2JETC

Crystal structure of a trypsin-like mutant (s189d , a226g) chymotrypsin.
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
93
structure length
93
Chain Sequence
TPEKLQQAALPIVSEADCKKSWGSKITDVMTCAGASGVDSCMGDSGGPLVCQKDGVWTLAGIVSWGSGVCSTSTPGVYSRVTALMPWVQQILE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CHYMOTRYPSINOGEN B CHAIN A
publication title The Crystal Structure of a Trypsin-Like Mutant Chymotrypsin: The Role of Position 226 in the Activity and Specificity of S189D Chymotrypsin.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 12
structure length 93
sequence length 93
ec nomenclature ec 3.4.21.1: Chymotrypsin.
pdb deposition date 2007-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2jetC00
3SHAH 3AASA 1CGHA 1YKTA 2FS9A 2PGQB 1OWKA 1KYNA 3ATLA 4F49A 2FOCA 1ZTJA 3DA9B 5HGGA 4CBOA 3ZVFA 1AUJA 3L33A 2Y7XA 4GSOA 2BY8X 2BDGA 2KAIA 1MQ5A 4K3JA 3CS7A 5FBIA 2G81E 4CRDA 2A2QH 1O3OA 1WAYB 1OSSA 4I8GA 1QCPA 3A8BA 2ZU5A 3HATH 2J94A 1HAYB 1UVSH 1TONA 3M7TA 2IJOB 2HPQH 5DKMA 1LDTT 1C9TA 3GCOA 1DS2E 4DVAU 3SHCH 4RN6A 1ZSKA 3SUFA 2ZU1A 1D6WA 1ZRBA 3AVZA 1O3IA 3NK8A 1TPAE 1GVLA 1UHBA 3QWCH 1W14U 1CT0E 3MO6A 1BBRH 2R3UA 1XUJA 3LOXA 2ZU4A 3ITIA 1P9SA 2AGIX 4ABDA 1NROH 1XVMA 1WQSA 1S81A 1GBJA 2ZFFH 3ZVDA 1IQEA 1A0JA 3ATWA 2J95A 5K7RA 1BBRK 1RIWC 4UONA 3Q00A 1GHAF 3E0NB 5FPTA 2GCHG 1QRWA 1FPCH 1GL1A 1TPSA 3MOCA 4JZ1A 2BLQA 2BY9X 1WU1A 1W0YH 3E90B 2D2DA 2R0KA 4MNXA 1IQMA 1DX5M 3RXHA 1SPJA 2VIPA 4I33A 1A1RA 1MZAA 1LTOA 2ZU3A 3TGIE 1T32A 2FLBH 5EG4A 2AERH 2NU3E 2J92A 1YPMH 1ETTH 1C1NA 2CV3A 1BTZA 1FLEE 3T27A 2CHAC 3BTQE 3SN8A 1MTSA 2ZIQH 1HBTH 3GOVB 1GJDB 4Y7AA 2AS9A 4U32A 1P8VC 1XVOA 1K1NA 1DSUA 2Q6DA 4X0WU 1AU8A 4OS4A 1C5OH 4D7GA 3LGIA 4QT8C 1HAPH 1SGIB 1NZQH 4OS7A 2A4GA 3QO6A 2VIDA 3MU1A 3HKJB 6GCHG 3E91A 1DT2A 2Z3CA 3F9EA 2VVVA 5CHAC 3SQEE 1O2XA 1SHHB 4K2YA 1A61H 5BPEA 1HCGA 1TYNA 4B2AA 2V3HH 1O3DA 3RU4D 1C5RA 2GCTC 4Y8XA 1N8OC 1BTHH 4BAKB 1KLIH 4INLA 1NU7B 5LGOA 2JH5D 1ZRKA 3V12A 1C2IA 3T25A 4OGXA 2PV9B 3FAOA 1S83A 1C2JA 4Y11E 1ZR0A 1EAXA 1D3QB 4AFZA 1KTSB 1O2OA 1AVWA 2KAIB 4U2WA 1S5SA 1YCPM 2HRVA 2F9BH 4XSKU 1TX7A 4IGDA 3HGNA 3RXCA 3LU9B 2G5VA 2FIRH 3URCA 1AN1E 3F6UH 4CBNA 2FWWA 1TMBH 1TPOA 1GMCF 4ISHH 4YM9A 3M5NA 1MCTA 4BTTB 1MTWA 1D3PB 1DXWA 1MH0A 1ZPZA 2R0LA 2O9QA 1GJ7B 1QTFA 4Y10E 3U1IB 3R3GB 5EU8A 4O3TA 4AG1A 4BAMB 1GBFA 2RA0A 3SOSA 5F03A 2SGDE 3UTUH 1BMLA 4Y7BA 1P2JA 1GHXH 4I8HA 1QJ1B 3ZZAA 1G9IE 4UD9H 1C5UA 1PPEE 1ESTA 3TITA 1P0SH 4Q7XA 1LPZB 4I32A 2G4UA 1PYTD 3MH5A 3SGQE 4DURA 3FP6E 5C3NA 1G2LA 3RC4A 1F0TA 1SVPA 4F4OC 1DLKB 1L4ZA 2XBXA 1GBHA 3S7HB 1LHCH 2Y6TA 3KQBA 3P17H 1W13U 4GUXA 8KME2 1O3GA 4UFDH 2P3FH 2ZHEH 1NO9H 3RXOA 1DDJA 4YT7H 6LPRA 1G3DA 4INHA 1ZMJA 1AFQB 4NIVA 3W94A 1O2MA 3SJIA 1KSNA 3MI4A 1ZMNA 1Y5BT 5HM9A 3ZZDA 2BM2A 4CR9A 2D8WA 1S82A 5GXPA 2ZZUH 5F8TA 4NWKA 3LJOA 3PMJA 1MKXK 1ELAA 2QIQA 1BQYA 1VITH 5EXNA 2GDEH 2B7DH 3GICB 5A2MH 1W2KH 3QTVH 5HMAA 2CMYA 1O3NA 4TPYA 4VGCB 1ELVA 3SU0A 1CSOE 3O8DA 2PFEA 1O3MA 3GCHC 2EI6A 1V3XA 2BLOA 3BG4C 1BMMH 2WPLS 1O5GH 1EATA 1AB9C 1EQ9A 2IPHA 2TIOA 1S0QA 3SGBE 2A7HA 1K1PA 1X7AC 2BOKA 1BA8B 3BTGE 3RXEA 3QK1A 2AMPA 2R2WU 4K8BA 1AO5A 4I31A 1O3HA 3RXKA 3U8RH 3SUDA 2A5KA 4BOHA 3OU0A 1ZGVA 2VIQA 3F9HA 1GMHG 3V13A 3SNDA 1AD8H 1E36B 2WPHS 1BMAA 3BV9B 1CT4E 6CHAB 7LPRA 5EW2H 3TPIZ 3TLOA 2ZFQH 1TIOA 1UK4A 2RCEA 4UFFH 2GV6A 3M5LA 1PQ7A 2ZDAH 1GHWH 1QB9A 2OXSA 5TCCA 1DVAH 1C2DA 2QA9E 1GI5A 1IHTH 4NIWA 2ANKH 4FUBA 2VGCB 1OX1A 1W7GH 2I6SA 4O3UA 4RKJB 2UUKB 1SGNE 3UIRA 4LXBH 1TLDA 4GCHF 3GY8A 2XYAA 1DPOA 3DHKH 1ARCA 1LQDB 1A5HA 1LVYA 1ID5H 4BXSA 1P2MA 2FEQH 3AW0A 3O8BA 3MO3A 1HB0B 1O0DH 5A8ZA 3FFGA 3KHVA 3TK6A 1V6DA 2WPKS 1O31A 3BTHE 1A5IA 3TH4H 1O2PA 2ZHQH 3A7WA 3HK3B 3LDXH 1HFDA 1GJ5H 1ABJH 4K69A 2BLWA 1JIRA 1G32B 3NUMA 4O9VA 2P59A 4UEHH 1ABIH 4TWYA 2GKVE 3S7KB 1B0EA 1ZSJA 4ISLA 1PPHE 1K1LA 1THRH 4B75A 1ORFA 1C5WB 1PQ5A 3LH1A 1EPTC 3SGAE 3TGJE 3KN2A 1EZQA 5A09A 2RG3A 1KDQB 4CREA 4WMEA 3AAVA 3GYMA 5EODA 1GHBG 3RXJA 3D62A 1HIAB 3ODFA 1T7CA 1CBWC 1ZPBA 1L4DA 3HGPA 2AIQA 5EQQA 5FCRA 3KQEA 2BY5X 1SC8U 3M35A 5C5NA 1HAZB 1KXBA 1BJVA 3UPEA 2OINA 1KXAA 3GCTF 1C2EA 4NA8A 4OS6A 1NRPH 1EZXC 4X1RU 5DP4A 5JBBS 2JH6D 1TWXB 3Q3KA 7KMEH 2G51A 5C20A 4WXVA 2UUJB 4THNH 2FTMA 2OBQA 1XX9A 3BF6H 4DCDA 1BRCE 1YPEH 4AFUA 4ABJA 4D76A 4ZAEA 3SJOA 1V2VT 1CO7E 1K1IA 3RMMH 2Q6FA 1RIWB 1BCUH 3PMAB 1GBLA 1K2I1 2FOBA 2HALA 3MHWU 3QDZB 5E2OA 4CH2B 2TGTA 3H7OA 3LIWA 3ZVAA 4ZKOU 1E38B 1SOZA 1YGCH 1EKBB 4FUEA 4WXIA 1BT7A 1MKWH 1MBMA 4TY6A 2Y5GA 2C93B 1LVMA 3MU0A 3U8OH 2WV5A 2GT7A 3K9XB 1XUGA 2FI5E 2FOGA 2ZGHA 1O3KA 2ZDVH 5JYIA 1GI7B 3BTTE 3TJUA 3LC5A 1ZZZA 5DJ7A 3BTME 5EPYA 1O2VA 1Y8TA 4X1SU 1MAYA 1NT1A 2VWLA 6ESTA 3LC3A 1SGDE 1C1PA 1CHOG 1Z1IA 3MMGA 2SGPE 1XXFA 2FESH 5TCAA 3L3TA 1O2TA 2V0BA 1IQLA 2PKSC 1E34B 2ZGXH 4YLUA 5J4QA 3RDZA 2ZF0H 1RJXB 4O97A 4CRFA 3QTOH 1SQOA 3O8CA 2EI7A 1PPBH 2BTCE 3PM3A 4FUIA 3LJJA 3OYPA 2VWNA 1TGBA 2BYAX 3ZYDA 4IMQA 5JDUB 4BXWA 2TGPZ 4Z0KA 1BZXE 1GI9B 3SUEA 2OC1A 1FNIA 2QXHA 4AB9A 1VJAU 1DXPA 1A0HB 3SV6A 3SJ9A 3B8JA 2NU0E 4O03A 1BB0B 2SNWA 1DSTA 3A88A 4CHAB 1V2KT 4FUCA 3UREA 3SORA 1AVGH 5AFYH 1V2ST 1P2OA 2ZG0H 3A7ZA 1L1GA 1A3EH 1PPZA 3MH7A 2P95A 5HM2A 1HAIH 4X8TH 5GDSH 1AI8H 1HAVB 2FXRA 1FAKH 1P2IA 3KGPA 2QV1A 2XW9A 1FY4A 1ANDA 1C5TA 4X2WA 4X8VH 4HTCH 4JYUH 1KXCA 2Z3EA 3T62A 1PJPA 1GBEA 3MYWA 1C2LA 1QBNA 1GG6C 2PLXA 2R9PA 4XBDA 2ZDMA 3QX5H 3TU7H 3RXGA 1GI0A 1V2WT 3M5OA 1SGTA 1NU9A 1Z1JA 2OLGA 1Q31A 2YNBA 2C8YB 2ZQ2A 1MBQA 4JYVH 5LPEA 2AEIH 1A7SA 3ZZ5A 5FBEA 1FY8E 1O2YA 2TGDA 2BY6X 3DUXH 2FX4A 2SGQE 2THFB 3GDUA 1UVOA 3SU2A 1SFQB 2GZ7A 1YPHC 1WTGH 3EQ0H 1HXFH 3LGTA 4K8YA 1HYLA 2A7CA 4Z6AH 1T31A 1O3PB 2OC7A 5CE1A 2PSXA 3P95A 4AZ2B 3SI4H 1GJ6A 5FCKA 1XUFA 1FI8A 3MWIU 1TGTA 3ODDA 4ABIA 2F9UA 1EX3A 2A4QA 1C1MA 1HAXB 1O5DH 3RXIA 1RTFB 1AHTH 5FXLA 4MQAA 4AG2A 4BNRA 5FAHA 2GD4B 1EPTA 1RS0A 4YOJA 3ZVEA 4BAOB 1CT2E 1UK3A 4NGAH 1BTWA 1TALA 1IQGA 4NWLA 2ZPQA 1A46H 1NPMA 5AHGH 1VITF 1WCZA 1TMUH 1UVUH 3FVFB 1Y3WA 1GI3A 3DFJA 1SGEE 3RXRA 2OCVB 4KTUA 4X8UH 2A45B 4U30A 3RXLA 1EAWA 3TGKE 1MAXA 1C5MD 3KEEA 1VCPA 3QN7A 1S84A 1O36A 4INKA 1ARBA 4Y79A 7ESTE 3BG4B 2OQ5A 1VR1H 1JIMA 1FAXA 4JZFH 3RMNH 1C1UH 1O34A 3SU4A 1XKBC 1QQUA 3VGCC 3JZ2B 4AFQA 1FUJA 2F91A 3A84A 2PUXB 1P2NA 1BRAA 3F68H 5G4BA 1DWEH 2UUYA 5LPRA 1ANEA 2ANMH 1IQNA 1HPGA 5J4SA 1HDTH 2BLVA 2BD3A 1EOJA 5JBCS 4AX9H 1KLJH 1O2SA 2VVUA 1G3CA 3P8GA 5C1XA 1FMGA 3VB3A 2P93A 1OWIA 3RLWH 3U69H 4ZHLU 2IN2A 2QYIA 2W5EA 3D65E 2TRMA 4RKOB 2O8TA 1VJ9U 2YNAA 3STIA 4X1QU 5T6DA 1GHVH 2ZGJA 1TNKA 1OPHB 3D49H 3RMLH 3ZZ8A 1AVXA 1SGPE 4Y76A 1ZLRA 1UTLM 4SGAE 4ZMAH 1LPKB 3LT3A 2FZZA 3SU5A 1SR5C 1F7ZA 2OBOA 4NCYA 2PW8H 2STBE 3UUZA 1ZHMA 2O8LA 1G37A 5L6NH 1OOKB 3MU4A 4DOQA 1AFEH 1YCPK 1D3DB 1QRZA 2P16A 5L2ZH 2CF8H 1G3EA 2GCHF 1MD8A 3UWIA 1UJ1A 2P8OB 5F8XA 1SBWA 2ZTXA 1MU6B 5A0BA 1A4WH 1D6RA 1O3AA 1SOTA 2ZFTA 4YZUA 1GJ8B 4MPVA 2XCFA 1QGFA 8GCHG 1FZZA 1C5SA 1XXDA 3IWMA 4HZHA 1V2MT 1DY8A 4BTUB 4WH6A 4AOQA 5ABWA 9LPRA 1GDUA 4DIIH 4XBBA 1LPGB 4IN1A 2Z6BD 1GMCG 2CXVA 1ELBA 3NPSA 2H2ZA 5PTPA 1F5RA 3SNAA 2Z7FE 2Z9LA 2ZO3H 5JBAS 3BTKE 1W12U 2ZECA 5C67A 5DGJA 2H9HA 3GYLB 3PMHB 2QC2A 1O5FH 1TA2A 3FANA 1YPLH 3T29A 1Y3UA 5GCHG 1UTPA 4CRGA 5A0AE 1C5PA 2A2XH 4K1SA 3PB1E 2ALVA 2VB0A 2W7UA 1NC6A 3FZDA 1ELFA 1P02A 1IQFA 1TBZH 3KL6A 6GCHF 3FP8E 3NCLA 1P10A 3UNQA 1GI4A 3GY3A 4BAHB 2F9NA 5GJ4B 3ZVBA 5F6MA 2SGFE 3E0PB 1IOEA 1KXFA 4OS1A 4I7YH 1QL8A 1F0SA 1DUEA 1UHBB 1XUKA 2Z9JA 3BG8A 4Q2KA 4Y6DA 5GIBA 1XKAC 3TK5A 2Y7ZA 2ASUB 2AGEX 1MUEB 3QLPH 4J2YB 4KP0A 1SGFA 4AYYB 1TNLA 1T4VH 1TFXA 3G01A 1EUFA 2HNTF 1K22H 5FPSA 1VGCC 1DUAA 1EJNA 1B5GH 1Z8RA 4AN7A 1MZDA 2FLRH 1Y59T 4NFFA 1O3JA 1PQAA 1LMWB 2NU1E 4FVDA 1TPPA 1QBOA 3A87A 1Z8IB 3STJA 2VIWA 2XC0A 2BVRH 1Z8GA 1VZQH 1G3BA 3LGYA 1UTNA 3GY2A 2FTLE 3RU4T 1P9UA 3E8LA 2J2UA 1V2NT 1SGQE 3V0XA 2F9OA 4ABGA 1RTKA 3M37A 2XWBI 1TGCA 3SJ8A 3ELAH 5TJXA 1N6XA 4LZ1H 2SNVA 1J16A 2BDAA 3CS0A 1O2RA 1MKXH 2PKSB 4I8JA 2DE8A 1Z7KA 1E37B 2H6MA 2OQUA 1GWAA 4B73A 2QY0B 3ATMA 3GDSA 3KNXA 2ZA5A 1W11U 2ZDNA 1HJAC 3EA9A 3P70B 2BD9A 1U6QA 1V2LT 5JPMH 1HAOH 2ZC9H 4TWWA 3A7VA 3TJVA 3BEIB 1DFPA 1BTPA 3P8OA 1EAUA 1TX8A 2FI4E 5AFZH 1UTMA 4B71A 4NSYA 3QGNB 1CA8B 3A82A 5E0JA 4GHQA 1F0RA 5DK1A 2C3SA 1V2PT 1ZMLA 5FHTA 2PTNA 1D9IA 1H8IH 1LVOA 3UWJH 1QJ6B 5DO4H 1DICA 4DJZB 5IYTA 3RXSA 3SJKA 3TVJB 2H9TH 2WPMS 3B23B 1O3FA 4E7RG 1DM4B 2BVSH 1FONA 3A7TA 4GCHG 1SLWB 2VVCA 2GV7A 3SO3A 3LH3A 3DD2H 2HGTH 4WWYA 2BMGB 4BTIB 1AMHA 3VEQB 3ESTA 1LKBA 1ELTA 3MH4A 4ZUHA 2ZGCA 2XBWA 1RXPA 1PYTC 1TOCB 2OUAA 1SSXA 1UCYE 3BSQA 1TBQH 2VWMA 5GWZA 2A32A 1O2NA 1GCTB 2UWPA 2VIVA 1EB1H 4MTBA 3GY6A 1C2GA 1T8LA 3M3VA 4A6LA 2BB4A 3Q77A 1QFKH 3BEUA 3TNSA 1ANBA 1SQAA 3A7XA 1MTNC 3LGUA 3A8CA 3EA8A 1O5EH 3SV7A 4HFPB 1CGIE 3U98H 1P01A 1WQVH 1C9PA 1B7XB 3NZIA 1VCWA 4LZ4B 3T28A 1AWFH 3F9FA 1GMHF 1FN8A 1AZZA 1YPJH 4AGJA 3UNRA 4NZQA 2AMDA 4Q7ZA 2ZFRH 2XBYA 4M7GA 2W3KA 1C1TA 4JMYA 2ULLA 3UOPA 1LHGH 1GHYH 1O3EA 4GVUA 3BIVH 1EP5A 8LPRA 4X2XA 1L1JA 3TH2H 4CRCA 3VXEH 4R0IA 4IC5A 1P12E 3BTFE 1KIGH 1L2EA 4OS2A 1Z6JH 4X6OA 1CU1A 2PSYA 1O5BB 1H4WA 1THPB 1EXFA 1AZ8A 2P94A 4X2VA 1EJMA 2TPIZ 1RD3B 1INCA 1O3BA 2OC0A 1A0LA 1C5VA 2QXGA 3A8AA 1A2CH 3V3MA 4ZHAA 1P57B 3RLYH 5HXFA 4E7NA 1NN6A 1BJUA 1TBRH 2BDYA 1YP9A 1SHYA 3H5CB 3LONA 1CA0C 3QGJA 1J15A 2ZKSA 1TNGA 1ESAA 4NA7A 3KIDU 1ZJDA 1GBMA 1BITA 2A4OA 4DW2U 4B76A 3F1SB 3IG6B 1QRXA 5T6GA 1NY22 1CGJE 2G55A 1FIZA 1TGSZ 3FZZA 1E0FD 1RFNA 5DP9A 3AAUA 4MLFB 1HUTH 1SLXB 1EOLA 2BXUH 1YPKH 4CR5A 4E06H 4ASHA 1HRTH 5EXMA 1GHBF 4LK4A 1V2JT 3EYDA 3RXUA 4ZXXH 2CHAB 2Q6GA 1Z8JB 3EA7A 4OGYA 5LH8A 1GL0E 2PHBA 1ZHRA 1O5AB 2ZTZA 1F92A 4NA9H 5E0GA 3SBKA 1O3LA 4DT7B 1ZPCA 1XUIA 1P3EA 5EPNA 1QQ4A 3BEFB 1HGTH 1O2GH 1OKXA 2XNIA 2Z9IA 3L6PA 1O2JA 5C1UA 1O35A 1ETSH 1QA7A 5B6OA 1FY3A 1NTPA 4XDEA 5T3HA 4MPXA 2C8XB 1GJBB 3A83A 5CHAB 3BN9A 3LKWA 1BHXB 4TY7A 1GJCB 1GMDF 5E8EH 1BOQA 1WUNH 1V2QT 3A81A 1NRSH 3NXPA 4I8KA 4IS5A 3P6ZB 1BRUP 1O3CA 1GHZA 4FUDA 2GCTB 3ZVGA 1N8OB 4RSPA 1K28D 2H1UA 2PTCE 2K1QA 1AFQC 3E6PH 1GJ4H 4WY3A 2CJIA 2PUQH 4ABBA 1FIWA 1PPCE 3RU4E 2BDCA 1DWCH 2A4RA 3LGWA 1QB1A 2QN5T 2BD7A 2O8MA 3PTBA 2ESTE 3E1XB 4PROA 4WMFA 1C1SA 3ZZ4A 4A1VA 1OYTH 2BDHA 2Y81A 3TNTA 3M3SA 1C2MA 3TJNA 2O8WA 3BIUH 4E05H 2XWAA 1CHOF 3M3TA 2XTTB 3MTYA 3WY8A 3QUMP 1QA0A 3SV8A 2XBVA 3VB6A 2A31A 3FP7E 1BRBE 1G36A 5DP6A 3Q3XA 7GCHG 5FX5A 1ETRH 4TYDA 3OY5U 3MU5A 3OX7U 2GMTC 1ELCA 1HAGE 2B0FA 3ZV8A 3MU8A 4WH8A 2H9EH 1Y3YA 4X6NA 2UWLA 3S0NA 1UCYK 1GGDC 3KCGH 1QURH 1AE8H 3DFLA 5DG6A 1BTUA 4HGCA 1P05A 2XC5A 1GPZA 4ZKSU 5C2ZA 2F9VA 4J1YA 4A1TA 2C4FH 2CGAA 4X1PU 4X6MA 1K9OE 1W0ZU 1FY5A 1GCDA 2J4IA 3ZZCA 2Z9GA 4K5ZA 1C1VH 1NFWA 6CHAC 1CQQA 5A8YA 2B9LA 4NIYA 1F0UA 1AWHB 2FYRA 1OWDA 2LPRA 2QXJA 2BD5A 1THSH 3VFEA 1OYQA 1ZGIA 5E0HA 2GZ8A 2VGCC 1FJSA 1VITG 1EAIA 1PFXC 1IHSH 2ZU2A 2ZFPH 4YO9A 4WJG2 4KGAA 1O30A 5DP5A 3VPKA 2BXTH 4FUHA 4OS5A 3QZRA 2HOBA 2Y80A 5AVDA 1GJAB 1J14A 4CRAA 1NFXA 1IQHA 1YYY1 4IW4E 3CENA 4MDSA 3LPRA 3SU6A 1K1MA 2ZQ1A 2BHGA 1WV7H 2HNTC 4MG3A 2R2MB 3RXAA 2Y5HA 5AF9H 2HLCA 4KELA 2BD8A 1SG8B 2BX3A 2VWOA 2ZDLA 1C1RA 1RRKA 3RC6A 2Z94A 1HJAB 1B0FA 2UUFB 3RC5A 2V3OH 1NFYA 4FUFA 2G4TA 2NWNA 5A0CA 1YC0A 4H4FA 5EOKA 2EI8A 1AE5A 1SGCA 3TK9A 2FYQA 2WUBA 4JZEH 4NZLA 1QB6A 5DP7A 3RXDA 1GHAG 3ZZBA 4D9QA 2FS8A 3GCHB 4XFQA 1UTQA 1C4Y2 3W95A 1BUIA 1EZUC 1SLUB 4X2YA 1G30B 3GISB 4YT6H 1AB9B 1JRTA 3GCNA 4XE4A 2OTVA 1V2RT 2TBSA 5C1YA 1ZHPA 4KTSA 3CP7A 1OP0A 1MTVA 2Q1JA 1ZYOA 2ODQA 4WMDA 1AY6H 4NIXA 3HK6B 3V7TA 1FY1A 4JZIA 3MH6A 2A5AA 3NKKA 1HV7A 2FI3E 4Y8ZA 1DITH 3VXFH 1MD7A 3C27B 1P03A 3RUOA 4A1XA 1EB2A 2PGBB 2Z3DA 4X6PA 3UQOA 3MNCA 2FPZA 1YBWA 3PWCA 1N1LA 1JXPA 1OP8A 1CE5A 2UWOA 2J9NA 3A80A 2ZHFH 1TB6H 4FVBA 1QL9A 3ZV9A 1YLDA 2FOHA 3RXMA 2CN0H 1UVPA 2C8WB 1YCPH 4UFEH 1J8AA 1SQTA 2F3CE 3M7QA 1XUHA 1GBBA 1K1OA 3QZQA 1S6HA 1MTNB 2VU8E 3U8TH 4A5TS 4ISOA 3MNXA 5L2YH 1O2LA 1KY9A 4YLQH 5SGAE 1KXDA 2AGGX 4ZXYH 5BRRE 1Q3XA 2A1DB 1OXGA 2C90B 2STAE 1ESBA 4ZKRU 2BZ6H 1LKAA 4HI3A 3PLKA 4UFGH 2W7SA 3ATIA 2XXLA 4D9RA 3K6ZA 1HJ9A 4GLYA 1TNHA 1YM0A 3PO1C 4MVNA 3U1JB 3RXPA 5DP8A 2GTBA 4JYTA 1AGJA 2ZHWH 5C5OA 2GGVB 2ZPRA 2XRCA 3SNCA 1MQ6A 3EGKH 4Q80A 4GAWA 1UVTH 1P06A 5LPFA 4MPUA 2AIPA 2OC8A 1C1OA 3M5MA 3RXQA 1BTXA 1ZJKA 1SI5H 3D23A 1EPTB 2ODPA 4JK6A 4ABAA 5EQRA 1SGFG 2JETC 1TOMH 5EQSA 1OS8A 1TQ7B 2PR3A 1O39A 2VNTA 4Y71A 5DPAA 4AB8A 1LCYA 3Q3YA 4R8TB 1O2IA 1UK2A 2G52A 1CBWB 1WSSH 4UE7H 1O2UA 1LHFH 2PWXA 2D1JA 1M9UA 2SGAA 1WTHD 1DANH 1GDQA 3EDXB 1CA0B 1TMTH 1ZSLA 4BANB 1DLEA 5FX6A 3PLPA 4CHAC 2ZNKH 1BMNH 2ZP0H 8GCHF 2W3IA 2A0QB 1O37A 1ZTKA 1O2KA 2ANWA 1O2HA 3MNBA 1QHRB 1GBIA 1OWEA 3IITA 4D7FA 1T4UH 1H1BA 3ENSB 1GDNA 1YF4A 4LOYH 4Y0YE 1PQ8A 2D26C 2AYWA 1C5LH 4FU7A 3T2NA 1MCVA 2JKHA 3K65B 2ANYA 5CMXH 2WPJS 1K21H 1QIXB 3R0FA 3UNSA 4IMZA 4B2BA 3SW2B 2A5IA 5GCHF 3A89A 3HPTB 1FPHH 3AW1A 3MFJA 2VH6A 1W8BH 1NRNH 3SQHE 1ACBE 1E35B 2H5CA 3MNSA 2BD4A 2ALPA 1XM1A 3P8FA 1T8MA 1ELEE 1NRRH 4MNVA 3ZVCA 2BOHB 2FX6A 3NWUA 1QBVH 2GP9B 4K60A 2ZDKA 1TX6A 2BZAA 3I29A 1S85A 2WINI 5E2PA 1F5LA 1TNJA 4U01A 1TAWA 1P2KA 1YPHE 5F8ZA 4B2CA 1P2QA 4A7IB 4IC6A 2QGRA 1H9LB 3PTNA 3E16B 3A8DA 3VB4A 2PKAA 2AMQA 5I46H 1K1JA 1TE0A 3BTWE 3RXBA 1OWJA 5JB8S 1NFUA 5K0HA 1HLTH 4DIHH 4ISNA 1GBAA 1TA6A 4FUJA 1L0ZA 1MU8B 3UR6A 2BQ7B 5EGMA 1KDQA 2I6QA 4MPWA 2DE9A 3A85A 1HIAA 2HNTE 5ESTE 3SI3H 1DOJA 1V2TT 3PV4A 1GI8B 2LNCA 3SU1A 1DWDH 4NSVA 2F9PA 1TABE 1FN6A 4WF8A 2BD2A 2GX4A 1SGYE 1D3TB 3UFAA 2ZCKP 3S9BA 1CVWH 2A7JA 1GBKA 3PROA 3TH3H 1AIXH 1C2HA 4H6SB 1DY9A 1Z6EA 1O2QA 4NFEA 1IQJA 3VB5A 1S0RA 3RXVA 2GMTB 4DY7B 2XCNA 1C1WH 1T8NA 1UTOA 3RMOH 1OWHA 3ZZ9A 1GGDB 1C5YB 1PPGE 3BTDE 1GG6B 1TNIA 2W26A 4H42U 3LGVA 2H5DA 2FP7B 4XBCA 3DT0H 2AFQB 5EXLA 2FODA 5I25A 1AKSA 2ZGBH 3EE0B 4KKDA 4Y0ZE 1RGQA 1O2ZA 4K1EA 2SFAA 2V35A 2G5NA 2GDDA 2Y5FA 1ELDE 4AORA 1HJ8A 1F5KU 1V2UT 1QL7A 2CF9H 2GVFA 2P3UB 1LO6A 1SL3A 4JZDH 1DWBH 1IAUA 3SZNA 1GI1A 5DP3A 4B74A 1NESE 3RM2H 2QXIA 1EASA 1BHXF 1JRSA 4JK5A 1SMFE 2WPIS 5A8XA 2BY7X 3URDA 2ZCLP 4IN2A 3C1KA 2G8TA 4TPIZ 4DGJA 1HAHH 3ATKA 1ANCA 3UY9A 2Z9KA 1LVBA 1HXEH 1TGNA 2BQWB 1O32A 3A7YA 3B9FH 4ABHA 1O33A 3H7TA 3SUGA 9ESTA 1V2OT 2WV4A 3GCTG 3GY7A 1C2KA 2P8OC 1HNEE 3SNBA 1O2WA 4AFSA 2ZI2H 1QR3E 1C2FA 1LHDH 1W10U 1Y3VA 2TGAA 3I77A 2BVXH 5ESBA 3UR9A 1JWTA 3PYHA 2FMJA 8ESTE 2B8OH 1A5GH 3HKIB 3GDVA 2J34A 1PPFE 1IQIA 2PKAB 1O38A 3U9AH 4MNWA 3RXFA 1GI2A 2BQ6B 4DG4A 4ZROA 1ELGA 1H8DH 3VGCB 1KLTA 4UDWH 3K2UA 3Q76A 2NU4E 3ZZ3A 2QF3A 2F83A 1HAVA 1BDAA 2M5TA 2WYGA 2FOAA 1VCQA 4FXGH 3M7UA 3MO9A 2O8UA 4YOGA 2G00A 1LHEH 4XOJA 1MTUA 2ZTYA 2ODYB 2BX4A 3JZ1B 4YESB 4KTCA 2FOMB 1FDPA 1S6FA 3KQDA 4X8SH 5EW1H 3S9CA 2RDLA 4ABEA 1JMOH 1NRQH 2VH0A 1GBTA 3KQCA 3PMBB 1EP6A 2FOEA 1NS3A 1P09A 2ZCHP 1Y3XA 3I78A 1C1QA 4BAQB 4D8NA 2ZEBA 1WBGB 1AUTC 3S9AA 1RTLA 1GJ9B 4ISIH 4SGBE 1TQ0B 3ZZ6A 2YOLA 1SB1H 1GBCA 5GPIB 3VB7A 5T6FA 2JH0D 3T5FH 2HVXA 3GY4A 1BBRE 4YTAA 4CH8B 3N7OA 1GMDG 2VINA 1UTKA 1C5ZB 1GVKB 1C5QA 3T26A 1KTTB 4JCNA 1SFIA 3P92A 2NU2E 3KF2A 3O8RA 1AKSB 3TJOA 4NG9H 2SGEE 1MKWK 1UMAH 1FQ3A 1ZTLA 1TRNA 1Z71A 2B5TB 2RA3A 3BTEE 4Y8YA 2EEKA 3ZYEA 1H9IE 1KXEA 5H4IB 3PO1B 1Y5AT 1W3CA 1TRYA 4WVPE 4ZHMU 1P3CA 2R3YA 2OP9A 1D4PB 5ETXA 1A3BH 4MNYA 2Y82A 2QAAA 2FM2A 1C4U2 3SV9A 3M61U 1MMJN 1AQ7A 3TIUA 3M36A 1FXYA 1F2SE 2JETB 1QNJA 1Y5UT 3A86A 2XC4A 2V6NA 1J9CH 1GVZA 1WYKA 1GI6A 1GBDA 4X1NU 3S69A 1G2MA 1L1NA 4VGCC 3SNEA 1LQEA 1OP2A 1UCYH 4A92A 1CHGA 2GT8A 4GPGA 2OD3B 2WUCA 3EAJA 3GY5A 4K1TA 3ZZ7A 2ZWLH 4H6TA 1IQKA 1FV9A 5FPYA 2ZPSA 2WYJA 5L30H 1C5NH 2DUCA 1EZSC 3OSYA 2FO9A 2ILNA 4ZH8A 2HWLB 2GZ9A 1H9HE 1DE7H 2AH4X 2P3TB 5HYOA 3RXTA 1SLVB 2J38A 3E3TA 2C8ZB 1YLCA 1XMNB 3K6YA 4I8LA 4FU9A 2EC9H 3SU3A 3PWBA 2VJ1A 1NM6A 1VGCB 3RP2A 4ZKNU 5JB9S 3SV2H 5JBTA 1UTJA 2FDAA 1WOFA 3PLBA 1Q2WA 2EA3A 1BIOA 4FU8A 1JBUH 2QCYA 1J17T 3P8NA 4B1TA 1T8OA 1JOUB 1SGRE 5IDKA 1O5CB 3OTJE 1P04A 1YPGH 4IBLH 7GCHF 4Q7YA 1GCTC 4FUGA 4GHTA 4ABFA 1ZOMA 2FOFA 2QF0A 2IOTA 1BTYA 2ZFSA 3UOUA 3F9GA 2BDBA 2VIOA 4YOIA 1P11E 3RM0H 1C5XB 2BDIA 1W7XH 3UQVA 1C4V2 1QJ7B 1N6YA 4AYVB 4ESTE 1EJAA 4AGKA 1TRMA 2ZHDA 4CRBA 2HPPH 3OY6U 1UO6A 1QY6A
chains in the Genus database with same CATH superfamily
3SHAH 3AASA 1CGHA 1YKTA 2FS9A 2PGQB 1OWKA 1KYNA 3ATLA 4F49A 2FOCA 1ZTJA 3DA9B 5HGGA 4CBOA 3ZVFA 1AUJA 3L33A 2Y7XA 4GSOA 2BY8X 2BDGA 2KAIA 1MQ5A 4K3JA 3CS7A 5FBIA 2G81E 4CRDA 2A2QH 1O3OA 1WAYB 1OSSA 4I8GA 1QCPA 3A8BA 2ZU5A 3HATH 2J94A 1HAYB 1UVSH 1TONA 3M7TA 2IJOB 2HPQH 5DKMA 1LDTT 1C9TA 3GCOA 1DS2E 4DVAU 3SHCH 4RN6A 1ZSKA 3SUFA 2ZU1A 1D6WA 1ZRBA 3AVZA 1O3IA 3NK8A 1TPAE 1GVLA 1UHBA 3QWCH 1W14U 1CT0E 3MO6A 1BBRH 2R3UA 1XUJA 3LOXA 2ZU4A 3ITIA 1P9SA 2AGIX 4ABDA 1NROH 1XVMA 1WQSA 1S81A 1GBJA 2ZFFH 3ZVDA 1IQEA 1A0JA 3ATWA 3OTPA 2J95A 5K7RA 1BBRK 1RIWC 3N7EA 4UONA 3Q00A 1GHAF 3E0NB 5FPTA 2GCHG 1QRWA 1FPCH 1GL1A 1TPSA 3MOCA 4JZ1A 2BLQA 2BY9X 1WU1A 1W0YH 1YY3A 3E90B 2D2DA 2R0KA 4MNXA 1IQMA 1DX5M 3RXHA 1SPJA 2VIPA 4I33A 1A1RA 1MZAA 1LTOA 2ZU3A 3TGIE 1T32A 2FLBH 5EG4A 2AERH 2NU3E 2J92A 1YPMH 1ETTH 1C1NA 2CV3A 1BTZA 1FLEE 3T27A 2CHAC 3BTQE 3SN8A 1MTSA 1YLNA 1MABB 1HBTH 2ZIQH 3GOVB 1GJDB 4Y7AA 2AS9A 4U32A 1P8VC 1XVOA 1K1NA 1WDIA 1DSUA 2Q6DA 4X0WU 1AU8A 4OS4A 1C5OH 4D7GA 3LGIA 4QT8C 1HAPH 1SGIB 1NZQH 4OS7A 2A4GA 3QO6A 2VIDA 3MU1A 3HKJB 6GCHG 5C0TA 3E91A 1DT2A 2Z3CA 3OEHD 3F9EA 2VVVA 5CHAC 3SQEE 1O2XA 1SHHB 4K2YA 1A61H 5BPEA 1HCGA 1TYNA 4B2AA 2V3HH 1O3DA 5KGOA 3RU4D 1C5RA 2GCTC 4Y8XA 1N8OC 1BTHH 4BAKB 1KLIH 4INLA 1NU7B 5LGOA 2JH5D 1ZRKA 3V12A 1C2IA 3T25A 4OGXA 2PV9B 3FAOA 1S83A 1C2JA 4Y11E 1ZR0A 1OHHD 1EAXA 1D3QB 4AFZA 1KTSB 1O2OA 1AVWA 2KAIB 4U2WA 1S5SA 1YCPM 2HRVA 2F9BH 4XSKU 1TX7A 4IGDA 2LELA 3HGNA 3RXCA 3LU9B 2G5VA 2FIRH 3URCA 1AN1E 3F6UH 4CBNA 2FWWA 1TMBH 1TPOA 1GMCF 4ISHH 4YM9A 3M5NA 1MCTA 4BTTB 1MTWA 1D3PB 1DXWA 2GJGA 1MH0A 1ZPZA 2R0LA 2O9QA 1GJ7B 1QTFA 4Y10E 3U1IB 3R3GB 5EU8A 4O3TA 4AG1A 4BAMB 1GBFA 2RA0A 3SOSA 5F03A 2SGDE 3UTUH 1BMLA 4Y7BA 1P2JA 1GHXH 4I8HA 1QJ1B 3ZZAA 1G9IE 4UD9H 1C5UA 1PPEE 1ESTA 3TITA 1P0SH 1E1QD 4Q7XA 1LPZB 4I32A 2G4UA 1PYTD 3MH5A 3SGQE 4DURA 3FP6E 5C3NA 1G2LA 1UW7A 3RC4A 1F0TA 1SVPA 4F4OC 1DLKB 1L4ZA 2XBXA 2K8IA 1GBHA 3S7HB 1LHCH 2J97A 2Y6TA 3KQBA 3P17H 1W13U 4GUXA 8KME2 1O3GA 4UFDH 2P3FH 5EJZA 2ZHEH 1NO9H 4RT0A 3RXOA 1DDJA 4YT7H 6LPRA 1G3DA 4INHA 1ZMJA 1AFQB 4NIVA 3W94A 1O2MA 3SJIA 1KSNA 3MI4A 1ZMNA 1Y5BT 5HM9A 3ZZDA 2BM2A 4CR9A 2D8WA 1S82A 5GXPA 2ZZUH 5F8TA 4NWKA 3LJOA 3PMJA 1MKXK 1ELAA 2QIQA 1BQYA 1VITH 5EXNA 2GDEH 2B7DH 3GICB 5A2MH 2YMSD 1W2KH 3QTVH 5HMAA 2CMYA 1O3NA 4TPYA 4VGCB 1ELVA 3SU0A 1CSOE 3O8DA 2PFEA 4XD7D 1BMFD 1O3MA 3GCHC 2EI6A 3F2GA 1V3XA 2BLOA 3BG4C 1BMMH 2JJ1D 2WPLS 1O5GH 4RT1A 1EATA 1AB9C 1EQ9A 2IPHA 2TIOA 1S0QA 3SGBE 2A7HA 1K1PA 1X7AC 2BOKA 3FOAA 1BA8B 3BTGE 3RXEA 3QK1A 2AMPA 2R2WU 4K8BA 1AO5A 4I31A 1O3HA 3RXKA 3U8RH 3SUDA 2A5KA 4ACBA 4BOHA 3OU0A 1ZGVA 2VIQA 3F9HA 1GMHG 3V13A 3W1EA 3SNDA 1AD8H 1E36B 2WPHS 1BMAA 3BV9B 2CK3D 1CT4E 6CHAB 7LPRA 5EW2H 3TPIZ 3TLOA 2ZFQH 3VG8A 1TIOA 1UK4A 2RCEA 4UFFH 2GV6A 3M5LA 1PQ7A 2ZDAH 1GHWH 1QB9A 2OXSA 5TCCA 1DVAH 1C2DA 2QA9E 1GI5A 1IHTH 4NIWA 2ANKH 4FUBA 2VGCB 1OX1A 4FOUC 1W7GH 2I6SA 4O3UA 3EE7A 4YXWD 4RI0A 4RKJB 2UUKB 1SGNE 3UIRA 4LXBH 4F48B 1TLDA 4GCHF 3GY8A 2XYAA 1DPOA 3DHKH 1ARCA 1LQDB 1A5HA 1LVYA 1ID5H 4BXSA 1P2MA 2FEQH 3AW0A 3O8BA 3MO3A 1HB0B 1O0DH 5A8ZA 4ASUD 3FFGA 3KHVA 3TK6A 1V6DA 2WPKS 1O31A 3BTHE 1A5IA 3TH4H 1O2PA 2ZHQH 3A7WA 3HK3B 3LDXH 1HFDA 2XNDD 1GJ5H 1ABJH 4K69A 2BLWA 1JIRA 1G32B 3NUMA 4O9VA 2P59A 4UEHH 1ABIH 4TWYA 2GKVE 3S7KB 1B0EA 2JIZD 1ZSJA 4ISLA 1PPHE 1K1LA 1THRH 4B75A 1ORFA 1C5WB 1PQ5A 3LH1A 1EPTC 3SGAE 3TGJE 3KN2A 1EZQA 5A09A 2RG3A 1KDQB 4CREA 4WMEA 3AAVA 3GYMA 5EODA 5DN6D 1GHBG 3RXJA 3D62A 1HIAB 3ODFA 1T7CA 1CBWC 1ZPBA 1L4DA 3HGPA 2AIQA 5EQQA 5FCRA 3KQEA 2BY5X 1SC8U 3M35A 5C5NA 1HAZB 1KXBA 1BJVA 3UPEA 2OINA 1KXAA 3GCTF 1C2EA 4NA8A 4OS6A 1NRPH 1EZXC 4X1RU 5DP4A 5JBBS 2JH6D 1TWXB 3Q3KA 7KMEH 2G51A 5C20A 4WXVA 2UUJB 4THNH 2FTMA 2OBQA 1E79D 1XX9A 3BF6H 4DCDA 1BRCE 1YPEH 4AFUA 4ABJA 4D76A 4ZAEA 3SJOA 1V2VT 1CO7E 1K1IA 3RMMH 2Q6FA 3DSGA 5HIYA 1RIWB 1BCUH 3PMAB 1GBLA 1K2I1 2FOBA 2HALA 3MHWU 3QDZB 5E2OA 4CH2B 2TGTA 3H7OA 3LIWA 3ZVAA 4ZKOU 1E38B 1SOZA 1YGCH 1EKBB 4FUEA 4WXIA 1BT7A 1MKWH 1MBMA 4TY6A 2KZ4A 2Y5GA 2C93B 3PRBA 1LVMA 3MU0A 3U8OH 2WV5A 2GT7A 3K9XB 1XUGA 2FI5E 2FOGA 2ZGHA 1O3KA 2ZDVH 5JYIA 1GI7B 3BTTE 3TJUA 3LC5A 1ZZZA 5DJ7A 3BTME 5EPYA 1O2VA 1Y8TA 4X1SU 1MAYA 1NT1A 2VWLA 2KX4A 2K0QA 6ESTA 3LC3A 1SGDE 1C1PA 5GNDA 1CHOG 1Z1IA 3MMGA 2SGPE 1XXFA 2FESH 5TCAA 3L3TA 1O2TA 2V0BA 1IQLA 2PKSC 1E34B 1S6LA 2ZGXH 4YLUA 5J4QA 3RDZA 2ZF0H 1RJXB 5B6LA 4O97A 4CRFA 3QTOH 1SQOA 3O8CA 2EI7A 1PPBH 2BTCE 3PM3A 4FUIA 3LJJA 3OYPA 2VWNA 5DSFA 3CNRA 1TGBA 2BYAX 3ZYDA 4IMQA 5JDUB 1W0KD 4BXWA 2TGPZ 4Z0KA 1BZXE 1GI9B 3SUEA 2OC1A 1FNIA 2QXHA 4AB9A 1VJAU 1DXPA 1A0HB 3SV6A 3SJ9A 3B8JA 2NU0E 4O03A 1BB0B 2SNWA 1DSTA 3A88A 4CHAB 1V2KT 4FUCA 3UREA 3SORA 1AVGH 5AFYH 1V2ST 5EIYA 1P2OA 2ZG0H 3A7ZA 1L1GA 1A3EH 1PPZA 3MH7A 2P95A 5HM2A 1HAIH 4X8TH 5GDSH 1AI8H 1HAVB 2FXRA 1FAKH 1P2IA 3KGPA 2QV1A 2XW9A 1FY4A 1ANDA 1C5TA 4X2WA 4X8VH 4HTCH 2KR7A 4JYUH 1KXCA 2Z3EA 3T62A 1PJPA 1GBEA 3MYWA 1C2LA 1QBNA 1GG6C 2PLXA 2VBCA 2R9PA 4XBDA 2ZDMA 3QX5H 3TU7H 3RXGA 1GI0A 1V2WT 3M5OA 1SGTA 1NU9A 1Z1JA 3N7DA 2OLGA 1Q31A 2YNBA 2C8YB 2ZQ2A 1MBQA 4JYVH 5LPEA 2AEIH 1A7SA 3ZZ5A 5FBEA 1FY8E 1O2YA 2TGDA 2BY6X 3DUXH 2FX4A 2SGQE 2THFB 3GDUA 1UVOA 3SU2A 1SFQB 2GZ7A 2WV9A 1YPHC 1WTGH 3EQ0H 1HXFH 2IJD1 3LGTA 3PV5A 2V7QD 4K8YA 1HYLA 2A7CA 4Z6AH 1T31A 1O3PB 2OC7A 3WWBA 5CE1A 2PSXA 3P95A 4AZ2B 3SI4H 1GJ6A 5FCKA 1XUFA 1FI8A 3MWIU 1TGTA 3ODDA 4ABIA 2F9UA 1EX3A 2A4QA 1C1MA 1HAXB 1O5DH 3RXIA 1RTFB 1AHTH 5FXLA 4MQAA 4AG2A 4BNRA 5FAHA 2GD4B 1EPTA 1RS0A 4YOJA 3ZVEA 4BAOB 1CT2E 1UK3A 4NGAH 1BTWA 1TALA 1IQGA 4NWLA 2ZPQA 1A46H 1NPMA 5AHGH 1VITF 1WCZA 1TMUH 1UVUH 3FVFB 1Y3WA 1GI3A 3DFJA 1SGEE 3RXRA 2OCVB 4KTUA 4X8UH 2A45B 4U30A 3RXLA 1EAWA 3TGKE 1MAXA 1C5MD 3KEEA 1VCPA 3QN7A 1S84A 5C17A 1O36A 4INKA 1ARBA 4Y79A 7ESTE 3BG4B 2OQ5A 1VR1H 1JIMA 1FAXA 4JZFH 3RMNH 1C1UH 1O34A 3SU4A 1XKBC 1QQUA 3VGCC 3JZ2B 4AFQA 1FUJA 2F91A 3A84A 2PUXB 1P2NA 1BRAA 3F68H 5CHBA 5G4BA 1E1RD 1DWEH 2UUYA 5LPRA 1ANEA 2ANMH 2KCOA 1IQNA 5FL7D 1HPGA 5J4SA 1HDTH 2BLVA 3SYJA 2BD3A 1EOJA 5JBCS 3FKSD 4AX9H 1KLJH 1O2SA 2VVUA 1G3CA 3P8GA 5C1XA 1FMGA 3VB3A 2P93A 1OWIA 5KECA 3RLWH 3U69H 4ZHLU 2IN2A 2QYIA 2W5EA 3D65E 2TRMA 4RKOB 2O8TA 1VJ9U 2YNAA 3STIA 4X1QU 5T6DA 1GHVH 2ZGJA 1TNKA 1OPHB 3D49H 3RMLH 3ZZ8A 1AVXA 1SGPE 4Y76A 1ZLRA 1UTLM 4SGAE 3U28C 1LPKB 4ZMAH 3LT3A 2FZZA 3SU5A 2L74A 1SR5C 1F7ZA 2OBOA 4NCYA 2PW8H 2WZQA 2STBE 3UUZA 1ZHMA 2O8LA 1G37A 5L6NH 1OOKB 3MU4A 4DOQA 1AFEH 1YCPK 1D3DB 1QRZA 2P16A 5L2ZH 2CF8H 1G3EA 2GCHF 1MD8A 3UWIA 1UJ1A 2P8OB 5F8XA 1SBWA 4FETA 2ZTXA 1MU6B 5A0BA 1A4WH 1D6RA 1O3AA 1SOTA 2ZFTA 4YZUA 1GJ8B 4MPVA 2XCFA 1QGFA 8GCHG 1FZZA 1C5SA 1XXDA 3IWMA 4HZHA 1V2MT 1DY8A 2J98A 4BTUB 2KFWA 4WH6A 4AOQA 5ABWA 9LPRA 1GDUA 4DIIH 4XBBA 1LPGB 4IN1A 2Z6BD 1GMCG 2CXVA 1ELBA 3NPSA 1H8HD 2H2ZA 5PTPA 1F5RA 3SNAA 2Z7FE 2Z9LA 2ZO3H 3F0PA 5JBAS 3BTKE 1W12U 2JJ2D 2ZECA 5C67A 5DGJA 2H9HA 3GYLB 3PMHB 2QC2A 1O5FH 1TA2A 3FANA 1YPLH 3T29A 1Y3UA 5GCHG 1UTPA 4CRGA 5A0AE 1C5PA 2A2XH 4K1SA 3PB1E 2ALVA 2VB0A 2W7UA 1NC6A 3FZDA 1ELFA 1P02A 1IQFA 1TBZH 3KL6A 6GCHF 3FP8E 3NCLA 1P10A 3UNQA 1GI4A 3GY3A 4BAHB 2F9NA 5GJ4B 3ZVBA 5F6MA 2SGFE 3E0PB 3AK5A 1IOEA 1KXFA 4OS1A 4I7YH 1QL8A 1F0SA 1DUEA 1UHBB 1XUKA 2Z9JA 3BG8A 4Q2KA 4Y6DA 5GIBA 1XKAC 3TK5A 2Y7ZA 2ASUB 3F3BA 2AGEX 1MUEB 3QLPH 4J2YB 4KP0A 1SGFA 4AYYB 1TNLA 1T4VH 1TFXA 3G01A 1EUFA 2HNTF 1K22H 5FPSA 1VGCC 1DUAA 1EJNA 1B5GH 1Z8RA 4AN7A 1MZDA 2FLRH 1Y59T 4NFFA 1O3JA 1PQAA 1LMWB 5EJLA 2NU1E 4FVDA 1TPPA 1QBOA 3A87A 1Z8IB 3STJA 2VIWA 2XC0A 2BVRH 1Z8GA 1VZQH 3OAAD 1G3BA 3LGYA 1UTNA 3GY2A 3KYGA 2FTLE 3RU4T 1P9UA 3E8LA 2J2UA 1V2NT 1SGQE 3V0XA 2F9OA 4ABGA 1RTKA 3M37A 2XWBI 1TGCA 3SJ8A 3ELAH 5TJXA 1N6XA 4LZ1H 2SNVA 1J16A 2BDAA 3CS0A 1O2RA 1MKXH 2PKSB 4I8JA 2DE8A 1Z7KA 1E37B 2H6MA 2OQUA 1GWAA 4B73A 2QY0B 3ATMA 3GDSA 3KNXA 2ZA5A 1W11U 2ZDNA 1HJAC 3EA9A 3P70B 1NBME 2WPDD 2BD9A 1U6QA 1V2LT 5C94A 5JPMH 1HAOH 2ZC9H 4TWWA 3A7VA 3TJVA 3BEIB 1DFPA 1BTPA 3P8OA 1EAUA 1TX8A 2FI4E 5AFZH 1UTMA 4B71A 4NSYA 4DT4A 3QGNB 1CA8B 3A82A 5E0JA 4GHQA 1F0RA 5DK1A 2C3SA 1V2PT 1ZMLA 5FHTA 2PTNA 1D9IA 1H8IH 1LVOA 3UWJH 4HG6A 1QJ6B 5DO4H 1DICA 4DJZB 5IYTA 3RXSA 3SJKA 3TVJB 2H9TH 2WPMS 5F53A 3B23B 1O3FA 4E7RG 1DM4B 2BVSH 1FONA 3A7TA 4GCHG 3DSOA 1SLWB 2VVCA 2GV7A 3SO3A 3LH3A 3DD2H 2HGTH 4WWYA 2BMGB 4BTIB 5C0UA 1AMHA 3VEQB 3ESTA 1LKBA 1ELTA 3MH4A 4ZUHA 2ZGCA 2XBWA 1RXPA 1PYTC 1TOCB 2OUAA 1SSXA 1UCYE 3BSQA 1TBQH 2VWMA 5GWZA 2A32A 1O2NA 1GCTB 2UWPA 2VIVA 1EB1H 4MTBA 3GY6A 1C2GA 1T8LA 3M3VA 4A6LA 2BB4A 3Q77A 1QFKH 3BEUA 3TNSA 1ANBA 5HIZA 1SQAA 3A7XA 1MTNC 3LGUA 3A8CA 3EA8A 1O5EH 3SV7A 4HFPB 1CGIE 3U98H 1P01A 1WQVH 2KM0A 1C9PA 1B7XB 3NZIA 1VCWA 4LZ4B 3T28A 1AWFH 3F9FA 1GMHF 2QF4A 1FN8A 1AZZA 1YPJH 4AGJA 3UNRA 4NZQA 2AMDA 4Q7ZA 2ZFRH 2M2AA 2XBYA 2W3KA 4M7GA 1C1TA 4JMYA 2ULLA 3UOPA 1LHGH 1GHYH 1O3EA 4GVUA 1COWD 4B6EA 3BIVH 3SZEA 1EP5A 8LPRA 4X2XA 2YMSC 3UAIC 1L1JA 3TH2H 4CRCA 3VXEH 4R0IA 4IC5A 4Q4LA 1P12E 3BTFE 1KIGH 1L2EA 5IK2D 4OS2A 1Z6JH 4X6OA 1CU1A 2PSYA 1O5BB 1H4WA 1THPB 1EXFA 1AZ8A 4P02A 2P94A 4X2VA 1EJMA 2TPIZ 1RD3B 1INCA 1O3BA 1A0LA 1C5VA 2OC0A 2QXGA 2KCPA 3A8AA 1A2CH 3V3MA 4ZHAA 1P57B 3RLYH 5HXFA 4E7NA 1NN6A 1BJUA 1TBRH 2BDYA 1YP9A 1SHYA 3H5CB 3LONA 1CA0C 3QGJA 1J15A 2ZKSA 1TNGA 1ESAA 4NA7A 3KIDU 1ZJDA 1GBMA 1BITA 2A4OA 4DW2U 4B76A 3F1SB 3IG6B 1QRXA 5T6GA 2HLDD 1NY22 1CGJE 2G55A 1FIZA 1TGSZ 3FZZA 1E0FD 1RFNA 5DP9A 3AAUA 2J5UA 4MLFB 1HUTH 1SLXB 1EOLA 2BXUH 1YPKH 4CR5A 4E06H 4ASHA 1K0HA 1HRTH 5EXMA 1GHBF 4LK4A 2AHME 1V2JT 3EYDA 3RXUA 4ZXXH 2V3MA 2CHAB 2Q6GA 1Z8JB 3EA7A 4OGYA 5LH8A 1GL0E 2PHBA 1ZHRA 1O5AB 2ZTZA 1F92A 4NA9H 5E0GA 3SBKA 1O3LA 4Z1MD 4DT7B 1ZPCA 1XUIA 1P3EA 5EPNA 1QQ4A 2KCAA 3BEFB 1HGTH 1O2GH 1OKXA 2XNIA 2Z9IA 3L6PA 1O2JA 5C1UA 1O35A 1ETSH 1QA7A 5B6OA 1FY3A 1NTPA 4XDEA 4OM9A 5T3HA 4MPXA 2C8XB 1GJBB 3A83A 5CHAB 3BN9A 3LKWA 1BHXB 4TY7A 1GJCB 1GMDF 3F0OA 5E8EH 1BOQA 1WUNH 1V2QT 3A81A 1NRSH 3NXPA 4I8KA 4IS5A 3P6ZB 1BRUP 1O3CA 1GHZA 4FUDA 2GCTB 3ZVGA 1N8OB 4RSPA 1K28D 2H1UA 2PTCE 2K1QA 1AFQC 3E6PH 1GJ4H 4WY3A 2CJIA 2PUQH 4ABBA 1FIWA 1PPCE 3RU4E 2BDCA 1DWCH 2A4RA 3LGWA 1QB1A 2QN5T 2BD7A 2O8MA 3PTBA 2ESTE 3E1XB 4PROA 4WMFA 1C1SA 3ZZ4A 4A1VA 1OYTH 2BDHA 2Y81A 3TNTA 3M3SA 1C2MA 3TJNA 2O8WA 3BIUH 4E05H 2XWAA 1CHOF 3M3TA 2XTTB 3MTYA 3WY8A 3QUMP 1QA0A 3SV8A 2XBVA 3OFND 3VB6A 2A31A 3FP7E 1BRBE 1G36A 5DP6A 3Q3XA 7GCHG 5FX5A 1ETRH 4TYDA 3OY5U 3MU5A 3OX7U 2GMTC 1ELCA 1HAGE 2B0FA 3ZV8A 3MU8A 4WH8A 2H9EH 4B6FA 1Y3YA 4X6NA 2UWLA 3S0NA 1UCYK 1GGDC 3KCGH 3H09A 1QURH 1AE8H 3DFLA 5DG6A 1BTUA 4HGCA 1P05A 2XC5A 1GPZA 4ZKSU 5C2ZA 2F9VA 4J1YA 4A1TA 2C4FH 2CGAA 4X1PU 4X6MA 1K9OE 1W0ZU 1FY5A 1GCDA 2J4IA 3ZZCA 2Z9GA 4K5ZA 1C1VH 1NFWA 6CHAC 1CQQA 5A8YA 2B9LA 2W6JD 4NIYA 1F0UA 1AWHB 2FYRA 1OWDA 2LPRA 2QXJA 4ZCNA 2BD5A 1THSH 3VFEA 1OYQA 1ZGIA 5E0HA 2GZ8A 2F4LA 2VGCC 1FJSA 1VITG 1EAIA 1PFXC 1IHSH 2ZU2A 2ZFPH 1SKYE 4YO9A 4WJG2 4KGAA 1O30A 5DP5A 3VPKA 2BXTH 4FUHA 4OS5A 5EJ1A 3QZRA 2HOBA 2Y80A 5AVDA 1GJAB 1J14A 4CRAA 1NFXA 1IQHA 1YYY1 4IW4E 3CENA 4MDSA 3LPRA 3SU6A 1K1MA 2ZQ1A 2BHGA 1WV7H 2HNTC 4MG3A 2R2MB 3RXAA 2Y5HA 5AF9H 2HLCA 4KELA 2BD8A 1SG8B 2BX3A 2VWOA 2ZDLA 1C1RA 1RRKA 3RC6A 2Z94A 2QE7D 1HJAB 1B0FA 2UUFB 3RC5A 2V3OH 1NFYA 2WHXA 4FUFA 2G4TA 2NWNA 4ACAA 5A0CA 1YC0A 4H4FA 5EOKA 2EI8A 1AE5A 3WWFA 1SGCA 3TK9A 2FYQA 2WUBA 4JZEH 1EFRD 4NZLA 1QB6A 5DP7A 3RXDA 1GHAG 3ZZBA 4D9QA 2FS8A 3GCHB 4XFQA 1UTQA 1C4Y2 3W95A 1BUIA 1EZUC 1SLUB 4X2YA 1G30B 3GISB 4YT6H 1AB9B 1JRTA 3GCNA 4XE4A 2OTVA 1V2RT 2TBSA 5C1YA 1ZHPA 2W6ID 3CP7A 1OP0A 4KTSA 1MTVA 2Q1JA 1ZYOA 2ODQA 4WMDA 4I86A 1AY6H 2EY4C 4NIXA 3HK6B 3V7TA 1FY1A 4JZIA 3MH6A 2A5AA 1KMHB 3NKKA 1HV7A 3F2HA 2FI3E 4Y8ZA 1DITH 2WSSD 3VXFH 2JDID 1MD7A 3C27B 1P03A 3RUOA 4A1XA 1EB2A 2PGBB 2Z3DA 4X6PA 3UQOA 3MNCA 2FPZA 1YBWA 3PWCA 1N1LA 1JXPA 1OP8A 1CE5A 2UWOA 2J9NA 3A80A 2IPQX 2ZHFH 1TB6H 4FVBA 1QL9A 3ZV9A 1YLDA 2FOHA 3RXMA 2CN0H 1UVPA 2C8WB 1YCPH 4UFEH 1J8AA 1SQTA 2F3CE 2RFKC 3M7QA 1XUHA 1GBBA 1K1OA 3QZQA 1S6HA 1MTNB 2VU8E 3U8TH 4A5TS 1W0JD 4ISOA 3MNXA 5L2YH 1O2LA 1KY9A 4YLQH 5SGAE 1KXDA 2AGGX 4ZXYH 5BRRE 1Q3XA 2A1DB 1OXGA 2C90B 2STAE 1ESBA 4ZKRU 2BZ6H 1LKAA 4HI3A 3PLKA 4UFGH 2W7SA 3ATIA 2XXLA 4D9RA 3K6ZA 1HJ9A 4GLYA 1TNHA 1YM0A 3PO1C 4MVNA 3U1JB 3RXPA 5DP8A 2GTBA 3F2FA 4M9FA 4JYTA 1AGJA 2ZHWH 5C5OA 2GGVB 2ZPRA 2XRCA 3SNCA 1MQ6A 2YMSB 3EGKH 4Q80A 4GAWA 1UVTH 4TT3D 1P06A 5LPFA 4MPUA 2AIPA 2OC8A 1C1OA 3M5MA 3RXQA 1BTXA 1ZJKA 1SI5H 3D23A 1EPTB 2ODPA 4JK6A 4ABAA 5EQRA 2RDEA 1SGFG 2JETC 1TOMH 5EQSA 1OS8A 1TQ7B 2PR3A 1O39A 2VNTA 4Y71A 5DPAA 4AB8A 1WXRA 1LCYA 3Q3YA 4R8TB 1O2IA 4XRNA 1UK2A 2G52A 1CBWB 1WSSH 4UE7H 1O2UA 1LHFH 2PWXA 2D1JA 1M9UA 2SGAA 1WTHD 1DANH 1GDQA 3EDXB 1CA0B 1TMTH 1ZSLA 4BANB 1DLEA 5FX6A 3PLPA 4CHAC 2ZNKH 1BMNH 2ZP0H 8GCHF 2W3IA 2A0QB 1O37A 1ZTKA 1O2KA 2ANWA 1O2HA 3MNBA 1QHRB 1GBIA 1OWEA 3IITA 4D7FA 1T4UH 1H1BA 3ENSB 1GDNA 2XOKD 1YF4A 4LOYH 4Y0YE 1PQ8A 2D26C 2AYWA 3DCLA 1C5LH 4FU7A 3T2NA 1MCVA 2PP6A 5HKKD 2JKHA 3K65B 2ANYA 5CMXH 2WPJS 1K21H 1QIXB 3R0FA 3UNSA 4IMZA 4B2BA 3SW2B 2A5IA 5GCHF 3A89A 3HPTB 3OEED 1FPHH 3AW1A 3MFJA 2VH6A 1W8BH 1NRNH 3SQHE 1ACBE 1E35B 2H5CA 3MNSA 2BD4A 2ALPA 1XM1A 3P8FA 1T8MA 3FN8A 1ELEE 1NRRH 4MNVA 3ZVCA 2BOHB 2FX6A 2QF5A 1QBVH 3NWUA 2GP9B 4K60A 2ZDKA 1TX6A 2BZAA 3I29A 1S85A 2WINI 5E2PA 1F5LA 1TNJA 4U01A 1TAWA 1P2KA 1YPHE 5F8ZA 4B2CA 1P2QA 4A7IB 4IC6A 2QGRA 1H9LB 3PTNA 3E16B 3A8DA 3VB4A 2PKAA 2AMQA 5I46H 1K1JA 1TE0A 3BTWE 3RXBA 1OWJA 5JB8S 1NFUA 5K0HA 1HLTH 4DIHH 4ISNA 1GBAA 1TA6A 4FUJA 1L0ZA 1MU8B 3UR6A 2BQ7B 5EGMA 1KDQA 2I6QA 4MPWA 2DE9A 3A85A 1HIAA 2HNTE 5ESTE 3SI3H 1DOJA 1V2TT 3MQKC 3PV4A 4Q63A 1GI8B 2LNCA 3SU1A 1DWDH 4NSVA 2F9PA 1TABE 1FN6A 4WF8A 2BD2A 2GX4A 1SGYE 2J98B 1D3TB 3UFAA 2ZCKP 4TSFD 3S9BA 1CVWH 2A7JA 1GBKA 3PROA 3TH3H 3PV2A 1AIXH 1C2HA 4H6SB 1DY9A 1Z6EA 1O2QA 4NFEA 1IQJA 3VB5A 1S0RA 3RXVA 2GMTB 4DY7B 2XCNA 1C1WH 1T8NA 1UTOA 3RMOH 1OWHA 3ZZ9A 1GGDB 1C5YB 1PPGE 3BTDE 1GG6B 1TNIA 2W26A 4H42U 3LGVA 2H5DA 2FP7B 4XBCA 3DT0H 2AFQB 5EXLA 2FODA 5I25A 1AKSA 2ZGBH 3EE0B 4KKDA 4Y0ZE 1RGQA 1O2ZA 3DSPA 4K1EA 2SFAA 2V35A 2G5NA 2GDDA 2Y5FA 1ELDE 4AORA 1HJ8A 1F5KU 1V2UT 1QL7A 2CF9H 2GVFA 2P3UB 5KEDA 1LO6A 1SL3A 4JZDH 4P00A 1DWBH 1IAUA 3SZNA 1GI1A 5DP3A 4B74A 1NESE 3RM2H 2QXIA 3ZIAD 1EASA 1BHXF 1JRSA 4JK5A 1SMFE 2WPIS 5A8XA 2BY7X 3URDA 2ZCLP 4IN2A 2HVYB 3C1KA 2G8TA 4TPIZ 4DGJA 1HAHH 3ATKA 3GS9A 1ANCA 3UY9A 2Z9KA 1LVBA 1HXEH 1TGNA 2BQWB 1O32A 3A7YA 3B9FH 2EQNA 4ABHA 1O33A 3H7TA 3SUGA 9ESTA 1V2OT 2WV4A 3GCTG 3GY7A 1C2KA 2P8OC 1HNEE 3SNBA 1O2WA 4AFSA 2ZI2H 1QR3E 1C2FA 1LHDH 1W10U 1Y3VA 2TGAA 3I77A 2BVXH 5ESBA 3UR9A 1JWTA 3PYHA 2FMJA 8ESTE 2B8OH 1A5GH 3HKIB 3GDVA 2J34A 1PPFE 1IQIA 2PKAB 1O38A 3U9AH 4MNWA 3RXFA 1GI2A 2BQ6B 4DG4A 4ZROA 1ELGA 1H8DH 3VGCB 1KLTA 4UDWH 3K2UA 3Q76A 2NU4E 3ZZ3A 2QF3A 2F83A 1HAVA 1BDAA 2M5TA 2WYGA 1YWUA 2LP6A 2FOAA 1VCQA 4FXGH 3M7UA 3MO9A 2O8UA 4YOGA 2G00A 1LHEH 4XOJA 2OK5A 1MTUA 2ZTYA 2ODYB 2BX4A 3JZ1B 4YESB 4KTCA 2FOMB 1FDPA 1S6FA 3KQDA 4X8SH 5EW1H 3S9CA 2RDLA 4ABEA 1JMOH 1NRQH 2VH0A 1GBTA 3KQCA 3PMBB 1EP6A 2FOEA 1NS3A 1P09A 2ZCHP 1Y3XA 3I78A 1C1QA 4BAQB 4D8NA 2ZEBA 3FO8D 1WBGB 1AUTC 3S9AA 1RTLA 1GJ9B 4ISIH 4SGBE 1TQ0B 3ZZ6A 2YOLA 3N99A 1SB1H 1GBCA 5GPIB 3VB7A 5T6FA 2JH0D 3T5FH 2HVXA 3GY4A 1BBRE 4YTAA 3UB0A 4CH8B 3N7OA 1GMDG 1VKYA 2VINA 1UTKA 1C5ZB 1GVKB 1C5QA 3T26A 2L6OA 1KTTB 4JCNA 1SFIA 3P92A 2NU2E 3KF2A 3O8RA 1AKSB 3TJOA 4NG9H 2SGEE 1MKWK 3PRDA 1UMAH 1FQ3A 1ZTLA 1TRNA 1Z71A 2B5TB 2RA3A 3BTEE 4Y8YA 2EEKA 3ZYEA 1H9IE 1KXEA 1FX0B 5H4IB 1SQRA 3PO1B 1Y5AT 1W3CA 1TRYA 4WVPE 4ZHMU 1P3CA 2R3YA 2OP9A 1D4PB 5ETXA 1A3BH 3NRLA 4MNYA 2Y82A 2QAAA 3WW7A 2FM2A 1NBMD 3OE7D 1C4U2 3SV9A 3M61U 1MMJN 1AQ7A 3TIUA 3M36A 1FXYA 1F2SE 2JETB 1QNJA 1QZ8A 1Y5UT 3A86A 2XC4A 2V6NA 1J9CH 1GVZA 1WYKA 1GI6A 1GBDA 1H8ED 4X1NU 3S69A 1G2MA 1L1NA 4VGCC 3SNEA 1LQEA 1OP2A 1UCYH 4A92A 1CHGA 2GT8A 4GPGA 2OD3B 2WUCA 3EAJA 3GY5A 4K1TA 3ZZ7A 2ZWLH 4H6TA 1IQKA 1FV9A 4AC9A 5FPYA 2ZPSA 2WYJA 5L30H 1C5NH 2DUCA 1EZSC 3OSYA 2FO9A 2ILNA 3KYFA 4ZH8A 2HWLB 2GZ9A 1H9HE 1DE7H 2AH4X 2P3TB 5HYOA 3RXTA 1SLVB 2J38A 3E3TA 2C8ZB 1YLCA 1XMNB 3K6YA 4I8LA 4FU9A 2EC9H 3SU3A 3PWBA 2VJ1A 1NM6A 1VGCB 3RP2A 4ZKNU 5JB9S 3SV2H 5JBTA 1UTJA 2FDAA 1WOFA 3PLBA 1Q2WA 2EA3A 2KCYA 1BIOA 4FU8A 1JBUH 2QCYA 1J17T 3P8NA 4B1TA 1T8OA 2F43B 1JOUB 1SGRE 5IDKA 1O5CB 3OTJE 1P04A 1YPGH 4IBLH 4F55A 7GCHF 3KQ5A 4Q7YA 1GCTC 4FUGA 4GHTA 4ABFA 1ZOMA 2FOFA 2QF0A 5T1VA 2IOTA 1BTYA 2ZFSA 3UOUA 3F9GA 2BDBA 2VIOA 4YOIA 1P11E 3RM0H 1C5XB 2BDIA 1W7XH 5CDFE 3UQVA 1C4V2 1QJ7B 1N6YA 4AYVB 4ESTE 1EJAA 4AGKA 1TRMA 2ZHDA 4CRBA 2HPPH 3OY6U 1UO6A 1QY6A
chains in the Genus database with same CATH topology
3SHAH 3AASA 1CGHA 1YKTA 2FS9A 2PGQB 1OWKA 1KYNA 3ATLA 4F49A 2FOCA 1ZTJA 3DA9B 5HGGA 4CBOA 3ZVFA 1AUJA 3L33A 2Y7XA 4GSOA 2BY8X 2BDGA 2KAIA 1MQ5A 4K3JA 3CS7A 5FBIA 2G81E 4CRDA 2A2QH 1O3OA 1WAYB 1OSSA 4I8GA 1QCPA 3A8BA 2ZU5A 3HATH 2J94A 1HAYB 1UVSH 1TONA 3M7TA 2IJOB 2HPQH 5DKMA 1LDTT 1C9TA 3GCOA 1DS2E 4DVAU 3SHCH 4RN6A 1ZSKA 3SUFA 2ZU1A 1D6WA 1ZRBA 3AVZA 1O3IA 3NK8A 1TPAE 1GVLA 1UHBA 3QWCH 1W14U 1CT0E 3MO6A 1BBRH 2R3UA 1XUJA 3LOXA 2ZU4A 3ITIA 1P9SA 2AGIX 4ABDA 1NROH 1XVMA 1WQSA 1S81A 1GBJA 2ZFFH 3ZVDA 1IQEA 1A0JA 3ATWA 2J95A 5K7RA 1BBRK 1RIWC 4UONA 3Q00A 1GHAF 3E0NB 5FPTA 2GCHG 1QRWA 1FPCH 1GL1A 1TPSA 3MOCA 4JZ1A 2BLQA 2BY9X 1WU1A 1W0YH 3E90B 2D2DA 2R0KA 4MNXA 1IQMA 1DX5M 3RXHA 1SPJA 2VIPA 4I33A 1A1RA 1MZAA 1LTOA 2ZU3A 3TGIE 1T32A 2FLBH 5EG4A 2AERH 2NU3E 2J92A 1YPMH 1ETTH 1C1NA 2CV3A 1BTZA 1FLEE 3T27A 2CHAC 3BTQE 3SN8A 1MTSA 2ZIQH 1HBTH 3GOVB 1GJDB 4Y7AA 2AS9A 4U32A 1P8VC 1XVOA 1K1NA 1DSUA 2Q6DA 4X0WU 1AU8A 4OS4A 1C5OH 4D7GA 3LGIA 4QT8C 1HAPH 1SGIB 1NZQH 4OS7A 2A4GA 3QO6A 2VIDA 3MU1A 3HKJB 6GCHG 3E91A 1DT2A 2Z3CA 3F9EA 2VVVA 5CHAC 3SQEE 1O2XA 1SHHB 4K2YA 1A61H 5BPEA 1HCGA 1TYNA 4B2AA 2V3HH 1O3DA 3RU4D 1C5RA 2GCTC 4Y8XA 1N8OC 1BTHH 4BAKB 1KLIH 4INLA 1NU7B 5LGOA 2JH5D 1ZRKA 3V12A 1C2IA 3T25A 4OGXA 2PV9B 3FAOA 1S83A 1C2JA 4Y11E 1ZR0A 1EAXA 1D3QB 4AFZA 1KTSB 1O2OA 1AVWA 2KAIB 4U2WA 1S5SA 1YCPM 2HRVA 2F9BH 4XSKU 1TX7A 4IGDA 3HGNA 3RXCA 3LU9B 2G5VA 2FIRH 3URCA 1AN1E 3F6UH 4CBNA 2FWWA 1TMBH 1TPOA 1GMCF 4ISHH 4YM9A 3M5NA 1MCTA 4BTTB 1MTWA 1D3PB 1DXWA 1MH0A 1ZPZA 2R0LA 2O9QA 1GJ7B 1QTFA 4Y10E 3U1IB 3R3GB 5EU8A 4O3TA 4AG1A 4BAMB 1GBFA 2RA0A 3SOSA 5F03A 2SGDE 3UTUH 1BMLA 4Y7BA 1P2JA 1GHXH 4I8HA 1QJ1B 3ZZAA 1G9IE 4UD9H 1C5UA 1PPEE 1ESTA 3TITA 1P0SH 4Q7XA 1LPZB 4I32A 2G4UA 1PYTD 3MH5A 3SGQE 4DURA 3FP6E 5C3NA 1G2LA 3RC4A 1F0TA 1SVPA 4F4OC 1DLKB 1L4ZA 2XBXA 1GBHA 3S7HB 1LHCH 2Y6TA 3KQBA 3P17H 1W13U 4GUXA 8KME2 1O3GA 4UFDH 2P3FH 2ZHEH 1NO9H 3RXOA 1DDJA 4YT7H 6LPRA 1G3DA 4INHA 1ZMJA 1AFQB 4NIVA 3W94A 1O2MA 3SJIA 1KSNA 3MI4A 1ZMNA 1Y5BT 5HM9A 3ZZDA 2BM2A 4CR9A 2D8WA 1S82A 5GXPA 2ZZUH 5F8TA 4NWKA 3LJOA 3PMJA 1MKXK 1ELAA 2QIQA 1BQYA 1VITH 5EXNA 2GDEH 2B7DH 3GICB 5A2MH 1W2KH 3QTVH 5HMAA 2CMYA 1O3NA 4TPYA 4VGCB 1ELVA 3SU0A 1CSOE 3O8DA 2PFEA 1O3MA 3GCHC 2EI6A 1V3XA 2BLOA 3BG4C 1BMMH 2WPLS 1O5GH 1EATA 1AB9C 1EQ9A 2IPHA 2TIOA 1S0QA 3SGBE 2A7HA 1K1PA 1X7AC 2BOKA 1BA8B 3BTGE 3RXEA 3QK1A 2AMPA 2R2WU 4K8BA 1AO5A 4I31A 1O3HA 3RXKA 3U8RH 3SUDA 2A5KA 4BOHA 3OU0A 1ZGVA 2VIQA 3F9HA 1GMHG 3V13A 3SNDA 1AD8H 1E36B 2WPHS 1BMAA 3BV9B 1CT4E 6CHAB 7LPRA 5EW2H 3TPIZ 3TLOA 2ZFQH 1TIOA 1UK4A 2RCEA 4UFFH 2GV6A 3M5LA 1PQ7A 2ZDAH 1GHWH 1QB9A 2OXSA 5TCCA 1DVAH 1C2DA 2QA9E 1GI5A 1IHTH 4NIWA 2ANKH 4FUBA 2VGCB 1OX1A 1W7GH 2I6SA 4O3UA 4RKJB 2UUKB 1SGNE 3UIRA 4LXBH 1TLDA 4GCHF 3GY8A 2XYAA 1DPOA 3DHKH 1ARCA 1LQDB 1A5HA 1LVYA 1ID5H 4BXSA 1P2MA 2FEQH 3AW0A 3O8BA 3MO3A 1HB0B 1O0DH 5A8ZA 3FFGA 3KHVA 3TK6A 1V6DA 2WPKS 1O31A 3BTHE 1A5IA 3TH4H 1O2PA 2ZHQH 3A7WA 3HK3B 3LDXH 1HFDA 1GJ5H 1ABJH 4K69A 2BLWA 1JIRA 1G32B 3NUMA 4O9VA 2P59A 4UEHH 1ABIH 4TWYA 2GKVE 3S7KB 1B0EA 1ZSJA 4ISLA 1PPHE 1K1LA 1THRH 4B75A 1ORFA 1C5WB 1PQ5A 3LH1A 1EPTC 3SGAE 3TGJE 3KN2A 1EZQA 5A09A 2RG3A 1KDQB 4CREA 4WMEA 3AAVA 3GYMA 5EODA 1GHBG 3RXJA 3D62A 1HIAB 3ODFA 1T7CA 1CBWC 1ZPBA 1L4DA 3HGPA 2AIQA 5EQQA 5FCRA 3KQEA 2BY5X 1SC8U 3M35A 5C5NA 1HAZB 1KXBA 1BJVA 3UPEA 2OINA 1KXAA 3GCTF 1C2EA 4NA8A 4OS6A 1NRPH 1EZXC 4X1RU 5DP4A 5JBBS 2JH6D 1TWXB 3Q3KA 7KMEH 2G51A 5C20A 4WXVA 2UUJB 4THNH 2FTMA 2OBQA 1XX9A 3BF6H 4DCDA 1BRCE 1YPEH 4AFUA 4ABJA 4D76A 4ZAEA 3SJOA 1V2VT 1CO7E 1K1IA 3RMMH 2Q6FA 1RIWB 1BCUH 3PMAB 1GBLA 1K2I1 2FOBA 2HALA 3MHWU 3QDZB 5E2OA 4CH2B 2TGTA 3H7OA 3LIWA 3ZVAA 4ZKOU 1E38B 1SOZA 1YGCH 1EKBB 4FUEA 4WXIA 1BT7A 1MKWH 1MBMA 4TY6A 2Y5GA 2C93B 1LVMA 3MU0A 3U8OH 2WV5A 2GT7A 3K9XB 1XUGA 2FI5E 2FOGA 2ZGHA 1O3KA 2ZDVH 5JYIA 1GI7B 3BTTE 3TJUA 3LC5A 1ZZZA 5DJ7A 3BTME 5EPYA 1O2VA 1Y8TA 4X1SU 1MAYA 1NT1A 2VWLA 6ESTA 3LC3A 1SGDE 1C1PA 1CHOG 1Z1IA 3MMGA 2SGPE 1XXFA 2FESH 5TCAA 3L3TA 1O2TA 2V0BA 1IQLA 2PKSC 1E34B 2ZGXH 4YLUA 5J4QA 3RDZA 2ZF0H 1RJXB 4O97A 4CRFA 3QTOH 1SQOA 3O8CA 2EI7A 1PPBH 2BTCE 3PM3A 4FUIA 3LJJA 3OYPA 2VWNA 1TGBA 2BYAX 3ZYDA 4IMQA 5JDUB 4BXWA 2TGPZ 4Z0KA 1BZXE 1GI9B 3SUEA 2OC1A 1FNIA 2QXHA 4AB9A 1VJAU 1DXPA 1A0HB 3SV6A 3SJ9A 3B8JA 2NU0E 4O03A 1BB0B 2SNWA 1DSTA 3A88A 4CHAB 1V2KT 4FUCA 3UREA 3SORA 1AVGH 5AFYH 1V2ST 1P2OA 2ZG0H 3A7ZA 1L1GA 1A3EH 1PPZA 3MH7A 2P95A 5HM2A 1HAIH 4X8TH 5GDSH 1AI8H 1HAVB 2FXRA 1FAKH 1P2IA 3KGPA 2QV1A 2XW9A 1FY4A 1ANDA 1C5TA 4X2WA 4X8VH 4HTCH 4JYUH 1KXCA 2Z3EA 3T62A 1PJPA 1GBEA 3MYWA 1C2LA 1QBNA 1GG6C 2PLXA 2R9PA 4XBDA 2ZDMA 3QX5H 3TU7H 3RXGA 1GI0A 1V2WT 3M5OA 1SGTA 1NU9A 1Z1JA 2OLGA 1Q31A 2YNBA 2C8YB 2ZQ2A 1MBQA 4JYVH 5LPEA 2AEIH 1A7SA 3ZZ5A 5FBEA 1FY8E 1O2YA 2TGDA 2BY6X 3DUXH 2FX4A 2SGQE 2THFB 3GDUA 1UVOA 3SU2A 1SFQB 2GZ7A 1YPHC 1WTGH 3EQ0H 1HXFH 3LGTA 4K8YA 1HYLA 2A7CA 4Z6AH 1T31A 1O3PB 2OC7A 5CE1A 2PSXA 3P95A 4AZ2B 3SI4H 1GJ6A 5FCKA 1XUFA 1FI8A 3MWIU 1TGTA 3ODDA 4ABIA 2F9UA 1EX3A 2A4QA 1C1MA 1HAXB 1O5DH 3RXIA 1RTFB 1AHTH 5FXLA 4MQAA 4AG2A 4BNRA 5FAHA 2GD4B 1EPTA 1RS0A 4YOJA 3ZVEA 4BAOB 1CT2E 1UK3A 4NGAH 1BTWA 1TALA 1IQGA 4NWLA 2ZPQA 1A46H 1NPMA 5AHGH 1VITF 1WCZA 1TMUH 1UVUH 3FVFB 1Y3WA 1GI3A 3DFJA 1SGEE 3RXRA 2OCVB 4KTUA 4X8UH 2A45B 4U30A 3RXLA 1EAWA 3TGKE 1MAXA 1C5MD 3KEEA 1VCPA 3QN7A 1S84A 1O36A 4INKA 1ARBA 4Y79A 7ESTE 3BG4B 2OQ5A 1VR1H 1JIMA 1FAXA 4JZFH 3RMNH 1C1UH 1O34A 3SU4A 1XKBC 1QQUA 3VGCC 3JZ2B 4AFQA 1FUJA 2F91A 3A84A 2PUXB 1P2NA 1BRAA 3F68H 5G4BA 1DWEH 2UUYA 5LPRA 1ANEA 2ANMH 1IQNA 1HPGA 5J4SA 1HDTH 2BLVA 2BD3A 1EOJA 5JBCS 4AX9H 1KLJH 1O2SA 2VVUA 1G3CA 3P8GA 5C1XA 1FMGA 3VB3A 2P93A 1OWIA 3RLWH 3U69H 4ZHLU 2IN2A 2QYIA 2W5EA 3D65E 2TRMA 4RKOB 2O8TA 1VJ9U 2YNAA 3STIA 4X1QU 5T6DA 1GHVH 2ZGJA 1TNKA 1OPHB 3D49H 3RMLH 3ZZ8A 1AVXA 1SGPE 4Y76A 1ZLRA 1UTLM 4SGAE 4ZMAH 1LPKB 3LT3A 2FZZA 3SU5A 1SR5C 1F7ZA 2OBOA 4NCYA 2PW8H 2STBE 3UUZA 1ZHMA 2O8LA 1G37A 5L6NH 1OOKB 3MU4A 4DOQA 1AFEH 1YCPK 1D3DB 1QRZA 2P16A 5L2ZH 2CF8H 1G3EA 2GCHF 1MD8A 3UWIA 1UJ1A 2P8OB 5F8XA 1SBWA 2ZTXA 1MU6B 5A0BA 1A4WH 1D6RA 1O3AA 1SOTA 2ZFTA 4YZUA 1GJ8B 4MPVA 2XCFA 1QGFA 8GCHG 1FZZA 1C5SA 1XXDA 3IWMA 4HZHA 1V2MT 1DY8A 4BTUB 4WH6A 4AOQA 5ABWA 9LPRA 1GDUA 4DIIH 4XBBA 1LPGB 4IN1A 2Z6BD 1GMCG 2CXVA 1ELBA 3NPSA 2H2ZA 5PTPA 1F5RA 3SNAA 2Z7FE 2Z9LA 2ZO3H 5JBAS 3BTKE 1W12U 2ZECA 5C67A 5DGJA 2H9HA 3GYLB 3PMHB 2QC2A 1O5FH 1TA2A 3FANA 1YPLH 3T29A 1Y3UA 5GCHG 1UTPA 4CRGA 5A0AE 1C5PA 2A2XH 4K1SA 3PB1E 2ALVA 2VB0A 2W7UA 1NC6A 3FZDA 1ELFA 1P02A 1IQFA 1TBZH 3KL6A 6GCHF 3FP8E 3NCLA 1P10A 3UNQA 1GI4A 3GY3A 4BAHB 2F9NA 5GJ4B 3ZVBA 5F6MA 2SGFE 3E0PB 1IOEA 1KXFA 4OS1A 4I7YH 1QL8A 1F0SA 1DUEA 1UHBB 1XUKA 2Z9JA 3BG8A 4Q2KA 4Y6DA 5GIBA 1XKAC 3TK5A 2Y7ZA 2ASUB 2AGEX 1MUEB 3QLPH 4J2YB 4KP0A 1SGFA 4AYYB 1TNLA 1T4VH 1TFXA 3G01A 1EUFA 2HNTF 1K22H 5FPSA 1VGCC 1DUAA 1EJNA 1B5GH 1Z8RA 4AN7A 1MZDA 2FLRH 1Y59T 4NFFA 1O3JA 1PQAA 1LMWB 2NU1E 4FVDA 1TPPA 1QBOA 3A87A 1Z8IB 3STJA 2VIWA 2XC0A 2BVRH 1Z8GA 1VZQH 1G3BA 3LGYA 1UTNA 3GY2A 2FTLE 3RU4T 1P9UA 3E8LA 2J2UA 1V2NT 1SGQE 3V0XA 2F9OA 4ABGA 1RTKA 3M37A 2XWBI 1TGCA 3SJ8A 3ELAH 5TJXA 1N6XA 4LZ1H 2SNVA 1J16A 2BDAA 3CS0A 1O2RA 1MKXH 2PKSB 4I8JA 2DE8A 1Z7KA 1E37B 2H6MA 2OQUA 1GWAA 4B73A 2QY0B 3ATMA 3GDSA 3KNXA 2ZA5A 1W11U 2ZDNA 1HJAC 3EA9A 3P70B 2BD9A 1U6QA 1V2LT 5JPMH 1HAOH 2ZC9H 4TWWA 3A7VA 3TJVA 3BEIB 1DFPA 1BTPA 3P8OA 1EAUA 1TX8A 2FI4E 5AFZH 1UTMA 4B71A 4NSYA 3QGNB 1CA8B 3A82A 5E0JA 4GHQA 1F0RA 5DK1A 2C3SA 1V2PT 1ZMLA 5FHTA 2PTNA 1D9IA 1H8IH 1LVOA 3UWJH 1QJ6B 5DO4H 1DICA 4DJZB 5IYTA 3RXSA 3SJKA 3TVJB 2H9TH 2WPMS 3B23B 1O3FA 4E7RG 1DM4B 2BVSH 1FONA 3A7TA 4GCHG 1SLWB 2VVCA 2GV7A 3SO3A 3LH3A 3DD2H 2HGTH 4WWYA 2BMGB 4BTIB 1AMHA 3VEQB 3ESTA 1LKBA 1ELTA 3MH4A 4ZUHA 2ZGCA 2XBWA 1RXPA 1PYTC 1TOCB 2OUAA 1SSXA 1UCYE 3BSQA 1TBQH 2VWMA 5GWZA 2A32A 1O2NA 1GCTB 2UWPA 2VIVA 1EB1H 4MTBA 3GY6A 1C2GA 1T8LA 3M3VA 4A6LA 2BB4A 3Q77A 1QFKH 3BEUA 3TNSA 1ANBA 1SQAA 3A7XA 1MTNC 3LGUA