2Z3EA

A mechanistic view of enzyme inhibition and peptide hydrolysis in the active site of the sars-cov 3c-like peptidase
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replicase polyprotein 1ab (pp1ab)
publication title A mechanistic view of enzyme inhibition and peptide hydrolysis in the active site of the SARS-CoV 3C-like peptidase
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase/hydrolase inhibitor
total genus 85
structure length 306
sequence length 306
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2007-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2z3eA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2z3eA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2z3eA02
2OUAA 1DY9A 1D4PB 3LOXA 1MTVA 1XVMA 1HAXB 1M9UA 3P92A 4NA7A 1S0QA 5DP5A 5PTPA 4IGDA 5JPMH 2SGDE 2BY5X 2QYIA 4CBNA 1FJSA 1KXDA 2CHAC 5ESTE 4ESTE 1FN6A 1GCDA 2A2QH 1O3LA 2BTCE 1CHOG 1KXFA 4MG3A 3NZIA 3RDZA 1AUJA 2VVCA 3UTUH 1F0SA 1OX1A 3RC4A 3MNBA 3SI4H 1RTKA 1BRBE 1EPTC 3QGNB 4MNXA 3STJA 4AGKA 3SN8A 1DFPA 1DICA 2O8MA 3RXFA 2QN5T 3NPSA 1EJAA 3LC3A 3ELAH 2Y6TA 3BIUH 2A45B 3SGAE 4YOJA 4BAHB 2P3FH 1SGQE 1NRRH 4MPXA 3KQDA 4SGAE 4IBLH 5LPEA 2TBSA 1TPAE 5JBTA 5B6OA 2NU1E 1NRPH 2CHAB 2H5DA 2A5AA 1ESBA 1SFQB 4UFEH 1GVZA 1LKBA 2ZTXA 2CN0H 1ELAA 1FY5A 3RM2H 1EZUC 4D9QA 4NFEA 3FP6E 1GHYH 4O9VA 2TPIZ 2WPIS 1CHOF 2AGGX 1FQ3A 4DW2U 1EAUA 3ZZ6A 1MMJN 2OC7A 3U8RH 1TIOA 1O2ZA 1VJAU 1BBRK 1KXEA 3A84A 1EX3A 1RTLA 1UVTH 3QTVH 1BMAA 1GL0E 3SQHE 1C2IA 1JBUH 5JBBS 1G3CA 1ACBE 3OU0A 4BAKB 1FUJA 1D3PB 2R2MB 4ZUHA 1K22H 3RXBA 2ZGHA 2ANYA 2ODPA 3GCOA 3PMJA 3MWIU 2JETB 3F68H 3QUMP 5DGJA 3UQOA 1GJ5H 1C1NA 2BX3A 5A0BA 1A46H 3SU2A 1AZ8A 5JB9S 3OX7U 2ANKH 3TH2H 2BY8X 3T27A 1GHZA 3RMNH 1EUFA 2PLXA 1TNKA 3ZVGA 1ESAA 1FY3A 1MUEB 2BLOA 1ZZZA 2UUJB 2C8WB 3OYPA 1P9UA 1KXCA 1KLJH 1XXDA 3NK8A 1A2CH 3IG6B 1ZSKA 1JWTA 1EZSC 1NS3A 2BD9A 4RSPA 2ALVA 4JZ1A 8ESTE 3E90B 1NT1A 1Z8IB 1PPHE 4U32A 3M3TA 1W8BH 2ZP0H 1S85A 1EP6A 3SU1A 4TPIZ 1H9IE 1FZZA 4I8HA 3A7VA 3GYLB 3LU9B 4FUEA 1NFXA 5TCAA 4ZHMU 1OP2A 2PUXB 2OQUA 1VGCB 1P03A 1QR3E 2JH5D 2QC2A 3UPEA 5C1UA 3TGIE 1HJ9A 2AS9A 4E06H 1GG6C 3C27B 3TPIZ 3T62A 4ABJA 1YPMH 2LPRA 1OKXA 2R3YA 1F5LA 3GDUA 1ZMNA 4Z6AH 2AH4X 3RXLA 4ZHAA 4ABFA 3PTBA 3HKJB 4AYYB 5C20A 1HFDA 3L3TA 3BSQA 1QNJA 1D9IA 1GL1A 1V2LT 4MQAA 3VGCC 3E1XB 2V6NA 4INHA 4INLA 3PTNA 1QJ1B 4A7IB 3IWMA 4OGXA 1D3DB 2ZO3H 1GBCA 1DSTA 3KNXA 3MO3A 5C67A 1GI3A 2W7UA 3SJIA 4Q7YA 4WXVA 1O2UA 1OWDA 2EI7A 2ZC9H 2BDHA 1SB1H 2F9UA 3FZDA 5GIBA 3MU5A 3NKKA 1NU7B 3N7OA 2YOLA 2ZHFH 1C1OA 1J9CH 5C1YA 1O3BA 1C1RA 4UDWH 4NZLA 4A1XA 1NROH 1WBGB 2OQ5A 4E7NA 1C5PA 1T8OA 4J1YA 2GZ9A 1GI0A 3VGCB 3CP7A 1UTMA 4K8BA 2Q1JA 1SMFE 1BUIA 2Z3CA 1K1NA 4AFUA 1W3CA 2I6SA 5HMAA 2CV3A 3UWIA 4GHQA 2ZDVH 3B8JA 3A8DA 5DP6A 4Y7AA 2BDBA 4H6TA 5DP3A 3MNSA 4Q7ZA 4DOQA 1HGTH 3OY6U 4RN6A 1HB0B 5LH8A 3GCTF 4XBDA 2VVVA 3EDXB 1BBRH 2QV1A 1LMWB 1MAXA 1N6XA 4KP0A 1VCQA 1NRNH 2SFAA 5EODA 2QF0A 1C1UH 4ABBA 5HYOA 3GDVA 1ZSJA 1UK2A 1D3TB 1W13U 4BANB 1ZHRA 1LVMA 1MBMA 5E0JA 1O3PB 3A86A 2PTCE 3AAVA 3Q3KA 2G5VA 3TITA 1SBWA 1BMMH 2K1QA 4GLYA 1O2TA 2BD8A 4ZHLU 1C1VH 1ID5H 1W11U 1F7ZA 1TQ0B 1FIZA 3PM3A 4KTCA 3ZZ9A 4Z0KA 2ZZUH 4Y8YA 1HXFH 1OP8A 3RC5A 1O2HA 3ZV8A 1P06A 4O03A 5GXPA 5L2ZH 3ZVDA 2ZU1A 3D62A 3E0PB 1ARCA 1BBRE 1P2MA 3SJ8A 5GCHG 1Z1JA 1P2JA 1BTZA 3BTKE 3A88A 3RM0H 1PPBH 4YM9A 3PWCA 2H2ZA 2FXRA 1SG8B 3HPTB 1TYNA 3FVFB 1O3KA 1GHAG 1L1NA 1ZJDA 1O3AA 3MH6A 1O2VA 2Z3EA 1TQ7B 1O30A 3UREA 1AHTH 3RXPA 5FCKA 2Y7ZA 1ELBA 3FZZA 4X1NU 2AGEX 2Z9JA 1E35B 1KLIH 1HAPH 2R0KA 1WYKA 2XC0A 1FN8A 2SGEE 3UNQA 4X8SH 3UNSA 1GJ7B 4KKDA 1ZYOA 4ZKRU 1EATA 1NM6A 3VXFH 1FLEE 4CBOA 1IQJA 3ZYEA 5GCHF 4CRBA 1GMHG 4UE7H 1C2FA 5A8YA 3ZZ8A 1CHGA 1QFKH 1O3IA 1TNIA 3LH1A 3Q3YA 3A87A 4YT6H 4IC5A 2WPKS 2HRVA 4FUJA 2PKAA 3EYDA 1ORFA 2FS8A 1SVPA 1SC8U 1GHAF 2WV4A 1BDAA 1MU8B 3ATKA 1RJXB 1ANBA 3BTWE 4E7RG 1GMCG 4F49A 4CR9A 1LHFH 1SGDE 2GZ7A 3BEFB 3DHKH 2NU3E 4K3JA 2BYAX 2FI4E 1WTGH 5ESBA 3V13A 2C90B 1QBVH 2XBYA 1QQUA 1GHWH 8LPRA 2XBVA 2AFQB 1QGFA 5EXMA 9ESTA 1AD8H 1GMHF 2C93B 2NU0E 3EAJA 1P57B 3RUOA 4FUDA 3M7UA 4BAQB 1A61H 1THPB 1C4U2 4A6LA 4LK4A 2H1UA 4D7GA 3GCHB 1N8OC 4X2XA 4YLQH 4NWLA 1P12E 1HDTH 3FP8E 1EXFA 2FI3E 4H42U 4J2YB 1ELEE 1O3GA 4Q80A 1GBJA 3NXPA 1SOTA 1A7SA 3GCNA 3AAUA 3Q76A 1OXGA 2A0QB 5EW2H 4OS7A 1EB2A 1PQ7A 2VH6A 1YKTA 1VITF 1XUGA 2JH0D 4I31A 1SHHB 1AKSB 5AFZH 1HAYB 2HALA 1IAUA 4RKJB 3A7XA 3QLPH 2R0LA 1UHBA 2GMTB 3BTQE 1C4Y2 1P09A 4UD9H 1TRNA 5GPIB 1IQMA 1LHCH 1AWFH 1CGHA 1HLTH 2FYQA 3A82A 4MLFB 1JIMA 4YLUA 3M5MA 4GAWA 5C5NA 1Z1IA 1C9TA 2PW8H 2D2DA 2GCHF 1ANEA 4KELA 4B74A 1BA8B 2VH0A 3Q00A 1UTOA 2ALPA 3ZZ3A 1C5TA 1NO9H 1C5QA 3JZ2B 1MTWA 3BF6H 1QCPA 1Z8JB 5EXLA 2BY9X 4WWYA 4JZFH 3LGVA 1KLTA 2FWWA 6GCHG 3RXEA 4KTSA 3PO1C 4TY7A 4OGYA 3S7KB 1DWDH 1AUTC 5IDKA 4X2VA 5FX5A 4DIIH 1QHRB 1CSOE 1FONA 4ISLA 2QIQA 3M3VA 3QWCH 1WOFA 2Z9LA 2THFB 1ZRKA 3I78A 3UY9A 2QY0B 1TAWA 1ZLRA 4XBCA 5F8XA 1GJ4H 1GGDC 3M37A 2DE8A 1BTUA 3T26A 1AFQB 4JK6A 3RXUA 1C2MA 3SUGA 3BTDE 5DG6A 1A0JA 2HNTC 1GHBG 3WY8A 1B0FA 1DXPA 2D1JA 4NSVA 4IN2A 5F03A 1HCGA 6GCHF 1A5IA 3P8NA 3SU6A 1UK4A 2ZTYA 6ESTA 1SFIA 1PPCE 2KAIB 1J16A 4CREA 1BMLA 1YBWA 5DJ7A 4XBBA 1DY8A 2BVSH 1GJCB 3KEEA 2WV5A 2ASUB 1O32A 3ZVAA 2BOHB 1UVSH 4BTTB 4OS1A 1QA0A 3SJ9A 2VU8E 1MCTA 4PROA 1GCTC 3BIVH 1C5SA 2ZGXH 3GY5A 4JK5A 1FDPA 4BTIB 2CF8H 2EI6A 1SGFA 2Q6GA 4WVPE 2ZHWH 1LHEH 1HAZB 1GHBF 1EQ9A 4WJG2 2F3CE 1HIAA 1W7XH 5EU8A 3TJNA 5AFYH 1YPKH 2PFEA 1TBZH 3SJKA 2XC5A 4QT8C 5DP4A 2BDIA 1EJNA 3VB7A 3BG4B 4ZKOU 4Y0YE 3MU8A 3TK6A 1E36B 2ZIQH 1EJMA 1RIWC 3Q77A 2V0BA 2A4QA 4X2WA 3U8OH 3SZNA 1LPKB 3RU4E 2ZA5A 5C3NA 3G01A 4Y6DA 1GBKA 4WMFA 3ZZDA 3C1KA 1TRYA 1TALA 2NU2E 1A4WH 1GI1A 3P17H 1HAVB 1Y5UT 2BD2A 3GYMA 3VPKA 1C2HA 2IPHA 3CS0A 1LQEA 3SUDA 3ATIA 3K6ZA 1YCPK 1BTHH 1C2JA 3ODDA 3A85A 1LHDH 4UFDH 3S9CA 1CA0C 1AE8H 5AVDA 1QBNA 5JDUB 2FLBH 3D23A 1O0DH 4CRAA 1GDUA 1MTNC 3KQCA 3BTHE 1AFEH 4I8GA 1MD7A 1RIWB 4UFGH 3K2UA 2P8OC 4A1TA 4NG9H 1VCPA 2C8XB 2R2WU 3TH3H 1O5BB 5DP7A 4GCHF 4LXBH 3BG8A 3S9BA 3SU5A 1ZPZA 2GCTC 1DPOA 1GWAA 3SU0A 5HM2A 4B2AA 2SNVA 1EAIA 1TGCA 1JRTA 1GDQA 1P2OA 1EZXC 1TBRH 2BM2A 2EC9H 5GDSH 3SW2B 5CE1A 4Y8XA 1NU9A 5L30H 1BT7A 1PQ8A 1UCYK 1BQYA 1SQTA 2VWNA 1DANH 3A89A 3U9AH 4IS5A 4U30A 1F2SE 1EPTA 4UFFH 1C5XB 2FYRA 2RA3A 2W7SA 1TA2A 1O3CA 7LPRA 1ETRH 1HAGE 4ZXXH 1SGIB 3KF2A 5BPEA 1GI6A 1P2QA 1C1QA 1EPTB 1NZQH 4ISHH 3SJOA 1O2KA 2Y80A 1OWKA 5A8ZA 1PPGE 1CT4E 2R3UA 2XCNA 2PTNA 2SNWA 3SQEE 5L2YH 2JKHA 3OSYA 1YPHE 5FBEA 2FPZA 1C5OH 2LIZA 2UUYA 3MHWU 1UTKA 1KY9A 2TGDA 3S0NA 2XWAA 1QRXA 1TOCB 2ZG0H 3SNDA 1SGEE 2F83A 3QGJA 1O3MA 2ZU5A 4NIYA 2P95A 3V0XA 5K0HA 1J15A 2GV7A 1O2SA 3T28A 1QRWA 1E38B 2GDDA 3SU3A 1W2KH 2G4TA 2A5KA 3LT3A 3MH7A 2F9BH 5FBIA 1TABE 4K8YA 1ELFA 2ZU3A 2Z6BD 1C1TA 1Z8GA 4FVBA 4K1SA 1J14A 1GHVH 2ZCHP 3SV2H 4NWKA 3F6UH 3A7WA 1BMNH 2Y7XA 1BRUP 3BV9B 1DLKB 1XUFA 1V6DA 1TX6A 2VIOA 4NFFA 2BQ6B 5GJ4B 1YPLH 3KHVA 1LVOA 3W95A 1SR5C 2QXIA 3QZRA 1P2NA 4B2CA 1GI8B 1RTFB 2G5NA 5EQRA 3SUEA 3UR9A 2RCEA 5K7RA 3QDZB 5JB8S 2EEKA 3D49H 2BLVA 1A3BH 5FHTA 3SO3A 2A5IA 2WYGA 3URDA 3RLWH 2Y5GA 2QA9E 1T32A 3ATLA 1V2WT 5TJXA 4X8TH 3V3MA 1V2MT 2AIPA 3TGKE 1QL7A 4A1VA 3EGKH 1ZTJA 1E0FD 2J38A 1SLWB 3AASA 1VJ9U 1BRAA 2O8UA 1P05A 2O8TA 4CH8B 3H7TA 2H9EH 2OCVB 1O35A 1YP9A 3RLYH 3M7TA 1QB1A 2WUBA 1GMDG 1O5GH 1HNEE 1C2EA 1AO5A 3O8CA 1U6QA 2BDGA 1NFWA 1YM0A 2ZPRA 3BTEE 3P8FA 1NFUA 1DLEA 4X6OA 2A4RA 1O2RA 2BB4A 1GG6B 4ABDA 3ATWA 4TPYA 3VFEA 3RXSA 3GCTG 1QJ7B 3TNTA 1TNJA 2VGCC 1O2PA 1F5RA 1P2KA 1S6HA 1SGYE 3R0FA 3DFLA 3M5NA 2G51A 1GBFA 4X1RU 3HGPA 1L1JA 1T7CA 4GHTA 2XRCA 2C3SA 3T25A 1O2JA 4AB8A 1XMNB 2O8LA 1C1WH 1QJ6B 3U8TH 5G4BA 1CGIE 1LO6A 2UWLA 1OWEA 1UTNA 2BDYA 5A0AE 1DWCH 5T3HA 1GMDF 2VIPA 2A7HA 2FM2A 2ESTE 2OP9A 1OS8A 1PYTD 3D65E 3SUFA 1UCYH 1HJ8A 1Y8TA 1G2LA 1HYLA 1WQSA 1EAWA 2ZDAH 3ESTA 4FUGA 1S81A 1X7AC 2OC1A 1AGJA 3F9GA 5E0HA 1HJAC 4YO9A 2SGQE 2FS9A 3BTGE 3TK5A 1SGFG 1WQVH 2VGCB 4HGCA 2G55A 1MAYA 1GBDA 1O2MA 3ATMA 1SGPE 2TGAA 3TVJB 4B73A 1G30B 1ANCA 3BTTE 3FP7E 1T4VH 1AU8A 2GZ8A 2R9PA 3ENSB 3MH5A 1QY6A 1O37A 2V3HH 3UUZA 3FAOA 8GCHG 1OWIA 1Y59T 2IJOB 1LHGH 2Y82A 1GDNA 1ELTA 5SGAE 3JZ1B 1YCPM 3NUMA 3P70B 1UCYE 4K60A 3S69A 3BTFE 2ZFPH 1K1LA 4ABGA 1DUEA 1LVBA 1EAXA 3F9FA 2Y81A 2CJIA 2HNTF 1E37B 2C8ZB 5LPRA 4A5TS 1ZHPA 1S82A 1DS2E 1CO7E 3ZYDA 3RXHA 4OS4A 3KGPA 1K1PA 1IHSH 1T8MA 1OPHB 3K6YA 5C2ZA 1O2GH 4NGAH 4X1PU 3ZZ7A 2FLRH 2DUCA 1MZDA 6CHAC 2BD5A 1VR1H 5EXNA 2FI5E 1AB9C 3VB3A 1P2IA 1CE5A 1O2OA 3ITIA 8GCHF 2XNIA 2P16A 3STIA 4JZIA 5EW1H 3P8GA 2GGVB 1GPZA 1TONA 3CS7A 1QTFA 5LPFA 1H8DH 1ZR0A 1BJUA 5HXFA 2HGTH 1TPOA 1FY8E 1DE7H 3BEUA 1W12U 2AERH 1P10A 2A31A 1C1SA 1LDTT 1W7GH 4NIWA 3O8RA 3TK9A 1XM1A 2H9TH 1IQLA 1GJ9B 2OXSA 2EA3A 5GWZA 3RU4D 1P3EA 3PROA 1A3EH 2PWXA 3AVZA 2FZZA 3EA8A 3HK3B 4FXGH 3AW0A 4WF8A 2XBWA 2ZPSA 3LGTA 1KDQB 2OBOA 1OYQA 4HTCH 2BXUH 3EE0B 4YESB 1NRQH 4FVDA 2YNAA 3MH4A 2BVXH 1CVWH 2HLCA 1FI8A 1NY22 3QO6A 1XKAC 3SBKA 1P3CA 1GBAA 4HFPB 1VITG 2ZU2A 3V12A 1AVWA 4WY3A 2ZTZA 3SV6A 5FPSA 3TNSA 2HOBA 1W14U 1ABJH 2B5TB 4FUCA 1O5FH 3OY5U 2J34A 3L6PA 2F9NA 4CRDA 1LTOA 2ZECA 2BD7A 3UR6A 2FEQH 4AFSA 1AMHA 1V2QT 3CENA 1ZPBA 2Z94A 1H4WA 5CHAC 1O3OA 1OP0A 2VIQA 4TYDA 1AE5A 2XYAA 4TWWA 4AX9H 2GCHG 1W10U 1GVLA 1Y3YA 2QCYA 5C1XA 4Y11E 1AKSA 4FUBA 1PJPA 4K1TA 1Y3UA 4YT7H 1JIRA 1BTWA 1MBQA 2W5EA 1S83A 2VWMA 1HV7A 4AG1A 5J4QA 3U1JB 4UEHH 2ANWA 2PR3A 1GBHA 1WAYB 3ZZ4A 2D8WA 1V3XA 1T8LA 4ZXYH 4AN7A 3SV9A 4ASHA 3EA7A 1G36A 4X6NA 3URCA 1TBQH 2ZDNA 2PHBA 3RMLH 2VIDA 3OTJE 1ZOMA 2BDCA 4X6PA 1B7XB 1G3DA 1WU1A 2QXJA 1N8OB 3MFJA 1QB6A 4WH8A 3TIUA 1D6RA 2CMYA 2VWLA 2BMGB 4IMZA 2NWNA 1MQ6A 2BXTH 2GV6A 3P6ZB 4DCDA 1EOJA 1YPJH 1XVOA 2OD3B 3MO6A 5A09A 2YNBA 1A0LA 2AEIH 2ZQ2A 2VVUA 4MVNA 2XTTB 4ZH8A 3A7ZA 3GY8A 1JXPA 1G3EA 1KSNA 1P9SA 3BEIB 2PKSC 1THSH 3B9FH 1O31A 1C5MD 1P04A 4BTUB 4AYVB 4NIXA 4Y8ZA 1G9IE 1Y5BT 4FU9A 1TFXA 1K1IA 1BIOA 3MMGA 1HRTH 4NIVA 1GJAB 1XXFA 1YPGH 5BRRE 1ZJKA 3QZQA 1AVGH 2EI8A 1SQOA 2A4OA 4MNWA 1Z6EA 3P95A 2P3TB 1QL9A 1TNHA 2ZDLA 1H9HE 2SGFE 4AZ2B 1C1PA 1F5KU 1PYTC 4UONA 5EPNA 1O2WA 2XCFA 1FXYA 4NCYA 1GI7B 4JCNA 3MU1A 1ELCA 2KAIA 1SGRE 4X6MA 1LKAA 3LPRA 1CBWC 1K1OA 2PKSB 3L33A 2Q6DA 3PO1B 3RC6A 1K9OE 2QGRA 2ZFTA 2ZPQA 1H9LB 2J2UA 1BITA 1ETTH 3NWUA 4R0IA 1HAOH 1P11E 1Q2WA 1SHYA 2FX6A 3LKWA 4ABHA 1UTJA 1GJDB 2OC0A 4F4OC 1ZHMA 3RXVA 3HATH 3M5OA 3SV8A 1NTPA 1P01A 1JMOH 1TPPA 4LOYH 1NESE 1GGDB 3RXMA 2WYJA 1LVYA 1TGNA 3TJOA 1F0TA 3VB4A 4B76A 2OINA 2FOHA 4CH2B 7GCHG 4FU7A 1JOUB 4Y79A 3E8LA 1G2MA 2I6QA 1XX9A 1BB0B 2FESH 1EOLA 2GX4A 3PB1E 1D3QB 1INCA 1BHXB 2HWLB 4GUXA 4R8TB 1IQHA 2ZGJA 4FUIA 4X8UH 1C5YB 1BTPA 2LNCA 3VXEH 3U1IB 3KL6A 4H4FA 4MTBA 2IN2A 1V2VT 4DIHH 3T2NA 4AGJA 1K1JA 1TWXB 4SGBE 2ZNKH 3TJVA 3H5CB 1HAVA 1TGBA 3ZV9A 2ZHEH 4GCHG 1MZAA 5A0CA 1GVKB 1TMTH 2ZI2H 4IW4E 4MNVA 4O3TA 2K7XA 1DM4B 1SPJA 3Q3XA 1O39A 1GCTB 2WPLS 1C9PA 2ZCKP 4U01A 2IOTA 1Z7KA 3DD2H 3A81A 1ESTA 5E8EH 1TX8A 4D8NA 4YOIA 3NCLA 1FY1A 1RFNA 1ZTLA 4M7GA 1SOZA 5I46H 4TWYA 7GCHF 2ZGBH 2P94A 2FO9A 2P3UB 1VITH 1UK3A 1BCUH 1C2LA 1MTUA 1MU6B 1QURH 3TLOA 5AF9H 3MOCA 3SGQE 3KQBA 1ELDE 2OTVA 1A0HB 4E05H 3K65B 1MQ5A 2G4UA 2BD3A 1SL3A 2GD4B 2J9NA 1C2DA 3LC5A 5A8XA 1BOQA 1B0EA 4Q7XA 1ZGVA 3RXCA 1GBTA 2ULLA 7KMEH 3PYHA 2STBE 1V2TT 1O3EA 4IMQA 1A5HA 2J4IA 2VJ1A 1S6FA 4K69A 5DKMA 2H5CA 3TH4H 1C1MA 1YLDA 3KCGH 1CA0B 4CR5A 1V2JT 1C5LH 1MTNB 3A8AA 3H7OA 1GBMA 1NN6A 1DSUA 1TMBH 1CT2E 2P8OB 2H9HA 1WTHD 2JETC 1FV9A 1TNGA 1QA7A 1Y3WA 1C4V2 3RXTA 1KYNA 1GJ6A 2GCTB 1ZTKA 2BOKA 3W94A 3VB5A 4I8JA 2B9LA 3F9HA 2ZKSA 1C5ZB 3KIDU 1AVXA 1V2ST 1OSSA 5E2OA 4BXSA 1ELGA 2UWOA 1K1MA 1WCZA 3RXJA 4ZMAH 3UIRA 1Y3VA 2FOMB 3EQ0H 2XXLA 1T8NA 2Q6FA 3UFAA 3TJUA 1GI4A 3E6PH 4K2YA 1TB6H 2ZEBA 4K1EA 4FUHA 1KXBA 2GDEH 2TRMA 2BZ6H 1D6WA 1YPHC 4D7FA 3HGNA 4NSYA 3QN7A 2Z9GA 2ODYB 4IN1A 5CMXH 3VEQB 3GISB 5F6MA 1Z6JH 2BZAA 2TIOA 1MKWK 1GI2A 3LJJA 5DP8A 5EOKA 2UUFB 2VNTA 3LIWA 1L2EA 1PPZA 3M3SA 3P8OA 2HPPH 5L6NH 1VGCC 1UJ1A 2C8YB 2M5TA 5DK1A 4I7YH 1TNLA 2BDAA 2SGAA 4XSKU 2ZHDA 4FUFA 1TRMA 2ZWLH 1DUAA 3A83A 1IQGA 1FMGA 3ZZ5A 4ABIA 3UOUA 4XE4A 1S0RA 1E34B 4DURA 3PLBA 1KTTB 2FMJA 3A8CA 1FAXA 1P0SH 1B5GH 3RXQA 4MPVA 5EG4A 2FDAA 1Z71A 1K21H 2TGPZ 4JMYA 2XBXA 3MNCA 1SGCA 2VIWA 4B1TA 1GBEA 4TY6A 2FX4A 1P02A 2G52A 1IQNA 1SGTA 3F1SB 1ZSLA 2A2XH 4AFQA 4DVAU 1DITH 1O3JA 5DP9A 1L4ZA 1V2RT 1DVAH 1O2LA 1PPFE 3MU4A 3RXGA 3UWJH 4VGCC 1F0UA 4BNRA 5E2PA 4NZQA 1L0ZA 4DT7B 1W0ZU 1V2NT 1QRZA 3DFJA 3E16B 1YCPH 2FOCA 2ODQA 1A1RA 2ZF0H 1O3NA 3DT0H 2ILNA 1O2QA 1YPEH 4Y7BA 2B7DH 2C4FH 2J95A 1OYTH 1N1LA 3MTYA 4X1QU 1MD8A 2B8OH 4Y76A 2HVXA 3QTOH 3SGBE 2BY6X 5DO4H 3EA9A 2A7JA 1LQDB 2WUCA 3ZZAA 5HM9A 4AOQA 1MCVA 1V2OT 2BQWB 2WINI 4KGAA 1O33A 2ZDKA 1TA6A 1BZXE 1O3FA 3UQVA 1GHXH 2VINA 3MYWA 2BHGA 4XDEA 2GVFA 1WUNH 1K28D 2F9VA 2WPJS 1ZMLA 1ELVA 4VGCB 4O3UA 1BJVA 1NFYA 4JYUH 2PUQH 1PQ5A 3GY3A 4JYTA 2ZFQH 2A32A 4X8VH 2FOEA 1T4UH 5TCCA 3UOPA 4JZEH 2XW9A 4WH6A 1GI9B 1MKXK 1UVUH 3RXAA 2FTMA 1GBIA 2BVRH 3SHAH 5ETXA 4OS6A 1TE0A 3VB6A 4ZKNU 1O3HA 1UMAH 2BLQA 2FTLE 2ZCLP 3ZZCA 2Z3DA 2JH6D 1CA8B 3O8DA 2FP7B 2A1DB 1F92A 2QXGA 1G3BA 1DWBH 1CQQA 2PGBB 1SLXB 1IQFA 2QF3A 1GBLA 3GICB 1CU1A 3B23B 7ESTE 5I25A 1XKBC 5EPYA 4DJZB 2HPQH 2Y5HA 1EB1H 4BAOB 4MPWA 1S5SA 3RXKA 4GVUA 1UTQA 1L1GA 4XFQA 2QXHA 4I32A 2UUKB 5LGOA 1H1BA 2ZQ1A 3RXIA 4MNYA 2VWOA 4OS2A 4ABAA 1HJAB 4O97A 1FY4A 3E91A 1AZZA 4XOJA 3SORA 2OLGA 4OS5A 1DDJA 3KQEA 3O8BA 2A4GA 3K9XB 1UTLM 1BHXF 3FFGA 3F9EA 1KIGH 1PQAA 1SGNE 4GSOA 3ZVBA 5FCRA 2G81E 1DWEH 1P8VC 3RMOH 4MDSA 1MKWH 1Y3XA 3BN9A 3HK6B 1AY6H 3DA9B 3U98H 1QIXB 4KTUA 3DUXH 1EZQA 4D76A 1THRH 4ISIH 1XUHA 4X0WU 4YTAA 1PPEE 1GJ8B 1ETSH 3GY7A 1TLDA 1C5NH 1RS0A 1SQAA 4NA8A 1GJBB 2B0FA 5F8TA 1PFXC 5F8ZA 1WV7H 4GPGA 4CRFA 5FPTA 1FPCH 4Y10E 4ZKSU 4HI3A 2GT7A 1KDQA 4WMDA 4I8KA 2UWPA 5JBAS 4WMEA 6CHAB 3KN2A 1AQ7A 1EKBB 3M35A 3SHCH 1ARBA 4ISOA 1AB9B 4DG4A 2V3OH 3V7TA 5JBCS 1IQKA 3EBNA 2F9PA 4JZDH 1QB9A 1O2NA 5T6FA 1YC0A 2OBQA 2Z9IA 5T6DA 5FXLA 1HUTH 2P59A 4RKOB 1LPZB 3MI4A 1DT2A 4Y71A 1JRSA 2P93A 1MH0A 4IC6A 4B71A 1GBBA 2GP9B 3GCHC 1YGCH 1FIWA 4ISNA 1BRCE 4YOGA 5H4IB 5AHGH 4ZROA 2FOFA 3SNEA 1ANDA 2PKAB 4ZAEA 2XC4A 1LPGB 5EQSA 1DXWA 2ZFFH 3PLKA 1CGJE 2SGPE 5ABWA 4YZUA 3MU0A 3E0NB 3GY2A 2AGIX 1RRKA 3A7TA 2RDLA 5DPAA 3RXRA 2AMPA 3AW1A 1BTXA 1HPGA 1J8AA 1AI8H 1IOEA 3SOSA 2FOBA 4I8LA 2GMTC 1IQEA 1QL8A 3QK1A 1J17T 1FAKH 1TMUH 2PGQB 2D26C 2NU4E 3S7HB 2WPMS 1C2KA 1FNIA 3SNCA 1MKXH 2F91A 3ODFA 1HBTH 4K5ZA 2STAE 3LGYA 2ZGCA 5T6GA 2V35A 2PV9B 1GMCF 2ZDMA 1NC6A 2H6MA 3PWBA 3BTME 1N6YA 4DGJA 4LZ1H 1QQ4A 3GOVB 3RMMH 4AFZA 5CHAB 1A5GH 1UTPA 2ZHQH 3SNBA 1C5UA 1KTSB 1UVPA 2J92A 1ABIH 4INKA 1O34A 2GKVE 1L4DA 3FANA 4AB9A 5FX6A 9LPRA 1KXAA 4LZ4B 4Q2KA 4BOHA 1NPMA 3LJOA 3I29A 4HZHA 3MO9A 3SNAA 5A2MH 3M5LA 2RG3A 4FU8A 2W26A 1H8IH 2AMQA 4CRGA 1UO6A 1NRSH 1UHBB 1HXEH 1MTSA 3TU7H 1VZQH 3ZVCA 2FOGA 1ZGIA 1YLCA 1V2UT 1DOJA 1LCYA 3R3GB 3LONA 1C5WB 1ZMJA 2G00A 4B75A 5C5OA 3I77A 5IYTA 1AFQC 1G32B 3MNXA 2G8TA 2ZFSA 4A92A 3M36A 4CRCA 1RXPA 1Y5AT 2Y5FA 3LDXH 2CF9H 3LGWA 1TPSA 3LGUA 1HAHH 2WPHS 3A7YA 1OWJA 3M7QA 1ZRBA 3ZZBA 3RXOA 1DX5M 1AWHB 1RGQA 4X1SU 1V2KT 2CGAA 2VIVA 2F9OA 2HNTE 2Z7FE 1S84A 4H6SB 2W3IA 1XUKA 2CXVA 3UNRA 5EGMA 3IITA 4ABEA 3SU4A 2FOAA 3GDSA 1Q3XA 1SLUB 1TGSZ 3T29A 1AN1E 4MPUA 3S9AA 3RU4T 1O2IA 3LH3A 3ZVEA 1SI5H 1Q31A 1O2XA 1ZPCA 2BX4A 1HAIH 3PLPA 1CT0E 3PMBB 2TGTA 1V2PT 4THNH 1O36A 4B2BA 1UVOA 8KME2 2AYWA 3A80A 1FPHH 1O38A 4CHAC 2XWBI 2QAAA 5HGGA 1WSSH 1K2I1 4BAMB 4AG2A 5JYIA 3A8BA 1TGTA 3BG4C 1TX7A 1YYY1 4I33A 4X2YA 3PMAB 1TOMH 2BD4A 3PMHB 2ZU4A 1CBWB 1O5AB 2ANMH 3HKIB 1RD3B 2O9QA 3SI3H 4U2WA 5J4SA 3E3TA 1BTYA 1SSXA 1EP5A 2O8WA 1O2YA 2Z9KA 2BY7X 1EASA 2DE9A 1G37A 2GTBA 2GT8A 5EQQA 4BXWA 1O5EH 2RA0A 1XUIA 1O5CB 2BLWA 2W3KA 4Y0ZE 3M61U 5E0GA 3RXDA 1F0RA 1XUJA 2PSXA 1IQIA 2J94A 4CHAB 3ZVFA 2OC8A 3QX5H 3PV4A 1O5DH 6LPRA 3GY6A 4D9RA 4DY7B 2FIRH 5FPYA 1HIAB 1IHTH 2ZFRH 1C5RA 4AORA 1OOKB 4NA9H 2BQ7B 2PSYA 3RP2A 2FODA 2A7CA 1YF4A 3GY4A 4WXIA 2AIQA 1GI5A 1C2GA 5FAHA 1VCWA 1SLVB 1Z8RA 3TGJE 1C5VA 1O3DA 3T5FH 1QBOA 3LGIA 4JYVH 1W0YH 2AMDA 3U69H 1OWHA 2VB0A 3SV7A 1AIXH 1T31A
chains in the Genus database with same CATH superfamily
2OUAA 1DY9A 5CDFE 1D4PB 3LOXA 1MTVA 1XVMA 1HAXB 1M9UA 3P92A 4NA7A 4I86A 1S0QA 5DP5A 5PTPA 4IGDA 5JPMH 2SGDE 2BY5X 2QYIA 4CBNA 1FJSA 1KXDA 2CHAC 5ESTE 4ESTE 1FN6A 1GCDA 1YWUA 2A2QH 1O3LA 2BTCE 1CHOG 1KXFA 4MG3A 3NZIA 3RDZA 3FN8A 1AUJA 2VVCA 3UTUH 1F0SA 1OX1A 3RC4A 3MNBA 3F3BA 3SI4H 1RTKA 1BRBE 1EPTC 3QGNB 4MNXA 3STJA 4AGKA 3SN8A 1DFPA 1DICA 2O8MA 3RXFA 2QN5T 4ASUD 3NPSA 1EJAA 3LC3A 3ELAH 2Y6TA 3BIUH 2A45B 3SGAE 4YOJA 4BAHB 2P3FH 1SGQE 1NRRH 4MPXA 3KQDA 4SGAE 4IBLH 5LPEA 2TBSA 1TPAE 5JBTA 5B6OA 2NU1E 1NRPH 2CHAB 2H5DA 2A5AA 1ESBA 1SFQB 4UFEH 1GVZA 1LKBA 2ZTXA 2CN0H 1ELAA 1FY5A 3RM2H 1EZUC 2YMSD 4D9QA 4NFEA 3FP6E 1GHYH 4O9VA 2TPIZ 2WPIS 1CHOF 2AGGX 1FQ3A 4DW2U 1EAUA 1YLNA 3ZZ6A 1MMJN 2OC7A 3U8RH 1TIOA 1O2ZA 1VJAU 1BBRK 1KXEA 3A84A 1EX3A 1RTLA 1UVTH 3QTVH 1BMAA 1GL0E 3SQHE 1C2IA 1JBUH 5JBBS 1G3CA 1ACBE 3OU0A 4BAKB 1FUJA 1D3PB 2R2MB 4ZUHA 1K22H 3RXBA 2ZGHA 2ANYA 2ODPA 3GCOA 3PMJA 3MWIU 2JETB 3F68H 3QUMP 5DGJA 3UQOA 1GJ5H 1C1NA 2BX3A 5A0BA 1A46H 3SU2A 1AZ8A 5JB9S 3OX7U 2W6ID 2ANKH 3TH2H 2BY8X 3T27A 1GHZA 3RMNH 1EUFA 2PLXA 1TNKA 3ZVGA 1ESAA 1FY3A 1MUEB 2BLOA 1ZZZA 2UUJB 2C8WB 3OYPA 1P9UA 1KXCA 1KLJH 1XXDA 3NK8A 1A2CH 3IG6B 1ZSKA 1JWTA 1EZSC 1NS3A 2BD9A 4RSPA 2ALVA 4JZ1A 5C94A 8ESTE 3E90B 1NT1A 1Z8IB 1PPHE 4U32A 3M3TA 1W8BH 1OHHD 2ZP0H 1S85A 1EP6A 3SU1A 4TPIZ 1H9IE 1FZZA 4I8HA 3A7VA 3GYLB 3LU9B 4FUEA 1NFXA 5TCAA 4ZHMU 1OP2A 2PUXB 2OQUA 1VGCB 1P03A 1QR3E 2JH5D 2QC2A 3UPEA 5C1UA 4FETA 3TGIE 1HJ9A 2AS9A 4E06H 1GG6C 3C27B 3TPIZ 3T62A 4ABJA 1YPMH 2LPRA 1OKXA 2R3YA 1F5LA 3GDUA 1ZMNA 4Z6AH 2AH4X 3RXLA 4ZHAA 4ABFA 3PTBA 3HKJB 4AYYB 5C20A 1HFDA 3L3TA 3BSQA 1QNJA 1D9IA 1GL1A 1V2LT 4MQAA 3VGCC 3E1XB 2V6NA 4INHA 4INLA 1YY3A 3PTNA 3OTPA 1QJ1B 4A7IB 3IWMA 4OGXA 1D3DB 2ZO3H 1GBCA 1DSTA 3KNXA 3MO3A 5C67A 1GI3A 2W7UA 3SJIA 4Q7YA 4WXVA 1O2UA 1OWDA 2EI7A 2ZC9H 2BDHA 1SB1H 2F9UA 3FZDA 5GIBA 3MU5A 3NKKA 1NU7B 3N7OA 2YOLA 2ZHFH 1C1OA 1J9CH 5C1YA 1O3BA 1C1RA 4UDWH 2QF5A 4NZLA 4A1XA 1NROH 1WBGB 2OQ5A 4E7NA 1C5PA 1T8OA 4J1YA 2GZ9A 1GI0A 3VGCB 3CP7A 1UTMA 4K8BA 2Q1JA 1SMFE 1BUIA 2Z3CA 1K1NA 4AFUA 1W3CA 2I6SA 5HMAA 2CV3A 3UWIA 4GHQA 2ZDVH 3B8JA 3A8DA 5DP6A 4Y7AA 2BDBA 4H6TA 5DP3A 1UW7A 3MNSA 4Q7ZA 4DOQA 1HGTH 3OY6U 4RN6A 1HB0B 5LH8A 3GCTF 4XBDA 2VVVA 3EDXB 1BBRH 2QV1A 1LMWB 1MAXA 1N6XA 4KP0A 1VCQA 1NRNH 2SFAA 5EODA 2QF0A 1C1UH 4ABBA 5HYOA 3GDVA 1ZSJA 1UK2A 1D3TB 1W13U 4BANB 1ZHRA 1LVMA 1MBMA 5E0JA 1O3PB 3A86A 2PTCE 3AAVA 3Q3KA 2G5VA 1SKYE 3TITA 1SBWA 1BMMH 2K1QA 4GLYA 1O2TA 2BD8A 4ZHLU 1C1VH 1ID5H 1W11U 1F7ZA 1TQ0B 1FIZA 3PM3A 4KTCA 3ZZ9A 4Z0KA 2ZZUH 4Y8YA 1HXFH 2RFKC 1OP8A 3RC5A 1O2HA 3SZEA 3ZV8A 1P06A 4O03A 5GXPA 5L2ZH 3UAIC 3ZVDA 2ZU1A 3D62A 3E0PB 1ARCA 1BBRE 1P2MA 3SJ8A 3N99A 5GCHG 2WZQA 1Z1JA 4TT3D 1P2JA 1BTZA 3BTKE 3A88A 3RM0H 1PPBH 4YM9A 3PWCA 2H2ZA 2FXRA 1SG8B 3HPTB 1TYNA 3FVFB 1O3KA 1GHAG 1L1NA 2F43B 1ZJDA 1O3AA 3MH6A 5EJ1A 1O2VA 2Z3EA 1TQ7B 1O30A 3UREA 2WHXA 1AHTH 3RXPA 5FCKA 2Y7ZA 1ELBA 3FZZA 1NBME 4X1NU 2AGEX 2Z9JA 1E35B 1KLIH 1HAPH 2R0KA 1WYKA 2XC0A 1FN8A 2SGEE 2YMSC 3UNQA 4X8SH 3UNSA 1GJ7B 4KKDA 1ZYOA 4ZKRU 1EATA 1NM6A 3VXFH 1FLEE 4CBOA 1IQJA 3WWFA 3ZYEA 5GCHF 4CRBA 1GMHG 4UE7H 1C2FA 5A8YA 3ZZ8A 1CHGA 1QFKH 1O3IA 1TNIA 3LH1A 3Q3YA 3A87A 2JJ1D 4IC5A 4YT6H 2WPKS 2HRVA 4FUJA 2PKAA 3EYDA 1ORFA 2FS8A 1SVPA 1SC8U 1GHAF 2WV4A 1BDAA 1MU8B 3ATKA 1RJXB 1ANBA 3BTWE 4E7RG 1GMCG 4F49A 4CR9A 1LHFH 1SGDE 2GZ7A 3BEFB 3DHKH 2NU3E 2KZ4A 4K3JA 2BYAX 2FI4E 2YMSB 1WTGH 5ESBA 3V13A 2C90B 1QBVH 2XBYA 1QQUA 1GHWH 8LPRA 2XBVA 2AFQB 1QGFA 5EXMA 9ESTA 1AD8H 1GMHF 2C93B 2NU0E 3EAJA 2JIZD 1P57B 3RUOA 4FUDA 3M7UA 3NRLA 4BAQB 5HKKD 1A61H 1THPB 1C4U2 4A6LA 4LK4A 2H1UA 4D7GA 3GCHB 1N8OC 4X2XA 4YLQH 4NWLA 1P12E 3SYJA 1HDTH 3FP8E 1EXFA 2FI3E 4H42U 4J2YB 1ELEE 1O3GA 4Q80A 1GBJA 4YXWD 3NXPA 1SOTA 1A7SA 3GCNA 3AAUA 3Q76A 1OXGA 2A0QB 5EW2H 4OS7A 1EB2A 1PQ7A 2VH6A 1YKTA 1VITF 1XUGA 2JH0D 2HVYB 4I31A 1SHHB 3N7DA 1AKSB 5AFZH 1HAYB 2GJGA 2HALA 1IAUA 4RKJB 3A7XA 3QLPH 5HIZA 2R0LA 1UHBA 2GMTB 3BTQE 1C4Y2 1P09A 4UD9H 1TRNA 5GPIB 1IQMA 1LHCH 1AWFH 1CGHA 1HLTH 2FYQA 2WSSD 3A82A 4MLFB 1JIMA 4YLUA 3M5MA 4GAWA 5C5NA 1Z1IA 1C9TA 2PW8H 2D2DA 2GCHF 1ANEA 4KELA 4B74A 1BA8B 2VBCA 2VH0A 3Q00A 1UTOA 2ALPA 3ZZ3A 1C5TA 1NO9H 4XD7D 1C5QA 3JZ2B 1MTWA 3BF6H 1QCPA 1Z8JB 5EXLA 2BY9X 4WWYA 4JZFH 3LGVA 1KLTA 2FWWA 6GCHG 3RXEA 4KTSA 3PO1C 4TY7A 4OGYA 3S7KB 1DWDH 1K0HA 1AUTC 5IDKA 4X2VA 5FX5A 4DIIH 1QHRB 1CSOE 1FONA 4ISLA 2QIQA 3M3VA 3QWCH 1WOFA 2Z9LA 2THFB 1ZRKA 3I78A 3UY9A 2QY0B 1TAWA 1ZLRA 4XBCA 5F8XA 1GJ4H 1GGDC 3M37A 2DE8A 1BTUA 3T26A 5KECA 1AFQB 4JK6A 3RXUA 1C2MA 4F55A 3SUGA 3BTDE 5DG6A 1A0JA 2HNTC 1GHBG 3WY8A 1B0FA 1DXPA 2D1JA 4NSVA 4IN2A 5F03A 1HCGA 6GCHF 1A5IA 3P8NA 3SU6A 1UK4A 2ZTYA 6ESTA 1SFIA 1PPCE 2KAIB 1J16A 4CREA 1BMLA 1YBWA 5DJ7A 4XBBA 1DY8A 2BVSH 1GJCB 3KEEA 2WV5A 2ASUB 1O32A 3ZVAA 2BOHB 1UVSH 4BTTB 4OS1A 1QA0A 3SJ9A 2VU8E 1W0JD 1MCTA 4PROA 1GCTC 3BIVH 1C5SA 2ZGXH 3GY5A 4JK5A 1FDPA 4BTIB 2CF8H 2EI6A 1SGFA 2Q6GA 4WVPE 4HG6A 2ZHWH 1LHEH 1HAZB 1GHBF 1EQ9A 4WJG2 2F3CE 1HIAA 1W7XH 5EU8A 3TJNA 5AFYH 1YPKH 2PFEA 1TBZH 3SJKA 2XC5A 4QT8C 5DP4A 2BDIA 1EJNA 3VB7A 3BG4B 4ZKOU 4Y0YE 3MU8A 3TK6A 1E36B 2ZIQH 1EJMA 1RIWC 3Q77A 2V0BA 3KQ5A 2A4QA 4X2WA 3U8OH 3SZNA 1LPKB 3RU4E 2ZA5A 5C3NA 3G01A 4Y6DA 1GBKA 4WMFA 3ZZDA 3C1KA 1TRYA 1TALA 2NU2E 1A4WH 1GI1A 3P17H 1HAVB 1Y5UT 2BD2A 3GYMA 3VPKA 1C2HA 2IPHA 3CS0A 1LQEA 3KYFA 3SUDA 3ATIA 3K6ZA 1YCPK 5C0UA 1BTHH 1C2JA 2J5UA 3ODDA 3A85A 1LHDH 4UFDH 3S9CA 1CA0C 1AE8H 5AVDA 1QBNA 5JDUB 2FLBH 3D23A 1O0DH 4CRAA 1GDUA 1MTNC 3KQCA 3BTHE 1AFEH 4I8GA 4TSFD 1MD7A 5DN6D 1RIWB 4UFGH 3K2UA 2P8OC 4A1TA 4NG9H 1VCPA 2C8XB 2R2WU 3TH3H 1O5BB 5DP7A 2L6OA 4GCHF 4LXBH 3BG8A 3S9BA 3SU5A 1ZPZA 2GCTC 1DPOA 1GWAA 3SU0A 5HM2A 4B2AA 2SNVA 1EAIA 5IK2D 1TGCA 1JRTA 1GDQA 1P2OA 1EZXC 1TBRH 2BM2A 2EC9H 5GDSH 3SW2B 5CE1A 4Y8XA 1NU9A 5L30H 1BT7A 1PQ8A 1UCYK 1BQYA 1SQTA 3H09A 2VWNA 1DANH 3A89A 3U9AH 4IS5A 4U30A 2QF4A 1F2SE 1EPTA 4UFFH 1C5XB 2FYRA 2RA3A 2W7SA 1TA2A 1O3CA 7LPRA 1ETRH 1HAGE 4ZXXH 1SGIB 3KF2A 5BPEA 1GI6A 1P2QA 1C1QA 1EPTB 1NZQH 4ISHH 3SJOA 1O2KA 2Y80A 1OWKA 5A8ZA 2KX4A 1NBMD 1PPGE 1CT4E 2R3UA 2XCNA 2PTNA 2SNWA 3SQEE 5L2YH 2JKHA 3OSYA 1YPHE 5FBEA 2FPZA 1C5OH 2LIZA 2UUYA 3MHWU 1UTKA 1KY9A 1SQRA 2TGDA 3S0NA 2XWAA 1QRXA 3UB0A 1TOCB 2ZG0H 3SNDA 1SGEE 2F83A 3QGJA 1O3MA 2ZU5A 4NIYA 2KM0A 2P95A 3V0XA 5K0HA 1J15A 2GV7A 3PV5A 1O2SA 3T28A 1QRWA 1E38B 1COWD 2GDDA 3SU3A 1W2KH 2G4TA 2A5KA 3LT3A 3MH7A 2F9BH 5FBIA 1TABE 4K8YA 1ELFA 2ZU3A 2Z6BD 1C1TA 1Z8GA 4FVBA 4K1SA 1J14A 1GHVH 2ZCHP 3SV2H 4NWKA 3DSOA 3F6UH 3A7WA 1BMNH 2Y7XA 1BRUP 3BV9B 4Q63A 1DLKB 1XUFA 1V6DA 1TX6A 2VIOA 5GNDA 4NFFA 2BQ6B 5GJ4B 1YPLH 3KHVA 1LVOA 3W95A 1SR5C 2QXIA 3QZRA 1P2NA 4B2CA 1GI8B 4F48B 1RTFB 2G5NA 5EQRA 3SUEA 3UR9A 2RCEA 5K7RA 3QDZB 5JB8S 2EEKA 3D49H 2BLVA 1A3BH 5FHTA 3SO3A 4AC9A 2A5IA 2WYGA 3F2FA 3URDA 3RLWH 2Y5GA 2QA9E 1T32A 3ATLA 1V2WT 5TJXA 4X8TH 3V3MA 1V2MT 2AIPA 3TGKE 1QL7A 4A1VA 3EGKH 1ZTJA 1E0FD 2J38A 1SLWB 3OEED 3AASA 1VJ9U 1BRAA 2O8UA 1P05A 2O8TA 4CH8B 3H7TA 2H9EH 2OCVB 1O35A 1YP9A 3RLYH 3M7TA 1QB1A 2WUBA 5EIYA 1GMDG 1O5GH 5EJLA 1HNEE 1C2EA 1AO5A 3O8CA 1U6QA 2BDGA 1NFWA 1YM0A 2ZPRA 3BTEE 3WW7A 3P8FA 1NFUA 1DLEA 4X6OA 2A4RA 1O2RA 2BB4A 1GG6B 4ABDA 3ATWA 4TPYA 3VFEA 3RXSA 3GCTG 1QJ7B 3TNTA 1TNJA 2VGCC 1O2PA 1F5RA 1P2KA 1S6HA 1SGYE 3R0FA 3DFLA 3M5NA 2G51A 1GBFA 4X1RU 3HGPA 1L1JA 1T7CA 4GHTA 2XRCA 2C3SA 3T25A 1O2JA 4AB8A 1XMNB 2O8LA 1C1WH 1QJ6B 3U8TH 5G4BA 1CGIE 1LO6A 2UWLA 1OWEA 1UTNA 2BDYA 5A0AE 1DWCH 5T3HA 1GMDF 2VIPA 2A7HA 2FM2A 2ESTE 2OP9A 1OS8A 1PYTD 3D65E 3SUFA 1UCYH 1HJ8A 1Y8TA 1G2LA 1HYLA 3OE7D 1WQSA 1EAWA 2ZDAH 3ESTA 1VKYA 4FUGA 1S81A 1X7AC 2OC1A 1AGJA 3F9GA 5E0HA 1HJAC 4YO9A 2SGQE 2FS9A 3BTGE 3TK5A 1SGFG 1WQVH 2VGCB 4HGCA 2G55A 1MAYA 1GBDA 1O2MA 3ATMA 1SGPE 2TGAA 3TVJB 4B73A 1G30B 1ANCA 3BTTE 3FP7E 1T4VH 1AU8A 2GZ8A 2R9PA 3ENSB 3MH5A 1QY6A 1O37A 2V3HH 3UUZA 3FAOA 8GCHG 1OWIA 1Y59T 2IJOB 1LHGH 2Y82A 1GDNA 3F0PA 1ELTA 5SGAE 2EQNA 3JZ1B 1YCPM 3NUMA 3P70B 1UCYE 4K60A 3S69A 3BTFE 2ZFPH 1E1QD 1K1LA 4ABGA 1DUEA 1LVBA 1EAXA 3F9FA 2Y81A 2CJIA 2HNTF 1E37B 2CK3D 2C8ZB 5LPRA 5FL7D 4A5TS 1ZHPA 1S82A 1DS2E 1CO7E 3ZYDA 3RXHA 4OS4A 3KGPA 1K1PA 1IHSH 4ACBA 1T8MA 1OPHB 3K6YA 5C2ZA 1O2GH 4NGAH 4X1PU 3ZZ7A 2FLRH 2DUCA 1MZDA 6CHAC 2BD5A 1VR1H 5EXNA 2FI5E 1AB9C 3VB3A 1P2IA 1CE5A 1O2OA 3ITIA 8GCHF 2XNIA 2P16A 3STIA 4JZIA 5EW1H 3P8GA 2GGVB 1GPZA 1TONA 3CS7A 1QTFA 5LPFA 1H8DH 1ZR0A 1BJUA 5HXFA 2HGTH 1TPOA 1FY8E 1DE7H 3BEUA 1W12U 2AERH 1WXRA 1P10A 2A31A 1C1SA 5F53A 1LDTT 1W7GH 4NIWA 3O8RA 3TK9A 1XM1A 2H9TH 1IQLA 1GJ9B 3OFND 2OXSA 2EA3A 5GWZA 3RU4D 1P3EA 3PROA 1A3EH 3DSPA 2PWXA 3AVZA 2FZZA 3EA8A 3HK3B 4FXGH 3OEHD 4OM9A 3AW0A 4WF8A 2XBWA 2ZPSA 3LGTA 1KDQB 2OBOA 1OYQA 4HTCH 2BXUH 3EE0B 3F0OA 4YESB 1NRQH 4RT0A 4FVDA 2YNAA 3MH4A 2BVXH 1CVWH 2HLCA 1KMHB 1FI8A 1NY22 3QO6A 1XKAC 3SBKA 1P3CA 1GBAA 4HFPB 1VITG 2ZU2A 3V12A 1AVWA 4WY3A 2ZTZA 3SV6A 5FPSA 3TNSA 2KFWA 2HOBA 1W14U 1ABJH 2B5TB 4FUCA 1O5FH 5CHBA 3OY5U 2J34A 3L6PA 2F9NA 4CRDA 1LTOA 2ZECA 2BD7A 3UR6A 2FEQH 4AFSA 5KGOA 1AMHA 1V2QT 3CENA 1ZPBA 2Z94A 1H4WA 5CHAC 1O3OA 1OP0A 2VIQA 4TYDA 1AE5A 2XYAA 4TWWA 4AX9H 2GCHG 1W10U 1GVLA 1Y3YA 2QCYA 5C1XA 4Y11E 1AKSA 4FUBA 1PJPA 4K1TA 1Y3UA 4YT7H 1JIRA 1BTWA 1MBQA 2W5EA 1S83A 2VWMA 1HV7A 4AG1A 5J4QA 3U1JB 4UEHH 2ANWA 2PR3A 1GBHA 1WAYB 3ZZ4A 2D8WA 1V3XA 1T8LA 4ZXYH 4AN7A 3SV9A 4ASHA 3EA7A 1G36A 4X6NA 5KEDA 3URCA 1TBQH 2ZDNA 2PHBA 3RMLH 2VIDA 3OTJE 1ZOMA 2BDCA 4X6PA 1B7XB 1G3DA 1WU1A 2QXJA 1N8OB 3MFJA 1QB6A 4WH8A 3TIUA 1D6RA 2CMYA 2VWLA 2KCOA 2BMGB 4IMZA 2NWNA 2J97A 1MQ6A 2BXTH 2GV6A 3P6ZB 4DCDA 3FO8D 1EOJA 1YPJH 1XVOA 2OD3B 3MO6A 5A09A 2YNBA 1A0LA 2AEIH 2ZQ2A 2VVUA 4MVNA 2EY4C 2XTTB 4ZH8A 3A7ZA 3GY8A 1JXPA 1G3EA 1KSNA 1P9SA 3BEIB 2PKSC 1THSH 3B9FH 1O31A 1C5MD 1P04A 2AHME 4BTUB 4AYVB 4NIXA 4Y8ZA 1G9IE 1Y5BT 4FU9A 4B6EA 1TFXA 1K1IA 1BIOA 3MMGA 1HRTH 4NIVA 1GJAB 1XXFA 1YPGH 5BRRE 1ZJKA 3QZQA 1AVGH 2EI8A 1SQOA 2A4OA 4MNWA 1Z6EA 2IPQX 3P95A 2P3TB 1QL9A 1TNHA 2ZDLA 2LP6A 1H9HE 2SGFE 4AZ2B 1C1PA 1F5KU 1PYTC 4UONA 5EPNA 1O2WA 2XCFA 1FXYA 4NCYA 1GI7B 4JCNA 3MU1A 1ELCA 2KAIA 1SGRE 4X6MA 1LKAA 3LPRA 1CBWC 1K1OA 2PKSB 3L33A 2Q6DA 3PO1B 3RC6A 1K9OE 2QGRA 2ZFTA 2ZPQA 1H9LB 2J2UA 1BITA 1ETTH 3NWUA 4R0IA 1HAOH 1P11E 1Q2WA 1SHYA 2FX6A 3LKWA 4ABHA 1UTJA 1GJDB 2OC0A 4F4OC 2RDEA 1ZHMA 3RXVA 3HATH 3M5OA 3SV8A 1NTPA 1P01A 5T1VA 1JMOH 1TPPA 4LOYH 1NESE 1GGDB 3RXMA 2WYJA 1LVYA 1TGNA 3TJOA 1F0TA 1E1RD 3VB4A 4Q4LA 4B76A 2OINA 4DT4A 2FOHA 4CH2B 7GCHG 4FU7A 1JOUB 4Y79A 3E8LA 3PRBA 1G2MA 2I6QA 1XX9A 1BB0B 2FESH 1EOLA 2GX4A 3PB1E 1D3QB 1INCA 1BHXB 2HWLB 4GUXA 4R8TB 1IQHA 2ZGJA 4FUIA 4X8UH 1C5YB 1BTPA 2LNCA 3VXEH 3U1IB 3KL6A 4H4FA 4MTBA 2IN2A 1V2VT 4DIHH 3T2NA 4AGJA 1K1JA 1TWXB 4SGBE 2ZNKH 2JJ2D 3TJVA 3H5CB 1HAVA 1TGBA 3ZV9A 2ZHEH 4GCHG 3MQKC 1MZAA 5A0CA 1GVKB 1TMTH 2ZI2H 4IW4E 4MNVA 4O3TA 2K7XA 1DM4B 1SPJA 3Q3XA 1O39A 1GCTB 2WPLS 1C9PA 2ZCKP 4U01A 2IOTA 1Z7KA 3DD2H 3A81A 1ESTA 5E8EH 1TX8A 4D8NA 4YOIA 3NCLA 1FY1A 1RFNA 1ZTLA 4M7GA 1SOZA 5I46H 4TWYA 7GCHF 2ZGBH 2P94A 2FO9A 2P3UB 2HLDD 1VITH 1UK3A 1BCUH 1C2LA 1MTUA 1MU6B 1QURH 3TLOA 5AF9H 3MOCA 3SGQE 3KQBA 1ELDE 2OTVA 1A0HB 4E05H 3K65B 1MQ5A 2G4UA 2BD3A 1SL3A 2GD4B 2J9NA 1C2DA 2XOKD 3LC5A 5A8XA 1BOQA 1B0EA 4Q7XA 1ZGVA 3RXCA 1GBTA 2ULLA 7KMEH 3PYHA 2STBE 1V2TT 1O3EA 4IMQA 1A5HA 2WV9A 2J4IA 2VJ1A 1S6FA 4K69A 5B6LA 5DKMA 2H5CA 3TH4H 1C1MA 1YLDA 3KCGH 1CA0B 4CR5A 1H8HD 1V2JT 1C5LH 1MTNB 3A8AA 3H7OA 1GBMA 1NN6A 2QE7D 1DSUA 1TMBH 1CT2E 1S6LA 2P8OB 2H9HA 1WTHD 2JETC 1FV9A 3FKSD 3ZIAD 1TNGA 1QA7A 1Y3WA 1C4V2 3RXTA 1KYNA 1GJ6A 2GCTB 1ZTKA 2BOKA 3W94A 3VB5A 4I8JA 2B9LA 3F9HA 2ZKSA 1C5ZB 3KIDU 4XRNA 1AVXA 1V2ST 1OSSA 5E2OA 4BXSA 1ELGA 2UWOA 2K8IA 1K1MA 1WCZA 3RXJA 4ZMAH 3UIRA 1Y3VA 2FOMB 3EQ0H 2XXLA 1T8NA 2Q6FA 3UFAA 3TJUA 1GI4A 3E6PH 4K2YA 1TB6H 2ZEBA 4K1EA 4FUHA 1KXBA 3DCLA 2GDEH 2TRMA 2BZ6H 1D6WA 1YPHC 4D7FA 3HGNA 4NSYA 3QN7A 5EJZA 2Z9GA 2ODYB 4IN1A 5CMXH 1EFRD 3VEQB 3GISB 5F6MA 1Z6JH 2BZAA 2TIOA 1MKWK 1GI2A 3LJJA 5DP8A 5EOKA 2UUFB 2VNTA 3LIWA 1L2EA 1PPZA 3M3SA 3P8OA 2HPPH 5L6NH 1VGCC 1UJ1A 2C8YB 2M5TA 5DK1A 4ZCNA 4I7YH 1TNLA 2BDAA 2SGAA 4XSKU 2ZHDA 4FUFA 1TRMA 2ZWLH 1DUAA 3A83A 1IQGA 1FMGA 3ZZ5A 4ABIA 3UOUA 4XE4A 1S0RA 1E34B 4DURA 3PLBA 1KTTB 2FMJA 3A8CA 1FAXA 1P0SH 1B5GH 3RXQA 4MPVA 3GS9A 5EG4A 2FDAA 1Z71A 1K21H 2TGPZ 4JMYA 2XBXA 3MNCA 1SGCA 2VIWA 4B1TA 1GBEA 4TY6A 2FX4A 1P02A 2V3MA 2G52A 1IQNA 1SGTA 3F1SB 1ZSLA 2A2XH 4AFQA 4DVAU 1DITH 1O3JA 5DP9A 1L4ZA 3AK5A 1V2RT 1DVAH 1O2LA 1PPFE 3MU4A 3RXGA 3UWJH 1E79D 4VGCC 1F0UA 4BNRA 5E2PA 4NZQA 1L0ZA 4DT7B 1W0ZU 1V2NT 1QRZA 3DFJA 3E16B 1YCPH 2FOCA 2ODQA 1A1RA 2ZF0H 4ACAA 1O3NA 3DT0H 2ILNA 1O2QA 1YPEH 2LELA 4Y7BA 2B7DH 2C4FH 2J95A 1OYTH 1N1LA 3MTYA 4X1QU 5DSFA 1MD8A 2B8OH 4Y76A 2HVXA 3QTOH 3SGBE 2BY6X 5DO4H 3EA9A 2A7JA 1LQDB 2WUCA 3ZZAA 5HM9A 4AOQA 1MCVA 1V2OT 2BQWB 2WINI 4KGAA 1O33A 2ZDKA 1TA6A 1BZXE 1O3FA 3UQVA 1GHXH 2VINA 3PRDA 3MYWA 2BHGA 4XDEA 2GVFA 1WUNH 1K28D 2F9VA 2WPJS 1ZMLA 1ELVA 4VGCB 4O3UA 1BJVA 1NFYA 4JYUH 2PUQH 1PQ5A 3GY3A 4JYTA 2ZFQH 2A32A 4X8VH 2FOEA 1T4UH 5TCCA 3UOPA 4JZEH 2XW9A 4WH6A 1GI9B 1MKXK 1UVUH 2WPDD 3RXAA 2FTMA 1GBIA 2BVRH 3SHAH 5ETXA 4OS6A 1TE0A 3VB6A 4ZKNU 1O3HA 1UMAH 2BLQA 2FTLE 2ZCLP 3ZZCA 2Z3DA 2JH6D 1CA8B 2V7QD 3O8DA 2FP7B 2A1DB 1F92A 2QXGA 1G3BA 1DWBH 1CQQA 2PGBB 1SLXB 2K0QA 1IQFA 3U28C 2QF3A 1GBLA 3GICB 1CU1A 3B23B 7ESTE 5I25A 1XKBC 5EPYA 4DJZB 2HPQH 2Y5HA 4P02A 1EB1H 4BAOB 4MPWA 1S5SA 3RXKA 4GVUA 1UTQA 1L1GA 4XFQA 2QXHA 4I32A 2UUKB 5LGOA 1H1BA 2ZQ1A 3RXIA 4MNYA 2VWOA 4OS2A 4ABAA 1HJAB 4O97A 1FY4A 3E91A 1AZZA 4XOJA 3SORA 2OLGA 4OS5A 1DDJA 3KQEA 3O8BA 2A4GA 3K9XB 1UTLM 1BHXF 3FFGA 3F9EA 1KIGH 1PQAA 1SGNE 4GSOA 3ZVBA 5FCRA 2G81E 1DWEH 1P8VC 3RMOH 4MDSA 1MKWH 1Y3XA 3BN9A 3HK6B 1AY6H 3DA9B 3U98H 1QIXB 4KTUA 3DUXH 1EZQA 4D76A 1THRH 4ISIH 1XUHA 4X0WU 4YTAA 1PPEE 1GJ8B 1ETSH 3DSGA 3GY7A 1TLDA 1C5NH 1RS0A 1SQAA 4NA8A 1GJBB 2B0FA 5F8TA 1PFXC 5F8ZA 1WV7H 4GPGA 4P00A 4CRFA 5FPTA 1FPCH 4Y10E 4ZKSU 4HI3A 2GT7A 1KDQA 4WMDA 4I8KA 2UWPA 5JBAS 4WMEA 6CHAB 1FX0B 3KN2A 1AQ7A 1EKBB 3M35A 3SHCH 1ARBA 4ISOA 1AB9B 4DG4A 3F2GA 2V3OH 4M9FA 5HIYA 3V7TA 5JBCS 1IQKA 3EBNA 3KYGA 2F9PA 4JZDH 1QB9A 1O2NA 5T6FA 1YC0A 2OBQA 5C17A 2Z9IA 5T6DA 5FXLA 1HUTH 3W1EA 2P59A 4RKOB 1LPZB 3MI4A 1DT2A 4Y71A 2XNDD 1JRSA 2M2AA 2P93A 1MH0A 4IC6A 4B71A 1GBBA 2PP6A 2IJD1 2GP9B 3GCHC 1YGCH 1FIWA 4ISNA 1BRCE 4YOGA 5H4IB 5AHGH 4ZROA 1W0KD 2FOFA 3SNEA 1ANDA 2PKAB 4ZAEA 2XC4A 1LPGB 5EQSA 1DXWA 2ZFFH 3PLKA 3VG8A 1CGJE 2SGPE 5ABWA 4YZUA 3MU0A 3E0NB 3GY2A 2AGIX 1RRKA 3A7TA 2RDLA 5DPAA 3RXRA 2AMPA 3AW1A 1BTXA 2L74A 1HPGA 1QZ8A 1J8AA 4RT1A 1AI8H 1IOEA 3SOSA 4RI0A 2FOBA 4I8LA 2GMTC 1IQEA 4FOUC 1QL8A 2JDID 3QK1A 1J17T 1FAKH 1TMUH 2PGQB 2D26C 3FOAA 2NU4E 3S7HB 2WPMS 1C2KA 1FNIA 3SNCA 1MKXH 2F91A 3ODFA 1HBTH 4K5ZA 2STAE 3LGYA 2ZGCA 5T6GA 2V35A 2PV9B 2KR7A 1WDIA 1GMCF 2ZDMA 1NC6A 2H6MA 3PWBA 3BTME 1N6YA 2J98A 4DGJA 4LZ1H 1QQ4A 3GOVB 3RMMH 4AFZA 5CHAB 1A5GH 1UTPA 2ZHQH 3SNBA 1C5UA 1KTSB 1UVPA 2J92A 1ABIH 4INKA 1O34A 2GKVE 1L4DA 3FANA 4AB9A 5FX6A 9LPRA 1KXAA 4LZ4B 4Q2KA 4BOHA 1NPMA 2J98B 3LJOA 3I29A 4HZHA 3MO9A 3SNAA 2KCAA 5A2MH 2F4LA 3M5LA 2RG3A 4FU8A 3EE7A 2W26A 1H8IH 2AMQA 4CRGA 1UO6A 1NRSH 1UHBB 1HXEH 1MTSA 3TU7H 5C0TA 1VZQH 3ZVCA 2FOGA 1ZGIA 1YLCA 1V2UT 1DOJA 1LCYA 1MABB 3R3GB 3LONA 1C5WB 1ZMJA 2G00A 4B75A 3OAAD 5C5OA 3I77A 5IYTA 1BMFD 1AFQC 1G32B 3MNXA 2G8TA 2ZFSA 4A92A 3M36A 4CRCA 1RXPA 1Y5AT 2Y5FA 3LDXH 2CF9H 3LGWA 3PV2A 1TPSA 3LGUA 1HAHH 2WPHS 3A7YA 1OWJA 2KCPA 3M7QA 1ZRBA 3ZZBA 3RXOA 1DX5M 1AWHB 1RGQA 4X1SU 1V2KT 2CGAA 2VIVA 1H8ED 2F9OA 2HNTE 2Z7FE 1S84A 4H6SB 2W3IA 4B6FA 1XUKA 2CXVA 3UNRA 5EGMA 3IITA 4ABEA 3SU4A 2FOAA 3GDSA 1Q3XA 1SLUB 1TGSZ 3T29A 1AN1E 2W6JD 3N7EA 2OK5A 4MPUA 3S9AA 3RU4T 1O2IA 3LH3A 3ZVEA 1SI5H 1Q31A 1O2XA 1ZPCA 3WWBA 2BX4A 1HAIH 3PLPA 1CT0E 3PMBB 3CNRA 2TGTA 1V2PT 4THNH 1O36A 4B2BA 1UVOA 8KME2 2AYWA 3A80A 1FPHH 1O38A 4CHAC 2XWBI 2QAAA 5HGGA 1WSSH 1K2I1 4BAMB 4Z1MD 4AG2A 5JYIA 3A8BA 1TGTA 3BG4C 1TX7A 1YYY1 4I33A 4X2YA 3PMAB 1TOMH 2BD4A 3PMHB 2ZU4A 1CBWB 1O5AB 2ANMH 3HKIB 1RD3B 2O9QA 3SI3H 4U2WA 5J4SA 3E3TA 1BTYA 1SSXA 1EP5A 2O8WA 1O2YA 2Z9KA 2BY7X 1EASA 2DE9A 1G37A 2GTBA 2GT8A 5EQQA 4BXWA 1O5EH 2RA0A 1XUIA 1O5CB 2BLWA 2KCYA 2W3KA 4Y0ZE 3M61U 5E0GA 3RXDA 1F0RA 1XUJA 2PSXA 1IQIA 2J94A 4CHAB 3ZVFA 2OC8A 3QX5H 3PV4A 1O5DH 6LPRA 3GY6A 4D9RA 4DY7B 2FIRH 5FPYA 1HIAB 1IHTH 2ZFRH 1C5RA 4AORA 1OOKB 4NA9H 2BQ7B 2PSYA 3RP2A 2FODA 2A7CA 1YF4A 3GY4A 4WXIA 2AIQA 1GI5A 1C2GA 5FAHA 1VCWA 1SLVB 1Z8RA 3F2HA 3TGJE 1C5VA 1O3DA 3T5FH 1QBOA 3LGIA 4JYVH 1W0YH 2AMDA 3U69H 1OWHA 2VB0A 3SV7A 1AIXH 1T31A
chains in the Genus database with same CATH topology
2OUAA 1DY9A 1D4PB 3LOXA 1MTVA 1XVMA 1HAXB 1M9UA 3P92A 4NA7A 1S0QA 5DP5A 5PTPA 4IGDA 5JPMH 2SGDE 2BY5X 2QYIA 4CBNA 1FJSA 1KXDA 2CHAC 5ESTE 4ESTE 1FN6A 1GCDA 2A2QH 1O3LA 2BTCE 1CHOG 1KXFA 4MG3A 3NZIA 3RDZA 1AUJA 2VVCA 3UTUH 1F0SA 1OX1A 3RC4A 3MNBA 3SI4H 1RTKA 1BRBE 1EPTC 3QGNB 4MNXA 3STJA 4AGKA 3SN8A 1DFPA 1DICA 2O8MA 3RXFA 2QN5T 3NPSA 1EJAA 3LC3A 3ELAH 2Y6TA 3BIUH 2A45B 3SGAE 4YOJA 4BAHB 2P3FH 1SGQE 1NRRH 4MPXA 3KQDA 4SGAE 4IBLH 5LPEA 2TBSA 1TPAE 5JBTA 5B6OA 2NU1E 1NRPH 2CHAB 2H5DA 2A5AA 1ESBA 1SFQB 4UFEH 1GVZA 1LKBA 2ZTXA 2CN0H 1ELAA 1FY5A 3RM2H 1EZUC 4D9QA 4NFEA 3FP6E 1GHYH 4O9VA 2TPIZ 2WPIS 1CHOF 2AGGX 1FQ3A 4DW2U 1EAUA 3ZZ6A 1MMJN 2OC7A 3U8RH 1TIOA 1O2ZA 1VJAU 1BBRK 1KXEA 3A84A 1EX3A 1RTLA 1UVTH 3QTVH 1BMAA 1GL0E 3SQHE 1C2IA 1JBUH 5JBBS 1G3CA 1ACBE 3OU0A 4BAKB 1FUJA 1D3PB 2R2MB 4ZUHA 1K22H 3RXBA 2ZGHA 2ANYA 2ODPA 3GCOA 3PMJA 3MWIU 2JETB 3F68H 3QUMP 5DGJA 3UQOA 1GJ5H 1C1NA 2BX3A 5A0BA 1A46H 3SU2A 1AZ8A 5JB9S 3OX7U 2ANKH 3TH2H 2BY8X 3T27A 1GHZA 3RMNH 1EUFA 2PLXA 1TNKA 3ZVGA 1ESAA 1FY3A 1MUEB 2BLOA 1ZZZA 2UUJB 2C8WB 3OYPA 1P9UA 1KXCA 1KLJH 1XXDA 3NK8A 1A2CH 3IG6B 1ZSKA 1JWTA 1EZSC 1NS3A 2BD9A 4RSPA 2ALVA 4JZ1A 8ESTE 3E90B 1NT1A 1Z8IB 1PPHE 4U32A 3M3TA 1W8BH 2ZP0H 1S85A 1EP6A 3SU1A 4TPIZ 1H9IE 1FZZA 4I8HA 3A7VA 3GYLB 3LU9B 4FUEA 1NFXA 5TCAA 4ZHMU 1OP2A 2PUXB 2OQUA 1VGCB 1P03A 1QR3E 2JH5D 2QC2A 3UPEA 5C1UA 3TGIE 1HJ9A 2AS9A 4E06H 1GG6C 3C27B 3TPIZ 3T62A 4ABJA 1YPMH 2LPRA 1OKXA 2R3YA 1F5LA 3GDUA 1ZMNA 4Z6AH 2AH4X 3RXLA 4ZHAA 4ABFA 3PTBA 3HKJB 4AYYB 5C20A 1HFDA 3L3TA 3BSQA 1QNJA 1D9IA 1GL1A 1V2LT 4MQAA 3VGCC 3E1XB 2V6NA 4INHA 4INLA 3PTNA 1QJ1B 4A7IB 3IWMA 4OGXA 1D3DB 2ZO3H 1GBCA 1DSTA 3KNXA 3MO3A 5C67A 1GI3A 2W7UA 3SJIA 4Q7YA 4WXVA 1O2UA 1OWDA 2EI7A 2ZC9H 2BDHA 1SB1H 2F9UA 3FZDA 5GIBA 3MU5A 3NKKA 1NU7B 3N7OA 2YOLA 2ZHFH 1C1OA 1J9CH 5C1YA 1O3BA 1C1RA 4UDWH 4NZLA 4A1XA 1NROH 1WBGB 2OQ5A 4E7NA 1C5PA 1T8OA 4J1YA 2GZ9A 1GI0A 3VGCB 3CP7A 1UTMA 4K8BA 2Q1JA 1SMFE 1BUIA 2Z3CA 1K1NA 4AFUA 1W3CA 2I6SA 5HMAA 2CV3A 3UWIA 4GHQA 2ZDVH 3B8JA 3A8DA 5DP6A 4Y7AA 2BDBA 4H6TA 5DP3A 3MNSA 4Q7ZA 4DOQA 1HGTH 3OY6U 4RN6A 1HB0B 5LH8A 3GCTF 4XBDA 2VVVA 3EDXB 1BBRH 2QV1A 1LMWB 1MAXA 1N6XA 4KP0A 1VCQA 1NRNH 2SFAA 5EODA 2QF0A 1C1UH 4ABBA 5HYOA 3GDVA 1ZSJA 1UK2A 1D3TB 1W13U 4BANB 1ZHRA 1LVMA 1MBMA 5E0JA 1O3PB 3A86A 2PTCE 3AAVA 3Q3KA 2G5VA 3TITA 1SBWA 1BMMH 2K1QA 4GLYA 1O2TA 2BD8A 4ZHLU 1C1VH 1ID5H 1W11U 1F7ZA 1TQ0B 1FIZA 3PM3A 4KTCA 3ZZ9A 4Z0KA 2ZZUH 4Y8YA 1HXFH 1OP8A 3RC5A 1O2HA 3ZV8A 1P06A 4O03A 5GXPA 5L2ZH 3ZVDA 2ZU1A 3D62A 3E0PB 1ARCA 1BBRE 1P2MA 3SJ8A 5GCHG 1Z1JA 1P2JA 1BTZA 3BTKE 3A88A 3RM0H 1PPBH 4YM9A 3PWCA 2H2ZA 2FXRA 1SG8B 3HPTB 1TYNA 3FVFB 1O3KA 1GHAG 1L1NA 1ZJDA 1O3AA 3MH6A 1O2VA 2Z3EA 1TQ7B 1O30A 3UREA 1AHTH 3RXPA 5FCKA 2Y7ZA 1ELBA 3FZZA 4X1NU 2AGEX 2Z9JA 1E35B 1KLIH 1HAPH 2R0KA 1WYKA 2XC0A 1FN8A 2SGEE 3UNQA 4X8SH 3UNSA 1GJ7B 4KKDA 1ZYOA 4ZKRU 1EATA 1NM6A 3VXFH 1FLEE 4CBOA 1IQJA 3ZYEA 5GCHF 4CRBA 1GMHG 4UE7H 1C2FA 5A8YA 3ZZ8A 1CHGA 1QFKH 1O3IA 1TNIA 3LH1A 3Q3YA 3A87A 4YT6H 4IC5A 2WPKS 2HRVA 4FUJA 2PKAA 3EYDA 1ORFA 2FS8A 1SVPA 1SC8U 1GHAF 2WV4A 1BDAA 1MU8B 3ATKA 1RJXB 1ANBA 3BTWE 4E7RG 1GMCG 4F49A 4CR9A 1LHFH 1SGDE 2GZ7A 3BEFB 3DHKH 2NU3E 4K3JA 2BYAX 2FI4E 1WTGH 5ESBA 3V13A 2C90B 1QBVH 2XBYA 1QQUA 1GHWH 8LPRA 2XBVA 2AFQB 1QGFA 5EXMA 9ESTA 1AD8H 1GMHF 2C93B 2NU0E 3EAJA 1P57B 3RUOA 4FUDA 3M7UA 4BAQB 1A61H 1THPB 1C4U2 4A6LA 4LK4A 2H1UA 4D7GA 3GCHB 1N8OC 4X2XA 4YLQH 4NWLA 1P12E 1HDTH 3FP8E 1EXFA 2FI3E 4H42U 4J2YB 1ELEE 1O3GA 4Q80A 1GBJA 3NXPA 1SOTA 1A7SA 3GCNA 3AAUA 3Q76A 1OXGA 2A0QB 5EW2H 4OS7A 1EB2A 1PQ7A 2VH6A 1YKTA 1VITF 1XUGA 2JH0D 4I31A 1SHHB 1AKSB 5AFZH 1HAYB 2HALA 1IAUA 4RKJB 3A7XA 3QLPH 2R0LA 1UHBA 2GMTB 3BTQE 1C4Y2 1P09A 4UD9H 1TRNA 5GPIB 1IQMA 1LHCH 1AWFH 1CGHA 1HLTH 2FYQA 3A82A 4MLFB 1JIMA 4YLUA 3M5MA 4GAWA 5C5NA 1Z1IA 1C9TA 2PW8H 2D2DA 2GCHF 1ANEA 4KELA 4B74A 1BA8B 2VH0A 3Q00A 1UTOA 2ALPA 3ZZ3A 1C5TA 1NO9H 1C5QA 3JZ2B 1MTWA 3BF6H 1QCPA 1Z8JB 5EXLA 2BY9X 4WWYA 4JZFH 3LGVA 1KLTA 2FWWA 6GCHG 3RXEA 4KTSA 3PO1C 4TY7A 4OGYA 3S7KB 1DWDH 1AUTC 5IDKA 4X2VA 5FX5A 4DIIH 1QHRB 1CSOE 1FONA 4ISLA 2QIQA 3M3VA 3QWCH 1WOFA 2Z9LA 2THFB 1ZRKA 3I78A 3UY9A 2QY0B 1TAWA 1ZLRA 4XBCA 5F8XA 1GJ4H 1GGDC 3M37A 2DE8A 1BTUA 3T26A 1AFQB 4JK6A 3RXUA 1C2MA 3SUGA 3BTDE 5DG6A 1A0JA 2HNTC 1GHBG 3WY8A 1B0FA 1DXPA 2D1JA 4NSVA 4IN2A 5F03A 1HCGA 6GCHF 1A5IA 3P8NA 3SU6A 1UK4A 2ZTYA 6ESTA 1SFIA 1PPCE 2KAIB 1J16A 4CREA 1BMLA 1YBWA 5DJ7A 4XBBA 1DY8A 2BVSH 1GJCB 3KEEA 2WV5A 2ASUB 1O32A 3ZVAA 2BOHB 1UVSH 4BTTB 4OS1A 1QA0A 3SJ9A 2VU8E 1MCTA 4PROA 1GCTC 3BIVH 1C5SA 2ZGXH 3GY5A 4JK5A 1FDPA 4BTIB 2CF8H 2EI6A 1SGFA 2Q6GA 4WVPE 2ZHWH 1LHEH 1HAZB 1GHBF 1EQ9A 4WJG2 2F3CE 1HIAA 1W7XH 5EU8A 3TJNA 5AFYH 1YPKH 2PFEA 1TBZH 3SJKA 2XC5A 4QT8C 5DP4A 2BDIA 1EJNA 3VB7A 3BG4B 4ZKOU 4Y0YE 3MU8A 3TK6A 1E36B 2ZIQH 1EJMA 1RIWC 3Q77A 2V0BA 2A4QA 4X2WA 3U8OH 3SZNA 1LPKB 3RU4E 2ZA5A 5C3NA 3G01A 4Y6DA 1GBKA 4WMFA 3ZZDA 3C1KA 1TRYA 1TALA 2NU2E 1A4WH 1GI1A 3P17H 1HAVB 1Y5UT 2BD2A 3GYMA 3VPKA 1C2HA 2IPHA 3CS0A 1LQEA 3SUDA 3ATIA 3K6ZA 1YCPK 1BTHH 1C2JA 3ODDA 3A85A 1LHDH 4UFDH 3S9CA 1CA0C 1AE8H 5AVDA 1QBNA 5JDUB 2FLBH 3D23A 1O0DH 4CRAA 1GDUA 1MTNC 3KQCA 3BTHE 1AFEH 4I8GA 1MD7A 1RIWB 4UFGH 3K2UA 2P8OC 4A1TA 4NG9H 1VCPA 2C8XB 2R2WU 3TH3H 1O5BB 5DP7A 4GCHF 4LXBH 3BG8A 3S9BA 3SU5A 1ZPZA 2GCTC 1DPOA 1GWAA 3SU0A 5HM2A 4B2AA 2SNVA 1EAIA 1TGCA 1JRTA 1GDQA 1P2OA 1EZXC 1TBRH 2BM2A 2EC9H 5GDSH 3SW2B 5CE1A 4Y8XA 1NU9A 5L30H 1BT7A 1PQ8A 1UCYK 1BQYA 1SQTA 2VWNA 1DANH 3A89A 3U9AH 4IS5A 4U30A 1F2SE 1EPTA 4UFFH 1C5XB 2FYRA 2RA3A 2W7SA 1TA2A 1O3CA 7LPRA 1ETRH 1HAGE 4ZXXH 1SGIB 3KF2A 5BPEA 1GI6A 1P2QA 1C1QA 1EPTB 1NZQH 4ISHH 3SJOA 1O2KA 2Y80A 1OWKA 5A8ZA 1PPGE 1CT4E 2R3UA 2XCNA 2PTNA 2SNWA 3SQEE 5L2YH 2JKHA 3OSYA 1YPHE 5FBEA 2FPZA 1C5OH 2LIZA 2UUYA 3MHWU 1UTKA 1KY9A 2TGDA 3S0NA 2XWAA 1QRXA 1TOCB 2ZG0H 3SNDA 1SGEE 2F83A 3QGJA 1O3MA 2ZU5A 4NIYA 2P95A 3V0XA 5K0HA 1J15A 2GV7A 1O2SA 3T28A 1QRWA 1E38B 2GDDA 3SU3A 1W2KH 2G4TA 2A5KA 3LT3A 3MH7A 2F9BH 5FBIA 1TABE 4K8YA 1ELFA 2ZU3A 2Z6BD 1C1TA 1Z8GA 4FVBA 4K1SA 1J14A 1GHVH 2ZCHP 3SV2H 4NWKA 3F6UH 3A7WA 1BMNH 2Y7XA 1BRUP 3BV9B 1DLKB 1XUFA 1V6DA 1TX6A 2VIOA 4NFFA 2BQ6B 5GJ4B 1YPLH 3KHVA 1LVOA 3W95A 1SR5C 2QXIA 3QZRA 1P2NA 4B2CA 1GI8B 1RTFB 2G5NA 5EQRA 3SUEA 3UR9A 2RCEA 5K7RA 3QDZB 5JB8S 2EEKA 3D49H 2BLVA 1A3BH 5FHTA 3SO3A 2A5IA 2WYGA 3URDA 3RLWH 2Y5GA 2QA9E 1T32A 3ATLA 1V2WT 5TJXA 4X8TH 3V3MA 1V2MT 2AIPA 3TGKE 1QL7A 4A1VA 3EGKH 1ZTJA 1E0FD 2J38A 1SLWB 3AASA 1VJ9U 1BRAA 2O8UA 1P05A 2O8TA 4CH8B 3H7TA 2H9EH 2OCVB 1O35A 1YP9A 3RLYH 3M7TA 1QB1A 2WUBA 1GMDG 1O5GH 1HNEE 1C2EA 1AO5A 3O8CA 1U6QA 2BDGA 1NFWA 1YM0A 2ZPRA 3BTEE 3P8FA 1NFUA 1DLEA 4X6OA 2A4RA 1O2RA 2BB4A 1GG6B 4ABDA 3ATWA 4TPYA 3VFEA 3RXSA 3GCTG 1QJ7B 3TNTA 1TNJA 2VGCC 1O2PA 1F5RA 1P2KA 1S6HA 1SGYE 3R0FA 3DFLA 3M5NA 2G51A 1GBFA 4X1RU 3HGPA 1L1JA 1T7CA 4GHTA 2XRCA 2C3SA 3T25A 1O2JA 4AB8A 1XMNB 2O8LA 1C1WH 1QJ6B 3U8TH 5G4BA 1CGIE 1LO6A 2UWLA 1OWEA 1UTNA 2BDYA 5A0AE 1DWCH 5T3HA 1GMDF 2VIPA 2A7HA 2FM2A 2ESTE 2OP9A 1OS8A 1PYTD 3D65E 3SUFA 1UCYH 1HJ8A 1Y8TA 1G2LA 1HYLA 1WQSA 1EAWA 2ZDAH 3ESTA 4FUGA 1S81A 1X7AC 2OC1A 1AGJA 3F9GA 5E0HA 1HJAC 4YO9A 2SGQE 2FS9A 3BTGE 3TK5A 1SGFG 1WQVH 2VGCB 4HGCA 2G55A 1MAYA 1GBDA 1O2MA 3ATMA 1SGPE 2TGAA 3TVJB 4B73A 1G30B 1ANCA 3BTTE 3FP7E 1T4VH 1AU8A 2GZ8A 2R9PA 3ENSB 3MH5A 1QY6A 1O37A 2V3HH 3UUZA 3FAOA 8GCHG 1OWIA 1Y59T 2IJOB 1LHGH 2Y82A 1GDNA 1ELTA 5SGAE 3JZ1B 1YCPM 3NUMA 3P70B 1UCYE 4K60A 3S69A 3BTFE 2ZFPH 1K1LA 4ABGA 1DUEA 1LVBA 1EAXA 3F9FA 2Y81A 2CJIA 2HNTF 1E37B 2C8ZB 5LPRA 4A5TS 1ZHPA 1S82A 1DS2E 1CO7E 3ZYDA 3RXHA 4OS4A 3KGPA 1K1PA 1IHSH 1T8MA 1OPHB 3K6YA 5C2ZA 1O2GH 4NGAH 4X1PU 3ZZ7A 2FLRH 2DUCA 1MZDA 6CHAC 2BD5A 1VR1H 5EXNA 2FI5E 1AB9C 3VB3A 1P2IA 1CE5A 1O2OA 3ITIA 8GCHF 2XNIA 2P16A 3STIA 4JZIA