1HAXB

Snapshots of serine protease catalysis: (a) acyl-enzyme intermediate between porcine pancreatic elastase and human beta-casomorphin-7 at ph 5
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILRNNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-CASOMORPHIN-7
publication title X-Ray Snapshots of Serine Protease Catalysis Reveal a Tetrahedral Intermediate
pubmed doi rcsb
total genus 60
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2001-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1haxB02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1haxB01
2FTLE 2PGQB 2AMDA 2BD5A 3BEIB 1SB1H 2GZ8A 1Z71A 1PPGE 2PFEA 5EPNA 1O5FH 1SSXA 4ISLA 3W95A 4NA7A 4A7IB 3Q00A 1TQ7B 2A7JA 1NPMA 4AX9H 2WYGA 5AVDA 1O2GH 2UWPA 3BIUH 4BNRA 1W11U 1BBRK 2GCTC 3ZZAA 1Z7KA 3BG8A 2B8OH 4ZMAH 2H9TH 4IGDA 3SU5A 1GGDB 1TA6A 2FTMA 2B0FA 4GSOA 1GJDB 2A0QB 1BZXE 2JKHA 1M9UA 3PMJA 1H9IE 3MI4A 3MNBA 2ODPA 1HJAB 1GI5A 1WV7H 3GCNA 3T29A 4NA8A 1QJ6B 4TPIZ 1W7GH 1TGBA 3QWCH 2XW9A 1F0RA 2RA0A 5HXFA 9LPRA 1QHRB 2ZGBH 4NIYA 4UD9H 2Z6BD 4HFPB 7KMEH 2ALVA 1QR3E 3QGNB 1SVPA 1RTLA 4UEHH 1TB6H 2AIQA 1J9CH 1BIOA 1S82A 1OP0A 3NCLA 1WYKA 1MTNC 1IQFA 3D49H 4K5ZA 4MPXA 4E06H 5ABWA 4CRFA 2OUAA 8GCHG 7ESTE 5T6DA 1BRCE 1C9PA 4R8TB 3QO6A 1KLJH 3VB7A 1F0TA 2FESH 2OBOA 2GVFA 1L1GA 3UPEA 3OSYA 4WMFA 2F9VA 2P3UB 1UVPA 2BX4A 2SFAA 1NM6A 5A8ZA 3F9EA 2GCHF 4FUDA 1UTPA 1C2EA 2Q6DA 3QX5H 1ZHPA 1O2PA 2ZGCA 1DLKB 1P57B 1C5SA 1ETSH 1YCPK 3L3TA 1UMAH 4XOJA 5TCAA 4B73A 2WPHS 1EUFA 1RJXB 1SGCA 1ZYOA 3M5LA 3S7HB 1ESBA 2G81E 2O8TA 1C1TA 3GCTG 4BAKB 3FP7E 2P94A 3E1XB 4LZ1H 2ZF0H 5C2ZA 2ZTXA 3TU7H 2P93A 4GCHF 2A4GA 2RCEA 1O32A 2W3KA 4Y7AA 3VFEA 1GBLA 1OP2A 1GBMA 1RIWC 1C5PA 3A7YA 2F9UA 3LU9B 2D2DA 2C90B 3PYHA 1C2IA 1ELTA 3TJUA 5E8EH 4DW2U 3BTFE 2O8LA 1MU6B 6ESTA 1HV7A 1GHXH 4ZXYH 2ZKSA 1C5YB 1IQGA 1O2MA 1P05A 5AF9H 1ZPZA 5DK1A 4HTCH 4FUJA 1DXPA 1YPGH 3HGPA 4I8KA 4IC5A 4AN7A 2PTNA 5ESBA 2XCNA 5T6FA 4DJZB 1VGCC 2A7CA 2R2WU 5GCHG 3ZZBA 1S83A 3ZVFA 1B0EA 2VH0A 2FZZA 1EB1H 3FVFB 2PV9B 2BVSH 4OS1A 3SNCA 1ELDE 2BLOA 1OS8A 5BRRE 4GHQA 1PFXC 4E7NA 1AFEH 3F9FA 5F03A 3GOVB 1BUIA 1V2OT 2AGIX 3UR6A 1TGTA 1N8OC 4ZROA 1DWEH 4X1SU 1ZSKA 1G3CA 2Y5FA 4X8UH 4E05H 1QTFA 1EQ9A 1NRPH 1GWAA 3RP2A 2B9LA 2SNVA 3TIUA 5HGGA 4TYDA 5IYTA 1NY22 4RN6A 2F9BH 1A7SA 4ZXXH 3RMNH 1KLIH 3B23B 1AY6H 3RU4T 3LT3A 7GCHF 1C5MD 1WQSA 2FOFA 1K21H 2CXVA 1O3PB 2ZPRA 3LGIA 1BMMH 2SGEE 3BEFB 3A89A 1GHYH 5EQSA 3F6UH 1GBEA 3QN7A 2HALA 4DGJA 2DE9A 3GY5A 1CE5A 1WAYB 1V3XA 4KKDA 3EQ0H 1SGFA 1UTMA 1THPB 2IN2A 3A81A 5CMXH 4X1QU 1OPHB 1Y5BT 4FUHA 2UUYA 4X2VA 1GDUA 2BY6X 1DANH 1HDTH 1FAKH 1OWEA 1SQAA 1YPLH 1D9IA 5EQQA 2THFB 4I31A 2QXHA 2ZIQH 3RXRA 1O3FA 1EATA 1GBKA 1TPPA 3A8CA 1ARCA 1G9IE 1SLWB 1A0LA 1P2MA 2V0BA 3VB4A 1FY3A 3ZV8A 1O3DA 5FPTA 3GDVA 3NK8A 2A2QH 8LPRA 1O34A 3LOXA 1FIWA 1YPEH 1IHSH 1C2FA 3K65B 2G5VA 1BMLA 4OGYA 4YT6H 2QCYA 2BLVA 2OC1A 1GVKB 5A0BA 4H6SB 3LH1A 5DJ7A 1QGFA 2FO9A 1ETRH 1ANCA 2R3YA 4DIIH 2XXLA 3R3GB 1QBNA 3RXAA 1PQ7A 1J15A 1QCPA 5FHTA 3OY6U 4UE7H 1F5LA 4D9QA 3L6PA 4IN1A 3KCGH 1ORFA 4INLA 4D76A 2PKSC 3BTDE 5EOKA 3KQBA 3VGCB 1AZZA 1IQMA 3VXFH 2A45B 1LHEH 2FDAA 5EXLA 4WH6A 4AGJA 3E6PH 2H9EH 1HIAA 1O3CA 1ELEE 3M37A 2BLWA 1AWFH 1P9UA 1YLCA 1BJUA 1WQVH 1TIOA 1GI3A 4OGXA 2PSYA 1D3PB 1P11E 1S81A 1A3BH 4SGAE 5JB8S 1DFPA 3PWBA 3A80A 3ZZ5A 3GCTF 1QL8A 3FAOA 3RXEA 3ZVEA 1HAXB 3ZV9A 3SU3A 4LOYH 3ITIA 3GDSA 1Q2WA 1LVMA 5F8XA 1V2JT 2HNTE 1UTQA 1QRXA 1AFQB 2P8OC 3T26A 1WSSH 1VJ9U 1BJVA 2BXUH 2CV3A 1G30B 1JWTA 1ZSLA 2FOEA 4K3JA 4NG9H 5EG4A 2EI6A 2WUCA 1V2WT 4E7RG 1EPTB 2H9HA 4Y76A 3CS7A 2ANWA 5BPEA 4Q80A 3WY8A 5EW2H 1MKWK 4Q7YA 1DWCH 1L1JA 1HAYB 1O3OA 1NRQH 1MAXA 2HWLB 1ZSJA 1NFWA 5GCHF 1OSSA 2ZDKA 1TONA 1FY4A 2BZAA 1E0FD 2ZEBA 2JH5D 1O2RA 1BRAA 1FPCH 1P2NA 1ZJKA 1UHBA 2ZDNA 3RDZA 1TAWA 4X2XA 1IQNA 2WPKS 3F1SB 5L30H 2R9PA 1EP5A 5A0CA 1FY1A 1O2LA 1S5SA 3A7TA 2VVUA 4ABEA 3E0PB 1O37A 1MH0A 3S9BA 5C5NA 2FODA 1GGDC 1Y3VA 1TE0A 5FCRA 2ZHEH 3IWMA 1HBTH 1QL9A 1ESTA 1P01A 1PQ5A 4FU7A 1ZOMA 1MD8A 1SLUB 4XBDA 2WPMS 1P09A 3SV6A 2QAAA 1Z8IB 1NROH 4D9RA 1RXPA 2VGCB 2AFQB 1DE7H 4O97A 3RXSA 2BD8A 1QIXB 1BMAA 2H1UA 3I78A 4KP0A 1HAVB 1MTSA 1QBOA 2XCFA 3Q77A 2OQUA 4FUCA 4K69A 2VWOA 1QQ4A 1HAZB 3QTOH 4K2YA 4R0IA 1ZHRA 2PUQH 3GYLB 9ESTA 3ATLA 1DY9A 2FIRH 3VB3A 1BRBE 2W7SA 4ISOA 1O36A 1DT2A 2V3OH 1SGNE 4I32A 1H4WA 3A83A 4Y71A 1C9TA 1YBWA 2A5IA 2Z9LA 2QA9E 1YPKH 4TY7A 1BITA 2XBWA 1SR5C 2PTCE 3F9GA 2ZPQA 1FXYA 2F83A 1GCDA 4JZFH 3ZZ4A 1TMBH 3SV7A 3RXDA 4MDSA 2OXSA 1GCTB 4J1YA 1DSUA 1C5TA 1ETTH 3GISB 4BXSA 2ZP0H 1EASA 2G8TA 3ATIA 1P12E 3OX7U 4MPVA 1WCZA 4X2YA 2ESTE 1XXFA 2ZA5A 1N6XA 1EKBB 4BTUB 7LPRA 1ELBA 1MU8B 2BD2A 3SNAA 1YGCH 1FDPA 1KDQA 4AYYB 3P17H 2OC0A 1SGIB 2SGDE 4GVUA 1GJ5H 4NIXA 5I46H 1H1BA 1ZRBA 4IS5A 5C3NA 5JBBS 4IN2A 1F7ZA 4DT7B 1HFDA 4KTSA 1K28D 1MMJN 1KSNA 2Z3CA 4ZH8A 4AG1A 1SGEE 1KYNA 4ZUHA 1GJBB 2BDGA 1TBRH 4ESTE 3PTBA 3A7WA 4WXIA 2C8WB 1OOKB 5CE1A 3P70B 1BDAA 3W94A 1ZHMA 2VWLA 4IW4E 1AHTH 1O3AA 3GY8A 5J4SA 2ZU3A 2G51A 3SUGA 1NS3A 2O8UA 2AERH 1ABJH 1PPZA 1SFQB 3AAVA 2A1DB 3MYWA 4IC6A 1O2QA 4IBLH 4O9VA 2DUCA 1O38A 4ABGA 2XC0A 2F9NA 2ZFSA 1G2MA 2XC5A 1TGNA 1O2NA 3EDXB 4ZKSU 1F92A 3BTME 3ZYDA 3KEEA 1GL0E 4YOJA 2ANKH 4CRGA 3UQOA 2FI4E 1C2KA 4DY7B 1LHFH 2QXGA 2AGGX 2XNIA 1V2VT 1FLEE 4HGCA 5E0HA 3AW1A 1J8AA 4MPUA 1ZRKA 3SGQE 4AZ2B 3TH2H 2FOHA 1JRSA 3A85A 2FP7B 3O8BA 4AFUA 3M7UA 3LGUA 1EOJA 3TK9A 2H6MA 1J16A 1TLDA 1F0UA 4K1EA 4NCYA 2PR3A 3FP8E 1JIMA 2NU4E 3QUMP 2CF8H 2BQ6B 1GI9B 2PW8H 1S6FA 1NT1A 1IQJA 1FIZA 1K1MA 4GAWA 1FZZA 1AUJA 4OS5A 4B71A 4BANB 3MTYA 2EI7A 1VR1H 1HXEH 5AFZH 1B0FA 2TIOA 3TJNA 1QNJA 2VU8E 2Y7ZA 1THSH 5TCCA 3SU2A 1OYTH 3SJOA 3S7KB 2FLRH 1TPOA 2QXIA 2ZQ2A 3UNQA 1GMDF 3KF2A 3TVJB 1CA0B 1AWHB 1SGFG 3P8NA 4XBCA 4U32A 2QN5T 1GMCF 1LQDB 1DPOA 2GDDA 2Z9JA 3IITA 1EAXA 1BHXF 5E2OA 2G55A 2CGAA 3BTKE 2QIQA 3SGAE 1A5IA 1V2UT 1QQUA 1C4V2 1Y3YA 1LHCH 2VIDA 1DDJA 1K1OA 1ABIH 1HJ8A 3SNDA 2BXTH 3RM0H 1Z8GA 3N7OA 2XYAA 1O2ZA 5SGAE 3STJA 1K1LA 1E36B 1MTWA 4NIWA 3K6YA 3UIRA 1CBWC 3A8AA 1RTFB 2CHAB 1P2QA 5C20A 1V2LT 2HPQH 1BTWA 3A8DA 4AB8A 1AVXA 1C2GA 2J9NA 1L2EA 2D8WA 1LQEA 3SO3A 2ANYA 4LXBH 3BTEE 3RXUA 3BV9B 2UWOA 2BVRH 2PWXA 2FPZA 2HVXA 4ISIH 1EZSC 3MNSA 3PLBA 2ODQA 1XUFA 3T5FH 1K1PA 2JH0D 2BQWB 3PM3A 1SOTA 3R0FA 1GJ4H 2BDBA 4FU9A 2VWNA 2H2ZA 2K1QA 2CF9H 1UK3A 1AI8H 3MH4A 1L4ZA 1EAIA 1O3LA 1GVZA 1C5VA 2I6SA 1XVOA 2Y6TA 1MZAA 1CT0E 1LPKB 1J17T 5ESTE 2HLCA 2GMTB 5FX6A 1LVYA 2P3TB 1P2OA 3A8BA 1T4UH 3ESTA 5GWZA 1ZPBA 1GBJA 1W12U 2QC2A 1P2JA 1CHOG 1UK2A 5LGOA 1QFKH 1ZTJA 1FV9A 1UCYH 3H7TA 3MFJA 4ZAEA 1C5QA 4K8BA 1NRNH 2W5EA 1THRH 1Y59T 3RXTA 2BLQA 3MH7A 1GHAG 2SGQE 1GHBF 4ZKOU 4DOQA 5K7RA 1S0RA 4H4FA 1NN6A 1IHTH 1EP6A 1TABE 4F49A 1D6WA 2F9OA 1Z8RA 1K22H 3BG4C 4XFQA 3S9CA 1PQAA 1GHVH 3K9XB 2B5TB 2PLXA 2TPIZ 2A4QA 5HYOA 2F3CE 1JOUB 3DD2H 1IQEA 3FZDA 4Y0YE 4GUXA 2HNTC 2ZPSA 2YOLA 1NFXA 4CRDA 2C8ZB 1EJAA 3ENSB 1UVOA 3MU4A 1CGJE 4NSYA 3RC6A 1AKSB 5EGMA 1OWDA 1TQ0B 1P3EA 5GJ4B 3TH3H 3TNTA 2BX3A 2ZHQH 2QF3A 1TRNA 1ZPCA 3PLPA 1G37A 3T28A 3PMBB 1CQQA 2Z94A 5K0HA 3VEQB 2Y5HA 3GY6A 3B9FH 3RXOA 1C1PA 2GT7A 1NU9A 1RGQA 3A88A 1K1JA 1K1NA 2ULLA 2RG3A 2PKAB 3DFLA 1O31A 2CN0H 4K1TA 1AD8H 2FI5E 1EJNA 1A0HB 1ZMLA 2Q6GA 3HPTB 1UVTH 2XBYA 4YZUA 1O33A 3BSQA 4BTIB 5L2ZH 1XUGA 1G3BA 1GHWH 1HAOH 3MU0A 3GY4A 4WXVA 2ZU2A 1TNHA 4FVDA 1A1RA 1FJSA 1GBBA 1CGIE 1O2WA 4A92A 5DP7A 3GCHB 2V3HH 1OWKA 1YYY1 1GJ9B 3M61U 3U1JB 3OY5U 1C5ZB 1LHGH 4OS7A 1BCUH 2XWAA 2PGBB 2Q6FA 2HPPH 3MO3A 2R0LA 2ZQ1A 1H8DH 2QY0B 3E90B 3ZVAA 3MH6A 1HXFH 3LGVA 3MNCA 2W3IA 1DICA 3E91A 1E34B 3URDA 1JXPA 1PPEE 1OKXA 4X8VH 3VB5A 1ZGVA 2WV4A 1W8BH 1KXCA 4YOIA 3SUFA 4CBOA 3O8RA 5F8ZA 4QT8C 4RKJB 4X6MA 1D3DB 3TJOA 2Y80A 5G4BA 1KTTB 4MTBA 4WJG2 1C1SA 5L6NH 3JZ2B 3NPSA 4BAHB 4D8NA 2FS8A 1WTHD 1HAIH 5DP8A 3HK6B 5E2PA 2OC7A 1Q31A 2GCTB 4NGAH 1W13U 6LPRA 3DT0H 5DP9A 2FOAA 1G3EA 3A82A 2AGEX 3QZRA 1QL7A 3TJVA 3SU0A 3A84A 2J2UA 1NRSH 1ANBA 2VJ1A 2D26C 1GMHG 2Z3EA 4U30A 8GCHF 3UOPA 2QXJA 3E0NB 1O5BB 2LPRA 2FLBH 5J4QA 1ZTKA 4JMYA 4FU8A 3SBKA 3DFJA 3RMLH 3QTVH 1K9OE 1Y3XA 1FQ3A 1UVUH 1C5RA 5JPMH 4Y8ZA 4B76A 3RXMA 4MLFB 3P6ZB 3DA9B 1GJ8B 1N6YA 4KTUA 2FYRA 3RLWH 3MO9A 1TPAE 1HYLA 3SI3H 5C1XA 4I8GA 2DE8A 1Y5AT 2AH4X 1LTOA 3LONA 2AIPA 3B8JA 1AU8A 1MTNB 4UFEH 4CR9A 1YC0A 5FPYA 2CMYA 1O2YA 1AKSA 5FAHA 1ELVA 5DP4A 3KIDU 2EEKA 1EAUA 3PO1B 1E38B 3E3TA 1LPZB 1QA0A 1A46H 2NU0E 5JB9S 3O8CA 5HM9A 4AFZA 3NZIA 1HAPH 1J14A 3BTWE 4BXWA 1OX1A 3O8DA 2OD3B 3UR9A 1P9SA 2BY9X 4UFFH 4MNYA 2BOKA 5DKMA 2CJIA 1O3IA 1UVSH 4CH2B 1CSOE 3CP7A 3M3TA 3V13A 4I7YH 3U9AH 4RKOB 4DG4A 1AQ7A 3U8TH 1H9HE 1OYQA 1TA2A 1DUEA 3RXQA 3ZVDA 1OWHA 1SQTA 1T8LA 3GY7A 1O3GA 3U69H 1HLTH 1LO6A 3SJKA 2R0KA 5PTPA 5EODA 2M5TA 2WV5A 1BMNH 4VGCB 1RIWB 3DHKH 4Q7ZA 2UWLA 1AVWA 2ZFQH 3MMGA 3TGKE 3A7ZA 1MTVA 3EE0B 3M3SA 1MBQA 1OP8A 1GVLA 4Y0ZE 1DWBH 1PPHE 1OXGA 1V2RT 1HJAC 3UNSA 2FOBA 3SJIA 2ZDVH 4A1XA 1C5NH 2O8WA 2TBSA 1GI2A 1VCQA 5DGJA 1Q3XA 1GHZA 2BB4A 2CHAC 1VGCB 5ETXA 4UDWH 5JBAS 1Z1IA 1TWXB 3ZZ9A 2AMQA 1CU1A 3GY3A 5DG6A 1P8VC 1Y3UA 1PQ8A 6CHAB 1MCTA 1NRRH 2O8MA 4YESB 4ABHA 4XE4A 1GJAB 4FUFA 1INCA 2D1JA 1N8OB 3LGTA 2PSXA 4WH8A 1HCGA 1HGTH 1O5AB 2R3UA 1Z6EA 1ELCA 1Y3WA 3ZVBA 5DP5A 1QA7A 1UO6A 2BD9A 1SGYE 1WOFA 1P02A 5FBIA 3DUXH 2BY5X 3UTUH 4B74A 3PB1E 1Z6JH 3MU8A 3QGJA 4X1RU 1C2HA 3E16B 1AZ8A 2R2MB 2IJOB 1T32A 1N1LA 2NU1E 2FYQA 5LPEA 3SN8A 1ZMNA 1AUTC 1BTHH 2BM2A 4FXGH 1ZLRA 1O5CB 2BDCA 3OTJE 2GTBA 2BY8X 3ODFA 2BYAX 2F9PA 2ZU1A 5FPSA 1TNJA 1Z8JB 2C3SA 3SNEA 2TGPZ 4JYUH 2GMTC 3SU4A 3SUDA 1SHHB 3V12A 3T25A 1MKXH 1TMUH 3AASA 5JDUB 1BHXB 1H8IH 1TX6A 4I33A 5GXPA 1GJCB 1GI7B 1ZTLA 4TPYA 3NUMA 2UUJB 1YKTA 2WYJA 1QBVH 2OP9A 3SUEA 2XRCA 4ABBA 1VITG 1LVOA 1EPTA 2SGFE 4JZIA 4Y11E 1ACBE 4TWWA 2GCHG 3LIWA 1CA8B 4WWYA 1JBUH 1YP9A 1O3MA 4YO9A 3KNXA 2KAIB 1BTPA 3QDZB 1C1OA 1QJ1B 1O2TA 3TPIZ 1NU7B 2HRVA 1EZUC 3RLYH 1F2SE 2JETB 3U8OH 4ABJA 2BQ7B 3GY2A 1JIRA 4KGAA 4MNXA 4B2CA 2A7HA 3VB6A 1S0QA 4B2AA 3ZZ3A 5A0AE 1C5LH 4GCHG 1AVGH 1GJ7B 2F91A 2J92A 1NFUA 2HNTF 3P8FA 1EB2A 1BA8B 1W10U 2G4TA 4WVPE 1SLXB 3ATMA 4FUBA 4NZQA 4XDEA 2VH6A 3JZ1B 4YM9A 2PKSB 1IOEA 1HNEE 4CREA 1PPFE 2Y82A 2Y5GA 4HZHA 1YPMH 2RA3A 4SGBE 3HGNA 4Q7XA 1C5UA 4NZLA 5JBCS 3SV2H 4GLYA 1LMWB 4CHAB 2STAE 1O5EH 5HM2A 1TALA 1HAVA 1MUEB 1KXEA 2H5CA 2FX6A 1T8NA 1UCYK 1C5WB 2A5AA 1AGJA 1A2CH 1BB0B 1LPGB 1Z1JA 3GCHC 1OWIA 1B7XB 3UWJH 1TFXA 2P8OB 3ODDA 2G5NA 3A7XA 3PMAB 1A5HA 4THNH 1D3TB 2GDEH 4NSVA 1FONA 1NESE 1QB1A 1W0ZU 3OU0A 3M7TA 3C1KA 3SU1A 1TBQH 2PUXB 2Z9KA 2PHBA 1RD3B 3Q76A 1A5GH 4JZDH 1T7CA 3RXFA 2FOCA 1A0JA 3PWCA 3PROA 1AB9B 1V2ST 1O0DH 4F4OC 4CRBA 1YPHE 3C27B 1HAHH 3NKKA 1LKBA 4J2YB 2GT8A 1KLTA 1XUJA 3RXKA 5DPAA 4K60A 4X8TH 4XBBA 1O3EA 1O2XA 5FBEA 2BVXH 1D4PB 1TGSZ 1BTUA 1K2I1 4UONA 1YPJH 5LH8A 2ODYB 2A4RA 3KQCA 2UUFB 4B75A 3V0XA 2OINA 3ZYEA 2BD4A 3MHWU 2TGDA 5C1YA 1SGDE 2RDLA 5EPYA 4GHTA 3SHAH 3M7QA 1EAWA 1QB6A 1BRUP 4JYVH 2ZWLH 3UUZA 3UNRA 1BT7A 5C67A 5C5OA 1ANDA 3SZNA 1TNKA 3VGCC 3RXJA 3PMHB 3PTNA 1F5RA 1W2KH 1WTGH 2ZHDA 1GI8B 1O5DH 1W3CA 1XX9A 3LDXH 2KAIA 4FVBA 5HMAA 2BD3A 1MQ5A 4AFQA 2AYWA 2V35A 3KN2A 2ZU4A 1SLVB 3LGYA 3UOUA 1G36A 4M7GA 1XKBC 3H7OA 4AGKA 1MCVA 1SBWA 4X0WU 4DCDA 1TX7A 3UY9A 2WUBA 4MVNA 4ABDA 3SW2B 3FZZA 1IAUA 2P59A 1TNLA 1PJPA 1ZGIA 3Q3YA 3NWUA 1O35A 3PO1C 3HATH 4U01A 2FI3E 5A8YA 2J34A 5EW1H 1V2MT 1AFQC 3KL6A 1GDNA 1T8OA 1W14U 3BEUA 1V2PT 1SGPE 3RMMH 3U98H 3AW0A 4CBNA 1W0YH 1C1WH 1VITF 1AO5A 1O3KA 2Z7FE 1EPTC 1QRZA 1CVWH 1XVMA 4I8LA 4K1SA 2GD4B 4I8HA 5AFYH 4Y8YA 4X2WA 4CRCA 1GI4A 1RS0A 1NO9H 4OS6A 2BOHB 6GCHG 4XSKU 3ZZ6A 3SOSA 4Z0KA 4K8YA 1C2DA 2ZI2H 2OC8A 5T6GA 1CT4E 1O30A 2XC4A 2VINA 1L1NA 2ALPA 1P10A 2QGRA 4WMEA 1GBDA 1FI8A 1HJ9A 5A8XA 1PYTC 1JMOH 8ESTE 1GBIA 2WINI 1EX3A 4BTTB 4VGCC 1D6RA 4BAMB 2FMJA 2XTTB 2BTCE 4X8SH 2ILNA 1GDQA 1SI5H 5DP6A 1GJ6A 1MAYA 1DUAA 2J94A 2ZFTA 1WBGB 3CENA 1ZR0A 4MNWA 2ZNKH 4A6LA 2J95A 1WU1A 1XM1A 3TNSA 1XMNB 2VIVA 4ISHH 1FNIA 2W7UA 1UTNA 1EZQA 2VGCC 1IQIA 1LDTT 1HIAB 2ZFRH 3GYMA 1VITH 3TK5A 3BTGE 3A87A 1QURH 1GBCA 1GL1A 3GDUA 1BBRH 1DLEA 1NZQH 3ELAH 2GGVB 1KTSB 5EXMA 6CHAC 4Y79A 3UFAA 1GPZA 1O2SA 2ZO3H 3STIA 4ZKNU 3S0NA 2OBQA 3P8GA 3K6ZA 1V2TT 3ZVCA 2Y7XA 3TGIE 1DM4B 3MWIU 1PPCE 5CHAB 3MNXA 5EXNA 3I29A 1O2VA 3S9AA 1O2JA 3P92A 1C5OH 1V2KT 3RUOA 1YLDA 1C2MA 2ZDAH 3SNBA 4DVAU 2J38A 3LC3A 3NXPA 2GP9B 3ZVGA 1NTPA 4INKA 3H5CB 1A61H 1ZMJA 3TGJE 3P8OA 3RXGA 3RXBA 4AORA 1VCWA 2VNTA 5GDSH 3V7TA 3F68H 3RXLA 3HKIB 1YM0A 1EXFA 3L33A 1L4DA 2H5DA 3EAJA 1GCTC 1MTUA 3SU6A 2A4OA 1SGRE 2Z9GA 5DP3A 1SPJA 3GCOA 2ZCLP 1GG6B 4U2WA 3MH5A 1C4U2 3URCA 1UHBB 1X7AC 2FS9A 2Q1JA 3QZQA 2B7DH 1SQOA 1U6QA 3FP6E 3KQEA 2XBVA 3LH3A 1TPSA 4RSPA 4CH8B 4X6PA 3ZZCA 5B6OA 1S84A 3SQHE 1ZZZA 1AE8H 3A7VA 3TITA 1VCPA 1FN6A 1DSTA 4O3TA 4NWKA 3UREA 3RU4E 1W7XH 4DIHH 3E8LA 1TBZH 5FXLA 3HKJB 3M35A 4AG2A 3KGPA 4ISNA 2BMGB 3HK3B 1MQ6A 1P04A 1V2QT 4WY3A 2ANMH 2C93B 1SC8U 1YCPH 4AOQA 1C1VH 4A5TS 5JYIA 2GV7A 1ESAA 1AE5A 1WUNH 3M5MA 3U8RH 1ARBA 2Y81A 1KXAA 3U1IB 2W26A 3EYDA 2FXRA 4AYVB 2FX4A 1CBWB 1DY8A 2HOBA 1O3NA 2GZ7A 2BD7A 3ZZ8A 4X1NU 1C1QA 2XWBI 3LJJA 2NWNA 3EA9A 1FY8E 2QF0A 2GKVE 3RM2H 1FAXA 1TGCA 2JETC 1CO7E 4KELA 1E35B 1UK4A 2LNCA 1O3HA 2VIOA 3LKWA 3MU1A 1S85A 3P95A 3OYPA 4HI3A 1O3JA 2WPIS 4Y10E 1T31A 4B1TA 2C4FH 2EA3A 2G52A 1DXWA 1C4Y2 2GZ9A 2J4IA 2ZTZA 3MU5A 2O9QA 2I6QA 2V6NA 2ZCKP 3BTQE 3ATKA 4UFGH 1AMHA 3KHVA 2TGAA 2BZ6H 2OTVA 3GICB 3RU4D 5EQRA 5EU8A 3BTHE 1QY6A 1CHOF 1A3EH 3T27A 1SOZA 1GI1A 1MKXK 3S69A 2SNWA 5TJXA 1O2IA 5AHGH 1C1UH 1O2KA 4LK4A 3ZZDA 1C2LA 1UJ1A 3T62A 4CHAC 1KDQB 2P16A 1EZXC 4MNVA 6GCHF 4YT7H 1SL3A 2BDYA 1ELFA 1HUTH 2PKAA 4BAQB 1GHAF 1P2KA 2ZECA 2STBE 5F8TA 1Y8TA 4ZHLU 1TX8A 1E37B 3LJOA 3SI4H 1XUKA 1C1MA 1XUHA 4FUEA 4AB9A 1LKAA 2VB0A 1CA0C 2VIWA 4O03A 3PV4A 1SMFE 2WPLS 5LPFA 4NIVA 3EGKH 2VWMA 5JBTA 1HPGA 3LGWA 1UTKA 1P0SH 4X6OA 4KTCA 1NFYA 4WMDA 3K2UA 1ANEA 2TRMA 1O5GH 3PLKA 2FOGA 4DURA 1CT2E 1Y5UT 3LC5A 3FANA 2ZHFH 3V3MA 2OLGA 4JCNA 3D62A 3ZZ7A 3IG6B 2YNBA 3SORA 1PYTD 1AB9C 2FOMB 1TOMH 2VIQA 2ZTYA 4ABIA 1T8MA 3T2NA 1C1RA 2ZGJA 4JZEH 2NU3E 2GV6A 4Q2KA 4ASHA 1H9LB 4ZKRU 4GPGA 1QRWA 3AVZA 2QV1A 3BG4B 1GMDG 1DVAH 1O2UA 1KIGH 1XXDA 2BHGA 3AAUA 1IQLA 1V2NT 2FM2A 1VZQH 1GMCG 2ZFFH 2ZG0H 4BAOB 1BTXA 2ZZUH 1FN8A 3MO6A 3SGBE 4Z6AH 3D65E 1XUIA 1SHYA 1YF4A 2VVCA 1TRYA 3BIVH 1TOCB 4YOGA 3VXEH 3VPKA 4H6TA 4ABFA 4FUGA 1G3DA 4H42U 1FMGA 3RXHA 3UWIA 4OS4A 3TLOA 1F0SA 5C1UA 1DOJA 4WF8A 2OCVB 4O3UA 1LCYA 1DWDH 3BN9A 1IQHA 2G00A 3RMOH 1FPHH 2G4UA 2ZU5A 3RXPA 1KXBA 5IDKA 1MD7A 3EA7A 1EOLA 1D3QB 3M3VA 5FX5A 4NA9H 1YPHC 1GBTA 3TK6A 1NC6A 2FEQH 3SHCH 2BDAA 5E0GA 5LPRA 1HRTH 4LZ4B 2ZCHP 1O3BA 1DS2E 3ATWA 1ELGA 4CRAA 3RXCA 2IPHA 4UFDH 1RTKA 2AS9A 1F5KU 4Y8XA 1SFIA 3LPRA 1VJAU 2C8YB 1TYNA 4MG3A 1B5GH 1V6DA 5H4IB 3SV8A 1EJMA 1XKAC 4CR5A 2BY7X 2YNAA 1GBHA 5A09A 1UCYE 2AMPA 1ZJDA 4IMQA 1O2HA 1GBFA 4NWLA 1SGQE 1BTYA 1TNGA 4YLUA 1RRKA 3SJ8A 4MQAA 1TRMA 2SGAA 2ZGHA 4A1TA 2A31A 5A2MH 1RFNA 1UTLM 3M5OA 3M36A 1DITH 2ZFPH 1AIXH 1GMHF 4Y7BA 4YLQH 1S6HA 1HAGE 4YTAA 4BOHA 2Z3DA 5F6MA 2QYIA 2ZHWH 4X1PU 1O39A 3TH4H 3A86A 3RC5A 5FCKA 2A32A 1ELAA 2GX4A 2ZDMA 4ABAA 1BOQA 1GBAA 1O2OA 3RXIA 1BQYA 1CHGA 3D23A 5L2YH 2JH6D 1FY5A 2FWWA 1OWJA 3RXVA 3SQEE 2EC9H 3BTTE 2OQ5A 3M5NA 2AEIH 2C8XB 1C1NA 1MKWH 1UTOA 1G2LA 4JZ1A 1UTJA 2WPJS 1C2JA 1SG8B 3G01A 4PROA 3QLPH 2ZDLA 2SGPE 2P3FH 3SV9A 1P03A 4D7FA 2NU2E 1G32B 4ZHAA 4ZHMU 5GIBA 3MOCA 1P06A 1BBRE 4JYTA 2ZC9H 2HGTH 2XBXA 1PPBH 2EI8A 2UUKB 3UQVA 3KQDA 4AFSA 2TGTA 1GHBG 1YCPM 4X6NA 1LHDH 5E0JA 1HB0B 1MBMA 3Q3XA 4FUIA 1IQKA 1TMTH 1QB9A 2ASUB 2VIPA 4A1VA 2P95A 2BDIA 3SJ9A 2A2XH 3CS0A 4IMZA 2ZGXH 1QJ7B 4INHA 5T3HA 1A4WH 1KY9A 1GI0A 3F9HA 5CHAC 1CGHA 4JK5A 4D7GA 1P2IA 1SGTA 1DX5M 1ID5H 1C5XB 1BTZA 2IOTA 5I25A 4NFEA 5DO4H 3BF6H 4I8JA 4NFFA 1K1IA 3QK1A 1KXDA 3Q3KA 3FFGA 1TNIA 2VVVA 1MZDA 1JRTA 4TY6A 4Y6DA 1AN1E 2BDHA 5GPIB 4B2BA 1FUJA 3I77A 1KXFA 4MPWA 1GI6A 1LVBA 1L0ZA 1GG6C 1T4VH 3RC4A 2Z9IA 8KME2 3EA8A 7GCHG 4JK6A 4OS2A 4TWYA 1P3CA 2A5KA
chains in the Genus database with same CATH superfamily
2FTLE 2PGQB 2AMDA 2BD5A 3BEIB 2F43B 1SB1H 2GZ8A 2K8IA 1Z71A 1PPGE 2PFEA 5EPNA 1O5FH 1SSXA 4ISLA 3W95A 4NA7A 4A7IB 3Q00A 1TQ7B 2A7JA 1NPMA 4AX9H 2WYGA 5AVDA 1O2GH 2UWPA 3BIUH 4BNRA 1W11U 1BBRK 2KCYA 2GCTC 3ZZAA 1Z7KA 3BG8A 2B8OH 4ZMAH 2H9TH 4IGDA 3SU5A 1GGDB 2FTMA 1TA6A 2B0FA 4GSOA 5GNDA 1GJDB 2A0QB 1BZXE 2JKHA 1M9UA 3PMJA 1H9IE 3MI4A 3MNBA 2ODPA 1HJAB 1GI5A 1WV7H 3GCNA 3T29A 4NA8A 1QJ6B 4TPIZ 1W7GH 1TGBA 4P02A 3QWCH 2XW9A 1QZ8A 1F0RA 2RA0A 5HXFA 9LPRA 1QHRB 3W1EA 2ZGBH 4NIYA 4UD9H 2Z6BD 4HFPB 7KMEH 2ALVA 1QR3E 3QGNB 4ZCNA 1SVPA 1RTLA 4UEHH 1TB6H 5DN6D 3F2HA 1NBME 2AIQA 1J9CH 2YMSB 1BIOA 1S82A 1OP0A 3NCLA 1WYKA 1MTNC 1IQFA 3D49H 4K5ZA 4MPXA 4E06H 5ABWA 4CRFA 2OUAA 5F53A 8GCHG 7ESTE 5T6DA 1BRCE 1C9PA 3KYGA 4R8TB 3QO6A 1KLJH 3VB7A 1F0TA 2FESH 2OBOA 2GVFA 1L1GA 3UPEA 3OSYA 4WMFA 3F3BA 2F9VA 2P3UB 1UVPA 2BX4A 2SFAA 1NM6A 5A8ZA 3F9EA 2GCHF 4FUDA 1UTPA 1C2EA 2Q6DA 3QX5H 1ZHPA 1O2PA 2ZGCA 1DLKB 1P57B 1C5SA 1ETSH 1YCPK 3L3TA 1UMAH 4XOJA 5TCAA 4B73A 2WPHS 1EUFA 1RJXB 3F0OA 1SGCA 1ZYOA 3M5LA 3S7HB 5IK2D 1ESBA 2G81E 2O8TA 1C1TA 3GCTG 4BAKB 3FP7E 2P94A 3E1XB 4LZ1H 2ZF0H 5C2ZA 2ZTXA 3TU7H 2P93A 4GCHF 2A4GA 2RCEA 1O32A 2W3KA 1NBMD 4Y7AA 2JDID 3VFEA 1GBLA 1OP2A 1GBMA 1RIWC 1C5PA 3A7YA 2F9UA 3LU9B 2D2DA 2C90B 3PYHA 1C2IA 1ELTA 3TJUA 5E8EH 4DW2U 3BTFE 2O8LA 1MU6B 6ESTA 1HV7A 1GHXH 4ZXYH 2ZKSA 1C5YB 1IQGA 1O2MA 1P05A 5AF9H 1ZPZA 5DK1A 4HTCH 4FUJA 1DXPA 1YPGH 3HGPA 4I8KA 4IC5A 4AN7A 2PTNA 5ESBA 2XCNA 5T6FA 4DJZB 1VGCC 2A7CA 2R2WU 5GCHG 3ZZBA 1S83A 1E1QD 3ZVFA 1B0EA 2VH0A 2FZZA 1EB1H 3FVFB 2PV9B 2BVSH 4OS1A 3SNCA 1ELDE 2BLOA 1OS8A 5BRRE 4GHQA 1PFXC 4E7NA 1AFEH 3F9FA 5F03A 3GOVB 3F0PA 1BUIA 1V2OT 2AGIX 3UR6A 1TGTA 1N8OC 4ZROA 1DWEH 4X1SU 1ZSKA 1G3CA 2Y5FA 2PP6A 4X8UH 4E05H 1QTFA 1EQ9A 3FOAA 1NRPH 4M9FA 1GWAA 3RP2A 2B9LA 2SNVA 3TIUA 5HGGA 4TYDA 3KQ5A 5IYTA 1NY22 4RN6A 2F9BH 1A7SA 4ZXXH 3RMNH 1KLIH 2QF5A 3B23B 1AY6H 3RU4T 3LT3A 7GCHF 1C5MD 1WQSA 2FOFA 1K21H 2CXVA 1O3PB 2ZPRA 3LGIA 2QE7D 1BMMH 2SGEE 3BEFB 3A89A 1GHYH 5EQSA 3F6UH 1GBEA 3QN7A 2HALA 4DGJA 2DE9A 3GY5A 1CE5A 1WAYB 1V3XA 4KKDA 3EQ0H 1SGFA 1UTMA 1THPB 2IN2A 3A81A 5CMXH 4X1QU 1OPHB 1Y5BT 4FUHA 2UUYA 4X2VA 1GDUA 2BY6X 1DANH 1HDTH 1FAKH 1OWEA 1SQAA 1YPLH 1D9IA 5EQQA 2THFB 4I31A 3SZEA 2QXHA 2ZIQH 3RXRA 1O3FA 1EATA 1GBKA 1TPPA 3A8CA 1ARCA 1G9IE 1SLWB 1A0LA 1P2MA 2V0BA 3VB4A 1FY3A 3ZV8A 1O3DA 5FPTA 3GDVA 3NK8A 2A2QH 4B6EA 8LPRA 1O34A 3LOXA 1FIWA 2J98A 1YPEH 1IHSH 1C2FA 3K65B 2G5VA 1BMLA 4OGYA 4YT6H 2QCYA 2BLVA 2OC1A 1GVKB 5A0BA 4H6SB 3LH1A 5DJ7A 1SKYE 1QGFA 2FO9A 3OE7D 1ETRH 2WPDD 1ANCA 2R3YA 4DIIH 4HG6A 2XXLA 3R3GB 1QBNA 3RXAA 1PQ7A 1J15A 1QCPA 5CHBA 3OY6U 4UE7H 5FHTA 1F5LA 4D9QA 3L6PA 4IN1A 3KCGH 1ORFA 4INLA 4D76A 2PKSC 2K0QA 3BTDE 5EOKA 3KQBA 3VGCB 1AZZA 1IQMA 3VXFH 2A45B 1LHEH 2FDAA 5EXLA 4WH6A 4AGJA 3E6PH 2H9EH 1HIAA 1O3CA 1ELEE 3M37A 2BLWA 1AWFH 1P9UA 1YLCA 1BJUA 1WQVH 1TIOA 1GI3A 4OGXA 2PSYA 1D3PB 1P11E 1S81A 1A3BH 4SGAE 5JB8S 1DFPA 3PWBA 3A80A 3ZZ5A 3GCTF 1QL8A 3FAOA 3RXEA 3ZVEA 1HAXB 3ZV9A 3SU3A 4FETA 4LOYH 3ITIA 3PRDA 3GDSA 1Q2WA 1LVMA 5F8XA 1V2JT 2HNTE 1UTQA 1QRXA 2GJGA 1AFQB 3KYFA 2P8OC 3T26A 1WSSH 1VJ9U 3CNRA 1BJVA 2BXUH 2CV3A 1G30B 1JWTA 1ZSLA 2FOEA 4K3JA 4NG9H 5EG4A 2EI6A 2WUCA 1V2WT 1W0JD 1EPTB 4E7RG 2H9HA 4Y76A 3CS7A 2ANWA 5BPEA 4Q80A 3WY8A 5EW2H 1MKWK 4Q7YA 1DWCH 1L1JA 1HAYB 1O3OA 1NRQH 1WDIA 1MAXA 2HWLB 1ZSJA 1NFWA 5GCHF 1OSSA 2ZDKA 1TONA 2HVYB 1FY4A 2BZAA 1E0FD 2ZEBA 2JH5D 1O2RA 1BRAA 1FPCH 1P2NA 1ZJKA 1UHBA 2ZDNA 3RDZA 1TAWA 4X2XA 3MQKC 1IQNA 2WPKS 3F1SB 5L30H 2R9PA 1EP5A 5A0CA 1FY1A 1O2LA 1S5SA 3A7TA 2VVUA 4ABEA 3E0PB 1O37A 1MH0A 3S9BA 5C5NA 2FODA 1GGDC 1Y3VA 2CK3D 1TE0A 5FCRA 2ZHEH 3IWMA 1HBTH 1QL9A 1ESTA 1P01A 1PQ5A 4FU7A 1ZOMA 1MD8A 1SLUB 4XBDA 2WPMS 1P09A 3SV6A 2QAAA 1Z8IB 1NROH 4D9RA 1RXPA 2VGCB 2AFQB 1DE7H 4O97A 3RXSA 2BD8A 1QIXB 1BMAA 2H1UA 3I78A 4KP0A 1HAVB 1MTSA 1QBOA 2XCFA 3Q77A 2JJ2D 2OQUA 4FUCA 4K69A 2VWOA 1QQ4A 1HAZB 3QTOH 4K2YA 4R0IA 1ZHRA 2PUQH 3GYLB 9ESTA 3ATLA 3F2FA 1DY9A 2FIRH 3VB3A 1BRBE 2W7SA 4ISOA 1O36A 1DT2A 2V3OH 1SGNE 2AHME 4I32A 1H4WA 3A83A 4Y71A 1C9TA 1YBWA 2A5IA 2Z9LA 2QA9E 1YPKH 4TY7A 1BITA 2XBWA 1SR5C 2PTCE 3F9GA 2ZPQA 1FXYA 2F83A 1GCDA 4JZFH 5KEDA 3ZZ4A 1TMBH 3SV7A 3RXDA 4MDSA 2OXSA 1GCTB 2KCPA 4J1YA 1DSUA 1C5TA 1ETTH 3GISB 4BXSA 2ZP0H 3UB0A 3VG8A 1EASA 2G8TA 3ATIA 1P12E 3OX7U 4MPVA 1WCZA 4X2YA 2ESTE 1XXFA 2ZA5A 1N6XA 1EKBB 4BTUB 7LPRA 1ELBA 1MU8B 2BD2A 3SNAA 1YGCH 1FDPA 1KDQA 4AYYB 3P17H 2OC0A 1SGIB 2SGDE 4GVUA 1GJ5H 4NIXA 5I46H 1H1BA 1ZRBA 2LELA 4IS5A 5C3NA 5JBBS 4IN2A 1F7ZA 4DT7B 1HFDA 4KTSA 1K28D 1MMJN 1KSNA 2Z3CA 4ZH8A 4AG1A 1SGEE 1KYNA 4ZUHA 1GJBB 2BDGA 1TBRH 1EFRD 4ESTE 3PTBA 3A7WA 4WXIA 2C8WB 1OOKB 5CE1A 3P70B 1BDAA 3W94A 2WV9A 1ZHMA 2VWLA 4IW4E 1AHTH 1O3AA 3GY8A 5J4SA 2ZU3A 2G51A 3SUGA 1NS3A 2O8UA 2AERH 1ABJH 5KECA 1PPZA 1SFQB 3AAVA 2A1DB 3MYWA 4IC6A 1O2QA 4IBLH 4O9VA 2DUCA 1O38A 4ABGA 2XC0A 2F9NA 2ZFSA 1G2MA 4RT0A 2XC5A 1TGNA 1O2NA 3EDXB 4ZKSU 1F92A 3BTME 3ZYDA 3KEEA 1GL0E 4YOJA 2ANKH 4CRGA 3UQOA 2FI4E 1C2KA 4DY7B 1LHFH 2QXGA 2AGGX 2XNIA 1V2VT 1FLEE 4HGCA 5E0HA 4F48B 3AW1A 1J8AA 4MPUA 2XOKD 1ZRKA 3SGQE 4AZ2B 3TH2H 2FOHA 1JRSA 3A85A 2FP7B 3O8BA 4AFUA 3M7UA 3LGUA 1EOJA 3TK9A 2H6MA 1J16A 1TLDA 1F0UA 4K1EA 4NCYA 2PR3A 3FP8E 1JIMA 2NU4E 3QUMP 2CF8H 4ACBA 2BQ6B 1GI9B 2PW8H 3U28C 1S6FA 1NT1A 1IQJA 1FIZA 1K1MA 4GAWA 1FZZA 1AUJA 4OS5A 4B71A 4BANB 3MTYA 2EI7A 1VR1H 1HXEH 5AFZH 1B0FA 2TIOA 3TJNA 1QNJA 2VU8E 2Y7ZA 1THSH 5TCCA 3SU2A 1OYTH 3SJOA 3S7KB 2FLRH 1TPOA 2QXIA 2ZQ2A 3N7DA 3UNQA 1GMDF 3KF2A 3TVJB 1CA0B 1AWHB 1SGFG 3P8NA 4XBCA 4U32A 2QN5T 4RT1A 3PRBA 1GMCF 1LQDB 1DPOA 2GDDA 2Z9JA 3IITA 1EAXA 1BHXF 5E2OA 2G55A 2CGAA 3BTKE 2QIQA 3SGAE 1A5IA 3OEHD 1V2UT 1QQUA 1C4V2 1Y3YA 1LHCH 2VIDA 1DDJA 1K1OA 1ABIH 1HJ8A 3SNDA 2BXTH 3RM0H 1Z8GA 3N7OA 2XYAA 1O2ZA 2VBCA 5SGAE 3STJA 1K1LA 4RI0A 1E36B 1MTWA 4NIWA 3K6YA 3UIRA 1CBWC 3A8AA 1RTFB 2CHAB 1P2QA 5C20A 1V2LT 2HPQH 2V7QD 1BTWA 3A8DA 4AB8A 1AVXA 1C2GA 2J9NA 1L2EA 2D8WA 1LQEA 3FKSD 3SO3A 2ANYA 4LXBH 3BTEE 3RXUA 1KMHB 3BV9B 2UWOA 2BVRH 2PWXA 2FPZA 2HVXA 4ISIH 1EZSC 3MNSA 3PLBA 2ODQA 1XUFA 3T5FH 1K1PA 2JH0D 2BQWB 3PM3A 1SOTA 3H09A 3R0FA 1GJ4H 2BDBA 4FU9A 2VWNA 2YMSD 2H2ZA 2K1QA 5FL7D 2CF9H 1UK3A 1AI8H 3MH4A 1L4ZA 4XRNA 1EAIA 1O3LA 1GVZA 1C5VA 2I6SA 1XVOA 2Y6TA 1MZAA 1CT0E 1LPKB 1J17T 5ESTE 2HLCA 2GMTB 5FX6A 1LVYA 4DT4A 2P3TB 1P2OA 3A8BA 1T4UH 3ESTA 5GWZA 1ZPBA 1GBJA 1W12U 2QC2A 1P2JA 1CHOG 1UK2A 5LGOA 1QFKH 1ZTJA 1YLNA 1FV9A 1UCYH 3H7TA 3MFJA 4ZAEA 1C5QA 4P00A 4K8BA 1NRNH 2W5EA 1THRH 1Y59T 3RXTA 2BLQA 3MH7A 1GHAG 2M2AA 2SGQE 1GHBF 3EE7A 3OTPA 4OM9A 4ZKOU 4DOQA 5K7RA 5EJ1A 1S0RA 4H4FA 1NN6A 1IHTH 1EP6A 1OHHD 1TABE 4F49A 1D6WA 2F9OA 1Z8RA 1K22H 3BG4C 4XFQA 3S9CA 1PQAA 1S6LA 1GHVH 3K9XB 2B5TB 2PLXA 2TPIZ 2A4QA 5HYOA 2F3CE 1K0HA 1JOUB 3DD2H 1IQEA 3FZDA 4Y0YE 4GUXA 3N7EA 2HNTC 2ZPSA 2YOLA 1NFXA 4CRDA 2C8ZB 1EJAA 3ENSB 1UVOA 3MU4A 1CGJE 4NSYA 3RC6A 1AKSB 5EGMA 1OWDA 1TQ0B 1P3EA 5GJ4B 3TH3H 3TNTA 2BX3A 2ZHQH 2QF3A 1TRNA 1ZPCA 3PLPA 1G37A 3T28A 3PMBB 1CQQA 2Z94A 5K0HA 3VEQB 2Y5HA 3GY6A 3B9FH 3RXOA 1C1PA 2GT7A 1NU9A 1RGQA 3A88A 1K1JA 1K1NA 2ULLA 2RG3A 2PKAB 3DFLA 3ZIAD 1O31A 2CN0H 4K1TA 1AD8H 2FI5E 1EJNA 1A0HB 2L6OA 1ZMLA 4I86A 2Q6GA 3HPTB 1UVTH 2XBYA 4YZUA 1O33A 3BSQA 4BTIB 5L2ZH 1XUGA 1G3BA 1GHWH 1HAOH 3MU0A 3GY4A 4WXVA 2ZU2A 1TNHA 4FVDA 1A1RA 1FJSA 1GBBA 1CGIE 1O2WA 4A92A 5DP7A 3GCHB 2V3HH 1OWKA 1YYY1 1GJ9B 3M61U 3U1JB 3OY5U 1C5ZB 1LHGH 4OS7A 1BCUH 2QF4A 2XWAA 2PGBB 2Q6FA 2HPPH 3MO3A 2JIZD 2R0LA 2ZQ1A 1H8DH 2QY0B 3E90B 3ZVAA 3MH6A 1HXFH 1SQRA 4ASUD 3LGVA 3MNCA 2W3IA 4TSFD 1DICA 3E91A 1E34B 3URDA 1JXPA 1PPEE 1OKXA 4X8VH 3VB5A 1ZGVA 2WV4A 1W8BH 1KXCA 4YOIA 3SUFA 4CBOA 3O8RA 5F8ZA 4QT8C 4RKJB 4X6MA 1D3DB 3TJOA 2Y80A 5G4BA 1KTTB 2LP6A 4MTBA 4WJG2 1C1SA 5L6NH 3JZ2B 3NPSA 4BAHB 4D8NA 2FS8A 1WTHD 1HAIH 5DP8A 3HK6B 5E2PA 2OC7A 2KZ4A 1Q31A 2GCTB 4NGAH 1W13U 6LPRA 3DT0H 5DP9A 2FOAA 1G3EA 2WZQA 3A82A 2AGEX 3QZRA 1QL7A 3TJVA 3SU0A 3A84A 2J2UA 5EJZA 1NRSH 1ANBA 2VJ1A 2D26C 1GMHG 2Z3EA 4U30A 8GCHF 3UOPA 2QXJA 3E0NB 1O5BB 2LPRA 2FLBH 5J4QA 1ZTKA 4JMYA 4FU8A 3SBKA 3DFJA 2RFKC 3RMLH 3QTVH 1K9OE 1Y3XA 1FQ3A 1UVUH 1C5RA 5JPMH 4Y8ZA 4B76A 3RXMA 4MLFB 4TT3D 3P6ZB 4Z1MD 3DA9B 1GJ8B 2L74A 1N6YA 4KTUA 2FYRA 3RLWH 3MO9A 4B6FA 1TPAE 1HYLA 5EJLA 3SI3H 5C1XA 4I8GA 2DE8A 1Y5AT 2AH4X 1LTOA 3LONA 2AIPA 3B8JA 1FX0B 1AU8A 1MTNB 4UFEH 4CR9A 1YC0A 5FPYA 2CMYA 1O2YA 1AKSA 3OEED 5FAHA 1ELVA 5DP4A 3KIDU 2EEKA 1EAUA 3PO1B 1E38B 3E3TA 1LPZB 1QA0A 1A46H 2NU0E 5JB9S 3O8CA 5HM9A 4AFZA 3NZIA 1HAPH 1J14A 3BTWE 4BXWA 1OX1A 3O8DA 2OD3B 3UR9A 1P9SA 2BY9X 4UFFH 4MNYA 2BOKA 5DKMA 2CJIA 1O3IA 1UVSH 4CH2B 1CSOE 3CP7A 3M3TA 3V13A 4I7YH 3U9AH 4RKOB 2IJD1 4DG4A 1AQ7A 3U8TH 1H9HE 1OYQA 1TA2A 1DUEA 3RXQA 3ZVDA 1OWHA 1SQTA 1T8LA 3GY7A 3AK5A 1O3GA 3U69H 4Q4LA 2WSSD 1HLTH 1LO6A 3SJKA 2R0KA 5PTPA 5EODA 2M5TA 2WV5A 1BMNH 4VGCB 2EQNA 1RIWB 2RDEA 3DHKH 4Q7ZA 2UWLA 1AVWA 2ZFQH 3MMGA 3TGKE 3A7ZA 1MTVA 3EE0B 3M3SA 1MBQA 1OP8A 1GVLA 4Y0ZE 1DWBH 1PPHE 1OXGA 1V2RT 1HJAC 3UNSA 2FOBA 3SJIA 3FN8A 2ZDVH 4A1XA 1C5NH 2O8WA 2TBSA 1GI2A 1VCQA 5DGJA 1Q3XA 1GHZA 2BB4A 2CHAC 1VGCB 5ETXA 4UDWH 5JBAS 1Z1IA 1TWXB 3ZZ9A 2AMQA 1CU1A 3GY3A 5DG6A 1P8VC 1Y3UA 1PQ8A 6CHAB 1MCTA 1NRRH 2O8MA 4YESB 4ABHA 4XE4A 1GJAB 4FUFA 3NRLA 1INCA 3DSPA 4YXWD 2D1JA 1N8OB 3LGTA 2PSXA 4WH8A 1HCGA 1HGTH 1O5AB 2R3UA 2YMSC 1Z6EA 1ELCA 1Y3WA 3ZVBA 5DP5A 1QA7A 1UO6A 2BD9A 3N99A 1SGYE 1WOFA 1P02A 5FBIA 3DUXH 2BY5X 3UTUH 4B74A 3PB1E 1Z6JH 3MU8A 3QGJA 4X1RU 1C2HA 3E16B 1AZ8A 2R2MB 2IJOB 1T32A 1N1LA 2NU1E 2FYQA 5LPEA 3SN8A 1ZMNA 1AUTC 1BTHH 2BM2A 4FXGH 1ZLRA 1O5CB 2BDCA 3OTJE 2GTBA 2BY8X 3ODFA 3OAAD 2BYAX 2F9PA 2ZU1A 5FPSA 1TNJA 1Z8JB 2C3SA 3SNEA 2TGPZ 4JYUH 2GMTC 3SU4A 3SUDA 1SHHB 3V12A 3T25A 1MKXH 1TMUH 3AASA 5JDUB 1BHXB 1H8IH 1TX6A 4I33A 5GXPA 1GJCB 1WXRA 1GI7B 1ZTLA 4TPYA 3NUMA 2UUJB 1YKTA 2WYJA 1QBVH 2OP9A 3SUEA 2XRCA 4ABBA 1VITG 1LVOA 1EPTA 2SGFE 4JZIA 2XNDD 4Y11E 1ACBE 4TWWA 2GCHG 3LIWA 1CA8B 4WWYA 1JBUH 1YP9A 1O3MA 4YO9A 3KNXA 2KAIB 1BTPA 3QDZB 1C1OA 1QJ1B 1O2TA 3TPIZ 1NU7B 2HRVA 1EZUC 3RLYH 3DSOA 1F2SE 2JETB 3U8OH 4ABJA 2BQ7B 3GY2A 1JIRA 4KGAA 4MNXA 5C0TA 4B2CA 2A7HA 3VB6A 1S0QA 4B2AA 3ZZ3A 5A0AE 1C5LH 4GCHG 1AVGH 1GJ7B 2F91A 2J92A 1NFUA 2HNTF 3P8FA 1EB2A 3UAIC 1BA8B 1W10U 2G4TA 4WVPE 1SLXB 3ATMA 4FUBA 4NZQA 4XDEA 2VH6A 3JZ1B 4YM9A 2PKSB 1IOEA 1HNEE 4CREA 5T1VA 1PPFE 2Y82A 2Y5GA 4HZHA 1YPMH 2RA3A 4SGBE 3HGNA 4Q7XA 1C5UA 1W0KD 4NZLA 5JBCS 3SV2H 4GLYA 1LMWB 4CHAB 2STAE 2KR7A 1O5EH 5HM2A 1TALA 1HAVA 1MUEB 1KXEA 2H5CA 2FX6A 1T8NA 1UCYK 1C5WB 2A5AA 1AGJA 1A2CH 1BB0B 1LPGB 1Z1JA 3GCHC 1OWIA 2KCAA 1B7XB 3UWJH 1YWUA 1TFXA 2P8OB 3ODDA 2G5NA 2WHXA 3A7XA 3PMAB 1A5HA 4THNH 1D3TB 2GDEH 4NSVA 4XD7D 1FONA 1NESE 1QB1A 1W0ZU 3OU0A 3M7TA 3C1KA 3SU1A 1YY3A 1TBQH 2PUXB 2Z9KA 2PHBA 1RD3B 3Q76A 1A5GH 4JZDH 1T7CA 3RXFA 2FOCA 1A0JA 3PWCA 3PROA 1AB9B 1V2ST 1O0DH 4F4OC 4CRBA 1YPHE 3C27B 1HAHH 3NKKA 1LKBA 4J2YB 2GT8A 1KLTA 1XUJA 3RXKA 5DPAA 4K60A 4X8TH 4XBBA 1O3EA 1O2XA 5FBEA 2BVXH 1D4PB 1TGSZ 4AC9A 1BTUA 1K2I1 4UONA 1YPJH 5LH8A 2ODYB 2A4RA 3KQCA 2UUFB 3OFND 4B75A 3V0XA 2OINA 3ZYEA 2BD4A 3MHWU 2TGDA 5C1YA 1SGDE 2RDLA 5EPYA 4GHTA 3SHAH 3M7QA 1EAWA 1QB6A 1BRUP 4JYVH 2ZWLH 3UUZA 3UNRA 4Q63A 1BT7A 5C67A 5C5OA 1ANDA 3SZNA 1TNKA 3VGCC 3RXJA 3PV5A 3PMHB 3PTNA 1F5RA 1W2KH 1WTGH 2ZHDA 1GI8B 1O5DH 1W3CA 1XX9A 3LDXH 2KAIA 4FVBA 5DSFA 5HMAA 5KGOA 2BD3A 1MQ5A 4AFQA 2AYWA 2V35A 3KN2A 2ZU4A 1SLVB 3LGYA 3UOUA 1G36A 4M7GA 1XKBC 3H7OA 4AGKA 1MCVA 4FOUC 1SBWA 4X0WU 4DCDA 1TX7A 3UY9A 2WUBA 4MVNA 3WWBA 4ABDA 5B6LA 3SW2B 3FZZA 1IAUA 2P59A 1TNLA 1PJPA 1ZGIA 3Q3YA 3NWUA 1O35A 3FO8D 2OK5A 3PO1C 5C0UA 3HATH 4U01A 2FI3E 5A8YA 2J34A 5EW1H 1V2MT 1AFQC 3KL6A 1GDNA 1T8OA 1W14U 3BEUA 1V2PT 1SGPE 3RMMH 3U98H 3AW0A 4CBNA 1W0YH 1C1WH 1VITF 1AO5A 1O3KA 2Z7FE 1EPTC 1QRZA 1CVWH 1XVMA 4I8LA 4K1SA 2GD4B 4I8HA 2J98B 2J5UA 5AFYH 4Y8YA 4X2WA 4CRCA 1GI4A 1RS0A 1NO9H 4OS6A 2BOHB 6GCHG 4XSKU 3ZZ6A 3SOSA 4Z0KA 4K8YA 1C2DA 2ZI2H 2OC8A 5T6GA 1CT4E 2F4LA 1O30A 2XC4A 2VINA 1L1NA 2ALPA 1P10A 1UW7A 2QGRA 4WMEA 1GBDA 1FI8A 1HJ9A 5A8XA 1PYTC 1JMOH 8ESTE 1GBIA 2WINI 1EX3A 4BTTB 4VGCC 1D6RA 4BAMB 2FMJA 2XTTB 2BTCE 4X8SH 2ILNA 1GDQA 1SI5H 1H8ED 5DP6A 1GJ6A 1MAYA 1DUAA 2J94A 2ZFTA 1WBGB 3CENA 1ZR0A 4MNWA 2ZNKH 4A6LA 2J95A 1WU1A 1XM1A 3TNSA 1XMNB 2VIVA 4ISHH 1FNIA 2W7UA 1UTNA 1EZQA 2VGCC 1IQIA 1LDTT 1HIAB 2ZFRH 3GYMA 1VITH 3TK5A 3BTGE 3A87A 1QURH 1GBCA 1GL1A 3GDUA 1BBRH 1DLEA 1NZQH 3ELAH 2GGVB 1KTSB 5EXMA 6CHAC 1COWD 4Y79A 1GPZA 1O2SA 2ZO3H 3STIA 3UFAA 4ZKNU 3S0NA 2OBQA 3P8GA 3K6ZA 1V2TT 3ZVCA 2Y7XA 3TGIE 1DM4B 3MWIU 1PPCE 5CHAB 3MNXA 5EXNA 3I29A 1O2VA 3S9AA 1O2JA 3P92A 1C5OH 1V2KT 3RUOA 1YLDA 1C2MA 2ZDAH 3SNBA 4DVAU 2J38A 3LC3A 3NXPA 2GP9B 3ZVGA 1VKYA 1NTPA 4INKA 3H5CB 1A61H 1ZMJA 3WW7A 3TGJE 2KM0A 3P8OA 3RXGA 3RXBA 4AORA 1VCWA 2VNTA 5GDSH 3V7TA 3F68H 3RXLA 3HKIB 1YM0A 1EXFA 5HKKD 3L33A 1L4DA 2H5DA 3EAJA 1GCTC 1MTUA 3SU6A 2A4OA 1SGRE 2Z9GA 5DP3A 1SPJA 3GCOA 2ZCLP 1GG6B 4U2WA 3MH5A 1C4U2 3URCA 1UHBB 3DCLA 1X7AC 2FS9A 2Q1JA 3QZQA 2B7DH 1SQOA 1U6QA 3FP6E 3KQEA 2XBVA 3LH3A 1TPSA 4RSPA 4CH8B 4X6PA 3ZZCA 5B6OA 1S84A 3SQHE 1ZZZA 1AE8H 3A7VA 3TITA 1VCPA 1FN6A 1DSTA 4O3TA 1E79D 4NWKA 3RU4E 1W7XH 3UREA 4DIHH 3E8LA 1TBZH 5FXLA 3HKJB 3M35A 4AG2A 3KGPA 4ISNA 2BMGB 3HK3B 1MQ6A 1P04A 1V2QT 4WY3A 2KX4A 2ANMH 2C93B 1SC8U 1YCPH 4AOQA 1C1VH 4A5TS 5JYIA 2GV7A 1E1RD 1AE5A 1ESAA 1WUNH 3M5MA 3U8RH 1ARBA 2Y81A 1KXAA 3U1IB 2W26A 3EYDA 2FXRA 2EY4C 4AYVB 2FX4A 1CBWB 5HIYA 1DY8A 4ACAA 2HOBA 1O3NA 2GZ7A 2BD7A 3ZZ8A 4X1NU 1C1QA 2XWBI 3LJJA 2NWNA 3EA9A 1FY8E 2QF0A 2GKVE 3RM2H 1FAXA 1TGCA 2JETC 1CO7E 4KELA 1E35B 1UK4A 2LNCA 1O3HA 2VIOA 3LKWA 3MU1A 1S85A 3P95A 3OYPA 2V3MA 4HI3A 1O3JA 2WPIS 4Y10E 1T31A 4B1TA 2C4FH 2EA3A 2G52A 1DXWA 1C4Y2 2GZ9A 2IPQX 2J4IA 2ZTZA 3MU5A 2O9QA 2I6QA 2V6NA 2J97A 2ZCKP 3ATKA 3BTQE 4UFGH 1AMHA 3KHVA 2TGAA 2BZ6H 2OTVA 3GICB 3RU4D 5EQRA 5EU8A 3BTHE 1QY6A 1CHOF 1A3EH 3T27A 1SOZA 2HLDD 1GI1A 1MKXK 3S69A 2SNWA 5TJXA 1O2IA 5AHGH 1C1UH 1O2KA 4LK4A 3ZZDA 1C2LA 1UJ1A 3T62A 4CHAC 3SYJA 1KDQB 2P16A 1EZXC 4MNVA 6GCHF 4YT7H 1SL3A 2BDYA 1ELFA 1HUTH 2PKAA 4BAQB 1GHAF 1P2KA 2ZECA 2STBE 5F8TA 1Y8TA 4ZHLU 1TX8A 1E37B 3LJOA 3SI4H 1XUKA 1C1MA 1XUHA 4FUEA 4AB9A 1LKAA 2VB0A 1CA0C 2VIWA 4O03A 3PV4A 1SMFE 2WPLS 5LPFA 4NIVA 3EGKH 2VWMA 5JBTA 1HPGA 3LGWA 1UTKA 1P0SH 4X6OA 4KTCA 1NFYA 4WMDA 3K2UA 1ANEA 2TRMA 1O5GH 3PLKA 2FOGA 4DURA 1CT2E 3F2GA 1Y5UT 3LC5A 3FANA 2ZHFH 3V3MA 2OLGA 4JCNA 3D62A 3ZZ7A 3IG6B 2YNBA 3SORA 1PYTD 1AB9C 2FOMB 1TOMH 2VIQA 2ZTYA 4ABIA 1T8MA 3T2NA 1C1RA 2ZGJA 4JZEH 2NU3E 2GV6A 4Q2KA 4ASHA 1H9LB 4ZKRU 4GPGA 1QRWA 3AVZA 1BMFD 2QV1A 3BG4B 1GMDG 1DVAH 1O2UA 1KIGH 1XXDA 2BHGA 3AAUA 2FM2A 1IQLA 1V2NT 1VZQH 1GMCG 2KFWA 2ZFFH 2ZG0H 1BTXA 2ZZUH 4BAOB 4F55A 3PV2A 1FN8A 3MO6A 3SGBE 4Z6AH 3D65E 1XUIA 1SHYA 1YF4A 2VVCA 1TRYA 3BIVH 1TOCB 4YOGA 3VXEH 3VPKA 4H6TA 4ABFA 3DSGA 4FUGA 1G3DA 4H42U 1FMGA 3RXHA 3UWIA 4OS4A 3TLOA 1F0SA 5C1UA 1DOJA 4WF8A 2OCVB 4O3UA 1LCYA 1DWDH 3BN9A 1IQHA 2G00A 3RMOH 1FPHH 2G4UA 2ZU5A 3RXPA 1KXBA 5IDKA 1MD7A 3EA7A 1EOLA 1D3QB 3M3VA 5FX5A 4NA9H 1YPHC 1GBTA 3TK6A 1NC6A 2FEQH 3SHCH 2BDAA 5E0GA 5LPRA 1HRTH 4LZ4B 2ZCHP 1O3BA 1DS2E 3ATWA 1ELGA 4CRAA 3RXCA 2IPHA 4UFDH 1RTKA 2AS9A 1F5KU 4Y8XA 1SFIA 3LPRA 1VJAU 2C8YB 1TYNA 4MG3A 1B5GH 1V6DA 5H4IB 3SV8A 1EJMA 1XKAC 4CR5A 2BY7X 2YNAA 1GBHA 5A09A 1UCYE 2AMPA 1ZJDA 2JJ1D 4IMQA 1O2HA 1GBFA 4NWLA 1SGQE 1BTYA 1TNGA 4YLUA 1RRKA 3SJ8A 4MQAA 1TRMA 2SGAA 2ZGHA 4A1TA 2A31A 5A2MH 1RFNA 1UTLM 5HIZA 3M5OA 3M36A 1DITH 2ZFPH 5EIYA 1AIXH 1GMHF 4Y7BA 4YLQH 1S6HA 1HAGE 4YTAA 4BOHA 2Z3DA 5F6MA 2QYIA 2ZHWH 4X1PU 1O39A 3TH4H 1MABB 3A86A 3RC5A 5FCKA 2A32A 1ELAA 2GX4A 2ZDMA 4ABAA 1BOQA 1GBAA 1O2OA 2KCOA 3RXIA 1BQYA 1CHGA 3D23A 5L2YH 2JH6D 1FY5A 2FWWA 1OWJA 3RXVA 3SQEE 2EC9H 3BTTE 3WWFA 2OQ5A 3M5NA 2AEIH 2C8XB 1C1NA 1MKWH 1UTOA 1G2LA 4JZ1A 1UTJA 2WPJS 1C2JA 1SG8B 3G01A 4PROA 3QLPH 2ZDLA 2SGPE 2P3FH 3SV9A 1P03A 4D7FA 2NU2E 1G32B 4ZHAA 2W6JD 4ZHMU 5GIBA 3MOCA 1P06A 1BBRE 4JYTA 2ZC9H 2HGTH 2XBXA 1PPBH 2EI8A 2UUKB 3UQVA 3KQDA 4AFSA 2TGTA 1GHBG 1YCPM 4X6NA 1LHDH 5E0JA 1HB0B 1MBMA 3Q3XA 4FUIA 5C17A 1IQKA 1TMTH 1QB9A 2ASUB 2VIPA 4A1VA 2P95A 2BDIA 3SJ9A 2A2XH 3CS0A 4IMZA 2ZGXH 1QJ7B 4INHA 5T3HA 1A4WH 1KY9A 1GI0A 3F9HA 5CHAC 1CGHA 4JK5A 4D7GA 5C94A 1P2IA 1SGTA 1DX5M 1ID5H 1C5XB 1BTZA 2IOTA 5I25A 4NFEA 5DO4H 3BF6H 4I8JA 4NFFA 1K1IA 3QK1A 1KXDA 3Q3KA 3FFGA 1TNIA 2VVVA 1MZDA 1JRTA 4TY6A 2W6ID 4Y6DA 1AN1E 2BDHA 5GPIB 1H8HD 1FUJA 4B2BA 3I77A 1KXFA 4MPWA 1GI6A 3GS9A 1LVBA 1L0ZA 1GG6C 1T4VH 3RC4A 2Z9IA 8KME2 3EA8A 5CDFE 7GCHG 4JK6A 4OS2A 4TWYA 1P3CA 2A5KA
chains in the Genus database with same CATH topology
2FTLE 2PGQB 2AMDA 2BD5A 3BEIB 1SB1H 2GZ8A 1Z71A 1PPGE 2PFEA 5EPNA 1O5FH 1SSXA 4ISLA 3W95A 4NA7A 4A7IB 3Q00A 1TQ7B 2A7JA 1NPMA 4AX9H 2WYGA 5AVDA 1O2GH 2UWPA 3BIUH 4BNRA 1W11U 1BBRK 2GCTC 3ZZAA 1Z7KA 3BG8A 2B8OH 4ZMAH 2H9TH 4IGDA 3SU5A 1GGDB 1TA6A 2FTMA 2B0FA 4GSOA 1GJDB 2A0QB 1BZXE 2JKHA 1M9UA 3PMJA 1H9IE 3MI4A 3MNBA 2ODPA 1HJAB 1GI5A 1WV7H 3GCNA 3T29A 4NA8A 1QJ6B 4TPIZ 1W7GH 1TGBA 3QWCH 2XW9A 1F0RA 2RA0A 5HXFA 9LPRA 1QHRB 2ZGBH 4NIYA 4UD9H 2Z6BD 4HFPB 7KMEH 2ALVA 1QR3E 3QGNB 1SVPA 1RTLA 4UEHH 1TB6H 2AIQA 1J9CH 1BIOA 1S82A 1OP0A 3NCLA 1WYKA 1MTNC 1IQFA 3D49H 4K5ZA 4MPXA 4E06H 5ABWA 4CRFA 2OUAA 8GCHG 7ESTE 5T6DA 1BRCE 1C9PA 4R8TB 3QO6A 1KLJH 3VB7A 1F0TA 2FESH 2OBOA 2GVFA 1L1GA 3UPEA 3OSYA 4WMFA 2F9VA 2P3UB 1UVPA 2BX4A 2SFAA 1NM6A 5A8ZA 3F9EA 2GCHF 4FUDA 1UTPA 1C2EA 2Q6DA 3QX5H 1ZHPA 1O2PA 2ZGCA 1DLKB 1P57B 1C5SA 1ETSH 1YCPK 3L3TA 1UMAH 4XOJA 5TCAA 4B73A 2WPHS 1EUFA 1RJXB 1SGCA 1ZYOA 3M5LA 3S7HB 1ESBA 2G81E 2O8TA 1C1TA 3GCTG 4BAKB 3FP7E 2P94A 3E1XB 4LZ1H 2ZF0H 5C2ZA 2ZTXA 3TU7H 2P93A 4GCHF 2A4GA 2RCEA 1O32A 2W3KA 4Y7AA 3VFEA 1GBLA 1OP2A 1GBMA 1RIWC 1C5PA 3A7YA 2F9UA 3LU9B 2D2DA 2C90B 3PYHA 1C2IA 1ELTA 3TJUA 5E8EH 4DW2U 3BTFE 2O8LA 1MU6B 6ESTA 1HV7A 1GHXH 4ZXYH 2ZKSA 1C5YB 1IQGA 1O2MA 1P05A 5AF9H 1ZPZA 5DK1A 4HTCH 4FUJA 1DXPA 1YPGH 3HGPA 4I8KA 4IC5A 4AN7A 2PTNA 5ESBA 2XCNA 5T6FA 4DJZB 1VGCC 2A7CA 2R2WU 5GCHG 3ZZBA 1S83A 3ZVFA 1B0EA 2VH0A 2FZZA 1EB1H 3FVFB 2PV9B 2BVSH 4OS1A 3SNCA 1ELDE 2BLOA 1OS8A 5BRRE 4GHQA 1PFXC 4E7NA 1AFEH 3F9FA 5F03A 3GOVB 1BUIA 1V2OT 2AGIX 3UR6A 1TGTA 1N8OC 4ZROA 1DWEH 4X1SU 1ZSKA 1G3CA 2Y5FA 4X8UH 4E05H 1QTFA 1EQ9A 1NRPH 1GWAA 3RP2A 2B9LA 2SNVA 3TIUA 5HGGA 4TYDA 5IYTA 1NY22 4RN6A 2F9BH 1A7SA 4ZXXH 3RMNH 1KLIH 3B23B 1AY6H 3RU4T 3LT3A 7GCHF 1C5MD 1WQSA 2FOFA 1K21H 2CXVA 1O3PB 2ZPRA 3LGIA 1BMMH 2SGEE 3BEFB 3A89A 1GHYH 5EQSA 3F6UH 1GBEA 3QN7A 2HALA 4DGJA 2DE9A 3GY5A 1CE5A 1WAYB 1V3XA 4KKDA 3EQ0H 1SGFA 1UTMA 1THPB 2IN2A 3A81A 5CMXH 4X1QU 1OPHB 1Y5BT 4FUHA 2UUYA 4X2VA 1GDUA 2BY6X 1DANH 1HDTH 1FAKH 1OWEA 1SQAA 1YPLH 1D9IA 5EQQA 2THFB 4I31A 2QXHA 2ZIQH 3RXRA 1O3FA 1EATA 1GBKA 1TPPA 3A8CA 1ARCA 1G9IE 1SLWB 1A0LA 1P2MA 2V0BA 3VB4A 1FY3A 3ZV8A 1O3DA 5FPTA 3GDVA 3NK8A 2A2QH 8LPRA 1O34A 3LOXA 1FIWA 1YPEH 1IHSH 1C2FA 3K65B 2G5VA 1BMLA 4OGYA 4YT6H 2QCYA 2BLVA 2OC1A 1GVKB 5A0BA 4H6SB 3LH1A 5DJ7A 1QGFA 2FO9A 1ETRH 1ANCA 2R3YA 4DIIH 2XXLA 3R3GB 1QBNA 3RXAA 1PQ7A 1J15A 1QCPA 5FHTA 3OY6U 4UE7H 1F5LA 4D9QA 3L6PA 4IN1A 3KCGH 1ORFA 4INLA 4D76A 2PKSC 3BTDE 5EOKA 3KQBA 3VGCB 1AZZA 1IQMA 3VXFH 2A45B 1LHEH 2FDAA 5EXLA 4WH6A 4AGJA 3E6PH 2H9EH 1HIAA 1O3CA 1ELEE 3M37A 2BLWA 1AWFH 1P9UA 1YLCA 1BJUA 1WQVH 1TIOA 1GI3A 4OGXA 2PSYA 1D3PB 1P11E 1S81A 1A3BH 4SGAE 5JB8S 1DFPA 3PWBA 3A80A 3ZZ5A 3GCTF 1QL8A 3FAOA 3RXEA 3ZVEA 1HAXB 3ZV9A 3SU3A 4LOYH 3ITIA 3GDSA 1Q2WA 1LVMA 5F8XA 1V2JT 2HNTE 1UTQA 1QRXA 1AFQB 2P8OC 3T26A 1WSSH 1VJ9U 1BJVA 2BXUH 2CV3A 1G30B 1JWTA 1ZSLA 2FOEA 4K3JA 4NG9H 5EG4A 2EI6A 2WUCA 1V2WT 4E7RG 1EPTB 2H9HA 4Y76A 3CS7A 2ANWA 5BPEA 4Q80A 3WY8A 5EW2H 1MKWK 4Q7YA 1DWCH 1L1JA 1HAYB 1O3OA 1NRQH 1MAXA 2HWLB 1ZSJA 1NFWA 5GCHF 1OSSA 2ZDKA 1TONA 1FY4A 2BZAA 1E0FD 2ZEBA 2JH5D 1O2RA 1BRAA 1FPCH 1P2NA 1ZJKA 1UHBA 2ZDNA 3RDZA 1TAWA 4X2XA 1IQNA 2WPKS 3F1SB 5L30H 2R9PA 1EP5A 5A0CA 1FY1A 1O2LA 1S5SA 3A7TA 2VVUA 4ABEA 3E0PB 1O37A 1MH0A 3S9BA 5C5NA 2FODA 1GGDC 1Y3VA 1TE0A 5FCRA 2ZHEH 3IWMA 1HBTH 1QL9A 1ESTA 1P01A 1PQ5A 4FU7A 1ZOMA 1MD8A 1SLUB 4XBDA 2WPMS 1P09A 3SV6A 2QAAA 1Z8IB 1NROH 4D9RA 1RXPA 2VGCB 2AFQB 1DE7H 4O97A 3RXSA 2BD8A 1QIXB 1BMAA 2H1UA 3I78A 4KP0A 1HAVB 1MTSA 1QBOA 2XCFA 3Q77A 2OQUA 4FUCA 4K69A 2VWOA 1QQ4A 1HAZB 3QTOH 4K2YA 4R0IA 1ZHRA 2PUQH 3GYLB 9ESTA 3ATLA 1DY9A 2FIRH 3VB3A 1BRBE 2W7SA 4ISOA 1O36A 1DT2A 2V3OH 1SGNE 4I32A 1H4WA 3A83A 4Y71A 1C9TA 1YBWA 2A5IA 2Z9LA 2QA9E 1YPKH 4TY7A 1BITA 2XBWA 1SR5C 2PTCE 3F9GA 2ZPQA 1FXYA 2F83A 1GCDA 4JZFH 3ZZ4A 1TMBH 3SV7A 3RXDA 4MDSA 2OXSA 1GCTB 4J1YA 1DSUA 1C5TA 1ETTH 3GISB 4BXSA 2ZP0H 1EASA 2G8TA 3ATIA 1P12E 3OX7U 4MPVA 1WCZA 4X2YA 2ESTE 1XXFA 2ZA5A 1N6XA 1EKBB 4BTUB 7LPRA 1ELBA 1MU8B 2BD2A 3SNAA 1YGCH 1FDPA 1KDQA 4AYYB 3P17H 2OC0A 1SGIB 2SGDE 4GVUA 1GJ5H 4NIXA 5I46H 1H1BA 1ZRBA 4IS5A 5C3NA 5JBBS 4IN2A 1F7ZA 4DT7B 1HFDA 4KTSA 1K28D 1MMJN 1KSNA 2Z3CA 4ZH8A 4AG1A 1SGEE 1KYNA 4ZUHA 1GJBB 2BDGA 1TBRH 4ESTE 3PTBA 3A7WA 4WXIA 2C8WB 1OOKB 5CE1A 3P70B 1BDAA 3W94A 1ZHMA 2VWLA 4IW4E 1AHTH 1O3AA 3GY8A 5J4SA 2ZU3A 2G51A 3SUGA 1NS3A 2O8UA 2AERH 1ABJH 1PPZA 1SFQB 3AAVA 2A1DB 3MYWA 4IC6A 1O2QA 4IBLH 4O9VA 2DUCA 1O38A 4ABGA 2XC0A 2F9NA 2ZFSA 1G2MA 2XC5A 1TGNA 1O2NA 3EDXB 4ZKSU 1F92A 3BTME 3ZYDA 3KEEA 1GL0E 4YOJA 2ANKH 4CRGA 3UQOA 2FI4E 1C2KA 4DY7B 1LHFH 2QXGA 2AGGX 2XNIA 1V2VT 1FLEE 4HGCA 5E0HA 3AW1A 1J8AA 4MPUA 1ZRKA 3SGQE 4AZ2B 3TH2H 2FOHA 1JRSA 3A85A 2FP7B 3O8BA 4AFUA 3M7UA 3LGUA 1EOJA 3TK9A 2H6MA 1J16A 1TLDA 1F0UA 4K1EA 4NCYA 2PR3A 3FP8E 1JIMA 2NU4E 3QUMP 2CF8H 2BQ6B 1GI9B 2PW8H 1S6FA 1NT1A 1IQJA 1FIZA 1K1MA 4GAWA 1FZZA 1AUJA 4OS5A 4B71A 4BANB 3MTYA 2EI7A 1VR1H 1HXEH 5AFZH 1B0FA 2TIOA 3TJNA 1QNJA 2VU8E 2Y7ZA 1THSH 5TCCA 3SU2A 1OYTH 3SJOA 3S7KB 2FLRH 1TPOA 2QXIA 2ZQ2A 3UNQA 1GMDF 3KF2A 3TVJB 1CA0B 1AWHB 1SGFG 3P8NA 4XBCA 4U32A 2QN5T 1GMCF 1LQDB 1DPOA 2GDDA 2Z9JA 3IITA 1EAXA 1BHXF 5E2OA 2G55A 2CGAA 3BTKE 2QIQA 3SGAE 1A5IA 1V2UT 1QQUA 1C4V2 1Y3YA 1LHCH 2VIDA 1DDJA 1K1OA 1ABIH 1HJ8A 3SNDA 2BXTH 3RM0H 1Z8GA 3N7OA 2XYAA 1O2ZA 5SGAE 3STJA 1K1LA 1E36B 1MTWA 4NIWA 3K6YA 3UIRA 1CBWC 3A8AA 1RTFB 2CHAB 1P2QA 5C20A 1V2LT 2HPQH 1BTWA 3A8DA 4AB8A 1AVXA 1C2GA 2J9NA 1L2EA 2D8WA 1LQEA 3SO3A 2ANYA 4LXBH 3BTEE 3RXUA 3BV9B 2UWOA 2BVRH 2PWXA 2FPZA 2HVXA 4ISIH 1EZSC 3MNSA 3PLBA 2ODQA 1XUFA 3T5FH 1K1PA 2JH0D 2BQWB 3PM3A 1SOTA 3R0FA 1GJ4H 2BDBA 4FU9A 2VWNA 2H2ZA 2K1QA 2CF9H 1UK3A 1AI8H 3MH4A 1L4ZA 1EAIA 1O3LA 1GVZA 1C5VA 2I6SA 1XVOA 2Y6TA 1MZAA 1CT0E 1LPKB 1J17T 5ESTE 2HLCA 2GMTB 5FX6A 1LVYA 2P3TB 1P2OA 3A8BA 1T4UH 3ESTA 5GWZA 1ZPBA 1GBJA 1W12U 2QC2A 1P2JA 1CHOG 1UK2A 5LGOA 1QFKH 1ZTJA 1FV9A 1UCYH 3H7TA 3MFJA 4ZAEA 1C5QA 4K8BA 1NRNH 2W5EA 1THRH 1Y59T 3RXTA 2BLQA 3MH7A 1GHAG 2SGQE 1GHBF 4ZKOU 4DOQA 5K7RA 1S0RA 4H4FA 1NN6A 1IHTH 1EP6A 1TABE 4F49A 1D6WA 2F9OA 1Z8RA 1K22H 3BG4C 4XFQA 3S9CA 1PQAA 1GHVH 3K9XB 2B5TB 2PLXA 2TPIZ 2A4QA 5HYOA 2F3CE 1JOUB 3DD2H 1IQEA 3FZDA 4Y0YE 4GUXA 2HNTC 2ZPSA 2YOLA 1NFXA 4CRDA 2C8ZB 1EJAA 3ENSB 1UVOA 3MU4A 1CGJE 4NSYA 3RC6A 1AKSB 5EGMA 1OWDA 1TQ0B 1P3EA 5GJ4B 3TH3H 3TNTA 2BX3A 2ZHQH 2QF3A 1TRNA 1ZPCA 3PLPA 1G37A 3T28A 3PMBB 1CQQA 2Z94A 5K0HA 3VEQB 2Y5HA 3GY6A 3B9FH 3RXOA 1C1PA 2GT7A 1NU9A 1RGQA 3A88A 1K1JA 1K1NA 2ULLA 2RG3A 2PKAB 3DFLA 1O31A 2CN0H 4K1TA 1AD8H 2FI5E 1EJNA 1A0HB 1ZMLA 2Q6GA 3HPTB 1UVTH 2XBYA 4YZUA 1O33A 3BSQA 4BTIB 5L2ZH 1XUGA 1G3BA 1GHWH 1HAOH 3MU0A 3GY4A 4WXVA 2ZU2A 1TNHA 4FVDA 1A1RA 1FJSA 1GBBA 1CGIE 1O2WA 4A92A 5DP7A 3GCHB 2V3HH 1OWKA 1YYY1 1GJ9B 3M61U 3U1JB 3OY5U 1C5ZB 1LHGH 4OS7A 1BCUH 2XWAA 2PGBB 2Q6FA 2HPPH 3MO3A 2R0LA 2ZQ1A 1H8DH 2QY0B 3E90B 3ZVAA 3MH6A 1HXFH 3LGVA 3MNCA 2W3IA 1DICA 3E91A 1E34B 3URDA 1JXPA 1PPEE 1OKXA 4X8VH 3VB5A 1ZGVA 2WV4A 1W8BH 1KXCA 4YOIA 3SUFA 4CBOA 3O8RA 5F8ZA 4QT8C 4RKJB 4X6MA 1D3DB 3TJOA 2Y80A 5G4BA 1KTTB 4MTBA 4WJG2 1C1SA 5L6NH 3JZ2B 3NPSA 4BAHB 4D8NA 2FS8A 1WTHD 1HAIH 5DP8A 3HK6B 5E2PA 2OC7A 1Q31A 2GCTB 4NGAH 1W13U 6LPRA 3DT0H 5DP9A 2FOAA 1G3EA 3A82A 2AGEX 3QZRA 1QL7A 3TJVA 3SU0A 3A84A 2J2UA 1NRSH 1ANBA 2VJ1A 2D26C 1GMHG 2Z3EA 4U30A 8GCHF 3UOPA 2QXJA 3E0NB 1O5BB 2LPRA 2FLBH 5J4QA 1ZTKA 4JMYA 4FU8A 3SBKA 3DFJA 3RMLH 3QTVH 1K9OE 1Y3XA 1FQ3A 1UVUH 1C5RA 5JPMH 4Y8ZA 4B76A 3RXMA 4MLFB 3P6ZB 3DA9B 1GJ8B 1N6YA 4KTUA 2FYRA 3RLWH 3MO9A 1TPAE 1HYLA 3SI3H 5C1XA 4I8GA 2DE8A 1Y5AT 2AH4X 1LTOA 3LONA 2AIPA 3B8JA 1AU8A 1MTNB 4UFEH 4CR9A 1YC0A 5FPYA 2CMYA 1O2YA 1AKSA 5FAHA 1ELVA 5DP4A 3KIDU 2EEKA 1EAUA 3PO1B 1E38B 3E3TA 1LPZB 1QA0A 1A46H 2NU0E 5JB9S 3O8CA 5HM9A 4AFZA 3NZIA 1HAPH 1J14A 3BTWE 4BXWA 1OX1A 3O8DA</