2Z3EA

A mechanistic view of enzyme inhibition and peptide hydrolysis in the active site of the sars-cov 3c-like peptidase
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Replicase polyprotein 1ab (pp1ab)
publication title A mechanistic view of enzyme inhibition and peptide hydrolysis in the active site of the SARS-CoV 3C-like peptidase
pubmed doi rcsb
source organism Sars coronavirus
total genus 85
structure length 306
sequence length 306
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2007-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2z3eA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2z3eA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2z3eA02
4F49A 3KHVA 5A8ZA 1V2LT 1QRWA 5EXNA 3T5FH 1GBFA 4AFZA 3F68H 1CHOF 1DWCH 4NA7A 1AMHA 3ESTA 2SGQE 2ZHQH 2J2UA 1RD3B 2F9BH 4WY3A 3A7VA 2LNCA 1LPKB 3LC5A 3UUZA 1GWAA 1O2GH 1O2VA 3QTOH 2FDAA 1TPOA 3MU1A 1E38B 3BG4C 3GDUA 1GJ6A 4H6SB 2CF8H 4D8NA 1HBTH 3VEQB 3NPSA 5C5NA 3UWIA 1TALA 1V2WT 1ARCA 4CRDA 4GLYA 4ZAEA 1JIRA 1EPTC 1BOQA 4U30A 2WUCA 1FN8A 4XFQA 4AN7A 1ZYOA 1GHBG 3BTEE 3SU0A 3A81A 3BG8A 5JPMH 3RXDA 1MD7A 3E91A 4U01A 4CREA 1MAXA 2O8UA 3AASA 1DLKB 2JH6D 5A8XA 1SC8U 1DT2A 3KN2A 2FOHA 3A8DA 2YNAA 4Y7BA 4O03A 4B2AA 1N8OC 3R0FA 3GISB 2CJIA 1EJAA 1FPHH 2G52A 1NRPH 1U6QA 4WJG2 2Q6DA 1F5LA 1EP5A 1XUFA 2WYJA 5DK1A 3TIUA 1SGFA 2R9PA 4NCYA 3KF2A 1GI0A 2ZFQH 1C1VH 3RXOA 1ZRKA 2I6QA 2P94A 1ELAA 1V3XA 3HK3B 1TGBA 4Y79A 5DGJA 1Y3UA 2ZU4A 4H42U 1DOJA 2FO9A 3ATKA 1NT1A 1TNLA 4BTIB 3AW1A 1C1WH 1S81A 1NRQH 4UFDH 4BANB 1MUEB 1C4U2 2QY0B 5EGMA 1C1TA 1KXAA 1V2ST 1ZPCA 5GDSH 2R2WU 2AMDA 5C3NA 3MU8A 2FOFA 1WOFA 2TRMA 1BJUA 2R2MB 7ESTE 1B5GH 1AFQC 4ABBA 4K69A 4NA8A 4IW4E 5FX6A 2ESTE 5GPIB 5FCKA 4CR5A 2ZGHA 3RXGA 2GMTC 3NUMA 3PROA 3RC5A 2NU2E 1DANH 4WMFA 1EZSC 1Z7KA 1JRTA 1A61H 3ODDA 1LPGB 4DT7B 3PO1B 2FODA 1E36B 1T8LA 1C1UH 1P2KA 4Z0KA 3TGIE 3EGKH 1ZMLA 2YOLA 1H9HE 4CRGA 1WU1A 1KLJH 1O3OA 2FTMA 1L0ZA 1BTWA 1O36A 3NK8A 4DOQA 1C5LH 1EOLA 4X6OA 3W94A 1QA0A 4OGYA 5DP5A 1TABE 3E16B 1P05A 1NU7B 3LOXA 1GJ5H 1DS2E 3BEFB 1TOMH 3MU0A 1SQOA 4NWLA 1Y3XA 3A84A 2K7XA 5EXMA 1QB6A 1FONA 1C1SA 4IBLH 1GMDF 2AIQA 3MO9A 4JYVH 3GCNA 2GX4A 3P17H 1T8OA 1O3MA 2ANWA 3ATMA 1HGTH 1HYLA 4I7YH 1PQ8A 1WTGH 4JK5A 1J8AA 5HXFA 2V3HH 4AORA 5TJXA 3STJA 1CSOE 2ASUB 1QIXB 1O2ZA 2BD3A 1BA8B 2XBXA 1V2QT 2OCVB 3GCOA 4O97A 2CGAA 3HPTB 1YF4A 1P01A 3OU0A 1GJCB 3RXQA 4E05H 2FXRA 2ZU2A 2JH5D 2FOCA 2A31A 5DJ7A 2J95A 3A82A 2B7DH 3PO1C 1O5BB 4E06H 2QC2A 1AE5A 2PKSB 2FIRH 1SHYA 4VGCC 3MH5A 2GZ8A 1S82A 2AIPA 2PSYA 3V3MA 1BTXA 5J4QA 5HYOA 2ZHWH 1AVXA 1KXFA 1YPKH 3GICB 1TQ7B 2BY9X 1IQGA 3RU4E 3C1KA 4MDSA 1HJ8A 3DD2H 4Q7XA 1V2RT 2BVSH 1HAOH 3U98H 1T8NA 3PMJA 1Y3VA 2Y5FA 1GHAF 3SV8A 1BTUA 4TYDA 4NA9H 2QIQA 2ZGCA 5T6DA 3RXMA 1HAHH 2OC8A 1XX9A 2FI5E 1GDUA 4K3JA 3RM2H 2BQWB 4MPVA 3K6ZA 2C93B 2F9OA 1BB0B 4FUGA 5JBTA 1C2KA 1G3BA 1PPCE 2V0BA 1W13U 2XNIA 1E0FD 2BDAA 3PMBB 2CHAB 3KQEA 2PKAB 3F9EA 1SLXB 1P02A 1GBHA 3RXVA 1FIZA 3SNEA 4X6PA 2O8MA 1ZGIA 3F9GA 4Y11E 3LGIA 3GY4A 2XXLA 4O3TA 1AU8A 1NC6A 5A09A 1DWBH 3GY5A 3TU7H 1ZGVA 3NKKA 1G3EA 2PUQH 4ZHLU 1A3BH 7LPRA 2BLOA 2P8OB 1OPHB 3PM3A 2FWWA 1MQ5A 2BVRH 2OLGA 1W8BH 2QA9E 5CMXH 2ZNKH 3RXAA 1TONA 1BTHH 1C5NH 3U69H 5FXLA 1YPEH 4AOQA 1A3EH 1GL1A 4X2YA 1H8DH 1O3NA 1IQEA 1KYNA 2BHGA 2YNBA 1CT2E 1NN6A 1ANEA 2QXJA 4BXWA 2WPKS 4I8JA 2TIOA 1B0FA 3ZZ5A 3URCA 4YLUA 4JZFH 1BMMH 3HK6B 1MTNC 1OS8A 4AB9A 1YPHE 4TPYA 2OC0A 3LH3A 1G9IE 1TAWA 1RTKA 4OS4A 1BMNH 5GWZA 4I8KA 3UOUA 1HIAA 1Y59T 3HGNA 1W7GH 2O8TA 4WH6A 4I8GA 5EOKA 1TGSZ 3MTYA 2ZPSA 3LJOA 3VB6A 1PQ7A 2A1DB 4GCHF 1SQAA 1CO7E 1FMGA 1EZUC 8GCHG 1SHHB 1S6HA 5DP7A 3NWUA 1P2JA 4E7NA 1NO9H 1MAYA 3ZYDA 1XXDA 3P8OA 3QZQA 1YLCA 3DFLA 2W5EA 1O2HA 2ZCHP 3CP7A 1MU6B 5FPTA 3SUDA 3SNBA 2TPIZ 3BEUA 1S0RA 2XCFA 5PTPA 4UFGH 1MMJN 4I31A 2AH4X 3O8CA 1NROH 5FPYA 1RRKA 3ZVEA 2ODQA 1O3JA 1MTWA 2JKHA 2GCHF 3RUOA 1Y5AT 1KXEA 1C5ZB 4Y6DA 4UFEH 1AKSB 3MO6A 2ZO3H 1D3DB 3SJ8A 3SU5A 1O33A 3SV2H 3OTJE 2PUXB 2BD8A 3UREA 3E90B 1VITH 4K8BA 2AMQA 1MU8B 3GY2A 1XVOA 1QBNA 1P2OA 1W14U 2HNTF 2BQ7B 4YTAA 1GI6A 2BY6X 1QTFA 2P3FH 1ID5H 2HNTC 1TGNA 1O3HA 3MMGA 2H9EH 4XE4A 3M7QA 1F0SA 2D2DA 1DDJA 3KL6A 3BN9A 3RXUA 4LK4A 5A8YA 5EW2H 1MKXK 1P9SA 3SU4A 1CHGA 1VJ9U 2PWXA 4DW2U 4YOGA 1CGJE 1EPTA 2P95A 1ZSJA 1ZRBA 4BNRA 1SGEE 2BD7A 1O2SA 1ETSH 2HOBA 1CQQA 2WINI 4X0WU 1AZ8A 1ESBA 1GBEA 2ZWLH 2PR3A 3MNBA 2FX4A 3FAOA 2H5CA 1TX8A 5K0HA 1O0DH 3PMAB 1P2IA 3URDA 3PB1E 1YYY1 4JZEH 1C5YB 1QB1A 2QN5T 4X1RU 1F92A 4IMZA 1CGHA 3MFJA 5DP3A 4JK6A 4TPIZ 4BAOB 1BBRE 1LKAA 5HM9A 1DY9A 1GMCG 3PMHB 1XUJA 1GHBF 3KGPA 3UPEA 3DT0H 5A0CA 2HPPH 3QUMP 1VCPA 2ZFPH 4B74A 1C2FA 1RTLA 1TBRH 4CRBA 1NS3A 3VXEH 3BIVH 2ODYB 5EU8A 3VGCB 1QL9A 1NTPA 1O2YA 5ETXA 1QR3E 3RXBA 3SNDA 3Q77A 5CHAC 1FY3A 5EQQA 2CN0H 2VVUA 1OP8A 1XKBC 1GCTB 2V3OH 1E35B 1FNIA 3P95A 1P2QA 3O8BA 1RIWC 3QGNB 1DX5M 3AAUA 1AUTC 2A4RA 4ISOA 4OS2A 4X1SU 1SGNE 4ZUHA 1TGTA 3UTUH 1FAKH 2XTTB 1SB1H 1P10A 4YLQH 1K9OE 1V2JT 4NWKA 1WSSH 4DIHH 1S83A 5TCAA 1SGDE 4ISLA 2UUKB 3STIA 1QL7A 2R0LA 5EPNA 2BD9A 3LU9B 1XVMA 2PLXA 3LGWA 3UNRA 3ELAH 3TNTA 1UHBA 1CBWC 1OWIA 2ZHFH 1GI4A 4JYUH 1GBCA 1C2GA 3TH3H 1EOJA 1M9UA 2B0FA 3VB4A 2FOMB 3A7TA 1OWKA 2Z6BD 4FUEA 2QXGA 4WXVA 3TK5A 1MH0A 2A45B 1P8VC 2BZ6H 2XC0A 1UTPA 4Q7YA 3M5MA 3HATH 1P2NA 4MNXA 1WCZA 1C5WB 4FUBA 3MNCA 1ZSKA 1L4DA 1O2OA 1YPMH 1LHEH 2NU4E 1DXWA 2XC4A 2THFB 2ZG0H 6CHAC 1YP9A 4IC5A 2P16A 1OWJA 2V6NA 1DLEA 4AZ2B 4BAKB 3RMMH 1AWFH 3GY7A 2WYGA 1AY6H 3GY6A 2TGAA 3PTNA 3EYDA 3I78A 2VH6A 2Y7XA 3EQ0H 1UCYE 4YESB 2QV1A 5B6OA 1K2I1 3RXSA 1P12E 5C1XA 1C1NA 4ABJA 3RXKA 1JMOH 1Z6EA 3KEEA 4A7IB 1ZHPA 3GCTG 4OGXA 1O2PA 3A83A 3FZZA 4GHQA 1SGPE 2IJOB 4XSKU 2OINA 2UUJB 5HM2A 2BQ6B 1LDTT 4FUHA 3T28A 1GHVH 1HNEE 1N6XA 4FUJA 2W3IA 4HZHA 3RXRA 1Y8TA 1ZMJA 1B7XB 1MBMA 1A5HA 3M37A 3UIRA 1GJDB 5EPYA 2HGTH 2OP9A 4MPXA 2AERH 1QB9A 5H4IB 2ZQ1A 2OBOA 1A2CH 4MQAA 1RS0A 3S7KB 3VXFH 2H2ZA 1LHGH 2VWOA 1D6RA 1YCPK 3MU5A 4X1NU 3V13A 1J17T 1BIOA 3FVFB 1EAIA 5AF9H 3M36A 1O37A 4NG9H 1AI8H 2WPJS 1MD8A 1VITG 4JYTA 1HPGA 1G37A 1ZLRA 4IGDA 1QURH 2LPRA 4FXGH 1Z1JA 2W7UA 4CHAB 3M7UA 3A8CA 4TY6A 3E0PB 1O2RA 2C3SA 1C5QA 3R3GB 2C8WB 1OOKB 1RXPA 3KQBA 4X8TH 1AB9C 4Y8YA 1C5PA 1BZXE 4IS5A 1MZDA 1HJAB 3EA8A 1O34A 1GBDA 4TWWA 1Z71A 2ANKH 3GYLB 1JOUB 1THPB 5E2PA 4ABHA 2XWAA 2FOBA 2ZCLP 1YPGH 1EXFA 2ZQ2A 4JZDH 1G2MA 4K1SA 4ABDA 3AW0A 3UWJH 4PROA 4ABFA 2Z9LA 2IPHA 1J14A 1SQTA 2BD5A 2ZU1A 1GL0E 1K28D 4OS6A 1O3KA 4ZKOU 5EW1H 3LGUA 1LKBA 2F9NA 1ZJDA 3RXLA 5C1UA 1GHWH 3MO3A 4BTUB 1LMWB 1P03A 4LOYH 3RXEA 4GAWA 3UNSA 3ZVDA 1J15A 2FM2A 8ESTE 3RDZA 4XDEA 3TH4H 2ZFFH 3RMOH 2C8YB 2QXIA 1FZZA 1QCPA 1UVSH 1FJSA 1XMNB 2QYIA 2J92A 3M3VA 3I77A 3EAJA 5E2OA 4GPGA 1YCPM 1KDQB 2F83A 3GOVB 1D3TB 1NRNH 1K1NA 1Y3WA 2G4UA 1AHTH 2ZDLA 1DUEA 1THRH 5ESTE 4GHTA 3C27B 2A7CA 3ATIA 2WPHS 5ABWA 1T32A 4CRAA 1O3DA 3S9AA 2WPMS 4QT8C 3NCLA 2QAAA 1PPHE 5LGOA 1QRXA 4XBBA 4ZROA 4JMYA 2ZFRH 2BY7X 2RCEA 1BRBE 1D4PB 1AZZA 1TPPA 3ZVBA 2CV3A 1ZPZA 2BM2A 4ZHAA 5JB8S 3KCGH 4ZKRU 1HRTH 4WXIA 3RLYH 2BOKA 8GCHF 1HAXB 1NPMA 4GVUA 3UQOA 1BMAA 1NRRH 4X6MA 3H7TA 4FVDA 1G3CA 5F8TA 4ISIH 1CT4E 1PPZA 1P0SH 3DHKH 1SL3A 2PTNA 1ELEE 3TGKE 2ZU5A 2C8ZB 2G8TA 1DSUA 3SO3A 4WWYA 2R3UA 1S85A 3EA7A 1FV9A 1HFDA 1BBRK 1V2NT 5DP8A 2GV7A 2ZTZA 2TGDA 1C5MD 5FBIA 3D62A 1RFNA 1A0LA 1EZQA 1TWXB 1SFQB 2F9VA 3SI4H 3IITA 4D7FA 1ESTA 1T31A 3ITIA 2DE9A 1EKBB 1O2MA 3TVJB 4I33A 4GUXA 2Y5GA 2H1UA 2GZ9A 1A4WH 4CRFA 1SPJA 1P06A 1YM0A 3L33A 4AFUA 1ZZZA 3LIWA 3D49H 2SNVA 1G30B 3FZDA 2AGEX 4AYVB 3BSQA 4OS5A 3VB5A 2I6SA 2ZDNA 2FX6A 3EBNA 1TB6H 4CH2B 1Z6JH 4MPUA 1O2UA 3U8RH 4YOJA 3ZZBA 1E34B 1X7AC 1UVUH 3K65B 1H8IH 2HPQH 5E8EH 1ANBA 1NM6A 4NFFA 4BAMB 1NY22 2ZDMA 2GDEH 4ZKNU 1AKSA 3SW2B 4ZXYH 3UY9A 2ZECA 3RMLH 3ZZDA 1GMHG 1IQKA 2GCTB 1HUTH 1SLUB 2J94A 3KIDU 1MKWK 2ALVA 1IAUA 3SHCH 2RA0A 4Q2KA 3GCHB 1P3CA 3OY6U 1LVYA 1VGCB 3A89A 1C4V2 1ELVA 3SBKA 1DY8A 4KTUA 4MLFB 2A5KA 2Y80A 1IQFA 1ELGA 1BHXB 1H1BA 1GMCF 5C1YA 1SGYE 2FTLE 1IQLA 5L30H 4Y76A 3RXHA 1NFUA 2P93A 1HXFH 2A2QH 2PKSC 3U8TH 2RDLA 1H4WA 2OBQA 1AWHB 4B73A 1HCGA 5L6NH 4K5ZA 1H9LB 2AGIX 4B75A 2EEKA 2BZAA 1SR5C 2Q1JA 4Y71A 2BDIA 3PLBA 3T62A 1W3CA 1UCYK 9LPRA 1G32B 3SN8A 1O3BA 4NIVA 1HLTH 2ZIQH 3SOSA 1KTTB 1KY9A 1GBAA 3GYMA 4AFSA 3ZZ4A 2QF0A 1J9CH 1GHXH 4FUDA 4MNYA 3O8RA 2VWLA 2O8LA 4HTCH 6ESTA 1BCUH 1FY1A 3AVZA 4Y8XA 4A1TA 1C5OH 1BTYA 1O2LA 5GXPA 1BBRH 1P09A 3SI3H 1N1LA 1QBVH 1PQ5A 1EAWA 1GI9B 2CHAC 1Z8GA 3QTVH 2ZF0H 1TYNA 1EUFA 2PGBB 1XUGA 5EG4A 4SGBE 1ANDA 2A4QA 1AQ7A 4NIXA 2VGCB 1O5GH 1W7XH 2A32A 1ACBE 8LPRA 2WUBA 1GJ8B 1TPSA 2GD4B 1AO5A 2P8OC 2HWLB 1IQMA 4I8LA 4MG3A 2VH0A 3MNXA 1LQEA 1S6FA 2UWOA 5FPSA 1PPBH 1PPGE 4A1VA 3GDSA 5FBEA 4X1QU 1Z1IA 3P8NA 4RN6A 2STBE 2VIOA 1THSH 1QQUA 5BPEA 2OQ5A 2JETB 5C5OA 1MBQA 1C2MA 3A7WA 4RKOB 2FPZA 3RM0H 1AUJA 2ILNA 2NWNA 4LZ4B 1O31A 1UTQA 1YGCH 1XKAC 2FS9A 1BITA 4ABIA 1K1IA 3P92A 4B76A 4B71A 1MKWH 1DICA 2BLQA 3GCTF 1TFXA 4TY7A 5DG6A 2VJ1A 1ZMNA 2CXVA 4NSVA 1K1LA 1QY6A 1VR1H 2ZC9H 1BMLA 3Q3YA 3M35A 4K8YA 1OP0A 4AFQA 3CS0A 4MPWA 2Q6FA 4K1TA 2VVCA 4XBDA 2Z3EA 3MH4A 4ZH8A 1TNHA 5F03A 1SSXA 1B0EA 2H5DA 4MTBA 1GHZA 4JZIA 1O2XA 3F9HA 1QJ6B 3MWIU 2WPIS 3RU4D 2TGTA 2G00A 2ZDVH 3EE0B 2P3TB 1ZSLA 4ABGA 1FLEE 2AEIH 3TLOA 2VNTA 1A0HB 3MYWA 1O3AA 5CE1A 3BV9B 3TH2H 1ZTLA 3ZVGA 1C9PA 1FI8A 3SGBE 2G51A 1OX1A 1A1RA 1O3EA 1XUKA 1PYTD 3SQEE 4X1PU 4AG2A 2WV5A 4KELA 1P2MA 1FY5A 1ZPBA 2ZFSA 2A0QB 3M5OA 2SNWA 1AN1E 3BTGE 1VITF 4ASHA 4JZ1A 1CA0B 1ARBA 2ALPA 2OC7A 1SLWB 3ZZAA 2TBSA 1F0TA 1LCYA 3UNQA 5BRRE 3VFEA 1Y5BT 4D9QA 1BQYA 1W10U 1CU1A 2A7HA 4YM9A 1Q31A 2D8WA 4X8SH 3RLWH 1O2NA 4DJZB 3PLPA 1DVAH 1S5SA 2QF3A 1EJMA 3SJ9A 1EB1H 2B8OH 1OYQA 1SVPA 3RXIA 1UK2A 1GCDA 5T6GA 2ZA5A 2Z7FE 3EDXB 5IYTA 1GGDB 1VJAU 2BXUH 1MZAA 2DUCA 1BT7A 2ZFTA 1TA2A 1O2KA 4AGKA 4Y0YE 1FQ3A 1P3EA 4BXSA 3U1JB 4WMEA 2FEQH 2XBWA 2J38A 1BDAA 1ETTH 2AGGX 1HV7A 1KXBA 4AGJA 5L2YH 1BRAA 1FAXA 1AFEH 5GCHG 3BTTE 2CMYA 1SLVB 1AGJA 1HAVB 5DPAA 5FX5A 1KXDA 5TCCA 1AVWA 5F6MA 2GT7A 3I29A 3GDVA 1IHSH 3RXFA 3WY8A 1V2MT 1TMTH 5C20A 4RSPA 3Q3XA 3LC3A 3JZ2B 1O2JA 5GJ4B 2HNTE 3LH1A 1BRCE 2EI6A 1TA6A 1P04A 1SGRE 1ZHRA 2HVXA 1VCWA 4FU7A 2J34A 2GDDA 1FUJA 1K22H 7KMEH 3VGCC 3P8GA 2Z9KA 3U1IB 3A8AA 3OX7U 4M7GA 2R3YA 1PPFE 2VIDA 1KTSB 1GCTC 2A4OA 4UDWH 4A5TS 1KDQA 1GJAB 1KLTA 2BY5X 1W11U 1O32A 1O3PB 1TBQH 3V0XA 4IN1A 8KME2 1XXFA 1MKXH 4U2WA 1C2EA 4BTTB 2PFEA 1C2JA 1OWHA 3LGYA 1ZJKA 3GY8A 4IC6A 1TRNA 4GSOA 1GI2A 2ODPA 2BVXH 2FOGA 3QWCH 4WH8A 5DP6A 2FOAA 1K21H 2XBVA 2ZKSA 5E0JA 1Q3XA 2FLRH 4J2YB 3CENA 4MVNA 1V2PT 1VCQA 1C9TA 3GY3A 4NSYA 1QA7A 1GVKB 1LO6A 1SOTA 1INCA 1FY8E 1A5IA 3H7OA 2V35A 4FVBA 5T6FA 3BG4B 2FYRA 3CS7A 4I32A 1AE8H 2KAIB 2O8WA 2OC1A 2NU1E 1EASA 5AVDA 1EPTB 4YOIA 2P59A 1C2DA 2ZEBA 3TITA 3SUFA 1EATA 1NESE 3RP2A 2BDCA 2VB0A 4D7GA 1GI8B 3BEIB 4A92A 2B5TB 2IN2A 1YPJH 3LJJA 1YC0A 1P11E 2SGAA 4ZMAH 2ZGXH 4UONA 4WF8A 3SZNA 2A7JA 3VB7A 1GMHF 1O5CB 4FUIA 2Y7ZA 7GCHG 3T25A 1N8OB 5G4BA 4E7RG 1NZQH 4DG4A 1HB0B 2A4GA 3ZYEA 2ZP0H 1LQDB 1PQAA 1WYKA 2AMPA 1T4UH 1GHYH 1UTJA 1K1OA 2BDGA 1DWEH 4Y0ZE 2ZPQA 1YLDA 4THNH 4CR9A 3SNAA 3DUXH 3M3TA 1QQ4A 3A80A 2BD4A 5FHTA 1QHRB 1SBWA 3UR6A 5LH8A 1QRZA 1F2SE 3RXPA 2ZHDA 3ZV9A 1EJNA 1EX3A 4UFFH 1ZTJA 3ODFA 2VIWA 3TJVA 2SGPE 3UFAA 1DXPA 1DFPA 4R0IA 1SG8B 3A7ZA 1A5GH 2ZGBH 3KQDA 3MH7A 1GJ9B 1AFQB 2NU3E 2PKAA 1TPAE 1YPLH 5ESBA 1WAYB 1SGTA 3ZZ3A 2P3UB 3TGJE 4CHAC 2UWPA 2OXSA 4Z6AH 1O38A 3MI4A 2BLWA 2GMTB 1UHBB 3SJOA 2FP7B 4Q80A 2SGEE 3ZV8A 1UK4A 3BTQE 3VB3A 3E0NB 4LXBH 1AVGH 1HJAC 1TBZH 2C8XB 3QDZB 5E0HA 1P57B 2BOHB 4JCNA 1GVLA 2XBYA 3V7TA 2FI3E 4HGCA 2GGVB 2QXHA 1TNKA 5AFYH 5LPEA 2GT8A 3RXJA 1C1MA 1OSSA 5FAHA 4FU9A 4INKA 1FDPA 1JRSA 4YT7H 1RGQA 2RG3A 3P70B 1EAUA 3SORA 5DO4H 1N6YA 4AX9H 2B9LA 3N7OA 4CBOA 1O5EH 4INHA 2XRCA 3F1SB 3KQCA 2PSXA 3T29A 2QCYA 2F91A 3E3TA 1V6DA 1IHTH 1UK3A 1GJBB 1PYTC 2SFAA 3K6YA 4INLA 3ATLA 4KGAA 2Q6GA 1DPOA 3ZVFA 1D9IA 5I46H 4X2XA 3QX5H 4X8UH 1BJVA 2Z94A 3RC4A 2XCNA 1HAZB 1YCPH 1DSTA 2EA3A 5F8ZA 4X8VH 5FCRA 1ZHMA 2H9HA 1JXPA 1EQ9A 1K1PA 3BTME 6GCHG 4Y10E 2F9UA 4ESTE 3E8LA 1W0ZU 4VGCB 2A5IA 1WV7H 1Y3YA 1ETRH 4BAQB 4F4OC 4NZQA 3RXTA 1KLIH 1LHDH 3OSYA 3MOCA 3RMNH 2Z3DA 4K2YA 2PW8H 3QGJA 1SFIA 1TMUH 3IG6B 2VINA 2OTVA 3G01A 2W3KA 3SUGA 4DY7B 2R0KA 1KXCA 2LIZA 1IQNA 5IDKA 2G81E 2SGDE 2RA3A 1RTFB 3QZRA 1CE5A 2G5VA 1ELDE 4O9VA 1SGCA 3K2UA 1ZR0A 3MH6A 3PLKA 1SI5H 3A86A 4UEHH 1FY4A 2FYQA 5DKMA 4TWYA 2OUAA 1O2IA 3MHWU 2OQUA 3SUEA 4WMDA 1UTOA 3ZZ6A 2O9QA 1CHOG 2DE8A 1YPHC 2VIQA 3U8OH 2BX4A 1TNGA 1TRMA 1WBGB 1C1QA 2Z9GA 2BX3A 1JIMA 1GBBA 3S9CA 1T4VH 1EZXC 3SV6A 4LZ1H 1C2HA 3D65E 4NFEA 2A5AA 1TE0A 1O39A 2AFQB 2IOTA 3FFGA 5C67A 3EA9A 4FUFA 4FUCA 1ZTKA 1CVWH 1OP2A 5J4SA 1OKXA 2GZ7A 1MCTA 2C4FH 3A7XA 2WV4A 2EI8A 3JZ1B 5HGGA 1PJPA 3SQHE 3P6ZB 4B2BA 1ELBA 2ZI2H 1TX6A 4ISHH 3UOPA 3TPIZ 4X6NA 3LKWA 4ABEA 4XBCA 1CT0E 3QO6A 3M5LA 1O2TA 1SGIB 4ISNA 2FI4E 1A7SA 4FU8A 3DFJA 4MNWA 2F9PA 3SHAH 1MCVA 1Z8RA 2ULLA 2GV6A 1V2TT 1EB2A 4UD9H 3H5CB 4CH8B 2D1JA 1GDNA 3SV7A 3QLPH 2ZGJA 2ZDKA 1ELCA 3BF6H 5DP4A 1MTNB 3PWCA 3HGPA 1IQHA 2BLVA 1UVOA 2FOEA 3LGVA 1TLDA 1MTUA 3B9FH 5JB9S 1RJXB 2GCTC 2H9TH 2XWBI 4DCDA 9ESTA 2UUFB 3SU2A 3T27A 5SGAE 1QJ1B 2WPLS 1LHCH 1HAPH 1G2LA 4AYYB 4XOJA 1XUHA 5I25A 1GDQA 3A8BA 3L6PA 2BMGB 1GJ7B 1HAYB 1ZOMA 3GCHC 1UTMA 4WVPE 4HFPB 2BYAX 1LTOA 5GCHF 1VGCC 1S84A 1BTPA 3KNXA 3ATWA 1BHXF 5EQSA 1C5RA 4CBNA 4IN2A 4NGAH 3ZVCA 4B1TA 2PTCE 1UTLM 2BDHA 3LDXH 2GTBA 4X2WA 4NIYA 4KP0A 1IOEA 2J9NA 3SGAE 3TJUA 2W26A 4D76A 3BTDE 3L3TA 2UUYA 5EODA 3A88A 1LPZB 3A85A 3A7YA 3F6UH 2J4IA 4K60A 3SGQE 3LT3A 2BTCE 3P8FA 2TGPZ 1UJ1A 2HRVA 1HAVA 3SNCA 4K1EA 3ZZ9A 1O3LA 2FESH 1F0RA 5EQRA 1FPCH 2EC9H 1JBUH 3T2NA 1YBWA 2FLBH 2D26C 2SGFE 4I8HA 2W7SA 2AS9A 4IMQA 3ZVAA 5E0GA 1QL8A 1GBMA 3Q00A 5EXLA 3SU3A 1Y5UT 1DWDH 1IQJA 4J1YA 2EI7A 1ABJH 1LVMA 1S0QA 3OYPA 2PGQB 4A6LA 5AFZH 1TOCB 2VWMA 1GJ4H 5F8XA 4B2CA 1C2LA 1ESAA 1F7ZA 1SGQE 4U32A 4D9RA 2Z3CA 3QK1A 3OY5U 1G3DA 1NFXA 2VGCC 1A0JA 3SJIA 1GI5A 1GI3A 1HAIH 1O5FH 4DURA 3M3SA 3D23A 1BUIA 4H6TA 1GMDG 1WTHD 4DGJA 1UVPA 4BOHA 1UO6A 3S69A 1V2UT 1GBTA 1OYTH 2ANYA 4KTCA 1TIOA 2ZDAH 5A0BA 2NU0E 1L1GA 3HKIB 2STAE 3FP7E 5LPFA 1KSNA 1G36A 1TNIA 1L2EA 1T7CA 5JDUB 3M61U 3M7TA 1UTKA 1CA8B 1O3FA 3BTKE 3W95A 1C1PA 2JETC 4DIIH 1D3QB 1XM1A 5JBAS 3LONA 1UCYH 3S7HB 1GBKA 1FN6A 1A46H 3Q3KA 5LPRA 1FXYA 1TMBH 1NFYA 1C5SA 2ZU3A 3ZZCA 5L2ZH 2BB4A 2HALA 7GCHF 3SU6A 1TQ0B 1OWDA 4NIWA 1OWEA 5CHAB 2KAIA 1LVOA 1C5VA 1ELFA 2ZHEH 4NZLA 2A2XH 1YKTA 1T8MA 1EP6A 4X2VA 3U9AH 3SJKA 3ZZ7A 1Z8JB 3E1XB 3PWBA 2PHBA 1GHAG 1RIWB 2GP9B 1C1OA 4KKDA 2ZTXA 1PPEE 2VIVA 1AD8H 4BAHB 4UE7H 4YO9A 1BRUP 1OXGA 1TGCA 1WUNH 2GKVE 1CGIE 4YT6H 1C4Y2 4ABAA 2GVFA 5JBCS 1K1JA 5JBBS 1TRYA 2QGRA 2Z9JA 4SGAE 5T3HA 3SU1A 1KIGH 1ANCA 1F5RA 1F5KU 2PV9B 1QJ7B 3F9FA 1NRSH 2UWLA 4OS1A 3BTWE 4AG1A 2XC5A 3FANA 3TJNA 2G5NA 2FMJA 2OD3B 1DM4B 1CBWB 4O3UA 5HMAA 1SMFE 5JYIA 1VZQH 2ZZUH 2M5TA 4CRCA 1QGFA 3LPRA 1GBIA 2ZTYA 3PTBA 3S9BA 3S0NA 1W0YH 3Q76A 3LGTA 1PFXC 1ORFA 3NXPA 1V2OT 3FP8E 3RU4T 3M5NA 1CA0C 1O2WA 1C1RA 1V2VT 2VWNA 2AYWA 2BDYA 4R8TB 2C90B 1DITH 1MQ6A 1HJ9A 3VPKA 3TJOA 3UQVA 1GBJA 1D6WA 1D3PB 3RXCA 6CHAB 1C5TA 3BTHE 1O35A 4Y8ZA 2G55A 4H4FA 1AIXH 3K9XB 1C5UA 1HIAB 1DUAA 2ZCKP 3MU4A 4A1XA 1MTSA 2Y5HA 1BTZA 1QFKH 1O2QA 1SGFG 3B23B 3RC6A 1UVTH 2F3CE 3UR9A 1V2KT 1GVZA 1GG6B 1TX7A 1HXEH 5C2ZA 4OS7A 3FP6E 1ABIH 4ZXXH 2FS8A 1W2KH 3DA9B 1H9IE 2JH0D 2XYAA 2K1QA 4YZUA 2HLCA 3V12A 1E37B 5DP9A 1GGDC 1HDTH 1Q2WA 3TNSA 1WQSA 2G4TA 2VU8E 2VVVA 5K7RA 1EAXA 1L1JA 1SOZA 1QBOA 1JWTA 4ZHMU 4KTSA 1GPZA 2BDBA 3O8DA 3MNSA 2ANMH 3PYHA 3TK9A 1O5DH 6LPRA 1TNJA 4GCHG 3AAVA 1O3GA 1GI7B 1LVBA 2Y6TA 3BTFE 1F0UA 2Z9IA 2Y81A 1MTVA 2XW9A 1ELTA 1W12U 1Z8IB 1DE7H 1GI1A 1UTNA 4MNVA 2BD2A 6GCHF 2FZZA 3NZIA 3ZZ8A 3SV9A 1J16A 1IQIA 1C5XB 1O3IA 1XUIA 2Y82A 3BIUH 2BY8X 1WQVH 1P9UA 5AHGH 1NFWA 1GG6C 2VIPA 5A2MH 3ENSB 3TK6A 4DVAU 2H6MA 4RKJB 3A87A 1NU9A 2CF9H 4ZKSU 3QN7A 2ZPRA 4HI3A 1O3CA 1GBLA 5GIBA 2GCHG 1C2IA 4Q7ZA 1L4ZA 3T26A 3IWMA 1UMAH 3B8JA 1HAGE 1L1NA 1LHFH 5A0AE 1O5AB 4Y7AA 1O30A 1AB9B 3HKJB 1K1MA 3E6PH 1QNJA 4AB8A 2BXTH 1FIWA 3PV4A
chains in the Genus database with same CATH superfamily
4F49A 3KHVA 5A8ZA 1V2LT 1QRWA 5EXNA 3T5FH 1GBFA 4AFZA 3F68H 1CHOF 1DWCH 4NA7A 1AMHA 3ESTA 2SGQE 2ZHQH 2J2UA 1RD3B 2F9BH 4WY3A 3A7VA 2LNCA 1LPKB 3LC5A 3UUZA 1GWAA 1O2GH 1O2VA 3QTOH 2FDAA 2IJD1 1TPOA 3MU1A 1E38B 3BG4C 3GDUA 1GJ6A 4H6SB 2CF8H 4ASUD 4D8NA 1HBTH 3VEQB 3NPSA 5C5NA 3UWIA 2M2AA 1TALA 1V2WT 5GNDA 1ARCA 4CRDA 4GLYA 4ZAEA 1JIRA 1EPTC 3OAAD 1BOQA 4U30A 2WUCA 1FN8A 4XFQA 4AN7A 1ZYOA 1GHBG 3BTEE 3SU0A 3A81A 3BG8A 5JPMH 3N7EA 2K8IA 3RXDA 1MD7A 3E91A 4U01A 4CREA 1MAXA 4TSFD 2O8UA 3AASA 1DLKB 2JH6D 5A8XA 1SC8U 1DT2A 3KN2A 3OE7D 2FOHA 3A8DA 2YNAA 4Y7BA 4O03A 4B2AA 1N8OC 3R0FA 3GISB 1KMHB 2CJIA 1EJAA 1FPHH 2G52A 1NRPH 1U6QA 4WJG2 2Q6DA 1NBME 1F5LA 1EP5A 1XUFA 2WYJA 5DK1A 3TIUA 1SGFA 2R9PA 4NCYA 3KF2A 1GI0A 2ZFQH 1C1VH 5EIYA 3RXOA 1ZRKA 2I6QA 2P94A 1ELAA 1V3XA 3HK3B 1TGBA 4Y79A 5DGJA 1Y3UA 2ZU4A 4H42U 1DOJA 2FO9A 3ATKA 1NT1A 2W6JD 1TNLA 4BTIB 3AW1A 1C1WH 1S81A 1NRQH 4UFDH 4BANB 1MUEB 1C4U2 2QY0B 5EGMA 1C1TA 1KXAA 1V2ST 1ZPCA 5GDSH 2R2WU 2AMDA 5C3NA 3MU8A 2FOFA 1WOFA 2TRMA 1BJUA 1YWUA 2R2MB 7ESTE 1B5GH 1AFQC 4ABBA 4K69A 4NA8A 4IW4E 5FX6A 2ESTE 5GPIB 5FCKA 4CR5A 2ZGHA 3RXGA 2GMTC 3NUMA 3PROA 3RC5A 2NU2E 1DANH 4WMFA 1EZSC 1Z7KA 1JRTA 1A61H 3ODDA 1LPGB 4DT7B 3PO1B 2FODA 1E36B 1T8LA 1C1UH 1P2KA 4Z0KA 3TGIE 3EGKH 1ZMLA 2YOLA 1H9HE 4CRGA 1WU1A 1KLJH 1O3OA 2FTMA 2XNDD 1L0ZA 1BTWA 2PP6A 3F2HA 1O36A 3NK8A 4DOQA 1C5LH 1EOLA 4X6OA 3W94A 1QA0A 4OGYA 5DP5A 1TABE 3E16B 1P05A 1NU7B 3LOXA 1GJ5H 1DS2E 3BEFB 1TOMH 3MU0A 1SQOA 3DCLA 4NWLA 1Y3XA 3A84A 2K7XA 5EXMA 1QB6A 1FONA 1C1SA 4IBLH 1GMDF 1BMFD 2AIQA 5CDFE 3MO9A 4JYVH 3GCNA 2GX4A 3P17H 1T8OA 5DSFA 1O3MA 2ANWA 3ATMA 1HGTH 1HYLA 4I7YH 1PQ8A 1WTGH 4JK5A 1J8AA 5HXFA 2V3HH 4AORA 5TJXA 3STJA 1CSOE 2ASUB 1QIXB 4B6EA 1O2ZA 2BD3A 1BA8B 2XBXA 1V2QT 2OCVB 3GCOA 4O97A 2CGAA 3HPTB 1YF4A 1P01A 3OU0A 3DSGA 1GJCB 3RXQA 4E05H 2FXRA 2ZU2A 2JH5D 2FOCA 2A31A 5DJ7A 2W6ID 2J95A 3A82A 2B7DH 3PO1C 1O5BB 4E06H 2QC2A 3UB0A 1AE5A 2PKSB 2FIRH 1SHYA 4VGCC 3MH5A 2GZ8A 1S82A 2AIPA 2PSYA 3V3MA 1BTXA 5J4QA 5HYOA 2ZHWH 5DN6D 1AVXA 1KXFA 1YPKH 3GICB 1TQ7B 2BY9X 1IQGA 3F2FA 3RU4E 3C1KA 4MDSA 1HJ8A 1SQRA 3DD2H 4Q7XA 1V2RT 4HG6A 2BVSH 1HAOH 3U98H 1T8NA 3PMJA 1Y3VA 2Y5FA 1GHAF 3SV8A 1BTUA 4TYDA 4NA9H 2QIQA 2ZGCA 5T6DA 2CK3D 3W1EA 3RXMA 1HAHH 2OC8A 1XX9A 2FI5E 3KYGA 2LELA 1GDUA 4K3JA 3RM2H 2BQWB 4MPVA 3K6ZA 2C93B 2F9OA 1BB0B 4FUGA 5JBTA 3KQ5A 1C2KA 1G3BA 1PPCE 2V0BA 1W13U 2XNIA 1E0FD 2BDAA 3PMBB 2CHAB 3KQEA 2PKAB 3F9EA 1SLXB 1P02A 1GBHA 3RXVA 1FIZA 3SNEA 4X6PA 2O8MA 1ZGIA 3F9GA 4Y11E 3LGIA 3GY4A 2XXLA 4O3TA 1AU8A 1NC6A 5A09A 1DWBH 3GY5A 3TU7H 1ZGVA 3NKKA 1G3EA 2PUQH 4ZHLU 1A3BH 1E1QD 7LPRA 2BLOA 2P8OB 3F0PA 1OPHB 3PM3A 2FWWA 1MQ5A 2BVRH 2OLGA 1W8BH 2JDID 2QA9E 5CMXH 2ZNKH 3RXAA 1TONA 1BTHH 1C5NH 5HIZA 5FXLA 3U69H 1YPEH 4AOQA 1A3EH 1GL1A 4X2YA 1H8DH 1O3NA 1IQEA 1KYNA 2BHGA 2YNBA 1CT2E 1NN6A 1ANEA 2QXJA 4BXWA 2WPKS 4I8JA 2TIOA 2KR7A 1B0FA 3ZZ5A 3URCA 4YLUA 4JZFH 1BMMH 3HK6B 1MTNC 1OS8A 4AB9A 1YPHE 4TPYA 2OC0A 3LH3A 1G9IE 1TAWA 1RTKA 4OS4A 1BMNH 5GWZA 4I8KA 3UOUA 1HIAA 1Y59T 3HGNA 1W7GH 2O8TA 4WH6A 4I8GA 5EOKA 4RI0A 1TGSZ 3MTYA 2ZPSA 3LJOA 3VB6A 1PQ7A 2A1DB 4GCHF 1SQAA 1CO7E 1FMGA 1EZUC 8GCHG 1SHHB 1S6HA 5DP7A 3NWUA 1P2JA 4E7NA 1NO9H 1MAYA 4TT3D 3ZYDA 1XXDA 3P8OA 3QZQA 1YLCA 3DFLA 2W5EA 1O2HA 2ZCHP 3VG8A 3CP7A 1MU6B 5FPTA 3SUDA 3SNBA 2TPIZ 3BEUA 1S0RA 2XCFA 5PTPA 4UFGH 1MMJN 3MQKC 4I31A 2AH4X 3O8CA 1NROH 5FPYA 1RRKA 3ZVEA 2ODQA 1O3JA 1MTWA 2JKHA 2GCHF 3RUOA 1Y5AT 1KXEA 1C5ZB 4Y6DA 4UFEH 1AKSB 3MO6A 2ZO3H 1D3DB 3SJ8A 3SU5A 1O33A 3SV2H 3OTJE 2PUXB 2BD8A 3UREA 3E90B 1VITH 4K8BA 2AMQA 1MU8B 3GY2A 1XVOA 1QBNA 1P2OA 1W14U 2HNTF 2BQ7B 4YTAA 1GI6A 2BY6X 1QTFA 2P3FH 1ID5H 2HNTC 1TGNA 1O3HA 3MMGA 2H9EH 4XE4A 3M7QA 1F0SA 2D2DA 1DDJA 3KL6A 1YLNA 3BN9A 3RXUA 4LK4A 5A8YA 5EW2H 1MKXK 1P9SA 3SU4A 1CHGA 1VJ9U 2PWXA 4DW2U 4YOGA 1CGJE 1EPTA 2P95A 1ZSJA 1ZRBA 4BNRA 1SGEE 2BD7A 3WW7A 1O2SA 1ETSH 2HOBA 1CQQA 2WINI 2WHXA 4X0WU 1AZ8A 1ESBA 1GBEA 2ZWLH 2PR3A 3MNBA 2FX4A 3FAOA 2H5CA 1TX8A 5K0HA 3N99A 1O0DH 3PMAB 1P2IA 3URDA 3PB1E 1YYY1 4JZEH 1C5YB 1QB1A 2QN5T 4X1RU 1F92A 4IMZA 1CGHA 3MFJA 5DP3A 4JK6A 4TPIZ 4BAOB 1BBRE 1LKAA 5CHBA 5HM9A 1DY9A 1GMCG 3PMHB 3OFND 1VKYA 1GHBF 1XUJA 3PV5A 3KGPA 3UPEA 3DT0H 5A0CA 2HPPH 3QUMP 1VCPA 2ZFPH 4B74A 1C2FA 1RTLA 1TBRH 4CRBA 1NS3A 3VXEH 3BIVH 2ODYB 5EU8A 3VGCB 1QL9A 1NTPA 1O2YA 5ETXA 1QR3E 3RXBA 3SNDA 3Q77A 5CHAC 1FY3A 5EQQA 2CN0H 2VVUA 1OP8A 1XKBC 1GCTB 2V3OH 1E35B 1FNIA 3P95A 1P2QA 3O8BA 1RIWC 3QGNB 2WSSD 1DX5M 3AAUA 1AUTC 2A4RA 4ISOA 4OS2A 4X1SU 1SGNE 4ZUHA 1TGTA 3UTUH 1FAKH 2XTTB 1SB1H 1P10A 4YLQH 1K9OE 1V2JT 4NWKA 1WSSH 4DIHH 1S83A 5TCAA 1SGDE 4ISLA 2UUKB 3STIA 2GJGA 1QL7A 2R0LA 5EPNA 2BD9A 3LU9B 1XVMA 2PLXA 3LGWA 3UNRA 3ELAH 3TNTA 1UHBA 1CBWC 1OWIA 2ZHFH 1GI4A 4JYUH 1QZ8A 1GBCA 1C2GA 3TH3H 1EOJA 1M9UA 2B0FA 3VB4A 2FOMB 2J98A 1OWKA 2Z6BD 3A7TA 2QXGA 4FUEA 4WXVA 3TK5A 1MH0A 2A45B 1P8VC 2KCYA 2BZ6H 1FX0B 2XC0A 1UTPA 4Q7YA 3M5MA 3HATH 1P2NA 4MNXA 1WCZA 1C5WB 4FUBA 3MNCA 1ZSKA 1L4DA 1O2OA 1YPMH 1LHEH 2NU4E 1DXWA 2XC4A 2THFB 2ZG0H 6CHAC 1YP9A 4IC5A 3CNRA 2P16A 1OWJA 2V6NA 1DLEA 4AZ2B 4BAKB 3RMMH 1AWFH 3GY7A 2WYGA 1AY6H 3GY6A 2TGAA 3PTNA 3EYDA 3I78A 2VH6A 2Y7XA 3EQ0H 1UCYE 4YESB 2QV1A 5B6OA 1K2I1 3RXSA 1P12E 5C1XA 1C1NA 4ABJA 3RXKA 1JMOH 1Z6EA 3KEEA 4A7IB 1ZHPA 3GCTG 4OGXA 1O2PA 3A83A 3FZZA 4GHQA 1SGPE 2IJOB 4XSKU 2OINA 2UUJB 5HM2A 2BQ6B 1LDTT 4FUHA 3T28A 1GHVH 1HNEE 1N6XA 4FUJA 2W3IA 4HZHA 3RXRA 1Y8TA 1ZMJA 1B7XB 1MBMA 3F2GA 1A5HA 3M37A 3UIRA 1GJDB 5EPYA 2HGTH 2OP9A 4MPXA 2AERH 1QB9A 5H4IB 1E1RD 2OBOA 2ZQ1A 1A2CH 4MQAA 1RS0A 3S7KB 3VXFH 2H2ZA 1LHGH 2VWOA 1D6RA 1YCPK 3MU5A 4X1NU 3V13A 1J17T 3UAIC 1BIOA 3FVFB 1EAIA 1H8HD 5AF9H 3M36A 1O37A 4NG9H 1AI8H 2WPJS 1MD8A 1VITG 4JYTA 1HPGA 1G37A 1ZLRA 4IGDA 1QURH 2LPRA 4FXGH 1Z1JA 2W7UA 4CHAB 3M7UA 3A8CA 4TY6A 3E0PB 2JIZD 1O2RA 5KEDA 2C3SA 1C5QA 3R3GB 2C8WB 1OOKB 1RXPA 3KQBA 4X8TH 1AB9C 4Y8YA 1C5PA 1BZXE 4IS5A 1MZDA 1HJAB 3EA8A 1O34A 1GBDA 4TWWA 1Z71A 2ANKH 3GYLB 1JOUB 1THPB 5E2PA 4ABHA 2XWAA 2FOBA 2ZCLP 1COWD 1YPGH 1EXFA 2ZQ2A 4JZDH 1G2MA 4K1SA 4ABDA 3AW0A 3UWJH 4PROA 4ABFA 2Z9LA 2IPHA 1J14A 1SQTA 2BD5A 2ZU1A 1GL0E 1K28D 4OS6A 1O3KA 4ZKOU 5EW1H 3LGUA 1LKBA 2F9NA 1ZJDA 3RXLA 5C1UA 1GHWH 3MO3A 4BTUB 1LMWB 1P03A 4LOYH 5KECA 3RXEA 4GAWA 3UNSA 3ZVDA 1J15A 2KCAA 2FM2A 8ESTE 3RDZA 3PV2A 4XDEA 3TH4H 2ZFFH 3RMOH 2C8YB 2QXIA 1FZZA 1QCPA 1UVSH 1FJSA 1XMNB 2QYIA 3OTPA 2J92A 3M3VA 3I77A 3EAJA 2J5UA 5E2OA 4GPGA 1YCPM 1KDQB 2F83A 3GOVB 2HLDD 1D3TB 1NRNH 1K1NA 1Y3WA 2G4UA 1AHTH 2ZDLA 1DUEA 1THRH 5ESTE 4GHTA 3C27B 2A7CA 3ATIA 2WPHS 5ABWA 1T32A 4CRAA 1O3DA 3S9AA 2WPMS 4QT8C 3NCLA 2QAAA 1PPHE 5LGOA 1QRXA 4XBBA 4ZROA 3NRLA 4JMYA 2ZFRH 2BY7X 2RCEA 1BRBE 1D4PB 1AZZA 1TPPA 3ZVBA 2CV3A 1ZPZA 2BM2A 3AK5A 4ZHAA 5JB8S 3KCGH 4ZKRU 1HRTH 4WXIA 3RLYH 2BOKA 8GCHF 1HAXB 1NPMA 4GVUA 3UQOA 1BMAA 1NRRH 4X6MA 3H7TA 4FVDA 1G3CA 5F8TA 4ISIH 1CT4E 1PPZA 1P0SH 3DHKH 1SL3A 2PTNA 1ELEE 3TGKE 2ZU5A 2C8ZB 2G8TA 1DSUA 3SO3A 4WWYA 3N7DA 2R3UA 1S85A 3EA7A 1FV9A 1HFDA 1BBRK 1V2NT 5DP8A 2GV7A 2ZTZA 2TGDA 1C5MD 5FBIA 3D62A 1RFNA 1A0LA 1EZQA 1TWXB 1SFQB 2F9VA 3SI4H 3IITA 4D7FA 1ESTA 1T31A 3ITIA 2DE9A 1EKBB 1O2MA 3TVJB 4I33A 4GUXA 2Y5GA 2QE7D 2H1UA 3DSOA 2GZ9A 1A4WH 1WDIA 4CRFA 1SPJA 1P06A 1YM0A 3L33A 4AFUA 1ZZZA 3LIWA 3D49H 2SNVA 1G30B 3FZDA 2AGEX 4AYVB 3BSQA 4OS5A 3VB5A 2I6SA 2ZDNA 2FX6A 3EBNA 1TB6H 4CH2B 3SZEA 1Z6JH 4MPUA 1O2UA 3U8RH 4YOJA 3ZZBA 1E34B 1X7AC 1UVUH 3K65B 1H8IH 2HPQH 5E8EH 1ANBA 1NM6A 4NFFA 4BAMB 1NY22 2ZDMA 2GDEH 4ZKNU 1AKSA 3SW2B 4ZXYH 3UY9A 2ZECA 3RMLH 3ZZDA 1GMHG 2XOKD 1IQKA 2GCTB 1HUTH 1SLUB 2J94A 3KIDU 1MKWK 2ALVA 1IAUA 3SHCH 2RA0A 4Q2KA 3GCHB 1P3CA 3OY6U 1LVYA 1VGCB 3A89A 1C4V2 1ELVA 3SBKA 1DY8A 4KTUA 1S6LA 4MLFB 2A5KA 2Y80A 1IQFA 1ELGA 1BHXB 1H1BA 1GMCF 5C1YA 1SGYE 2FTLE 1IQLA 2JJ2D 1NBMD 5L30H 4Y76A 3RXHA 1NFUA 4AC9A 5EJLA 2P93A 1HXFH 2A2QH 2PKSC 3U8TH 2RDLA 1H4WA 3GS9A 2OBQA 1AWHB 5C0UA 4B73A 1HCGA 5L6NH 4K5ZA 1H9LB 2AGIX 3PRDA 2EEKA 4B75A 2BZAA 1SR5C 2Q1JA 4Y71A 2BDIA 3PLBA 3T62A 2HVYB 1W3CA 1UCYK 9LPRA 1G32B 3SN8A 1O3BA 4NIVA 1HLTH 2ZIQH 3SOSA 1KTTB 2K0QA 1KY9A 1GBAA 3GYMA 4AFSA 3ZZ4A 2QF0A 1J9CH 1GHXH 4FUDA 4MNYA 3O8RA 2VWLA 2O8LA 4HTCH 6ESTA 1BCUH 1FY1A 3AVZA 4Y8XA 4A1TA 1C5OH 1BTYA 1O2LA 5GXPA 1BBRH 1P09A 3SI3H 1N1LA 1QBVH 1PQ5A 1EAWA 1GI9B 2CHAC 1Z8GA 3QTVH 2ZF0H 1TYNA 1EUFA 2PGBB 1XUGA 4XD7D 5EG4A 2V7QD 4SGBE 1ANDA 2A4QA 1AQ7A 4NIXA 2VGCB 1O5GH 1W7XH 2A32A 1ACBE 8LPRA 3OEHD 2WUBA 1GJ8B 1TPSA 2GD4B 3FO8D 1AO5A 2P8OC 2HWLB 1IQMA 4I8LA 4MG3A 2VH0A 3MNXA 1LQEA 1S6FA 2UWOA 5FPSA 1PPBH 1PPGE 4A1VA 3GDSA 5FBEA 4X1QU 1Z1IA 3P8NA 4RN6A 2STBE 2VIOA 1THSH 1QQUA 5BPEA 2OQ5A 2JETB 5C5OA 1MBQA 1C2MA 3A7WA 4RKOB 2FPZA 3RM0H 1AUJA 2ILNA 2NWNA 4LZ4B 1O31A 1UTQA 1YGCH 1XKAC 2FS9A 1BITA 4ABIA 1K1IA 3P92A 4B76A 4B71A 1MKWH 1DICA 2BLQA 3GCTF 1H8ED 1TFXA 4TY7A 5DG6A 2VJ1A 1ZMNA 2CXVA 4NSVA 1K1LA 1QY6A 1VR1H 2ZC9H 1BMLA 3Q3YA 3M35A 4K8YA 1OP0A 4AFQA 3CS0A 4MPWA 2Q6FA 4K1TA 2VVCA 4XBDA 2Z3EA 3MH4A 4ZH8A 1TNHA 5F03A 4B6FA 1SSXA 1B0EA 2H5DA 4MTBA 1GHZA 4JZIA 1O2XA 3F9HA 1QJ6B 3MWIU 2WPIS 3RU4D 2TGTA 2G00A 2ZDVH 3EE0B 2P3TB 1ZSLA 4ABGA 1FLEE 2AEIH 3TLOA 2VNTA 1A0HB 3MYWA 1O3AA 5CE1A 3BV9B 3TH2H 1ZTLA 3ZVGA 1C9PA 3FOAA 1FI8A 3SGBE 2G51A 1OX1A 1A1RA 1O3EA 1XUKA 3SYJA 1PYTD 3SQEE 4X1PU 4AG2A 2WV5A 4KELA 1P2MA 1FY5A 1ZPBA 2ZFSA 2A0QB 3M5OA 2SNWA 1K0HA 1AN1E 3BTGE 1VITF 4ASHA 4JZ1A 1CA0B 1ARBA 2ALPA 2OC7A 1SLWB 5HIYA 3ZZAA 2TBSA 1F0TA 1LCYA 4XRNA 3UNQA 5BRRE 3VFEA 1Y5BT 4D9QA 1BQYA 1W10U 1CU1A 2A7HA 4YM9A 1Q31A 2D8WA 4X8SH 3RLWH 1O2NA 4DJZB 3PLPA 1DVAH 1S5SA 5HKKD 2QF3A 1EJMA 3SJ9A 1EB1H 2B8OH 1OYQA 1SVPA 3RXIA 1UK2A 4FETA 1GCDA 5T6GA 2ZA5A 2Z7FE 3EDXB 2KM0A 5IYTA 1GGDB 1VJAU 2BXUH 1MZAA 2DUCA 1BT7A 2ZFTA 1TA2A 1O2KA 4AGKA 4Y0YE 1FQ3A 1P3EA 4BXSA 3U1JB 4WMEA 2FEQH 2XBWA 2J38A 1BDAA 1ETTH 2AGGX 1HV7A 1KXBA 4AGJA 5L2YH 1BRAA 1FAXA 1AFEH 1EFRD 5GCHG 3BTTE 2CMYA 1SLVB 3DSPA 1AGJA 1HAVB 5DPAA 5FX5A 1KXDA 5TCCA 1AVWA 5F6MA 2GT7A 3I29A 3GDVA 1IHSH 3RXFA 3WY8A 1V2MT 1TMTH 5C20A 4RSPA 3Q3XA 3LC3A 3JZ2B 1O2JA 5GJ4B 2HNTE 3LH1A 1BRCE 2EI6A 1TA6A 1P04A 1SGRE 1ZHRA 2HVXA 1VCWA 4FU7A 2J34A 2GDDA 1FUJA 1K22H 7KMEH 3VGCC 3P8GA 2Z9KA 3U1IB 3A8AA 3OX7U 4M7GA 2R3YA 1PPFE 2VIDA 1KTSB 1GCTC 2A4OA 4UDWH 4A5TS 1KDQA 1GJAB 1KLTA 2BY5X 1W11U 1O32A 1O3PB 1TBQH 3V0XA 4IN1A 8KME2 1XXFA 1MKXH 4U2WA 1C2EA 4BTTB 1YY3A 2PFEA 1C2JA 1OWHA 3LGYA 1ZJKA 3GY8A 4IC6A 1TRNA 4GSOA 1GI2A 2ODPA 2BVXH 2FOGA 3QWCH 4WH8A 5DP6A 2FOAA 1K21H 2XBVA 2ZKSA 5E0JA 1Q3XA 2FLRH 4J2YB 3CENA 4MVNA 1V2PT 1VCQA 4YXWD 1C9TA 3GY3A 4NSYA 1QA7A 1GVKB 1LO6A 1SOTA 1INCA 1FY8E 1A5IA 3H7OA 2V35A 4FVBA 5T6FA 3BG4B 2FYRA 5T1VA 3CS7A 4I32A 1AE8H 2L6OA 2KAIB 2O8WA 2OC1A 2NU1E 1EASA 5AVDA 1EPTB 4YOIA 2P59A 1C2DA 2ZEBA 3TITA 3SUFA 1EATA 1NESE 3RP2A 2BDCA 2VB0A 4D7GA 1GI8B 3BEIB 4A92A 2B5TB 2IN2A 1YPJH 2EQNA 3LJJA 1YC0A 1P11E 2SGAA 4ZMAH 2ZGXH 3PRBA 4UONA 4WF8A 3SZNA 2A7JA 3VB7A 4ACBA 1GMHF 3WWFA 1O5CB 4FUIA 2Y7ZA 7GCHG 3T25A 2KZ4A 3EE7A 1N8OB 5G4BA 4E7RG 1NZQH 4DG4A 1HB0B 2A4GA 3ZYEA 2ZP0H 1LQDB 5B6LA 1PQAA 1WYKA 2AMPA 1T4UH 1GHYH 1UTJA 1K1OA 2BDGA 1SKYE 1DWEH 4Y0ZE 2ZPQA 1YLDA 3OEED 4THNH 3KYFA 4CR9A 3SNAA 3DUXH 3M3TA 1QQ4A 3A80A 2BD4A 5FHTA 1QHRB 1SBWA 3UR6A 5LH8A 1QRZA 1F2SE 2KCPA 5C94A 3RXPA 2ZHDA 3ZV9A 1EJNA 1EX3A 4UFFH 1ZTJA 3ODFA 2VIWA 3TJVA 2SGPE 4ZCNA 3UFAA 1DXPA 1DFPA 4R0IA 1SG8B 3A7ZA 1A5GH 2ZGBH 3KQDA 3MH7A 1GJ9B 1AFQB 2NU3E 3F3BA 2PKAA 1TPAE 1YPLH 5ESBA 1WAYB 1SGTA 3ZZ3A 2P3UB 3TGJE 4CHAC 2WV9A 2UWPA 2OXSA 4Z6AH 1O38A 3MI4A 2BLWA 2GMTB 1UHBB 3SJOA 2FP7B 4Q80A 2SGEE 5F53A 3ZV8A 1UK4A 3BTQE 3VB3A 3E0NB 4LXBH 1AVGH 1HJAC 1TBZH 2C8XB 2J98B 3QDZB 5E0HA 1P57B 3H09A 2BOHB 4JCNA 1GVLA 2XBYA 3V7TA 2FI3E 4DT4A 4HGCA 2GGVB 2QXHA 1TNKA 5AFYH 5LPEA 2GT8A 3RXJA 1C1MA 1OSSA 5FAHA 4FU9A 4INKA 1FDPA 1JRSA 4YT7H 1RGQA 2RG3A 3P70B 1EAUA 3SORA 5DO4H 1N6YA 4AX9H 2B9LA 3N7OA 4CBOA 1O5EH 4M9FA 4INHA 2XRCA 3F1SB 3KQCA 2PSXA 3T29A 2QCYA 2F91A 3E3TA 1V6DA 1IHTH 2WZQA 1UK3A 1GJBB 1PYTC 2SFAA 3K6YA 4INLA 2OK5A 3ATLA 4KGAA 2Q6GA 1DPOA 3ZVFA 1D9IA 5I46H 4X2XA 3QX5H 4X8UH 1BJVA 2Z94A 3RC4A 2XCNA 1HAZB 1YCPH 1DSTA 2EA3A 5F8ZA 4X8VH 5FCRA 1E79D 1ZHMA 2H9HA 1JXPA 1MABB 1EQ9A 1K1PA 3BTME 6GCHG 4Y10E 2F9UA 4ESTE 3E8LA 1W0ZU 4VGCB 2RDEA 2A5IA 1WV7H 1Y3YA 1ETRH 4BAQB 4F4OC 4NZQA 3RXTA 1KLIH 1LHDH 3OSYA 3MOCA 3RMNH 2Z3DA 4K2YA 2PW8H 3WWBA 3QGJA 1SFIA 1TMUH 3IG6B 2VINA 2OTVA 3G01A 2W3KA 3SUGA 4DY7B 2R0KA 1KXCA 2LIZA 1IQNA 5IDKA 2G81E 2SGDE 2RA3A 1RTFB 3QZRA 1CE5A 2G5VA 1ELDE 4O9VA 1SGCA 3K2UA 1ZR0A 3MH6A 3PLKA 1SI5H 3A86A 4UEHH 1FY4A 2FYQA 5DKMA 4TWYA 2OUAA 1O2IA 3MHWU 2OQUA 3SUEA 4WMDA 4F55A 1UTOA 3ZZ6A 2O9QA 1CHOG 2DE8A 1YPHC 2VIQA 3U8OH 2BX4A 1TNGA 1TRMA 1WBGB 1C1QA 2Z9GA 2BX3A 1JIMA 1GBBA 2IPQX 3S9CA 1T4VH 1EZXC 3SV6A 4LZ1H 1C2HA 3D65E 4NFEA 2A5AA 1TE0A 1O39A 2AFQB 2IOTA 2YMSD 3FFGA 5C67A 3EA9A 4FUFA 4FUCA 1ZTKA 1CVWH 1OP2A 5J4SA 1OKXA 2KFWA 2GZ7A 1MCTA 2C4FH 5FL7D 3A7XA 2WV4A 2EI8A 3JZ1B 3FKSD 1PJPA 5HGGA 3SQHE 3P6ZB 4B2BA 1ELBA 2ZI2H 1TX6A 4ISHH 4OM9A 3UOPA 3TPIZ 4X6NA 3LKWA 4ABEA 4XBCA 1CT0E 3QO6A 3M5LA 1O2TA 1SGIB 2L74A 4ISNA 2FI4E 1A7SA 4FU8A 3DFJA 4MNWA 2F9PA 3SHAH 5C0TA 1MCVA 1Z8RA 2ULLA 4Q63A 2GV6A 1V2TT 1EB2A 4UD9H 4I86A 3H5CB 4CH8B 2D1JA 1GDNA 3FN8A 3SV7A 3QLPH 2ZGJA 2ZDKA 1ELCA 3BF6H 5DP4A 1MTNB 3PWCA 3HGPA 1IQHA 2BLVA 1UVOA 2FOEA 3LGVA 1TLDA 1MTUA 3B9FH 5JB9S 1RJXB 2GCTC 2H9TH 2XWBI 4DCDA 9ESTA 5EJZA 2UUFB 3SU2A 3T27A 5SGAE 1QJ1B 2WPLS 1LHCH 1HAPH 1G2LA 4AYYB 4XOJA 1XUHA 5I25A 1GDQA 3A8BA 3L6PA 2BMGB 3U28C 1GJ7B 1HAYB 1ZOMA 3GCHC 1UTMA 4WVPE 4HFPB 2BYAX 1LTOA 5GCHF 1VGCC 1S84A 1BTPA 3KNXA 3ATWA 1BHXF 5EQSA 1C5RA 4CBNA 4IN2A 4NGAH 3ZVCA 4B1TA 2PTCE 1UTLM 2BDHA 3LDXH 2GTBA 4X2WA 4NIYA 4KP0A 2F43B 1IOEA 2J9NA 3SGAE 3TJUA 2W26A 4D76A 3BTDE 3L3TA 2UUYA 5EODA 3A88A 1LPZB 3A85A 3A7YA 3F6UH 2J4IA 4K60A 3SGQE 3LT3A 2BTCE 3P8FA 2TGPZ 1UJ1A 2HRVA 1HAVA 5C17A 3SNCA 4K1EA 4F48B 3ZZ9A 1O3LA 2FESH 1F0RA 5EQRA 1FPCH 2EC9H 1JBUH 3T2NA 1YBWA 2FLBH 2D26C 2SGFE 4I8HA 2W7SA 2AS9A 4IMQA 3ZVAA 5E0GA 1QL8A 1GBMA 4RT1A 3Q00A 5EXLA 3SU3A 1Y5UT 1DWDH 1IQJA 4J1YA 2EI7A 2AHME 1ABJH 1LVMA 1S0QA 3OYPA 2PGQB 4A6LA 2J97A 5AFZH 1TOCB 2VWMA 1GJ4H 2VBCA 5F8XA 4B2CA 1C2LA 1ESAA 1F7ZA 1SGQE 4U32A 4D9RA 2Z3CA 1W0JD 2WPDD 3QK1A 5EJ1A 3OY5U 1G3DA 1NFXA 2VGCC 1A0JA 4Q4LA 3SJIA 1GI5A 1GI3A 1HAIH 1O5FH 4DURA 3M3SA 3D23A 1BUIA 4H6TA 1GMDG 1WTHD 4DGJA 1UVPA 4BOHA 1UO6A 3S69A 1V2UT 1GBTA 1OYTH 2ANYA 4KTCA 1TIOA 4P00A 2ZDAH 5A0BA 2NU0E 1L1GA 3HKIB 2STAE 3FP7E 5LPFA 1KSNA 1G36A 1TNIA 1L2EA 1T7CA 5JDUB 3M61U 3M7TA 1UTKA 1CA8B 1O3FA 3BTKE 3W95A 1C1PA 2JETC 2RFKC 4DIIH 1D3QB 1XM1A 2QF5A 5JBAS 4Z1MD 3LONA 1UCYH 3S7HB 1GBKA 1FN6A 1A46H 3Q3KA 5LPRA 1FXYA 1TMBH 1NFYA 1C5SA 2ZU3A 3ZZCA 5L2ZH 2EY4C 2JJ1D 2BB4A 2HALA 7GCHF 3SU6A 1TQ0B 1OWDA 4NIWA 1OWEA 5CHAB 2KAIA 1LVOA 1C5VA 1ELFA 2ZHEH 4NZLA 2A2XH 3ZIAD 1YKTA 1T8MA 1EP6A 4X2VA 3U9AH 3SJKA 4FOUC 3ZZ7A 1Z8JB 3E1XB 3PWBA 2PHBA 1GHAG 4P02A 1RIWB 2GP9B 1C1OA 4KKDA 2ZTXA 1PPEE 2VIVA 1AD8H 4BAHB 4UE7H 4YO9A 1BRUP 1OXGA 1TGCA 1WUNH 2GKVE 1CGIE 2LP6A 4YT6H 1C4Y2 4ABAA 2GVFA 5JBCS 1K1JA 5JBBS 1TRYA 2QGRA 2Z9JA 4SGAE 5T3HA 3SU1A 1KIGH 1ANCA 1F5RA 1F5KU 2PV9B 1QJ7B 3F9FA 1NRSH 2UWLA 4OS1A 3BTWE 4AG1A 2XC5A 3FANA 3TJNA 4RT0A 2G5NA 2FMJA 2OD3B 1DM4B 1UW7A 1CBWB 2KCOA 4O3UA 1SMFE 5HMAA 5JYIA 1VZQH 2ZZUH 5KGOA 2M5TA 4CRCA 1QGFA 3LPRA 1GBIA 4ACAA 2ZTYA 3PTBA 3S9BA 3S0NA 1W0YH 3Q76A 3LGTA 1PFXC 1ORFA 3NXPA 1V2OT 3FP8E 3RU4T 3M5NA 2YMSB 1CA0C 1O2WA 1C1RA 1V2VT 2VWNA 2AYWA 2BDYA 4R8TB 2C90B 1DITH 1MQ6A 1HJ9A 3VPKA 3TJOA 3UQVA 1GBJA 1D6WA 1D3PB 3RXCA 6CHAB 1C5TA 3BTHE 1O35A 4Y8ZA 2G55A 4H4FA 1AIXH 3K9XB 1C5UA 1HIAB 1DUAA 2ZCKP 3MU4A 4A1XA 1MTSA 2Y5HA 1BTZA 1QFKH 1O2QA 1SGFG 3B23B 3RC6A 5IK2D 1UVTH 2F3CE 3UR9A 1V2KT 1GVZA 1GG6B 1TX7A 1HXEH 5C2ZA 4OS7A 3FP6E 1ABIH 4ZXXH 2FS8A 1W2KH 3DA9B 1H9IE 2JH0D 2XYAA 2K1QA 2KX4A 4YZUA 2HLCA 3V12A 1E37B 5DP9A 1GGDC 1HDTH 1Q2WA 3TNSA 1WQSA 2G4TA 2VU8E 2VVVA 5K7RA 1EAXA 1L1JA 1SOZA 1QBOA 1JWTA 4ZHMU 2V3MA 3F0OA 4KTSA 1WXRA 1GPZA 2BDBA 3O8DA 3MNSA 2ANMH 3PYHA 3TK9A 1O5DH 6LPRA 2YMSC 1TNJA 4GCHG 3AAVA 1O3GA 1GI7B 1LVBA 2Y6TA 3BTFE 1F0UA 2Z9IA 2Y81A 1MTVA 2XW9A 1ELTA 1W12U 1Z8IB 1DE7H 1GI1A 1OHHD 1UTNA 4MNVA 2BD2A 6GCHF 2FZZA 3NZIA 3ZZ8A 3SV9A 1J16A 1IQIA 1C5XB 1O3IA 1XUIA 2Y82A 3BIUH 2BY8X 1WQVH 1P9UA 5AHGH 1NFWA 1GG6C 2VIPA 5A2MH 3ENSB 3TK6A 4DVAU 2H6MA 4RKJB 3A87A 2QF4A 1NU9A 2CF9H 4ZKSU 1W0KD 3QN7A 2ZPRA 4HI3A 1O3CA 1GBLA 5GIBA 2GCHG 1C2IA 4Q7ZA 1L4ZA 3T26A 3IWMA 1UMAH 3B8JA 1HAGE 1L1NA 1LHFH 2F4LA 5A0AE 1O5AB 4Y7AA 1O30A 1AB9B 3HKJB 1K1MA 3E6PH 1QNJA 4AB8A 2BXTH 1FIWA 3PV4A
chains in the Genus database with same CATH topology
4F49A 3KHVA 5A8ZA 1V2LT 1QRWA 5EXNA 3T5FH 1GBFA 4AFZA 3F68H 1CHOF 1DWCH 4NA7A 1AMHA 3ESTA 2SGQE 2ZHQH 2J2UA 1RD3B 2F9BH 4WY3A 3A7VA 2LNCA 1LPKB 3LC5A 3UUZA 1GWAA 1O2GH 1O2VA 3QTOH 2FDAA 1TPOA 3MU1A 1E38B 3BG4C 3GDUA 1GJ6A 4H6SB 2CF8H 4D8NA 1HBTH 3VEQB 3NPSA 5C5NA 3UWIA 1TALA 1V2WT 1ARCA 4CRDA 4GLYA 4ZAEA 1JIRA 1EPTC 1BOQA 4U30A 2WUCA 1FN8A 4XFQA 4AN7A 1ZYOA 1GHBG 3BTEE 3SU0A 3A81A 3BG8A 5JPMH 3RXDA 1MD7A 3E91A 4U01A 4CREA 1MAXA 2O8UA 3AASA 1DLKB 2JH6D 5A8XA 1SC8U 1DT2A 3KN2A 2FOHA 3A8DA 2YNAA 4Y7BA 4O03A 4B2AA 1N8OC 3R0FA 3GISB 2CJIA 1EJAA 1FPHH 2G52A 1NRPH 1U6QA 4WJG2 2Q6DA 1F5LA 1EP5A 1XUFA 2WYJA 5DK1A 3TIUA 1SGFA 2R9PA 4NCYA 3KF2A 1GI0A 2ZFQH 1C1VH 3RXOA 1ZRKA 2I6QA 2P94A 1ELAA 1V3XA 3HK3B 1TGBA 4Y79A 5DGJA 1Y3UA 2ZU4A 4H42U 1DOJA 2FO9A 3ATKA 1NT1A 1TNLA 4BTIB 3AW1A 1C1WH 1S81A 1NRQH 4UFDH 4BANB 1MUEB 1C4U2 2QY0B 5EGMA 1C1TA 1KXAA 1V2ST 1ZPCA 5GDSH 2R2WU 2AMDA 5C3NA 3MU8A 2FOFA 1WOFA 2TRMA 1BJUA 2R2MB 7ESTE 1B5GH 1AFQC 4ABBA 4K69A 4NA8A 4IW4E 5FX6A 2ESTE 5GPIB 5FCKA 4CR5A 2ZGHA 3RXGA 2GMTC 3NUMA 3PROA 3RC5A 2NU2E 1DANH 4WMFA 1EZSC 1Z7KA 1JRTA 1A61H 3ODDA 1LPGB 4DT7B 3PO1B 2FODA 1E36B 1T8LA 1C1UH 1P2KA 4Z0KA 3TGIE 3EGKH 1ZMLA 2YOLA 1H9HE 4CRGA 1WU1A 1KLJH 1O3OA 2FTMA 1L0ZA 1BTWA 1O36A 3NK8A 4DOQA 1C5LH 1EOLA 4X6OA 3W94A 1QA0A 4OGYA 5DP5A 1TABE 3E16B 1P05A 1NU7B 3LOXA 1GJ5H 1DS2E 3BEFB 1TOMH 3MU0A 1SQOA 4NWLA 1Y3XA 3A84A 2K7XA 5EXMA 1QB6A 1FONA 1C1SA 4IBLH 1GMDF 2AIQA 3MO9A 4JYVH 3GCNA 2GX4A 3P17H 1T8OA 1O3MA 2ANWA 3ATMA 1HGTH 1HYLA 4I7YH 1PQ8A 1WTGH 4JK5A 1J8AA 5HXFA 2V3HH 4AORA 5TJXA 3STJA 1CSOE 2ASUB 1QIXB 1O2ZA 2BD3A 1BA8B 2XBXA 1V2QT 2OCVB 3GCOA 4O97A 2CGAA 3HPTB 1YF4A 1P01A 3OU0A 1GJCB 3RXQA 4E05H 2FXRA 2ZU2A 2JH5D 2FOCA 2A31A 5DJ7A 2J95A 3A82A 2B7DH 3PO1C 1O5BB 4E06H 2QC2A 1AE5A 2PKSB 2FIRH 1SHYA 4VGCC 3MH5A 2GZ8A 1S82A 2AIPA 2PSYA 3V3MA 1BTXA 5J4QA 5HYOA 2ZHWH 1AVXA 1KXFA 1YPKH 3GICB 1TQ7B 2BY9X 1IQGA 3RU4E 3C1KA 4MDSA 1HJ8A 3DD2H 4Q7XA 1V2RT 2BVSH 1HAOH 3U98H 1T8NA 3PMJA 1Y3VA 2Y5FA 1GHAF 3SV8A 1BTUA 4TYDA 4NA9H 2QIQA 2ZGCA 5T6DA 3RXMA 1HAHH 2OC8A 1XX9A 2FI5E 1GDUA 4K3JA 3RM2H 2BQWB 4MPVA 3K6ZA 2C93B 2F9OA 1BB0B 4FUGA 5JBTA 1C2KA 1G3BA 1PPCE 2V0BA 1W13U 2XNIA 1E0FD 2BDAA 3PMBB 2CHAB 3KQEA 2PKAB 3F9EA 1SLXB 1P02A 1GBHA 3RXVA 1FIZA 3SNEA 4X6PA 2O8MA 1ZGIA 3F9GA 4Y11E 3LGIA 3GY4A 2XXLA 4O3TA 1AU8A 1NC6A 5A09A 1DWBH 3GY5A 3TU7H 1ZGVA 3NKKA 1G3EA 2PUQH 4ZHLU 1A3BH 7LPRA 2BLOA 2P8OB 1OPHB 3PM3A 2FWWA 1MQ5A 2BVRH 2OLGA 1W8BH 2QA9E 5CMXH 2ZNKH 3RXAA 1TONA 1BTHH 1C5NH 3U69H 5FXLA 1YPEH 4AOQA 1A3EH 1GL1A 4X2YA 1H8DH 1O3NA 1IQEA 1KYNA 2BHGA 2YNBA 1CT2E 1NN6A 1ANEA 2QXJA 4BXWA 2WPKS 4I8JA 2TIOA 1B0FA 3ZZ5A 3URCA 4YLUA 4JZFH 1BMMH 3HK6B 1MTNC 1OS8A 4AB9A 1YPHE 4TPYA 2OC0A 3LH3A 1G9IE 1TAWA 1RTKA 4OS4A 1BMNH 5GWZA 4I8KA 3UOUA 1HIAA 1Y59T 3HGNA 1W7GH 2O8TA 4WH6A 4I8GA 5EOKA 1TGSZ 3MTYA 2ZPSA 3LJOA 3VB6A 1PQ7A 2A1DB 4GCHF 1SQAA 1CO7E 1FMGA 1EZUC 8GCHG 1SHHB 1S6HA 5DP7A 3NWUA 1P2JA 4E7NA 1NO9H 1MAYA 3ZYDA 1XXDA 3P8OA 3QZQA 1YLCA 3DFLA 2W5EA 1O2HA 2ZCHP 3CP7A 1MU6B 5FPTA 3SUDA 3SNBA 2TPIZ 3BEUA 1S0RA 2XCFA 5PTPA 4UFGH 1MMJN 4I31A 2AH4X 3O8CA 1NROH 5FPYA 1RRKA 3ZVEA 2ODQA 1O3JA 1MTWA 2JKHA 2GCHF 3RUOA 1Y5AT 1KXEA 1C5ZB 4Y6DA 4UFEH 1AKSB 3MO6A 2ZO3H 1D3DB 3SJ8A 3SU5A 1O33A 3SV2H 3OTJE 2PUXB 2BD8A 3UREA 3E90B 1VITH 4K8BA 2AMQA 1MU8B 3GY2A 1XVOA 1QBNA 1P2OA 1W14U 2HNTF 2BQ7B 4YTAA 1GI6A 2BY6X 1QTFA 2P3FH 1ID5H 2HNTC 1TGNA 1O3HA 3MMGA 2H9EH 4XE4A 3M7QA 1F0SA 2D2DA 1DDJA 3KL6A 3BN9A 3RXUA 4LK4A 5A8YA 5EW2H 1MKXK 1P9SA 3SU4A 1CHGA 1VJ9U 2PWXA 4DW2U 4YOGA 1CGJE 1EPTA 2P95A 1ZSJA 1ZRBA 4BNRA 1SGEE 2BD7A 1O2SA 1ETSH 2HOBA 1CQQA 2WINI 4X0WU 1AZ8A 1ESBA 1GBEA 2ZWLH 2PR3A 3MNBA 2FX4A 3FAOA 2H5CA 1TX8A 5K0HA 1O0DH 3PMAB 1P2IA 3URDA 3PB1E 1YYY1 4JZEH 1C5YB 1QB1A 2QN5T 4X1RU 1F92A 4IMZA 1CGHA 3MFJA 5DP3A 4JK6A 4TPIZ 4BAOB 1BBRE 1LKAA 5HM9A 1DY9A 1GMCG 3PMHB 1XUJA 1GHBF 3KGPA 3UPEA 3DT0H 5A0CA 2HPPH 3QUMP 1VCPA 2ZFPH 4B74A 1C2FA 1RTLA 1TBRH 4CRBA 1NS3A 3VXEH 3BIVH 2ODYB 5EU8A 3VGCB 1QL9A 1NTPA 1O2YA 5ETXA 1QR3E 3RXBA 3SNDA 3Q77A 5CHAC 1FY3A 5EQQA 2CN0H 2VVUA 1OP8A 1XKBC 1GCTB 2V3OH 1E35B 1FNIA 3P95A 1P2QA 3O8BA 1RIWC 3QGNB 1DX5M 3AAUA 1AUTC 2A4RA 4ISOA 4OS2A 4X1SU 1SGNE 4ZUHA 1TGTA 3UTUH 1FAKH 2XTTB 1SB1H 1P10A 4YLQH 1K9OE 1V2JT 4NWKA 1WSSH 4DIHH 1S83A 5TCAA 1SGDE 4ISLA 2UUKB 3STIA 1QL7A 2R0LA 5EPNA 2BD9A 3LU9B 1XVMA 2PLXA 3LGWA 3UNRA 3ELAH 3TNTA 1UHBA 1CBWC 1OWIA 2ZHFH 1GI4A 4JYUH 1GBCA 1C2GA 3TH3H 1EOJA 1M9UA 2B0FA 3VB4A 2FOMB 3A7TA 1OWKA 2Z6BD 4FUEA 2QXGA 4WXVA 3TK5A 1MH0A 2A45B 1P8VC 2BZ6H 2XC0A 1UTPA 4Q7YA 3M5MA 3HATH 1P2NA 4MNXA 1WCZA 1C5WB 4FUBA 3MNCA 1ZSKA 1L4DA 1O2OA 1YPMH 1LHEH 2NU4E 1DXWA 2XC4A 2THFB 2ZG0H 6CHAC 1YP9A 4IC5A 2P16A 1OWJA 2V6NA 1DLEA 4AZ2B 4BAKB 3RMMH 1AWFH 3GY7A 2WYGA 1AY6H 3GY6A 2TGAA 3PTNA 3EYDA 3I78A 2VH6A 2Y7XA 3EQ0H 1UCYE 4YESB 2QV1A 5B6OA 1K2I1 3RXSA 1P12E 5C1XA 1C1NA 4ABJA 3RXKA 1JMOH 1Z6EA 3KEEA 4A7IB 1ZHPA 3GCTG 4OGXA 1O2PA 3A83A 3FZZA 4GHQA 1SGPE 2IJOB 4XSKU 2OINA 2UUJB 5HM2A 2BQ6B 1LDTT 4FUHA 3T28A 1GHVH 1HNEE 1N6XA 4FUJA 2W3IA 4HZHA 3RXRA 1Y8TA 1ZMJA 1B7XB 1MBMA 1A5HA 3M37A 3UIRA 1GJDB 5EPYA 2HGTH 2OP9A 4MPXA 2AERH 1QB9A 5H4IB 2ZQ1A 2OBOA 1A2CH 4MQAA 1RS0A 3S7KB 3VXFH 2H2ZA 1LHGH 2VWOA 1D6RA 1YCPK 3MU5A 4X1NU 3V13A 1J17T 1BIOA 3FVFB 1EAIA 5AF9H 3M36A 1O37A 4NG9H 1AI8H 2WPJS 1MD8A 1VITG 4JYTA 1HPGA 1G37A 1ZLRA 4IGDA 1QURH 2LPRA 4FXGH 1Z1JA 2W7UA 4CHAB 3M7UA 3A8CA 4TY6A 3E0PB 1O2RA 2C3SA 1C5QA 3R3GB 2C8WB 1OOKB 1RXPA 3KQBA 4X8TH 1AB9C 4Y8YA 1C5PA 1BZXE 4IS5A 1MZDA 1HJAB 3EA8A 1O34A 1GBDA 4TWWA 1Z71A 2ANKH 3GYLB 1JOUB 1THPB 5E2PA 4ABHA 2XWAA 2FOBA 2ZCLP 1YPGH 1EXFA 2ZQ2A 4JZDH 1G2MA 4K1SA 4ABDA 3AW0A 3UWJH 4PROA 4ABFA 2Z9LA 2IPHA 1J14A 1SQTA 2BD5A 2ZU1A 1GL0E 1K28D 4OS6A 1O3KA 4ZKOU 5EW1H 3LGUA 1LKBA 2F9NA 1ZJDA 3RXLA 5C1UA 1GHWH 3MO3A 4BTUB 1LMWB 1P03A 4LOYH 3RXEA 4GAWA 3UNSA 3ZVDA 1J15A 2FM2A 8ESTE 3RDZA 4XDEA 3TH4H 2ZFFH 3RMOH 2C8YB 2QXIA 1FZZA 1QCPA 1UVSH 1FJSA 1XMNB 2QYIA 2J92A 3M3VA 3I77A 3EAJA 5E2OA 4GPGA 1YCPM 1KDQB 2F83A 3GOVB 1D3TB 1NRNH 1K1NA 1Y3WA 2G4UA 1AHTH 2ZDLA 1DUEA 1THRH 5ESTE 4GHTA 3C27B 2A7CA 3ATIA 2WPHS 5ABWA 1T32A 4CRAA 1O3DA 3S9AA 2WPMS 4QT8C 3NCLA 2QAAA 1PPHE 5LGOA 1QRXA 4XBBA 4ZROA 4JMYA 2ZFRH 2BY7X 2RCEA 1BRBE 1D4PB 1AZZA 1TPPA 3ZVBA 2CV3A 1ZPZA 2BM2A 4ZHAA 5JB8S 3KCGH 4ZKRU 1HRTH 4WXIA 3RLYH 2BOKA 8GCHF 1HAXB 1NPMA 4GVUA 3UQOA 1BMAA 1NRRH 4X6MA 3H7TA 4FVDA 1G3CA 5F8TA 4ISIH 1CT4E 1PPZA 1P0SH 3DHKH 1SL3A 2PTNA 1ELEE 3TGKE 2ZU5A 2C8ZB 2G8TA 1DSUA 3SO3A 4WWYA 2R3UA 1S85A 3EA7A 1FV9A 1HFDA 1BBRK 1V2NT 5DP8A 2GV7A 2ZTZA 2TGDA 1C5MD 5FBIA 3D62A 1RFNA 1A0LA 1EZQA 1TWXB 1SFQB 2F9VA 3SI4H 3IITA 4D7FA 1ESTA 1T31A 3ITIA 2DE9A 1EKBB 1O2MA 3TVJB 4I33A 4GUXA 2Y5GA 2H1UA 2GZ9A 1A4WH 4CRFA 1SPJA 1P06A 1YM0A 3L33A 4AFUA 1ZZZA 3LIWA 3D49H 2SNVA 1G30B 3FZDA 2AGEX 4AYVB 3BSQA 4OS5A 3VB5A 2I6SA 2ZDNA 2FX6A 3EBNA 1TB6H 4CH2B 1Z6JH 4MPUA 1O2UA 3U8RH 4YOJA 3ZZBA 1E34B 1X7AC 1UVUH 3K65B 1H8IH 2HPQH 5E8EH 1ANBA 1NM6A 4NFFA 4BAMB 1NY22 2ZDMA 2GDEH 4ZKNU 1AKSA 3SW2B 4ZXYH 3UY9A 2ZECA 3RMLH 3ZZDA 1GMHG 1IQKA 2GCTB 1HUTH 1SLUB 2J94A 3KIDU 1MKWK 2ALVA 1IAUA 3SHCH 2RA0A 4Q2KA 3GCHB 1P3CA 3OY6U 1LVYA 1VGCB 3A89A 1C4V2 1ELVA 3SBKA 1DY8A 4KTUA 4MLFB 2A5KA 2Y80A 1IQFA 1ELGA 1BHXB 1H1BA 1GMCF 5C1YA 1SGYE 2FTLE 1IQLA 5L30H 4Y76A 3RXHA 1NFUA 2P93A 1HXFH 2A2QH 2PKSC 3U8TH 2RDLA 1H4WA 2OBQA 1AWHB 4B73A 1HCGA 5L6NH 4K5ZA 1H9LB 2AGIX 4B75A 2EEKA 2BZAA 1SR5C 2Q1JA 4Y71A 2BDIA 3PLBA 3T62A 1W3CA 1UCYK 9LPRA 1G32B 3SN8A 1O3BA 4NIVA 1HLTH 2ZIQH 3SOSA 1KTTB 1KY9A 1GBAA 3GYMA 4AFSA 3ZZ4A 2QF0A 1J9CH 1GHXH 4FUDA 4MNYA 3O8RA 2VWLA 2O8LA 4HTCH 6ESTA 1BCUH 1FY1A 3AVZA 4Y8XA 4A1TA 1C5OH 1BTYA 1O2LA 5GXPA 1BBRH 1P09A 3SI3H 1N1LA 1QBVH 1PQ5A 1EAWA 1GI9B 2CHAC 1Z8GA 3QTVH 2ZF0H 1TYNA 1EUFA 2PGBB 1XUGA 5EG4A 4SGBE 1ANDA 2A4QA 1AQ7A