4ZKSU

The crystal structure of upain-1-w3a in complex with inactive upa (upa-s195a) at ph7.4
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
246
structure length
246
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDAGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title The crystal structure of mupain-1-IG in complex with murinised human uPA at pH7.4
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 58
structure length 246
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2015-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4zksU02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4zksU01
2P8OC 4WWYA 1YLCA 3UREA 1SL3A 1Z6EA 2GD4B 4IC6A 3EAJA 1L1JA 2Y5HA 1HAVA 1O2LA 5TCAA 5TJXA 1QB9A 3NUMA 4ZKRU 3S69A 1O5DH 4FUCA 3RXRA 1G32B 2WUBA 3ZVDA 4MVNA 1GCDA 1O30A 3GY2A 4A7IB 2Y80A 3SV8A 2G5NA 2G4UA 1ELGA 2R0LA 4U32A 1BTPA 3TH2H 2VIVA 4NCYA 3RXUA 3PLBA 4Y7AA 3ITIA 1C2GA 4UONA 3QZQA 2GMTC 1O35A 1CVWH 4U30A 4X8UH 3U8TH 1ZTKA 2EI8A 2NU4E 1E36B 5EW1H 5DPAA 1AO5A 1DT2A 1GI3A 5FXLA 2AEIH 4MNVA 1G36A 3DT0H 1K9OE 1MUEB 1S0QA 1DOJA 4GPGA 3UWIA 1UK2A 1HB0B 1WYKA 1DITH 3BEFB 2OQUA 2P59A 4GSOA 2OBQA 1SGIB 1GBKA 2VVCA 2Z94A 2ZG0H 4AGJA 1Z7KA 2C90B 4Q80A 2ZDNA 2ZHQH 1CHGA 2CXVA 1HFDA 1A0LA 1O3LA 1TBZH 1SHYA 2BD3A 1VJAU 4DVAU 1F0TA 1BHXF 3N7OA 1SOTA 1KY9A 5EU8A 1C1RA 1EZXC 2Q1JA 3NKKA 2G55A 5JBBS 2ZFQH 2BD7A 2QGRA 1FNIA 1SGNE 5DP9A 1BJVA 2C8YB 1G30B 1LHDH 3BN9A 2ZPRA 2PGQB 1QRXA 3PYHA 2FS9A 5JYIA 1O3KA 3O8CA 3GY5A 4MPWA 1OWIA 1SQTA 1YPHC 5H4IB 4YOGA 1C5TA 1GJBB 2BY8X 1G3CA 1VITH 2BVSH 3BSQA 1AMHA 2SGPE 2FOHA 4JZDH 3RU4T 1HIAA 3RXQA 1SFQB 1S84A 4Y0YE 2CN0H 2RDLA 3MNCA 2EI6A 3TJVA 2AERH 2R0KA 5C5OA 2BD8A 2OXSA 2BDAA 2A1DB 3RXBA 2FMJA 4CHAB 2I6SA 5A2MH 3GDUA 2XC5A 1G9IE 2ODQA 3BF6H 1JMOH 1TIOA 4JYTA 1EAUA 5HMAA 2BB4A 4ABHA 4BANB 4INHA 1C5OH 3M7QA 2BY7X 1QCPA 1K1IA 2ZGHA 1DUAA 1SGQE 3KCGH 1TYNA 1KLTA 1EJAA 2A4RA 1VGCB 2FP7B 2WV5A 3M3SA 2A5IA 1ZZZA 4IBLH 1P2QA 2P94A 2XBYA 3MH6A 3HKJB 2G5VA 2C8WB 5B6OA 2BXTH 3IG6B 1D3DB 1J16A 1NY22 4KKDA 2BZ6H 1FZZA 1AWHB 1XUGA 1BHXB 2GT7A 1QL7A 2W3KA 2D26C 4KP0A 2ANMH 1H4WA 4OS4A 1QB6A 1UCYH 1NFWA 3A8BA 3GCTG 3PTBA 3DD2H 5DP6A 1HCGA 2JH0D 1OWEA 1XKAC 2CHAC 4ZHMU 4D7FA 5C20A 1EXFA 1VITG 1W0YH 2F9OA 3SU0A 1OP2A 1THRH 4GCHG 1CGJE 4IS5A 3U9AH 5J4QA 4X6MA 2PWXA 4JZ1A 1QY6A 1TQ7B 3SNBA 1KDQA 3ATWA 4MPVA 1UO6A 2IJOB 4UFDH 1FN8A 2O8UA 4AZ2B 1LVBA 4ABAA 1NT1A 4NFEA 1QGFA 1SMFE 3E0PB 1C5WB 3RC6A 1O2ZA 4NA9H 3E16B 2DE8A 1O0DH 1P0SH 1F5LA 1E0FD 3RXMA 1X7AC 2HNTC 4IC5A 1AN1E 1LCYA 1OOKB 2EI7A 4NG9H 4XDEA 2J94A 4B75A 2XBWA 2ZU1A 1LPZB 2ZNKH 3UPEA 4Q7XA 3LIWA 4DY7B 1MTNB 3RXJA 2V3HH 4GUXA 4JK5A 1CSOE 3FVFB 1N1LA 4FUHA 1VZQH 1CA0C 4CBOA 1FLEE 4CRGA 2XBVA 3GISB 2C4FH 2ZDLA 5FX6A 1O2IA 1C5QA 1GBCA 4ISHH 1H1BA 3IWMA 4AB8A 1C1TA 2STBE 4NWLA 1XUHA 1EAWA 1Y3UA 1OP0A 3RU4E 1T8LA 2OC0A 3GCTF 1QBVH 2G00A 4WH8A 5AVDA 3BTGE 5HM9A 1C1PA 1N8OC 1CO7E 2ZA5A 1SI5H 2ZDAH 1YCPM 1P11E 1V2KT 4KTSA 4WXVA 1UHBB 4HTCH 1DXPA 1SB1H 1PFXC 1SLXB 2ZWLH 3EA8A 1WSSH 4GCHF 1P2NA 1S82A 1O5FH 2ALPA 4ASHA 1AY6H 2TRMA 1C5MD 1D3TB 1BTXA 2HLCA 1P2IA 1VCWA 1SLUB 2ZCHP 2B8OH 1O32A 1MKWK 1IQIA 3HK3B 1V2UT 1BJUA 2JETB 2Y82A 4ABJA 2YNAA 2BQ7B 3P8OA 4GHQA 3BG4B 3AVZA 4Z0KA 2PKSB 5DO4H 1AZ8A 2BDGA 2BMGB 5GIBA 1EAXA 1MD8A 3LU9B 1ZHMA 1ZOMA 1ELFA 2BYAX 1XKBC 4FUBA 3GDVA 4RKOB 4R0IA 1JRSA 1P2MA 3PWCA 1OPHB 4FUEA 1ABIH 1C2LA 5AFZH 2PSYA 2PTNA 1ZSLA 1O3CA 4FXGH 3PO1B 3U8RH 3LC3A 2ZCKP 3SORA 1BMAA 1D9IA 1F7ZA 2NU0E 2GV7A 2GT8A 2ODPA 1GJDB 4YM9A 2VINA 3M36A 4YLUA 1Y59T 1CBWB 2Z6BD 3T5FH 1V2ST 3V0XA 3VB4A 5EQQA 1SGRE 1SPJA 2GP9B 1AU8A 2H5DA 1UJ1A 1O2XA 3S0NA 1GMHF 1S6HA 2JH5D 2ZGXH 2PKAA 1YPGH 1S0RA 7GCHG 1UTKA 1C1SA 3A86A 3E90B 1DSTA 5CE1A 4O3UA 2BHGA 4ZXXH 3A8CA 3MU8A 2ANKH 2UUJB 3TK6A 3ATKA 2JH6D 1QA7A 1XXDA 3AAUA 3MI4A 1GHVH 2OCVB 3FZZA 3ZV9A 1ELTA 2AYWA 1GI5A 8LPRA 3MH4A 4CBNA 3CENA 4AFSA 1YPKH 1HUTH 2UWLA 2OBOA 2K1QA 2ZO3H 1A3EH 1TX8A 3SOSA 4FUIA 1TABE 1O2GH 4UFEH 5EQSA 1EASA 3SU6A 1P2OA 4E7NA 1XUKA 1XX9A 1GBIA 1YP9A 1AZZA 4A1XA 1WCZA 2R9PA 4ESTE 3TK9A 4GHTA 4Y8XA 4F49A 2TGAA 3ZVAA 1HDTH 1QL9A 3KN2A 1MMJN 1GI8B 3ATIA 1DUEA 1V2WT 3OU0A 5C1XA 1FAKH 5ETXA 2ZCLP 5T6GA 2NU1E 3Q3YA 3STIA 3SW2B 1LQEA 2C3SA 1GWAA 1A7SA 1GBMA 1V2TT 1H9IE 1O2YA 3LJJA 1O3GA 1FQ3A 1ELBA 2FLBH 5DKMA 2ZC9H 3QK1A 1XM1A 2ZF0H 4ISOA 2ZDMA 1NFYA 1C1OA 3VGCC 3FZDA 7GCHF 1GBDA 1TNLA 1GBBA 1EATA 1UK3A 1PJPA 1EPTC 1K1PA 6CHAB 1PQAA 3K65B 1JIMA 4WMEA 5C1UA 3MH5A 3GDSA 5T6FA 3LJOA 4F4OC 4IN1A 3TH4H 3TJOA 1D3PB 3UUZA 3KQDA 1WOFA 2RCEA 1EUFA 2V6NA 1FY5A 3ZZ6A 2R2WU 1FPCH 3GY6A 4AYYB 3TPIZ 1C4Y2 1ANEA 1GHBG 1MBQA 1YCPK 3HGPA 4TYDA 2PV9B 1TONA 2UUFB 1J8AA 2A7CA 3QLPH 4A1VA 2OQ5A 2VH0A 4ZUHA 4ABIA 3Q76A 1TGNA 1NRQH 1BBRK 1NROH 1IQNA 1KTSB 4X1SU 1EZUC 3FFGA 3GOVB 3GYMA 2FO9A 2VGCB 1DLEA 3KF2A 1AUJA 1D6WA 1MZAA 3E8LA 2WPLS 3QGJA 1EPTA 4DIIH 3LOXA 1IHTH 4FU7A 3RLWH 2P3TB 4UE7H 1RIWB 2G52A 1HAXB 2ZPSA 4NA8A 4D9RA 1YPLH 5AHGH 3VB5A 4CHAC 4CR9A 1FAXA 1ESBA 3SU5A 1GJ6A 1AWFH 3QGNB 2VIPA 5GJ4B 4ZAEA 1BOQA 3ZVBA 2BDIA 1Z8RA 2QIQA 1T31A 1ETTH 1NU9A 1VR1H 1HXEH 4TPYA 1ZTJA 1ZHRA 2BXUH 3A88A 3K2UA 2ANYA 3OTJE 1VGCC 2QCYA 1C4U2 3RMMH 1GL1A 3CS0A 2ZKSA 2DE9A 1O34A 1TGCA 4UEHH 3MU5A 3MH7A 4ABDA 3A7WA 3LONA 4FUGA 1QIXB 3GY8A 1WUNH 1XMNB 2BQWB 7ESTE 3MU4A 3RXVA 3U69H 1C5LH 1GDUA 1C5ZB 1RGQA 2BY6X 4HGCA 4AFUA 3A89A 4YT6H 1EP5A 1GJ4H 1Y5UT 1WAYB 2V0BA 3TGKE 3VEQB 2O8TA 2EEKA 4B1TA 1UVOA 4NIYA 1UCYE 1GHBF 4D8NA 3F9FA 1THSH 1F0UA 2PLXA 2GCTB 1MTUA 1GCTB 1S6FA 3ZZ4A 2QV1A 1HLTH 1SGDE 1SGTA 1O2JA 2PUQH 3SUGA 2WV4A 3A7XA 1G2LA 1NFXA 3L6PA 4X0WU 1EJNA 1GI6A 2ZECA 1L4DA 2RA0A 1LHFH 1QJ6B 4LZ1H 5A8YA 2TGDA 4RSPA 1K1JA 2ZFRH 1KXEA 1Y3WA 4XBDA 3BTDE 1ZPZA 1LDTT 4O03A 3A84A 5C67A 3I78A 1HGTH 1H8DH 3SGBE 2QXGA 4Y6DA 1ELDE 3P95A 3S7KB 4JYUH 1GJAB 2STAE 1F5RA 3PTNA 3VFEA 3SU1A 1YF4A 1W13U 1C1VH 1V6DA 4X2VA 2OP9A 3O8BA 2FOMB 4Y10E 4X1QU 3SJ8A 3EA9A 4BXSA 4X2XA 1MTNC 1C5YB 4Y7BA 4X6PA 1NESE 3SJOA 1OS8A 1TFXA 4OGYA 2XCNA 1AUTC 2ZIQH 1W3CA 4MQAA 5I25A 1GI7B 5C1YA 1DWBH 3ZYDA 5F8ZA 4J2YB 1O2SA 1W14U 1NFUA 4BAOB 1GDQA 3TK5A 1W12U 3ODFA 3QTOH 3RM0H 4XBCA 1EAIA 5DP5A 1EZSC 2ZPQA 5E2PA 3A7YA 2B9LA 1BUIA 1C9PA 1O3NA 1P03A 1OSSA 1TNIA 5ESBA 4O3TA 4ZKNU 4Y11E 3RC4A 4FUJA 1UTNA 3D62A 3NCLA 4X8SH 2P16A 1IQHA 5HM2A 4BAKB 1UMAH 3T62A 1Z8JB 4O9VA 3BTEE 2GVFA 4YLQH 4XBBA 1C2IA 4U2WA 2FOGA 1Q3XA 2BVXH 1O3FA 2OC1A 3V7TA 3MNSA 1K21H 2PR3A 2W26A 2BX3A 5F8TA 1Z1JA 3RXEA 2B7DH 2ZGCA 3SNAA 5EOKA 1CT0E 4XOJA 2XC0A 1HV7A 2D1JA 3OY5U 1EJMA 2SGQE 4YTAA 3F9HA 2JETC 4WJG2 4Y8YA 1Y5BT 1O3DA 3UQOA 3RLYH 1DWCH 5FCKA 1F2SE 2ZDKA 2QXHA 1RJXB 5DK1A 1GI2A 4X1RU 1K1LA 2GV6A 4K5ZA 2HRVA 2ZFTA 2FWWA 1C2MA 1BMNH 1GBAA 4DG4A 5BRRE 1E37B 1GI4A 1PPZA 1K1NA 1O31A 1UHBA 2KAIB 3RXDA 4K1TA 3P8GA 1D4PB 1NRSH 4OS7A 1QNJA 1GI1A 2QA9E 5L30H 2ZFSA 3PMAB 4RN6A 1RTKA 4X6OA 1TMTH 1GDNA 3UNSA 1Y3XA 3D49H 3PO1C 3MTYA 1P10A 3LH3A 5GPIB 1ESTA 1O3AA 1QJ1B 2BDCA 4B71A 1BITA 4X1NU 1VCQA 3FAOA 1WV7H 1W10U 2A0QB 3M5MA 1LTOA 4UDWH 6ESTA 3HGNA 2CGAA 3HPTB 4XSKU 3ZZ7A 1HJAB 1O3BA 2TBSA 1L2EA 1V2NT 3SBKA 5FPSA 3RMNH 2J34A 3V12A 3RXAA 2EA3A 2Z9IA 5FBEA 1FUJA 1FXYA 4ABFA 4AN7A 4HZHA 1AHTH 1Z8IB 1RFNA 3PMHB 1GG6C 3R0FA 1A5HA 2W7UA 1GHXH 2B5TB 1DSUA 4A1TA 3ZV8A 1ZRBA 4AX9H 2ZGBH 3RXLA 1ETSH 5ESTE 5JDUB 1QURH 2XNIA 4K8BA 5HXFA 3TVJB 3GCHB 3NK8A 3A81A 2F9NA 3AASA 4CRDA 8ESTE 4PROA 1LHCH 3Q3KA 1S81A 1EKBB 5A8XA 3R3GB 2GCHG 4FVDA 4IN2A 1Z6JH 3M61U 2F9UA 2ZU4A 1C2DA 2BDBA 1UTPA 1WU1A 3RP2A 1DLKB 3MU0A 2Y6TA 1GBJA 2WPJS 1GBEA 1CT2E 2F91A 3FP6E 5LH8A 3A7VA 1MCVA 1ZJKA 4ZHLU 1EB2A 1TGSZ 1EOJA 5G4BA 1FV9A 1Z71A 2PHBA 2BOHB 1BB0B 1OYTH 1JRTA 2AMPA 4Y79A 1KYNA 5FBIA 4THNH 3EDXB 4SGAE 3JZ2B 1PPCE 4WY3A 1GHAG 2G51A 3T2NA 2Q6DA 2QXIA 1W8BH 1HAPH 1DY8A 1GL0E 4I8JA 1RXPA 4K60A 1L4ZA 1O3OA 3ZZBA 5A0BA 5JB9S 3BIUH 3UOUA 1L1NA 3KGPA 2GMTB 1CHOG 1NO9H 1GJ5H 2VU8E 2AIQA 2H6MA 1EX3A 5DGJA 1ORFA 3RXIA 1C2HA 1H8IH 2F9BH 1C2EA 1LHEH 1T8NA 3GY3A 4I8GA 3OY6U 2Z3DA 1YYY1 1TMBH 1MU8B 3SNCA 1KLIH 1ANCA 4FVBA 1ZYOA 4XE4A 5EQRA 1JBUH 1SFIA 1TNJA 1VITF 4AOQA 1UTMA 3E0NB 1HIAB 4JYVH 5EODA 1LVYA 4TY6A 1SBWA 1BTWA 1A4WH 2GCHF 1PPEE 2A4GA 4BNRA 1T8MA 3PMBB 3T29A 3HKIB 1ELEE 2PSXA 1YM0A 1V2LT 1SGFG 1V2MT 3GCOA 3SNEA 1CQQA 1OXGA 4ISLA 3MYWA 3S7HB 2J4IA 4HI3A 1TRNA 1ZPBA 1P05A 1GVLA 4E05H 1TOCB 5HGGA 2FPZA 4X8TH 3ZZDA 5TCCA 4AYVB 1FY8E 1HAZB 1ESAA 4B76A 1GHAF 3AAVA 3Q00A 3QWCH 3F1SB 4WXIA 2JKHA 1RS0A 3NPSA 5FX5A 1SQOA 5BPEA 2XXLA 1P12E 2THFB 2FI5E 5F6MA 1F0RA 3ENSB 2QYIA 2IN2A 5E0HA 1CHOF 1YLDA 1MKXH 4CH2B 1VJ9U 1GVKB 3GY7A 1P09A 1TX6A 3RU4D 2FTLE 4H42U 1GMDG 1QRZA 4INLA 3ZVCA 5C2ZA 1PPHE 1A5GH 4RKJB 2SFAA 5FAHA 4X6NA 5CHAB 1P3EA 5L2YH 1KXDA 1HJ9A 1LVMA 1EZQA 1DM4B 3SQHE 1Q31A 2P3FH 1QHRB 5DJ7A 3NZIA 4YO9A 2SGEE 4WH6A 1SHHB 4GVUA 4H6SB 2QF3A 4I33A 5EGMA 3QTVH 1C1UH 2ZTZA 4BTIB 3ZZ9A 1J14A 1KDQB 1C2JA 2I6QA 1MBMA 1P8VC 3PLPA 3BG8A 1UCYK 1LO6A 2BY9X 2CV3A 5EPNA 1NRRH 1QB1A 4JMYA 2ZEBA 3TLOA 3M5LA 3SU3A 3RXPA 3UY9A 3GICB 2ZI2H 1V2OT 1DWDH 1HAIH 4K3JA 2GCTC 3LT3A 1GCTC 1BZXE 1MCTA 2AGIX 4B73A 4MNXA 1B0FA 1O3IA 1AVWA 1L1GA 4OS1A 1RTFB 1QRWA 1ARCA 1JWTA 1T7CA 3M3TA 1XUIA 3LGVA 2XWBI 1E34B 1ARBA 1FN6A 3RC5A 2ULLA 2Z9JA 5A0CA 2GDEH 1T4UH 1Y5AT 4I8KA 2VNTA 4TWYA 2SNVA 2O9QA 6GCHG 1HYLA 2Z3EA 4NZLA 1IQKA 4HFPB 4Q7YA 1CU1A 4YOJA 1ABJH 1BDAA 1QBOA 1MTVA 1IQLA 1HBTH 4TWWA 3KNXA 4LXBH 3VB6A 1YKTA 1A5IA 3DA9B 1BTHH 2YNBA 3U1JB 2VWNA 3IITA 1GMDF 2VIDA 1QFKH 2VWMA 1KXAA 3RXHA 2OTVA 4NZQA 1AQ7A 1GBFA 1AFQB 3ZYEA 1T32A 3C27B 1OKXA 1TAWA 3RXCA 1QJ7B 4DGJA 1BRAA 2Y7ZA 4JZEH 3O8DA 4Q7ZA 2Q6GA 3UNQA 1YPHE 3P70B 4NIWA 2BD2A 3A7ZA 3T28A 2FZZA 3DUXH 4WMDA 1SR5C 2GTBA 2G8TA 3GCNA 1ZRKA 5F03A 1DICA 5FHTA 1NPMA 2VWLA 1TB6H 1NS3A 2FI3E 4A6LA 4ZH8A 3MFJA 1DS2E 1UTOA 5DG6A 1KXBA 3T27A 4H6TA 2J38A 2VIWA 1IOEA 5F8XA 1N8OB 2A32A 1DX5M 1UVUH 3RMLH 2WYGA 1O36A 1O2PA 3SHAH 1LQDB 3SUEA 3P17H 1SOZA 3LGYA 1OX1A 1AKSB 1PQ5A 3M35A 5E0JA 3MNBA 1GMCG 3URDA 1A0JA 4MLFB 2UUKB 4AFQA 1F0SA 1TBRH 2BLQA 1SGEE 3K6ZA 4LOYH 1OP8A 3AW1A 1UVTH 2SGDE 1IAUA 1O39A 6GCHF 3F9GA 2BX4A 1O33A 1L0ZA 1D3QB 3H7OA 1PYTD 1UVPA 3FANA 9LPRA 4I7YH 4A5TS 2FX4A 1C5VA 3ATLA 1O2TA 3C1KA 4ISIH 3A7TA 4CRCA 1O3EA 1SGCA 2R3UA 2ZFPH 3V13A 2PKAB 4ZKSU 1NN6A 1O2RA 4BTTB 5C3NA 1YC0A 4TPIZ 3QZRA 2R2MB 3P8FA 1IQMA 4NIXA 2VWOA 1GVZA 2GGVB 4KGAA 1DE7H 5FPYA 3RXSA 3QX5H 3OX7U 5FPTA 2AMQA 3EGKH 3ZZ3A 1XUJA 1GGDB 1TNHA 4OS6A 2AH4X 1FONA 5DP3A 4AB9A 3B9FH 3TITA 3A8AA 7LPRA 1GHWH 2FLRH 3EA7A 2H1UA 1TPOA 1HJAC 3MU1A 2QAAA 1CA8B 3PB1E 3TNTA 1HNEE 1GPZA 3M3VA 3DFJA 4GAWA 4I8LA 3LC5A 3M7TA 4B2BA 1ZMLA 5GCHG 3SU4A 1DWEH 1GHZA 1J9CH 2KAIA 4FU9A 4Q2KA 1O2WA 2PUXB 4D76A 2HNTE 1O2QA 2BM2A 1LHGH 1UK4A 1Z1IA 2GKVE 2J92A 3F68H 1CT4E 3PM3A 4CRAA 3WY8A 4WF8A 1G3DA 3GCHC 2XW9A 4MDSA 3SV9A 4MG3A 1GMCF 3ZZCA 1V3XA 1QL8A 3E6PH 3QUMP 4Y71A 1NU7B 3V3MA 1QR3E 1E35B 1ZHPA 1DANH 2BY5X 3A87A 3ZVEA 5GWZA 2ZFFH 2QXJA 1W7GH 2VIQA 1C5XB 1Z8GA 1SLVB 4IGDA 1A2CH 1J17T 1GI0A 2BD5A 4D7GA 2A4QA 5EG4A 2FOEA 2LNCA 1HJ8A 2OUAA 1BTZA 2ZZUH 4IMZA 1TLDA 1A0HB 1LMWB 4X2WA 3JZ1B 1A61H 4AG1A 3MWIU 2Z7FE 1W0ZU 4B2AA 1KSNA 3BTWE 2BLVA 2HPQH 2VVVA 3QN7A 1B5GH 1G3BA 1ZTLA 2FX6A 3F9EA 2Z9KA 5C5NA 1O2HA 5JPMH 1P01A 4LZ4B 3SI3H 2TPIZ 4KTUA 1G2MA 3LH1A 1T4VH 3RXOA 3E91A 1WTGH 3D23A 3FP7E 4WVPE 4K69A 5LGOA 5EW2H 2FIRH 5DP4A 1BRUP 2HVXA 2W7SA 2XTTB 2NU3E 2ZGJA 3DHKH 1HAOH 3BTHE 3L33A 2OLGA 1C9TA 1TBQH 1TGBA 1MQ5A 2BDHA 2FESH 5GCHF 2FOFA 4Y0ZE 3PROA 2GDDA 1BTYA 1CGIE 1DVAH 3VGCB 4MPXA 1QBNA 1O5GH 2HWLB 1RD3B 4X2YA 1C2FA 1FJSA 2VB0A 5T3HA 3KHVA 2BVRH 3G01A 7KMEH 1EPTB 2Y5GA 3BTFE 1C5PA 4LK4A 4DURA 2BD4A 3BTTE 2SGFE 1ANBA 3QDZB 4ZXYH 2WINI 4CR5A 2D2DA 3ZVFA 1W2KH 2ZTYA 4ABBA 3PV4A 2Y7XA 1B0EA 1XXFA 2W5EA 4FUDA 1ZPCA 2ZU3A 2Z3CA 4J1YA 2HPPH 1PYTC 2FOAA 2QN5T 3NXPA 3SUDA 1BRBE 5JBTA 2AS9A 5E0GA 3BG4C 4UFFH 4AGKA 1O5CB 2PKSC 1MKWH 1P9UA 2F3CE 1P2JA 4OGXA 3W95A 2ZU2A 1O2KA 1KTTB 1BBRE 1INCA 4BOHA 2FTMA 1ELAA 2BOKA 2A5AA 2BDYA 4VGCB 1GJ8B 4ZKOU 2UWOA 3U98H 2B0FA 2RG3A 1EOLA 1GBTA 3KQCA 1FMGA 2A2XH 1N6XA 2Y81A 1AB9B 1K1MA 1TA2A 3S9BA 3K9XB 3P92A 5J4SA 3P6ZB 3P8NA 2ZU5A 3M5NA 5LPRA 1GBHA 2FDAA 1MTSA 2TIOA 4K2YA 2ZHWH 5AFYH 1XUFA 1C5SA 2ANWA 2PGBB 5DP8A 1CBWC 1IQJA 3VXEH 5LPFA 5CHAC 5GXPA 3BV9B 1FIWA 4AORA 3ODDA 1AE5A 3RM2H 4NSVA 2A45B 2WPKS 2V35A 1MU6B 8KME2 2BLOA 3MOCA 3DFLA 3RXFA 5E2OA 1HAVB 1TNGA 1O2MA 1FI8A 2ZTXA 4JZIA 5EPYA 1ZSJA 2ZQ2A 4O97A 1DFPA 2TGPZ 3LGTA 1YPMH 4YESB 5I46H 1ZJDA 1TMUH 3M5OA 2CJIA 3A85A 2PFEA 4DJZB 2R3YA 1IQFA 1C5RA 1QQ4A 3SJKA 5SGAE 1WBGB 1TRYA 1XVOA 2J9NA 3OSYA 2XCFA 2BQ6B 3UR6A 4ZHAA 1A46H 1SQAA 2FEQH 1QQUA 1MTWA 3SV6A 3KQBA 3MO6A 1RRKA 2TGTA 1J15A 1FDPA 2W3IA 3LKWA 2G4TA 1MAXA 1IQGA 4DT7B 2O8WA 1XVMA 1KXCA 2P8OB 1C1QA 1FY1A 5JBAS 3SZNA 2BZAA 3UWJH 4MPUA 2OC7A 3TJNA 1OYQA 1TPAE 1JXPA 2WYJA 1Y8TA 1BA8B 2SGAA 1TRMA 1F5KU 3S9AA 5A09A 1ZMJA 1ZGIA 1GBLA 3UR9A 1H9HE 5L6NH 5K7RA 2GZ8A 3SI4H 2WUCA 3SGAE 2PTCE 3SV7A 2ODYB 3SU2A 1DXWA 1K2I1 1ZGVA 1SG8B 1C5UA 1WQVH 2DUCA 3CS7A 1TALA 2Z9GA 3W94A 1KLJH 4E06H 5LPEA 3BEIB 2FM2A 3GYLB 1D6RA 2UUYA 1TX7A 1JOUB 3SGQE 1AI8H 1AFQC 4DOQA 3OYPA 5A8ZA 2OC8A 1O2UA 1S85A 3M7UA 1P02A 3T25A 1DPOA 2HALA 4ABGA 5JBCS 5ABWA 1LVOA 1U6QA 1YGCH 2ZHEH 3SJ9A 1F92A 4CH8B 6CHAC 4NA7A 1GJ9B 2XC4A 1PQ7A 4U01A 3UNRA 1BCUH 3E3TA 3UFAA 3SNDA 1HAHH 2ZQ1A 4NFFA 3EYDA 1N6YA 1FY4A 1GMHG 1O38A 2ZHDA 1C2KA 3QO6A 6LPRA 2Q6FA 2XRCA 2ZDVH 9ESTA 1O3PB 1O2OA 1NZQH 1A1RA 3FP8E 4KELA 4Y8ZA 1Y3VA 3E1XB 2J2UA 1HAYB 1YCPH 1S83A 1K28D 1ELCA 2QC2A 1P04A 2VGCC 2A5KA 4IMQA 1BBRH 1G3EA 3TH3H 1O37A 2GZ9A 3PLKA 1BQYA 1C4V2 2G81E 4BAMB 1Y3YA 3RXGA 2XYAA 3STJA 4E7RG 1RIWC 1OWDA 2QF0A 2H9TH 3UQVA 4AFZA 3TNSA 2ASUB 2BTCE 1ID5H 1SGFA 1TQ0B 5L2ZH 2GZ7A 3EE0B 2VJ1A 1C1NA 1AFEH 4K8YA 4ZMAH 1PPFE 2WPMS 5JB8S 1WQSA 1O3HA 1MAYA 1GI9B 1SLWB 1LPKB 1HPGA 1FIZA 2CF8H 1TA6A 2HNTF 1AKSA 3BTME 1M9UA 1AIXH 4DIHH 1TPSA 2PW8H 4OS5A 5A0AE 3O8RA 1O2VA 4WMFA 4CRFA 3ESTA 2IOTA 2Y5FA 4UFGH 4TY7A 1GGDC 4IW4E 2V3OH 1THPB 1HAGE 4R8TB 3L3TA 2IPHA 3KL6A 3H7TA 1ZR0A 1NM6A 3EQ0H 4X8VH 2F83A 2AIPA 1CGHA 3BIVH 2WPHS 1BRCE 4INKA 5EXMA 1P06A 2FOCA 1C5NH 4NGAH 1GG6B 4XFQA 4K1SA 1C1MA 1MH0A 1P57B 1O5BB 1K1OA 2A2QH 2CMYA 2CHAB 4MTBA 1SVPA 1BTUA 2H9EH 1GJCB 2EC9H 3D65E 3LGUA 2FYQA 3MNXA 5GDSH 3RXKA 3ATMA 2AMDA 1GJ7B 3TGJE 2BD9A 3NWUA 3U8OH 2F9PA 1V2QT 2C8ZB 5EXLA 1BMMH 1V2RT 8GCHG 3A82A 1DDJA 4AG2A 4FUFA 1LPGB 4ZROA 2F9VA 2A7HA 1SGYE 4GLYA 4K1EA 5E8EH 1NC6A 1EP6A 4BTUB 1WTHD 1A3BH 4JZFH 3UTUH 1KIGH 3TGIE 2RA3A 1ZLRA 2FODA 3PWBA 3GY4A 2SNWA 2D8WA 2FOBA 1OWHA 1O2NA 4Z6AH 3TJUA 2OINA 1MD7A 2AGGX 5AF9H 1DY9A 3RDZA 1NRPH 2NWNA 3UIRA 4CREA 3A8DA 5FCRA 1CA0B 3HATH 4CRBA 1PQ8A 2FXRA 2P93A 1TWXB 4JCNA 4DCDA 1B7XB 1P9SA 2J95A 1IHSH 2C8XB 3A80A 3SJIA 1P2KA 4I31A 2A4OA 4MNYA 1K22H 4I8HA 1ZMNA 3SUFA 1BIOA 3S9CA 1UTJA 2AGEX 5DP7A 2H2ZA 3BTQE 2NU2E 2H9HA 5IYTA 4B2CA 1OWJA 1ACBE 1ANDA 2ALVA 3ZZ8A 3A83A 1KXFA 1ZSKA 1P3CA 1ELVA 2O8LA 2ZHFH 2FS8A 1RTLA 2LPRA 1BT7A 3F6UH 1IQEA 4YZUA 3LGWA 1G37A 2HGTH 2A7JA 1W11U 3Q3XA 3VB7A 2GX4A 1TPPA 1TOMH 3ZZAA 2CF9H 3K6YA 1QTFA 4MNWA 3RUOA 4Y76A 2VIOA 3MMGA 3LPRA 1FY3A 2QY0B 3SO3A 2XWAA 5HYOA 1UVSH 1JIRA 8GCHF 2A31A 2C93B 4A92A 2OD3B 2P3UB 3KEEA 3T26A 5K0HA 1C1WH 4D9QA 4NSYA 3ELAH 4ABEA 4DW2U 3KIDU 3CP7A 3VB3A 1PPBH 2H5CA 3I77A 5EXNA 4BAQB 1PPGE 4KTCA 2P95A 2XBXA 1HRTH 3TIUA 4BAHB 4VGCC 1S5SA 2Z9LA 1CE5A 2AFQB 3BTKE 3LGIA 1AB9C 2WPIS 1TNKA 1UTLM 3PMJA 2BLWA 3MHWU 1MKXK 4I32A 1YPEH 1EQ9A 1BMLA 3M37A 3MO3A 4B74A 3I29A 1YBWA 2ILNA 3HK6B 4ISNA 1TGTA 1QA0A 2UWPA 2FI4E 2VVUA 1MZDA 1O5EH 3BEUA 1V2JT 4SGBE 1O5AB 4BXWA 4X1PU 2YOLA 3RMOH 3SV2H 3ZZ5A 2ESTE 4UD9H 5IDKA 2ZP0H 1AE8H 3Q77A 1O3JA 2M5TA 3LDXH 1Q2WA 3URCA 1V2VT 3SQEE 1LKBA 1NRNH 1GHYH 1EB1H 4NIVA 5T6DA 1AVXA 1AGJA 3SHCH 1VCPA 1AVGH 3U1IB 1OWKA 3VXFH 1SSXA 2FYRA 2HOBA 1W7XH 1LKAA 1FPHH 1O3MA 1V2PT 4M7GA 3AW0A 4YT7H 1E38B 1ETRH 3SN8A 1SGPE 4OS2A 3VPKA 5CMXH 1HXFH 2O8MA 3RXTA 3MO9A 4QT8C 3B8JA 1NTPA 1H9LB 1MQ6A 1TE0A 1T8OA 4H4FA 4NWKA 4JK6A 3H5CB 4YOIA 3KQEA 2VH6A 5PTPA 3TU7H 4FU8A 3ZVGA 1YPJH 3B23B 1SC8U 1UTQA 1AD8H 3UOPA
chains in the Genus database with same CATH superfamily
2P8OC 4WWYA 1YLCA 3UREA 1SL3A 1Z6EA 2GD4B 4IC6A 3EAJA 1L1JA 2Y5HA 1HAVA 1O2LA 5TCAA 5TJXA 1QB9A 3NUMA 4ZKRU 3S69A 1O5DH 4FUCA 3RXRA 1G32B 1YLNA 2WUBA 3ZVDA 4M9FA 4MVNA 1GCDA 1O30A 3GY2A 4A7IB 2Y80A 3SV8A 2G5NA 3OE7D 3AK5A 2G4UA 1ELGA 2R0LA 4U32A 1BTPA 3TH2H 2VIVA 4NCYA 2KZ4A 3RXUA 3PLBA 4Y7AA 3ITIA 1C2GA 4UONA 3QZQA 2GMTC 1O35A 1CVWH 4U30A 4X8UH 3U8TH 1ZTKA 2EI8A 2NU4E 1E36B 5EW1H 5DPAA 1AO5A 1DT2A 1GI3A 5FXLA 2AEIH 2KCAA 4MNVA 1G36A 3DT0H 1K9OE 1MUEB 1S0QA 1DOJA 4GPGA 3UWIA 1UK2A 1HB0B 1WYKA 1DITH 3BEFB 2OQUA 2P59A 4GSOA 2OBQA 1SGIB 1GBKA 2VVCA 2Z94A 2ZG0H 4AGJA 1Z7KA 2C90B 4Q80A 2ZDNA 2ZHQH 1CHGA 2CXVA 1HFDA 1A0LA 1O3LA 1TBZH 1SHYA 2BD3A 1VJAU 4DVAU 1F0TA 1BHXF 3N7OA 1SOTA 1KY9A 5EU8A 1C1RA 1EZXC 2Q1JA 3NKKA 2G55A 5JBBS 2QF5A 2ZFQH 2BD7A 2QGRA 1FNIA 1SGNE 5DP9A 1BJVA 2C8YB 1G30B 1LHDH 3BN9A 2ZPRA 2PGQB 1QRXA 3PYHA 2FS9A 5JYIA 1O3KA 3O8CA 3GY5A 4MPWA 1OWIA 1SQTA 4B6EA 1YPHC 5H4IB 4YOGA 1C5TA 1GJBB 2BY8X 1G3CA 1VITH 2BVSH 3BSQA 1AMHA 2SGPE 2FOHA 4JZDH 3RU4T 1HIAA 3RXQA 1SFQB 1S84A 4Y0YE 2CN0H 2RDLA 3MNCA 2EI6A 3TJVA 2AERH 2R0KA 1W0KD 5C5OA 2BD8A 2OXSA 2BDAA 2A1DB 3RXBA 2FMJA 4CHAB 2I6SA 5A2MH 3GDUA 2XC5A 1G9IE 2ODQA 3BF6H 1JMOH 1TIOA 4JYTA 1EAUA 5HMAA 2BB4A 4ABHA 4BANB 4INHA 1C5OH 3M7QA 2BY7X 1QCPA 1K1IA 2ZGHA 1DUAA 1SGQE 3KCGH 1TYNA 1KLTA 1EJAA 4AC9A 2A4RA 1VGCB 2FP7B 2WV5A 3M3SA 2A5IA 1ZZZA 4IBLH 1P2QA 2P94A 2XBYA 3MH6A 3HKJB 2G5VA 2C8WB 5B6OA 2BXTH 3IG6B 1D3DB 1J16A 1NY22 4KKDA 2BZ6H 1FZZA 3OTPA 1AWHB 1XUGA 1BHXB 2GT7A 1QL7A 2W3KA 2D26C 4KP0A 2ANMH 1H4WA 4OS4A 1QB6A 1UCYH 1NFWA 2YMSD 3A8BA 3GCTG 3PTBA 3DD2H 5DP6A 4DT4A 1HCGA 2JH0D 1OWEA 1XKAC 2CHAC 4ZHMU 4D7FA 5C20A 1EXFA 1VITG 1W0YH 2F9OA 3SU0A 1OP2A 1THRH 4GCHG 1CGJE 4IS5A 3U9AH 5J4QA 4X6MA 2PWXA 4JZ1A 1QY6A 1TQ7B 3SNBA 1KDQA 3ATWA 4MPVA 1UO6A 2IJOB 4UFDH 1FN8A 2O8UA 3DSPA 4AZ2B 1LVBA 4ABAA 1NT1A 4NFEA 1QGFA 1SMFE 3E0PB 1C5WB 3RC6A 1O2ZA 4NA9H 3E16B 2DE8A 1O0DH 1P0SH 1F5LA 1E0FD 5HIYA 3RXMA 1X7AC 3OAAD 2HNTC 4IC5A 1AN1E 1LCYA 1OOKB 2EI7A 4NG9H 4XDEA 2J94A 4B75A 2XBWA 2ZU1A 1LPZB 2ZNKH 3UPEA 4Q7XA 3LIWA 4DY7B 1MTNB 3RXJA 2V3HH 4GUXA 4JK5A 1CSOE 3FVFB 1N1LA 4FUHA 1VZQH 1CA0C 4CBOA 1FLEE 4CRGA 2XBVA 3GISB 2C4FH 2ZDLA 2HVYB 5FX6A 1O2IA 1C5QA 1GBCA 4ISHH 1H1BA 3IWMA 4AB8A 1C1TA 2STBE 4NWLA 1XUHA 1EAWA 1Y3UA 5KEDA 1OP0A 3RU4E 2RFKC 1T8LA 2OC0A 3GCTF 1QBVH 2G00A 2WSSD 4WH8A 5AVDA 3BTGE 5HM9A 1C1PA 1N8OC 1CO7E 2ZA5A 1SI5H 2ZDAH 1YCPM 1P11E 1V2KT 4KTSA 4WXVA 2CK3D 1UHBB 4HTCH 1DXPA 1SB1H 1PFXC 1SLXB 2XOKD 2ZWLH 1WSSH 3EA8A 1P2NA 1S82A 4GCHF 1O5FH 1COWD 2ALPA 4ASHA 1AY6H 3PRDA 2TRMA 2QF4A 1C5MD 1D3TB 1BTXA 2HLCA 1P2IA 1VCWA 1SLUB 1SQRA 2ZCHP 2B8OH 1O32A 1MKWK 1IQIA 3FOAA 1V2UT 3HK3B 1BJUA 2JETB 2Y82A 4ABJA 2YNAA 2BQ7B 3P8OA 4GHQA 3BG4B 3AVZA 4Z0KA 2PKSB 4TSFD 5DO4H 1AZ8A 2BDGA 2BMGB 5GIBA 1EAXA 1MD8A 3LU9B 1ZHMA 1ZOMA 1ELFA 2BYAX 1XKBC 4FUBA 3GDVA 4RKOB 4R0IA 1JRSA 2M2AA 1P2MA 3PWCA 1OPHB 4FUEA 1ABIH 1C2LA 5AFZH 2PSYA 2PTNA 1ZSLA 1O3CA 1E1QD 4FXGH 3PO1B 3U8RH 3LC3A 2ZCKP 3SORA 1BMAA 1D9IA 1F7ZA 2NU0E 2GV7A 2GT8A 2ODPA 1GJDB 4YM9A 2VINA 3M36A 4YLUA 1Y59T 1CBWB 2Z6BD 3T5FH 1V2ST 3V0XA 3VB4A 5EQQA 1SGRE 2YMSC 1SPJA 2GP9B 1AU8A 2VBCA 2H5DA 1UJ1A 1O2XA 3S0NA 1GMHF 1S6HA 2JH5D 2ZGXH 2PKAA 1YPGH 1S0RA 7GCHG 1UTKA 1C1SA 3A86A 3E90B 1DSTA 5CE1A 4O3UA 2BHGA 4ZXXH 3A8CA 3MU8A 2ANKH 2UUJB 3TK6A 3ATKA 2JH6D 1QA7A 1XXDA 3AAUA 3MI4A 1GHVH 2OCVB 3FZZA 3ZV9A 1ELTA 2AYWA 1GI5A 8LPRA 3MH4A 4CBNA 3CENA 2V7QD 4AFSA 1YPKH 1HUTH 2UWLA 2OBOA 2K1QA 2ZO3H 1A3EH 1TX8A 3SOSA 4FUIA 4Q63A 1TABE 4F55A 1O2GH 4UFEH 5EQSA 1EASA 3SU6A 1P2OA 4E7NA 1XUKA 1XX9A 1GBIA 1YP9A 1AZZA 4A1XA 1WCZA 2R9PA 4ESTE 3TK9A 4GHTA 4Y8XA 4F49A 2TGAA 3ZVAA 1HDTH 1QL9A 3KN2A 1MMJN 1GI8B 3ATIA 1DUEA 1V2WT 2RDEA 3OU0A 5C1XA 1FAKH 5ETXA 2ZCLP 5T6GA 2NU1E 3Q3YA 3STIA 3SW2B 1LQEA 2C3SA 5DSFA 5C0UA 1GWAA 1A7SA 1GBMA 1V2TT 1H9IE 1O2YA 3LJJA 1O3GA 1FQ3A 1ELBA 2FLBH 5DKMA 2ZC9H 3QK1A 1XM1A 2ZF0H 4ISOA 2ZDMA 1NFYA 1C1OA 3VGCC 3FZDA 7GCHF 1GBDA 1TNLA 1GBBA 2WV9A 1EATA 1UK3A 1PJPA 1EPTC 1K1PA 6CHAB 3EE7A 1PQAA 3K65B 1JIMA 4WMEA 5C1UA 3MH5A 3GDSA 5T6FA 3LJOA 4F4OC 4IN1A 3TH4H 3TJOA 1D3PB 3UUZA 3KQDA 1WOFA 2RCEA 1EUFA 2V6NA 1FY5A 3ZZ6A 2R2WU 1FPCH 3GY6A 4AYYB 3TPIZ 1C4Y2 1ANEA 1GHBG 1MBQA 1YCPK 3HGPA 4TYDA 2PV9B 1TONA 2UUFB 1J8AA 2A7CA 3QLPH 4A1VA 2OQ5A 2VH0A 4ZUHA 4ABIA 3Q76A 1TGNA 1NRQH 1BBRK 1NROH 1IQNA 1KTSB 4X1SU 1EZUC 2KR7A 3FFGA 3GOVB 3GYMA 4YXWD 2FO9A 2VGCB 1DLEA 3KF2A 1AUJA 1D6WA 1MZAA 3E8LA 2WPLS 3QGJA 1EPTA 4DIIH 3LOXA 1IHTH 4FU7A 3RLWH 2P3TB 4UE7H 1RIWB 2G52A 1HAXB 2ZPSA 4NA8A 4D9RA 1YPLH 5AHGH 2WPDD 3VB5A 5T1VA 4CHAC 4CR9A 1FAXA 1ESBA 3SU5A 1GJ6A 1AWFH 3QGNB 2VIPA 5GJ4B 4ZAEA 1BOQA 3ZVBA 2BDIA 1Z8RA 2QIQA 1T31A 1ETTH 4RI0A 1NU9A 1VR1H 1HXEH 4TPYA 1ZTJA 3DSGA 1ZHRA 2BXUH 3A88A 3K2UA 2ANYA 5GNDA 3OTJE 1VGCC 2QCYA 2EQNA 1C4U2 3RMMH 1GL1A 3CNRA 2ZKSA 2DE9A 1O34A 1TGCA 3CS0A 4UEHH 3MU5A 3MH7A 4ABDA 3A7WA 3LONA 4FUGA 1QIXB 3GY8A 1WUNH 1XMNB 2BQWB 7ESTE 3MU4A 3RXVA 3U69H 1C5LH 1GDUA 1C5ZB 1RGQA 2BY6X 4HGCA 4AFUA 3A89A 4YT6H 1EP5A 1GJ4H 1Y5UT 1WAYB 2V0BA 3TGKE 3VEQB 2O8TA 2EEKA 4B1TA 1UVOA 4NIYA 1UCYE 1GHBF 4D8NA 3F9FA 3OFND 1THSH 1F0UA 2PLXA 2GCTB 1MTUA 1GCTB 1S6FA 3ZZ4A 2QV1A 1HLTH 1W0JD 1SGDE 1SGTA 1O2JA 2PUQH 2LELA 3SUGA 2WV4A 3A7XA 1G2LA 1NFXA 3L6PA 4X0WU 1EJNA 1GI6A 2ZECA 1L4DA 2RA0A 1LHFH 1QJ6B 4LZ1H 5A8YA 2TGDA 4RSPA 1K1JA 2K8IA 2ZFRH 1KXEA 1Y3WA 4XBDA 3BTDE 1ZPZA 1LDTT 4O03A 3A84A 5C67A 3I78A 1HGTH 1H8DH 5CHBA 2QXGA 3SGBE 2F4LA 4Y6DA 4ZCNA 1ELDE 3P95A 3S7KB 4JYUH 1GJAB 3F0PA 2STAE 1F5RA 3PTNA 3VFEA 3SU1A 1YF4A 1W13U 1C1VH 3F2GA 1V6DA 4X2VA 2WZQA 2OP9A 3O8BA 2FOMB 4Y10E 4X1QU 3SJ8A 3EA9A 4BXSA 4X2XA 1MTNC 1C5YB 4Y7BA 4X6PA 1NESE 3SJOA 5C17A 1OS8A 1TFXA 2OK5A 4OGYA 2XCNA 1AUTC 2ZIQH 1W3CA 4MQAA 5I25A 1GI7B 5C1YA 1DWBH 3ZYDA 5F8ZA 1KMHB 1O2SA 4J2YB 1W14U 1NFUA 4BAOB 1GDQA 3TK5A 1W12U 3ODFA 3QTOH 3RM0H 4XBCA 1EAIA 5DP5A 1EZSC 2ZPQA 5E2PA 3A7YA 2B9LA 1BUIA 1C9PA 1O3NA 1P03A 1OSSA 1TNIA 5ESBA 4O3TA 4ZKNU 4Y11E 3RC4A 4FUJA 1UTNA 3D62A 3NCLA 4X8SH 2P16A 1IQHA 5HM2A 4BAKB 4ACAA 1UMAH 3T62A 1Z8JB 4O9VA 3MQKC 3BTEE 2GVFA 4YLQH 4XBBA 1C2IA 4U2WA 2FOGA 1Q3XA 2BVXH 1O3FA 2OC1A 3V7TA 3MNSA 1K21H 2PR3A 2W26A 2BX3A 5F8TA 1Z1JA 3RXEA 2B7DH 2ZGCA 3SNAA 5EOKA 1CT0E 4XOJA 2XC0A 1HV7A 2D1JA 3OY5U 1EJMA 2SGQE 4YTAA 3F9HA 2JETC 4WJG2 4Y8YA 1Y5BT 1O3DA 3UQOA 3RLYH 1DWCH 5FCKA 1F2SE 2ZDKA 2QXHA 1RJXB 1MABB 5DK1A 1GI2A 4X1RU 1K1LA 2GV6A 4K5ZA 2HRVA 2JDID 2ZFTA 2FWWA 1C2MA 1BMNH 1GBAA 2V3MA 4DG4A 3PV2A 5BRRE 1E37B 1GI4A 1PPZA 1K1NA 1O31A 1UHBA 2KAIB 3RXDA 4K1TA 3P8GA 1D4PB 3N7DA 1NRSH 5C0TA 4OS7A 1QNJA 1GI1A 2QA9E 5L30H 2ZFSA 3PMAB 4RN6A 1RTKA 4X6OA 1TMTH 1GDNA 3KYGA 3UNSA 1Y3XA 3D49H 3PO1C 1H8ED 1P10A 3LH3A 3MTYA 5GPIB 1ESTA 1O3AA 1QJ1B 2BDCA 4B71A 1BITA 4X1NU 1VCQA 3FAOA 1WV7H 1W10U 2A0QB 3M5MA 1LTOA 4UDWH 6ESTA 3HGNA 2CGAA 3HPTB 4XSKU 3ZZ7A 1HJAB 1O3BA 2TBSA 1L2EA 1V2NT 3SBKA 5FPSA 3RMNH 2J34A 3V12A 3RXAA 2EA3A 2Z9IA 5FBEA 5IK2D 1FUJA 1FXYA 4ABFA 4AN7A 4HZHA 5FL7D 1AHTH 1Z8IB 1RFNA 3PMHB 1GG6C 3R0FA 1A5HA 2W7UA 1GHXH 2B5TB 1DSUA 4A1TA 3ZV8A 1ZRBA 4AX9H 2ZGBH 3RXLA 1ETSH 5ESTE 5JDUB 1QURH 2XNIA 4K8BA 5HXFA 3TVJB 3GCHB 3NK8A 3A81A 2F9NA 3AASA 4CRDA 8ESTE 4PROA 1LHCH 3Q3KA 1S81A 1EKBB 5A8XA 3R3GB 2GCHG 4FVDA 4IN2A 1Z6JH 3F2HA 3M61U 2F9UA 2ZU4A 1C2DA 2BDBA 1UTPA 1WU1A 3RP2A 1DLKB 3MU0A 2Y6TA 1GBJA 2WPJS 1GBEA 1CT2E 2F91A 3FP6E 5LH8A 3A7VA 1MCVA 1ZJKA 4ZHLU 2KCYA 1EB2A 1TGSZ 1EOJA 1SKYE 5G4BA 1FV9A 1Z71A 2PHBA 2BOHB 1BB0B 1OYTH 1JRTA 2AMPA 4Y79A 1KYNA 5FBIA 4THNH 3EDXB 4SGAE 3JZ2B 1PPCE 4WY3A 1GHAG 2G51A 5KGOA 2Q6DA 3T2NA 2QXIA 1W8BH 1HAPH 1DY8A 2KCOA 1GL0E 4I8JA 1RXPA 4K60A 1L4ZA 1O3OA 3ZZBA 5A0BA 5JB9S 3BIUH 3UOUA 1L1NA 3KGPA 2GMTB 1CHOG 1NO9H 1GJ5H 2VU8E 2AIQA 2H6MA 1EX3A 3NRLA 5DGJA 1ORFA 3PV5A 3RXIA 1C2HA 1H8IH 2F9BH 1C2EA 1LHEH 1T8NA 1NBME 3GY3A 1OHHD 4I8GA 3OY6U 2Z3DA 1YYY1 1TMBH 1MU8B 3SNCA 1KLIH 1ANCA 4FVBA 1ZYOA 4XE4A 3W1EA 4OM9A 5EQRA 1JBUH 1SFIA 1TNJA 1VITF 4AOQA 1UTMA 3E0NB 1HIAB 4JYVH 5EODA 1LVYA 4TY6A 1SBWA 1BTWA 1A4WH 2GCHF 1PPEE 2A4GA 4BNRA 1T8MA 3PMBB 3T29A 3HKIB 1ELEE 2PSXA 1YM0A 1V2LT 1SGFG 1V2MT 3GCOA 3SNEA 1CQQA 1OXGA 4ISLA 3MYWA 3S7HB 2J4IA 4HI3A 1TRNA 1ZPBA 1P05A 1GVLA 4E05H 1TOCB 2GJGA 5HGGA 2FPZA 4X8TH 1S6LA 3ZZDA 5TCCA 4RT0A 4AYVB 1FY8E 1HAZB 1ESAA 4B76A 1GHAF 3AAVA 3Q00A 3QWCH 3F1SB 4WXIA 2JKHA 1RS0A 3NPSA 5FX5A 1SQOA 5BPEA 2XXLA 1P12E 2THFB 3WW7A 2FI5E 5F6MA 1F0RA 3ENSB 2QYIA 2IN2A 5E0HA 1CHOF 1YLDA 1MKXH 4CH2B 1VJ9U 2XNDD 1GVKB 3GY7A 1P09A 1TX6A 3RU4D 2FTLE 4H42U 1GMDG 1QRZA 4INLA 3ZVCA 5C2ZA 1PPHE 1A5GH 4RKJB 2SFAA 5FAHA 4X6NA 2QE7D 5CHAB 3WWBA 3UB0A 1P3EA 2K0QA 5L2YH 1KXDA 1HJ9A 1LVMA 1EZQA 1DM4B 3SQHE 1Q31A 2P3FH 1QHRB 5DJ7A 3NZIA 4YO9A 2SGEE 4WH6A 1SHHB 4GVUA 4H6SB 2QF3A 4I33A 5EGMA 3QTVH 2EY4C 1C1UH 2KX4A 2ZTZA 4BTIB 3ZZ9A 1J14A 1KDQB 1C2JA 2I6QA 1MBMA 1P8VC 2J5UA 3PLPA 3BG8A 1UCYK 1LO6A 2W6JD 2BY9X 2CV3A 5EPNA 1NRRH 1QB1A 4JMYA 2ZEBA 3TLOA 3M5LA 3SU3A 3RXPA 3UY9A 3GICB 4P02A 2ZI2H 1V2OT 1DWDH 1HAIH 4K3JA 2GCTC 3LT3A 1GCTC 1BZXE 1MCTA 2AGIX 4B73A 4MNXA 1B0FA 1O3IA 1AVWA 1L1GA 4OS1A 1RTFB 1QRWA 1ARCA 1JWTA 1T7CA 3M3TA 1XUIA 3LGVA 2XWBI 1E34B 1ARBA 1FN6A 3RC5A 2ULLA 2Z9JA 5A0CA 2GDEH 1T4UH 1Y5AT 4I8KA 2VNTA 4TWYA 2SNVA 2O9QA 6GCHG 1HYLA 2Z3EA 4NZLA 1IQKA 4HFPB 4Q7YA 1CU1A 4YOJA 1ABJH 1BDAA 1QBOA 1MTVA 1IQLA 1HBTH 4TWWA 5HIZA 3KNXA 4LXBH 3VB6A 1YKTA 1A5IA 3DA9B 1BTHH 2YNBA 3U1JB 2VWNA 3IITA 1GMDF 2VIDA 1QFKH 2VWMA 1KXAA 3RXHA 1FX0B 2OTVA 4NZQA 1AQ7A 1GBFA 2J98B 1AFQB 3ZYEA 2KM0A 2F43B 1T32A 3C27B 1OKXA 1TAWA 3RXCA 1QJ7B 3U28C 4DGJA 1BRAA 2Y7ZA 4JZEH 3O8DA 4Q7ZA 2Q6GA 3UNQA 1YPHE 3P70B 4NIWA 2BD2A 3A7ZA 3T28A 2FZZA 3DUXH 4WMDA 1SR5C 2GTBA 2G8TA 3GCNA 1ZRKA 5F03A 1DICA 5FHTA 1NPMA 2VWLA 1TB6H 1NS3A 2FI3E 4A6LA 4ZH8A 3MFJA 1DS2E 1UTOA 5DG6A 1KXBA 3T27A 4H6TA 5EJZA 2J38A 2VIWA 1IOEA 5F8XA 1N8OB 2A32A 1DX5M 1UVUH 3RMLH 2WYGA 1O36A 1O2PA 3SHAH 1LQDB 3SUEA 3P17H 1SOZA 3LGYA 1OX1A 1AKSB 1PQ5A 3M35A 5E0JA 4FETA 3MNBA 1GMCG 3URDA 1A0JA 4MLFB 2UUKB 4AFQA 1F0SA 1TBRH 2BLQA 1SGEE 3K6ZA 4LOYH 1OP8A 3AW1A 1UVTH 2SGDE 1IAUA 1O39A 6GCHF 3F9GA 2BX4A 1YY3A 5CDFE 5HKKD 1O33A 1L0ZA 1D3QB 2AHME 3H7OA 1PYTD 1UVPA 3FANA 9LPRA 4I7YH 4A5TS 2FX4A 1C5VA 3ATLA 1O2TA 3C1KA 4ISIH 3A7TA 4CRCA 1O3EA 2KCPA 4Q4LA 1VKYA 1SGCA 2R3UA 2ZFPH 3V13A 2PKAB 4ZKSU 1NN6A 1O2RA 4BTTB 5C3NA 1YC0A 4TPIZ 3QZRA 2R2MB 3P8FA 1IQMA 4NIXA 2VWOA 1GVZA 2GGVB 4KGAA 1DE7H 5FPYA 3RXSA 3QX5H 3OX7U 5FPTA 2AMQA 3EGKH 3ZZ3A 1XUJA 1GGDB 1TNHA 4OS6A 2W6ID 2AH4X 1FONA 5DP3A 4AB9A 3B9FH 3TITA 3A8AA 7LPRA 1GHWH 2FLRH 3EA7A 2H1UA 4XRNA 1TPOA 1HJAC 3OEED 3MU1A 2QAAA 1CA8B 3PB1E 2YMSB 3TNTA 1HNEE 1GPZA 3M3VA 3DFJA 4GAWA 4I8LA 3LC5A 3M7TA 4B2BA 1ZMLA 5GCHG 3SU4A 1DWEH 1GHZA 1J9CH 2KAIA 4FU9A 4Q2KA 1O2WA 2PUXB 4D76A 2HNTE 1O2QA 2BM2A 1LHGH 1UK4A 1Z1IA 2GKVE 2J92A 3F68H 1CT4E 3PM3A 4CRAA 3WY8A 2JJ1D 4WF8A 1G3DA 3GCHC 2XW9A 4MDSA 3SV9A 4MG3A 1GMCF 3ZZCA 1V3XA 1QL8A 3DSOA 2LP6A 3E6PH 3QUMP 4Y71A 1WXRA 1NU7B 3V3MA 1QR3E 1E35B 1ZHPA 1DANH 2BY5X 3A87A 3ZVEA 5GWZA 2ZFFH 2QXJA 1W7GH 2VIQA 1C5XB 1Z8GA 2JJ2D 1SLVB 4I86A 4IGDA 1A2CH 1J17T 1GI0A 2BD5A 4D7GA 2A4QA 5EG4A 2FOEA 2LNCA 1HJ8A 2OUAA 1BTZA 2ZZUH 4IMZA 1TLDA 1A0HB 1LMWB 4X2WA 1UW7A 1A61H 3JZ1B 2WHXA 4AG1A 3MWIU 2KFWA 2Z7FE 1W0ZU 4B2AA 1KSNA 3BTWE 2BLVA 2HPQH 2VVVA 3QN7A 1B5GH 1G3BA 1ZTLA 2FX6A 3UAIC 3F9EA 2Z9KA 3WWFA 5C5NA 1O2HA 5JPMH 1P01A 4LZ4B 3SI3H 2TPIZ 4KTUA 1G2MA 3LH1A 1T4VH 3RXOA 3E91A 1WTGH 3D23A 5DN6D 3FP7E 3FKSD 4WVPE 4K69A 5LGOA 5EW2H 2FIRH 5DP4A 1BRUP 2HVXA 2W7SA 2XTTB 2NU3E 2ZGJA 3DHKH 1HAOH 3BTHE 3L33A 2OLGA 1C9TA 1TBQH 1TGBA 3SYJA 1MQ5A 2BDHA 2FESH 5GCHF 2FOFA 4Y0ZE 3PROA 2PP6A 2GDDA 1BTYA 1CGIE 1DVAH 3VGCB 4MPXA 1QBNA 1O5GH 2HWLB 1E79D 1RD3B 4X2YA 1C2FA 1FJSA 2VB0A 5T3HA 4XD7D 3KHVA 2BVRH 3G01A 7KMEH 1EPTB 1BMFD 2Y5GA 3BTFE 1C5PA 4LK4A 4DURA 2BD4A 3BTTE 2SGFE 1ANBA 3QDZB 4ZXYH 2WINI 4CR5A 2D2DA 3ZVFA 1W2KH 2ZTYA 4ABBA 3PV4A 2Y7XA 1B0EA 1XXFA 2W5EA 4FUDA 1ZPCA 2ZU3A 2Z3CA 4J1YA 2HPPH 1PYTC 2FOAA 2QN5T 3NXPA 3SUDA 1BRBE 5JBTA 2AS9A 5E0GA 3BG4C 4UFFH 4AGKA 1O5CB 2PKSC 1MKWH 1P9UA 2F3CE 1P2JA 4OGXA 3W95A 2ZU2A 1O2KA 1KTTB 1BBRE 1INCA 4BOHA 2FTMA 1ELAA 2BOKA 2A5AA 2BDYA 4VGCB 1GJ8B 4ZKOU 2UWOA 3U98H 2B0FA 2RG3A 1EOLA 1GBTA 3KQCA 1FMGA 2A2XH 1N6XA 2Y81A 1AB9B 1K1MA 1TA2A 3S9BA 3K9XB 3P92A 5J4SA 3P6ZB 3P8NA 2ZU5A 3M5NA 5LPRA 1GBHA 2FDAA 1MTSA 2TIOA 4K2YA 2ZHWH 5AFYH 1XUFA 1C5SA 2ANWA 2PGBB 5DP8A 1CBWC 2IJD1 1IQJA 3VXEH 5LPFA 5CHAC 5GXPA 3BV9B 1FIWA 4AORA 3ODDA 1AE5A 3RM2H 3N7EA 4NSVA 4ASUD 2A45B 2WPKS 2V35A 1MU6B 5F53A 8KME2 2BLOA 3MOCA 3DFLA 3RXFA 5E2OA 1HAVB 1TNGA 1O2MA 1FI8A 2ZTXA 4JZIA 5EPYA 1ZSJA 2ZQ2A 4O97A 1DFPA 2TGPZ 3LGTA 1YPMH 4YESB 5I46H 1ZJDA 1TMUH 3M5OA 2CJIA 3A85A 2PFEA 4DJZB 2R3YA 1IQFA 3KYFA 1C5RA 1QQ4A 3SJKA 5SGAE 1WBGB 1TRYA 1XVOA 2J9NA 3OSYA 2XCFA 1QZ8A 2BQ6B 3UR6A 4ZHAA 1A46H 1SQAA 2FEQH 1QQUA 1MTWA 3SV6A 3KQBA 3MO6A 1RRKA 2TGTA 1J15A 1FDPA 2W3IA 3LKWA 2G4TA 1MAXA 1IQGA 4DT7B 2O8WA 1XVMA 1KXCA 2P8OB 1C1QA 1FY1A 5JBAS 3SZNA 2BZAA 3UWJH 4B6FA 4MPUA 2OC7A 3TJNA 1OYQA 1TPAE 1JXPA 2WYJA 1Y8TA 1EFRD 1BA8B 2SGAA 1TRMA 1F5KU 3S9AA 5A09A 1ZMJA 1ZGIA 1GBLA 3UR9A 1H9HE 5L6NH 5K7RA 2GZ8A 3SI4H 2WUCA 3SGAE 2PTCE 3SV7A 2ODYB 3SU2A 1DXWA 1K2I1 1ZGVA 1SG8B 1C5UA 1WQVH 2DUCA 3CS7A 1TALA 2Z9GA 3W94A 1KLJH 4E06H 5LPEA 3BEIB 2FM2A 3GYLB 1D6RA 2UUYA 1TX7A 1JOUB 3SGQE 1AI8H 1AFQC 4P00A 4DOQA 3OYPA 5A8ZA 2OC8A 1O2UA 1S85A 3M7UA 1P02A 3T25A 1DPOA 2HALA 4ABGA 5JBCS 5ABWA 1LVOA 1U6QA 1YGCH 2ZHEH 3SJ9A 1F92A 4CH8B 6CHAC 4NA7A 1GJ9B 1YWUA 2XC4A 1PQ7A 4U01A 3UNRA 1BCUH 5EIYA 3E3TA 4Z1MD 3UFAA 3SNDA 1HAHH 2ZQ1A 4NFFA 3EYDA 1N6YA 1FY4A 1GMHG 1O38A 2ZHDA 1C2KA 3QO6A 6LPRA 2Q6FA 2XRCA 2ZDVH 9ESTA 1O3PB 1O2OA 1NZQH 1A1RA 2J98A 3FP8E 4KELA 4Y8ZA 1Y3VA 3E1XB 2J2UA 1HAYB 1YCPH 1S83A 1WDIA 1K28D 5EJ1A 1ELCA 2QC2A 1P04A 2VGCC 2A5KA 4IMQA 1BBRH 1G3EA 3TH3H 1O37A 2GZ9A 3PLKA 1BQYA 1C4V2 2G81E 4BAMB 1Y3YA 3RXGA 2XYAA 3STJA 4E7RG 1RIWC 1OWDA 2QF0A 2H9TH 3UQVA 4AFZA 3TNSA 4ACBA 2ASUB 2BTCE 1ID5H 1SGFA 1TQ0B 5L2ZH 2GZ7A 3EE0B 2VJ1A 1C1NA 1AFEH 4K8YA 4ZMAH 1PPFE 2WPMS 1NBMD 1WQSA 1O3HA 5JB8S 1MAYA 1GI9B 1SLWB 1LPKB 1HPGA 1FIZA 2CF8H 1TA6A 2HNTF 2J97A 1AKSA 5EJLA 3BTME 5C94A 1M9UA 3KQ5A 1AIXH 4DIHH 1TPSA 2PW8H 4OS5A 5A0AE 3O8RA 1O2VA 4WMFA 4CRFA 3ESTA 2IOTA 2Y5FA 4UFGH 4TY7A 1GGDC 4IW4E 2V3OH 1THPB 1HAGE 3ZIAD 4R8TB 3L3TA 2IPHA 3KL6A 3H7TA 1ZR0A 1NM6A 3EQ0H 4X8VH 2F83A 2AIPA 1CGHA 3DCLA 3BIVH 2WPHS 1BRCE 4INKA 5EXMA 1P06A 2FOCA 1C5NH 4NGAH 1GG6B 4XFQA 4F48B 4TT3D 4K1SA 1C1MA 1MH0A 1P57B 1O5BB 1K1OA 2A2QH 2CMYA 2CHAB 4MTBA 1SVPA 1BTUA 2H9EH 1GJCB 2EC9H 3D65E 3LGUA 4HG6A 2FYQA 3MNXA 5GDSH 3RXKA 3ATMA 2AMDA 1GJ7B 3TGJE 2BD9A 3NWUA 3U8OH 2F9PA 1V2QT 2C8ZB 5EXLA 3FN8A 1BMMH 1V2RT 1E1RD 3OEHD 8GCHG 3A82A 3SZEA 1DDJA 4AG2A 4FUFA 1LPGB 4ZROA 2F9VA 2A7HA 1SGYE 4GLYA 4K1EA 5E8EH 1NC6A 1EP6A 4BTUB 1WTHD 1A3BH 3F2FA 4JZFH 3UTUH 1KIGH 3TGIE 3GS9A 2RA3A 1ZLRA 2FODA 3PWBA 3GY4A 2SNWA 2D8WA 2FOBA 1OWHA 1O2NA 4Z6AH 3TJUA 2OINA 1MD7A 2AGGX 5AF9H 1DY9A 3RDZA 1NRPH 2NWNA 3UIRA 4CREA 3A8DA 5FCRA 3FO8D 1CA0B 3HATH 4CRBA 1PQ8A 2FXRA 2P93A 1TWXB 4JCNA 4DCDA 3F0OA 1B7XB 1P9SA 2J95A 1IHSH 2C8XB 3A80A 5B6LA 3SJIA 1P2KA 3N99A 4I31A 2A4OA 4MNYA 1K22H 4I8HA 1ZMNA 3SUFA 1BIOA 3S9CA 1UTJA 2AGEX 5DP7A 2H2ZA 3BTQE 2NU2E 2H9HA 5IYTA 4B2CA 1OWJA 1ACBE 1ANDA 2ALVA 3ZZ8A 3A83A 1KXFA 1ZSKA 1P3CA 5KECA 1ELVA 2O8LA 3F3BA 2ZHFH 2FS8A 1RTLA 2LPRA 1BT7A 3F6UH 1IQEA 4YZUA 3LGWA 1G37A 2HGTH 2A7JA 1W11U 3Q3XA 3VB7A 2GX4A 1TPPA 1TOMH 4RT1A 3ZZAA 2CF9H 3K6YA 1QTFA 4MNWA 3RUOA 4Y76A 2VIOA 3MMGA 3LPRA 1FY3A 2QY0B 3SO3A 2XWAA 5HYOA 1UVSH 1JIRA 3H09A 8GCHF 2A31A 2C93B 4A92A 2OD3B 2P3UB 3KEEA 3T26A 5K0HA 1C1WH 4D9QA 4NSYA 3ELAH 4ABEA 4DW2U 3KIDU 3CP7A 3VB3A 1PPBH 2H5CA 3I77A 5EXNA 4BAQB 1PPGE 4KTCA 2P95A 2XBXA 1HRTH 3TIUA 4BAHB 4VGCC 1S5SA 2Z9LA 3PRBA 1CE5A 2AFQB 3BTKE 3LGIA 1AB9C 2IPQX 2WPIS 1TNKA 1UTLM 3PMJA 2BLWA 3MHWU 1MKXK 4I32A 1YPEH 1EQ9A 1BMLA 3M37A 3MO3A 4B74A 3I29A 1YBWA 2ILNA 3HK6B 4ISNA 1TGTA 1QA0A 2UWPA 2FI4E 2VVUA 1MZDA 1O5EH 3BEUA 1V2JT 4SGBE 1O5AB 4BXWA 4X1PU 2YOLA 4FOUC 3RMOH 3SV2H 3ZZ5A 2ESTE 4UD9H 5IDKA 3VG8A 2ZP0H 1AE8H 3Q77A 1O3JA 2M5TA 3LDXH 1Q2WA 3URCA 1V2VT 3SQEE 1LKBA 1NRNH 1GHYH 1EB1H 4NIVA 2JIZD 5T6DA 1AVXA 1AGJA 3SHCH 1VCPA 1AVGH 2L74A 3U1IB 1OWKA 3VXFH 1SSXA 2FYRA 2HOBA 1W7XH 1LKAA 1FPHH 1O3MA 1V2PT 4M7GA 3AW0A 4YT7H 1H8HD 1E38B 1ETRH 3SN8A 1SGPE 4OS2A 3VPKA 5CMXH 1HXFH 2O8MA 3RXTA 3MO9A 4QT8C 3B8JA 1NTPA 1H9LB 1MQ6A 2L6OA 1TE0A 1T8OA 4H4FA 4NWKA 4JK6A 3H5CB 4YOIA 2HLDD 3KQEA 2VH6A 5PTPA 3TU7H 4FU8A 3ZVGA 1YPJH 3B23B 1SC8U 1UTQA 1K0HA 1AD8H 3UOPA
chains in the Genus database with same CATH topology
2P8OC 4WWYA 1YLCA 3UREA 1SL3A 1Z6EA 2GD4B 4IC6A 3EAJA 1L1JA 2Y5HA 1HAVA 1O2LA 5TCAA 5TJXA 1QB9A 3NUMA 4ZKRU 3S69A 1O5DH 4FUCA 3RXRA 1G32B 2WUBA 3ZVDA 4MVNA 1GCDA 1O30A 3GY2A 4A7IB 2Y80A 3SV8A 2G5NA 2G4UA 1ELGA 2R0LA 4U32A 1BTPA 3TH2H 2VIVA 4NCYA 3RXUA 3PLBA 4Y7AA 3ITIA 1C2GA 4UONA 3QZQA 2GMTC 1O35A 1CVWH 4U30A 4X8UH 3U8TH 1ZTKA 2EI8A 2NU4E 1E36B 5EW1H 5DPAA 1AO5A 1DT2A 1GI3A 5FXLA 2AEIH 4MNVA 1G36A 3DT0H 1K9OE 1MUEB 1S0QA 1DOJA 4GPGA 3UWIA 1UK2A 1HB0B 1WYKA 1DITH 3BEFB 2OQUA 2P59A 4GSOA 2OBQA 1SGIB 1GBKA 2VVCA 2Z94A 2ZG0H 4AGJA 1Z7KA 2C90B 4Q80A 2ZDNA 2ZHQH 1CHGA 2CXVA 1HFDA 1A0LA 1O3LA 1TBZH 1SHYA 2BD3A 1VJAU 4DVAU 1F0TA 1BHXF 3N7OA 1SOTA 1KY9A 5EU8A 1C1RA 1EZXC 2Q1JA 3NKKA 2G55A 5JBBS 2ZFQH 2BD7A 2QGRA 1FNIA 1SGNE 5DP9A 1BJVA 2C8YB 1G30B 1LHDH 3BN9A 2ZPRA 2PGQB 1QRXA 3PYHA 2FS9A 5JYIA 1O3KA 3O8CA 3GY5A 4MPWA 1OWIA 1SQTA 1YPHC 5H4IB 4YOGA 1C5TA 1GJBB 2BY8X 1G3CA 1VITH 2BVSH 3BSQA 1AMHA 2SGPE 2FOHA 4JZDH 3RU4T 1HIAA 3RXQA 1SFQB 1S84A 4Y0YE 2CN0H 2RDLA 3MNCA 2EI6A 3TJVA 2AERH 2R0KA 5C5OA 2BD8A 2OXSA 2BDAA 2A1DB 3RXBA 2FMJA 4CHAB 2I6SA 5A2MH 3GDUA 2XC5A 1G9IE 2ODQA 3BF6H 1JMOH 1TIOA 4JYTA 1EAUA 5HMAA 2BB4A 4ABHA 4BANB 4INHA 1C5OH 3M7QA 2BY7X 1QCPA 1K1IA 2ZGHA 1DUAA 1SGQE 3KCGH 1TYNA 1KLTA 1EJAA 2A4RA 1VGCB 2FP7B 2WV5A 3M3SA 2A5IA 1ZZZA 4IBLH 1P2QA 2P94A 2XBYA 3MH6A 3HKJB 2G5VA 2C8WB 5B6OA 2BXTH 3IG6B 1D3DB 1J16A 1NY22 4KKDA 2BZ6H 1FZZA 1AWHB 1XUGA 1BHXB 2GT7A 1QL7A 2W3KA 2D26C 4KP0A 2ANMH 1H4WA 4OS4A 1QB6A 1UCYH 1NFWA 3A8BA 3GCTG 3PTBA 3DD2H 5DP6A 1HCGA 2JH0D 1OWEA 1XKAC 2CHAC 4ZHMU 4D7FA 5C20A 1EXFA 1VITG 1W0YH 2F9OA 3SU0A 1OP2A 1THRH 4GCHG 1CGJE 4IS5A 3U9AH 5J4QA 4X6MA 2PWXA 4JZ1A 1QY6A 1TQ7B 3SNBA 1KDQA 3ATWA 4MPVA 1UO6A 2IJOB 4UFDH 1FN8A 2O8UA 4AZ2B 1LVBA 4ABAA 1NT1A 4NFEA 1QGFA 1SMFE 3E0PB 1C5WB 3RC6A 1O2ZA 4NA9H 3E16B 2DE8A 1O0DH 1P0SH 1F5LA 1E0FD 3RXMA 1X7AC 2HNTC 4IC5A 1AN1E 1LCYA 1OOKB 2EI7A 4NG9H 4XDEA 2J94A 4B75A 2XBWA 2ZU1A 1LPZB 2ZNKH 3UPEA 4Q7XA 3LIWA 4DY7B 1MTNB 3RXJA 2V3HH 4GUXA 4JK5A 1CSOE 3FVFB 1N1LA 4FUHA 1VZQH 1CA0C 4CBOA 1FLEE 4CRGA 2XBVA 3GISB 2C4FH 2ZDLA 5FX6A 1O2IA 1C5QA 1GBCA 4ISHH 1H1BA 3IWMA 4AB8A 1C1TA 2STBE 4NWLA 1XUHA 1EAWA 1Y3UA 1OP0A 3RU4E 1T8LA 2OC0A 3GCTF 1QBVH 2G00A 4WH8A 5AVDA 3BTGE 5HM9A 1C1PA 1N8OC 1CO7E 2ZA5A 1SI5H 2ZDAH 1YCPM 1P11E 1V2KT 4KTSA 4WXVA 1UHBB 4HTCH 1DXPA 1SB1H 1PFXC 1SLXB 2ZWLH 3EA8A 1WSSH 4GCHF 1P2NA 1S82A 1O5FH 2ALPA 4ASHA 1AY6H 2TRMA 1C5MD 1D3TB 1BTXA 2HLCA 1P2IA 1VCWA 1SLUB 2ZCHP 2B8OH 1O32A 1MKWK 1IQIA 3HK3B 1V2UT 1BJUA 2JETB 2Y82A 4ABJA 2YNAA 2BQ7B 3P8OA 4GHQA 3BG4B 3AVZA 4Z0KA 2PKSB 5DO4H 1AZ8A 2BDGA 2BMGB 5GIBA 1EAXA 1MD8A 3LU9B 1ZHMA 1ZOMA 1ELFA 2BYAX 1XKBC 4FUBA 3GDVA 4RKOB 4R0IA 1JRSA 1P2MA 3PWCA 1OPHB 4FUEA 1ABIH 1C2LA 5AFZH 2PSYA 2PTNA 1ZSLA 1O3CA 4FXGH 3PO1B 3U8RH 3LC3A 2ZCKP 3SORA 1BMAA 1D9IA 1F7ZA 2NU0E 2GV7A 2GT8A 2ODPA 1GJDB 4YM9A 2VINA 3M36A 4YLUA 1Y59T 1CBWB 2Z6BD 3T5FH 1V2ST 3V0XA 3VB4A 5EQQA 1SGRE 1SPJA 2GP9B 1AU8A 2H5DA 1UJ1A 1O2XA 3S0NA 1GMHF 1S6HA 2JH5D 2ZGXH 2PKAA 1YPGH 1S0RA 7GCHG 1UTKA 1C1SA 3A86A 3E90B 1DSTA 5CE1A 4O3UA 2BHGA 4ZXXH 3A8CA 3MU8A 2ANKH 2UUJB 3TK6A 3ATKA 2JH6D 1QA7A 1XXDA 3AAUA 3MI4A 1GHVH 2OCVB 3FZZA 3ZV9A 1ELTA 2AYWA 1GI5A 8LPRA 3MH4A 4CBNA 3CENA 4AFSA 1YPKH 1HUTH 2UWLA 2OBOA 2K1QA 2ZO3H 1A3EH 1TX8A 3SOSA 4FUIA 1TABE 1O2GH 4UFEH 5EQSA 1EASA 3SU6A 1P2OA 4E7NA 1XUKA 1XX9A 1GBIA 1YP9A 1AZZA 4A1XA 1WCZA 2R9PA 4ESTE 3TK9A 4GHTA 4Y8XA 4F49A 2TGAA 3ZVAA 1HDTH 1QL9A 3KN2A 1MMJN 1GI8B 3ATIA 1DUEA 1V2WT 3OU0A 5C1XA 1FAKH 5ETXA 2ZCLP 5T6GA 2NU1E 3Q3YA 3STIA 3SW2B 1LQEA 2C3SA 1GWAA 1A7SA 1GBMA 1V2TT 1H9IE 1O2YA 3LJJA 1O3GA 1FQ3A 1ELBA 2FLBH 5DKMA 2ZC9H 3QK1A 1XM1A 2ZF0H 4ISOA 2ZDMA 1NFYA 1C1OA 3VGCC 3FZDA 7GCHF 1GBDA 1TNLA 1GBBA 1EATA 1UK3A 1PJPA 1EPTC 1K1PA 6CHAB 1PQAA 3K65B 1JIMA 4WMEA 5C1UA 3MH5A 3GDSA 5T6FA 3LJOA 4F4OC 4IN1A 3TH4H 3TJOA 1D3PB 3UUZA 3KQDA 1WOFA 2RCEA 1EUFA 2V6NA 1FY5A 3ZZ6A 2R2WU 1FPCH 3GY6A 4AYYB 3TPIZ 1C4Y2 1ANEA 1GHBG 1MBQA 1YCPK 3HGPA 4TYDA 2PV9B 1TONA 2UUFB 1J8AA 2A7CA 3QLPH 4A1VA 2OQ5A 2VH0A 4ZUHA 4ABIA 3Q76A 1TGNA 1NRQH 1BBRK 1NROH 1IQNA 1KTSB 4X1SU 1EZUC 3FFGA 3GOVB 3GYMA 2FO9A 2VGCB 1DLEA 3KF2A 1AUJA 1D6WA 1MZAA 3E8LA 2WPLS 3QGJA 1EPTA 4DIIH 3LOXA 1IHTH 4FU7A 3RLWH 2P3TB 4UE7H 1RIWB 2G52A 1HAXB 2ZPSA 4NA8A 4D9RA 1YPLH 5AHGH 3VB5A 4CHAC 4CR9A 1FAXA 1ESBA 3SU5A 1GJ6A 1AWFH 3QGNB 2VIPA 5GJ4B 4ZAEA 1BOQA 3ZVBA 2BDIA 1Z8RA 2QIQA 1T31A 1ETTH 1NU9A 1VR1H 1HXEH 4TPYA 1ZTJA 1ZHRA 2BXUH 3A88A 3K2UA 2ANYA 3OTJE 1VGCC 2QCYA 1C4U2 3RMMH 1GL1A 3CS0A 2ZKSA 2DE9A 1O34A 1TGCA 4UEHH 3MU5A 3MH7A 4ABDA 3A7WA 3LONA 4FUGA 1QIXB 3GY8A 1WUNH 1XMNB 2BQWB 7ESTE 3MU4A 3RXVA 3U69H 1C5LH 1GDUA 1C5ZB 1RGQA 2BY6X 4HGCA 4AFUA 3A89A 4YT6H 1EP5A 1GJ4H 1Y5UT 1WAYB 2V0BA 3TGKE 3VEQB 2O8TA 2EEKA 4B1TA 1UVOA 4NIYA 1UCYE 1GHBF 4D8NA 3F9FA 1THSH 1F0UA 2PLXA 2GCTB 1MTUA 1GCTB 1S6FA 3ZZ4A 2QV1A 1HLTH 1SGDE 1SGTA 1O2JA 2PUQH 3SUGA 2WV4A 3A7XA 1G2LA 1NFXA 3L6PA 4X0WU 1EJNA 1GI6A 2ZECA 1L4DA 2RA0A 1LHFH 1QJ6B 4LZ1H 5A8YA 2TGDA 4RSPA 1K1JA 2ZFRH 1KXEA 1Y3WA 4XBDA 3BTDE 1ZPZA 1LDTT 4O03A 3A84A 5C67A 3I78A 1HGTH 1H8DH 3SGBE 2QXGA 4Y6DA 1ELDE 3P95A 3S7KB 4JYUH 1GJAB 2STAE 1F5RA 3PTNA 3VFEA 3SU1A 1YF4A 1W13U 1C1VH 1V6DA 4X2VA 2OP9A 3O8BA 2FOMB 4Y10E 4X1QU 3SJ8A 3EA9A 4BXSA 4X2XA 1MTNC 1C5YB 4Y7BA 4X6PA 1NESE 3SJOA 1OS8A 1TFXA 4OGYA 2XCNA 1AUTC 2ZIQH 1W3CA 4MQAA 5I25A 1GI7B 5C1YA 1DWBH 3ZYDA 5F8ZA 4J2YB 1O2SA 1W14U 1NFUA 4BAOB 1GDQA 3TK5A 1W12U 3ODFA 3QTOH 3RM0H 4XBCA 1EAIA 5DP5A 1EZSC 2ZPQA 5E2PA 3A7YA 2B9LA 1BUIA 1C9PA 1O3NA 1P03A 1OSSA 1TNIA 5ESBA 4O3TA 4ZKNU 4Y11E 3RC4A 4FUJA 1UTNA 3D62A 3NCLA 4X8SH 2P16A 1IQHA 5HM2A 4BAKB 1UMAH 3T62A 1Z8JB 4O9VA 3BTEE 2GVFA 4YLQH 4XBBA 1C2IA 4U2WA 2FOGA 1Q3XA 2BVXH 1O3FA 2OC1A 3V7TA 3MNSA 1K21H 2PR3A 2W26A 2BX3A 5F8TA 1Z1JA 3RXEA 2B7DH 2ZGCA 3SNAA 5EOKA 1CT0E 4XOJA 2XC0A 1HV7A 2D1JA 3OY5U 1EJMA 2SGQE 4YTAA 3F9HA 2JETC 4WJG2 4Y8YA 1Y5BT 1O3DA 3UQOA 3RLYH 1DWCH 5FCKA 1F2SE 2ZDKA 2QXHA 1RJXB 5DK1A 1GI2A 4X1RU 1K1LA 2GV6A 4K5ZA 2HRVA 2ZFTA 2FWWA 1C2MA 1BMNH 1GBAA 4DG4A 5BRRE 1E37B 1GI4A 1PPZA 1K1NA 1O31A 1UHBA 2KAIB 3RXDA 4K1TA 3P8GA 1D4PB 1NRSH 4OS7A 1QNJA 1GI1A 2QA9E 5L30H 2ZFSA 3PMAB 4RN6A 1RTKA 4X6OA 1TMTH 1GDNA 3UNSA 1Y3XA 3D49H 3PO1C 3MTYA 1P10A 3LH3A 5GPIB 1ESTA 1O3AA 1QJ1B 2BDCA 4B71A 1BITA 4X1NU 1VCQA 3FAOA 1WV7H 1W10U 2A0QB 3M5MA 1LTOA 4UDWH 6ESTA 3HGNA 2CGAA 3HPTB 4XSKU 3ZZ7A 1HJAB 1O3BA 2TBSA 1L2EA 1V2NT 3SBKA 5FPSA 3RMNH 2J34A 3V12A 3RXAA 2EA3A 2Z9IA 5FBEA 1FUJA 1FXYA 4ABFA 4AN7A 4HZHA 1AHTH 1Z8IB 1RFNA 3PMHB 1GG6C 3R0FA 1A5HA 2W7UA 1GHXH 2B5TB 1DSUA 4A1TA 3ZV8A 1ZRBA 4AX9H 2ZGBH 3RXLA 1ETSH 5ESTE 5JDUB 1QURH 2XNIA 4K8BA 5HXFA 3TVJB 3GCHB 3NK8A 3A81A 2F9NA 3AASA 4CRDA 8ESTE 4PROA 1LHCH 3Q3KA 1S81A 1EKBB 5A8XA 3R3GB 2GCHG 4FVDA 4IN2A 1Z6JH 3M61U 2F9UA 2ZU4A 1C2DA 2BDBA 1UTPA 1WU1A 3RP2A 1DLKB 3MU0A 2Y6TA 1GBJA 2WPJS 1GBEA 1CT2E 2F91A 3FP6E 5LH8A 3A7VA 1MCVA 1ZJKA 4ZHLU 1EB2A 1TGSZ 1EOJA 5G4BA 1FV9A 1Z71A 2PHBA 2BOHB 1BB0B 1OYTH 1JRTA 2AMPA 4Y79A 1KYNA 5FBIA 4THNH 3EDXB 4SGAE 3JZ2B 1PPCE 4WY3A 1GHAG 2G51A 3T2NA 2Q6DA 2QXIA 1W8BH 1HAPH 1DY8A 1GL0E 4I8JA 1RXPA 4K60A 1L4ZA 1O3OA 3ZZBA 5A0BA 5JB9S 3BIUH 3UOUA 1L1NA 3KGPA 2GMTB 1CHOG 1NO9H 1GJ5H 2VU8E 2AIQA 2H6MA 1EX3A 5DGJA 1ORFA 3RXIA 1C2HA 1H8IH 2F9BH 1C2EA 1LHEH 1T8NA 3GY3A 4I8GA 3OY6U 2Z3DA 1YYY1 1TMBH 1MU8B 3SNCA 1KLIH 1ANCA 4FVBA 1ZYOA 4XE4A 5EQRA 1JBUH 1SFIA 1TNJA 1VITF 4AOQA 1UTMA 3E0NB 1HIAB 4JYVH 5EODA 1LVYA 4TY6A 1SBWA 1BTWA 1A4WH 2GCHF 1PPEE 2A4GA 4BNRA 1T8MA 3PMBB 3T29A 3HKIB 1ELEE 2PSXA 1YM0A 1V2LT 1SGFG 1V2MT 3GCOA 3SNEA 1CQQA 1OXGA 4ISLA 3MYWA 3S7HB 2J4IA 4HI3A 1TRNA 1ZPBA 1P05A 1GVLA 4E05H 1TOCB 5HGGA 2FPZA 4X8TH 3ZZDA 5TCCA 4AYVB 1FY8E 1HAZB 1ESAA 4B76A 1GHAF 3AAVA 3Q00A 3QWCH 3F1SB 4WXIA 2JKHA 1RS0A 3NPSA 5FX5A 1SQOA 5BPEA 2XXLA 1P12E 2THFB 2FI5E 5F6MA 1F0RA 3ENSB 2QYIA 2IN2A 5E0HA 1CHOF 1YLDA