2JETC

Crystal structure of a trypsin-like mutant (s189d , a226g) chymotrypsin.
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
93
structure length
93
Chain Sequence
TPEKLQQAALPIVSEADCKKSWGSKITDVMTCAGASGVDSCMGDSGGPLVCQKDGVWTLAGIVSWGSGVCSTSTPGVYSRVTALMPWVQQILE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Crystal Structure of a Trypsin-Like Mutant Chymotrypsin: The Role of Position 226 in the Activity and Specificity of S189D Chymotrypsin.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
molecule keywords CHYMOTRYPSINOGEN B CHAIN A
total genus 12
structure length 93
sequence length 93
ec nomenclature ec 3.4.21.1: Chymotrypsin.
pdb deposition date 2007-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2jetC00
5BRRE 3F9EA 1ESAA 1H9HE 1WOFA 1A3EH 5HMAA 2A32A 2QV1A 2QXGA 1Z6EA 1KIGH 3TLOA 5ESBA 5F8ZA 3LC5A 4K1SA 1GBIA 1J14A 1P04A 4I32A 5JB8S 1DOJA 1TNIA 4IN1A 1S5SA 2NU3E 1SLXB 3ENSB 1EAUA 5LGOA 3DD2H 1BUIA 2BTCE 1IQEA 4DY7B 1Q31A 2EC9H 1A5GH 1MUEB 3VB3A 1AVWA 1UVOA 3S0NA 1OWEA 3LC3A 1FPHH 1FY4A 4Y76A 1SFIA 2NU2E 1WU1A 2ZQ2A 3GCTF 1CHOF 1ZPBA 3QDZB 4JYVH 1EP6A 1QJ1B 1IQFA 1SLUB 4KTSA 2SGQE 1W2KH 2R2WU 4CRGA 2GZ8A 2W7UA 1CGHA 3RC4A 4Y8ZA 2ZFFH 3L33A 1D6RA 3L6PA 5PTPA 4ABAA 2ANMH 2K1QA 2JH6D 4X1PU 2QC2A 4K60A 2C4FH 5FX5A 2FLRH 2W3KA 2CHAC 2VWOA 1ESTA 2PGQB 3BTWE 3EGKH 4NFEA 2WV4A 1KYNA 1UVTH 3M7TA 2HNTE 1T7CA 3ZV8A 3SUGA 3KQBA 1QFKH 1YPKH 1AVXA 4MPUA 2P94A 1Y5BT 1VJ9U 4AG2A 1E36B 2PGBB 1BCUH 4ISIH 4ZKSU 1HJAB 4YT6H 1XVOA 1GJ4H 1V2NT 1LKAA 3PMAB 3Q00A 3A8DA 2OBOA 1E0FD 3LH1A 4DOQA 3RLWH 1HXFH 4FU9A 2HWLB 2J38A 2PKSB 4TY7A 1OWJA 5FCKA 3NK8A 1ARCA 2FOEA 4THNH 1CHGA 1D4PB 1MTSA 1TGCA 3E0NB 1XMNB 1SGEE 2R9PA 2ZU2A 1P06A 3A8CA 3VB4A 1AI8H 2BZAA 3BTHE 1QJ6B 2FYQA 1Y3UA 1F5LA 1QL9A 5T6DA 3RC5A 5DP6A 1IQIA 1AGJA 1TIOA 2BLOA 1WCZA 1W3CA 1A0HB 1GMDG 4MTBA 4I8HA 2BD3A 2P95A 3UFAA 1D6WA 1K1MA 2TGAA 4IGDA 8KME2 3GY8A 5DKMA 3ATMA 2TBSA 1AMHA 3V12A 4UEHH 2QXIA 1Z71A 1ELDE 2OC1A 4UFGH 1MTVA 1NRQH 2Q6GA 4ABDA 3F68H 2TGDA 1ELEE 2XC5A 2TGTA 3A7ZA 2H9HA 3FZZA 3ZZ6A 5ESTE 4CRAA 3M7QA 2UUJB 2VB0A 4XBBA 4Y11E 2WINI 4WMDA 4Q80A 3ELAH 1THRH 3RXIA 3SU6A 2GTBA 1AWFH 1E35B 3U69H 4I31A 3BTME 1WQVH 2SNVA 2PV9B 1LHCH 1KXAA 2AIPA 3RXFA 3RDZA 1P03A 2ZFSA 4YM9A 3HK6B 1A61H 1C1VH 3O8RA 1O38A 2BDAA 3URDA 3EA8A 1YPGH 3DUXH 1TA6A 2DUCA 1ACBE 1YF4A 2VVUA 4ZHAA 4WF8A 4ISNA 2DE8A 1D3TB 1GI2A 1T4VH 3SW2B 1ORFA 4CRDA 1DM4B 2W3IA 1K2I1 1BQYA 1GHWH 4BTTB 1OKXA 3A7VA 4BAQB 5B6OA 1GHXH 3SQHE 1DLEA 1AY6H 4NWKA 3RXKA 5AFZH 2FP7B 3M5OA 2ZI2H 2BDYA 4I8LA 4O9VA 1GMHF 3M3VA 1RFNA 1TA2A 3RXOA 3TVJB 1AD8H 4JYUH 4AX9H 6GCHF 5IYTA 1TPPA 2SGAA 3A81A 3BTGE 3TJUA 2PLXA 2CF9H 1QQ4A 2WPJS 2ZQ1A 2FS8A 3SV9A 2BDBA 4ISLA 4X2XA 3S7KB 4X6OA 5C67A 2BY5X 2HLCA 2ZDAH 2V3HH 1FPCH 1P2NA 3LKWA 1G37A 3PMBB 4H6SB 3HATH 2QY0B 5SGAE 3DHKH 1DSTA 1KXBA 1HAZB 1BBRK 3LONA 1C5SA 2GMTC 3SNCA 4X2VA 3AW0A 2OCVB 2P3TB 3HK3B 3PLPA 1NFYA 1DLKB 1WQSA 3CS7A 3FZDA 3H7OA 2PHBA 2XBVA 2GVFA 3BV9B 1GHBF 1QIXB 1GBAA 1GBKA 1ZRKA 1HV7A 5DG6A 3ITIA 4WJG2 1K28D 3OYPA 3SNDA 2PW8H 1KLTA 4U2WA 3E8LA 4F4OC 1GCTC 1Z6JH 1G36A 1AKSB 4Y7AA 1IQGA 1NS3A 5L2ZH 2KAIA 2QGRA 1YPLH 1C2JA 1H8DH 1QCPA 2Q1JA 4ZKNU 1S6FA 1T4UH 1T8LA 3M3SA 4Q7YA 2P8OC 1O34A 1O3BA 1G30B 3I77A 1M9UA 2V6NA 3TGKE 1EJMA 3TJVA 3MU4A 5G4BA 2FX6A 1XXDA 2ZU5A 2GV6A 1C9PA 2ZC9H 1GBDA 1V2RT 3TNSA 3FFGA 6CHAB 1GMDF 3SJIA 3AASA 2Z3EA 1ZSKA 1SGCA 3SHCH 4ZXXH 4B73A 1O30A 3EA7A 1G3CA 5DO4H 3V3MA 1FAXA 5FXLA 2FESH 1IQHA 3MOCA 5EGMA 5A2MH 4H42U 3BTTE 2ZTYA 4E06H 4NSYA 2NWNA 4K69A 3KN2A 3M61U 4I33A 1KXDA 4YLUA 2YNBA 3H5CB 2RG3A 1IQLA 3RP2A 1O37A 1W11U 4AYVB 3B9FH 1ZJKA 1QJ7B 5HYOA 1L1GA 2NU0E 2WUCA 2BDGA 2PUXB 1IQNA 1F2SE 1YGCH 4BTUB 3JZ2B 2O8TA 3MO6A 1FY8E 2BDHA 1SHHB 1GCDA 1YCPM 1HIAA 2BD7A 2STAE 1V2KT 1QHRB 2AIQA 3PM3A 4B75A 3KF2A 1ZRBA 2PKAB 4IC6A 3MNSA 3MNCA 4OS7A 1BMMH 4UFEH 2GMTB 1YPHE 5AHGH 1OP8A 3GCTG 1CQQA 1BHXF 3QTVH 3RMMH 4NSVA 3C1KA 5LPRA 2Y81A 2WPHS 1KXEA 2ANKH 1S83A 4MLFB 1O3AA 4XSKU 1BBRE 3H7TA 1KY9A 5GDSH 3IG6B 5GJ4B 1HAXB 1P12E 1UTKA 1S6HA 4FUBA 2F9BH 1H1BA 2GKVE 3SUFA 1GL0E 5CHAC 1J17T 1TX6A 2FXRA 3LGIA 1QRXA 1MCVA 1EPTA 2O8UA 2GCTB 4NCYA 3SOSA 2R3YA 3UPEA 1C5RA 3MU8A 3P8OA 4NIVA 1DSUA 1O3LA 3E0PB 1BTXA 5I46H 3AAUA 2ILNA 2ANYA 2ZCLP 2IOTA 2WPKS 5DP7A 1XUGA 4X6PA 3TK9A 1BRUP 1TX7A 1MKWK 1P2JA 4CRBA 2RA0A 1TYNA 3I29A 2WPMS 2FOAA 1VGCB 1CT2E 1UO6A 1PPZA 3MYWA 3RMOH 4AGKA 4UDWH 1MAXA 5FBIA 1BTWA 1GJCB 3ZVCA 1TNJA 3P8GA 3LU9B 1K1PA 4WH6A 1TABE 4TPYA 3TK6A 1IAUA 7GCHF 2UUFB 1T8OA 3TH3H 5T6FA 4RN6A 9ESTA 2ZDNA 3DFLA 3S9AA 3R0FA 1CGJE 1MCTA 2BQWB 1LVMA 4YZUA 3ZVGA 1ARBA 3TIUA 4MPWA 1DUAA 3QGNB 2ZIQH 3VFEA 1V2QT 1AFQC 1JXPA 2XYAA 2TIOA 5LH8A 4K2YA 4CH8B 2VIWA 1TNKA 2BD9A 1BRAA 3VPKA 3A84A 1P0SH 2FTLE 1BA8B 1EZUC 1TQ0B 1MAYA 1P2KA 2NU1E 1EZQA 3TITA 1ZHPA 2BOKA 1LVBA 1LPGB 2Y6TA 2RCEA 3HGNA 4TWYA 2VIVA 4BAMB 3SZNA 1D3QB 3KQCA 4R0IA 1HAHH 1WYKA 4FUGA 5E2PA 3FANA 4CRFA 1UJ1A 1VCQA 2BY9X 1O3IA 3NKKA 2FM2A 1TBRH 3TH2H 2OTVA 1TQ7B 4AFQA 2JETB 2ZEBA 1AFQB 1HGTH 3UIRA 2LNCA 4YESB 3R3GB 2XC4A 3SNBA 2B8OH 4HZHA 2XC0A 2XCNA 3RXDA 1O2WA 1KTSB 4UD9H 1C1OA 1TOMH 1BJVA 3UOUA 2V35A 1GGDC 1C1UH 1DX5M 3KGPA 5DP8A 3GDVA 3KQEA 3A82A 3RXGA 2TGPZ 5E0GA 2ZO3H 2OC7A 2ZHEH 1TNHA 2GZ9A 3RM2H 3RXHA 1HDTH 1AKSA 1TBZH 2BHGA 1DS2E 3SNEA 1OS8A 2ZGBH 3KNXA 4FUDA 2ZHWH 1XKBC 3SU1A 4ABGA 4AFSA 4CH2B 4X8VH 1PPEE 4YO9A 2FTMA 3BEFB 4UFFH 4BAKB 1V2WT 3A83A 3LJOA 1TALA 4DW2U 1O33A 2BDIA 1BTPA 2BX3A 2C93B 1V2JT 4SGAE 1QQUA 4YOIA 1GMCG 1FXYA 1SGNE 3LGYA 4J1YA 4ABFA 1JBUH 2HOBA 1Z8RA 3C27B 1P01A 1P57B 1WUNH 2SNWA 3QZQA 2Y7ZA 1BZXE 5ABWA 1UCYH 3LT3A 4IMZA 3ZVEA 1DVAH 2FOGA 2HNTF 1YPEH 2SGDE 2OUAA 3A8BA 3HKIB 3TK5A 4DT7B 2ZDLA 5A8XA 1CO7E 2C8XB 5ETXA 1RXPA 3RC6A 1O3GA 2BQ6B 3P8NA 4K8BA 1O3HA 3ZZCA 5JBAS 3P92A 3A86A 4ZKOU 1A3BH 1Z8IB 1THPB 4IBLH 1DANH 1ZLRA 2VWLA 3MFJA 4FUJA 3E16B 4I8KA 3ZVFA 1RIWC 1MH0A 5F6MA 2ASUB 2XRCA 4JZIA 3ATKA 3F1SB 1EAIA 2AGGX 1K22H 1OWDA 1P05A 1CGIE 4E7RG 1AE5A 1CA8B 2QA9E 4HTCH 1CT0E 1S0QA 2BM2A 2Y5FA 3ZZ4A 5L6NH 2ZFRH 1DXPA 2Y82A 3IWMA 1AO5A 1GVKB 1L1JA 2V0BA 1A0LA 1DUEA 3I78A 3HGPA 2SGPE 5FHTA 1BJUA 3SI3H 1O39A 1ELCA 1GMHG 5GXPA 4ABEA 2NU4E 1MTNB 1FQ3A 1EPTB 1HNEE 4BTIB 3T2NA 1A5HA 2F9UA 1G3BA 3B8JA 1O3FA 2ZNKH 3TPIZ 1O3PB 1C1QA 1KSNA 4UONA 3E90B 1O5GH 3BSQA 1MQ6A 2H9EH 4IN2A 3QLPH 3UNRA 1Y8TA 5EODA 1O36A 2FOHA 3GICB 1EQ9A 2BZ6H 2Z94A 4OS4A 5F8TA 3SU3A 1WSSH 2ODYB 1QY6A 2A45B 3SUEA 1C2IA 1XUIA 2P93A 3ATLA 1ZTJA 1C2LA 1K1NA 3OY6U 1XUJA 1IQKA 3T25A 1W0ZU 4YLQH 1AFEH 3MNBA 4ZKRU 1V2ST 2P16A 2B7DH 4IS5A 5JDUB 4K1TA 4WH8A 3SUDA 2BD4A 1SL3A 2VIQA 1NZQH 1C2FA 1G9IE 1LPZB 2AMPA 2BY8X 2ALVA 1SQAA 1S84A 2ZHDA 4JMYA 1DITH 4OGYA 1GJ6A 4DVAU 5GPIB 3U98H 3ATWA 1K1LA 1FY3A 5L30H 3O8CA 1F0RA 4MDSA 1ZOMA 2GV7A 1KTTB 1IHSH 2ZGXH 1H8IH 2OBQA 1GHYH 2A31A 4X8SH 1P2IA 4YT7H 1A5IA 4CBOA 2EA3A 1QURH 3OY5U 1EJNA 3GYLB 1TRYA 1EASA 2V3OH 4ZHMU 2VWMA 1CE5A 3D65E 5JBBS 2GT7A 4Y0ZE 4A92A 5GWZA 1SPJA 1XKAC 1SHYA 4AGJA 5AF9H 1GBJA 4MG3A 1UVUH 1YC0A 1GMCF 4INLA 2QYIA 4TWWA 4X1SU 4O97A 5AVDA 3SV7A 1PYTD 2BVRH 4VGCB 1ZMNA 1O2XA 1FDPA 2IPHA 4KKDA 3BTEE 4Y8YA 1BIOA 1DWCH 3QZRA 1GI3A 5LPFA 1O2LA 2FDAA 1ELBA 1EZSC 1W13U 1V2OT 3GISB 2VIDA 1TMBH 3PO1C 1FN6A 1RTFB 1L1NA 1L2EA 2G5VA 4K1EA 1HAIH 1NRNH 4OGXA 2OD3B 5F03A 2VIOA 1O2JA 1W7XH 1GBTA 2ZCHP 4F49A 5TJXA 1W14U 1QA7A 3SGBE 1MKXH 1O35A 4NGAH 1QBVH 5JBTA 2IJOB 3LH3A 3K6ZA 4OS2A 4GHTA 1UHBB 1HYLA 1C5LH 2ZU3A 3KCGH 1GDNA 2ZDKA 1C5TA 3KL6A 4CR5A 2EI7A 1FY5A 2RDLA 2FOCA 3M36A 1HAPH 3O8BA 2VH0A 4WXIA 4I8GA 5T6GA 1LMWB 1TRNA 1Q2WA 1Y3VA 3FP6E 2ODQA 1CA0C 2C90B 2QXHA 5L2YH 3EYDA 2QF0A 2UWOA 1GWAA 2ZPSA 2P3FH 2SGFE 1Q3XA 4Y79A 2PSXA 1W8BH 1NTPA 1XVMA 1G3DA 1TWXB 3BG4B 3BEUA 2FOFA 1SLVB 4CREA 1TAWA 4D9QA 1PPHE 1MBQA 1NFUA 4XDEA 1C1WH 1MD7A 1V2UT 1LHDH 1O31A 3RXPA 1WV7H 2Y7XA 3GCNA 1AZZA 1O5DH 1CBWB 1XXFA 1O3KA 4NA7A 1UK2A 1ELTA 2A5KA 5EPNA 3SJOA 1DXWA 1VR1H 1O5AB 1S0RA 1FNIA 1W10U 4I7YH 1C5UA 3MNXA 1BTYA 1SGIB 2GX4A 1C5YB 1YBWA 1SG8B 1Z1JA 3PYHA 2FIRH 3F6UH 5FPSA 2H6MA 1O2UA 1MD8A 2AH4X 2CMYA 1CBWC 3T5FH 4BXSA 3UUZA 4O3TA 4ISHH 1C1PA 1QRZA 3GOVB 2OQUA 4BAHB 1ZSLA 4INHA 2AS9A 2Z9IA 3GY5A 1NRRH 1JIRA 3MU0A 4X1QU 4NIXA 3GCOA 1GHAG 4KTUA 1THSH 2ZHFH 1TRMA 3SV6A 2C8YB 1PJPA 2G55A 3MO3A 1C1RA 1UTLM 3SHAH 5TCCA 2AEIH 1GI0A 1BMLA 1HJ9A 1P2QA 1OPHB 5FCRA 1C2EA 3PMHB 1GL1A 3CP7A 4ZROA 1LHFH 1NRPH 3PLKA 1FN8A 5DGJA 1EAWA 2JH0D 1BBRH 2QIQA 1A46H 2ZGHA 4D7GA 3EQ0H 5EQSA 4YOJA 3AW1A 1TX8A 1GBLA 4CHAC 1YCPH 3EDXB 1SGPE 4WMEA 1MTNC 1TGTA 2A7CA 1VITG 4JYTA 1JIMA 2ZPQA 5C2ZA 5C1UA 2H5CA 4Q7ZA 3LGVA 4ZH8A 4A5TS 1C5WB 4H6TA 3G01A 3UR9A 5C1XA 4K8YA 4ASHA 1C2KA 2PTCE 1EB2A 2VNTA 2Q6FA 1O5FH 5HM9A 5EW1H 4HFPB 1LTOA 2PKAA 4PROA 1NO9H 1WTHD 3MI4A 4JK5A 1HUTH 1N6XA 2A7JA 4XOJA 1C4U2 3ZYEA 1GG6C 4BAOB 4AOQA 3SJ9A 1O2OA 3RXLA 2AGIX 1O3MA 3SV8A 1ESBA 1QL7A 4ZUHA 1PFXC 2G8TA 3EA9A 1GJ7B 3TNTA 2VINA 1A0JA 5C20A 5FPYA 4CBNA 3TGIE 3EE0B 3K9XB 1KXFA 4ABBA 4K3JA 6LPRA 3AAVA 2GGVB 5EQRA 2XBYA 5EU8A 4Y7BA 2A4QA 2ZF0H 2TPIZ 2SFAA 4NA8A 1Z8GA 1XX9A 1FI8A 3HPTB 3NXPA 3BTDE 1OYQA 5K7RA 4MNVA 2VVCA 4GLYA 3SBKA 3MTYA 1NPMA 2O9QA 1H9LB 4O03A 3ZZAA 1UTNA 3AVZA 1RTKA 1XUHA 1QL8A 2A2XH 1OX1A 2BX4A 1F5KU 1SQOA 4YOGA 1N6YA 3ZVAA 1HXEH 1NROH 1ZTLA 2ZGJA 1OP0A 3SGAE 1SR5C 3L3TA 1FJSA 1A4WH 4ZHLU 5K0HA 1N8OB 4INKA 2ZZUH 1Y5UT 2ZECA 4RSPA 4M7GA 4GHQA 2GD4B 1ZZZA 3K2UA 3ZV9A 3T28A 3B23B 3SJKA 1S85A 3UQOA 1TLDA 1AIXH 1EAXA 1D3PB 1C5VA 1O2RA 5E8EH 5A0AE 1TPSA 1GI1A 2PKSC 1NC6A 1UMAH 3QK1A 2I6SA 3UY9A 4A7IB 3ZVDA 1GVLA 1DICA 1J8AA 1QGFA 2KAIB 2F9PA 1C5MD 2XW9A 2P3UB 1FZZA 2BD2A 4X6NA 3OTJE 4GUXA 3BG4C 7ESTE 1JRSA 4A6LA 8ESTE 1P10A 2Z6BD 1HAVA 2AYWA 2XWBI 2XWAA 3UQVA 2GCHF 3CENA 1SQTA 2Q6DA 4JZFH 3GY2A 1YLDA 8LPRA 2IN2A 1O2MA 2BD5A 4DURA 1ZMJA 3LPRA 1PQ5A 2FI3E 5IDKA 1LHEH 3DT0H 1FIZA 1ZTKA 3ZZ3A 1O2VA 3S9CA 4UE7H 3KEEA 1AVGH 3O8DA 1O2GH 1TPOA 1AU8A 4E05H 3GY6A 4LK4A 3M35A 3ZYDA 2FMJA 1MTWA 1XUKA 1EZXC 2B5TB 1B7XB 1O3CA 2GCTC 2RA3A 5FAHA 4D7FA 2B9LA 1T32A 3U1IB 3WY8A 4AORA 4NIYA 4AFUA 1JMOH 2ZDVH 1HB0B 1TMUH 1O2YA 4TY6A 1O3EA 2ZFQH 4Q7XA 3ZZ7A 3A87A 3BEIB 2HRVA 1ANBA 3BTKE 5DP5A 1N1LA 3RM0H 1GI4A 1TONA 4WWYA 5BPEA 1BB0B 2FPZA 3D23A 5C5NA 1ELFA 1YM0A 2WV5A 5FBEA 1A7SA 3EAJA 2A5AA 5DP9A 3A80A 1GI5A 4O3UA 1CHOG 2J2UA 3BF6H 1GBCA 1C4V2 3N7OA 1C2HA 1TGBA 2C8ZB 3OU0A 5FX6A 4JZEH 4NG9H 1F7ZA 1QA0A 3VGCB 2EEKA 4U30A 3SV2H 4DG4A 1SGFA 1SOTA 5F8XA 1LO6A 5JB9S 1JWTA 4Z6AH 3RMLH 3PWBA 5T3HA 4RKJB 4Z0KA 2FO9A 2BMGB 1LQEA 4FXGH 1E38B 7LPRA 1TMTH 1V2MT 3SORA 3SU2A 1QB9A 4WY3A 1UVPA 4B2CA 1C1NA 3T27A 1GI8B 2ZP0H 4B74A 4WXVA 1BMNH 1UTPA 2H9TH 4Y71A 1UTOA 4GCHF 2A1DB 4B2BA 1BHXB 3S69A 1PQ8A 1K1OA 1FAKH 1ELGA 2HNTC 1EOJA 5HM2A 1T8NA 2P59A 3GY3A 1L4DA 3PROA 2P8OB 3K65B 1NN6A 3M5MA 3BN9A 2VWNA 5GCHF 4OS1A 2ZTXA 4BNRA 1QBNA 3PV4A 1V2VT 3OSYA 4KTCA 4B71A 4DIHH 4NA9H 4MPXA 2JETC 3RU4T 1MQ5A 4TPIZ 4A1VA 3D49H 1AWHB 1O3NA 1LHGH 1SSXA 2ZTZA 3E3TA 3LIWA 3ODDA 1ZHMA 2OC8A 2D8WA 1EKBB 3ZZ5A 2ODPA 2GT8A 1IQJA 3ZZBA 5H4IB 4DGJA 1KDQA 2R0KA 3Q3YA 3GCHC 1O5CB 1QB1A 1AUTC 4X6MA 1GJ5H 4AB9A 1UTJA 2PSYA 1VZQH 1SGYE 2XXLA 2ZHQH 2GP9B 1BTHH 1O2SA 5EXLA 3ATIA 3RXRA 4ZAEA 1C5ZB 5EQQA 1C2MA 1WTGH 1PQAA 1ABIH 1NFWA 2PWXA 1NU7B 1TGSZ 3U8OH 4E7NA 1Y3WA 4AG1A 3T62A 4D8NA 2BXUH 1ZSJA 4FUIA 1SB1H 1DT2A 4B1TA 1HFDA 1UK4A 3SO3A 2UWLA 2VIPA 2FI4E 3W95A 1C5PA 1QRWA 2J94A 1O5BB 4DIIH 3RXCA 4KGAA 4HI3A 4GPGA 3TGJE 5A09A 1DWBH 2Z3DA 1C4Y2 1E34B 2GDDA 9LPRA 1KLIH 5GCHG 2D26C 1PPBH 5E0HA 1HPGA 2F83A 1O2TA 5DPAA 3Q77A 2D2DA 2ZDMA 4RKOB 1C1TA 1NESE 5JBCS 1ZHRA 1GI6A 1GJAB 3ESTA 5A8ZA 1PPCE 1NU9A 1D3DB 5A0CA 1W12U 3A88A 1ZMLA 1J9CH 2GZ7A 3GDSA 2PTNA 3LGWA 1SFQB 2FOBA 3A7WA 1GI9B 2D1JA 4GSOA 3V13A 4DJZB 3SJ8A 1TFXA 5CHAB 1G32B 1OSSA 1GBEA 2BXTH 2F3CE 3MH4A 2FYRA 2STBE 2FEQH 1UK3A 1ETRH 4FVBA 1EB1H 4IC5A 1TBQH 3UR6A 4D9RA 3BTQE 3CS0A 4MNYA 1FIWA 3MU5A 1MZDA 4WVPE 4MNWA 2F91A 3ZVBA 2PUQH 3RXVA 3GY7A 4FUFA 2AGEX 2OC0A 1ZR0A 3RLYH 4SGBE 3LJJA 1OYTH 1SMFE 3U1JB 1P9UA 1LVYA 2M5TA 1FUJA 2CF8H 2WUBA 3PTNA 2QXJA 3K6YA 3GCHB 1PPFE 1SVPA 3M5NA 4TYDA 1KXCA 1UHBA 3KIDU 3FP7E 3SU0A 2FOMB 3E6PH 1MU6B 1GBBA 2BLQA 3UTUH 1HCGA 1FV9A 2CXVA 3SNAA 3RXUA 3SQEE 3KQDA 1Z1IA 4QT8C 1GBMA 3UOPA 1BRBE 1C5NH 3LDXH 1YPMH 1O2KA 1FONA 4BOHA 1SLWB 4LXBH 2C8WB 4KP0A 4XBCA 3QO6A 1P8VC 4X8UH 1OWIA 2A7HA 4NWLA 1AE8H 3OX7U 2J92A 3NWUA 2EI6A 1IOEA 3MH5A 4X8TH 3DFJA 1OWKA 4BXWA 4ABJA 5DJ7A 1Z8JB 2Z9KA 3GYMA 3VEQB 4ABIA 4ZMAH 3FVFB 2QAAA 1NY22 4JZDH 1NRSH 1SGTA 2O8WA 3VB6A 2YNAA 2VH6A 2CV3A 1GBHA 2FWWA 5CMXH 3ODFA 3MU1A 1A1RA 1HAYB 3ZZ8A 1F0UA 3U9AH 2QN5T 3NPSA 2R3UA 4NIWA 3T26A 2OINA 2QF3A 4XFQA 1FMGA 1MZAA 4HGCA 4I8JA 4B76A 2W7SA 1N8OC 1LQDB 3SN8A 1HRTH 1LVOA 1GJBB 3UNSA 2B0FA 6CHAC 1LPKB 3BTFE 1RTLA 3JZ1B 1O2HA 1O32A 1ANDA 1EXFA 2BY7X 5EOKA 1INCA 2Y5GA 7GCHG 1OP2A 3LGTA 2R0LA 2ESTE 2ZWLH 2BVXH 1BT7A 1ZYOA 2QCYA 4MPVA 1OOKB 2BYAX 1O0DH 4X0WU 4KELA 1GCTB 1YCPK 3PB1E 1YPHC 1ANEA 1V2TT 3PLBA 4X1RU 4Y6DA 5AFYH 4JCNA 8GCHG 3E91A 1DWEH 1IQMA 4YTAA 2BY6X 1QB6A 3TH4H 1SGRE 1V6DA 2ZFPH 2Z9LA 2AERH 1E37B 5EPYA 1SI5H 1MMJN 4Y0YE 1OWHA 1Y3YA 4D76A 2A4OA 3TU7H 2Z3CA 1BOQA 2ZU4A 1TE0A 4XBDA 4JZ1A 7KMEH 2VU8E 2TRMA 1O3OA 1L4ZA 2JKHA 1O3DA 3P70B 1DWDH 1HAGE 4NFFA 1YLCA 1O2PA 1LKBA 2ZU1A 3VXFH 1Z7KA 1Y5AT 2OP9A 1DPOA 4GAWA 5C5OA 3BG8A 3BIUH 5I25A 1TB6H 3QGJA 5E2OA 5EW2H 1CA0B 1ELVA 2UUKB 1P3CA 1P2MA 2FODA 1ID5H 2WYGA 4FUEA 4IW4E 2R2MB 3P17H 3SGQE 1HJ8A 1GJDB 1S81A 4U01A 3VB5A 4X1NU 3SU4A 3STIA 1DY9A 5CE1A 2XBXA 1B5GH 2HPPH 4OS5A 1O5EH 3GDUA 4FUCA 1MBMA 1C1MA 4AB8A 2G81E 2OQ5A 2XTTB 1YPJH 1NFXA 2THFB 3MH6A 3W94A 1X7AC 2H5DA 2H2ZA 1GBFA 1T8MA 4Y10E 1YP9A 1MKWH 3P6ZB 3BIVH 2UUYA 4Y8XA 2WPLS 4MNXA 2VGCC 4H4FA 4J2YB 3NZIA 1K21H 4CHAB 2Z9GA 3QTOH 3RXBA 2SGEE 2GCHG 1H9IE 1GDQA 4UFDH 1C5QA 2CN0H 1ZGIA 1AB9B 4AN7A 4X2WA 1DY8A 1QBOA 1BITA 1TPAE 3RMNH 2Y80A 2F9NA 1U6QA 1W7GH 1RS0A 1HBTH 5GIBA 1B0EA 2ZFTA 1C2DA 3A8AA 2AMDA 1ZGVA 3F9HA 4WMFA 3VGCC 4A1TA 2CGAA 3T29A 3RXMA 2XCFA 1J15A 1BDAA 1P02A 2A4RA 1B0FA 3U8RH 1PPGE 1EJAA 1SGDE 3FAOA 2GDEH 2FLBH 5DP4A 1MU8B 4FU8A 4IMQA 4BANB 3RXSA 1GHAF 1FLEE 6ESTA 1QNJA 1QTFA 4LZ4B 3S7HB 4NZLA 2ZCKP 1ZJDA 1GHZA 3MHWU 2XBWA 1C5OH 1UCYE 2CJIA 4A1XA 2F9VA 1P11E 4AYYB 2EI8A 2G5NA 2J95A 3A7XA 3UWIA 2UWPA 2PFEA 1O3JA 1HAOH 2YOLA 5JPMH 3Q76A 1WBGB 1C2GA 4XE4A 3NCLA 4LOYH 1G3EA 1MTUA 3M3TA 3QX5H 1GPZA 2Z9JA 5FPTA 4ZXYH 5C3NA 1LCYA 2ANWA 3IITA 2G4UA 2G00A 3VXEH 1TNLA 3QWCH 2CHAB 1HAVB 3RXEA 5J4QA 1C9TA 2G51A 4Q2KA 3UNQA 2G4TA 4MVNA 1LDTT 1TNGA 2A0QB 2Z7FE 6GCHG 1JRTA 1SGFG 2ZA5A 3ZZDA 1DDJA 2C3SA 5A8YA 2OLGA 1F0SA 2DE9A 2ZGCA 3V7TA 1CVWH 1H4WA 2O8MA 1HJAC 1O2NA 2AFQB 1DE7H 1V2PT 1MKXK 1AHTH 4JK6A 1KLJH 1ETSH 3RXQA 4FU7A 1DFPA 3RU4D 3UWJH 1F5RA 2Y5HA 3URCA 2J4IA 1W0YH 2W26A 4ISOA 5TCAA 4CRCA 3NUMA 4B2AA 1ABJH 1EATA 5HGGA 3ZZ9A 5E0JA 1RGQA 4X2YA 3PO1B 2FI5E 1GHBG 4ESTE 2HPQH 3M5LA 1V2LT 3RXTA 3SU5A 3V0XA 5A0BA 1D9IA 3RXJA 1NM6A 5EG4A 1Y3XA 2JH5D 2H1UA 2ZKSA 1P9SA 4VGCC 5EXMA 1ELAA 1GHVH 1GVZA 4ABHA 1EP5A 1EOLA 1UTMA 3Q3XA 1TGNA 1NT1A 2AMQA 2VVVA 2LPRA 3RU4E 2O8LA 3QUMP 1VCPA 4OS6A 1TOCB 1XUFA 1SBWA 1SC8U 1Y59T 2BLVA 1F92A 4FUHA 4AZ2B 1IHTH 2A2QH 1V3XA 3TJOA 1JOUB 2ZPRA 2J34A 1K1JA 1A2CH 1CT4E 3FP8E 4MQAA 2BVSH 1RJXB 1AUJA 1G2LA 1VITF 1J16A 2BQ7B 3GY4A 1C5XB 1XM1A 1O2ZA 1WAYB 3QN7A 1O2IA 1EPTC 2F9OA 5JYIA 2ULLA 2XNIA 2BOHB 3SI4H 2W5EA 1T31A 1CU1A 1HLTH 1ZPCA 1GGDB 1AZ8A 3STJA 4AFZA 1YYY1 3A7YA 4FVDA 3A89A 1K9OE 4K5ZA 5HXFA 2OXSA 5C1YA 1O2QA 1G2MA 4DCDA 1BTUA 1HIAB 5EXNA 1K1IA 1OXGA 1UCYK 4LZ1H 1S82A 4GVUA 1BMAA 2I6QA 1FY1A 1C1SA 1GJ8B 4NZQA 5DK1A 3F9GA 1SOZA 3PTBA 4U32A 2BB4A 4CR9A 3LOXA 4GCHG 3A85A 1RIWB 1SGQE 3F9FA 1YKTA 1RRKA 2BLWA 3MO9A 3DA9B 8GCHF 1PQ7A 5DP3A 3TJNA 1AN1E 1VCWA 1UTQA 2BD8A 2FZZA 3E1XB 3D62A 3Q3KA 1AQ7A 3P95A 3U8TH 1UVSH 2G52A 2J9NA 3LGUA 3S9BA 1P3EA 4R8TB 1GDUA 5LPEA 1RD3B 3HKJB 2FX4A 1P09A 1QR3E 1GJ9B 3MH7A 1EUFA 1BTZA 3M37A 2VGCB 1CSOE 2A5IA 2HALA 3PWCA 1ZPZA 1VITH 3VB7A 1P2OA 2HVXA 3MWIU 1KDQB 2BDCA 1ETTH 1GG6B 2HGTH 2PR3A 1ANCA 3P8FA 1AB9C 3RXAA 3KHVA 1L0ZA 3M7UA 1F0TA 1VGCC 2WYJA 3PMJA 2A4GA 2WPIS 3RUOA 1PYTC 2ZG0H 3MMGA 2ALPA 5J4SA 1EX3A 1BRCE 1VJAU 2VJ1A 3UREA 3A7TA 2FS9A 1GI7B
chains in the Genus database with same CATH superfamily
5BRRE 3F9EA 4I86A 1ESAA 1H9HE 1WOFA 1A3EH 2CK3D 5HMAA 2A32A 2QV1A 2QXGA 1Z6EA 1KIGH 3TLOA 5ESBA 5F8ZA 3LC5A 4K1SA 1GBIA 1J14A 1P04A 4I32A 5JB8S 1DOJA 1TNIA 4IN1A 1S5SA 2NU3E 1SLXB 3ENSB 1EAUA 5LGOA 3DD2H 1BUIA 2BTCE 1IQEA 4DY7B 1Q31A 2EC9H 1A5GH 1MUEB 3VB3A 1AVWA 1UVOA 3S0NA 4P00A 1OWEA 3LC3A 1FPHH 1FY4A 4Y76A 1SFIA 2NU2E 1WU1A 2ZQ2A 3GCTF 1CHOF 1ZPBA 3QDZB 4JYVH 1EP6A 1QJ1B 1IQFA 1SLUB 4KTSA 2SGQE 1W2KH 2R2WU 4CRGA 2GZ8A 2W7UA 1CGHA 3RC4A 4Y8ZA 2ZFFH 3L33A 1D6RA 3L6PA 5PTPA 4ABAA 2ANMH 2K1QA 2JH6D 4X1PU 2QC2A 4K60A 2C4FH 5FX5A 2FLRH 2W3KA 2CHAC 5C17A 2VWOA 3FKSD 1ESTA 2PGQB 3BTWE 3EGKH 4NFEA 2WV4A 2F4LA 1KYNA 1UVTH 3M7TA 2HNTE 1T7CA 3ZV8A 3SUGA 3KQBA 1QFKH 1YPKH 1AVXA 2V3MA 4F48B 4MPUA 2P94A 1Y5BT 1VJ9U 4AG2A 1E36B 2PGBB 1BCUH 4ISIH 4ZKSU 1HJAB 2KR7A 4YT6H 1XVOA 1GJ4H 1V2NT 1LKAA 3PMAB 3Q00A 3A8DA 2OBOA 1E0FD 3LH1A 4DOQA 3RLWH 1HXFH 4FU9A 2HWLB 2J38A 2PKSB 4TY7A 1OWJA 5FCKA 3NK8A 1ARCA 2FOEA 4THNH 1CHGA 4RT1A 1D4PB 1MTSA 1TGCA 3E0NB 1XMNB 1SGEE 2R9PA 2ZU2A 1P06A 3A8CA 3VB4A 3WW7A 1AI8H 2BZAA 3BTHE 1QJ6B 2FYQA 1Y3UA 1F5LA 1QL9A 5T6DA 3RC5A 5DP6A 1IQIA 1AGJA 1TIOA 2BLOA 1WCZA 1W3CA 1A0HB 1GMDG 4MTBA 4I8HA 2QE7D 2BD3A 2P95A 3UFAA 1D6WA 1K1MA 2TGAA 4IGDA 8KME2 3NRLA 3GY8A 5DKMA 3ATMA 2TBSA 3N7EA 1AMHA 1COWD 3V12A 4UEHH 2QXIA 1Z71A 1ELDE 2OC1A 4UFGH 1MTVA 1NRQH 2Q6GA 4ABDA 3F68H 2TGDA 1ELEE 2XC5A 2TGTA 3A7ZA 2H9HA 3FZZA 3ZZ6A 5ESTE 2WSSD 4FOUC 4CRAA 2WHXA 3M7QA 2UUJB 2VB0A 4XBBA 4Y11E 2EY4C 2WINI 4WMDA 4Q80A 3ELAH 1THRH 3RXIA 3SU6A 2GTBA 1AWFH 1E35B 3U69H 4I31A 3BTME 1WQVH 2SNVA 2PV9B 1LHCH 2K0QA 1KXAA 2AIPA 3RXFA 3RDZA 1P03A 2ZFSA 4YM9A 3HK6B 1A61H 5KECA 1C1VH 3O8RA 1O38A 2BDAA 3URDA 3EA8A 1YPGH 3DUXH 1TA6A 2DUCA 1ACBE 1YF4A 5DN6D 1E1RD 2VVUA 4ZHAA 4WF8A 4ISNA 2DE8A 1D3TB 5EJLA 1GI2A 1T4VH 3SW2B 1ORFA 4CRDA 1DM4B 2W3IA 1K2I1 1BQYA 1GHWH 4BTTB 1OKXA 3A7VA 4BAQB 5B6OA 1GHXH 3SQHE 1DLEA 1AY6H 4NWKA 3RXKA 5AFZH 2FP7B 3M5OA 2ZI2H 2BDYA 4I8LA 4O9VA 1GMHF 3M3VA 1RFNA 1TA2A 3RXOA 3TVJB 1AD8H 4JYUH 4AX9H 6GCHF 5IYTA 1TPPA 2SGAA 3A81A 3BTGE 3TJUA 2PLXA 2CF9H 1QQ4A 2WPJS 2ZQ1A 2FS8A 3SV9A 2BDBA 4ISLA 2LELA 4X2XA 3S7KB 4X6OA 5C67A 2BY5X 2HLCA 2ZDAH 2V3HH 1FPCH 1P2NA 3LKWA 1G37A 3PMBB 4H6SB 3HATH 2QY0B 5SGAE 2YMSC 3DHKH 1DSTA 4AC9A 4Q63A 1KXBA 1HAZB 1BBRK 3LONA 1C5SA 2GMTC 3SNCA 4X2VA 3AW0A 2OCVB 2P3TB 3HK3B 3PLPA 1NFYA 1DLKB 1WQSA 3CS7A 3FZDA 3H7OA 2PHBA 2XBVA 2GVFA 3BV9B 1GHBF 1QIXB 1GBAA 1GBKA 1ZRKA 1HV7A 5DG6A 3ITIA 4WJG2 1K28D 3OYPA 3SNDA 2PW8H 1KLTA 4U2WA 3E8LA 4F4OC 1GCTC 1Z6JH 1BMFD 1G36A 1AKSB 4Y7AA 1IQGA 1NS3A 5L2ZH 2KAIA 2QGRA 1YPLH 1C2JA 1H8DH 1QCPA 2Q1JA 4ZKNU 1S6FA 1T4UH 1T8LA 3M3SA 4Q7YA 2P8OC 1O34A 1O3BA 1G30B 3I77A 1M9UA 2V6NA 3TGKE 1EJMA 3TJVA 3MU4A 5G4BA 2FX6A 1XXDA 2ZU5A 2GV6A 3U28C 1C9PA 1S6LA 2ZC9H 1GBDA 1V2RT 3TNSA 3FFGA 6CHAB 1GMDF 3SJIA 3AASA 2Z3EA 1ZSKA 1SGCA 3SHCH 3F2HA 4ZXXH 4B73A 1O30A 3EA7A 1G3CA 5DO4H 3V3MA 1FAXA 5FXLA 2FESH 1IQHA 3MOCA 5EGMA 5C0TA 5A2MH 4H42U 3BTTE 2ZTYA 4E06H 4NSYA 2NWNA 3F2GA 3CNRA 4K69A 3KN2A 3M61U 4I33A 1KXDA 4YXWD 4YLUA 2YNBA 3H5CB 2RG3A 1IQLA 3RP2A 1O37A 1W11U 4AYVB 3B9FH 1ZJKA 1EFRD 1QJ7B 5HYOA 1L1GA 2NU0E 2WUCA 2BDGA 2PUXB 1IQNA 1F2SE 1YGCH 4BTUB 3JZ2B 2O8TA 3MO6A 1FY8E 2BDHA 1SHHB 1GCDA 1YCPM 1HIAA 2BD7A 2STAE 1V2KT 1QHRB 2AIQA 3PM3A 4B75A 3KF2A 3OE7D 1ZRBA 2PKAB 4IC6A 3MNSA 3MNCA 4OS7A 1BMMH 1FX0B 4UFEH 2GMTB 1YPHE 5AHGH 1OP8A 3GCTG 1CQQA 1BHXF 3QTVH 3F3BA 3RMMH 4NSVA 3C1KA 5LPRA 2Y81A 2WPHS 1KXEA 2ANKH 1S83A 4MLFB 1O3AA 4XSKU 1BBRE 3H7TA 1KY9A 5GDSH 3IG6B 5GJ4B 1HAXB 1P12E 1UTKA 1S6HA 4FUBA 2F9BH 1H1BA 2GKVE 1WDIA 1GL0E 3SUFA 5CHAC 1J17T 1TX6A 2FXRA 3LGIA 5B6LA 1QRXA 1MCVA 1EPTA 2O8UA 2GCTB 4NCYA 3SOSA 2R3YA 3UPEA 3W1EA 1C5RA 3MU8A 3P8OA 4NIVA 1DSUA 1O3LA 3E0PB 5HIYA 1BTXA 5I46H 3AAUA 2ILNA 2ANYA 2ZCLP 2IOTA 2WPKS 5DP7A 1XUGA 4X6PA 3TK9A 1BRUP 1TX7A 1MKWK 1P2JA 4CRBA 2RA0A 1TYNA 3I29A 2WPMS 2FOAA 1VGCB 1CT2E 1UO6A 1PPZA 3MYWA 3RMOH 5F53A 4AGKA 4UDWH 1MAXA 5FBIA 1BTWA 1GJCB 3ZVCA 1TNJA 3P8GA 3LU9B 1K1PA 4WH6A 1TABE 4TPYA 3TK6A 1IAUA 4DT4A 2UUFB 7GCHF 1T8OA 3TH3H 5T6FA 4RN6A 9ESTA 2ZDNA 3DFLA 3S9AA 3R0FA 1CGJE 1MCTA 2BQWB 1LVMA 4YZUA 3ZVGA 1ARBA 3TIUA 2J98A 4MPWA 1DUAA 3QGNB 2ZIQH 3VFEA 1V2QT 1AFQC 1JXPA 2XYAA 2TIOA 5LH8A 4K2YA 4CH8B 2JJ2D 1TNKA 2BD9A 2VIWA 1BRAA 3VPKA 3A84A 1P0SH 2FTLE 1BA8B 1EZUC 1TQ0B 1MAYA 1P2KA 2NU1E 1EZQA 3TITA 1ZHPA 2BOKA 1LVBA 1LPGB 2Y6TA 4XRNA 2RCEA 3HGNA 4TWYA 2VIVA 4BAMB 3SZNA 1D3QB 3KQCA 4R0IA 1HAHH 1WYKA 4FUGA 5E2PA 3FANA 4CRFA 1UJ1A 1VCQA 2BY9X 1O3IA 3NKKA 2FM2A 1TBRH 3TH2H 2OTVA 1TQ7B 4AFQA 2JETB 2ZEBA 1AFQB 3KYFA 1HGTH 3UIRA 2LNCA 4YESB 3R3GB 2XC4A 3SNBA 2B8OH 4HZHA 2XC0A 2XCNA 3RXDA 1O2WA 1KTSB 4UD9H 1C1OA 1TOMH 1BJVA 3UOUA 2V35A 1GGDC 1C1UH 1DX5M 3KGPA 5DP8A 3GDVA 3KQEA 3A82A 3RXGA 2TGPZ 5E0GA 2ZO3H 2OC7A 2ZHEH 1TNHA 2GZ9A 3RM2H 3RXHA 1HDTH 1AKSA 1TBZH 2BHGA 1DS2E 3SNEA 1OS8A 2ZGBH 3KNXA 4FUDA 4OM9A 2ZHWH 1XKBC 3SU1A 4ABGA 4AFSA 4CH2B 4X8VH 1PPEE 4YO9A 2FTMA 3BEFB 4UFFH 4BAKB 1V2WT 3A83A 3LJOA 1TALA 4DW2U 1O33A 3FO8D 2BDIA 1BTPA 2BX3A 2C93B 1V2JT 4RT0A 4SGAE 1QQUA 4YOIA 1GMCG 1FXYA 1SGNE 3LGYA 4J1YA 4ABFA 1JBUH 2HOBA 1Z8RA 3C27B 1P01A 1P57B 1WUNH 2SNWA 3QZQA 2Y7ZA 1BZXE 5ABWA 1UCYH 3LT3A 2KCYA 4IMZA 3ZVEA 1DVAH 2FOGA 2HNTF 1YPEH 2SGDE 2OUAA 3A8BA 3HKIB 3TK5A 4DT7B 2ZDLA 5A8XA 1CO7E 2C8XB 5ETXA 1RXPA 3OEED 3RC6A 1O3GA 2BQ6B 3P8NA 4K8BA 1O3HA 3ZZCA 5JBAS 3P92A 3A86A 4ZKOU 1A3BH 1Z8IB 1THPB 4IBLH 3N7DA 1DANH 1ZLRA 2VWLA 3MFJA 4FUJA 3E16B 4I8KA 3ZVFA 1RIWC 1MH0A 5F6MA 2ASUB 2XRCA 4JZIA 3ATKA 3F1SB 1EAIA 2AGGX 1K22H 1OWDA 1P05A 1CGIE 4E7RG 3GS9A 1AE5A 1CA8B 2QA9E 4HTCH 1CT0E 1S0QA 2BM2A 2Y5FA 3ZZ4A 5L6NH 2ZFRH 1DXPA 2Y82A 3IWMA 1AO5A 1GVKB 1L1JA 2V0BA 1A0LA 1DUEA 1WXRA 3I78A 3HGPA 2SGPE 5FHTA 1BJUA 3SI3H 1O39A 1ELCA 1GMHG 5GXPA 4ABEA 2NU4E 1MTNB 1FQ3A 1EPTB 1HNEE 4BTIB 3T2NA 1A5HA 2F9UA 1G3BA 3B8JA 1O3FA 2ZNKH 3TPIZ 1O3PB 1C1QA 1KSNA 4UONA 3E90B 1O5GH 3BSQA 1MQ6A 2H9EH 4IN2A 3QLPH 2IPQX 5EJ1A 3UNRA 1Y8TA 1OHHD 5EODA 1O36A 2FOHA 3GICB 1EQ9A 2BZ6H 2Z94A 3OFND 4OS4A 5F8TA 3SU3A 3F0PA 1WSSH 2HLDD 2ODYB 1QY6A 2A45B 3SUEA 1C2IA 1XUIA 2P93A 3ATLA 1ZTJA 1C2LA 1K1NA 3OY6U 1XUJA 1IQKA 3T25A 1W0ZU 4YLQH 1AFEH 3MNBA 4ZKRU 1V2ST 2P16A 2B7DH 4IS5A 5FL7D 4K1TA 5JDUB 4B6EA 4WH8A 3SUDA 2BD4A 1SL3A 2VIQA 1NZQH 1C2FA 1KMHB 3OTPA 1G9IE 1LPZB 2AMPA 2BY8X 2ALVA 1SQAA 1S84A 2ZHDA 4JMYA 1DITH 4OGYA 1GJ6A 4DVAU 5GPIB 3U98H 3WWBA 3ATWA 1K1LA 2XNDD 1FY3A 5L30H 3O8CA 1F0RA 4MDSA 1ZOMA 2GV7A 1KTTB 1IHSH 2ZGXH 1H8IH 2OBQA 1GHYH 2A31A 4X8SH 1P2IA 4YT7H 1A5IA 4CBOA 2EA3A 1QURH 3OY5U 1EJNA 3GYLB 1TRYA 1EASA 2V3OH 4ZHMU 2VWMA 2M2AA 1CE5A 3D65E 5JBBS 2GT7A 4Y0ZE 4A92A 3SZEA 5GWZA 1SPJA 2KX4A 1XKAC 1SHYA 4AGJA 5AF9H 1GBJA 4MG3A 1UVUH 1YC0A 1GMCF 4INLA 2QYIA 4TWWA 4X1SU 4O97A 5AVDA 3SV7A 2BVRH 1PYTD 4VGCB 1ZMNA 1O2XA 1FDPA 2IPHA 4KKDA 3BTEE 4Y8YA 1BIOA 1DWCH 2AHME 3QZRA 1GI3A 5LPFA 1O2LA 1ELBA 1EZSC 1W13U 2FDAA 1V2OT 3PV5A 3GISB 2VIDA 1TMBH 3PO1C 1FN6A 1RTFB 1L1NA 1L2EA 5KEDA 2G5VA 4K1EA 1HAIH 1NRNH 4OGXA 2OD3B 4XD7D 5F03A 2VIOA 1O2JA 1W7XH 1GBTA 2ZCHP 4F49A 2L6OA 5TJXA 1W14U 1QA7A 3SGBE 1MKXH 1O35A 4NGAH 1QBVH 5JBTA 2IJOB 3LH3A 3K6ZA 4OS2A 4GHTA 1UHBB 2JJ1D 1HYLA 1C5LH 2ZU3A 3KCGH 1GDNA 2ZDKA 1C5TA 3KL6A 4CR5A 2EI7A 1FY5A 2RDLA 2FOCA 3M36A 1HAPH 3O8BA 2VH0A 4WXIA 4I8GA 5T6GA 1LMWB 1TRNA 1Q2WA 1Y3VA 3FP6E 5HKKD 2ODQA 3N99A 1CA0C 2C90B 2QXHA 5L2YH 3EYDA 4FETA 2QF0A 2UWOA 1GWAA 2ZPSA 2P3FH 2SGFE 1Q3XA 4Y79A 2PSXA 1W8BH 1NTPA 1XVMA 1G3DA 1TWXB 3BG4B 3BEUA 2FOFA 1SLVB 4CREA 1TAWA 4D9QA 1PPHE 1MBQA 1NFUA 4XDEA 1C1WH 1MD7A 1V2UT 3DSGA 1LHDH 1O31A 3RXPA 1WV7H 2Y7XA 3GCNA 1AZZA 1O5DH 1CBWB 1XXFA 1O3KA 4NA7A 1UK2A 1ELTA 2A5KA 5EPNA 3SJOA 1DXWA 1VR1H 1O5AB 1S0RA 1FNIA 1W10U 4I7YH 1C5UA 3MNXA 1BTYA 1SGIB 2GX4A 2QF4A 1C5YB 1YBWA 3KYGA 1SG8B 1Z1JA 5CDFE 3PYHA 2FIRH 3F6UH 5FPSA 2H6MA 1O2UA 1MD8A 2AH4X 2CMYA 1CBWC 3T5FH 4BXSA 3UUZA 4O3TA 4ISHH 1C1PA 1QRZA 3GOVB 2OQUA 4BAHB 1ZSLA 4INHA 2AS9A 2Z9IA 3GY5A 1NRRH 1JIRA 3MU0A 4X1QU 4NIXA 2IJD1 3GCOA 3MQKC 1GHAG 4KTUA 1THSH 2ZHFH 1TRMA 3SV6A 2C8YB 1PJPA 1QZ8A 2G55A 3MO3A 1C1RA 1UTLM 3SHAH 5TCCA 2AEIH 1GI0A 1BMLA 1HJ9A 1P2QA 1OPHB 5FCRA 1C2EA 3PMHB 1GL1A 3CP7A 4ZROA 1LHFH 1NRPH 3PLKA 1FN8A 5DGJA 1EAWA 2JH0D 2L74A 1BBRH 2QIQA 1A46H 2ZGHA 4D7GA 3EQ0H 2PP6A 5EQSA 4YOJA 3AW1A 1TX8A 1GBLA 4CHAC 1YCPH 3EDXB 1SGPE 4WMEA 1MTNC 1TGTA 2A7CA 1VITG 2JDID 4JYTA 1JIMA 2ZPQA 5C2ZA 5C1UA 2H5CA 4Q7ZA 3LGVA 4ACBA 4ZH8A 4A5TS 1C5WB 4H6TA 3G01A 3UR9A 5C1XA 4K8YA 4ASHA 1C2KA 2PTCE 1EB2A 3VG8A 2VNTA 2Q6FA 1O5FH 5HM9A 5EW1H 4HFPB 1LTOA 1E1QD 2PKAA 4PROA 1NO9H 1WTHD 3MI4A 4JK5A 1HUTH 1N6XA 2A7JA 4XOJA 1C4U2 3ZYEA 1GG6C 4BAOB 4AOQA 3SJ9A 1O2OA 3RXLA 2AGIX 1O3MA 3SV8A 1ESBA 1QL7A 4ZUHA 1PFXC 2G8TA 3EA9A 1GJ7B 3TNTA 2VINA 1A0JA 5C20A 5FPYA 1YY3A 4CBNA 3TGIE 3EE0B 3K9XB 1KXFA 4ABBA 4K3JA 6LPRA 3AAVA 2GGVB 5EQRA 2XBYA 5EU8A 4Y7BA 2A4QA 2ZF0H 2TPIZ 2SFAA 4NA8A 1Z8GA 1XX9A 1FI8A 3HPTB 1VKYA 3NXPA 3BTDE 1OYQA 5K7RA 4MNVA 2VVCA 4GLYA 3SBKA 3MTYA 1NPMA 2O9QA 1H9LB 4O03A 3ZZAA 1UTNA 3AVZA 2K8IA 1RTKA 1XUHA 1QL8A 2A2XH 1OX1A 2WZQA 2BX4A 1F5KU 1SQOA 1H8ED 4YOGA 2KCPA 1N6YA 3ZVAA 1HXEH 1NROH 1ZTLA 2ZGJA 1OP0A 3SGAE 1SR5C 3L3TA 1FJSA 1A4WH 4ZHLU 5K0HA 1N8OB 4INKA 2ZZUH 1Y5UT 2ZECA 4RSPA 4M7GA 4GHQA 2GD4B 1ZZZA 3K2UA 3ZV9A 3T28A 3B23B 3SJKA 1S85A 3UQOA 1TLDA 1AIXH 1EAXA 2RFKC 1D3PB 1C5VA 1O2RA 5E8EH 5A0AE 1TPSA 1GI1A 2PKSC 4B6FA 1NC6A 1UMAH 3QK1A 2I6SA 3UY9A 4A7IB 3ZVDA 3SYJA 1GVLA 1DICA 1J8AA 1QGFA 2KAIB 2W6ID 2F9PA 1C5MD 2XW9A 2P3UB 1FZZA 2BD2A 4X6NA 3OTJE 4GUXA 3BG4C 7ESTE 1JRSA 4A6LA 8ESTE 1P10A 3DSPA 2Z6BD 1HAVA 2AYWA 2XWBI 2XWAA 3UQVA 2GCHF 3CENA 1SQTA 2Q6DA 4JZFH 3GY2A 1YLDA 8LPRA 2IN2A 1O2MA 2BD5A 4DURA 1ZMJA 3LPRA 1PQ5A 2FI3E 5IDKA 1LHEH 3DT0H 1FIZA 1ZTKA 3ZZ3A 1O2VA 3S9CA 4UE7H 3KEEA 1AVGH 3O8DA 1O2GH 1TPOA 1AU8A 4E05H 3GY6A 3KQ5A 4LK4A 3M35A 3ZYDA 2FMJA 1MTWA 1XUKA 3UAIC 1EZXC 2B5TB 1B7XB 1O3CA 2GCTC 2RA3A 5FAHA 4D7FA 2B9LA 1T32A 3U1IB 3WY8A 4AORA 1YLNA 2VBCA 4NIYA 4AFUA 1JMOH 2ZDVH 1HB0B 1TMUH 1O2YA 5IK2D 4TY6A 3PRDA 1O3EA 2ZFQH 4Q7XA 3ZZ7A 2J5UA 3A87A 3BEIB 2HRVA 1ANBA 3BTKE 5DP5A 1N1LA 3RM0H 1GI4A 1TONA 2KM0A 2RDEA 1BB0B 4WWYA 5BPEA 2FPZA 3D23A 5C5NA 1ELFA 1YM0A 2WV5A 5FBEA 1A7SA 3EAJA 2A5AA 5DP9A 3A80A 1GI5A 4O3UA 1CHOG 2J2UA 3BF6H 1GBCA 1C4V2 3N7OA 1C2HA 4TT3D 1TGBA 2C8ZB 3OU0A 4P02A 5FX6A 4JZEH 2OK5A 5EIYA 4NG9H 1F7ZA 4F55A 1QA0A 3VGCB 2EEKA 4U30A 3SV2H 4DG4A 1SGFA 1SOTA 5F8XA 1LO6A 5JB9S 3AK5A 1JWTA 4Z6AH 3RMLH 3PWBA 5T3HA 4RKJB 4Z0KA 2FO9A 2BMGB 1LQEA 4FXGH 1E38B 7LPRA 1TMTH 1V2MT 3SORA 3SU2A 1QB9A 4WY3A 1K0HA 1UVPA 4B2CA 1C1NA 3T27A 1GI8B 2ZP0H 4B74A 4WXVA 1BMNH 1UTPA 2H9TH 4Y71A 1UTOA 4GCHF 5KGOA 2A1DB 4B2BA 1BHXB 3S69A 1PQ8A 1K1OA 1FAKH 1ELGA 2HNTC 1EOJA 5HM2A 1T8NA 2P59A 3GY3A 1L4DA 3PROA 2P8OB 3K65B 1NN6A 3M5MA 3BN9A 2VWNA 5GCHF 4OS1A 2YMSD 2ZTXA 4BNRA 1QBNA 3PV4A 1V2VT 3OSYA 4KTCA 4B71A 4DIHH 4NA9H 4MPXA 2JETC 3RU4T 2J98B 1MQ5A 4TPIZ 4A1VA 3D49H 1AWHB 1O3NA 1LHGH 1SSXA 2ZTZA 3E3TA 3LIWA 3ODDA 1ZHMA 2OC8A 2D8WA 1EKBB 3ZZ5A 2ODPA 2GT8A 1IQJA 3ZZBA 2F43B 5H4IB 4DGJA 1KDQA 2R0KA 3Q3YA 3GCHC 1O5CB 1QB1A 1AUTC 4X6MA 1GJ5H 4AB9A 1UTJA 2PSYA 1VZQH 1SGYE 2XXLA 2ZHQH 2GP9B 1BTHH 1O2SA 5EXLA 3ATIA 3RXRA 4ZAEA 1C5ZB 5EQQA 1C2MA 1WTGH 1PQAA 3DSOA 1ABIH 1NFWA 2PWXA 1NU7B 1TGSZ 5T1VA 3U8OH 4E7NA 1Y3WA 4AG1A 3T62A 4D8NA 2BXUH 1ZSJA 4FUIA 1SB1H 3FN8A 1DT2A 4B1TA 1HFDA 1UK4A 5CHBA 3SO3A 2UWLA 2VIPA 2FI4E 3H09A 3W95A 5DSFA 1C5PA 1QRWA 2J94A 1O5BB 4DIIH 3RXCA 4KGAA 4M9FA 4HI3A 4GPGA 3TGJE 5A09A 1DWBH 2Z3DA 1C4Y2 1E34B 2GDDA 9LPRA 1KLIH 5GCHG 2D26C 1PPBH 5E0HA 1HPGA 2F83A 1O2TA 5DPAA 3Q77A 2D2DA 2ZDMA 4RKOB 5HIZA 1C1TA 1NESE 5JBCS 1ZHRA 3EE7A 1GI6A 1GJAB 3ESTA 5A8ZA 1PPCE 1NU9A 1D3DB 5A0CA 1W12U 3WWFA 3A88A 2WPDD 1ZMLA 1J9CH 2GZ7A 3GDSA 2PTNA 3LGWA 1SFQB 2FOBA 3A7WA 1GI9B 2D1JA 4GSOA 3V13A 4DJZB 3SJ8A 1TFXA 5CHAB 1G32B 1OSSA 1GBEA 2BXTH 2F3CE 3MH4A 2FYRA 2STBE 2FEQH 1UK3A 1ETRH 4FVBA 1EB1H 4IC5A 1TBQH 3UR6A 4D9RA 3BTQE 3CS0A 4MNYA 1FIWA 3MU5A 1MZDA 4WVPE 4MNWA 2F91A 3ZVBA 2PUQH 3RXVA 3GY7A 4FUFA 2AGEX 2OC0A 1ZR0A 1UW7A 3RLYH 4SGBE 3LJJA 1OYTH 1SMFE 3U1JB 1P9UA 1LVYA 2M5TA 1FUJA 2CF8H 2WUBA 3PTNA 2QXJA 3K6YA 3GCHB 1PPFE 1SVPA 3M5NA 4TYDA 1KXCA 1UHBA 3KIDU 3FP7E 3SU0A 2FOMB 3E6PH 1MU6B 1GBBA 2BLQA 3UTUH 1HCGA 1FV9A 2CXVA 3SNAA 3RXUA 3SQEE 2WV9A 3KQDA 1Z1IA 4QT8C 5C94A 1GBMA 3UOPA 1BRBE 1C5NH 3LDXH 1YPMH 1O2KA 1FONA 4BOHA 1SLWB 4LXBH 1E79D 2C8WB 4KP0A 4XBCA 3QO6A 1P8VC 4X8UH 1OWIA 1W0KD 2A7HA 4NWLA 1AE8H 3OX7U 2J92A 3NWUA 2EI6A 1IOEA 3MH5A 4X8TH 3DFJA 1OWKA 4BXWA 4ABJA 5DJ7A 1Z8JB 2Z9KA 3GYMA 3VEQB 4ABIA 4ZMAH 3FVFB 2QAAA 1NY22 4JZDH 1NRSH 1SGTA 2O8WA 3VB6A 2YNAA 2VH6A 2CV3A 1GBHA 2FWWA 5CMXH 3ODFA 3MU1A 1A1RA 1HAYB 3ZZ8A 1F0UA 3U9AH 2QN5T 3NPSA 2R3UA 4NIWA 3T26A 2OINA 2QF3A 4XFQA 1FMGA 1MZAA 4HGCA 4I8JA 4B76A 2W7SA 1N8OC 1LQDB 3SN8A 1HRTH 1LVOA 2KZ4A 1GJBB 3UNSA 2B0FA 6CHAC 1LPKB 3BTFE 1RTLA 3JZ1B 1O2HA 1O32A 1ANDA 1EXFA 2BY7X 5EOKA 1INCA 2Y5GA 7GCHG 1OP2A 3LGTA 2R0LA 2ESTE 2ZWLH 2BVXH 4HG6A 1BT7A 1ZYOA 2QCYA 4MPVA 1OOKB 2BYAX 1O0DH 4X0WU 4KELA 1GCTB 1YCPK 3DCLA 3PB1E 1YPHC 1ANEA 1V2TT 3PLBA 4X1RU 4Y6DA 5AFYH 4JCNA 8GCHG 3E91A 1DWEH 1IQMA 2KFWA 4YTAA 2BY6X 1QB6A 3ZIAD 3TH4H 1SGRE 1V6DA 2ZFPH 2Z9LA 2AERH 1E37B 5EPYA 1SI5H 1MMJN 4Y0YE 1OWHA 1Y3YA 4D76A 2A4OA 3TU7H 2Z3CA 1BOQA 2ZU4A 1TE0A 4XBDA 4JZ1A 7KMEH 2VU8E 2TRMA 1O3OA 1L4ZA 2JKHA 1O3DA 3P70B 1DWDH 1HAGE 4NFFA 1YLCA 1MABB 1O2PA 1LKBA 1W0JD 2ZU1A 3VXFH 1Z7KA 1Y5AT 2OP9A 1DPOA 4GAWA 5C5OA 3BG8A 3BIUH 5I25A 3UB0A 2J97A 1TB6H 3QGJA 5E2OA 5EW2H 1CA0B 1ELVA 1H8HD 2UUKB 1P3CA 1P2MA 2FODA 1ID5H 2WYGA 4FUEA 4IW4E 2R2MB 3P17H 3SGQE 1HJ8A 3F2FA 1GJDB 1S81A 4U01A 3VB5A 4X1NU 3SU4A 2EQNA 3STIA 1DY9A 2KCOA 5CE1A 2XBXA 1B5GH 2HPPH 4OS5A 1O5EH 3GDUA 4FUCA 1MBMA 1C1MA 4AB8A 2G81E 2OQ5A 2XTTB 1YPJH 1NFXA 2THFB 3MH6A 3W94A 1X7AC 2H5DA 2QF5A 2H2ZA 1GBFA 1T8MA 4Y10E 1YP9A 1MKWH 3P6ZB 3BIVH 2UUYA 4Y8XA 2WPLS 4MNXA 2VGCC 2LP6A 4H4FA 4J2YB 3NZIA 1K21H 4CHAB 2Z9GA 2GJGA 3QTOH 3RXBA 2SGEE 2GCHG 1H9IE 1GDQA 4UFDH 1C5QA 2CN0H 1ZGIA 1AB9B 4AN7A 4X2WA 1DY8A 1QBOA 1BITA 1TPAE 3RMNH 2Y80A 2F9NA 1U6QA 1W7GH 1RS0A 1HBTH 5GIBA 4Z1MD 1B0EA 2ZFTA 1C2DA 3A8AA 2AMDA 1ZGVA 3F9HA 4WMFA 3VGCC 3PV2A 4A1TA 2CGAA 3T29A 3RXMA 2XCFA 1J15A 1BDAA 1P02A 2A4RA 1B0FA 3U8RH 1PPGE 1EJAA 1SGDE 3FAOA 2GDEH 2FLBH 5DP4A 1MU8B 4FU8A 4IMQA 4BANB 3RXSA 1GHAF 1FLEE 6ESTA 1QNJA 1QTFA 4LZ4B 3S7HB 4NZLA 2ZCKP 1ZJDA 1GHZA 3MHWU 2XBWA 1C5OH 1UCYE 2CJIA 4A1XA 2F9VA 1P11E 4AYYB 2EI8A 2G5NA 2J95A 3A7XA 3UWIA 2JIZD 2UWPA 2PFEA 1O3JA 1HAOH 4ZCNA 2YOLA 5JPMH 3Q76A 1WBGB 1C2GA 4XE4A 3NCLA 4LOYH 1G3EA 1MTUA 3M3TA 3QX5H 1GPZA 2Z9JA 5FPTA 4ZXYH 5C3NA 1LCYA 2ANWA 3IITA 2G4UA 2YMSB 2G00A 3PRBA 3VXEH 1TNLA 3QWCH 4Q4LA 2CHAB 1HAVB 3RXEA 5J4QA 1C9TA 2G51A 4Q2KA 3UNQA 2G4TA 4MVNA 1LDTT 1TNGA 2A0QB 2Z7FE 6GCHG 1JRTA 1SGFG 2ZA5A 3ZZDA 1DDJA 2C3SA 5A8YA 2OLGA 1F0SA 2DE9A 2ZGCA 3V7TA 1CVWH 1H4WA 2O8MA 1HJAC 1O2NA 2AFQB 1DE7H 1V2PT 1MKXK 3F0OA 1AHTH 4JK6A 1YWUA 2V7QD 1KLJH 1ETSH 3RXQA 4FU7A 1DFPA 5EJZA 3RU4D 3UWJH 1F5RA 2Y5HA 3URCA 2J4IA 1W0YH 2W26A 4ISOA 5TCAA 4CRCA 3NUMA 4B2AA 1ABJH 1EATA 5HGGA 3ZZ9A 5E0JA 1RGQA 4X2YA 3PO1B 2FI5E 1GHBG 4ESTE 2HPQH 3M5LA 1V2LT 3RXTA 3SU5A 3V0XA 5A0BA 4ASUD 1D9IA 3RXJA 1NM6A 5EG4A 1Y3XA 2JH5D 2H1UA 2ZKSA 1P9SA 4VGCC 5EXMA 1SKYE 1ELAA 1GHVH 1GVZA 4ABHA 1EP5A 1EOLA 1SQRA 1UTMA 3Q3XA 1TGNA 1NT1A 2AMQA 2VVVA 2LPRA 3RU4E 2O8LA 3QUMP 1VCPA 4OS6A 1TOCB 1XUFA 2HVYB 1SBWA 1SC8U 1Y59T 2BLVA 1F92A 4FUHA 3OEHD 4AZ2B 1IHTH 2A2QH 1V3XA 4TSFD 3TJOA 1JOUB 2ZPRA 2J34A 1K1JA 1NBMD 1A2CH 1CT4E 3FP8E 4MQAA 2BVSH 1RJXB 1AUJA 1G2LA 1VITF 1J16A 2BQ7B 3GY4A 1C5XB 1XM1A 1O2ZA 1WAYB 3QN7A 5GNDA 1O2IA 1EPTC 2F9OA 5JYIA 2ULLA 2XNIA 2BOHB 3SI4H 2W5EA 1T31A 1CU1A 1HLTH 1ZPCA 4RI0A 1GGDB 1AZ8A 3STJA 4AFZA 1YYY1 3A7YA 4FVDA 3A89A 1K9OE 4K5ZA 5HXFA 2OXSA 5C1YA 1O2QA 1G2MA 4DCDA 1BTUA 1HIAB 5EXNA 1K1IA 1OXGA 1UCYK 4LZ1H 1S82A 4GVUA 1BMAA 2I6QA 5C0UA 1FY1A 1C1SA 1GJ8B 4NZQA 3FOAA 5DK1A 3F9GA 1SOZA 3PTBA 4U32A 2BB4A 4CR9A 3LOXA 4GCHG 3A85A 1RIWB 1SGQE 3F9FA 1YKTA 1RRKA 2BLWA 3MO9A 1NBME 3DA9B 8GCHF 1PQ7A 5DP3A 3TJNA 1AN1E 2XOKD 1VCWA 1UTQA 2BD8A 2FZZA 3E1XB 3D62A 3Q3KA 1AQ7A 3P95A 3U8TH 1UVSH 2G52A 2J9NA 3LGUA 3S9BA 1P3EA 4R8TB 1GDUA 5LPEA 1RD3B 3HKJB 2FX4A 1P09A 1QR3E 1GJ9B 2W6JD 3MH7A 4ACAA 1EUFA 1BTZA 3M37A 2VGCB 1CSOE 2A5IA 2HALA 3PWCA 1ZPZA 1VITH 3VB7A 1P2OA 2HVXA 3MWIU 1KDQB 2BDCA 1ETTH 1GG6B 2HGTH 2PR3A 1ANCA 3P8FA 1AB9C 3RXAA 3KHVA 1L0ZA 3M7UA 1F0TA 1VGCC 2WYJA 2KCAA 3PMJA 2A4GA 2WPIS 3OAAD 3RUOA 1PYTC 2ZG0H 3MMGA 2ALPA 5J4SA 1EX3A 1BRCE 1VJAU 2VJ1A 3UREA 3A7TA 2FS9A 1GI7B
chains in the Genus database with same CATH topology
5BRRE 3F9EA 1ESAA 1H9HE 1WOFA 1A3EH 5HMAA 2A32A 2QV1A 2QXGA 1Z6EA 1KIGH 3TLOA 5ESBA 5F8ZA 3LC5A 4K1SA 1GBIA 1J14A 1P04A 4I32A 5JB8S 1DOJA 1TNIA 4IN1A 1S5SA 2NU3E 1SLXB 3ENSB 1EAUA 5LGOA 3DD2H 1BUIA 2BTCE 1IQEA 4DY7B 1Q31A 2EC9H 1A5GH 1MUEB 3VB3A 1AVWA 1UVOA 3S0NA 1OWEA 3LC3A 1FPHH 1FY4A 4Y76A 1SFIA 2NU2E 1WU1A 2ZQ2A 3GCTF 1CHOF 1ZPBA 3QDZB 4JYVH 1EP6A 1QJ1B 1IQFA 1SLUB 4KTSA 2SGQE 1W2KH 2R2WU 4CRGA 2GZ8A 2W7UA 1CGHA 3RC4A 4Y8ZA 2ZFFH 3L33A 1D6RA 3L6PA 5PTPA 4ABAA 2ANMH 2K1QA 2JH6D 4X1PU 2QC2A 4K60A 2C4FH 5FX5A 2FLRH 2W3KA 2CHAC 2VWOA 1ESTA 2PGQB 3BTWE 3EGKH 4NFEA 2WV4A 1KYNA 1UVTH 3M7TA 2HNTE 1T7CA 3ZV8A 3SUGA 3KQBA 1QFKH 1YPKH 1AVXA 4MPUA 2P94A 1Y5BT 1VJ9U 4AG2A 1E36B 2PGBB 1BCUH 4ISIH 4ZKSU 1HJAB 4YT6H 1XVOA 1GJ4H 1V2NT 1LKAA 3PMAB 3Q00A 3A8DA 2OBOA 1E0FD 3LH1A 4DOQA 3RLWH 1HXFH 4FU9A 2HWLB 2J38A 2PKSB 4TY7A 1OWJA 5FCKA 3NK8A 1ARCA 2FOEA 4THNH 1CHGA 1D4PB 1MTSA 1TGCA 3E0NB 1XMNB 1SGEE 2R9PA 2ZU2A 1P06A 3A8CA 3VB4A 1AI8H 2BZAA 3BTHE 1QJ6B 2FYQA 1Y3UA 1F5LA 1QL9A 5T6DA 3RC5A 5DP6A 1IQIA 1AGJA 1TIOA 2BLOA 1WCZA 1W3CA 1A0HB 1GMDG 4MTBA 4I8HA 2BD3A 2P95A 3UFAA 1D6WA 1K1MA 2TGAA 4IGDA 8KME2 3GY8A 5DKMA 3ATMA 2TBSA 1AMHA 3V12A 4UEHH 2QXIA 1Z71A 1ELDE 2OC1A 4UFGH 1MTVA 1NRQH 2Q6GA 4ABDA 3F68H 2TGDA 1ELEE 2XC5A 2TGTA 3A7ZA 2H9HA 3FZZA 3ZZ6A 5ESTE 4CRAA 3M7QA 2UUJB 2VB0A 4XBBA 4Y11E 2WINI 4WMDA 4Q80A 3ELAH 1THRH 3RXIA 3SU6A 2GTBA 1AWFH 1E35B 3U69H 4I31A 3BTME 1WQVH 2SNVA 2PV9B 1LHCH 1KXAA 2AIPA 3RXFA 3RDZA 1P03A 2ZFSA 4YM9A 3HK6B 1A61H 1C1VH 3O8RA 1O38A 2BDAA 3URDA 3EA8A 1YPGH 3DUXH 1TA6A 2DUCA 1ACBE 1YF4A 2VVUA 4ZHAA 4WF8A 4ISNA 2DE8A 1D3TB 1GI2A 1T4VH 3SW2B 1ORFA 4CRDA 1DM4B 2W3IA 1K2I1 1BQYA 1GHWH 4BTTB 1OKXA 3A7VA 4BAQB 5B6OA 1GHXH 3SQHE 1DLEA 1AY6H 4NWKA 3RXKA 5AFZH 2FP7B 3M5OA 2ZI2H 2BDYA 4I8LA 4O9VA 1GMHF 3M3VA 1RFNA 1TA2A 3RXOA 3TVJB 1AD8H 4JYUH 4AX9H 6GCHF 5IYTA 1TPPA 2SGAA 3A81A 3BTGE 3TJUA 2PLXA 2CF9H 1QQ4A 2WPJS 2ZQ1A 2FS8A 3SV9A 2BDBA 4ISLA 4X2XA 3S7KB 4X6OA 5C67A 2BY5X 2HLCA 2ZDAH 2V3HH 1FPCH 1P2NA 3LKWA 1G37A 3PMBB 4H6SB 3HATH 2QY0B 5SGAE 3DHKH 1DSTA 1KXBA 1HAZB 1BBRK 3LONA 1C5SA 2GMTC 3SNCA 4X2VA 3AW0A 2OCVB 2P3TB 3HK3B 3PLPA 1NFYA 1DLKB 1WQSA 3CS7A 3FZDA 3H7OA 2PHBA 2XBVA 2GVFA 3BV9B 1GHBF 1QIXB 1GBAA 1GBKA 1ZRKA 1HV7A 5DG6A 3ITIA 4WJG2 1K28D 3OYPA 3SNDA 2PW8H 1KLTA 4U2WA 3E8LA 4F4OC 1GCTC 1Z6JH 1G36A 1AKSB 4Y7AA 1IQGA 1NS3A 5L2ZH 2KAIA 2QGRA 1YPLH 1C2JA 1H8DH 1QCPA 2Q1JA 4ZKNU 1S6FA 1T4UH 1T8LA 3M3SA 4Q7YA 2P8OC 1O34A 1O3BA 1G30B 3I77A 1M9UA 2V6NA 3TGKE 1EJMA 3TJVA 3MU4A 5G4BA 2FX6A 1XXDA 2ZU5A 2GV6A 1C9PA 2ZC9H 1GBDA 1V2RT 3TNSA 3FFGA 6CHAB 1GMDF 3SJIA 3AASA 2Z3EA 1ZSKA 1SGCA 3SHCH 4ZXXH 4B73A 1O30A 3EA7A 1G3CA 5DO4H 3V3MA 1FAXA 5FXLA 2FESH 1IQHA 3MOCA 5EGMA 5A2MH 4H42U 3BTTE 2ZTYA 4E06H 4NSYA 2NWNA 4K69A 3KN2A 3M61U 4I33A 1KXDA 4YLUA 2YNBA 3H5CB 2RG3A 1IQLA 3RP2A 1O37A 1W11U 4AYVB 3B9FH 1ZJKA 1QJ7B 5HYOA 1L1GA 2NU0E 2WUCA 2BDGA 2PUXB 1IQNA 1F2SE 1YGCH 4BTUB 3JZ2B 2O8TA 3MO6A 1FY8E 2BDHA 1SHHB 1GCDA 1YCPM 1HIAA 2BD7A 2STAE 1V2KT 1QHRB 2AIQA 3PM3A 4B75A 3KF2A 1ZRBA 2PKAB 4IC6A 3MNSA 3MNCA 4OS7A 1BMMH 4UFEH 2GMTB 1YPHE 5AHGH 1OP8A 3GCTG 1CQQA 1BHXF 3QTVH 3RMMH 4NSVA 3C1KA 5LPRA 2Y81A 2WPHS 1KXEA 2ANKH 1S83A 4MLFB 1O3AA 4XSKU 1BBRE 3H7TA 1KY9A 5GDSH 3IG6B 5GJ4B 1HAXB 1P12E 1UTKA 1S6HA 4FUBA 2F9BH 1H1BA 2GKVE 3SUFA 1GL0E 5CHAC 1J17T 1TX6A 2FXRA 3LGIA 1QRXA 1MCVA 1EPTA 2O8UA 2GCTB 4NCYA 3SOSA 2R3YA 3UPEA 1C5RA 3MU8A 3P8OA 4NIVA 1DSUA 1O3LA 3E0PB 1BTXA 5I46H 3AAUA 2ILNA 2ANYA 2ZCLP 2IOTA 2WPKS 5DP7A 1XUGA 4X6PA 3TK9A 1BRUP 1TX7A 1MKWK 1P2JA 4CRBA 2RA0A 1TYNA 3I29A 2WPMS 2FOAA 1VGCB 1CT2E 1UO6A 1PPZA 3MYWA 3RMOH 4AGKA 4UDWH 1MAXA 5FBIA 1BTWA 1GJCB 3ZVCA 1TNJA 3P8GA 3LU9B 1K1PA 4WH6A 1TABE 4TPYA 3TK6A 1IAUA 7GCHF 2UUFB 1T8OA 3TH3H 5T6FA 4RN6A 9ESTA 2ZDNA 3DFLA 3S9AA 3R0FA 1CGJE 1MCTA 2BQWB 1LVMA 4YZUA 3ZVGA 1ARBA 3TIUA 4MPWA 1DUAA 3QGNB 2ZIQH 3VFEA 1V2QT 1AFQC 1JXPA 2XYAA 2TIOA 5LH8A 4K2YA 4CH8B 2VIWA 1TNKA 2BD9A 1BRAA 3VPKA 3A84A 1P0SH 2FTLE 1BA8B 1EZUC 1TQ0B 1MAYA 1P2KA 2NU1E 1EZQA 3TITA 1ZHPA 2BOKA 1LVBA 1LPGB 2Y6TA 2RCEA 3HGNA 4TWYA 2VIVA 4BAMB 3SZNA 1D3QB 3KQCA 4R0IA 1HAHH 1WYKA 4FUGA 5E2PA 3FANA 4CRFA 1UJ1A 1VCQA 2BY9X 1O3IA 3NKKA 2FM2A 1TBRH 3TH2H 2OTVA 1TQ7B 4AFQA 2JETB 2ZEBA 1AFQB 1HGTH 3UIRA 2LNCA 4YESB 3R3GB 2XC4A 3SNBA 2B8OH 4HZHA 2XC0A 2XCNA 3RXDA 1O2WA 1KTSB 4UD9H 1C1OA 1TOMH 1BJVA 3UOUA 2V35A 1GGDC 1C1UH 1DX5M 3KGPA 5DP8A 3GDVA 3KQEA 3A82A 3RXGA 2TGPZ 5E0GA 2ZO3H 2OC7A 2ZHEH 1TNHA 2GZ9A 3RM2H 3RXHA 1HDTH 1AKSA 1TBZH 2BHGA 1DS2E 3SNEA 1OS8A 2ZGBH 3KNXA 4FUDA 2ZHWH 1XKBC 3SU1A 4ABGA 4AFSA 4CH2B 4X8VH 1PPEE 4YO9A 2FTMA 3BEFB 4UFFH 4BAKB 1V2WT 3A83A 3LJOA 1TALA 4DW2U 1O33A 2BDIA 1BTPA 2BX3A 2C93B 1V2JT 4SGAE 1QQUA 4YOIA 1GMCG 1FXYA 1SGNE 3LGYA 4J1YA 4ABFA 1JBUH 2HOBA 1Z8RA 3C27B 1P01A 1P57B 1WUNH 2SNWA 3QZQA 2Y7ZA 1BZXE 5ABWA 1UCYH 3LT3A 4IMZA 3ZVEA 1DVAH 2FOGA 2HNTF 1YPEH 2SGDE 2OUAA 3A8BA 3HKIB 3TK5A 4DT7B 2ZDLA 5A8XA 1CO7E 2C8XB 5ETXA 1RXPA 3RC6A 1O3GA 2BQ6B 3P8NA 4K8BA 1O3HA 3ZZCA 5JBAS 3P92A 3A86A 4ZKOU 1A3BH 1Z8IB 1THPB 4IBLH 1DANH 1ZLRA 2VWLA 3MFJA 4FUJA 3E16B 4I8KA 3ZVFA 1RIWC 1MH0A 5F6MA 2ASUB 2XRCA 4JZIA 3ATKA 3F1SB 1EAIA 2AGGX 1K22H 1OWDA 1P05A 1CGIE 4E7RG 1AE5A 1CA8B 2QA9E 4HTCH 1CT0E 1S0QA 2BM2A 2Y5FA 3ZZ4A 5L6NH 2ZFRH 1DXPA 2Y82A 3IWMA 1AO5A 1GVKB 1L1JA 2V0BA 1A0LA 1DUEA 3I78A 3HGPA 2SGPE 5FHTA 1BJUA 3SI3H 1O39A 1ELCA 1GMHG 5GXPA 4ABEA 2NU4E 1MTNB 1FQ3A 1EPTB 1HNEE 4BTIB 3T2NA 1A5HA 2F9UA 1G3BA 3B8JA 1O3FA 2ZNKH 3TPIZ 1O3PB 1C1QA 1KSNA 4UONA 3E90B 1O5GH 3BSQA 1MQ6A 2H9EH 4IN2A 3QLPH 3UNRA 1Y8TA 5EODA 1O36A 2FOHA 3GICB 1EQ9A 2BZ6H 2Z94A 4OS4A 5F8TA 3SU3A 1WSSH 2ODYB 1QY6A 2A45B 3SUEA 1C2IA 1XUIA 2P93A 3ATLA 1ZTJA 1C2LA 1K1NA 3OY6U 1XUJA 1IQKA 3T25A 1W0ZU 4YLQH 1AFEH 3MNBA 4ZKRU 1V2ST 2P16A 2B7DH 4IS5A 5JDUB 4K1TA 4WH8A 3SUDA 2BD4A 1SL3A 2VIQA 1NZQH 1C2FA 1G9IE 1LPZB 2AMPA 2BY8X 2ALVA 1SQAA 1S84A 2ZHDA 4JMYA 1DITH 4OGYA 1GJ6A 4DVAU 5GPIB 3U98H 3ATWA 1K1LA 1FY3A 5L30H 3O8CA 1F0RA 4MDSA 1ZOMA 2GV7A 1KTTB 1IHSH 2ZGXH 1H8IH 2OBQA 1GHYH 2A31A 4X8SH 1P2IA 4YT7H 1A5IA 4CBOA 2EA3A 1QURH 3OY5U 1EJNA 3GYLB 1TRYA 1EASA 2V3OH 4ZHMU 2VWMA 1CE5A 3D65E 5JBBS 2GT7A 4Y0ZE 4A92A 5GWZA 1SPJA 1XKAC 1SHYA 4AGJA 5AF9H 1GBJA 4MG3A 1UVUH 1YC0A 1GMCF 4INLA 2QYIA 4TWWA 4X1SU 4O97A 5AVDA 3SV7A 1PYTD 2BVRH 4VGCB 1ZMNA 1O2XA 1FDPA 2IPHA 4KKDA 3BTEE 4Y8YA 1BIOA 1DWCH 3QZRA 1GI3A 5LPFA 1O2LA 2FDAA 1ELBA 1EZSC 1W13U 1V2OT 3GISB 2VIDA 1TMBH 3PO1C 1FN6A 1RTFB 1L1NA 1L2EA 2G5VA 4K1EA 1HAIH 1NRNH 4OGXA 2OD3B 5F03A 2VIOA 1O2JA 1W7XH 1GBTA 2ZCHP 4F49A 5TJXA 1W14U 1QA7A 3SGBE 1MKXH 1O35A 4NGAH 1QBVH 5JBTA 2IJOB 3LH3A 3K6ZA 4OS2A 4GHTA 1UHBB 1HYLA 1C5LH 2ZU3A 3KCGH 1GDNA 2ZDKA 1C5TA 3KL6A 4CR5A 2EI7A 1FY5A 2RDLA 2FOCA 3M36A 1HAPH 3O8BA 2VH0A 4WXIA 4I8GA 5T6GA 1LMWB 1TRNA 1Q2WA 1Y3VA 3FP6E 2ODQA 1CA0C 2C90B 2QXHA 5L2YH 3EYDA 2QF0A 2UWOA 1GWAA 2ZPSA 2P3FH 2SGFE 1Q3XA 4Y79A 2PSXA 1W8BH 1NTPA 1XVMA 1G3DA 1TWXB 3BG4B 3BEUA 2FOFA 1SLVB 4CREA 1TAWA 4D9QA 1PPHE 1MBQA 1NFUA 4XDEA 1C1WH 1MD7A 1V2UT 1LHDH 1O31A 3RXPA 1WV7H 2Y7XA 3GCNA 1AZZA 1O5DH 1CBWB 1XXFA 1O3KA 4NA7A 1UK2A 1ELTA 2A5KA 5EPNA 3SJOA 1DXWA 1VR1H 1O5AB 1S0RA 1FNIA 1W10U 4I7YH 1C5UA 3MNXA 1BTYA 1SGIB 2GX4A 1C5YB 1YBWA 1SG8B 1Z1JA 3PYHA 2FIRH 3F6UH 5FPSA 2H6MA 1O2UA 1MD8A 2AH4X 2CMYA 1CBWC 3T5FH 4BXSA 3UUZA 4O3TA 4ISHH 1C1PA 1QRZA 3GOVB 2OQUA 4BAHB 1ZSLA 4INHA 2AS9A 2Z9IA 3GY5A 1NRRH 1JIRA 3MU0A 4X1QU 4NIXA 3GCOA 1GHAG 4KTUA 1THSH 2ZHFH 1TRMA 3SV6A 2C8YB 1PJPA 2G55A 3MO3A 1C1RA 1UTLM 3SHAH 5TCCA 2AEIH 1GI0A 1BMLA 1HJ9A 1P2QA 1OPHB 5FCRA 1C2EA 3PMHB 1GL1A 3CP7A 4ZROA 1LHFH 1NRPH 3PLKA 1FN8A 5DGJA 1EAWA 2JH0D 1BBRH 2QIQA 1A46H 2ZGHA 4D7GA 3EQ0H 5EQSA 4YOJA 3AW1A 1TX8A 1GBLA 4CHAC 1YCPH 3EDXB 1SGPE 4WMEA 1MTNC 1TGTA 2A7CA 1VITG 4JYTA 1JIMA 2ZPQA 5C2ZA 5C1UA 2H5CA 4Q7ZA 3LGVA 4ZH8A 4A5TS 1C5WB 4H6TA 3G01A 3UR9A 5C1XA 4K8YA 4ASHA 1C2KA 2PTCE 1EB2A 2VNTA 2Q6FA 1O5FH 5HM9A 5EW1H 4HFPB 1LTOA 2PKAA 4PROA 1NO9H 1WTHD 3MI4A 4JK5A 1HUTH 1N6XA 2A7JA 4XOJA