1HAXB

Snapshots of serine protease catalysis: (a) acyl-enzyme intermediate between porcine pancreatic elastase and human beta-casomorphin-7 at ph 5
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILRNNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-CASOMORPHIN-7
publication title X-Ray Snapshots of Serine Protease Catalysis Reveal a Tetrahedral Intermediate
pubmed doi rcsb
molecule tags Hydrolase
total genus 60
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2001-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1haxB02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1haxB01
1ZR0A 1WQSA 2BOKA 3MO9A 4Y11E 3BEUA 4MTBA 2WPHS 5DGJA 1SGDE 1P9SA 3PMBB 3M61U 2P8OC 3FP7E 3R0FA 1TOCB 1QGFA 5FHTA 1GG6B 4ZXXH 2Z9GA 3SQHE 4GCHG 5GPIB 2TBSA 3TGJE 1WV7H 2VH0A 3MYWA 1B5GH 2A4RA 1SGPE 2JETB 3RXRA 1AFEH 1LQDB 4K1EA 1PPFE 1Z7KA 4WH8A 4BXWA 1GHVH 5T6FA 5C20A 1C1NA 3LGUA 3V7TA 1P3EA 3DFJA 2BLQA 3S69A 1TB6H 2GCHG 5G4BA 4JZDH 3ZVGA 3K6YA 4D8NA 3ZZ9A 2O8UA 3H5CB 3RP2A 5EGMA 1OP0A 1ZMNA 3VB5A 4AFZA 1LTOA 5JBTA 9ESTA 1P09A 2VINA 1A5GH 1D4PB 3O8DA 1OWHA 2ZQ2A 4IN2A 1N6YA 2EEKA 3QX5H 1KLTA 5A09A 2PTCE 5C1UA 3OYPA 4O3TA 1GBHA 1FY4A 1IQGA 2V6NA 1BMMH 2R9PA 4BAQB 3MOCA 1HXEH 1ELCA 1CVWH 5A0BA 1CA0C 2R2MB 1GJBB 2BDBA 1TRNA 1FN8A 4X1RU 2VNTA 2GKVE 3BV9B 1MBQA 2Z9KA 3RXPA 1CSOE 1V2QT 1ACBE 1VJ9U 2A2QH 1Z6JH 4B76A 1AUJA 2FOGA 1BBRH 1KSNA 1QL9A 3TVJB 1P11E 1THSH 5FBEA 4I8JA 1V2RT 4UFDH 1TONA 1DFPA 1HJAB 3BSQA 2Z6BD 3BTTE 4YLQH 4HTCH 4YOJA 1EAXA 2TRMA 4DIHH 2BDAA 4INHA 1Z8RA 4TWYA 8LPRA 3JZ2B 1NU7B 1S84A 3MFJA 4H4FA 2F9NA 1O5DH 4LOYH 4X1SU 2BY7X 1G2LA 1YKTA 1KTTB 1P2KA 1FN6A 3LDXH 4JYUH 3VB4A 1K21H 1GMDG 1CT2E 1FONA 2FO9A 2O8MA 2OUAA 4Z6AH 4YLUA 1YF4A 3GDUA 2RG3A 4A6LA 1C2EA 3AAVA 1GI7B 2WYGA 1S6FA 1G3DA 1GGDB 2FTMA 1W0YH 2XBYA 4MG3A 4WJG2 1C4V2 4CRGA 1FNIA 4K8YA 4NA9H 5L6NH 1G30B 2OBOA 4HI3A 3HK6B 1ZJKA 2M5TA 4UONA 3M7QA 1L1JA 1MTWA 1BHXF 5L2ZH 1O5EH 3QN7A 1P06A 1HYLA 2GD4B 2J2UA 2VIOA 3SU3A 3VGCB 4A1VA 4F49A 1SC8U 1TIOA 1SGEE 1ZPZA 1THRH 1MAXA 3UTUH 1BDAA 1MTNB 1V2WT 1IQFA 5H4IB 1IHTH 1MZDA 2UUKB 1KXBA 1GI1A 1KLJH 5GCHF 2QIQA 1QB6A 1O35A 4XE4A 2VJ1A 5HM9A 3R3GB 4Q2KA 1BRCE 2OC1A 1OXGA 2JH6D 3K65B 1O3MA 4D9QA 4J1YA 4ABHA 1SGNE 5LPFA 1JIRA 1ZMLA 1CU1A 1GHXH 2A7CA 1QA0A 3RU4D 1QBNA 4K1SA 3U1JB 4YZUA 1DWDH 1M9UA 1H1BA 1N8OC 1AMHA 2SGPE 4HFPB 4X1NU 1AQ7A 1F5KU 1HIAA 1LVYA 3K2UA 2Z3EA 3OTJE 5IDKA 5E2PA 5HXFA 2VB0A 2ZHQH 4X0WU 1CT0E 1O3AA 1UTMA 2G5VA 1K1OA 5JBAS 1BBRE 2BM2A 1UHBA 2BY8X 1GBCA 4AG2A 1BUIA 3B8JA 1LPZB 4BAHB 1FJSA 3DFLA 1TNHA 3ZVCA 4NIYA 1HAGE 2VVCA 3NUMA 1EPTB 1NESE 2A0QB 4BAMB 1TABE 1THPB 1HV7A 3HGNA 1Z71A 2F9UA 4ABGA 3SN8A 1TE0A 3H7OA 4KTCA 3KEEA 3KHVA 2A2XH 3NPSA 3OY5U 2FOEA 4KGAA 3TK9A 1G3CA 1SL3A 1WUNH 3GDSA 2NU3E 2AMQA 1C5PA 3BEFB 3SW2B 1O2VA 2DE8A 1AE5A 2P3TB 2ZECA 1GJ5H 3F1SB 3KQEA 4X6NA 3V3MA 1YPMH 1YPKH 1J9CH 1EUFA 4Y0ZE 4AFQA 1P2JA 2FOBA 1HAIH 1TGCA 5F8TA 2ZGHA 1ETRH 2ZFTA 4E06H 1PJPA 4FU9A 1BJUA 4X2YA 2H2ZA 1FAKH 1GHBF 1ZRBA 3FANA 4DOQA 3EDXB 2A45B 2IOTA 2P95A 1YP9A 3SOSA 3SU4A 5DO4H 1BA8B 2FS8A 3UQOA 2Y80A 1HNEE 1UK2A 4UD9H 3LJJA 2ZU4A 4YTAA 1QRWA 3ELAH 1A1RA 1GDNA 1C1WH 3MI4A 4AB9A 4XFQA 1S0QA 3E16B 3VB7A 2J95A 1ELAA 1C1RA 2G51A 1EP5A 4I31A 1C5TA 1TMBH 1V2ST 5EQSA 1NFYA 1FI8A 4AYYB 3AW1A 2W3IA 5DJ7A 2K1QA 2R3UA 4OS1A 3P8GA 1SGQE 1O2SA 3RLYH 1CBWC 3OX7U 3SGBE 3SZNA 1D3TB 2YOLA 3GICB 1QA7A 2HGTH 1QJ1B 1BQYA 3E91A 2ZU1A 1KYNA 4Q80A 1G32B 4IBLH 1UTLM 1QB1A 2I6SA 5FCRA 3T26A 2GGVB 3UOPA 3TLOA 2CHAB 1A0JA 1F0SA 1FY3A 1C2KA 1GJ6A 1P10A 2ZHDA 3PMJA 2H9EH 5FPSA 1AVWA 1TWXB 2C8YB 1HAXB 1T7CA 1DSUA 4CRBA 4Y7BA 4Y6DA 5GDSH 3SU5A 1QRXA 4VGCB 1O3FA 4NIWA 3TITA 3VFEA 6CHAB 3DA9B 4GSOA 4YM9A 1BRUP 1LPKB 2HNTE 3KCGH 4A5TS 3ZZCA 1C2IA 3GYMA 3RUOA 1C4U2 4JYVH 4TPYA 1HAZB 3ODDA 1QJ7B 4OGXA 3C1KA 1JBUH 4O3UA 1LDTT 1RTFB 6GCHG 2PLXA 2ZF0H 5A0CA 1XUKA 1O2XA 1TYNA 2PHBA 3S9CA 1BHXB 4U32A 2CJIA 1EQ9A 1LVMA 4WVPE 3U69H 3RXVA 2SNWA 2QXJA 2A7HA 1GVZA 1ARBA 1O2JA 1LVOA 1EJNA 1W13U 1TGBA 1YPGH 1FY5A 1RFNA 1EZXC 2BDGA 2AYWA 3GOVB 2BD3A 1HAVA 4I8LA 2FODA 4K2YA 3RXBA 1TNLA 1IQIA 3RXMA 1U6QA 2SGFE 1AUTC 4DVAU 1BTZA 1TRMA 1GI8B 1SGFA 1ZTLA 1NFUA 3ATMA 3GISB 1D6RA 1W8BH 3V12A 5ESBA 2XTTB 3NXPA 1ZGVA 3QZQA 2FTLE 1EATA 1W7XH 1MMJN 1AZZA 4B75A 3L33A 1UK4A 3A8BA 1GL1A 3V13A 2WPMS 1SVPA 3ATIA 4X2XA 1KIGH 5F03A 2VVUA 1A5HA 4CBOA 3RMOH 3GCTG 5DPAA 1BCUH 1TBQH 2BTCE 4CR5A 2WUBA 3TIUA 2PUQH 4ABIA 4ZKRU 3RM0H 1HXFH 1FIWA 1XVOA 1O30A 2H9TH 1P2QA 2XWBI 2BD7A 2C8ZB 2H1UA 3BTKE 3BTQE 3P95A 1GBKA 4Q7YA 2G4TA 5EXMA 4DW2U 2ZPSA 2B9LA 1L4DA 3LGTA 4BANB 3A8AA 1C5OH 1L1NA 2TPIZ 2ZDVH 1BTHH 1QL7A 3UFAA 1QNJA 3EA8A 3M5MA 3KF2A 2H5DA 1O5CB 1O36A 5EQRA 4DJZB 5DG6A 1BRAA 3VXEH 1V2PT 2AGEX 5LGOA 3BEIB 2XCFA 2Y6TA 1CE5A 1NU9A 1GBBA 1TNIA 1W3CA 3TH3H 4D7GA 1P3CA 2JETC 2WINI 5F6MA 1SG8B 2GZ9A 1O2WA 5A8XA 1YPLH 2XNIA 5JB8S 1SOZA 4X6OA 5C1XA 3HATH 1F0UA 3SUGA 3EGKH 4K8BA 2FESH 2F9BH 4FUFA 1UTKA 1OWKA 3LT3A 3SV8A 1PPCE 1P2NA 2AGIX 4JZFH 1SOTA 5TJXA 1ELVA 1J14A 3DD2H 1PQ5A 1TBZH 2ZO3H 1MTUA 5JBCS 1QBVH 3PWBA 1TA2A 3UY9A 3ZZ4A 1WOFA 3UWJH 3RXAA 2EI6A 2OP9A 2VVVA 4GCHF 1TX8A 3LU9B 1S6HA 1Z1JA 4NSYA 3RXFA 4A7IB 1O39A 1UTPA 2GDDA 2C4FH 2C90B 4WMEA 3LH3A 3FZDA 2ANYA 4ZKNU 5T3HA 1G2MA 5C2ZA 3T62A 1S5SA 4GVUA 2ZPRA 2FWWA 2CGAA 2ZFPH 3ODFA 2THFB 1SB1H 1MBMA 2F91A 2QXGA 2SGDE 1GJ4H 3AASA 1P12E 1O2KA 2ODQA 2W3KA 4ZHMU 3PLKA 4ZHAA 4GLYA 3RXDA 1NY22 1H4WA 2GZ7A 1O5GH 1B0EA 2P3FH 3ITIA 4K1TA 1ANCA 4CHAC 4FUIA 5ESTE 4QT8C 1N6XA 2UUFB 2J92A 1AFQC 5AHGH 1VGCB 2ULLA 3UREA 1AKSB 4MNXA 3UUZA 2XC0A 1AZ8A 1PPHE 1V2OT 3A8DA 1O2YA 4MNVA 3M3VA 1HFDA 1P05A 2F9PA 1GGDC 1AD8H 2O8WA 4DURA 3M3TA 2PV9B 1ARCA 1C2FA 1AI8H 4CRCA 1LQEA 2A31A 1TX6A 1DPOA 2VWOA 3KL6A 4CRDA 3PO1B 3D23A 1GJAB 1DWEH 2A7JA 3MNXA 3DHKH 1DUEA 2GCTC 2PFEA 5J4QA 2YNBA 4LZ1H 2FM2A 2GMTB 1J15A 4DY7B 2XC4A 1FV9A 1MTNC 1GMDF 1C5WB 3M36A 1CGIE 3UNRA 1GI5A 1XKAC 2G55A 1TX7A 3E1XB 3ZV8A 4UFEH 1YBWA 2OC8A 4FU8A 5GIBA 1GMHG 4BXSA 2BLWA 2XXLA 3E0NB 1SLXB 7ESTE 1WU1A 1CHGA 2EI8A 4NIXA 4SGBE 3P8NA 3TNTA 4OS5A 5C5OA 1NS3A 1V2NT 3VB6A 2ZTYA 2F9OA 1GHAF 1SGYE 2PWXA 3A85A 1O31A 3ZYDA 2ZFFH 2AERH 3BTDE 3NKKA 4AGKA 3LGVA 4AYVB 2PKSC 1GDQA 4RKOB 2AMPA 1AB9C 2HNTC 3RC4A 2Y5FA 1P0SH 3M3SA 3MU5A 1MCTA 1TLDA 1GJ7B 1H9HE 3ENSB 4Y76A 1C5LH 4DG4A 5BRRE 2HPPH 1TQ7B 3ZZ7A 1GHWH 1Y8TA 3BTFE 4FVBA 5A8ZA 3A7VA 1X7AC 2BDHA 1TALA 2OQUA 2ASUB 4YOGA 1FXYA 3SJIA 7GCHG 4AN7A 4NA7A 1A0HB 2Z9IA 1C2DA 5K7RA 1J8AA 1EPTA 1T8OA 3UNSA 1GBIA 3LGWA 5GWZA 1HRTH 3A84A 1FUJA 4B71A 1KLIH 1NC6A 4NIVA 1DICA 3TH2H 4JK6A 3P8FA 4I33A 3PTBA 1O2GH 3RXUA 1DXWA 1O33A 2ZDLA 2FOCA 2PKAB 2ILNA 3K6ZA 1SQAA 1O3CA 4PROA 4TPIZ 2P3UB 3JZ1B 5DK1A 2WV4A 3E6PH 3U98H 1ZMJA 2Z9LA 1FY1A 1RD3B 1EKBB 4YO9A 1C2HA 1K1MA 4UFFH 4BTTB 1PQ8A 1LHCH 1TNGA 2ZP0H 2STBE 1ZGIA 1SGCA 1SLVB 5EPNA 3QUMP 3A87A 1EOJA 1VITF 1BZXE 1ELEE 1ANEA 1Z1IA 2G5NA 3P17H 1NRQH 2GP9B 2VGCB 1G37A 2A1DB 4X2WA 4CREA 3SGAE 3SJ8A 2BD9A 2FXRA 1O3EA 4Y8YA 5FX6A 5DP3A 1CHOF 2XBVA 5FCKA 3F9EA 1PPZA 1DLKB 1MAYA 2WPKS 5I46H 4B73A 1QFKH 3C27B 3PTNA 3KQCA 3SQEE 5ABWA 1YPHE 1A4WH 3SO3A 3VXFH 1GVLA 1L1GA 1TPAE 2P93A 2VWMA 2ZA5A 1EAWA 2ZWLH 4OS4A 3SUDA 3U8OH 1FY8E 6LPRA 1LHDH 4NGAH 2ZDNA 4WXIA 1L2EA 3D49H 3RMLH 2CHAC 4U2WA 2AH4X 1IQJA 5JBBS 5JDUB 1FPCH 1OX1A 4NZQA 1TPOA 3NZIA 3T2NA 1ZSKA 1EJMA 5A0AE 2VIWA 4K60A 1C1OA 4AX9H 1E36B 3BIUH 1Q31A 1ESAA 1PQ7A 2IPHA 2WPIS 3K9XB 6CHAC 3A7TA 1K1IA 1O38A 2ZTXA 3TJVA 2HLCA 3ZVBA 1O3IA 2ZCLP 3SU2A 1DY8A 2FDAA 2HWLB 3NCLA 1GI3A 2ZI2H 1W14U 3SU0A 1QR3E 4OS6A 2VIQA 3CS7A 3ZV9A 1O5AB 1EZQA 3PLPA 3A7WA 1IAUA 4IMZA 1C1UH 1YCPK 2ZG0H 3LC5A 1F7ZA 1WCZA 1GCTC 2FOAA 5L30H 2GX4A 4ABJA 1H8DH 2FP7B 4AG1A 4B1TA 3QTOH 3MU4A 1O3JA 3SV2H 1RXPA 2HOBA 2PTNA 4ZXYH 1BT7A 1JIMA 1MQ6A 1GBTA 4NCYA 3A86A 1HJ9A 2GT8A 4ZHLU 1SMFE 1V2MT 1SLUB 4ASHA 1C5NH 5EG4A 3SV9A 3GCOA 2PUXB 1DDJA 4M7GA 1C4Y2 2Y7ZA 2H6MA 4ABFA 3LOXA 3AAUA 1GJ9B 1Y3XA 2UUJB 5HMAA 4E7NA 6GCHF 2O8LA 1NZQH 5EW2H 2Z94A 4I32A 1YPEH 1C5UA 3HGPA 2EI7A 3B23B 1QTFA 1C5RA 1ID5H 4Q7ZA 4NG9H 6ESTA 1W7GH 2NU4E 2SFAA 1RIWC 3IWMA 3PWCA 4WMFA 1TNJA 3SNEA 3RXHA 4GAWA 3SUFA 3U8RH 3GCHC 2ZFRH 3SI3H 3RXSA 1TNKA 2FX6A 3F9GA 1D9IA 1DUAA 4Y8ZA 4TY7A 1BTXA 3U8TH 1O3GA 1EB1H 3LIWA 3A89A 4H42U 2R0KA 2VIDA 1PPBH 2PGQB 3TJOA 1BTYA 4Y10E 3LC3A 3O8CA 1C2LA 2Y81A 2BVRH 5GCHG 1QCPA 2B7DH 5FBIA 1T4UH 2QCYA 1ELFA 1ZOMA 1YGCH 2VH6A 3PMHB 1FZZA 1OYTH 1Q2WA 1C2MA 4XSKU 1EAIA 3NWUA 1MCVA 1UVOA 3E0PB 5C67A 1WQVH 3PM3A 3DUXH 1AGJA 3ESTA 2W5EA 2OTVA 1UVSH 2CF9H 1EOLA 3RDZA 1GI2A 1ZZZA 4BAKB 1VJAU 4CRAA 3FZZA 1SBWA 2BLVA 5DP4A 3GCTF 4INKA 2ZIQH 3EE0B 4GPGA 1QBOA 1XUIA 4YOIA 4ZUHA 2QN5T 4DIIH 1O3BA 3SJOA 1ABJH 1O2OA 2FYRA 3AVZA 1T8MA 2BD8A 4ZKOU 4FUEA 3SV7A 2ALVA 4UEHH 3RXIA 2OC7A 3BG4C 1XXDA 4MPUA 1WTGH 4JK5A 1AVXA 1UVUH 2BD2A 2Y5HA 4XBCA 3T25A 1P2MA 3AW0A 4MPWA 1CA8B 4XDEA 4JZEH 1IQLA 3ZVEA 3A7YA 1Y3YA 2FS9A 4WXVA 5FX5A 1DITH 1GBAA 1ELDE 1N8OB 2FX4A 2CN0H 2D8WA 1GJ8B 1MKXK 1EAUA 1PFXC 1UVPA 2A5AA 1VITH 1IQMA 1MTVA 1XXFA 3IITA 3QGNB 4Y79A 2C8XB 2HALA 3A8CA 5AFZH 1LHFH 2H9HA 2BLOA 8GCHF 2Q1JA 4H6TA 1O3KA 2R0LA 3KGPA 3BTEE 1EZSC 1V6DA 3MH7A 3ZVDA 3W95A 1JOUB 1S83A 3W94A 1Q3XA 1GWAA 4OS2A 4NWLA 5HYOA 3QTVH 2YNAA 4IW4E 2A4QA 3SHCH 3D65E 2XYAA 4FUCA 4WF8A 1H9LB 1C5MD 2P94A 2BX4A 3ZVAA 1GBDA 5CE1A 1OYQA 1O2RA 1MTSA 1O2NA 1O2QA 2BQWB 2GDEH 3RXKA 1C5ZB 1INCA 2BYAX 2EA3A 3GY7A 4KP0A 3L6PA 2FI5E 3M37A 3KN2A 2QGRA 5CHAC 2Z3CA 4R8TB 3BTGE 4AORA 2GTBA 3I78A 4X2VA 1XVMA 3QZRA 4F4OC 2G8TA 4UFGH 1YCPH 2QF3A 8ESTE 4B2BA 1YYY1 1ELTA 1F2SE 1L4ZA 3QWCH 1G3EA 1V2KT 1ELBA 3RLWH 2ZFSA 1MKWH 3LPRA 2UUYA 1SGFG 3U1IB 1AKSA 3BTHE 1C1PA 1GDUA 3OY6U 2J34A 2CMYA 3BF6H 2OQ5A 2GVFA 3SI4H 1HDTH 1QRZA 3ZZAA 2Y7XA 2FLRH 2PW8H 4AGJA 1TA6A 2C8WB 1E34B 5JB9S 1Y59T 1ETSH 1TPPA 1GI0A 1A2CH 1C5QA 3A80A 1ZJDA 2O9QA 2AIPA 1TPSA 1GG6C 2Z9JA 4GHTA 5F8XA 1YPHC 5SGAE 1D6WA 1P03A 1O5FH 2GV7A 2AIQA 1ZLRA 3ZZ3A 1GHYH 3MU8A 1DX5M 1O2LA 5AF9H 2GZ8A 1O34A 1F0RA 5LPEA 2Q6GA 2C3SA 1O2MA 5L2YH 5EQQA 3O8BA 1HAHH 4A1TA 1IQNA 1EP6A 5J4SA 1P01A 2ODPA 3I29A 3UWIA 1RGQA 3ZZDA 9LPRA 1ESBA 2FI4E 1OWJA 3G01A 1SGRE 4NFFA 1YM0A 4LK4A 1QIXB 1GMCG 3S0NA 3STIA 1SHHB 3SORA 3SNDA 1T8LA 1PQAA 5A8YA 4INLA 3M35A 3DT0H 3QGJA 1FIZA 2I6QA 1NFWA 1OWEA 1EASA 3SJ9A 2FEQH 2RDLA 3VPKA 2J94A 3SV6A 2SGEE 2GCHF 1LPGB 1UTJA 1BRBE 5T6GA 1WAYB 3F9HA 4TY6A 1HB0B 1ZPBA 5GJ4B 3RXGA 2C93B 3D62A 4FU7A 1T32A 1V2TT 1LHEH 4X8VH 4JYTA 2BXUH 1K9OE 1NRRH 3LGIA 3SJKA 4HGCA 1HJAC 1V3XA 1VCPA 1YLDA 3Q3YA 4AFUA 2BQ6B 1JMOH 2BDCA 1GL0E 2OLGA 2ZGCA 4Y8XA 3SNAA 3TGKE 1OPHB 1ZHPA 3S9BA 1J16A 4HZHA 1O5BB 2FPZA 5DP9A 3LGYA 3E90B 1AO5A 3BTWE 1KXFA 4X8UH 1HAOH 2ZCKP 1GI6A 1ZSLA 1AIXH 4I8HA 2BZAA 1BJVA 1NM6A 3MHWU 3PB1E 3TNSA 3UQVA 3PMAB 3S9AA 1A0LA 4MLFB 2XBXA 4I8KA 2PKAA 1MKXH 2UWOA 1UVTH 2WYJA 1P2OA 1LMWB 4ISOA 1Y5AT 1G9IE 1OKXA 3ATKA 1Z8JB 2WUCA 3RM2H 1RJXB 1AY6H 1CGHA 1GJCB 1VZQH 4JCNA 3RXQA 2B0FA 1GBFA 2DUCA 2BD5A 4MNWA 1A61H 2BZ6H 1FLEE 2FOHA 3FAOA 4Q7XA 1DWBH 1EZUC 1QJ6B 1JXPA 2D26C 4BAOB 3VGCC 3MU0A 1QHRB 1H8IH 2QY0B 2BX3A 1CO7E 2GT7A 1S82A 2BMGB 5AVDA 2R2WU 1O2IA 1DVAH 1G3BA 3SU6A 4FUBA 4TYDA 1OOKB 4Y71A 2CF8H 1HJ8A 1A3BH 3T5FH 1ELGA 1OS8A 3PV4A 4B2AA 3UR6A 3HKIB 2TGAA 4FVDA 3M5OA 3GY2A 1BIOA 1B0FA 1VR1H 2AEIH 4BOHA 1S85A 4X1QU 2A5KA 4U30A 2ZQ1A 3URDA 3LKWA 3S7KB 3UNQA 1XUJA 3V0XA 2V35A 1K1PA 1LKBA 1BMAA 1YC0A 2RA3A 2ZFQH 3STJA 5JPMH 1ORFA 4JZIA 4X8TH 4AB8A 1XMNB 4CH2B 3ZZ6A 2RCEA 3A88A 3MMGA 2ZGJA 4XOJA 1TQ0B 5E2OA 4XBBA 1YCPM 2ANMH 2F83A 1OP8A 4LZ4B 2ANWA 2QYIA 2BDYA 1O3NA 1E0FD 3LJOA 1K1JA 1EPTC 1KXDA 1YLCA 2XC5A 5FPTA 1D3PB 1S81A 1HAPH 2PSXA 3MNCA 2CXVA 3NK8A 4BTUB 1HPGA 1V2UT 1W0ZU 2P16A 1ZRKA 4THNH 1K1NA 3U9AH 1WSSH 1BMLA 2ZKSA 1BTUA 1E38B 1V2LT 2JH5D 4CRFA 3CENA 2RA0A 5EW1H 2GV6A 2F9VA 2ZDMA 1KDQB 5TCCA 1P2IA 2OC0A 1PPGE 5C5NA 3OSYA 1N1LA 1DLEA 3FP6E 3B9FH 4K69A 2KAIB 1XUHA 4RKJB 1LHGH 2F3CE 4ZMAH 5F8ZA 2VIVA 1WTHD 3GCNA 4CHAB 2PGBB 3A7XA 1Z8IB 4YT6H 4KTSA 1Y3WA 4NSVA 2V0BA 2ZU3A 3EYDA 2AS9A 1AFQB 3KIDU 2ZGBH 1SQOA 4X6MA 4WWYA 2B8OH 1C5XB 1C2JA 3RXEA 4TWWA 3RXJA 1DOJA 1RTKA 4WH6A 5EPYA 3UIRA 1BTWA 2UWLA 2XW9A 3ZZ8A 3A83A 2UWPA 4BNRA 4Y7AA 1DY9A 3TK5A 3LH1A 2FYQA 3VEQB 1KXCA 4MNYA 4ISIH 3TGIE 1NTPA 1KXEA 4MVNA 2G81E 3SGQE 4ABAA 1GHAG 1QL8A 1GBJA 4Y0YE 1ABIH 4ABEA 1AWHB 3M5NA 4O03A 1CGJE 1TRYA 2JKHA 3RXCA 1Y5BT 5T6DA 3FVFB 2Q6FA 1J17T 5ETXA 2GCTB 1WBGB 1CQQA 1ZHRA 4FXGH 2P8OB 2ZGXH 4IGDA 4AFSA 1NPMA 1SGTA 1Y5UT 2AGGX 3MTYA 1VCWA 2SNVA 5E0HA 1HLTH 3FP8E 1BMNH 4OGYA 2BXTH 4VGCC 4D76A 3QO6A 3EAJA 4FUDA 4AOQA 1LVBA 1GBMA 4KELA 7KMEH 1TGTA 1MZAA 3CS0A 5C1YA 2QV1A 2AFQB 1EX3A 2ZDKA 2BDIA 2HRVA 1H9IE 4Z0KA 1P9UA 4ISHH 3SUEA 1T4VH 2PKSB 1DWCH 3UPEA 3T28A 2QXIA 1C1MA 1NRSH 1XUFA 1IOEA 1MU6B 1WYKA 1TMUH 3QDZB 1AB9B 1IQEA 4X6PA 1MKWK 3F6UH 1K28D 2FI3E 5DP6A 1DSTA 4KKDA 3HPTB 3EA9A 2ALPA 2W7UA 3ZVFA 3CP7A 1O37A 1UCYK 1A3EH 4KTUA 1CA0B 2PSYA 3LONA 3MH5A 4X8SH 1K1LA 3RXTA 3E8LA 4I7YH 2FZZA 2ZNKH 2TGPZ 1AWFH 2J38A 1SI5H 1O0DH 3M5LA 4MQAA 1GJDB 3RXOA 3A7ZA 1SR5C 1Z6EA 3A81A 3FFGA 2BQ7B 1VITG 3RC5A 2O8TA 2TGTA 1GPZA 1AHTH 2LPRA 3GYLB 2WPJS 4I8GA 5DP7A 1SFQB 1DXPA 4U01A 5EODA 1TMTH 2DE9A 1FQ3A 5LH8A 2NWNA 2ZCHP 5E8EH 1CHOG 1LCYA 2A5IA 2ODYB 5EOKA 4WMDA 4SGAE 1NRNH 4MPVA 2Q6DA 2B5TB 1LO6A 1W10U 1ZSJA 2XCNA 1XUGA 1ANBA 4YT7H 2NU1E 1Y3UA 1RTLA 1ANDA 2BOHB 5FPYA 2Y82A 2VU8E 1C9TA 4E7RG 1KTSB 1C5VA 3EA7A 4E05H 1T31A 4RSPA 1P8VC 4ZKSU 5PTPA 4D9RA 2IN2A 1UMAH 1O2PA 3EQ0H 1B7XB 4ZH8A 2P59A 1JRTA 3T29A 1F5RA 1AN1E 2JH0D 2BVSH 4LXBH 2FOMB 1IQKA 3GDVA 1QY6A 5FAHA 1SFIA 3S7HB 3VB3A 1ZYOA 2FLBH 4ZROA 1JWTA 2QF0A 2XWAA 1QQUA 4FUGA 2G00A 3KNXA 1A46H 3Q76A 1HAYB 2FIRH 2ZTZA 1EB2A 3GY6A 4UDWH 1AE8H 4OS7A 2ZEBA 1O3OA 2ANKH 2PR3A 4JZ1A 1TFXA 5IYTA 3T27A 1D3DB 1FMGA 1DE7H 1O2UA 1GCDA 1F0TA 1HIAB 1XM1A 1PPEE 2D2DA 1BITA 1DS2E 1QURH 4GUXA 3BG8A 3ATWA 1OWIA 1DANH 1P04A 4BTIB 1TGNA 2ZDAH 1SSXA 1UHBB 5AFYH 1NRPH 3PLBA 4FUJA 4D7FA 2BY9X 2NU2E 2BVXH 2LNCA 2ZHEH 3Q3XA 4ABDA 3P92A 1VCQA 1F92A 5E0GA 2OBQA 1D3QB 3Q77A 4MDSA 1EJAA 1QQ4A 3SNCA 1C1TA 1TAWA 3KQBA 3QK1A 1K2I1 3P6ZB 1GCTB 2Y5GA 1ZTJA 1LKAA 2V3OH 1GHBG 1GI9B 1HUTH 2VIPA 2TIOA 2R3YA 1AVGH 1FAXA 4AZ2B 4A92A 3ZYEA 2FOFA 1GMCF 3A82A 4A1XA 3RMMH 5E0JA 1V2JT 3QLPH 2HVXA 4B74A 3PROA 3I77A 2TGDA 3SNBA 5DKMA 3GY8A 1SHYA 2BB4A 1BB0B 2V3HH 1G36A 4R0IA 1MQ5A 3RU4T 4ESTE 1O3HA 4ISNA 8KME2 1VGCC 2OCVB 2EC9H 2A4OA 1C5SA 3F9FA 2BY6X 2OD3B 3MH4A 1O2TA 1V2VT 1ETTH 2Z7FE 3ATLA 1UO6A 1OSSA 1O3LA 1GVKB 3BIVH 4CBNA 1TGSZ 1RIWB 2ESTE 3GY4A 3GY3A 4WY3A 1YPJH 3TU7H 1SLWB 1ZTKA 1MD7A 4CR9A 5A2MH 2HPQH 1NFXA 1UCYH 3GCHB 1P57B 2ZU5A 3F68H 1ZPCA 4IS5A 4ISLA 3RC6A 1UK3A 5EU8A 3PO1C 1ESTA 3BTME 1S0RA 1F5LA 3Q3KA 4CH8B 2IJOB 2ZZUH 1NT1A 4MPXA 2G4UA 3MO3A 2GMTC 1KY9A 1A5IA 3O8RA 1W12U 4NZLA 3SBKA 1P02A 4K3JA 5EXNA 1HBTH 1CBWB 2D1JA 2SGAA 5JYIA 1UTNA 3MWIU 2AMDA 1GI4A 1Z8GA 1HGTH 4H6SB 4RN6A 5C3NA 3RU4E 4ZAEA 1XX9A 4GHQA 1NO9H 2H5CA 3L3TA 1O2HA 1O3DA 2OINA 3RXLA 1L0ZA 3MO6A 3UOUA 1DM4B 1BTPA 2STAE 3E3TA 4ABBA 3TH4H 2WV5A 2ZHFH 2G52A 1BBRK 5CMXH 3SHAH 3URCA 5HGGA 1BOQA 3IG6B 2BHGA 3MNBA 1XKBC 1MD8A 1DT2A 3M7TA 2NU0E 8GCHG 4XBDA 3RMNH 1FDPA 3BG4B 3BN9A 4IC6A 1SGIB 1SPJA 1PYTC 2QAAA 5TCAA 4NFEA 2QXHA 2J9NA 1UJ1A 3WY8A 1GMHF 1W11U 5FXLA 3HK3B 3TPIZ 2VWLA 5HM2A 3TJUA 3SU1A 1KXAA 1MH0A 2FMJA 3P8OA 3HKJB 1SQTA 1CT4E 1O3PB 1PYTD 1Y3VA 1C5YB 3OU0A 3P70B 1OWDA 1UTOA 4NA8A 1O2ZA 1JRSA 5B6OA 1HAVB 4FUHA 4UE7H 2BY5X 1UTQA 4X1PU 4IN1A 4O9VA 1C1SA 1A7SA 1C1VH 2A4GA 3UR9A 5LPRA 2W7SA 2W26A 3GY5A 2QC2A 7LPRA 2SGQE 5BPEA 1OP2A 2BD4A 2QA9E 1IQHA 1C1QA 1FPHH 4B2CA 1NROH 5DP8A 4DCDA 1GBEA 3PYHA 3TK6A 5I25A 5DP5A 1UCYE 4YESB 3TJNA 1KDQA 1EXFA 2ZHWH 2OXSA 3M7UA 1C2GA 3ZZBA 1GBLA 7GCHF 5K0HA 4IMQA 4NWKA 1E37B 1HCGA 1AU8A 4K5ZA 4JMYA 3KQDA 3Q00A 2KAIA 2ZPQA 1TBRH 5GXPA 2XRCA 3N7OA 1O32A 5CHAB 1E35B 1MUEB 1IHSH 2A32A 2VGCC 2VWNA 1TOMH 2ZC9H 1ZHMA 1C9PA 3MNSA 1T8NA 2Z3DA 4IC5A 5EXLA 2XBWA 2ZU2A 1MU8B 1K22H 4O97A 1RS0A 3MH6A 2HNTF 4J2YB 1QB9A 4DGJA 4DT7B 1GHZA 2CV3A 3H7TA 1RRKA 3ZZ5A 3MU1A 1NN6A 1W2KH 2WPLS 2J4IA
chains in the Genus database with same CATH superfamily
1ZR0A 1WQSA 2BOKA 3MO9A 4Y11E 3BEUA 4MTBA 2WPHS 5DGJA 1SGDE 1P9SA 3PMBB 3M61U 2P8OC 3FP7E 3R0FA 1TOCB 1QGFA 5FHTA 1GG6B 4ZXXH 2Z9GA 3SQHE 4GCHG 5GPIB 2TBSA 3TGJE 1WV7H 2VH0A 3MYWA 1B5GH 2A4RA 1SGPE 2JETB 3RXRA 1AFEH 1LQDB 4K1EA 1PPFE 1Z7KA 4WH8A 4BXWA 1GHVH 5T6FA 5C20A 1C1NA 3LGUA 3V7TA 1P3EA 3DFJA 2BLQA 3S69A 1TB6H 2GCHG 5G4BA 4JZDH 2XNDD 3K6YA 3ZVGA 3ZZ9A 4D8NA 2O8UA 3H5CB 1WDIA 3RP2A 2KX4A 5EGMA 1OP0A 1ZMNA 3VB5A 4AFZA 1LTOA 5JBTA 9ESTA 1P09A 2VINA 1A5GH 1D4PB 3O8DA 1OWHA 2ZQ2A 3OTPA 4IN2A 1N6YA 2EEKA 3QX5H 1KLTA 5A09A 2PTCE 5C1UA 3OYPA 4O3TA 1GBHA 1FY4A 1IQGA 2V6NA 1BMMH 2R9PA 4BAQB 3MOCA 1HXEH 1ELCA 1CVWH 5A0BA 1CA0C 2R2MB 1GJBB 1SQRA 2BDBA 1TRNA 1FN8A 4X1RU 2VNTA 2GKVE 3BV9B 1MBQA 2Z9KA 3RXPA 1CSOE 1V2QT 1ACBE 1VJ9U 2A2QH 1Z6JH 4B76A 1AUJA 2FOGA 1BBRH 1KSNA 1QL9A 3TVJB 1P11E 1THSH 5FBEA 4I8JA 1V2RT 4UFDH 1TONA 1DFPA 1HJAB 3BSQA 2Z6BD 3BTTE 4YLQH 4HTCH 4YOJA 1EAXA 2TRMA 4DIHH 2BDAA 4INHA 1Z8RA 3F2HA 4TWYA 8LPRA 3JZ2B 1NU7B 1S84A 3MFJA 4H4FA 2F9NA 1O5DH 4LOYH 4X1SU 2BY7X 1G2LA 1YKTA 1KTTB 1P2KA 1FN6A 3LDXH 4JYUH 3VB4A 1K21H 1GMDG 1CT2E 1FONA 2FO9A 2O8MA 2OUAA 4Z6AH 3DSOA 4YLUA 1YF4A 3GDUA 2RG3A 4A6LA 1C2EA 3AAVA 1GI7B 2WYGA 5B6LA 1S6FA 1G3DA 1GGDB 2FTMA 1W0YH 2XBYA 4MG3A 4WJG2 1C4V2 4CRGA 1FNIA 4K8YA 4NA9H 5L6NH 1G30B 2OBOA 4HI3A 3HK6B 3KQ5A 1ZJKA 2M5TA 4UONA 3M7QA 1L1JA 1MTWA 1BHXF 5L2ZH 1O5EH 3QN7A 1P06A 1HYLA 2GD4B 2J2UA 2VIOA 3SU3A 3VGCB 4A1VA 2GJGA 4F49A 1SC8U 1TIOA 1SGEE 1ZPZA 1THRH 1MAXA 3UTUH 1BDAA 1MTNB 1V2WT 1IQFA 5H4IB 1IHTH 1MZDA 2UUKB 1KXBA 1GI1A 1KLJH 5GCHF 2QIQA 1QB6A 1O35A 4XE4A 2VJ1A 5HM9A 3R3GB 4Q2KA 1BRCE 2OC1A 1OXGA 2JH6D 3K65B 1O3MA 4D9QA 4J1YA 4ABHA 1SGNE 5LPFA 1JIRA 1ZMLA 1CU1A 1GHXH 2A7CA 1QA0A 3RU4D 1QBNA 4ACAA 4K1SA 3U1JB 3KYGA 2KCPA 4YZUA 1DWDH 1M9UA 1H1BA 1N8OC 1AMHA 2SGPE 4HFPB 4X1NU 1AQ7A 1F5KU 1HIAA 1LVYA 3K2UA 2Z3EA 3OTJE 5IDKA 5E2PA 5HXFA 2VB0A 2ZHQH 4X0WU 1CT0E 1O3AA 1UTMA 3FO8D 2G5VA 1K1OA 5JBAS 1BBRE 2BM2A 1UHBA 2BY8X 1GBCA 4AG2A 1BUIA 3B8JA 4FETA 1LPZB 4BAHB 1FJSA 3DFLA 1TNHA 3ZVCA 3MQKC 4NIYA 1HAGE 2VVCA 3NUMA 1EPTB 1NESE 2A0QB 4BAMB 1TABE 1THPB 1HV7A 3HGNA 1Z71A 2F9UA 1YWUA 4ABGA 3SN8A 1TE0A 3H7OA 4KTCA 3KEEA 3KHVA 2A2XH 3NPSA 3OY5U 2FOEA 4KGAA 3TK9A 1G3CA 1SL3A 1WUNH 2XOKD 3GDSA 2NU3E 2AMQA 4FOUC 1C5PA 3BEFB 3SW2B 1O2VA 2DE8A 1AE5A 2P3TB 2ZECA 1GJ5H 3F1SB 3FOAA 3KQEA 4X6NA 3V3MA 1YPMH 1YPKH 1J9CH 1EUFA 4Y0ZE 4AFQA 1P2JA 2FOBA 1HAIH 1TGCA 5F8TA 2ZGHA 1ETRH 2ZFTA 4E06H 1PJPA 1W0KD 3FN8A 1BJUA 4FU9A 4X2YA 2H2ZA 1FAKH 2VBCA 1GHBF 1ZRBA 3FANA 4DOQA 3EDXB 2A45B 2IOTA 2P95A 1YP9A 3SOSA 3SU4A 5DO4H 1BA8B 2FS8A 3UQOA 2Y80A 1HNEE 1UK2A 4UD9H 3LJJA 2ZU4A 4YTAA 1QRWA 3ELAH 1A1RA 1GDNA 1C1WH 3MI4A 4AB9A 4XFQA 1S0QA 3E16B 3VB7A 2J95A 1ELAA 1C1RA 2G51A 1EP5A 4I31A 1C5TA 1TMBH 1V2ST 5EQSA 1NFYA 1FI8A 4AYYB 3AW1A 2W3IA 5DJ7A 2K1QA 2R3UA 4OS1A 3P8GA 1SGQE 1O2SA 2J98B 3RLYH 1CBWC 3OX7U 3SGBE 3SZNA 1D3TB 2YOLA 4TSFD 3GICB 1QA7A 2HGTH 2KCOA 1QJ1B 1BQYA 3E91A 2ZU1A 1KYNA 4Q80A 1G32B 4IBLH 1UTLM 1QB1A 2I6SA 5FCRA 3T26A 2GGVB 3UOPA 3TLOA 2CHAB 2HLDD 1A0JA 1F0SA 1FY3A 1C2KA 1GJ6A 1P10A 3AK5A 2ZHDA 3PMJA 2H9EH 5FPSA 1AVWA 1TWXB 2C8YB 1HAXB 1T7CA 1DSUA 4CRBA 4Y7BA 4Y6DA 5GDSH 3SU5A 1QRXA 4VGCB 1O3FA 4NIWA 3TITA 3VFEA 6CHAB 3DA9B 4GSOA 4YM9A 1BRUP 1LPKB 2HNTE 2CK3D 3KCGH 4A5TS 3ZZCA 1C2IA 3GYMA 3WWFA 3RUOA 1C4U2 4JYVH 4TPYA 1HAZB 3ODDA 1QJ7B 4OGXA 2M2AA 3C1KA 1JBUH 4O3UA 1LDTT 1RTFB 6GCHG 2PLXA 2ZF0H 5A0CA 1E79D 1XUKA 1O2XA 1TYNA 2PHBA 3S9CA 1BHXB 4U32A 2AHME 2CJIA 1EQ9A 5HIZA 1LVMA 4WVPE 3U69H 3RXVA 2SNWA 2QXJA 2A7HA 1GVZA 1ARBA 1O2JA 1LVOA 1EJNA 1W13U 1TGBA 1YPGH 1FY5A 1RFNA 1EZXC 2BDGA 2AYWA 2V3MA 3GOVB 2WZQA 2BD3A 1HAVA 4I8LA 2FODA 4K2YA 3RXBA 1TNLA 1IQIA 3RXMA 2RDEA 1U6QA 2SGFE 2JJ1D 1AUTC 4DVAU 1BTZA 3CNRA 1TRMA 1GI8B 1SGFA 3DSGA 1ZTLA 1NFUA 4P00A 3ATMA 3GISB 1D6RA 1W8BH 3V12A 5ESBA 2XTTB 3NXPA 1ZGVA 3QZQA 2FTLE 1EATA 1W7XH 1MMJN 1AZZA 4B75A 3L33A 1UK4A 3A8BA 1GL1A 3V13A 2WPMS 1SVPA 3ATIA 4X2XA 4OM9A 1KIGH 2J97A 5F03A 2VVUA 1A5HA 4CBOA 3RMOH 3GCTG 5DPAA 1BCUH 1TBQH 2BTCE 4CR5A 1KMHB 2WUBA 3TIUA 2PUQH 4ABIA 4ZKRU 3RM0H 1HXFH 1FIWA 1XVOA 1O30A 2H9TH 1P2QA 2XWBI 2BD7A 2C8ZB 2H1UA 3BTKE 3BTQE 3P95A 1GBKA 4Q7YA 2G4TA 5EXMA 4DW2U 2ZPSA 2B9LA 1L4DA 3LGTA 4BANB 3A8AA 1C5OH 1L1NA 2TPIZ 2ZDVH 1BTHH 1QL7A 3UFAA 1QNJA 3EA8A 3M5MA 3KF2A 2H5DA 1O5CB 1O36A 5EQRA 4DJZB 3FKSD 5DG6A 1BRAA 3VXEH 1V2PT 2AGEX 5LGOA 3BEIB 2XCFA 2Y6TA 1CE5A 1NU9A 1GBBA 1TNIA 1W3CA 3TH3H 4D7GA 3N99A 1P3CA 2JETC 2WINI 5F6MA 1SG8B 2GZ9A 1O2WA 5A8XA 1YPLH 2XNIA 5JB8S 1SOZA 4X6OA 5C1XA 3HATH 1F0UA 3SUGA 3EGKH 4K8BA 2FESH 2F9BH 4FUFA 1UTKA 1OWKA 3LT3A 3SV8A 1PPCE 1P2NA 2AGIX 4JZFH 1SOTA 5TJXA 1ELVA 1J14A 3DD2H 1PQ5A 1TBZH 2ZO3H 1MTUA 5JBCS 1QBVH 3SYJA 3PWBA 1TA2A 3UY9A 2QE7D 3ZZ4A 1WOFA 3UWJH 3RXAA 2EI6A 2OP9A 2VVVA 4GCHF 1TX8A 3F3BA 3LU9B 1S6HA 1YY3A 1Z1JA 4NSYA 3RXFA 4A7IB 1O39A 1UTPA 2GDDA 2C4FH 2C90B 4WMEA 3LH3A 3FZDA 2ANYA 4ZKNU 5T3HA 1G2MA 5C2ZA 3T62A 1S5SA 4GVUA 2ZPRA 3DCLA 2FWWA 2CGAA 2ZFPH 3ODFA 2THFB 1SB1H 1MBMA 2F91A 2QXGA 2SGDE 1GJ4H 3AASA 1P12E 1O2KA 2ODQA 2W3KA 4ZHMU 3PLKA 4ZHAA 4GLYA 3RXDA 1NY22 1H4WA 2GZ7A 1O5GH 1B0EA 2P3FH 3ITIA 4K1TA 1ANCA 4CHAC 4FUIA 5ESTE 4QT8C 1N6XA 2UUFB 2J92A 1AFQC 5AHGH 1VGCB 2ULLA 3UREA 5EJZA 1AKSB 4MNXA 3UUZA 2XC0A 1AZ8A 1PPHE 1V2OT 2PP6A 3A8DA 1O2YA 4MNVA 3M3VA 1HFDA 1P05A 2F9PA 1GGDC 1AD8H 2O8WA 4DURA 1E1QD 3M3TA 2PV9B 1ARCA 1C2FA 1AI8H 4CRCA 1LQEA 2A31A 1TX6A 1DPOA 2VWOA 3KL6A 4CRDA 3PO1B 3D23A 1GJAB 1DWEH 2A7JA 3MNXA 3DHKH 1DUEA 2GCTC 3H09A 2PFEA 5J4QA 2YNBA 4LZ1H 2FM2A 2GMTB 1J15A 4DY7B 2XC4A 1FV9A 1MTNC 1GMDF 3OEHD 1C5WB 3M36A 1CGIE 3UNRA 1GI5A 1XKAC 2G55A 1TX7A 3E1XB 3ZV8A 4UFEH 1YBWA 2OC8A 4FU8A 5GIBA 1GMHG 4BXSA 2BLWA 2XXLA 3E0NB 1SLXB 7ESTE 1WU1A 2KCYA 1CHGA 2EI8A 4NIXA 4SGBE 3P8NA 3TNTA 4OS5A 5C5OA 1NS3A 1V2NT 3VB6A 2ZTYA 2F9OA 1GHAF 1SGYE 2PWXA 3A85A 1O31A 3ZYDA 2ZFFH 2AERH 3BTDE 3NKKA 4RT1A 4AGKA 3LGVA 4AYVB 2PKSC 5KEDA 1GDQA 4RKOB 2AMPA 3PV2A 1AB9C 2HNTC 3RC4A 3GS9A 2Y5FA 1P0SH 3M3SA 3MU5A 1MCTA 1TLDA 1GJ7B 1H9HE 1BMFD 3ENSB 4Y76A 1C5LH 4DG4A 5BRRE 2HPPH 1TQ7B 3ZZ7A 1GHWH 1Y8TA 3BTFE 4FVBA 5A8ZA 4XRNA 3A7VA 1X7AC 2BDHA 1TALA 2OQUA 2ASUB 4YOGA 1FXYA 3SJIA 7GCHG 4AN7A 4NA7A 1A0HB 5EIYA 2Z9IA 4RT0A 1C2DA 5K7RA 2JIZD 1J8AA 1EPTA 1T8OA 3UNSA 1GBIA 3LGWA 5GWZA 4XD7D 1HRTH 3A84A 1FUJA 4B71A 1KLIH 1NC6A 4NIVA 1DICA 3TH2H 4JK6A 2JJ2D 3P8FA 1FX0B 4I33A 3PTBA 1O2GH 3RXUA 1DXWA 1O33A 2ZDLA 2FOCA 2PKAB 2ILNA 3K6ZA 1SQAA 1O3CA 4PROA 4TPIZ 2P3UB 3JZ1B 5DK1A 2WV4A 3E6PH 3U98H 1ZMJA 2Z9LA 2EY4C 1FY1A 1RD3B 1EKBB 4YO9A 1C2HA 1K1MA 4UFFH 4BTTB 5KGOA 1QZ8A 1PQ8A 1LHCH 1TNGA 2ZP0H 2STBE 1ZGIA 1SGCA 3OEED 4ASUD 1SLVB 5EPNA 3QUMP 3A87A 1EOJA 1VITF 1BZXE 1ELEE 1ANEA 1Z1IA 2G5NA 3P17H 1NRQH 2GP9B 2VGCB 1G37A 2A1DB 4X2WA 4CREA 3SGAE 3SJ8A 2BD9A 2FXRA 1O3EA 4Y8YA 5FX6A 5DP3A 1CHOF 2XBVA 5FCKA 3F9EA 1PPZA 1DLKB 1MAYA 2WPKS 5I46H 4B73A 1QFKH 3C27B 3PTNA 3KQCA 3SQEE 5ABWA 1YPHE 1A4WH 3SO3A 3VXFH 1GVLA 1L1GA 1TPAE 2P93A 2VWMA 2ZA5A 1EAWA 2ZWLH 4OS4A 3SUDA 3U8OH 1FY8E 2V7QD 6LPRA 1LHDH 4NGAH 2ZDNA 4WXIA 1L2EA 3ZIAD 3D49H 3RMLH 5CHBA 2J98A 2CHAC 4U2WA 2AH4X 1IQJA 5JBBS 5JDUB 1FPCH 1OX1A 4NZQA 1TPOA 3NZIA 3T2NA 1ZSKA 1EJMA 5A0AE 2VIWA 4K60A 1C1OA 4AX9H 1E36B 3BIUH 1Q31A 1ESAA 1PQ7A 2IPHA 2WPIS 3K9XB 6CHAC 3A7TA 1K1IA 1O38A 2ZTXA 3TJVA 2HLCA 3ZVBA 1O3IA 2ZCLP 3SU2A 1DY8A 2FDAA 2HWLB 3NCLA 1GI3A 2ZI2H 1W14U 3SU0A 1QR3E 4OS6A 2VIQA 5IK2D 3CS7A 3ZV9A 1O5AB 1K0HA 1EZQA 3PLPA 3A7WA 1IAUA 4IMZA 1C1UH 1YCPK 2ZG0H 3LC5A 1F7ZA 1WCZA 1GCTC 2FOAA 5L30H 1OHHD 4Q63A 2K0QA 2GX4A 4ABJA 1H8DH 2FP7B 4AG1A 4B1TA 3QTOH 3MU4A 1O3JA 3SV2H 1RXPA 2HOBA 2PTNA 2W6JD 4ZXYH 1BT7A 1JIMA 1MQ6A 1GBTA 4NCYA 4AC9A 3A86A 1HJ9A 2GT8A 4ZHLU 1SMFE 1V2MT 1SLUB 4ASHA 1C5NH 5EG4A 3SV9A 3GCOA 2PUXB 1DDJA 4M7GA 1C4Y2 2Y7ZA 2H6MA 4ABFA 3LOXA 3AAUA 1GJ9B 1Y3XA 2UUJB 5HMAA 4E7NA 6GCHF 2O8LA 1NZQH 5EW2H 2Z94A 4I32A 1YPEH 1C5UA 3HGPA 2EI7A 3B23B 1QTFA 1C5RA 1ID5H 4Q7ZA 4NG9H 6ESTA 1W7GH 2NU4E 2SFAA 1RIWC 3IWMA 3PWCA 4WMFA 1TNJA 3SNEA 3RXHA 4GAWA 3SUFA 3U8RH 3GCHC 2ZFRH 3SI3H 2KM0A 3RXSA 1TNKA 2FX6A 3F9GA 1D9IA 1DUAA 4Y8ZA 4TY7A 1BTXA 3U8TH 1O3GA 1EB1H 5C0TA 2HVYB 3LIWA 3A89A 5DSFA 4H42U 2R0KA 2VIDA 1PPBH 2PGQB 3TJOA 1BTYA 4Y10E 3LC3A 3O8CA 1C2LA 2Y81A 2BVRH 5GCHG 1QCPA 2B7DH 5FBIA 1T4UH 2QCYA 1ELFA 1ZOMA 5C94A 1YGCH 2VH6A 3PMHB 1FZZA 1OYTH 1Q2WA 1C2MA 4XSKU 1EAIA 3NWUA 1MCVA 1UVOA 3E0PB 5C67A 1WQVH 3PM3A 3N7EA 3DUXH 1AGJA 3ESTA 2W5EA 2OTVA 1UVSH 2CF9H 1EOLA 3RDZA 1GI2A 1ZZZA 4BAKB 1VJAU 4CRAA 3FZZA 1SBWA 2BLVA 5DP4A 3GCTF 4INKA 2ZIQH 3EE0B 4GPGA 1QBOA 1XUIA 4YOIA 4ZCNA 4ZUHA 2QN5T 2OK5A 4DIIH 1O3BA 3SJOA 1ABJH 1O2OA 2FYRA 3AVZA 3PRBA 1T8MA 2BD8A 4ZKOU 4FUEA 3SV7A 2ALVA 4UEHH 3RXIA 2OC7A 3BG4C 1XXDA 4MPUA 1WTGH 4JK5A 1AVXA 1UVUH 4M9FA 4HG6A 2BD2A 2Y5HA 4XBCA 3T25A 1P2MA 3AW0A 4MPWA 1CA8B 4XDEA 4JZEH 1IQLA 4F55A 3ZVEA 3A7YA 1Y3YA 2FS9A 4WXVA 5FX5A 2YMSC 1DITH 1GBAA 1ELDE 1N8OB 2FX4A 2CN0H 2D8WA 1GJ8B 1MKXK 1UW7A 1EAUA 1PFXC 1UVPA 2A5AA 1VITH 1IQMA 1MTVA 1XXFA 3IITA 3QGNB 4Y79A 2C8XB 2HALA 3A8CA 5AFZH 1LHFH 2H9HA 2BLOA 8GCHF 2Q1JA 2YMSD 4H6TA 1O3KA 2R0LA 3KGPA 3BTEE 1EZSC 2LP6A 1V6DA 3MH7A 3ZVDA 3W95A 1JOUB 1S83A 3W94A 1Q3XA 1GWAA 4OS2A 4NWLA 5HYOA 3QTVH 1H8ED 2YNAA 4IW4E 2L6OA 2A4QA 3SHCH 3D65E 2XYAA 4FUCA 4WF8A 1H9LB 1C5MD 4DT4A 2P94A 2BX4A 3ZVAA 1GBDA 2KFWA 5CE1A 1OYQA 1O2RA 1MTSA 1O2NA 1O2QA 2BQWB 2GDEH 3RXKA 1C5ZB 1INCA 2BYAX 2EA3A 3GY7A 4KP0A 5CDFE 3L6PA 2FI5E 3M37A 2K8IA 3KN2A 2QGRA 1S6LA 5CHAC 2Z3CA 4R8TB 3BTGE 4AORA 2GTBA 3I78A 4X2VA 1XVMA 3QZRA 4F4OC 2G8TA 4UFGH 1YCPH 2QF3A 8ESTE 4B2BA 1YYY1 1ELTA 1F2SE 1L4ZA 3QWCH 1G3EA 1V2KT 1ELBA 3RLWH 2ZFSA 1VKYA 1MKWH 2W6ID 3LPRA 2UUYA 1SGFG 3U1IB 1AKSA 3BTHE 1C1PA 1GDUA 3OY6U 2J34A 2CMYA 3BF6H 2OQ5A 2GVFA 3SI4H 1HDTH 1QRZA 3ZZAA 2Y7XA 5DN6D 2FLRH 2PW8H 4AGJA 1TA6A 2C8WB 1E34B 5JB9S 1Y59T 1ETSH 1TPPA 1GI0A 1A2CH 1C5QA 1YLNA 3A80A 3PV5A 1ZJDA 2O9QA 2AIPA 1TPSA 1GG6C 2Z9JA 4GHTA 5F8XA 1YPHC 5SGAE 1D6WA 1P03A 1O5FH 2GV7A 2AIQA 1ZLRA 3ZZ3A 1GHYH 3MU8A 1DX5M 1O2LA 5AF9H 2GZ8A 1O34A 1F0RA 5LPEA 2Q6GA 2C3SA 1O2MA 5L2YH 5EQQA 3O8BA 3KYFA 1HAHH 4A1TA 1IQNA 1EP6A 5J4SA 1P01A 5EJ1A 2ODPA 3I29A 3UWIA 1RGQA 3ZZDA 9LPRA 1ESBA 2FI4E 3W1EA 1OWJA 3G01A 1SGRE 4NFFA 1YM0A 4LK4A 5KECA 1QIXB 1GMCG 3S0NA 3STIA 1SHHB 3SORA 3SNDA 1T8LA 1PQAA 5A8YA 4INLA 3M35A 2QF5A 3DT0H 3QGJA 1FIZA 2I6QA 1NFWA 1OWEA 1EASA 3SJ9A 2FEQH 4Z1MD 2RDLA 3VPKA 2J94A 3SV6A 2SGEE 2GCHF 5GNDA 1LPGB 1UTJA 1BRBE 5T6GA 1WAYB 3F9HA 4TY6A 1HB0B 1ZPBA 5GJ4B 3RXGA 2C93B 3D62A 4FU7A 1T32A 1V2TT 1LHEH 4X8VH 4JYTA 2BXUH 1K9OE 1NRRH 3LGIA 3SJKA 4HGCA 1HJAC 1V3XA 1VCPA 1YLDA 3WW7A 3Q3YA 4AFUA 2BQ6B 3OE7D 1JMOH 2BDCA 1GL0E 2OLGA 2ZGCA 4Y8XA 3SNAA 3EE7A 1OPHB 3TGKE 1ZHPA 3S9BA 1J16A 4HZHA 1O5BB 2FPZA 5DP9A 3LGYA 3E90B 1AO5A 3BTWE 1KXFA 4X8UH 1HAOH 2ZCKP 1GI6A 1ZSLA 1AIXH 4I8HA 2BZAA 1BJVA 1NM6A 3MHWU 3PB1E 3TNSA 3UQVA 3DSPA 3PMAB 3S9AA 1A0LA 4MLFB 2XBXA 1NBME 4I8KA 2PKAA 1MKXH 2UWOA 1UVTH 2WYJA 1P2OA 1LMWB 4ISOA 1Y5AT 1G9IE 1OKXA 3ATKA 1Z8JB 2WUCA 3RM2H 1COWD 1RJXB 1AY6H 1CGHA 1GJCB 1VZQH 4JCNA 3RXQA 2B0FA 1GBFA 2DUCA 2BD5A 4MNWA 1A61H 2BZ6H 1FLEE 2FOHA 3FAOA 4Q7XA 1DWBH 1EZUC 1QJ6B 1JXPA 2D26C 4BAOB 3VGCC 3MU0A 1QHRB 1H8IH 2QY0B 2BX3A 1CO7E 2GT7A 1S82A 2BMGB 5AVDA 2R2WU 2EQNA 1O2IA 1DVAH 1G3BA 3SU6A 4FUBA 4TYDA 1OOKB 4Y71A 2CF8H 1HJ8A 1A3BH 3T5FH 1ELGA 1OS8A 3PV4A 4B2AA 3UR6A 3HKIB 2TGAA 4FVDA 3M5OA 3GY2A 1BIOA 1B0FA 1VR1H 2AEIH 4BOHA 1S85A 4X1QU 2A5KA 4U30A 2ZQ1A 3URDA 3LKWA 3S7KB 3UNQA 1XUJA 3V0XA 2V35A 1K1PA 1LKBA 1BMAA 1YC0A 2RA3A 2ZFQH 3STJA 5JPMH 1ORFA 4JZIA 4X8TH 4AB8A 1XMNB 4CH2B 5C0UA 3ZZ6A 2RCEA 3A88A 3MMGA 2ZGJA 4XOJA 1TQ0B 5E2OA 4XBBA 1YCPM 3OAAD 2ANMH 2F83A 1OP8A 4LZ4B 2ANWA 2QYIA 2BDYA 1MABB 1O3NA 1E0FD 3LJOA 1K1JA 1EPTC 1KXDA 1YLCA 2XC5A 5FPTA 1D3PB 1S81A 1HAPH 2PSXA 3MNCA 2CXVA 3NK8A 4BTUB 1HPGA 1V2UT 1W0ZU 2P16A 1ZRKA 4THNH 1K1NA 3U9AH 1WSSH 1BMLA 2ZKSA 1BTUA 1E38B 1V2LT 2JH5D 4F48B 2RFKC 4CRFA 3CENA 2RA0A 5EW1H 2GV6A 2F9VA 2ZDMA 1KDQB 5TCCA 1P2IA 2OC0A 4ACBA 1PPGE 5C5NA 3OSYA 1N1LA 1DLEA 3FP6E 3B9FH 4K69A 2KAIB 1XUHA 3F2FA 4RKJB 1LHGH 2F3CE 4ZMAH 5F8ZA 2VIVA 1WTHD 3GCNA 4CHAB 2PGBB 3A7XA 1Z8IB 4YT6H 4KTSA 1Y3WA 4NSVA 2V0BA 2ZU3A 3EYDA 2AS9A 1AFQB 3KIDU 2ZGBH 3PRDA 4RI0A 1SQOA 4X6MA 4WWYA 2B8OH 1C5XB 1C2JA 3RXEA 4TWWA 3RXJA 1DOJA 1RTKA 4WH6A 5EPYA 3UIRA 1BTWA 2UWLA 2XW9A 3ZZ8A 3A83A 2UWPA 2IJD1 4BNRA 4Y7AA 1DY9A 3TK5A 3LH1A 2FYQA 3VEQB 2LELA 1KXCA 4MNYA 4ISIH 3TGIE 1NTPA 1KXEA 4MVNA 2G81E 3SGQE 4ABAA 1GHAG 1QL8A 1GBJA 4Y0YE 1ABIH 4ABEA 1AWHB 3M5NA 4O03A 1CGJE 1TRYA 2JKHA 3RXCA 1Y5BT 5T6DA 3FVFB 2Q6FA 1J17T 5ETXA 2GCTB 1WBGB 1CQQA 1ZHRA 4FXGH 3N7DA 2P8OB 2ZGXH 4IGDA 4AFSA 1NPMA 1SGTA 1Y5UT 2AGGX 3MTYA 1VCWA 2SNVA 5E0HA 1HLTH 3FP8E 5FL7D 1BMNH 4OGYA 2BXTH 4VGCC 4D76A 3QO6A 3EAJA 4FUDA 4AOQA 1LVBA 5C17A 1GBMA 4KELA 7KMEH 1TGTA 1MZAA 2WSSD 3CS0A 5C1YA 2QV1A 2WV9A 2AFQB 1EX3A 2ZDKA 2BDIA 2HRVA 1H9IE 4Z0KA 1P9UA 4ISHH 3SUEA 1T4VH 2PKSB 1DWCH 3UPEA 3T28A 2QXIA 1C1MA 1NRSH 1XUFA 1IOEA 1MU6B 1WYKA 1TMUH 3QDZB 1AB9B 1IQEA 4X6PA 1MKWK 3F6UH 1K28D 2FI3E 5DP6A 3WWBA 1DSTA 4KKDA 2F43B 3HPTB 3EA9A 2ALPA 2W7UA 3ZVFA 3CP7A 1O37A 1UCYK 1EFRD 3F0OA 1A3EH 4KTUA 1CA0B 2PSYA 3LONA 3MH5A 4X8SH 1K1LA 3RXTA 3E8LA 4I7YH 3UAIC 2FZZA 2ZNKH 2L74A 2TGPZ 1AWFH 2J38A 1SI5H 3UB0A 2WPDD 1O0DH 3M5LA 4MQAA 1GJDB 3RXOA 3A7ZA 1SR5C 1Z6EA 3A81A 3FFGA 2BQ7B 1VITG 3RC5A 2O8TA 2TGTA 1GPZA 1AHTH 2LPRA 3GYLB 2WPJS 4I8GA 5DP7A 1SFQB 1DXPA 4U01A 5EODA 1TMTH 2DE9A 4YXWD 1FQ3A 5LH8A 2NWNA 2ZCHP 2QF4A 5E8EH 1CHOG 1LCYA 2A5IA 2ODYB 5EOKA 4WMDA 4SGAE 1NRNH 4MPVA 2Q6DA 2B5TB 3NRLA 1LO6A 1W10U 1ZSJA 2XCNA 1XUGA 1ANBA 4YT7H 2NU1E 1Y3UA 1RTLA 1ANDA 2BOHB 5FPYA 2Y82A 2VU8E 1C9TA 4E7RG 2KCAA 1KTSB 1C5VA 3EA7A 4B6FA 4E05H 1T31A 4RSPA 1P8VC 4ZKSU 5PTPA 4D9RA 2IN2A 1UMAH 1O2PA 1NBMD 3EQ0H 1B7XB 4ZH8A 2P59A 1JRTA 3T29A 1F5RA 1AN1E 2JH0D 2BVSH 4LXBH 2FOMB 1IQKA 3GDVA 1QY6A 5FAHA 1W0JD 1SFIA 3S7HB 3VB3A 1ZYOA 2FLBH 4ZROA 1JWTA 2QF0A 2XWAA 1QQUA 4FUGA 2G00A 3KNXA 1A46H 3Q76A 1HAYB 2FIRH 2ZTZA 1E1RD 1EB2A 3GY6A 4UDWH 1AE8H 4OS7A 2ZEBA 1O3OA 2ANKH 2PR3A 4JZ1A 1TFXA 5IYTA 3T27A 1D3DB 1FMGA 1DE7H 1O2UA 1GCDA 1F0TA 1HIAB 1XM1A 1PPEE 2D2DA 1BITA 1DS2E 1QURH 4GUXA 3BG8A 3ATWA 1OWIA 1DANH 1P04A 4BTIB 1TGNA 3OFND 3VG8A 2ZDAH 1SSXA 1UHBB 5AFYH 1NRPH 3PLBA 4FUJA 4D7FA 2BY9X 2NU2E 2BVXH 2LNCA 2ZHEH 3Q3XA 4ABDA 1WXRA 3P92A 1VCQA 1F92A 5E0GA 2OBQA 1D3QB 3Q77A 4MDSA 1EJAA 1QQ4A 3SNCA 1C1TA 1TAWA 3KQBA 3QK1A 1K2I1 5T1VA 3P6ZB 1GCTB 2Y5GA 1ZTJA 2JDID 5EJLA 3SZEA 1LKAA 2V3OH 1GHBG 1GI9B 1HUTH 2VIPA 2TIOA 2R3YA 1AVGH 1FAXA 5HKKD 4AZ2B 4A92A 3ZYEA 2FOFA 1GMCF 3A82A 4A1XA 3RMMH 5E0JA 1V2JT 3QLPH 2HVXA 4I86A 4B74A 3PROA 3I77A 2TGDA 3SNBA 5DKMA 3GY8A 1SHYA 2BB4A 1BB0B 2V3HH 1G36A 4R0IA 1MQ5A 3RU4T 4ESTE 1O3HA 4ISNA 8KME2 1VGCC 2OCVB 2EC9H 2A4OA 1C5SA 3F9FA 2BY6X 2OD3B 3MH4A 2J5UA 1O2TA 1V2VT 1ETTH 2Z7FE 3ATLA 1UO6A 1OSSA 1O3LA 1GVKB 3BIVH 4CBNA 1TGSZ 1RIWB 2ESTE 3GY4A 3GY3A 4WY3A 1YPJH 3TU7H 1SLWB 1ZTKA 1MD7A 4CR9A 5A2MH 2HPQH 1NFXA 1UCYH 3GCHB 1P57B 2ZU5A 3F68H 1ZPCA 4IS5A 4ISLA 3RC6A 2F4LA 1UK3A 5EU8A 3PO1C 1ESTA 3BTME 1S0RA 1F5LA 3Q3KA 4CH8B 2IJOB 2IPQX 2ZZUH 1NT1A 4MPXA 2G4UA 3MO3A 2GMTC 1KY9A 1A5IA 3O8RA 1W12U 4NZLA 3SBKA 1P02A 1H8HD 4K3JA 5EXNA 1HBTH 1CBWB 2D1JA 2SGAA 4TT3D 3F2GA 5JYIA 1UTNA 3MWIU 2AMDA 1GI4A 1Z8GA 1HGTH 4H6SB 4RN6A 5C3NA 3RU4E 4ZAEA 1XX9A 4Q4LA 4GHQA 3U28C 1NO9H 2H5CA 3L3TA 1O2HA 1O3DA 2OINA 3RXLA 1L0ZA 3MO6A 3UOUA 1DM4B 1BTPA 2STAE 3E3TA 4ABBA 3TH4H 2WV5A 2ZHFH 2G52A 1BBRK 5CMXH 3SHAH 3URCA 5HGGA 1BOQA 3IG6B 2BHGA 3MNBA 1XKBC 1MD8A 1DT2A 3F0PA 3M7TA 2NU0E 8GCHG 4XBDA 3RMNH 2KR7A 1FDPA 3BG4B 3BN9A 4IC6A 1SGIB 1SPJA 1PYTC 2QAAA 5TCAA 4NFEA 2QXHA 2J9NA 1UJ1A 3WY8A 1GMHF 4P02A 1W11U 5FXLA 3HK3B 3TPIZ 2WHXA 2VWLA 5HM2A 3TJUA 3SU1A 1KXAA 1MH0A 2FMJA 3P8OA 3HKJB 1SQTA 1CT4E 1O3PB 2YMSB 1PYTD 1Y3VA 1C5YB 3OU0A 3P70B 1OWDA 5HIYA 1UTOA 4NA8A 1O2ZA 1JRSA 5B6OA 1HAVB 4FUHA 4UE7H 2BY5X 1UTQA 4X1PU 4IN1A 4O9VA 1C1SA 1A7SA 1C1VH 2A4GA 3UR9A 5LPRA 4B6EA 2W7SA 2W26A 3GY5A 2QC2A 7LPRA 2SGQE 5BPEA 1OP2A 2BD4A 2QA9E 1IQHA 1C1QA 1FPHH 4B2CA 1NROH 5DP8A 5F53A 4DCDA 1GBEA 3PYHA 3TK6A 5I25A 5DP5A 1UCYE 4YESB 3TJNA 1KDQA 1EXFA 2ZHWH 2OXSA 3M7UA 1C2GA 3ZZBA 1GBLA 7GCHF 5K0HA 4IMQA 4NWKA 1E37B 1HCGA 1AU8A 4K5ZA 4JMYA 3KQDA 3Q00A 2KAIA 2ZPQA 1TBRH 5GXPA 2XRCA 3N7OA 1O32A 5CHAB 1E35B 1MUEB 1IHSH 2A32A 2VGCC 2VWNA 1TOMH 2ZC9H 1ZHMA 1C9PA 3MNSA 1T8NA 2Z3DA 4IC5A 5EXLA 2XBWA 2ZU2A 1MU8B 1K22H 4O97A 1RS0A 3MH6A 2HNTF 4J2YB 1QB9A 4DGJA 4DT7B 1SKYE 1GHZA 2CV3A 3H7TA 1RRKA 3ZZ5A 3MU1A 1NN6A 1W2KH 2WPLS 2J4IA 2KZ4A
chains in the Genus database with same CATH topology
1ZR0A 1WQSA 2BOKA 3MO9A 4Y11E 3BEUA 4MTBA 2WPHS 5DGJA 1SGDE 1P9SA 3PMBB 3M61U 2P8OC 3FP7E 3R0FA 1TOCB 1QGFA 5FHTA 1GG6B 4ZXXH 2Z9GA 3SQHE 4GCHG 5GPIB 2TBSA 3TGJE 1WV7H 2VH0A 3MYWA 1B5GH 2A4RA 1SGPE 2JETB 3RXRA 1AFEH 1LQDB 4K1EA 1PPFE 1Z7KA 4WH8A 4BXWA 1GHVH 5T6FA 5C20A 1C1NA 3LGUA 3V7TA 1P3EA 3DFJA 2BLQA 3S69A 1TB6H 2GCHG 5G4BA 4JZDH 3ZVGA 3K6YA 4D8NA 3ZZ9A 2O8UA 3H5CB 3RP2A 5EGMA 1OP0A 1ZMNA 3VB5A 4AFZA 1LTOA 5JBTA 9ESTA 1P09A 2VINA 1A5GH 1D4PB 3O8DA 1OWHA 2ZQ2A 4IN2A 1N6YA 2EEKA 3QX5H 1KLTA 5A09A 2PTCE 5C1UA 3OYPA 4O3TA 1GBHA 1FY4A 1IQGA 2V6NA 1BMMH 2R9PA 4BAQB 3MOCA 1HXEH 1ELCA 1CVWH 5A0BA 1CA0C 2R2MB 1GJBB 2BDBA 1TRNA 1FN8A 4X1RU 2VNTA 2GKVE 3BV9B 1MBQA 2Z9KA 3RXPA 1CSOE 1V2QT 1ACBE 1VJ9U 2A2QH 1Z6JH 4B76A 1AUJA 2FOGA 1BBRH 1KSNA 1QL9A 3TVJB 1P11E 1THSH 5FBEA 4I8JA 1V2RT 4UFDH 1TONA 1DFPA 1HJAB 3BSQA 2Z6BD 3BTTE 4YLQH 4HTCH 4YOJA 1EAXA 2TRMA 4DIHH 2BDAA 4INHA 1Z8RA 4TWYA 8LPRA 3JZ2B 1NU7B 1S84A 3MFJA 4H4FA 2F9NA 1O5DH 4LOYH 4X1SU 2BY7X 1G2LA 1YKTA 1KTTB 1P2KA 1FN6A 3LDXH 4JYUH 3VB4A 1K21H 1GMDG 1CT2E 1FONA 2FO9A 2O8MA 2OUAA 4Z6AH 4YLUA 1YF4A 3GDUA 2RG3A 4A6LA 1C2EA 3AAVA 1GI7B 2WYGA 1S6FA 1G3DA 1GGDB 2FTMA 1W0YH 2XBYA 4MG3A 4WJG2 1C4V2 4CRGA 1FNIA 4K8YA 4NA9H 5L6NH 1G30B 2OBOA 4HI3A 3HK6B 1ZJKA 2M5TA 4UONA 3M7QA 1L1JA 1MTWA 1BHXF 5L2ZH 1O5EH 3QN7A 1P06A 1HYLA 2GD4B 2J2UA 2VIOA 3SU3A 3VGCB 4A1VA 4F49A 1SC8U 1TIOA 1SGEE 1ZPZA 1THRH 1MAXA 3UTUH 1BDAA 1MTNB 1V2WT 1IQFA 5H4IB 1IHTH 1MZDA 2UUKB 1KXBA 1GI1A 1KLJH 5GCHF 2QIQA 1QB6A 1O35A 4XE4A 2VJ1A 5HM9A 3R3GB 4Q2KA 1BRCE 2OC1A 1OXGA 2JH6D 3K65B 1O3MA 4D9QA 4J1YA 4ABHA 1SGNE 5LPFA 1JIRA 1ZMLA 1CU1A 1GHXH 2A7CA 1QA0A 3RU4D 1QBNA 4K1SA 3U1JB 4YZUA 1DWDH 1M9UA 1H1BA 1N8OC 1AMHA 2SGPE 4HFPB 4X1NU 1AQ7A 1F5KU 1HIAA 1LVYA 3K2UA 2Z3EA 3OTJE 5IDKA 5E2PA 5HXFA 2VB0A 2ZHQH 4X0WU 1CT0E 1O3AA 1UTMA 2G5VA 1K1OA 5JBAS 1BBRE 2BM2A 1UHBA 2BY8X 1GBCA 4AG2A 1BUIA 3B8JA 1LPZB 4BAHB 1FJSA 3DFLA 1TNHA 3ZVCA 4NIYA 1HAGE 2VVCA 3NUMA 1EPTB 1NESE 2A0QB 4BAMB 1TABE 1THPB 1HV7A 3HGNA 1Z71A 2F9UA 4ABGA 3SN8A 1TE0A 3H7OA 4KTCA 3KEEA 3KHVA 2A2XH 3NPSA 3OY5U 2FOEA 4KGAA 3TK9A 1G3CA 1SL3A 1WUNH 3GDSA 2NU3E 2AMQA 1C5PA 3BEFB 3SW2B 1O2VA 2DE8A 1AE5A 2P3TB 2ZECA 1GJ5H 3F1SB 3KQEA 4X6NA 3V3MA 1YPMH 1YPKH 1J9CH 1EUFA 4Y0ZE 4AFQA 1P2JA 2FOBA 1HAIH 1TGCA 5F8TA 2ZGHA 1ETRH 2ZFTA 4E06H 1PJPA 4FU9A 1BJUA 4X2YA 2H2ZA 1FAKH 1GHBF 1ZRBA 3FANA 4DOQA 3EDXB 2A45B 2IOTA 2P95A 1YP9A 3SOSA 3SU4A 5DO4H 1BA8B 2FS8A 3UQOA 2Y80A 1HNEE 1UK2A 4UD9H 3LJJA 2ZU4A 4YTAA 1QRWA 3ELAH 1A1RA 1GDNA 1C1WH 3MI4A 4AB9A 4XFQA 1S0QA 3E16B 3VB7A 2J95A 1ELAA 1C1RA 2G51A 1EP5A 4I31A 1C5TA 1TMBH 1V2ST 5EQSA 1NFYA 1FI8A 4AYYB 3AW1A 2W3IA 5DJ7A 2K1QA 2R3UA 4OS1A 3P8GA 1SGQE 1O2SA 3RLYH 1CBWC 3OX7U 3SGBE 3SZNA 1D3TB 2YOLA 3GICB 1QA7A 2HGTH 1QJ1B 1BQYA 3E91A 2ZU1A 1KYNA 4Q80A 1G32B 4IBLH 1UTLM 1QB1A 2I6SA 5FCRA 3T26A 2GGVB 3UOPA 3TLOA 2CHAB 1A0JA 1F0SA 1FY3A 1C2KA 1GJ6A 1P10A 2ZHDA 3PMJA 2H9EH 5FPSA 1AVWA 1TWXB 2C8YB 1HAXB 1T7CA 1DSUA 4CRBA 4Y7BA 4Y6DA 5GDSH 3SU5A 1QRXA 4VGCB 1O3FA 4NIWA 3TITA 3VFEA 6CHAB 3DA9B 4GSOA 4YM9A 1BRUP 1LPKB 2HNTE 3KCGH 4A5TS 3ZZCA 1C2IA 3GYMA 3RUOA 1C4U2 4JYVH 4TPYA 1HAZB 3ODDA 1QJ7B 4OGXA 3C1KA 1JBUH 4O3UA 1LDTT 1RTFB 6GCHG 2PLXA 2ZF0H 5A0CA 1XUKA 1O2XA 1TYNA 2PHBA 3S9CA 1BHXB 4U32A 2CJIA 1EQ9A 1LVMA 4WVPE 3U69H 3RXVA 2SNWA 2QXJA 2A7HA 1GVZA 1ARBA 1O2JA 1LVOA 1EJNA 1W13U 1TGBA 1YPGH 1FY5A 1RFNA 1EZXC 2BDGA 2AYWA 3GOVB 2BD3A 1HAVA 4I8LA 2FODA 4K2YA 3RXBA 1TNLA 1IQIA 3RXMA 1U6QA 2SGFE 1AUTC 4DVAU 1BTZA 1TRMA 1GI8B 1SGFA 1ZTLA 1NFUA 3ATMA 3GISB 1D6RA 1W8BH 3V12A 5ESBA 2XTTB 3NXPA 1ZGVA 3QZQA 2FTLE 1EATA 1W7XH 1MMJN 1AZZA 4B75A 3L33A 1UK4A 3A8BA 1GL1A 3V13A 2WPMS 1SVPA 3ATIA 4X2XA 1KIGH 5F03A 2VVUA 1A5HA 4CBOA 3RMOH 3GCTG 5DPAA 1BCUH 1TBQH 2BTCE 4CR5A 2WUBA 3TIUA 2PUQH 4ABIA 4ZKRU 3RM0H 1HXFH 1FIWA 1XVOA 1O30A 2H9TH 1P2QA 2XWBI 2BD7A 2C8ZB 2H1UA 3BTKE 3BTQE 3P95A 1GBKA 4Q7YA 2G4TA 5EXMA 4DW2U 2ZPSA 2B9LA 1L4DA 3LGTA 4BANB 3A8AA 1C5OH 1L1NA 2TPIZ 2ZDVH 1BTHH 1QL7A 3UFAA 1QNJA 3EA8A 3M5MA 3KF2A 2H5DA 1O5CB 1O36A 5EQRA 4DJZB 5DG6A 1BRAA 3VXEH 1V2PT 2AGEX 5LGOA 3BEIB 2XCFA 2Y6TA 1CE5A 1NU9A 1GBBA 1TNIA 1W3CA 3TH3H 4D7GA 1P3CA 2JETC 2WINI 5F6MA 1SG8B 2GZ9A 1O2WA 5A8XA 1YPLH 2XNIA 5JB8S 1SOZA 4X6OA 5C1XA 3HATH 1F0UA 3SUGA 3EGKH 4K8BA 2FESH 2F9BH 4FUFA 1UTKA 1OWKA 3LT3A 3SV8A 1PPCE 1P2NA 2AGIX 4JZFH 1SOTA 5TJXA 1ELVA 1J14A 3DD2H 1PQ5A 1TBZH 2ZO3H 1MTUA 5JBCS 1QBVH 3PWBA 1TA2A 3UY9A 3ZZ4A 1WOFA 3UWJH 3RXAA 2EI6A 2OP9A 2VVVA 4GCHF 1TX8A 3LU9B 1S6HA 1Z1JA 4NSYA 3RXFA 4A7IB 1O39A 1UTPA 2GDDA 2C4FH 2C90B 4WMEA 3LH3A 3FZDA 2ANYA 4ZKNU 5T3HA 1G2MA 5C2ZA 3T62A 1S5SA 4GVUA 2ZPRA 2FWWA 2CGAA 2ZFPH 3ODFA 2THFB 1SB1H 1MBMA 2F91A 2QXGA 2SGDE 1GJ4H 3AASA 1P12E 1O2KA 2ODQA 2W3KA 4ZHMU 3PLKA 4ZHAA 4GLYA 3RXDA 1NY22 1H4WA 2GZ7A 1O5GH 1B0EA 2P3FH 3ITIA 4K1TA 1ANCA 4CHAC 4FUIA 5ESTE 4QT8C 1N6XA 2UUFB 2J92A 1AFQC 5AHGH 1VGCB 2ULLA 3UREA 1AKSB 4MNXA 3UUZA 2XC0A 1AZ8A 1PPHE 1V2OT 3A8DA 1O2YA 4MNVA 3M3VA 1HFDA 1P05A 2F9PA 1GGDC 1AD8H 2O8WA 4DURA 3M3TA 2PV9B 1ARCA 1C2FA 1AI8H 4CRCA 1LQEA 2A31A 1TX6A 1DPOA 2VWOA 3KL6A 4CRDA 3PO1B 3D23A 1GJAB 1DWEH 2A7JA 3MNXA 3DHKH 1DUEA 2GCTC 2PFEA 5J4QA 2YNBA 4LZ1H 2FM2A 2GMTB 1J15A 4DY7B 2XC4A 1FV9A 1MTNC 1GMDF 1C5WB 3M36A 1CGIE 3UNRA 1GI5A 1XKAC 2G55A 1TX7A 3E1XB 3ZV8A 4UFEH 1YBWA 2OC8A 4FU8A 5GIBA 1GMHG 4BXSA 2BLWA 2XXLA 3E0NB 1SLXB 7ESTE 1WU1A 1CHGA 2EI8A 4NIXA 4SGBE 3P8NA 3TNTA 4OS5A 5C5OA 1NS3A 1V2NT 3VB6A 2ZTYA 2F9OA 1GHAF 1SGYE 2PWXA 3A85A 1O31A 3ZYDA 2ZFFH 2AERH 3BTDE 3NKKA 4AGKA 3LGVA 4AYVB 2PKSC 1GDQA 4RKOB 2AMPA 1AB9C 2HNTC 3RC4A 2Y5FA 1P0SH 3M3SA 3MU5A 1MCTA 1TLDA 1GJ7B 1H9HE 3ENSB 4Y76A 1C5LH 4DG4A 5BRRE 2HPPH 1TQ7B 3ZZ7A 1GHWH 1Y8TA 3BTFE 4FVBA 5A8ZA 3A7VA 1X7AC 2BDHA 1TALA 2OQUA 2ASUB 4YOGA 1FXYA 3SJIA 7GCHG 4AN7A 4NA7A 1A0HB 2Z9IA 1C2DA 5K7RA 1J8AA 1EPTA 1T8OA 3UNSA 1GBIA 3LGWA 5GWZA 1HRTH 3A84A 1FUJA 4B71A 1KLIH 1NC6A 4NIVA 1DICA 3TH2H 4JK6A 3P8FA 4I33A 3PTBA 1O2GH 3RXUA 1DXWA 1O33A 2ZDLA 2FOCA 2PKAB 2ILNA 3K6ZA 1SQAA 1O3CA 4PROA 4TPIZ 2P3UB 3JZ1B 5DK1A 2WV4A 3E6PH 3U98H 1ZMJA 2Z9LA 1FY1A 1RD3B 1EKBB 4YO9A 1C2HA 1K1MA 4UFFH 4BTTB 1PQ8A 1LHCH 1TNGA 2ZP0H 2STBE 1ZGIA 1SGCA 1SLVB 5EPNA 3QUMP 3A87A 1EOJA 1VITF 1BZXE 1ELEE 1ANEA 1Z1IA 2G5NA 3P17H 1NRQH 2GP9B 2VGCB 1G37A 2A1DB 4X2WA 4CREA 3SGAE 3SJ8A 2BD9A 2FXRA 1O3EA 4Y8YA 5FX6A 5DP3A 1CHOF 2XBVA 5FCKA 3F9EA 1PPZA 1DLKB 1MAYA 2WPKS 5I46H 4B73A 1QFKH 3C27B 3PTNA 3KQCA 3SQEE 5ABWA 1YPHE 1A4WH 3SO3A 3VXFH 1GVLA 1L1GA 1TPAE 2P93A 2VWMA 2ZA5A 1EAWA 2ZWLH 4OS4A 3SUDA 3U8OH 1FY8E 6LPRA 1LHDH 4NGAH 2ZDNA 4WXIA 1L2EA 3D49H 3RMLH 2CHAC 4U2WA 2AH4X 1IQJA 5JBBS 5JDUB 1FPCH 1OX1A 4NZQA 1TPOA 3NZIA 3T2NA 1ZSKA 1EJMA 5A0AE 2VIWA 4K60A 1C1OA 4AX9H 1E36B 3BIUH 1Q31A 1ESAA 1PQ7A 2IPHA 2WPIS 3K9XB 6CHAC 3A7TA 1K1IA 1O38A 2ZTXA 3TJVA 2HLCA 3ZVBA 1O3IA 2ZCLP 3SU2A 1DY8A 2FDAA 2HWLB 3NCLA 1GI3A 2ZI2H 1W14U 3SU0A 1QR3E 4OS6A 2VIQA 3CS7A 3ZV9A 1O5AB 1EZQA 3PLPA 3A7WA 1IAUA 4IMZA 1C1UH 1YCPK 2ZG0H 3LC5A 1F7ZA 1WCZA 1GCTC 2FOAA 5L30H 2GX4A 4ABJA 1H8DH 2FP7B 4AG1A 4B1TA 3QTOH 3MU4A 1O3JA 3SV2H 1RXPA 2HOBA 2PTNA 4ZXYH 1BT7A 1JIMA 1MQ6A 1GBTA 4NCYA 3A86A 1HJ9A 2GT8A 4ZHLU 1SMFE 1V2MT 1SLUB 4ASHA 1C5NH 5EG4A 3SV9A 3GCOA 2PUXB 1DDJA 4M7GA 1C4Y2 2Y7ZA 2H6MA 4ABFA 3LOXA 3AAUA 1GJ9B 1Y3XA 2UUJB 5HMAA 4E7NA 6GCHF 2O8LA 1NZQH 5EW2H 2Z94A 4I32A 1YPEH 1C5UA 3HGPA 2EI7A 3B23B 1QTFA 1C5RA 1ID5H 4Q7ZA 4NG9H 6ESTA 1W7GH 2NU4E 2SFAA 1RIWC 3IWMA 3PWCA 4WMFA 1TNJA 3SNEA 3RXHA 4GAWA 3SUFA 3U8RH 3GCHC 2ZFRH 3SI3H 3RXSA 1TNKA 2FX6A 3F9GA 1D9IA 1DUAA 4Y8ZA 4TY7A 1BTXA 3U8TH 1O3GA 1EB1H 3LIWA 3A89A 4H42U 2R0KA 2VIDA 1PPBH 2PGQB 3TJOA 1BTYA 4Y10E 3LC3A 3O8CA 1C2LA 2Y81A 2BVRH 5GCHG 1QCPA 2B7DH 5FBIA 1T4UH 2QCYA 1ELFA 1ZOMA 1YGCH 2VH6A 3PMHB 1FZZA 1OYTH 1Q2WA 1C2MA 4XSKU 1EAIA 3NWUA 1MCVA 1UVOA 3E0PB 5C67A 1WQVH 3PM3A 3DUXH 1AGJA 3ESTA 2W5EA 2OTVA 1UVSH