3TU7H 1C1TA 1TYNA 3RMOH 3ZV8A 2BDBA 3A8CA 5L30H 2ANMH 3FFGA 4YLUA 1THPB 1GBBA 4D9RA 3KQCA 3S9CA 2V35A 5DP6A 1XUGA 2NU2E 3RXTA 1SGQE 2QXIA 5LPRA 4TY7A 3E1XB 1O5CB 1EQ9A 2ILNA 1C4V2 1O3PB 2DE8A 2VWLA 1EAXA 2YNAA 1HNEE 2Z9JA 1Q2WA 3A81A 3A84A 1C1SA 1YCPM 2VU8E 2EI7A 1HAXB 1HYLA 1OSSA 1THSH 3SV7A 4X6OA 1J16A 4O03A 1W0ZU 1ZMLA 2F9UA 1C2MA 5C1YA 3RMNH 2Z7FE 3SJIA 4A7IB 5DP8A 2WV5A 2GVFA 2Y5FA 1MQ6A 1ELVA 1CU1A 4ABJA 1FZZA 3KIDU 2QYIA 1ABIH 1IQHA 1Z1IA 2FLBH 2BZ6H 1MKXK 2G81E 1O3AA 3S9BA 1XVOA 3MNSA 4RN6A 1O3HA 2BQ7B 2FO9A 3MHWU 5TJXA 2FOAA 3GY3A 2PGBB 1C2EA 1S83A 1OXGA 1UJ1A 3E6PH 2QAAA 5JBBS 1G9IE 3JZ1B 5FAHA 1D3QB 1S5SA 4ZKRU 3PMHB 3HKIB 2BLWA 1EOJA 5A8YA 3T25A <