2JETC

Crystal structure of a trypsin-like mutant (s189d , a226g) chymotrypsin.
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
93
structure length
93
Chain Sequence
b'TPEKLQQAALPIVSEADCKKSWGSKITDVMTCAGASGVDSCMGDSGGPLVCQKDGVWTLAGIVSWGSGVCSTSTPGVYSRVTALMPWVQQILE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CHYMOTRYPSINOGEN B CHAIN A
publication title The Crystal Structure of a Trypsin-Like Mutant Chymotrypsin: The Role of Position 226 in the Activity and Specificity of S189D Chymotrypsin.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 12
structure length 93
sequence length 93
ec nomenclature ec 3.4.21.1: Chymotrypsin.
pdb deposition date 2007-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2jetC00
1C1PA 2XTTB 1O37A 1NU7B 1UK4A 1ABJH 1UCYE 1E37B 4AZ2B 2H9HA 3F68H 2P8OB 3P95A 1C5NH 3DD2H 1BBRK 2J94A 1W13U 1P06A 1V2WT 2GV7A 1GHBF 3MU1A 1SHYA 1TBZH 1O3KA 4YOGA 3UOUA 4ESTE 1UTMA 1NESE 2FTLE 1SI5H 4FUJA 3URDA 2BDAA 1W7GH 3PO1C 2QC2A 2TRMA 3LGTA 3ATIA 1UCYK 5DP6A 1RXPA 4UEHH 3A7XA 1FNIA 1ACBE 2BZAA 1O5FH 1ELEE 1TGTA 1UHBA 1EOJA 1O2TA 1DDJA 1XVMA 1TNLA 4Y6DA 5T6FA 2J4IA 1SBWA 5TCCA 2ZGBH 1GI7B 1TPSA 3A89A 4BTIB 4K1SA 3RMOH 1C4V2 2A2XH 3Q3XA 2CF9H 2OLGA 1K28D 2XC4A 1Z1IA 2BQ7B 2ZDVH 3UNSA 1UTLM 3NCLA 3PWCA 2IJOB 1N6YA 1NU9A 5EW2H 1TGSZ 2PR3A 4I8KA 1ELBA 4KP0A 3K2UA 1SLUB 1LO6A 1P05A 2GCTB 3BTFE 3VGCC 4IMZA 3T26A 3Q3KA 3F9FA 1NTPA 1M9UA 1TPAE 1AIXH 1ETRH 3SU2A 1Y3UA 1CHOG 1V2JT 1GWAA 1F0TA 1L2EA 2ILNA 4UFFH 3SUDA 1PPZA 2XCNA 1A1RA 1OYQA 3E6PH 3LC3A 1RD3B 6GCHG 5A8YA 2GCHG 3LKWA 1ZGVA 1DY8A 1DVAH 3LONA 2JH0D 1FAXA 1GI5A 4KTSA 2ZECA 1EATA 3Q3YA 1DWEH 4ISOA 4BANB 1WTHD 3SJOA 1V2QT 4NA8A 3RC5A 4VGCC 3NKKA 2ZHQH 4B2CA 1BOQA 3BEIB 5T6DA 4ZROA 2A7JA 2FOEA 1ELAA 6CHAC 2TPIZ 1AUTC 1OOKB 4IW4E 4NFEA 1GG6B 2ANWA 1X7AC 3JZ2B 2ODQA 2PV9B 3PM3A 4BTTB 1H8IH 2PKAB 2B9LA 1V2VT 3UNRA 1GMCF 1IQKA 1MTNB 1RFNA 1TNHA 3ENSB 2TGPZ 2AIPA 1EZQA 5T3HA 1LHFH 1LHDH 1ORFA 9LPRA 5K0HA 4ABEA 5JBCS 4GCHG 4YLQH 1TQ0B 2QYIA 2ZGCA 1YPEH 2BD8A 1O36A 1GJCB 1O2NA 4D9QA 1N1LA 2BMGB 1DXPA 1JWTA 2Z3DA 5IDKA 4WY3A 1GVZA 2DE9A 1C5MD 2ZEBA 2BHGA 1BDAA 1TPPA 2Z9JA 1CT4E 1C2DA 2PGQB 1FIZA 4JZIA 3SNAA 4AG1A 2P16A 1ZOMA 4I32A 2BY6X 1H8DH 1UTPA 2OQUA 2ZFSA 1C4U2 2CJIA 1KXBA 1O2VA 4E06H 4RSPA 2ODYB 5E0GA 3KGPA 2QA9E 2WPHS 4OS6A 3CS7A 1D3QB 5EGMA 1QL8A 4X1RU 4K69A 1WCZA 5J4QA 3E16B 3WY8A 3GCNA 3E3TA 4Y10E 1BCUH 2BDIA 3UR6A 1HAOH 1CU1A 1ZSLA 8KME2 1G3CA 1J15A 2A4RA 3KN2A 2GT7A 3SUEA 1BQYA 1O2GH 3FFGA 1ZRBA 1TNGA 4OS7A 5TCAA 1W10U 2A7CA 1K1NA 1INCA 1OP8A 4NA7A 1SLVB 4Y0ZE 1DSUA 3BG4C 3SJ8A 2VGCC 1HNEE 2FX6A 1CA0B 3LT3A 1GHWH 2C8XB 2Z94A 3VB3A 4ZKNU 2JETB 1TAWA 2PUXB 1QGFA 4QT8C 5A8ZA 1O2JA 2ZU5A 4JK5A 1VITH 1GJ8B 1UTOA 5FBEA 2ZDAH 1O2IA 1GHAF 1VZQH 3Q00A 4I8GA 1GI3A 4YESB 2VVCA 2F9UA 5DKMA 3H5CB 1K1MA 2GDEH 1RJXB 2ZHWH 4MG3A 1C2MA 1SGTA 1YLCA 2HOBA 5I46H 1TLDA 4UD9H 3JZ1B 1V2MT 4WH6A 1D3PB 4YT7H 1UVPA 3SI4H 7ESTE 1Y3VA 1MU6B 3BV9B 1Z71A 2HPQH 1YCPM 4MNYA 3A84A 2ZGJA 4JZEH 2FOAA 5E0JA 1C1VH 2F3CE 4FUHA 1YPLH 4Q2KA 4ZH8A 3SU6A 5GCHF 1O2HA 2A4GA 4Q80A 1TYNA 1YPHC 4NA9H 2OCVB 1KIGH 3TVJB 1NN6A 1DM4B 1Z7KA 3M61U 5FX5A 1RTFB 3T28A 1HCGA 4X1SU 1GBEA 3SO3A 1WTGH 2VB0A 2OC7A 1S81A 2JH6D 2HVXA 2PGBB 2BY9X 1BZXE 3G01A 3GCOA 3FAOA 4Y76A 2HLCA 2H9EH 3TLOA 1FN6A 2P95A 4MDSA 2WYGA 5L2ZH 1AFEH 4Y7BA 1NT1A 3TJVA 3U8OH 5JB9S 1A0JA 1SGRE 1T8MA 3MU8A 3LGIA 2FP7B 1KLIH 3GDVA 3V0XA 2V0BA 5DK1A 1OX1A 2PTCE 1SVPA 2A2QH 2VIPA 1G2MA 4NCYA 5DP7A 1LDTT 2QN5T 5FCRA 3M5OA 2PKSB 2OP9A 1V2LT 3EA7A 1W0YH 2A45B 3F1SB 1T32A 2G4TA 1TNIA 1XKAC 1KLTA 3M7TA 1O2ZA 3E0PB 1MKXK 1GGDC 1SGCA 2AGGX 3HKIB 3LJOA 1CBWC 1G3EA 1CVWH 1ZTJA 3V7TA 1FPHH 1MKWK 1O5GH 3SHCH 4Y71A 1MTWA 3UOPA 3KQEA 3GCHC 1ESAA 2XNIA 3A7TA 3O8RA 1O3GA 4X8TH 1QL7A 4SGBE 3K65B 2VNTA 2BY5X 1KSNA 2Q6GA 1PFXC 3T27A 5A0AE 1C9TA 2GZ8A 5TJXA 1UTKA 4FUCA 3OY6U 3RM0H 4DW2U 3QO6A 4FU9A 1ANCA 4CR5A 3A86A 1NFUA 1V2PT 4FUEA 1DWDH 2AERH 2H6MA 2ZTYA 2BDBA 1TRYA 1GJ4H 2W26A 1UCYH 3TJUA 3SU0A 2Z9GA 2FOBA 2F9OA 2JKHA 3A8AA 1G3DA 4XBCA 3ZZ3A 1TPOA 1K22H 4ASHA 2Z7FE 1GJ9B 4UE7H 3QDZB 1W14U 1XX9A 1MD7A 2C8ZB 4B75A 1P2JA 1TMBH 2XRCA 1DS2E 1JOUB 4LOYH 2OC8A 3T62A 5PTPA 1TNKA 5C5OA 1EPTB 1O3OA 2OC0A 2ODPA 1C1OA 2Y6TA 1GHVH 2AMQA 1JMOH 3VB6A 2Y7ZA 3A85A 2HPPH 1LHEH 2XC0A 1EQ9A 2EA3A 1GI4A 1HAIH 3GCTF 1LHGH 1A61H 1MZDA 1EPTA 5DJ7A 3SV9A 1A5GH 1C5QA 1VGCC 3QGJA 4FVBA 1JXPA 2B8OH 3AASA 1C1UH 2SGPE 4R0IA 3OYPA 3NUMA 1HUTH 4XBDA 1RIWC 1PJPA 1P12E 2Q6FA 1C5WB 3RXBA 1GVKB 3QTOH 2FWWA 5ESTE 4GLYA 7GCHG 4X6NA 1P01A 3KL6A 4Y8XA 1C2GA 4I7YH 3SGBE 5AFYH 4Z6AH 4U01A 2BD7A 1W12U 4INHA 3S0NA 2WYJA 1WQSA 3VXFH 1YPJH 3MFJA 4ISLA 1EP6A 1SG8B 3KF2A 1K1LA 1RGQA 1DOJA 3OX7U 1OXGA 4YOJA 2C3SA 1AHTH 2LNCA 4IC5A 3KQCA 3KCGH 3OSYA 1JBUH 5LH8A 2XYAA 1ZMNA 5GXPA 1AKSB 2ZHFH 4K3JA 1SLXB 3SOSA 1YPGH 3A8CA 4NZQA 2XC5A 2O8LA 2BQ6B 1O39A 1NROH 5EODA 1F7ZA 4OGXA 5HGGA 1GHXH 1TBQH 1UK3A 1S6HA 3SJ9A 1V2KT 1XUKA 1AKSA 5EXLA 1GHZA 3RU4T 1HV7A 4GUXA 3TJOA 1HLTH 4LZ1H 1NZQH 2OUAA 1O5DH 4I8HA 1XUHA 1F0UA 4YT6H 4BNRA 1V2OT 2VINA 4DIHH 1SGQE 3V3MA 1FAKH 3ZZCA 4R8TB 3SV2H 4E7RG 5GJ4B 2HRVA 2PTNA 1AVGH 3GISB 2ALVA 3HKJB 1YYY1 1TX7A 1FUJA 1IQGA 3RXTA 1H4WA 1YC0A 3MMGA 3FANA 4CBOA 2D1JA 1E36B 3OU0A 1OWHA 2ZTXA 2GMTC 2Z9LA 1FY1A 4X1PU 2UWLA 4WMDA 1HJ8A 2FX4A 1BHXF 1FI8A 1GMHG 1W3CA 2F9VA 3KIDU 2BVRH 5BRRE 5F8TA 2ZPSA 1NRSH 5C67A 3M7UA 8GCHG 4IC6A 3S9BA 2GD4B 1TRNA 1Z8RA 1ANEA 3SQEE 1HFDA 1OS8A 1LPGB 1HXFH 1AI8H 1JIRA 2NU4E 4CHAC 3ODFA 1Y5AT 2AH4X 3MI4A 3BTWE 1FIWA 4Y8ZA 1C9PA 3QZQA 4CRCA 1BBRE 1BMLA 2ZQ2A 2XBVA 1O2XA 3MTYA 2B0FA 3KQBA 4OS4A 1SGNE 1YP9A 4X6MA 1XUGA 2Y7XA 4FUDA 4IMQA 2C8WB 4JYVH 1SGFA 4AGKA 1PYTC 3TNTA 1GBIA 5H4IB 4WXVA 1T4VH 1GCDA 1JRTA 2FOHA 1AE5A 1AB9B 2Y5HA 1ZJDA 3SNDA 1FQ3A 3AAVA 2FZZA 3E8LA 1H1BA 5EU8A 1Z6JH 1NPMA 1QB9A 1O2QA 3R0FA 1LKAA 5CHAC 4I8JA 3RXIA 4AFUA 4D7FA 4AX9H 2BB4A 2W5EA 3SNBA 3SU3A 1UHBB 4A1VA 2FIRH 1BTUA 2BD2A 1BJVA 1B0FA 3DFJA 4GAWA 2C93B 3LJJA 5JPMH 3RXLA 4KTUA 5FXLA 4AG2A 1GVLA 3TH2H 1G32B 3SJIA 3RXJA 1SC8U 1Z1JA 1NY22 1BTYA 2ZFPH 3GY4A 3SZNA 2SFAA 4D8NA 1YPHE 2AGIX 3W95A 4X6PA 4BAMB 4KTCA 2ZCHP 4X1NU 3VB7A 3SHAH 1IAUA 1MTVA 1P0SH 2XBWA 5LPEA 3BTME 1QQ4A 2OQ5A 2TGAA 3P8GA 1KXDA 1ZJKA 1DUAA 5FPSA 2BD9A 1DLKB 1THRH 1EAWA 2YNAA 2G5VA 2GV6A 4AFZA 4ZXXH 2W3KA 4JYTA 2ZZUH 1KDQA 2B7DH 3M36A 4K8YA 1P2NA 1BRUP 3E0NB 1NO9H 1RRKA 2SGEE 1P04A 3SV6A 4AYVB 3RXOA 3LDXH 1TFXA 3V13A 4DIIH 1GBLA 5LPFA 1BRBE 1SGIB 1P03A 3V12A 1GI9B 1YLDA 4AN7A 1SQAA 2P94A 4JZDH 4DURA 5GDSH 5DO4H 5DG6A 5J4SA 1OWDA 2WINI 4FUFA 1D6RA 2FEQH 4WH8A 5A8XA 1VITG 2ANMH 1C2JA 1Y59T 1A46H 1Z8GA 5EW1H 1LVBA 1UK2A 2R9PA 1EAIA 1GI0A 2IN2A 2P3FH 1GBCA 1C1QA 4XFQA 2PSYA 2Z9IA 5GIBA 1IQLA 1ZPBA 1E34B 3PLPA 2HGTH 3GY7A 2QXJA 3EDXB 3R3GB 4YTAA 1EJMA 1W2KH 3DUXH 3MNXA 1C5ZB 2Y5FA 1ZSKA 1KXFA 3P17H 2FI5E 2Z6BD 4LZ4B 1SGEE 3SN8A 2AFQB 1IQMA 3QWCH 1F0SA 2ZWLH 1S5SA 1DY9A 3PTNA 3RXGA 2ZI2H 4ABAA 1GPZA 3SNEA 5FCKA 2AIQA 2VWMA 1LVYA 2QXGA 5L30H 1Y3YA 2KAIA 5I25A 3O8DA 1WBGB 2B5TB 1LTOA 1DWCH 2CHAB 2ZP0H 2EC9H 1YPKH 2G52A 4Z0KA 4DVAU 3Q76A 1B0EA 2V3OH 1WAYB 2J95A 1WQVH 1FZZA 3MU5A 1C1SA 1O3AA 5E8EH 1C2LA 1ZTLA 1K21H 4Y7AA 3EGKH 2VH0A 4BTUB 5JBAS 1SR5C 5HM2A 3BTDE 1O3BA 3K6ZA 4OS2A 1SPJA 3ATWA 1LPKB 2ESTE 2Y81A 1GJDB 3BEUA 3ZZ4A 4Y8YA 1MMJN 1HJAC 1P2MA 1QJ6B 4MNWA 4UFEH 4ABGA 1GJBB 2EEKA 2UUJB 3BF6H 5FHTA 3RUOA 2FMJA 3F9HA 5FX6A 2EI8A 4FUGA 4NIYA 2UUFB 3RXDA 1QBVH 1GHYH 5JBBS 1YCPH 2FYRA 5DGJA 2VVUA 4TPYA 5G4BA 1KXAA 2STBE 3U1IB 1K1OA 1AU8A 3Q77A 4YLUA 1CHOF 2ZPQA 4D76A 3LGVA 2BOHB 2QY0B 4X8VH 1Y5UT 3ZVFA 6GCHF 4B74A 1NFYA 2GCHF 2A4OA 2AMDA 1O30A 1EAXA 3A87A 4K8BA 1PQAA 1GMDG 1V2NT 4AFSA 3RXEA 1N8OC 2J92A 4MNXA 1AFQC 1LPZB 4WXIA 3QUMP 4ABBA 4A5TS 1L1GA 6ESTA 1NC6A 2IPHA 2LPRA 1IOEA 3OY5U 3U1JB 1UTQA 2QF3A 1D3TB 1MH0A 1E38B 3M7QA 1LQEA 2BY8X 2GP9B 1E0FD 2QXIA 5C1YA 4WF8A 5AHGH 3F9GA 4B2BA 1CQQA 4IN2A 2CF8H 5LGOA 2ZGXH 3PV4A 1CT2E 2ZFTA 3PWBA 1FJSA 2UUKB 1D4PB 1A3EH 1L1JA 1WU1A 3BTHE 2WPKS 3K9XB 1VCWA 1PPBH 1Q2WA 1KXEA 3PYHA 4U32A 1Z8JB 4MTBA 2FDAA 3I77A 4NSVA 3A8BA 3ZYDA 3M3TA 1GBKA 1KY9A 1FMGA 1THSH 1W8BH 4YOIA 4KELA 3STIA 3TGIE 1O2WA 5JDUB 1EB1H 2THFB 1ZHRA 3L33A 2HNTF 4MPWA 4GCHF 2FYQA 3A82A 1HJ9A 1DUEA 3L6PA 1F5LA 1QA0A 1GCTB 1WYKA 1GI2A 1MZAA 1LHCH 4A1XA 1OYTH 4MNVA 2W7SA 1SGFG 3MWIU 1BTWA 1C1WH 3BTEE 4XBBA 1QL9A 3S9AA 3P8NA 3ZV8A 1P10A 2Z9KA 2BDCA 3I29A 4DT7B 4FU7A 4AFQA 2P59A 1D9IA 1QB1A 4X1QU 2PW8H 3VEQB 3PO1B 1UTNA 2NU3E 1A2CH 1P11E 1J17T 4X0WU 3P8FA 1GBTA 1K1PA 1QB6A 1SGDE 4U30A 1ARCA 2RA3A 2BLVA 1V2UT 3ZVDA 4CRBA 1AWHB 2ZCKP 3BN9A 3A7VA 3T25A 3MO6A 2GTBA 1O3DA 3BIUH 3RXFA 2ZCLP 1J9CH 3MU4A 3T29A 3SU5A 1T7CA 4X2VA 3FZZA 1V6DA 2P8OC 3MNBA 1SOTA 3PLBA 1T8OA 3IG6B 3M5LA 4CRFA 5EOKA 1C5TA 1OKXA 2NWNA 3ZYEA 3TPIZ 4WMFA 3PTBA 1ID5H 2ZHEH 3URCA 1BMAA 1UJ1A 3SW2B 2ZIQH 3TITA 1QRXA 5AVDA 4RN6A 3RXHA 5FBIA 1GDQA 2VVVA 3FP6E 3SUFA 3UR9A 2RCEA 1BUIA 1F92A 3ATKA 2BM2A 1AN1E 1LCYA 3NK8A 3VGCB 4ISHH 3LGWA 1BBRH 3IITA 1DFPA 1MCVA 1TGBA 2RDLA 4CR9A 1FXYA 1SL3A 4ZXYH 3F9EA 1A0LA 3GICB 3RXQA 1DITH 1KLJH 3ZV9A 1TB6H 4BOHA 2VIVA 1EP5A 2PLXA 1C1TA 1GBDA 1SFIA 5C1XA 1BT7A 1ANBA 2ZPRA 3SGQE 1NFWA 4XSKU 1GBJA 1S85A 3A80A 1EUFA 1G36A 4BAHB 4VGCB 3QGNB 3BEFB 3KNXA 1QY6A 1O2LA 2GCTC 1L0ZA 6CHAB 1GJ5H 1TBRH 2EI7A 2VWOA 1L1NA 1BJUA 2VIOA 4HFPB 4ABDA 1HAZB 3ELAH 1F5KU 1A3BH 1T31A 5C5NA 1BRCE 2ALPA 2QXHA 1PPFE 1HIAA 4DOQA 1CO7E 2ASUB 1AO5A 1TNJA 5C1UA 1CE5A 1JIMA 1C5VA 4LXBH 3BTTE 4ZKOU 2BY7X 1FY8E 2WPLS 1C1NA 3DA9B 9ESTA 2O8UA 3EYDA 4TYDA 1SQTA 2HWLB 3PB1E 1T8NA 1G37A 1O2RA 1TGNA 1QNJA 1PQ7A 4ZHMU 2CXVA 1KYNA 1UVOA 1F2SE 2RG3A 1DE7H 1EJNA 1GG6C 5FPTA 2W7UA 3T5FH 1C2KA 3QZRA 1DPOA 1PPGE 1CGJE 1F0RA 2Q1JA 3SJKA 3UQVA 4UFDH 1FV9A 2J34A 3RXSA 1ZR0A 1MTNC 4B2AA 1OWIA 1PYTD 1HXEH 2D8WA 5EQSA 1ZRKA 3RC4A 3SI3H 1H9IE 4ISIH 3SUGA 2NU2E 2ZFRH 2A31A 1RS0A 4Y0YE 1EOLA 1ZHPA 1AMHA 1J16A 3GYMA 3ZVAA 1BTHH 1CGHA 5DPAA 3TIUA 3F6UH 3UIRA 2GGVB 4CH8B 1FY3A 2QCYA 2BTCE 1SQOA 1CGIE 3NZIA 4NFFA 1FLEE 1K2I1 3EAJA 3BG4B 1C5RA 2VGCB 1QHRB 3E91A 5FAHA 1DT2A 1GHBG 2Q6DA 3BTGE 1P9SA 3FVFB 1ESBA 2WV5A 5DP8A 1S6FA 2Y82A 3ZZ5A 4BAKB 1ZPCA 3RLWH 1FPCH 5EXMA 4X8SH 2TIOA 4NIXA 3UY9A 1P09A 1GDUA 4OGYA 1G30B 2C8YB 2V6NA 4CRAA 2F9BH 1GDNA 2UWOA 3MNSA 1MAXA 1GI8B 1AY6H 3ITIA 1VCPA 3MO3A 3RP2A 1HB0B 4J2YB 2I6QA 4A6LA 3PMAB 3STJA 1H9HE 1BMNH 3CP7A 1SHHB 5EQRA 3GY2A 1GL1A 4HTCH 1OWEA 4BAOB 4K5ZA 2A4QA 5ABWA 5ETXA 1AQ7A 2BYAX 2UUYA 4J1YA 1LKBA 3E90B 1EKBB 1O3IA 1AZZA 1CA0C 1W7XH 1C1MA 2GDDA 1QJ1B 2JETC 2SGQE 3GY5A 3LGUA 3U98H 2FM2A 1Q3XA 4GVUA 4JK6A 1SGYE 3RLYH 1SSXA 1LVOA 3PMHB 1EZSC 1PQ8A 2BLOA 2NU0E 2PUQH 1C4Y2 3AW1A 3E1XB 4I33A 3C27B 3GYLB 4NGAH 3UTUH 2BQWB 3SU4A 3M5MA 1L4DA 1EZXC 1OP2A 3VPKA 2K1QA 1O2MA 4H42U 3RDZA 5JYIA 3ATMA 1IHTH 2VIWA 1AVXA 3A8DA 1XVOA 7GCHF 1BTXA 3ESTA 2FXRA 1EASA 5JB8S 1YKTA 5F8ZA 1HYLA 3BSQA 3P70B 4CH2B 3GY3A 3TNSA 1VCQA 1ZZZA 1HAHH 3TGKE 2BDHA 3KHVA 3TK6A 1C5SA 1LVMA 4O03A 3TJNA 4K2YA 1S83A 1K1JA 1S84A 1Y5BT 1O3PB 3DHKH 2BLWA 3ATLA 5EPYA 2BLQA 4U2WA 1C2FA 2VJ1A 3BG8A 3I78A 1YF4A 3RXMA 1QTFA 1D3DB 1ELCA 1AE8H 1EB2A 1WSSH 3HGNA 2FPZA 1O2UA 3SV7A 1MBQA 1UO6A 2QIQA 2QGRA 2ZO3H 2XBXA 2QAAA 1C2IA 1P9UA 1NS3A 1CSOE 1PQ5A 2AYWA 1MD8A 1GGDB 1LQDB 4Q7XA 1EAUA 1CBWB 1GBAA 4BXSA 4RKOB 1YBWA 1GMCG 1VJAU 4KKDA 4F4OC 4ISNA 3EA8A 1O3CA 4JMYA 1C5XB 4Q7ZA 3GCHB 1P3CA 2BX4A 2IOTA 1KDQB 1HDTH 3EE0B 3OTJE 4RKJB 2SNVA 4MPVA 1BIOA 4WWYA 2G4UA 3SORA 5DP9A 3AAUA 2O8MA 1A7SA 2ZDNA 3ZVEA 4D9RA 2PKSC 2R3UA 4X8UH 3M37A 1ELFA 1THPB 1QR3E 1QRZA 2VIQA 1TRMA 1C5UA 3RXVA 1IQHA 1Z6EA 2BZ6H 2BD5A 2G5NA 2M5TA 3U9AH 1UTJA 1OP0A 1AWFH 3M3VA 3UUZA 4IBLH 3CS0A 4MLFB 2BXUH 1HAVB 1GMHF 3NPSA 2XWBI 3BTKE 3VFEA 1QJ7B 3SQHE 5C3NA 2AS9A 5JBTA 1GBFA 4FUBA 2ZGHA 1O3EA 1N6XA 8GCHF 1T4UH 1S82A 1NRPH 1MKXH 1EXFA 1UVUH 1O31A 2VWNA 1O3FA 3PMBB 1TA2A 1HAVA 2ZU3A 1ETTH 1MKWH 1ZSJA 1SB1H 1W11U 1ZTKA 1AZ8A 1GJAB 4A92A 1EJAA 1GBBA 1C1RA 4FU8A 5A2MH 3L3TA 3RMLH 2FOMB 3GY8A 3IWMA 4THNH 3UNQA 4K1TA 1ZYOA 3RU4E 2ZU4A 4Y79A 2SGFE 2A5IA 3UPEA 1V2RT 3RM2H 1DSTA 4M7GA 3VXEH 5ESBA 1AVWA 1L4ZA 1VGCB 2KAIB 4NZLA 1O3HA 1QRWA 5AF9H 1K9OE 4NWLA 1P2QA 1TIOA 1JRSA 2YNBA 1HAGE 3TGJE 2F9NA 2QV1A 1BHXB 5HXFA 4A1TA 1TQ7B 1RIWB 3NXPA 1ZGIA 5K7RA 2NU1E 1GHAG 3ZZ7A 2AGEX 1EPTC 3SNCA 4AB8A 1Q31A 4B71A 2STAE 1G2LA 2BXTH 1GI1A 2OD3B 3B23B 2AEIH 4FXGH 1OPHB 3B8JA 3UWJH 5DP4A 2BDYA 2J9NA 3LOXA 2ZU1A 2D2DA 2H5CA 4Y11E 2SNWA 3ZVGA 2OBQA 3MYWA 1BA8B 2R0LA 2G81E 5T6GA 2H2ZA 2A5KA 2HNTC 4CREA 5GCHG 4TY6A 5DP3A 1TALA 1ANDA 4ZHLU 3P92A 8ESTE 3ZZDA 1OSSA 4O3UA 1O2PA 3A7YA 1BTPA 3MH7A 1HAYB 1GL0E 2PKAA 3UWIA 4D7GA 3KEEA 2VWLA 1ZHMA 4ZUHA 1ESTA 2P3UB 1QA7A 4SGAE 4BXWA 1BTZA 2CV3A 4AOQA 1J8AA 3MHWU 2F83A 4INLA 3SBKA 2FESH 2OTVA 3TH3H 1IQJA 3MH6A 1O3LA 3HPTB 2BD3A 4O3TA 5E2PA 5BPEA 1C5LH 2OBOA 4X2YA 1GBHA 2ULLA 2PWXA 4DGJA 2G8TA 2EI6A 2FLBH 4F49A 3BIVH 3C1KA 2H1UA 4ZAEA 4NG9H 3DFLA 1O32A 1TMTH 2OINA 2ZTZA 2BD4A 2W3IA 2WPIS 3RU4D 1FONA 2WPJS 2PHBA 1O5CB 1TE0A 1P8VC 1VITF 4O97A 4XOJA 2DE8A 2XW9A 1O3NA 1QIXB 3QK1A 2WV4A 3MNCA 1MCTA 1CHGA 2PFEA 1MTSA 2ZHDA 4FUIA 1C5OH 3RXKA 5GPIB 4AB9A 5GWZA 3TK9A 1MUEB 1QBOA 2GMTB 1NRRH 4JCNA 5HM9A 2GT8A 5L6NH 1G9IE 3EQ0H 4HZHA 1OWKA 3MU0A 3SGAE 1C5PA 1IHSH 1O5EH 1RTLA 4I8LA 3A7WA 4MQAA 2ANKH 3PROA 1ZMJA 1ZPZA 4UONA 2FOGA 1FN8A 4B1TA 4BAQB 2ZU2A 4CHAB 2A0QB 1NM6A 5HMAA 3LH3A 3ZVBA 2G51A 4IN1A 1WV7H 2V35A 1EZUC 5SGAE 1O2KA 1PPEE 3SU1A 3KQDA 4ABIA 1SOZA 1U6QA 5DP5A 2XBYA 2ZFQH 4MPUA 1ARBA 2J2UA 3ZZ8A 4B73A 5EXNA 3PLKA 1O0DH 3BTQE 2R0KA 1ABIH 3CENA 1IQNA 1A0HB 1DICA 3VB5A 1IQIA 1H9LB 2TGDA 4H4FA 1HAXB 2UWPA 4Q7YA 1TABE 3S69A 4H6SB 5C2ZA 5F03A 2ZDKA 1O38A 3RXAA 4JZFH 4TPIZ 2FO9A 1TWXB 5CHAB 3MH4A 2OXSA 4CRDA 5E0HA 1HPGA 2FODA 3M35A 4GHTA 1RTKA 3GCTG 1GJ7B 3RMMH 1P2IA 1VR1H 2ZDMA 2P3TB 4GSOA 2AMPA 4INKA 2A5AA 4OS5A 4TWWA 1C2HA 1J14A 1O5BB 1Y8TA 3FP7E 1BB0B 3M5NA 2R2WU 1TA6A 4K1EA 4NIWA 2QF0A 2GVFA 1AB9C 3AVZA 1G3BA 2ANYA 1OWJA 1O35A 1TX6A 5A0CA 3O8CA 4GHQA 1IQEA 4H6TA 2P93A 2ZQ1A 3LPRA 4TY7A 1P2OA 2DUCA 2V3HH 5EPNA 2FLRH 3D62A 4K60A 4X6OA 3HATH 4E7NA 1GMDF 3RXUA 1MTUA 1KTTB 1GJ6A 3ZVCA 3RXPA 4A7IB 3A81A 1NRQH 1XUIA 2Y5GA 3M3SA 2CMYA 2CN0H 2Z3CA 1Z8IB 4DG4A 3LU9B 5B6OA 4IGDA 4DY7B 2ZC9H 1WOFA 5CE1A 1EX3A 2BVXH 4OS1A 1FY5A 5AFZH 2ZG0H 1MBMA 3FP8E 2G00A 4NWKA 4AORA 2C90B 3MOCA 1O2OA 3QN7A 1O34A 1TX8A 2FS8A 3U8TH 8LPRA 1PPCE 1Y3XA 5A0BA 3GDUA 3QX5H 4X2WA 1V2TT 1DWBH 3P8OA 1K1IA 1B7XB 1UVSH 2ZNKH 1NFXA 1XXFA 3P6ZB 4PROA 1D6WA 2WUBA 4KGAA 3S7HB 1BITA 3LH1A 4TWYA 1P02A 4MVNA 1TOMH 2FS9A 2ZKSA 4DJZB 1HIAB 2OC1A 1TMUH 1QURH 4FVDA 5EG4A 1QCPA 2ZA5A 2BX3A 1O5AB 4WJG2 1CT0E 3TH4H 4ZHAA 1S0RA 2GX4A 1SGPE 3SV8A 1DX5M 2A1DB 6LPRA 1FY4A 4HI3A 2O8TA 4NSYA 1ELTA 4CRGA 5C20A 3ZZ6A 5F6MA 4CBNA 1PPHE 2BDGA 5HYOA 1C5YB 2WUCA 1MQ5A 2ZF0H 1ETSH 2ZDLA 4WVPE 1AD8H 4YZUA 2H9TH 1KXCA 3T2NA 3GOVB 1O3MA 3HK3B 4YM9A 1XM1A 1A4WH 1LMWB 1UVTH 1E35B 4E05H 2FI4E 3HK6B 3D49H 1QQUA 3RC6A 3RXRA 2ZFFH 2J38A 2TBSA 2F9PA 2FTMA 1P2KA 4GPGA 1AUJA 3UREA 2O8WA 1HJAB 1WUNH 1B5GH 1YCPK 1SMFE 2SGAA 3GDSA 5A09A 3PMJA 4UDWH 5EQQA 2CHAC 1XMNB 1UMAH 2YOLA 3HGPA 2JH5D 2XCFA 2RA0A 3U8RH 2FOFA 3ZZAA 1IQFA 3A88A 5CMXH 1AGJA 3MH5A 2BOKA 3EA9A 4AYYB 4AGJA 2WPMS 1W0ZU 4ABHA 3MO9A 1NRNH 3UFAA 3DT0H 3O8BA 2VIDA 4XE4A 3RMNH 4I31A 2I6SA 1ZLRA 3ODDA 1QBNA 1TOCB 2G55A 4MPXA 2TGTA 3FZDA 1HGTH 1QFKH 1V2ST 5IYTA 1T8LA 3A7ZA 1ELGA 2GZ7A 3B9FH 4B76A 1YGCH 2C4FH 4UFGH 4X2XA 1BMMH 3W94A 1XKBC 4HGCA 1N8OB 1ZMLA 1AFQB 2F91A 3GY6A 1O33A 4LK4A 3U69H 3H7TA 4XDEA 3D23A 3S7KB 1ELDE 2XWAA 7KMEH 3VB4A 2R3YA 7LPRA 1XXDA 2HNTE 1GBMA 3H7OA 2H5DA 3QTVH 3UQOA 2Y80A 3S9CA 1XUFA 2FI3E 2O9QA 1C2EA 1ELVA 3NWUA 1P3EA 3QLPH 1A5IA 2VU8E 1SFQB 2BVSH 4ZKRU 1MAYA 4JYUH 1O2SA 1TONA 1F5RA 3TU7H 1SLWB 3N7OA 2A7HA 5L2YH 1GI6A 2FOCA 3LC5A 3A83A 1DXWA 1HRTH 3ZZ9A 2XXLA 2GKVE 5FPYA 1MQ6A 4ZMAH 1P57B 1A5HA 1YPMH 1DANH 3K6YA 3RXCA 2Z3EA 1KTSB 5LPRA 2HALA 1O3JA 3LGYA 1V3XA 2CGAA 5F8XA 1CA8B 3LIWA 4ABJA 4O9VA 3AW0A 4YO9A 2GZ9A 4DCDA 1BRAA 5E2OA 4NIVA 1HAPH 1DLEA 1HBTH 4WMEA 2SGDE 2PSXA 3ZZBA 4IS5A 2D26C 4ABFA 1FDPA 1O2YA 4ZKSU 2A32A 1VJ9U 3TK5A 1MU8B 2VH6A 1YM0A 1TGCA 1XUJA 2R2MB 4JZ1A 1GCTC 1Y3WA 3D65E 1S0QA
chains in the Genus database with same CATH superfamily
2KZ4A 1C1PA 2XTTB 1O37A 1NU7B 1UK4A 5DSFA 1ABJH 1UCYE 1E37B 4AZ2B 2H9HA 3F68H 4Q63A 2P8OB 3P95A 1C5NH 3DD2H 1BBRK 2J94A 1W13U 1P06A 1V2WT 2GV7A 1GHBF 3MU1A 1SHYA 1TBZH 1O3KA 4YOGA 3UOUA 2KX4A 4ESTE 1UTMA 1NESE 2FTLE 1SI5H 4FUJA 3URDA 2BDAA 1W7GH 3PO1C 2QC2A 3OEED 2TRMA 3LGTA 3ATIA 1UCYK 2EY4C 5DP6A 1RXPA 4UEHH 3A7XA 1FNIA 1ACBE 2BZAA 1O5FH 1ELEE 1TGTA 1UHBA 1EOJA 1O2TA 1DDJA 1XVMA 1TNLA 4Y6DA 5T6FA 2J4IA 1SBWA 5TCCA 2ZGBH 1NBMD 1GI7B 1TPSA 3A89A 4BTIB 4K1SA 3RMOH 1C4V2 2A2XH 3Q3XA 2CF9H 2OLGA 1K28D 2XC4A 1Z1IA 2BQ7B 2ZDVH 3UNSA 1UTLM 3NCLA 3PWCA 2IJOB 1N6YA 1NU9A 1SKYE 5EW2H 1TGSZ 2PR3A 4I8KA 1ELBA 4KP0A 3K2UA 1SLUB 1LO6A 1P05A 2GCTB 3BTFE 3VGCC 4IMZA 3T26A 3Q3KA 3F9FA 1NTPA 1M9UA 1TPAE 1AIXH 1ETRH 3SU2A 1Y3UA 1CHOG 4RT1A 1V2JT 1GWAA 1F0TA 1L2EA 2ILNA 4UFFH 3F3BA 3SUDA 1PPZA 2XCNA 1A1RA 1OYQA 3E6PH 3LC3A 1RD3B 6GCHG 5A8YA 2GCHG 3LKWA 1ZGVA 1DY8A 1DVAH 3LONA 2JH0D 1FAXA 5CDFE 1GI5A 4KTSA 2ZECA 3ZIAD 1EATA 3Q3YA 1DWEH 4ISOA 4BANB 1WTHD 2PP6A 1V2QT 3NRLA 3SJOA 4NA8A 3RC5A 4VGCC 3NKKA 2ZHQH 4B2CA 1BOQA 3BEIB 3KQ5A 5T6DA 4ACAA 4ZROA 2A7JA 2FOEA 1ELAA 6CHAC 2TPIZ 1AUTC 1OOKB 4IW4E 4NFEA 2LP6A 1GG6B 2ANWA 1X7AC 3WWBA 3JZ2B 2ODQA 2PV9B 3PM3A 4BTTB 2CK3D 1H8IH 2PKAB 2B9LA 1V2VT 5IK2D 3UNRA 1GMCF 1IQKA 1MTNB 1RFNA 1TNHA 3ENSB 2TGPZ 2AIPA 1EZQA 5T3HA 1LHFH 1LHDH 1ORFA 9LPRA 5K0HA 4ABEA 5JBCS 3F0OA 4GCHG 4YLQH 2J5UA 1TQ0B 2QYIA 3AK5A 2ZGCA 1YPEH 2BD8A 1O36A 1GJCB 1BMFD 1O2NA 4D9QA 1N1LA 2BMGB 1DXPA 1JWTA 2Z3DA 5IDKA 4WY3A 1GVZA 2DE9A 1C5MD 2ZEBA 2WHXA 2BHGA 1BDAA 1TPPA 2Z9JA 1CT4E 1C2DA 2PGQB 1FIZA 1MABB 4JZIA 3SNAA 5KEDA 4AG1A 2P16A 1ZOMA 4I32A 2BY6X 1H8DH 1UTPA 4HG6A 2OQUA 2ZFSA 1C4U2 2CJIA 1KXBA 1O2VA 4E06H 4RSPA 2ODYB 5E0GA 3KGPA 2QA9E 2WPHS 4OS6A 3CS7A 1D3QB 5EGMA 1QL8A 4X1RU 4K69A 1WCZA 2JIZD 5J4QA 3E16B 3MQKC 3DSPA 3WY8A 3GCNA 3E3TA 4Y10E 1BCUH 2BDIA 3UR6A 1HAOH 1CU1A 1ZSLA 8KME2 1G3CA 1J15A 2A4RA 3KN2A 2GT7A 3SUEA 1BQYA 1O2GH 3FFGA 1ZRBA 1TNGA 2F4LA 4OS7A 5TCAA 4TT3D 1VKYA 1W10U 2XNDD 2A7CA 1K1NA 1INCA 1OP8A 4NA7A 1SLVB 4Y0ZE 1DSUA 3BG4C 3SJ8A 2VGCC 4F55A 1HNEE 2FX6A 1CA0B 3LT3A 1GHWH 3N7DA 2C8XB 2Z94A 3VB3A 4ZKNU 2JETB 1TAWA 2PUXB 4XD7D 1QGFA 4QT8C 5A8ZA 1O2JA 2ZU5A 4JK5A 2HVYB 1VITH 1GJ8B 1UTOA 5FBEA 2ZDAH 1O2IA 1GHAF 2K8IA 1VZQH 3Q00A 1K0HA 4I8GA 1GI3A 4YESB 2VVCA 2F9UA 5DKMA 3H5CB 1K1MA 2GDEH 1RJXB 2ZHWH 4MG3A 1C2MA 1SGTA 1YLCA 2HOBA 5I46H 1TLDA 4UD9H 3JZ1B 1V2MT 4WH6A 1D3PB 4YT7H 1UVPA 3SI4H 7ESTE 1Y3VA 1MU6B 3BV9B 1Z71A 2HPQH 1YCPM 4MNYA 3A84A 2ZGJA 4JZEH 2FOAA 5E0JA 1C1VH 2F3CE 4FUHA 1YPLH 4Q2KA 4ZH8A 3SU6A 5GCHF 1O2HA 2A4GA 4Q80A 1TYNA 1YPHC 4NA9H 4DT4A 2OCVB 1KIGH 3TVJB 1NN6A 1DM4B 1Z7KA 3M61U 4OM9A 5FX5A 1RTFB 4B6EA 3T28A 1HCGA 4X1SU 1GBEA 3SO3A 1WTGH 2VB0A 2OC7A 1S81A 2JH6D 2HVXA 2PGBB 2BY9X 2KM0A 1BZXE 3G01A 3GCOA 3FAOA 4Y76A 2HLCA 2H9EH 3TLOA 1FN6A 2P95A 4MDSA 2WYGA 5L2ZH 1AFEH 4Y7BA 1NT1A 3TJVA 3U8OH 5JB9S 1A0JA 1SGRE 1T8MA 3MU8A 3LGIA 2FP7B 1KLIH 3GDVA 3V0XA 2V0BA 2YMSD 5DK1A 1OX1A 2PTCE 1SVPA 2A2QH 2VIPA 1G2MA 4NCYA 5DP7A 1LDTT 2QN5T 5FCRA 3M5OA 2PKSB 2OP9A 1V2LT 3EA7A 1W0YH 2A45B 3F1SB 1T32A 2G4TA 1TNIA 1XKAC 1KLTA 3M7TA 1O2ZA 3E0PB 1MKXK 1GGDC 2JJ2D 1SGCA 2AGGX 3HKIB 3LJOA 1CBWC 1G3EA 1CVWH 1EFRD 1ZTJA 3V7TA 1FPHH 1MKWK 1O5GH 2F43B 3SHCH 4Y71A 1COWD 1MTWA 3UOPA 3KQEA 3GCHC 1ESAA 2XNIA 3A7TA 3O8RA 1O3GA 4X8TH 1QL7A 4SGBE 3K65B 2VNTA 2BY5X 1KSNA 2JDID 2Q6GA 1PFXC 3T27A 5A0AE 1C9TA 2GZ8A 5TJXA 1UTKA 4FUCA 3OY6U 3RM0H 4DW2U 3QO6A 4FU9A 1ANCA 1W0JD 3A86A 4CR5A 1NFUA 1V2PT 4FUEA 1DWDH 2AERH 2H6MA 2ZTYA 2BDBA 3WWFA 1TRYA 1GJ4H 2W26A 1UCYH 3TJUA 3SU0A 2Z9GA 4I86A 2FOBA 2F9OA 2JKHA 3A8AA 1G3DA 4XBCA 3ZZ3A 1TPOA 1K22H 4ASHA 2V7QD 2Z7FE 1GJ9B 2KCAA 4UE7H 3QDZB 1W14U 1XX9A 5CHBA 1MD7A 2C8ZB 4B75A 1P2JA 1TMBH 2XRCA 1DS2E 1JOUB 4LOYH 2OC8A 3T62A 5PTPA 1TNKA 5C5OA 1EPTB 1O3OA 2OC0A 2ODPA 3DCLA 1C1OA 2Y6TA 1GHVH 2AMQA 1JMOH 3VB6A 3PV2A 2Y7ZA 3A85A 2HPPH 1LHEH 2XC0A 1EQ9A 2EA3A 1GI4A 1HAIH 5EJZA 3GCTF 1LHGH 1A61H 1MZDA 1EPTA 5DJ7A 3SV9A 1A5GH 1C5QA 1VGCC 3QGJA 4FVBA 1JXPA 2B8OH 3AASA 1C1UH 2SGPE 4R0IA 3OYPA 3NUMA 3FO8D 1HUTH 4AC9A 4XBDA 1RIWC 1PJPA 5C0TA 1P12E 2Q6FA 1C5WB 3RXBA 1GVKB 3QTOH 2FWWA 5ESTE 4GLYA 5HIZA 7GCHG 4X6NA 4Z1MD 1P01A 3KL6A 4Y8XA 3DSOA 1C2GA 4I7YH 3SGBE 5AFYH 4Z6AH 4U01A 2BD7A 1W12U 4INHA 3S0NA 2WYJA 1WQSA 3VXFH 1YPJH 3MFJA 4ISLA 1EP6A 3H09A 1SG8B 3KF2A 1K1LA 1RGQA 1DOJA 3OX7U 1OXGA 4YOJA 2C3SA 1AHTH 2LNCA 4IC5A 3KQCA 3KCGH 3OSYA 1JBUH 5LH8A 2XYAA 1ZMNA 5GXPA 1AKSB 1WXRA 2ZHFH 5EIYA 4K3JA 1SLXB 3SOSA 1YPGH 3A8CA 4P00A 5T1VA 4NZQA 2XC5A 2O8LA 2BQ6B 1O39A 1NROH 2KCYA 5EODA 1F7ZA 4OGXA 5HGGA 1GHXH 1TBQH 5C17A 1UK3A 1S6HA 3SJ9A 1V2KT 1XUKA 1AKSA 5EXLA 1GHZA 3RU4T 1HV7A 4GUXA 3TJOA 1HLTH 4LZ1H 1NZQH 2OUAA 1O5DH 4I8HA 1XUHA 1F0UA 4YT6H 4BNRA 1V2OT 2VINA 4DIHH 1SGQE 3V3MA 1FAKH 3ZZCA 4R8TB 3SV2H 4E7RG 4B6FA 5GJ4B 2HRVA 2PTNA 1AVGH 3GISB 2ALVA 3HKJB 1YYY1 1TX7A 1FUJA 1IQGA 3RXTA 1H4WA 1YC0A 3MMGA 3FANA 4CBOA 2D1JA 1E36B 3OU0A 1OWHA 2ZTXA 2GMTC 2Z9LA 1FY1A 4X1PU 2UWLA 4WMDA 1HJ8A 2FX4A 1BHXF 1FI8A 1GMHG 1W3CA 2F9VA 3KIDU 3F2HA 2BVRH 5BRRE 5F8TA 2ZPSA 1NRSH 5C67A 3M7UA 8GCHG 4IC6A 3S9BA 2GD4B 1TRNA 2KR7A 1Z8RA 3OTPA 1ANEA 3SQEE 1HFDA 1OS8A 1LPGB 1HXFH 1AI8H 1JIRA 2NU4E 4CHAC 3ODFA 1Y5AT 2QF5A 2AH4X 3MI4A 3BTWE 1FIWA 4Y8ZA 1C9PA 3QZQA 4CRCA 1BBRE 1BMLA 2ZQ2A 2XBVA 1O2XA 3MTYA 2B0FA 3KQBA 4OS4A 1SGNE 1YP9A 4X6MA 1XUGA 2Y7XA 4FUDA 4IMQA 2C8WB 4JYVH 1SGFA 4AGKA 2IPQX 1PYTC 3TNTA 1GBIA 5H4IB 4WXVA 1T4VH 1GCDA 1JRTA 2FOHA 1AE5A 1AB9B 2JJ1D 2Y5HA 1ZJDA 3SNDA 1FQ3A 3AAVA 2FZZA 3E8LA 1H1BA 5EU8A 1Z6JH 1NPMA 1QB9A 1O2QA 3R0FA 1LKAA 5CHAC 4I8JA 3RXIA 4AFUA 1OHHD 4D7FA 4AX9H 2BB4A 2W5EA 3SNBA 3SU3A 1UHBB 4A1VA 2FIRH 1BTUA 2BD2A 1BJVA 1B0FA 3DFJA 4GAWA 2C93B 3LJJA 5JPMH 3RXLA 4KTUA 5FXLA 4AG2A 1QZ8A 1GVLA 3TH2H 2VBCA 1G32B 3SJIA 3RXJA 1SC8U 1Z1JA 1NY22 1BTYA 2ZFPH 3GY4A 3SZNA 2SFAA 4D8NA 1YPHE 2AGIX 3W95A 4X6PA 4BAMB 4KTCA 2ZCHP 4X1NU 3VB7A 3SHAH 1IAUA 1MTVA 1P0SH 2XBWA 5LPEA 3BTME 1QQ4A 2K0QA 2OQ5A 2TGAA 3P8GA 1KXDA 1ZJKA 1DUAA 5FPSA 2BD9A 1DLKB 1THRH 1EAWA 2YNAA 2G5VA 2GV6A 4AFZA 4ZXXH 2W3KA 4JYTA 2ZZUH 1KDQA 2B7DH 3M36A 4K8YA 3F0PA 1P2NA 1BRUP 3E0NB 1NO9H 1RRKA 2SGEE 1P04A 3SV6A 4AYVB 3RXOA 3LDXH 1TFXA 3V13A 4DIIH 1GBLA 5LPFA 1BRBE 1SGIB 1P03A 2QE7D 3V12A 1GI9B 1YLDA 4AN7A 1SQAA 2P94A 4JZDH 4DURA 5GDSH 5DO4H 5DG6A 5J4SA 1OWDA 2WINI 4FUFA 1D6RA 2FEQH 4WH8A 5A8XA 1VITG 2ANMH 1C2JA 1Y59T 1A46H 1Z8GA 5EW1H 1LVBA 1UK2A 2R9PA 3N99A 1EAIA 1GI0A 2IN2A 2P3FH 1GBCA 1C1QA 4XFQA 2W6ID 3OAAD 2PSYA 2Z9IA 5GIBA 1IQLA 1ZPBA 1E34B 3PLPA 2HGTH 3GY7A 2QXJA 3EDXB 3R3GB 4YTAA 1EJMA 1W2KH 3DUXH 3MNXA 3WW7A 1C5ZB 1YLNA 2Y5FA 1ZSKA 1KXFA 3P17H 2FI5E 2Z6BD 4LZ4B 1SGEE 3SN8A 2AFQB 1IQMA 2WPDD 3QWCH 1F0SA 2ZWLH 1S5SA 1DY9A 3PTNA 3RXGA 2ZI2H 4ABAA 1GPZA 3SNEA 5FCKA 2AIQA 2YMSB 2VWMA 1LVYA 2QXGA 5L30H 1Y3YA 2KAIA 3PRBA 3O8DA 5I25A 1WBGB 2B5TB 1LTOA 1DWCH 2CHAB 2ZP0H 5EJ1A 2EC9H 1YPKH 2G52A 4Z0KA 4DVAU 3Q76A 1B0EA 2V3OH 1WAYB 2J95A 1WQVH 1FZZA 3MU5A 1C1SA 1O3AA 5E8EH 1C2LA 3PRDA 1ZTLA 1K21H 1W0KD 4Y7AA 3EGKH 2VH0A 4BTUB 5JBAS 1SR5C 5HM2A 3BTDE 1O3BA 3K6ZA 3GS9A 4OS2A 1SPJA 3ATWA 1LPKB 2ESTE 2Y81A 1GJDB 3UB0A 3BEUA 3ZZ4A 4Y8YA 1MMJN 1HJAC 1P2MA 1QJ6B 4MNWA 4UFEH 1FX0B 3OE7D 4ABGA 1GJBB 2EEKA 2W6JD 2UUJB 3BF6H 5FHTA 3RUOA 2FMJA 3F9HA 5FX6A 2EI8A 4FUGA 4NIYA 2QF4A 2UUFB 3RXDA 1E1QD 1QBVH 1GHYH 5JBBS 1YCPH 2FYRA 5DGJA 2VVUA 1H8ED 4TPYA 5G4BA 1KXAA 2STBE 3U1IB 1K1OA 1AU8A 3Q77A 4YLUA 1CHOF 2ZPQA 4D76A 3LGVA 2BOHB 2QY0B 4X8VH 1Y5UT 3ZVFA 6GCHF 4B74A 1NFYA 2GCHF 2A4OA 2AMDA 1O30A 1EAXA 3A87A 4K8BA 1PQAA 1GMDG 1V2NT 4AFSA 3RXEA 1N8OC 2J92A 4MNXA 1AFQC 1LPZB 4WXIA 3QUMP 4ABBA 4A5TS 1L1GA 6ESTA 1NC6A 2IPHA 2LPRA 1IOEA 3OY5U 3U1JB 1UTQA 2QF3A 1D3TB 1MH0A 1E38B 3M7QA 1LQEA 2BY8X 2GP9B 1E0FD 2QXIA 5C1YA 4WF8A 5AHGH 3F9GA 4B2BA 1CQQA 4IN2A 2CF8H 5LGOA 2ZGXH 3PV4A 1CT2E 2ZFTA 3PWBA 1FJSA 2UUKB 1D4PB 1A3EH 3OEHD 1L1JA 1WU1A 3BTHE 2WPKS 3K9XB 1VCWA 1PPBH 1Q2WA 1KXEA 3PYHA 4U32A 3F2GA 1Z8JB 4MTBA 2FDAA 3I77A 4NSVA 3A8BA 3ZYDA 3M3TA 1GBKA 1KY9A 1FMGA 1THSH 1W8BH 4YOIA 4KELA 3STIA 3TGIE 1O2WA 5JDUB 1EB1H 2THFB 1ZHRA 3L33A 2HNTF 4MPWA 4GCHF 2FYQA 3A82A 1HJ9A 1DUEA 3L6PA 1F5LA 1QA0A 1GCTB 1WYKA 4RI0A 1GI2A 1MZAA 1LHCH 4A1XA 1OYTH 4MNVA 2W7SA 1SGFG 3MWIU 1BTWA 1C1WH 3BTEE 4XBBA 1QL9A 3S9AA 3P8NA 3ZV8A 1P10A 2Z9KA 2BDCA 3I29A 4DT7B 4FU7A 4AFQA 2P59A 1D9IA 1QB1A 4X1QU 2PW8H 3VEQB 3PO1B 1UTNA 2NU3E 1A2CH 1P11E 1J17T 4X0WU 3P8FA 1GBTA 1K1PA 1QB6A 1SGDE 4U30A 1ARCA 2RA3A 2BLVA 1V2UT 3ZVDA 4CRBA 1AWHB 2ZCKP 3BN9A 3A7VA 5HKKD 3T25A 3MO6A 2GTBA 1O3DA 3BIUH 3RXFA 2ZCLP 1J9CH 3MU4A 3N7EA 3T29A 3SU5A 1T7CA 4X2VA 3FZZA 1V6DA 2P8OC 3MNBA 1SOTA 3PLBA 1T8OA 3IG6B 3M5LA 4CRFA 5EOKA 1C5TA 1OKXA 2NWNA 3ZYEA 3TPIZ 4WMFA 3PTBA 1ID5H 2ZHEH 3URCA 5B6LA 1BMAA 1UJ1A 3SW2B 2ZIQH 1UW7A 3TITA 2GJGA 1QRXA 5AVDA 4RN6A 1E1RD 3RXHA 5FBIA 1GDQA 2VVVA 3FP6E 3SUFA 3UR9A 2RCEA 1BUIA 1F92A 3ATKA 2BM2A 1AN1E 1LCYA 3NK8A 3VGCB 4ISHH 3LGWA 1BBRH 3IITA 1DFPA 1MCVA 1TGBA 2RDLA 4CR9A 1FXYA 1SL3A 4ZXYH 3F9EA 1A0LA 3GICB 3RXQA 1DITH 1KLJH 3ZV9A 1TB6H 4BOHA 2VIVA 1EP5A 2PLXA 1C1TA 1GBDA 1SFIA 5C1XA 1BT7A 1ANBA 2ZPRA 2J97A 3SGQE 1NFWA 4XSKU 2WV9A 1GBJA 1S85A 3A80A 1EUFA 1G36A 4BAHB 4VGCB 3QGNB 3BEFB 3KNXA 1QY6A 1O2LA 2GCTC 1L0ZA 6CHAB 1GJ5H 1TBRH 2EI7A 2VWOA 1L1NA 1BJUA 2VIOA 4HFPB 4ABDA 2EQNA 1HAZB 3ELAH 1F5KU 1A3BH 1T31A 5C5NA 1BRCE 2ALPA 2QXHA 1PPFE 1HIAA 4DOQA 1CO7E 2ASUB 1AO5A 1TNJA 5C1UA 1CE5A 3F2FA 1JIMA 2M2AA 1C5VA 4LXBH 3BTTE 4ZKOU 2BY7X 1FY8E 2WPLS 1C1NA 3DA9B 9ESTA 2O8UA 3EYDA 4TYDA 1SQTA 2HWLB 4YXWD 3PB1E 1T8NA 1G37A 1O2RA 1TGNA 1QNJA 1PQ7A 4ZHMU 2CXVA 1KYNA 1UVOA 1F2SE 2RG3A 2LELA 1DE7H 1EJNA 1GG6C 5FPTA 2W7UA 3T5FH 1C2KA 3QZRA 1DPOA 1PPGE 1CGJE 1F0RA 2Q1JA 3SJKA 3UQVA 4UFDH 1FV9A 2J34A 3RXSA 1ZR0A 1MTNC 4B2AA 1OWIA 1PYTD 1HXEH 2D8WA 5EQSA 1ZRKA 3RC4A 3SI3H 1H9IE 4ISIH 3SUGA 2NU2E 2ZFRH 2A31A 1RS0A 4Y0YE 1EOLA 1ZHPA 1AMHA 1J16A 3GYMA 3ZVAA 1BTHH 1CGHA 5DPAA 3TIUA 3F6UH 3UIRA 2GGVB 4CH8B 1FY3A 2QCYA 2BTCE 1SQOA 1CGIE 3NZIA 4NFFA 1FLEE 1K2I1 3EAJA 3BG4B 1C5RA 2VGCB 1QHRB 3E91A 5HIYA 5FAHA 3W1EA 1DT2A 1GHBG 2Q6DA 3BTGE 1P9SA 2KFWA 3FVFB 1ESBA 2WV5A 5DP8A 1S6FA 2Y82A 3ZZ5A 4BAKB 1ZPCA 3RLWH 1FPCH 5EXMA 4X8SH 2TIOA 4NIXA 3UY9A 1P09A 1GDUA 4OGYA 1G30B 2C8YB 2V6NA 4CRAA 2F9BH 1GDNA 2UWOA 3MNSA 1SQRA 1MAXA 1GI8B 1AY6H 3ITIA 1VCPA 3MO3A 3RP2A 1HB0B 4J2YB 2I6QA 4A6LA 3PMAB 3STJA 1H9HE 1BMNH 3CP7A 1SHHB 5EQRA 3GY2A 1GL1A 4HTCH 1OWEA 4BAOB 4K5ZA 2A4QA 5ABWA 5ETXA 1AQ7A 2BYAX 2UUYA 4J1YA 1LKBA 3E90B 1EKBB 1O3IA 1AZZA 1CA0C 1W7XH 2J98A 1C1MA 2GDDA 1QJ1B 2JETC 2SGQE 3GY5A 3LGUA 3U98H 2FM2A 1Q3XA 4GVUA 4JK6A 1SGYE 3RLYH 1SSXA 1LVOA 3PMHB 1EZSC 1PQ8A 2BLOA 2NU0E 2PUQH 1C4Y2 3AW1A 3E1XB 4I33A 3C27B 3GYLB 4NGAH 3UTUH 2BQWB 3SU4A 3M5MA 1L4DA 1EZXC 1OP2A 3VPKA 2K1QA 1O2MA 4H42U 3RDZA 5JYIA 3ATMA 1IHTH 2VIWA 1AVXA 3A8DA 1XVOA 7GCHF 1BTXA 3ESTA 2FXRA 1EASA 5JB8S 1WDIA 1YKTA 3SYJA 5F8ZA 1HYLA 3BSQA 3P70B 3PV5A 4CH2B 3GY3A 3TNSA 1VCQA 1ZZZA 1HAHH 4FETA 3TGKE 2BDHA 3KHVA 5F53A 3TK6A 1C5SA 1LVMA 4O03A 1YWUA 3TJNA 4K2YA 1S83A 1K1JA 1S84A 1Y5BT 3SZEA 1O3PB 3DHKH 5KECA 2BLWA 3ATLA 5EPYA 2BLQA 2AHME 4U2WA 1C2FA 2VJ1A 3BG8A 3I78A 1YF4A 3RXMA 1QTFA 1D3DB 1ELCA 1AE8H 1EB2A 1WSSH 3HGNA 2FPZA 1O2UA 3SV7A 1MBQA 1UO6A 2QIQA 2QGRA 2ZO3H 2XBXA 2QAAA 1C2IA 1P9UA 1NS3A 1CSOE 1PQ5A 2AYWA 1MD8A 1GGDB 1LQDB 4Q7XA 1EAUA 1CBWB 1GBAA 4BXSA 4RKOB 1YBWA 1GMCG 1VJAU 4KKDA 4F4OC 3UAIC 4ISNA 3EA8A 1O3CA 4JMYA 1C5XB 4Q7ZA 3GCHB 1P3CA 2BX4A 2IOTA 1KDQB 1HDTH 3EE0B 3OTJE 4RKJB 2SNVA 4MPVA 1BIOA 4WWYA 2G4UA 3SORA 5DP9A 3AAUA 2O8MA 1A7SA 2ZDNA 3EE7A 3ZVEA 4D9RA 2PKSC 2R3UA 4X8UH 3M37A 1ELFA 1THPB 1QR3E 1QRZA 2VIQA 1TRMA 1C5UA 3RXVA 1IQHA 1Z6EA 2BZ6H 2BD5A 2G5NA 2M5TA 3U9AH 1UTJA 1OP0A 1AWFH 3M3VA 3UUZA 4IBLH 3CS0A 4MLFB 2BXUH 1HAVB 1GMHF 3NPSA 2XWBI 3BTKE 3VFEA 1QJ7B 3SQHE 5C3NA 2AS9A 5JBTA 1GBFA 4FUBA 2ZGHA 1O3EA 1N6XA 8GCHF 1T4UH 1S82A 1NRPH 1MKXH 1EXFA 2OK5A 1UVUH 1O31A 2VWNA 1O3FA 3PMBB 1TA2A 1HAVA 2ZU3A 1ETTH 1MKWH 1ZSJA 1SB1H 1W11U 1ZTKA 1AZ8A 1GJAB 4A92A 1EJAA 1GBBA 1C1RA 3FN8A 4FU8A 5A2MH 3L3TA 3RMLH 3KYGA 2FOMB 3GY8A 3IWMA 4THNH 3UNQA 4K1TA 1ZYOA 3RU4E 2ZU4A 4Y79A 2SGFE 2A5IA 3UPEA 1V2RT 3RM2H 1DSTA 4M7GA 3VXEH 5ESBA 1AVWA 1L4ZA 3FKSD 1VGCB 2KAIB 4NZLA 1O3HA 1QRWA 5AF9H 1K9OE 4NWLA 1P2QA 1TIOA 1JRSA 2YNBA 1HAGE 3TGJE 2F9NA 2QV1A 1BHXB 5HXFA 4A1TA 1TQ7B 1RIWB 3NXPA 1ZGIA 5K7RA 2NU1E 1GHAG 3ZZ7A 2AGEX 1EPTC 3SNCA 4AB8A 1Q31A 4B71A 2STAE 1G2LA 2BXTH 1GI1A 2OD3B 3B23B 2AEIH 4FXGH 1OPHB 3B8JA 3UWJH 5DP4A 2BDYA 2J9NA 3LOXA 2ZU1A 2D2DA 2H5CA 4Y11E 2SNWA 3ZVGA 2OBQA 3MYWA 1BA8B 2R0LA 2G81E 1S6LA 5T6GA 2H2ZA 2A5KA 2HNTC 4CREA 5GCHG 4TY6A 5DP3A 1TALA 1ANDA 4ZHLU 3P92A 8ESTE 3ZZDA 1OSSA 4O3UA 1O2PA 4TSFD 3A7YA 1BTPA 3MH7A 1HAYB 1GL0E 2PKAA 3UWIA 4D7GA 3KEEA 2VWLA 1ZHMA 4ZUHA 1ESTA 2P3UB 1QA7A 4SGAE 4BXWA 1BTZA 2CV3A 4AOQA 1J8AA 3MHWU 3VG8A 2F83A 4INLA 3SBKA 2FESH 2OTVA 3TH3H 1IQJA 3MH6A 1O3LA 3HPTB 2BD3A 4O3TA 5E2PA 5BPEA 1C5LH 2OBOA 4X2YA 1GBHA 2ULLA 2PWXA 4DGJA 2G8TA 2EI6A 2FLBH 4F49A 3BIVH 3C1KA 2H1UA 4ZAEA 4NG9H 3DFLA 1O32A 1TMTH 2OINA 2ZTZA 2BD4A 2W3IA 2WPIS 3RU4D 1FONA 2WPJS 2PHBA 1O5CB 1TE0A 2RDEA 1P8VC 1VITF 4O97A 4XOJA 2DE8A 2XW9A 1O3NA 1QIXB 3QK1A 2WV4A 3MNCA 1MCTA 1CHGA 2PFEA 1MTSA 2ZHDA 4FUIA 1C5OH 3RXKA 5GPIB 4AB9A 5GWZA 3TK9A 1MUEB 1QBOA 2GMTB 1NRRH 3FOAA 4JCNA 5HM9A 2GT8A 5DN6D 5L6NH 1G9IE 3EQ0H 4HZHA 1OWKA 3MU0A 3SGAE 1C5PA 1IHSH 1O5EH 1RTLA 4I8LA 3A7WA 4RT0A 4MQAA 2ANKH 3PROA 1ZMJA 1ZPZA 4UONA 2FOGA 1FN8A 4B1TA 4BAQB 2ZU2A 4CHAB 2A0QB 1NM6A 5HMAA 3LH3A 3ZVBA 2G51A 4IN1A 1WV7H 2V35A 1EZUC 5SGAE 1O2KA 1PPEE 3SU1A 3KQDA 4ABIA 1SOZA 1U6QA 5DP5A 2XBYA 2ZFQH 4MPUA 1ARBA 2J2UA 3ZZ8A 4B73A 5EXNA 3PLKA 1O0DH 3BTQE 2R0KA 1ABIH 3CENA 1IQNA 1A0HB 1DICA 3VB5A 1IQIA 1H9LB 2TGDA 4H4FA 1HAXB 2UWPA 4Q7YA 1TABE 3S69A 4H6SB 5C2ZA 5F03A 2ZDKA 1O38A 3RXAA 4JZFH 4TPIZ 2FO9A 1TWXB 5CHAB 3MH4A 2OXSA 4CRDA 5E0HA 1HPGA 2FODA 3M35A 4GHTA 1RTKA 3GCTG 1GJ7B 3RMMH 1P2IA 1VR1H 2ZDMA 2P3TB 4GSOA 2AMPA 4INKA 2A5AA 4OS5A 4TWWA 1C2HA 1J14A 1O5BB 1Y8TA 3FP7E 1BB0B 3M5NA 2R2WU 1TA6A 4K1EA 4NIWA 2QF0A 2GVFA 1AB9C 3AVZA 1G3BA 2ANYA 1OWJA 1O35A 1TX6A 5A0CA 3O8CA 4GHQA 1IQEA 4H6TA 2P93A 2ZQ1A 3LPRA 4TY7A 1P2OA 2DUCA 2V3HH 5EPNA 2FLRH 3D62A 4K60A 4X6OA 3HATH 4E7NA 1GMDF 3RXUA 1MTUA 1KTTB 4XRNA 1GJ6A 3ZVCA 3RXPA 4A7IB 3A81A 1NRQH 1XUIA 2Y5GA 3M3SA 2CMYA 2CN0H 2KCPA 2Z3CA 1Z8IB 4DG4A 3LU9B 5B6OA 4IGDA 4DY7B 2ZC9H 1WOFA 5CE1A 1EX3A 2BVXH 4OS1A 1FY5A 3CNRA 2ZG0H 5AFZH 1MBMA 3FP8E 2G00A 4NWKA 4AORA 2C90B 3MOCA 1O2OA 3QN7A 1O34A 1TX8A 2FS8A 3U8TH 8LPRA 1PPCE 1Y3XA 4F48B 5A0BA 3GDUA 3QX5H 4X2WA 1V2TT 4ZCNA 1DWBH 3P8OA 1K1IA 1B7XB 1UVSH 2ZNKH 5EJLA 1NFXA 1XXFA 3P6ZB 4PROA 1D6WA 1YY3A 2WUBA 4KGAA 3S7HB 1BITA 3LH1A 4TWYA 1P02A 4MVNA 5GNDA 1TOMH 4Q4LA 2FS9A 2ZKSA 4DJZB 1HIAB 2OC1A 1TMUH 1QURH 4FVDA 5EG4A 1QCPA 2ZA5A 2BX3A 1O5AB 4WJG2 1CT0E 3TH4H 4ZHAA 1S0RA 2GX4A 5C94A 1SGPE 3SV8A 1DX5M 2A1DB 6LPRA 1FY4A 1E79D 2O8TA 4HI3A 4NSYA 1ELTA 4CRGA 5C20A 3ZZ6A 5F6MA 4CBNA 1H8HD 1PPHE 2BDGA 5HYOA 1C5YB 2WUCA 1MQ5A 2ZF0H 1ETSH 4ACBA 2ZDLA 4WVPE 1AD8H 4YZUA 4M9FA 2H9TH 1KXCA 3T2NA 3GOVB 2XOKD 1O3MA 3HK3B 4YM9A 5C0UA 1XM1A 1A4WH 3OFND 1LMWB 1UVTH 2WSSD 1E35B 4ASUD 4E05H 2FI4E 4FOUC 3HK6B 3D49H 1QQUA 3RC6A 3RXRA 2ZFFH 2J38A 2TBSA 2F9PA 2FTMA 1P2KA 2YMSC 1AUJA 4GPGA 3UREA 2L6OA 2O8WA 1HJAB 1WUNH 1B5GH 1YCPK 1SMFE 2SGAA 3GDSA 5A09A 3PMJA 4UDWH 5EQQA 2CHAC 1XMNB 1UMAH 2YOLA 3HGPA 2JH5D 2XCFA 2RA0A 3U8RH 2FOFA 3ZZAA 1IQFA 3A88A 5CMXH 1AGJA 3MH5A 2BOKA 3EA9A 4AYYB 2WZQA 2IJD1 4AGJA 2WPMS 1W0ZU 4ABHA 3MO9A 1NRNH 3UFAA 3DT0H 3O8BA 2VIDA 4XE4A 3RMNH 4I31A 2I6SA 2L74A 1ZLRA 3ODDA 1QBNA 1TOCB 2G55A 2RFKC 4MPXA 2TGTA 3FZDA 1HGTH 2V3MA 1QFKH 1V2ST 5IYTA 1T8LA 3A7ZA 1ELGA 2GZ7A 3B9FH 4B76A 1YGCH 2C4FH 4UFGH 4X2XA 1BMMH 3W94A 1XKBC 4HGCA 1N8OB 1ZMLA 1AFQB 2F91A 3GY6A 1O33A 4LK4A 3U69H 3H7TA 4XDEA 3D23A 3DSGA 3S7KB 1ELDE 2XWAA 7KMEH 3VB4A 5KGOA 2R3YA 7LPRA 1XXDA 2HNTE 2J98B 1GBMA 3H7OA 2H5DA 3U28C 3QTVH 3UQOA 2Y80A 3S9CA 1XUFA 2FI3E 2O9QA 1C2EA 1ELVA 3NWUA 1P3EA 3QLPH 1A5IA 2VU8E 1SFQB 2BVSH 1KMHB 5FL7D 2KCOA 4ZKRU 1MAYA 4JYUH 1O2SA 1TONA 1F5RA 4P02A 3TU7H 1SLWB 3N7OA 2A7HA 5L2YH 1GI6A 2FOCA 3LC5A 3A83A 1DXWA 1HRTH 3ZZ9A 2XXLA 2GKVE 1NBME 5FPYA 1MQ6A 4ZMAH 1P57B 1A5HA 1YPMH 1DANH 3K6YA 3KYFA 3RXCA 2Z3EA 1KTSB 5LPRA 2HALA 1O3JA 3LGYA 1V3XA 2CGAA 5F8XA 1CA8B 3LIWA 4ABJA 4O9VA 2HLDD 3AW0A 4YO9A 2GZ9A 4DCDA 1BRAA 5E2OA 4NIVA 1HAPH 1DLEA 1HBTH 4WMEA 2SGDE 2PSXA 3ZZBA 4IS5A 2D26C 4ABFA 1FDPA 1O2YA 4ZKSU 2A32A 1VJ9U 3TK5A 1MU8B 2VH6A 1YM0A 1TGCA 1XUJA 2R2MB 4JZ1A 1GCTC 1Y3WA 3D65E 1S0QA
chains in the Genus database with same CATH topology
1C1PA 2XTTB 1O37A 1NU7B 1UK4A 1ABJH 1UCYE 1E37B 4AZ2B 2H9HA 3F68H 2P8OB 3P95A 1C5NH 3DD2H 1BBRK 2J94A 1W13U 1P06A 1V2WT 2GV7A 1GHBF 3MU1A 1SHYA 1TBZH 1O3KA 4YOGA 3UOUA 4ESTE 1UTMA 1NESE 2FTLE 1SI5H 4FUJA 3URDA 2BDAA 1W7GH 3PO1C 2QC2A 2TRMA 3LGTA 3ATIA 1UCYK 5DP6A 1RXPA 4UEHH 3A7XA 1FNIA 1ACBE 2BZAA 1O5FH 1ELEE 1TGTA 1UHBA 1EOJA 1O2TA 1DDJA 1XVMA 1TNLA 4Y6DA 5T6FA 2J4IA 1SBWA 5TCCA 2ZGBH 1GI7B 1TPSA 3A89A 4BTIB 4K1SA 3RMOH 1C4V2 2A2XH 3Q3XA 2CF9H 2OLGA 1K28D 2XC4A 1Z1IA 2BQ7B 2ZDVH 3UNSA 1UTLM 3NCLA 3PWCA 2IJOB 1N6YA 1NU9A 5EW2H 1TGSZ 2PR3A 4I8KA 1ELBA 4KP0A 3K2UA 1SLUB 1LO6A 1P05A 2GCTB 3BTFE 3VGCC 4IMZA 3T26A 3Q3KA 3F9FA 1NTPA 1M9UA 1TPAE 1AIXH 1ETRH 3SU2A 1Y3UA 1CHOG 1V2JT 1GWAA 1F0TA 1L2EA 2ILNA 4UFFH 3SUDA 1PPZA 2XCNA 1A1RA 1OYQA 3E6PH 3LC3A 1RD3B 6GCHG 5A8YA 2GCHG 3LKWA 1ZGVA 1DY8A 1DVAH 3LONA 2JH0D 1FAXA 1GI5A 4KTSA 2ZECA 1EATA 3Q3YA 1DWEH 4ISOA 4BANB 1WTHD 3SJOA 1V2QT 4NA8A 3RC5A 4VGCC 3NKKA 2ZHQH 4B2CA 1BOQA 3BEIB 5T6DA 4ZROA 2A7JA 2FOEA 1ELAA 6CHAC 2TPIZ 1AUTC 1OOKB 4IW4E 4NFEA 1GG6B 2ANWA 1X7AC 3JZ2B 2ODQA 2PV9B 3PM3A 4BTTB 1H8IH 2PKAB 2B9LA 1V2VT 3UNRA 1GMCF 1IQKA 1MTNB 1RFNA 1TNHA 3ENSB 2TGPZ 2AIPA 1EZQA 5T3HA 1LHFH 1LHDH 1ORFA 9LPRA 5K0HA 4ABEA 5JBCS 4GCHG 4YLQH 1TQ0B 2QYIA 2ZGCA 1YPEH 2BD8A 1O36A 1GJCB 1O2NA 4D9QA 1N1LA 2BMGB 1DXPA 1JWTA 2Z3DA 5IDKA 4WY3A 1GVZA 2DE9A 1C5MD 2ZEBA 2BHGA 1BDAA 1TPPA 2Z9JA 1CT4E 1C2DA 2PGQB 1FIZA 4JZIA 3SNAA 4AG1A 2P16A 1ZOMA 4I32A 2BY6X 1H8DH 1UTPA 2OQUA 2ZFSA 1C4U2 2CJIA 1KXBA 1O2VA 4E06H 4RSPA 2ODYB 5E0GA 3KGPA 2QA9E 2WPHS 4OS6A 3CS7A 1D3QB 5EGMA 1QL8A 4X1RU 4K69A 1WCZA 5J4QA 3E16B 3WY8A 3GCNA 3E3TA 4Y10E 1BCUH 2BDIA 3UR6A 1HAOH 1CU1A 1ZSLA 8KME2 1G3CA 1J15A 2A4RA 3KN2A 2GT7A 3SUEA 1BQYA 1O2GH 3FFGA 1ZRBA 1TNGA 4OS7A 5TCAA 1W10U 2A7CA 1K1NA 1INCA 1OP8A 4NA7A 1SLVB 4Y0ZE 1DSUA 3BG4C 3SJ8A 2VGCC 1HNEE 2FX6A 1CA0B 3LT3A 1GHWH 2C8XB 2Z94A 3VB3A 4ZKNU 2JETB 1TAWA 2PUXB 1QGFA 4QT8C 5A8ZA 1O2JA 2ZU5A 4JK5A 1VITH 1GJ8B 1UTOA 5FBEA 2ZDAH 1O2IA 1GHAF 1VZQH 3Q00A 4I8GA 1GI3A 4YESB 2VVCA 2F9UA 5DKMA 3H5CB 1K1MA 2GDEH 1RJXB 2ZHWH 4MG3A 1C2MA 1SGTA 1YLCA 2HOBA 5I46H 1TLDA 4UD9H 3JZ1B 1V2MT 4WH6A 1D3PB 4YT7H 1UVPA 3SI4H 7ESTE 1Y3VA 1MU6B 3BV9B 1Z71A 2HPQH 1YCPM 4MNYA 3A84A 2ZGJA 4JZEH 2FOAA 5E0JA 1C1VH 2F3CE 4FUHA 1YPLH 4Q2KA 4ZH8A 3SU6A 5GCHF 1O2HA 2A4GA 4Q80A 1TYNA 1YPHC 4NA9H 2OCVB 1KIGH 3TVJB 1NN6A 1DM4B 1Z7KA 3M61U 5FX5A 1RTFB 3T28A 1HCGA 4X1SU 1GBEA 3SO3A 1WTGH 2VB0A 2OC7A 1S81A 2JH6D 2HVXA 2PGBB 2BY9X 1BZXE 3G01A 3GCOA 3FAOA 4Y76A 2HLCA 2H9EH 3TLOA 1FN6A 2P95A 4MDSA 2WYGA 5L2ZH 1AFEH 4Y7BA 1NT1A 3TJVA 3U8OH 5JB9S 1A0JA 1SGRE 1T8MA 3MU8A 3LGIA 2FP7B 1KLIH 3GDVA 3V0XA 2V0BA 5DK1A 1OX1A 2PTCE 1SVPA 2A2QH 2VIPA 1G2MA 4NCYA 5DP7A 1LDTT 2QN5T 5FCRA 3M5OA 2PKSB 2OP9A 1V2LT 3EA7A 1W0YH 2A45B 3F1SB 1T32A 2G4TA 1TNIA 1XKAC 1KLTA 3M7TA 1O2ZA 3E0PB 1MKXK 1GGDC 1SGCA 2AGGX 3HKIB 3LJOA 1CBWC 1G3EA 1CVWH 1ZTJA 3V7TA 1FPHH 1MKWK 1O5GH 3SHCH 4Y71A 1MTWA 3UOPA 3KQEA 3GCHC 1ESAA 2XNIA 3A7TA 3O8RA 1O3GA 4X8TH 1QL7A 4SGBE 3K65B 2VNTA 2BY5X 1KSNA 2Q6GA 1PFXC 3T27A 5A0AE 1C9TA 2GZ8A 5TJXA 1UTKA 4FUCA 3OY6U 3RM0H 4DW2U 3QO6A 4FU9A 1ANCA 4CR5A 3A86A 1NFUA 1V2PT 4FUEA 1DWDH 2AERH 2H6MA 2ZTYA 2BDBA 1TRYA 1GJ4H 2W26A 1UCYH 3TJUA 3SU0A 2Z9GA 2FOBA 2F9OA 2JKHA 3A8AA 1G3DA 4XBCA 3ZZ3A 1TPOA 1K22H 4ASHA 2Z7FE 1GJ9B 4UE7H 3QDZB 1W14U 1XX9A 1MD7A 2C8ZB 4B75A 1P2JA 1TMBH 2XRCA 1DS2E 1JOUB 4LOYH 2OC8A 3T62A 5PTPA 1TNKA 5C5OA 1EPTB 1O3OA 2OC0A 2ODPA 1C1OA 2Y6TA 1GHVH 2AMQA 1JMOH 3VB6A 2Y7ZA 3A85A 2HPPH 1LHEH 2XC0A 1EQ9A 2EA3A 1GI4A 1HAIH 3GCTF 1LHGH 1A61H 1MZDA 1EPTA 5DJ7A 3SV9A 1A5GH 1C5QA 1VGCC 3QGJA 4FVBA 1JXPA 2B8OH 3AASA 1C1UH 2SGPE 4R0IA 3OYPA 3NUMA 1HUTH 4XBDA 1RIWC 1PJPA 1P12E 2Q6FA 1C5WB 3RXBA 1GVKB 3QTOH 2FWWA 5ESTE 4GLYA 7GCHG 4X6NA 1P01A 3KL6A 4Y8XA 1C2GA 4I7YH 3SGBE 5AFYH 4Z6AH 4U01A 2BD7A 1W12U 4INHA 3S0NA 2WYJA 1WQSA 3VXFH 1YPJH 3MFJA 4ISLA 1EP6A 1SG8B 3KF2A 1K1LA 1RGQA 1DOJA 3OX7U 1OXGA 4YOJA 2C3SA 1AHTH 2LNCA 4IC5A 3KQCA 3KCGH 3OSYA 1JBUH 5LH8A 2XYAA 1ZMNA 5GXPA 1AKSB 2ZHFH 4K3JA 1SLXB 3SOSA 1YPGH 3A8CA 4NZQA 2XC5A 2O8LA 2BQ6B 1O39A 1NROH 5EODA 1F7ZA 4OGXA 5HGGA 1GHXH 1TBQH 1UK3A 1S6HA 3SJ9A 1V2KT 1XUKA 1AKSA 5EXLA 1GHZA 3RU4T 1HV7A 4GUXA 3TJOA 1HLTH 4LZ1H 1NZQH 2OUAA 1O5DH 4I8HA 1XUHA 1F0UA 4YT6H 4BNRA 1V2OT 2VINA 4DIHH 1SGQE 3V3MA 1FAKH 3ZZCA 4R8TB 3SV2H 4E7RG 5GJ4B 2HRVA 2PTNA 1AVGH 3GISB 2ALVA 3HKJB 1YYY1 1TX7A 1FUJA 1IQGA 3RXTA 1H4WA 1YC0A 3MMGA 3FANA 4CBOA 2D1JA 1E36B 3OU0A 1OWHA 2ZTXA 2GMTC 2Z9LA 1FY1A 4X1PU 2UWLA 4WMDA 1HJ8A 2FX4A 1BHXF 1FI8A 1GMHG 1W3CA 2F9VA 3KIDU 2BVRH 5BRRE 5F8TA 2ZPSA 1NRSH 5C67A 3M7UA 8GCHG 4IC6A 3S9BA 2GD4B 1TRNA 1Z8RA 1ANEA 3SQEE 1HFDA 1OS8A 1LPGB 1HXFH 1AI8H 1JIRA 2NU4E 4CHAC 3ODFA 1Y5AT 2AH4X 3MI4A 3BTWE 1FIWA 4Y8ZA 1C9PA 3QZQA 4CRCA 1BBRE 1BMLA 2ZQ2A 2XBVA 1O2XA 3MTYA 2B0FA 3KQBA 4OS4A 1SGNE 1YP9A 4X6MA 1XUGA 2Y7XA 4FUDA 4IMQA 2C8WB 4JYVH 1SGFA 4AGKA 1PYTC 3TNTA 1GBIA 5H4IB 4WXVA 1T4VH 1GCDA 1JRTA 2FOHA 1AE5A 1AB9B 2Y5HA 1ZJDA 3SNDA 1FQ3A 3AAVA 2FZZA 3E8LA 1H1BA 5EU8A 1Z6JH 1NPMA 1QB9A 1O2QA 3R0FA 1LKAA 5CHAC 4I8JA 3RXIA 4AFUA 4D7FA 4AX9H 2BB4A 2W5EA 3SNBA 3SU3A 1UHBB 4A1VA 2FIRH 1BTUA 2BD2A 1BJVA 1B0FA 3DFJA 4GAWA 2C93B 3LJJA 5JPMH 3RXLA 4KTUA 5FXLA 4AG2A 1GVLA 3TH2H 1G32B 3SJIA 3RXJA 1SC8U 1Z1JA 1NY22 1BTYA 2ZFPH 3GY4A 3SZNA 2SFAA 4D8NA 1YPHE 2AGIX 3W95A 4X6PA 4BAMB 4KTCA 2ZCHP 4X1NU 3VB7A 3SHAH 1IAUA 1MTVA 1P0SH 2XBWA 5LPEA 3BTME 1QQ4A 2OQ5A 2TGAA 3P8GA 1KXDA 1ZJKA 1DUAA 5FPSA 2BD9A 1DLKB 1THRH 1EAWA 2YNAA 2G5VA 2GV6A 4AFZA 4ZXXH 2W3KA 4JYTA 2ZZUH 1KDQA 2B7DH 3M36A 4K8YA 1P2NA 1BRUP 3E0NB 1NO9H 1RRKA 2SGEE 1P04A 3SV6A 4AYVB 3RXOA 3LDXH 1TFXA 3V13A 4DIIH 1GBLA 5LPFA 1BRBE 1SGIB 1P03A 3V12A 1GI9B 1YLDA 4AN7A 1SQAA 2P94A 4JZDH 4DURA 5GDSH 5DO4H 5DG6A 5J4SA 1OWDA 2WINI 4FUFA 1D6RA 2FEQH 4WH8A 5A8XA 1VITG 2ANMH 1C2JA 1Y59T 1A46H 1Z8GA 5EW1H 1LVBA 1UK2A 2R9PA 1EAIA 1GI0A 2IN2A 2P3FH 1GBCA 1C1QA 4XFQA 2PSYA 2Z9IA 5GIBA 1IQLA 1ZPBA 1E34B 3PLPA 2HGTH 3GY7A 2QXJA 3EDXB 3R3GB 4YTAA 1EJMA 1W2KH 3DUXH 3MNXA 1C5ZB 2Y5FA 1ZSKA 1KXFA 3P17H 2FI5E 2Z6BD 4LZ4B 1SGEE 3SN8A 2AFQB 1IQMA 3QWCH 1F0SA 2ZWLH 1S5SA 1DY9A 3PTNA 3RXGA 2ZI2H 4ABAA 1GPZA 3SNEA 5FCKA 2AIQA 2VWMA 1LVYA 2QXGA 5L30H 1Y3YA 2KAIA 5I25A 3O8DA 1WBGB 2B5TB 1LTOA 1DWCH 2CHAB 2ZP0H 2EC9H 1YPKH 2G52A 4Z0KA 4DVAU 3Q76A 1B0EA 2V3OH 1WAYB 2J95A 1WQVH 1FZZA 3MU5A 1C1SA 1O3AA 5E8EH 1C2LA 1ZTLA 1K21H 4Y7AA 3EGKH 2VH0A 4BTUB 5JBAS 1SR5C 5HM2A 3BTDE 1O3BA 3K6ZA 4OS2A 1SPJA 3ATWA 1LPKB 2ESTE 2Y81A 1GJDB 3BEUA 3ZZ4A 4Y8YA 1MMJN 1HJAC 1P2MA 1QJ6B 4MNWA 4UFEH 4ABGA 1GJBB 2EEKA 2UUJB 3BF6H 5FHTA 3RUOA 2FMJA 3F9HA 5FX6A 2EI8A 4FUGA 4NIYA 2UUFB 3RXDA 1QBVH 1GHYH 5JBBS 1YCPH 2FYRA 5DGJA 2VVUA 4TPYA 5G4BA 1KXAA 2STBE 3U1IB 1K1OA 1AU8A 3Q77A 4YLUA 1CHOF 2ZPQA 4D76A 3LGVA 2BOHB 2QY0B 4X8VH 1Y5UT 3ZVFA 6GCHF 4B74A 1NFYA 2GCHF 2A4OA 2AMDA 1O30A 1EAXA 3A87A 4K8BA 1PQAA 1GMDG 1V2NT 4AFSA 3RXEA 1N8OC 2J92A 4MNXA 1AFQC 1LPZB 4WXIA 3QUMP 4ABBA 4A5TS 1L1GA 6ESTA 1NC6A 2IPHA 2LPRA 1IOEA 3OY5U 3U1JB 1UTQA 2QF3A 1D3TB 1MH0A 1E38B 3M7QA 1LQEA 2BY8X 2GP9B 1E0FD 2QXIA 5C1YA 4WF8A 5AHGH 3F9GA 4B2BA 1CQQA 4IN2A 2CF8H 5LGOA 2ZGXH 3PV4A 1CT2E 2ZFTA 3PWBA 1FJSA 2UUKB 1D4PB 1A3EH 1L1JA 1WU1A 3BTHE 2WPKS 3K9XB 1VCWA 1PPBH 1Q2WA 1KXEA 3PYHA 4U32A 1Z8JB 4MTBA 2FDAA 3I77A 4NSVA 3A8BA 3ZYDA 3M3TA 1GBKA 1KY9A 1FMGA 1THSH 1W8BH 4YOIA 4KELA 3STIA 3TGIE 1O2WA 5JDUB 1EB1H 2THFB 1ZHRA 3L33A 2HNTF 4MPWA 4GCHF 2FYQA 3A82A 1HJ9A 1DUEA 3L6PA 1F5LA 1QA0A 1GCTB 1WYKA 1GI2A 1MZAA 1LHCH 4A1XA 1OYTH 4MNVA 2W7SA 1SGFG 3MWIU 1BTWA 1C1WH 3BTEE 4XBBA 1QL9A 3S9AA 3P8NA 3ZV8A 1P10A 2Z9KA 2BDCA 3I29A 4DT7B 4FU7A 4AFQA 2P59A 1D9IA 1QB1A 4X1QU 2PW8H 3VEQB 3PO1B 1UTNA 2NU3E 1A2CH 1P11E 1J17T 4X0WU 3P8FA 1GBTA 1K1PA 1QB6A 1SGDE 4U30A 1ARCA 2RA3A 2BLVA 1V2UT 3ZVDA 4CRBA 1AWHB 2ZCKP 3BN9A 3A7VA 3T25A 3MO6A 2GTBA 1O3DA 3BIUH 3RXFA 2ZCLP 1J9CH 3MU4A 3T29A 3SU5A 1T7CA 4X2VA 3FZZA 1V6DA 2P8OC 3MNBA 1SOTA 3PLBA 1T8OA 3IG6B 3M5LA 4CRFA 5EOKA 1C5TA 1OKXA 2NWN