4ZKSU

The crystal structure of upain-1-w3a in complex with inactive upa (upa-s195a) at ph7.4
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
246
structure length
246
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDAGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title The crystal structure of mupain-1-IG in complex with murinised human uPA at pH7.4
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 58
structure length 246
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2015-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4zksU02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4zksU01
1GJCB 1GCDA 4DIIH 1QL9A 5DP9A 1HJAC 4YM9A 4Y11E 2J4IA 1YPMH 5EGMA 2BVSH 1BMNH 3HATH 5E8EH 1H4WA 3EE0B 2XC4A 2ZGBH 1DM4B 3T27A 4AGKA 1C5RA 2F9UA 2BLQA 1YPGH 1C5YB 1MCTA 2B0FA 1WTGH 4DIHH 1BA8B 1DDJA 3S9BA 2JH5D 3O8CA 2RG3A 1BBRE 2OC8A 2VVCA 3GY2A 1UVSH 2AGIX 3MOCA 1PPCE 4D9QA 4MNYA 2GCHG 1ABIH 5TJXA 4BTIB 5EPNA 2WV4A 3ZZAA 4SGAE 2QYIA 3A85A 3SU0A 1DFPA 1MU8B 2Y5HA 3TJNA 3VB4A 3TK6A 1XUKA 1NO9H 1AKSB 3SHCH 5DPAA 2HGTH 1Y3YA 2TGTA 1UTQA 5F03A 1D3TB 3NCLA 2RCEA 3E8LA 1UCYK 2FTMA 2ZZUH 6GCHF 2VWOA 3KQEA 4IW4E 2PFEA 1LDTT 2ZTZA 4AGJA 3SNCA 4B2CA 2CXVA 4AG2A 1C9TA 1AKSA 1O32A 2TRMA 2AERH 3AAUA 2YNAA 4Z0KA 3RLYH 2QV1A 4IC6A 3MU0A 3M37A 4JZ1A 1AI8H 2F3CE 3SV6A 4X8UH 3PMHB 4GVUA 1NRNH 3BTKE 3ZYDA 1AU8A 4ZROA 1W0YH 1O30A 5CHAB 1WQSA 1MKXH 4DJZB 2P95A 1FY4A 5BRRE 1THSH 2PKAA 9ESTA 1C1NA 1D6RA 1CHGA 5T6DA 1G37A 3PO1B 4ZKSU 2ZWLH 2F9NA 3BIUH 4K69A 5A8YA 4BXWA 4FUCA 2F9BH 3A7WA 3GY6A 2C93B 3JZ2B 3LOXA 3ZZ7A 4XBCA 1C4U2 3KQBA 1XVMA 1BRCE 4Y10E 1FPHH 3A84A 3ATIA 5J4SA 3NUMA 1PQ7A 2WYGA 4CRDA 4KGAA 2OUAA 1EX3A 1ZOMA 4ZHLU 1BMAA 2UWLA 1GI9B 4ISHH 2O8WA 5C1UA 1C5LH 1T8LA 2H9EH 5GPIB 1TNGA 4HFPB 1QJ7B 1ZMJA 2IJOB 1SB1H 3TNSA 1ZJDA 2Z3CA 3HK3B 2OINA 1OWDA 1NRRH 1C1PA 1DICA 1SGCA 1ESTA 1KXFA 2SGDE 1K1PA 2KAIA 5FCRA 1IHTH 1ZPCA 1QY6A 1SPJA 2FLRH 2Q6DA 1BZXE 2BVRH 2Z3DA 4O03A 1SGYE 1P2QA 1ZSJA 3ODFA 4FU7A 1ELCA 2VIWA 4B2BA 1O2OA 1O3DA 2FWWA 1T4VH 3ZVBA 5JPMH 2XYAA 1ANCA 3SV7A 1SFIA 2BDCA 4WJG2 1MTNC 3BIVH 2THFB 2C90B 1FAXA 4D76A 3SUEA 1ELFA 1QFKH 1GJAB 4K1EA 3ZVEA 3B8JA 3DFLA 1K1JA 4JCNA 1ZZZA 4GCHF 3RXLA 4XSKU 2ZGCA 2GV6A 4A92A 1J9CH 2J9NA 2Z3EA 3GDSA 4ZUHA 2LNCA 1OWEA 1BTZA 3LGVA 1O2QA 3GCNA 3ZZ9A 3BN9A 1AD8H 3RXFA 1CE5A 2ZO3H 6GCHG 2BQWB 1CBWB 5EXMA 1ELVA 1MCVA 3P8NA 3BG4C 4KTUA 4INHA 3O8DA 1SGEE 1P8VC 5A8ZA 1F5KU 3SUDA 1MKXK 3RP2A 2ODYB 2FOAA 2QXJA 4E7RG 3PMBB 1THRH 1P05A 1H9IE 3ZVFA 1AWFH 2P3UB 2B5TB 3D23A 3Q3XA 1GVZA 1AHTH 1O2YA 3UR9A 3UUZA 2AGGX 2G51A 3B23B 1SGIB 1GI5A 1NRQH 2FOMB 3OX7U 1TNLA 1DANH 1O2NA 2QAAA 5DP3A 1P2KA 2AEIH 3SUGA 3F9FA 1MTVA 2Z6BD 2VB0A 2XTTB 2JETC 2QF0A 3AASA 1D3DB 2ZU2A 3SNEA 3RLWH 4NFFA 3P92A 1ZJKA 4OS2A 2XBVA 3GCTG 3ZZ5A 2G4TA 3D62A 2Y6TA 1O5DH 1KY9A 1GHZA 1K1MA 3VB3A 2OXSA 3QLPH 1BTXA 1XXDA 1YPEH 2PSXA 3K6YA 3KCGH 1AO5A 1PQ5A 1O3IA 1YPHC 3A86A 1GHYH 2EI8A 2H1UA 1DLEA 1RS0A 2FOCA 2G5NA 1EXFA 1D4PB 2A4RA 4FUEA 2Z9KA 4HTCH 2I6QA 4D9RA 2AIPA 1BTPA 2WUBA 4AZ2B 4BXSA 1TIOA 3HKIB 3C1KA 2J2UA 2RDLA 4MG3A 2SFAA 2FZZA 1H1BA 5EW1H 4ZHMU 1HV7A 4Y79A 1Z71A 2F9OA 4I8GA 2HPQH 3TGJE 4YT7H 5L30H 1VJAU 4CH8B 1GBKA 1V2VT 1Q3XA 2ZGXH 2EI7A 1X7AC 3SJ9A 3A7VA 3TGIE 3GY7A 1S6HA 2AH4X 3SOSA 3TJUA 2H6MA 2W7SA 1NESE 1W14U 5FBIA 4FU9A 1SGFG 1V2WT 2A45B 2SGPE 3MH6A 1ANDA 1SSXA 2HRVA 4Y71A 3SNBA 2ZIQH 3ZZDA 4DY7B 1O3GA 2QC2A 3E3TA 3S0NA 2OTVA 3UTUH 1RTFB 2C8ZB 1A4WH 1FN8A 2QXGA 1C1SA 1W13U 2ZGHA 2QY0B 3EYDA 3FP8E 2BXUH 1QR3E 1TE0A 3QUMP 2XXLA 1O3OA 5E2PA 5EODA 1T32A 3MO9A 3RU4T 3QTVH 1XVOA 5HYOA 1DUAA 2ZG0H 4GCHG 3RXEA 1ANBA 1DXWA 4O97A 3MO6A 1H8IH 3RUOA 1C2FA 1C1WH 4K8BA 3A7XA 1Y5AT 2C3SA 3KIDU 2FS8A 3TJOA 3M5LA 3MWIU 1GL1A 1UTMA 2R0LA 5I46H 2B9LA 3IG6B 3PTNA 4X6OA 1ZLRA 1FJSA 3ZVCA 1HJAB 4I8KA 4IN1A 5T6FA 3TPIZ 3UQOA 2VIQA 1HAGE 4FUHA 5CMXH 1C9PA 4MNWA 1TGSZ 1O3AA 2BD5A 3BEIB 2NWNA 2XW9A 1YYY1 1TGTA 2JH6D 1HAHH 2CMYA 5TCAA 1O36A 4YLQH 2BD7A 4CHAB 1P2IA 3V0XA 4DVAU 3DD2H 6ESTA 1KLTA 5H4IB 1DWBH 2QN5T 1BITA 1HJ9A 1O39A 5B6OA 4U30A 3RXGA 1ZMLA 1NN6A 2GP9B 2FX4A 3FZZA 3OSYA 4LK4A 4RN6A 3QK1A 1P10A 5PTPA 8KME2 1UTJA 3MNCA 2FP7B 3BTEE 1VITF 1G3CA 3ZYEA 2A2XH 4OS1A 1ELTA 2ZI2H 3HKJB 1ZMNA 1IQKA 1TALA 1PPEE 5F8ZA 1Z1IA 2BXTH 5DP4A 2ZU5A 3O8RA 1C5PA 1AWHB 3A88A 1FMGA 5I25A 2STAE 3UR6A 1GCTB 5LH8A 1KTTB 2Y81A 3L6PA 1P3CA 1XMNB 4X1NU 1O5AB 1BOQA 4THNH 2BD9A 2R0KA 1EAWA 2VH0A 3ODDA 4YOJA 3SZNA 2ALVA 4DT7B 3RC4A 1YLCA 1NT1A 1HAIH 1C5UA 1HCGA 4U01A 2F91A 4OS7A 1GDQA 1P9SA 1Z8IB 1BMMH 2AMQA 1Y3UA 2D26C 5FHTA 3URCA 3RXSA 2VWNA 3RXAA 2ANYA 2A5IA 1C4Y2 3SJKA 3VEQB 3MNSA 1BRUP 3EA7A 4AFUA 1OWKA 1TA6A 4WVPE 1FI8A 1M9UA 1NC6A 1HXFH 1PYTC 1GWAA 3MNBA 3MU5A 2FM2A 1F5RA 4XOJA 4GHQA 2PGBB 1PPHE 4B2AA 2PKSC 2FX6A 1A7SA 1ZTLA 1SGPE 3P95A 4CH2B 2C8WB 1O5BB 1MAXA 3P6ZB 1T8OA 3EDXB 1TX6A 1O31A 3P8FA 4JZIA 4B73A 2RA0A 1QL7A 3PLBA 1TPAE 1RTLA 1CU1A 1PFXC 1WV7H 2ANKH 4KTCA 1S85A 2YOLA 1TWXB 1JIMA 1YPJH 2OC7A 1YPKH 3GYMA 5C5OA 1P57B 1V3XA 4QT8C 4PROA 4O3UA 2GT7A 4FUDA 1W3CA 1OP0A 4IMQA 3M61U 2A7HA 3PMAB 1AFEH 1RGQA 2Y7XA 3RMLH 3SNDA 2WPIS 4A1XA 1FN6A 1GJBB 5DKMA 4NIXA 1TMTH 4BAMB 1TGBA 4KTSA 3GY4A 3P17H 5DK1A 1V2JT 3SJOA 1HRTH 2BDAA 1GMDF 4CRCA 5IDKA 4K3JA 2A31A 1K28D 1P2NA 1FQ3A 5FXLA 3FP7E 1Z8JB 4H6TA 1QTFA 4ISOA 3O8BA 4KKDA 1CGJE 1V2RT 2TBSA 4A1VA 4WF8A 1THPB 3RM0H 1A46H 2XWBI 4AFZA 1MTNB 2ZHWH 1EP5A 1V2UT 3C27B 1S0RA 4ISNA 2PTCE 1E36B 2F9PA 4RKJB 1ZHRA 2GKVE 1IQIA 1GDNA 4H6SB 1GPZA 1V6DA 3ZZ6A 1LVBA 2WPJS 3A80A 4NWLA 2P8OC 1QB1A 2GGVB 1JIRA 1HJ8A 1C5XB 1IQMA 1Q31A 2HVXA 1GL0E 3E16B 5A0BA 1Y59T 4K1SA 2W5EA 3BG4B 3BTQE 1WSSH 4MLFB 4XBDA 1VCQA 1HAXB 5EPYA 1TPOA 3ZZ4A 2WV5A 4BTTB 1FDPA 1K22H 4ISLA 2SGAA 2Q6GA 1OPHB 2Y80A 2DE8A 4CBNA 5C67A 4A6LA 2XRCA 4HGCA 2Z94A 4E06H 4E05H 3LKWA 1TNKA 2FOEA 2NU0E 1S82A 3M7UA 1KIGH 8ESTE 1O0DH 2PW8H 3U1IB 1AY6H 1TBZH 3PMJA 2ALPA 5ESBA 1C1VH 2FESH 2UUYA 3FP6E 5A0CA 1A5IA 4WMFA 1C2KA 2HWLB 3EGKH 4DW2U 4NWKA 1GGDB 2JETB 2NU3E 2J38A 2BDHA 3JZ1B 3RXTA 1UK4A 1OOKB 3ZV9A 1TNIA 1AFQC 3GDUA 5T6GA 2ZQ2A 1ZRKA 4NZQA 4ASHA 1BCUH 2BQ6B 1Z7KA 1G36A 1V2KT 1ELGA 1LKAA 2NU1E 3SU2A 5LPFA 1QA7A 1C5TA 3LT3A 4WWYA 2BTCE 3A8DA 6CHAB 2GCTC 4ABFA 4O3TA 1EPTB 4R0IA 2RA3A 3F9EA 1ZTKA 3CP7A 3SORA 4Q7YA 2H9HA 3FANA 1HIAB 1PPBH 1YKTA 3SU5A 1XUJA 5SGAE 4GPGA 1ARCA 2HNTC 5HXFA 1TRYA 1O3FA 4A7IB 3V3MA 1GVKB 4RSPA 3EA8A 4Y0YE 3TIUA 2YNBA 1DPOA 2WPKS 1NU9A 3AW0A 3D49H 2FTLE 4GHTA 4AB8A 1HB0B 3LIWA 1EPTA 1LVOA 4F49A 2C8XB 5FPTA 1J14A 5F8XA 1BBRH 1CGHA 4J1YA 5DO4H 4I7YH 1TQ0B 5A0AE 5LPEA 1TQ7B 8LPRA 1HIAA 8GCHF 5A2MH 2O8LA 4Y6DA 3T28A 4MPXA 4NZLA 1P0SH 1H8DH 1NFUA 2BX3A 4I8LA 1MAYA 5GCHF 2P16A 1SHYA 1VCPA 4MNXA 1V2QT 1L1JA 1PPZA 5G4BA 2AYWA 1S5SA 5C1YA 2BZ6H 1CQQA 3KEEA 5J4QA 3RXRA 1QIXB 3UNRA 1NFXA 4RKOB 3V13A 1FY8E 2J95A 1MQ6A 1G9IE 4OS5A 3RMOH 3IITA 1UTLM 2A4QA 2ULLA 2WPHS 3WY8A 2ZTYA 5E2OA 4X2XA 3LJOA 2D8WA 2ZCHP 4K2YA 1BHXB 4FUIA 4NA8A 2SNWA 1P02A 1RIWC 9LPRA 1Y5UT 2DUCA 1JXPA 3FFGA 4Y8YA 4NA7A 3OYPA 1TFXA 1A61H 3TITA 4FVBA 2ZPSA 1C1QA 1DITH 3SU6A 5C1XA 1FNIA 1N1LA 4FUJA 1VR1H 3A81A 1J16A 1ETTH 2P94A 2ZU4A 4MNVA 3NZIA 4GLYA 3BTGE 4B1TA 2PWXA 3A7YA 1SQTA 4B75A 2BLOA 2XBXA 1GJ7B 2PV9B 4X8TH 1ZHMA 2AGEX 2VU8E 4AB9A 3SGBE 3MMGA 1JWTA 4B74A 4TPYA 1O2JA 1O3CA 2ASUB 2QGRA 3MO3A 1V2LT 3A7TA 4UONA 1SOTA 1B7XB 1C1UH 2A7JA 1GG6C 2OBQA 2GDEH 4K5ZA 3U8OH 4Y8ZA 2PUQH 1O2TA 4K8YA 4JMYA 1YP9A 1NROH 5C3NA 1JOUB 1V2MT 3RXIA 2XCNA 2G4UA 4UEHH 1L1GA 3K65B 3TH4H 1QQ4A 4MTBA 3S9CA 3SGAE 1AVXA 1GBHA 4ZMAH 1KDQB 3ATWA 3MTYA 2Z9IA 1AVWA 3FAOA 1D3QB 1LO6A 3R3GB 1BBRK 1P06A 1IQFA 1O3LA 3L33A 1XUHA 2VH6A 1SLWB 1F0SA 3GCOA 3SU3A 1MTWA 2FIRH 3SQHE 1O2SA 4I33A 1C4V2 4TY6A 3CENA 4M7GA 3TNTA 3W95A 2FS9A 1G3EA 3BTME 3VXEH 1TOMH 3F9GA 3Q3KA 3ZZCA 5LGOA 4LXBH 3KQCA 1C5VA 5DP7A 1NU7B 2FDAA 3LGYA 1RD3B 1O3NA 1KDQA 1GI1A 2QA9E 1Y5BT 1SGTA 1Z6JH 4X8SH 1O2HA 1LVMA 2F83A 1TOCB 1Y8TA 4UD9H 3A8CA 2PKSB 2V3OH 1MZDA 1ELAA 1GHAF 1EAXA 1HAVB 2ZHEH 5EQQA 1AZZA 1BTUA 4ZKOU 1XM1A 3SI3H 3VGCC 4I8HA 1HUTH 4IMZA 1W8BH 3E0PB 1TMUH 4LZ1H 1UVOA 1QBNA 2WUCA 3RXHA 1F2SE 3VB7A 1RRKA 1SHHB 1SGQE 1UK3A 1XUFA 4MPUA 3RXDA 1AZ8A 4NCYA 2ZPRA 2BY8X 5EQSA 1KXCA 3QO6A 3PB1E 4Y7AA 2PSYA 3SJIA 3ZVDA 1U6QA 2GZ9A 3QZQA 2GVFA 2OQUA 4WMDA 1F7ZA 3SNAA 3MI4A 2TGAA 2GD4B 4JYTA 2Z7FE 3I78A 6LPRA 2R2WU 1LQDB 3H7TA 2VIDA 2XC5A 1O3BA 5C5NA 1WYKA 1G2LA 3I77A 3SU1A 1OWIA 1BTHH 1XXFA 1CSOE 2PLXA 2V0BA 1Z6EA 4LOYH 5L6NH 1GHVH 1IHSH 2OC0A 2Z9JA 1GJ5H 1BJVA 1EJMA 2ZFRH 3TK5A 2ZFPH 1AE5A 4U32A 2CF9H 4YZUA 2G5VA 2SGQE 1TB6H 2VVVA 5DP6A 1D3PB 1OKXA 1UJ1A 3LC3A 5K7RA 1S81A 2XWAA 1EZXC 2VGCB 3BTTE 1Z8RA 1NRPH 3DA9B 5DG6A 3RM2H 2BDIA 2P8OB 5ABWA 2D2DA 2A32A 2IOTA 2OBOA 1SLVB 4ZKRU 2ZDLA 4D7GA 4IGDA 4X6MA 1EAIA 1OSSA 1W7GH 4VGCC 5FCKA 1Q2WA 2EC9H 2R9PA 5GXPA 2ZCLP 2G8TA 2AMPA 1H9HE 1QQUA 3T25A 1A2CH 1UK2A 3LU9B 2QIQA 3Q3YA 1S0QA 4XDEA 1HDTH 2F9VA 2FODA 3K2UA 3AAVA 3U1JB 2FOGA 5EG4A 1BHXF 1YCPH 1F92A 3L3TA 5JYIA 1MMJN 1HGTH 2AIQA 2P59A 4AX9H 2GTBA 3KNXA 1BB0B 4TWWA 1MKWH 3LPRA 2ZDAH 5FPYA 2AFQB 1CHOF 1PPGE 2XNIA 2XC0A 1DT2A 3Q76A 2ZDKA 1RFNA 4Y7BA 3OY5U 3A87A 2W7UA 3A8BA 4UFFH 2QCYA 1GI8B 1K1LA 2BLVA 3A89A 1LHGH 4H4FA 4X1QU 3LH3A 1CVWH 3W94A 1AFQB 2WYJA 3EA9A 3SV2H 1DXPA 1AMHA 1CA0C 2CJIA 1GHAG 4AYVB 7LPRA 2OCVB 1UVPA 2Z9GA 1F5LA 4Q7ZA 2B7DH 1O35A 3BTHE 2BOHB 1KLIH 3QWCH 3ZV8A 1VITH 2GCTB 3QGJA 4WY3A 1MUEB 1Y3WA 3SJ8A 4KELA 4O9VA 4X6NA 1LHEH 2BM2A 1NFWA 1QB6A 3RXMA 1P2OA 1UO6A 1O33A 1C5QA 2XCFA 3M5NA 4AOQA 4ZAEA 2EA3A 1OP8A 2ZDVH 3RXKA 2HALA 5E0JA 1C2HA 3TJVA 1AB9C 3E0NB 3ZZBA 1CBWC 2Y7ZA 1QRXA 1MBQA 4TYDA 4JZFH 2FOHA 3BTWE 3T29A 3S7HB 4JK6A 1EB1H 5EXLA 3TH2H 1GMCF 1UCYE 4MVNA 1SR5C 1QJ6B 2ZTXA 1ARBA 4ISIH 3RDZA 4BAOB 1UHBB 1IQJA 2OC1A 2ANMH 2VIVA 1O37A 3UNQA 4TY7A 2P93A 4UDWH 5FX6A 4F4OC 1KYNA 1GI6A 5GWZA 3GCHC 1A1RA 1WAYB 1UTNA 1K1OA 3E91A 1B5GH 1JRTA 3T26A 1MD7A 1O2KA 1FV9A 1KXBA 4CR5A 5CE1A 5GJ4B 5JBTA 1XX9A 4ZHAA 1W10U 4IN2A 1VJ9U 1C2DA 1P2MA 1IOEA 1XKBC 3SQEE 3STIA 4BAHB 4ABDA 1W0ZU 1XUIA 2R2MB 2PTNA 1C5SA 1GHBF 2G81E 3B9FH 3HK6B 4XFQA 1AQ7A 5GIBA 3K9XB 1DSTA 1GVLA 1YCPK 3RMMH 2W3KA 3TK9A 1S6FA 3DUXH 3PTBA 3S69A 5HM9A 1GI4A 2FI3E 2CGAA 2A5KA 2I6SA 1RIWB 1G3DA 1K21H 2BDYA 4ABBA 2C4FH 4Y8XA 4UFEH 2FLBH 1LPZB 1NM6A 3CS7A 4NIYA 1L2EA 1P04A 5E0HA 3IWMA 1HYLA 1ELDE 1CT4E 2VIOA 1G32B 1K2I1 1O2RA 3FVFB 3RXBA 3S7KB 2SNVA 1WQVH 1AVGH 4X8VH 1GBMA 2ANWA 3BG8A 3M7TA 4NSVA 3RU4E 3URDA 3BEFB 1UTOA 3UFAA 1CHOG 4DG4A 1PPFE 1EJAA 2UUFB 4AFSA 2BDBA 2UWOA 1LCYA 1XKAC 1O3KA 3UWIA 3A82A 1KXAA 2UWPA 1VITG 4Q80A 3M36A 1BJUA 1TGNA 1VZQH 1GBCA 2FXRA 1B0FA 1GG6B 4ESTE 1YM0A 1K9OE 1P03A 1YGCH 4ABJA 4SGBE 1O38A 1QJ1B 4MPVA 3DFJA 1EP6A 4LZ4B 3MU8A 3UOPA 3UQVA 1FPCH 1C5MD 1WBGB 2ZA5A 1L4ZA 3PV4A 4UFDH 2GV7A 3RC5A 1PYTD 1EZUC 4K60A 1W7XH 1GBAA 1YPLH 1MBMA 3VB5A 1L1NA 3LJJA 2GMTC 4I8JA 4X2VA 1ELBA 1CT0E 2V6NA 1L4DA 5AHGH 1GBIA 1FIWA 2A4OA 3V7TA 4YOIA 1CT2E 3RXQA 1BQYA 1JBUH 3E6PH 1AE8H 1AGJA 1Z8GA 3M35A 2ZFTA 4ABAA 1O3PB 4YLUA 4BAQB 2FEQH 4MPWA 2A7CA 3PWBA 5E0GA 1SL3A 1GMCG 2WPLS 1C2JA 3F9HA 1SFQB 2FYQA 3LGTA 4CHAC 1AUJA 4R8TB 2HNTE 1T8NA 1QGFA 4FUFA 1Y3VA 1C2LA 1K1NA 3PLKA 4GSOA 1LHDH 1ETSH 4ABHA 5ESTE 3F6UH 3U8TH 4WXVA 1NTPA 4WH8A 3ATLA 1O2GH 4CBOA 3VGCB 1TNHA 4AG1A 1GMHF 1J15A 2BMGB 1F0RA 1GI0A 1ZSKA 3E1XB 3EAJA 1SGNE 3LC5A 2JH0D 1UTKA 1C1TA 1E37B 1O3JA 4AN7A 1O2PA 2HPPH 1D9IA 4AFQA 2BY7X 2BY5X 3M3TA 1GBFA 1FUJA 2CHAC 1LQEA 2ZC9H 3QZRA 3UREA 2J34A 5C20A 3RXUA 1GHBG 1GCTC 2VWLA 4Y76A 3VB6A 1W11U 3UOUA 4X2YA 2H9TH 2BOKA 1QHRB 4YO9A 2Q6FA 1O3MA 1V2TT 1SG8B 4D7FA 1IQGA 1RXPA 2TIOA 2J94A 1C2EA 1T31A 2PKAB 2HNTF 1HXEH 3M7QA 3AW1A 1S83A 1GDUA 4NG9H 4WH6A 1L0ZA 1P2JA 1FONA 2C8YB 2XBWA 1JRSA 4CRBA 1ABJH 2V3HH 1VCWA 1G3BA 1GMDG 3P8GA 7ESTE 2O8TA 5EXNA 3RU4D 5HGGA 1C5NH 5DGJA 1UVTH 1O2XA 1A3EH 3QTOH 1N6XA 3I29A 1KLJH 1IQEA 3MH5A 1SC8U 2W3IA 3BSQA 5JB9S 2TPIZ 2Y5FA 4OS6A 3HPTB 4D8NA 3H7OA 2SGFE 2ZNKH 3GOVB 5T3HA 5AF9H 3GCTF 4J2YB 2ZHFH 3SI4H 2ZU3A 4DCDA 2ESTE 2BY9X 1N6YA 3OTJE 1SLXB 3SGQE 2ZFSA 2UUJB 2BDGA 1V2ST 1LPKB 3ESTA 4BOHA 1SVPA 1F0UA 1SLUB 1ANEA 3PROA 3SO3A 2TGDA 1YCPM 4VGCB 1GI7B 1HAYB 1EOJA 2KAIB 4INLA 2BLWA 1G30B 1DWCH 1A0LA 2GZ7A 2OP9A 1TABE 2V35A 1HAZB 1OWJA 1OYTH 1H9LB 4YESB 7GCHF 5TCCA 1C2IA 5FX5A 4X2WA 3UY9A 1QB9A 3SV8A 3Q00A 3T2NA 1MTUA 3GICB 1ZSLA 3KHVA 3DHKH 4K1TA 5EOKA 2BYAX 4NA9H 4Q2KA 2ZFQH 5EW2H 2GT8A 2SGEE 2ZKSA 1P09A 2IN2A 1FY3A 2FI5E 3ZVGA 2ZCKP 2BD8A 3ATMA 2FOFA 1VGCC 1BRAA 3LONA 1CGIE 5GDSH 1KTSB 1GBJA 4CREA 3V12A 1P9UA 3HGPA 1GJ4H 3KF2A 1NZQH 1DE7H 1O3EA 2QXIA 1N8OC 1FIZA 1ZYOA 1CA0B 2AMDA 2FO9A 3D65E 1BT7A 3ZZ3A 1C5WB 3SN8A 1EZQA 1GI3A 1V2OT 1GMHG 2VIPA 1V2PT 1GJDB 1GJ6A 4Q7XA 5JDUB 1OX1A 2ZPQA 2P3TB 1PQ8A 1K1IA 2EEKA 1O34A 2GZ8A 1LHCH 1T8MA 5F6MA 1WTHD 1EKBB 2A2QH 2OQ5A 4CRFA 1TMBH 2ZECA 1CO7E 1OXGA 2VINA 1QL8A 1BMLA 3CS0A 3QDZB 1C2GA 2WINI 2PGQB 4U2WA 1C1MA 5FAHA 3LGIA 1C1RA 1V2NT 3FZDA 1TYNA 4JZEH 3TVJB 3NPSA 1A5HA 1DUEA 1ZR0A 1QNJA 1AB9B 4TWYA 4FU8A 1EQ9A 2R3UA 1YPHE 1AUTC 3G01A 1HAPH 3STJA 1CA8B 2ILNA 3SHAH 4HZHA 2BD4A 1WOFA 5HMAA 3M3SA 1DS2E 3PWCA 2CF8H 2OLGA 8GCHG 1G2MA 2ZU1A 1IQHA 1GJ9B 1GJ8B 3S9AA 1NPMA 3MYWA 1QCPA 1SBWA 1GBDA 1QRZA 2BQ7B 3GCHB 3PYHA 1INCA 1MU6B 5GCHG 1E35B 1TBQH 1FLEE 4X1RU 1P01A 4B71A 1T4UH 1HPGA 1SQOA 3BV9B 1EAUA 1GGDC 1Z1JA 3P70B 1EB2A 1ELEE 1SGDE 2FPZA 1BTWA 4GAWA 1FY1A 1RJXB 4YTAA 2PUXB 3OU0A 3TU7H 4FUGA 2OD3B 3MU4A 1FAKH 3RMNH 2LPRA 2GDDA 3SV9A 1XUGA 6CHAC 1AIXH 3ELAH 4IBLH 1HAVA 1EPTC 1O2ZA 2ZGJA 2M5TA 4NGAH 1HBTH 3QGNB 1TA2A 2BB4A 4DURA 1OWHA 3MHWU 1ETRH 3GDVA 1FXYA 1DSUA 1DY9A 2STBE 4YOGA 1O2LA 7GCHG 2A4GA 4CRGA 1EATA 3BF6H 5K0HA 3MFJA 1TAWA 7KMEH 3NK8A 4Y0ZE 4ZXXH 1F0TA 2ZDMA 1QBOA 4ABIA 2O8UA 5JBCS 3KGPA 2ODPA 3TGKE 1QBVH 1TLDA 1WCZA 5CHAC 2ZEBA 2DE9A 3GY5A 2B8OH 2A5AA 1C5ZB 3NWUA 2O8MA 3LGUA 1MZAA 3LGWA 1ORFA 1W2KH 2FYRA 1HAOH 1O2UA 2A0QB 1ZGIA 5DP8A 5A09A 1GI2A 4ZH8A 1DWEH 3UNSA 1E0FD 3PO1C 4DGJA 2TGPZ 1KXDA 1NRSH 1NY22 1P11E 2UUKB 1B0EA 2PHBA 4FUBA 4INKA 2ZDNA 3SUFA 1PQAA 2CN0H 1YLDA 2Q1JA 1E38B 1YBWA 5L2YH 1ID5H 1LKBA 3U8RH 1P12E 5ETXA 3GYLB 2W26A 4OS4A 3VFEA 2P3FH 1A5GH 3RXVA 2GMTB 3MH4A 1BDAA 4CR9A 4NFEA 4JYVH 4I31A 2BD3A 2AS9A 5AFZH 4I32A 4CRAA 4A5TS 5DJ7A 1UTPA 5BPEA 1DOJA 3ITIA 2FI4E 4AYYB 1C5OH 1TX8A 1D6WA 3GY3A 2Y5GA 1S84A 5IYTA 1IQLA 3UWJH 3BEUA 1TRMA 3BTDE 1DVAH 3T62A 1SI5H 4BANB 1ZTJA 3UIRA 1A0HB 1SQAA 3VPKA 5L2ZH 3U98H 1ACBE 2Y82A 3F68H 1QURH 4JK5A 3RC6A 1HFDA 4GUXA 4AORA 1A0JA 4JYUH 3M3VA 3A8AA 4ZKNU 3F1SB 1O2WA 1TONA 4NIVA 4E7NA 1AN1E 1EJNA 1O5CB 1FY5A 1OS8A 1DY8A 3H5CB 2HLCA 1ESAA 2G00A 1Y3XA 5EQRA 3MH7A 3E90B 2BD2A 1BUIA 2PR3A 4NIWA 3KQDA 4X0WU 1TBRH 2G55A 2FMJA 1IAUA 2XBYA 4XE4A 1EZSC 2BY6X 2CHAB 4H42U 3TLOA 1MH0A 1LMWB 5AVDA 2ZQ1A 2ZHDA 4FXGH 1GBEA 1MQ5A 1WUNH 2BHGA 1P3EA 5LPRA 2VWMA 1LPGB 2JKHA 1SOZA 4DOQA 2ODQA 2EI6A 2BX4A 3RXJA 1EOLA 4A1TA 2ZP0H 2VJ1A 4BTUB 3K6ZA 1C1OA 1TPSA 1LVYA 2QXHA 3KN2A 1JMOH 3SBKA 1O5GH 4BNRA 2NU2E 4YT6H 5C2ZA 1O5EH 3A7ZA 4ZXYH 2K1QA 3EQ0H 4OGXA 1TPPA 2D1JA 4X1PU 1HLTH 4WMEA 4ABEA 1KSNA 3ZVAA 3A83A 2GCHF 2H5CA 2VVUA 5DP5A 1OYQA 1NS3A 1J8AA 2NU4E 2QF3A 3U69H 4JZDH 3KL6A 1GHXH 1O3HA 1RTKA 1ESBA 2ZF0H 4IS5A 2CV3A 1DLKB 1UHBA 3NXPA 1QRWA 4KP0A 4B76A 4Z6AH 5FBEA 5A8XA 1GBTA 2VNTA 4MDSA 3Q77A 4MQAA 4TPIZ 3RXCA 3M5MA 1TNJA 2BVXH 4UFGH 1DWDH 1BRBE 2Z9LA 2WPMS 1EUFA 1WU1A 1MKWK 2H2ZA 1W12U 1DX5M 5JBBS 3UPEA 3M5OA 4FVDA 3GY8A 5JB8S 3SU4A 1TRNA 1FZZA 3PM3A 1ZHPA 1UMAH 2GX4A 1QA0A 5HM2A 1UCYH 3BTFE 2H5DA 1YC0A 3VXFH 1GHWH 1T7CA 1ZPZA 3SW2B 1O2IA 3DT0H 3LH1A 1HNEE 1E34B 1SMFE 3TH3H 3RXOA 1OP2A 1A3BH 1O5FH 1VGCB 3N7OA 3OY6U 5JBAS 1O2MA 4HI3A 3ATKA 4X6PA 1YF4A 3GISB 1ZGVA 3PLPA 5AFYH 5FPSA 1N8OB 3T5FH 5EU8A 1BTYA 3ENSB 3RXPA 2R3YA 3MU1A 2G52A 4IC5A 2FOBA 3MNXA 2ZHQH 3ZZ8A 4BAKB 3LDXH 1NFYA 3QN7A 3U9AH 1BIOA 1ZRBA 4ABGA 1J17T 1SGFA 1SGRE 1UVUH 4X1SU 1IQNA 3HGNA 3NKKA 1MTSA 2O9QA 1GBBA 3AVZA 4WXIA 2ZFFH 1TX7A 2BZAA 4UE7H 1C2MA 1ZPBA 2A1DB 1LTOA 4OGYA 3QX5H 3P8OA 1GBLA 1TGCA 2VGCC 2HOBA 4XBBA 3R0FA 1EASA 1O2VA 2J92A 1KXEA 1PJPA 2IPHA 1LHFH 5F8TA 1MD8A 4NSYA
chains in the Genus database with same CATH superfamily
1GJCB 1GCDA 4DIIH 1QL9A 5DP9A 1HJAC 4YM9A 4Y11E 2J4IA 1YPMH 5EGMA 2BVSH 1BMNH 3HATH 5E8EH 1H4WA 3EE0B 2XC4A 2ZGBH 1DM4B 3T27A 4AGKA 1C5RA 2F9UA 2BLQA 1YPGH 1C5YB 1MCTA 2B0FA 1WTGH 4DIHH 1BA8B 1DDJA 3S9BA 2JH5D 3O8CA 2RG3A 1BBRE 2OC8A 2VVCA 3GY2A 1UVSH 2AGIX 3MOCA 1PPCE 4D9QA 4MNYA 2GCHG 1ABIH 5TJXA 4BTIB 5EPNA 2WV4A 3ZZAA 4SGAE 2QYIA 3A85A 3SU0A 1DFPA 1MU8B 2Y5HA 3TJNA 3VB4A 3TK6A 1XUKA 1NO9H 1AKSB 3SHCH 5DPAA 2HGTH 1Y3YA 2TGTA 1UTQA 5F03A 1D3TB 3NCLA 2RCEA 3E8LA 1UCYK 2FTMA 2ZZUH 6GCHF 2VWOA 3KQEA 4IW4E 2PFEA 1LDTT 2ZTZA 4AGJA 3SNCA 4B2CA 2CXVA 4AG2A 1C9TA 1AKSA 1O32A 2TRMA 2AERH 3AAUA 2YNAA 4Z0KA 3RLYH 5EJ1A 2QV1A 4IC6A 3MU0A 3M37A 4JZ1A 1AI8H 2F3CE 3SV6A 4X8UH 3PMHB 4GVUA 1NRNH 3BTKE 3ZYDA 1AU8A 4ZROA 1W0YH 1O30A 5CHAB 1WQSA 1MKXH 4DJZB 2P95A 1FY4A 5BRRE 1THSH 2PKAA 9ESTA 1C1NA 1D6RA 1CHGA 5T6DA 1G37A 3PO1B 4ZKSU 2ZWLH 2F9NA 3BIUH 4K69A 5A8YA 4BXWA 4FUCA 2F9BH 3A7WA 3GY6A 2C93B 3JZ2B 3LOXA 3ZZ7A 4XBCA 2V3MA 1C4U2 3KQBA 1XVMA 1BRCE 4Y10E 1FPHH 3A84A 3ATIA 5J4SA 3NUMA 1PQ7A 2WYGA 4CRDA 4KGAA 2OUAA 3PRDA 1EX3A 1ZOMA 3UAIC 4ZHLU 1BMAA 2UWLA 1GI9B 4ISHH 2O8WA 5C1UA 1C5LH 1T8LA 2H9EH 5GPIB 1TNGA 4HFPB 1QJ7B 1ZMJA 2IJOB 1SB1H 3TNSA 1ZJDA 2Z3CA 3HK3B 2OINA 1OWDA 1NRRH 1C1PA 1DICA 5GNDA 1SGCA 1ESTA 1KXFA 2SGDE 1K1PA 2KAIA 5FCRA 1IHTH 1ZPCA 1QY6A 1SPJA 2FLRH 2Q6DA 1BZXE 2BVRH 2Z3DA 4O03A 1SGYE 1P2QA 1ZSJA 3ODFA 4FU7A 1ELCA 2VIWA 4B2BA 1O2OA 1O3DA 5C0TA 2FWWA 1T4VH 3ZVBA 5JPMH 2XYAA 1ANCA 3SV7A 1SFIA 2BDCA 4WJG2 1MTNC 3BIVH 2THFB 2C90B 1FAXA 4D76A 3SUEA 1ELFA 1QFKH 1GJAB 4K1EA 3ZVEA 3B8JA 1QZ8A 3DFLA 1K1JA 4JCNA 1ZZZA 4GCHF 3RXLA 4XSKU 2ZGCA 2GV6A 4A92A 1J9CH 2J9NA 5EIYA 2Z3EA 3GDSA 4ZUHA 2LNCA 1OWEA 1BTZA 3LGVA 1O2QA 3GCNA 3ZZ9A 4XD7D 3BN9A 1AD8H 3RXFA 1CE5A 2ZO3H 6GCHG 2BQWB 1CBWB 5EXMA 1ELVA 1MCVA 3P8NA 4XRNA 3BG4C 4KTUA 4INHA 3O8DA 1SGEE 1P8VC 5A8ZA 1F5KU 3SUDA 1MKXK 3RP2A 2ODYB 2FOAA 2QXJA 4E7RG 3PMBB 1THRH 1P05A 1H9IE 2HVYB 3ZVFA 1AWFH 1WXRA 2P3UB 2B5TB 3D23A 3Q3XA 1GVZA 1AHTH 1O2YA 3UR9A 3UUZA 2AGGX 2G51A 3B23B 1SGIB 1GI5A 1NRQH 2FOMB 3OX7U 1TNLA 1DANH 1O2NA 2QAAA 5DP3A 1P2KA 2AEIH 3SUGA 3F9FA 1MTVA 2Z6BD 2VB0A 5FL7D 2XTTB 4P02A 2JETC 2QF0A 3AASA 1D3DB 2WV9A 2ZU2A 3SNEA 3RLWH 4NFFA 3P92A 1ZJKA 4OS2A 1WDIA 2XBVA 3GCTG 3ZZ5A 2V7QD 2G4TA 3D62A 2Y6TA 1O5DH 1KY9A 3H09A 1GHZA 1K1MA 3VB3A 2OXSA 3QLPH 2JDID 1BTXA 1XXDA 1YPEH 2PSXA 3K6YA 3DSOA 3KCGH 1AO5A 1PQ5A 1O3IA 1YPHC 3A86A 1GHYH 2EI8A 2H1UA 1DLEA 1RS0A 2G5NA 2FOCA 1EXFA 1D4PB 2A4RA 4FUEA 2Z9KA 4HTCH 2I6QA 4D9RA 2AIPA 1BTPA 2WUBA 4AZ2B 4BXSA 1TIOA 3HKIB 3C1KA 2J2UA 2RDLA 4MG3A 2SFAA 2FZZA 1H1BA 4B6EA 5EW1H 4ZHMU 1HV7A 4Y79A 1Z71A 2F9OA 4I8GA 2HPQH 3TGJE 4YT7H 5L30H 1VJAU 4CH8B 1GBKA 1V2VT 1Q3XA 2ZGXH 2EI7A 1X7AC 3SJ9A 3A7VA 3TGIE 3GY7A 1S6HA 2AH4X 3SOSA 3TJUA 2H6MA 2W7SA 1NESE 1W14U 5FBIA 4FU9A 1SGFG 1V2WT 2A45B 2SGPE 3MH6A 1ANDA 1SSXA 2HRVA 4Y71A 3SNBA 2ZIQH 3ZZDA 4DY7B 1O3GA 2QC2A 3E3TA 3S0NA 2OTVA 3UTUH 5KEDA 1RTFB 2C8ZB 1A4WH 1FN8A 2QXGA 1C1SA 1W13U 2ZGHA 2QY0B 3EYDA 3FP8E 2BXUH 1QR3E 1S6LA 1TE0A 3QUMP 2XXLA 1O3OA 1YWUA 5E2PA 5EODA 1T32A 3MO9A 4RT0A 3RU4T 3QTVH 1XVOA 5HYOA 1DUAA 2ZG0H 4GCHG 3RXEA 1ANBA 1DXWA 4O97A 3MO6A 1H8IH 3RUOA 1C2FA 1C1WH 3FN8A 4K8BA 3A7XA 1Y5AT 2C3SA 3KIDU 2FS8A 3TJOA 3M5LA 3MWIU 1GL1A 1UTMA 2R0LA 5I46H 2B9LA 3IG6B 3PTNA 4X6OA 1ZLRA 1FJSA 3ZVCA 1HJAB 4I8KA 4IN1A 5T6FA 3TPIZ 3UQOA 2VIQA 1HAGE 4FUHA 5CMXH 1C9PA 1MABB 4MNWA 1TGSZ 1O3AA 2BD5A 3BEIB 2NWNA 2XW9A 1YYY1 1W0KD 1TGTA 2JH6D 1HAHH 2CMYA 5TCAA 1O36A 4YLQH 2BD7A 4CHAB 1P2IA 3V0XA 4DVAU 3DD2H 6ESTA 1KLTA 5H4IB 1DWBH 2F4LA 3WWBA 2QN5T 1BITA 1HJ9A 5DSFA 1O39A 5B6OA 4U30A 3RXGA 1ZMLA 1NN6A 2GP9B 2FX4A 3FZZA 3OSYA 4LK4A 4RN6A 3QK1A 1P10A 5PTPA 8KME2 1UTJA 3MNCA 2FP7B 2M2AA 3BTEE 1VITF 1G3CA 2LELA 3ZYEA 2A2XH 4OS1A 1ELTA 2ZI2H 3HKJB 1ZMNA 1IQKA 1TALA 1PPEE 3F3BA 5F8ZA 1Z1IA 2BXTH 5DP4A 2ZU5A 3O8RA 1C5PA 1AWHB 3A88A 1FMGA 5I25A 2STAE 3UR6A 1GCTB 5LH8A 1KTTB 2Y81A 3L6PA 1UW7A 1P3CA 1XMNB 4X1NU 1O5AB 2WHXA 1BOQA 4THNH 2BD9A 2R0KA 1EAWA 2VH0A 3ODDA 4YOJA 3SZNA 2ALVA 4DT7B 3RC4A 1YLCA 1NT1A 1HAIH 4B6FA 1C5UA 3WWFA 1HCGA 3ZIAD 4U01A 2F91A 4OS7A 4AC9A 1GDQA 1P9SA 1Z8IB 1BMMH 2AMQA 4FOUC 1Y3UA 2D26C 5FHTA 3URCA 3RXSA 1SQRA 2VWNA 3RXAA 2ANYA 2A5IA 1C4Y2 3SJKA 3VEQB 3MNSA 1BRUP 3EA7A 4AFUA 1OWKA 1TA6A 4WVPE 1FI8A 1M9UA 1NC6A 1HXFH 1PYTC 1GWAA 3MNBA 3MU5A 2FM2A 1F5RA 4XOJA 2J98B 4GHQA 2PGBB 1PPHE 4B2AA 2PKSC 2FX6A 1A7SA 1ZTLA 1SGPE 3P95A 4CH2B 2C8WB 1O5BB 1MAXA 3P6ZB 1T8OA 3EDXB 1TX6A 1O31A 3P8FA 4JZIA 2XOKD 4B73A 2RA0A 1QL7A 3PLBA 1TPAE 1RTLA 1CU1A 2KX4A 1PFXC 1WV7H 2ANKH 4KTCA 1S85A 2YOLA 1TWXB 1JIMA 1YPJH 2OC7A 1YPKH 3GYMA 2J98A 1P57B 5C5OA 3F2FA 1V3XA 4QT8C 4PROA 4O3UA 2GT7A 4FUDA 1W3CA 1OP0A 1E1RD 3N7EA 4IMQA 3M61U 2A7HA 3PMAB 1AFEH 1RGQA 2Y7XA 3RMLH 3SNDA 2WPIS 4A1XA 1FN6A 1GJBB 5DKMA 4NIXA 1TMTH 4BAMB 1TGBA 4KTSA 3GY4A 3P17H 5DK1A 1V2JT 3SJOA 1HRTH 3WW7A 2BDAA 1GMDF 4CRCA 5IDKA 1BMFD 2A31A 4K3JA 1K28D 1P2NA 1FQ3A 5FXLA 3FP7E 1Z8JB 4H6TA 1QTFA 2WSSD 4ISOA 3O8BA 4KKDA 1CGJE 1V2RT 2TBSA 4A1VA 4WF8A 1THPB 3RM0H 1A46H 2XWBI 4AFZA 1MTNB 2ZHWH 1EP5A 3MQKC 1V2UT 3C27B 1S0RA 4ISNA 4F48B 2PTCE 1E36B 2F9PA 4RKJB 1ZHRA 2GKVE 1H8ED 1IQIA 1GDNA 4H6SB 1GPZA 1V6DA 3ZZ6A 1LVBA 2WPJS 3A80A 4NWLA 2P8OC 1QB1A 2GGVB 1JIRA 1HJ8A 5EJZA 1C5XB 1IQMA 1Q31A 2HVXA 1GL0E 3E16B 5A0BA 2PP6A 1Y59T 4K1SA 2W5EA 4YXWD 3BG4B 3BTQE 1WSSH 4MLFB 3U28C 4XBDA 1VCQA 1HAXB 5EPYA 1TPOA 3ZZ4A 2WV5A 4BTTB 1FDPA 1K22H 4ISLA 2SGAA 2Q6GA 1OPHB 2Y80A 2DE8A 4CBNA 5C67A 4A6LA 2XRCA 4HGCA 2Z94A 4E06H 4E05H 3LKWA 1TNKA 2FOEA 2KCOA 2NU0E 1S82A 3M7UA 1KIGH 8ESTE 1O0DH 2PW8H 3U1IB 1AY6H 1TBZH 3PMJA 2ALPA 5ESBA 2WPDD 1C1VH 2FESH 2UUYA 3FP6E 5A0CA 1A5IA 3OE7D 4WMFA 1C2KA 2HWLB 3EGKH 4DW2U 4NWKA 1GGDB 2JETB 2NU3E 2J38A 3W1EA 2BDHA 3JZ1B 3RXTA 1UK4A 1OOKB 3ZV9A 1TNIA 1AFQC 1NBMD 3GDUA 5T6GA 2ZQ2A 1ZRKA 4NZQA 4ASHA 1BCUH 2BQ6B 1Z7KA 1G36A 1V2KT 1ELGA 1LKAA 2NU1E 3SU2A 5LPFA 1QA7A 1C5TA 3LT3A 4WWYA 2BTCE 3A8DA 6CHAB 2GCTC 4ABFA 4O3TA 1EPTB 4R0IA 2RA3A 3F9EA 1ZTKA 3CP7A 3SORA 4Q7YA 2H9HA 3FANA 5HIZA 1HIAB 1PPBH 1YKTA 3SU5A 1XUJA 5SGAE 4GPGA 1ARCA 2HNTC 5HXFA 1TRYA 1O3FA 4A7IB 5KECA 4ACBA 3V3MA 1GVKB 2YMSD 3EA8A 4RSPA 4Y0YE 3TIUA 2YNBA 1DPOA 2WPKS 1NU9A 3AW0A 3D49H 2FTLE 4GHTA 4AB8A 1HB0B 3LIWA 1EPTA 1LVOA 4F49A 2C8XB 5FPTA 1J14A 5F8XA 1BBRH 5IK2D 1CGHA 4J1YA 5DO4H 4I7YH 1TQ0B 5A0AE 5LPEA 1TQ7B 8LPRA 1HIAA 8GCHF 5A2MH 2O8LA 4Y6DA 3T28A 4MPXA 4NZLA 1P0SH 1H8DH 1NFUA 2BX3A 4I8LA 5F53A 1MAYA 5GCHF 2P16A 1SHYA 1VCPA 4MNXA 2K0QA 1V2QT 1L1JA 1PPZA 5G4BA 2AYWA 1S5SA 5C1YA 1KMHB 1CQQA 2BZ6H 3KEEA 5J4QA 3RXRA 1QIXB 3UNRA 1NFXA 4RKOB 3V13A 1FY8E 2J95A 1MQ6A 2XNDD 1G9IE 4OS5A 3RMOH 3IITA 1UTLM 2A4QA 2ULLA 2WPHS 3WY8A 2ZTYA 5E2OA 4X2XA 3LJOA 2D8WA 2ZCHP 4K2YA 1BHXB 4FUIA 4NA8A 2SNWA 1P02A 1RIWC 9LPRA 1Y5UT 2DUCA 1JXPA 3FFGA 4Y8YA 4NA7A 3OYPA 1TFXA 1A61H 3EE7A 3TITA 1K0HA 4FVBA 2ZPSA 3CNRA 1C1QA 1DITH 3SU6A 5C1XA 1FNIA 1N1LA 4FUJA 1VR1H 3A81A 1J16A 1ETTH 4ZCNA 2P94A 2ZU4A 4MNVA 3KYFA 3NZIA 4GLYA 3BTGE 4B1TA 2PWXA 5C17A 3A7YA 1SQTA 4B75A 2BLOA 2XBXA 1GJ7B 2PV9B 4X8TH 4ASUD 4RT1A 1ZHMA 2AGEX 2VU8E 4AB9A 3SGBE 3MMGA 1JWTA 4B74A 4TPYA 1O2JA 1O3CA 2ASUB 2HLDD 2QGRA 1V2LT 3A7TA 3MO3A 1SOTA 4UONA 1B7XB 1C1UH 2A7JA 1GG6C 2OBQA 2GDEH 4K5ZA 3U8OH 4Y8ZA 2PUQH 1O2TA 4K8YA 4JMYA 1YP9A 1NROH 5C3NA 1JOUB 1V2MT 3RXIA 2XCNA 2G4UA 4UEHH 3PRBA 1L1GA 3K65B 3TH4H 1QQ4A 4MTBA 3S9CA 3SGAE 1AVXA 1GBHA 4ZMAH 1KDQB 3ATWA 3MTYA 2Z9IA 1AVWA 3FAOA 1D3QB 1LO6A 3R3GB 1BBRK 1P06A 1IQFA 1O3LA 2K8IA 3L33A 1XUHA 2VH6A 1SLWB 1F0SA 3GCOA 3SU3A 1MTWA 2FIRH 3SQHE 1O2SA 4I33A 1C4V2 4TY6A 3CENA 4M7GA 3TNTA 3W95A 2FS9A 1G3EA 3BTME 3VXEH 1TOMH 3F9GA 3Q3KA 3ZZCA 5LGOA 4LXBH 3KQCA 1C5VA 5DP7A 1NU7B 2FDAA 3LGYA 1RD3B 1O3NA 1KDQA 2EY4C 1GI1A 4RI0A 2QA9E 1Y5BT 1SGTA 1Z6JH 4X8SH 1O2HA 1LVMA 2F83A 1TOCB 1Y8TA 4UD9H 3A8CA 2PKSB 2V3OH 1MZDA 1ELAA 1GHAF 1EAXA 1HAVB 2ZHEH 5EQQA 1AZZA 1BTUA 1H8HD 4ZKOU 1XM1A 3SI3H 3VGCC 4I8HA 1HUTH 4IMZA 1W8BH 3E0PB 1TMUH 3F2HA 4LZ1H 1UVOA 1QBNA 2WUCA 3RXHA 1F2SE 3VB7A 1RRKA 1SHHB 1SGQE 1UK3A 1XUFA 4MPUA 3RXDA 1AZ8A 4NCYA 2WZQA 2ZPRA 2BY8X 5EQSA 1KXCA 3QO6A 3PB1E 4Y7AA 2PSYA 3SJIA 3ZVDA 1U6QA 2GZ9A 3QZQA 2GVFA 2OQUA 4WMDA 1F7ZA 3SNAA 3MI4A 2TGAA 2GD4B 4OM9A 4JYTA 2Z7FE 3I78A 6LPRA 2R2WU 1LQDB 3H7TA 2VIDA 2XC5A 1O3BA 5C5NA 1WYKA 2EQNA 1G2LA 3I77A 3SU1A 1OWIA 1BTHH 1XXFA 1CSOE 2PLXA 2V0BA 1Z6EA 4LOYH 5L6NH 1GHVH 1IHSH 2OC0A 2Z9JA 1GJ5H 1BJVA 1EJMA 2ZFRH 3TK5A 2YMSB 2ZFPH 1AE5A 3OAAD 4U32A 2CF9H 4YZUA 2G5VA 2SGQE 1TB6H 2VVVA 5DP6A 2AHME 1D3PB 1OKXA 1UJ1A 3DSGA 3LC3A 5K7RA 1S81A 2XWAA 1EZXC 2VGCB 3BTTE 1Z8RA 1NRPH 3DA9B 4Q4LA 5DG6A 3RM2H 2BDIA 2P8OB 5ABWA 2D2DA 2A32A 2IOTA 2OBOA 1SLVB 4ZKRU 2ZDLA 4D7GA 4IGDA 4X6MA 1EAIA 1OSSA 1W7GH 4VGCC 5FCKA 1Q2WA 2EC9H 2R9PA 5GXPA 2ZCLP 2G8TA 2AMPA 1H9HE 1QQUA 3T25A 1A2CH 1UK2A 3LU9B 2QIQA 3Q3YA 1S0QA 4XDEA 1HDTH 2F9VA 2FODA 3K2UA 3AAVA 3U1JB 2FOGA 5EG4A 1BHXF 1YCPH 1F92A 3L3TA 5JYIA 1MMJN 1HGTH 2AIQA 2P59A 4AX9H 2GTBA 3KNXA 1BB0B 4TWWA 1MKWH 1W0JD 3LPRA 2J97A 2ZDAH 5FPYA 2AFQB 1CHOF 1PPGE 2XNIA 2XC0A 1DT2A 3Q76A 2ZDKA 1RFNA 4Y7BA 3OY5U 3A87A 2W7UA 3A8BA 4UFFH 2QCYA 1GI8B 1K1LA 2BLVA 3A89A 1LHGH 4H4FA 4X1QU 3LH3A 1CVWH 3W94A 1AFQB 2WYJA 1OHHD 3EA9A 3SV2H 1DXPA 1AMHA 1CA0C 2CJIA 1GHAG 4AYVB 7LPRA 2JJ1D 2OCVB 1UVPA 2Z9GA 1F5LA 4Q7ZA 2B7DH 1O35A 3BTHE 2BOHB 1KLIH 3QWCH 3ZV8A 1VITH 2GCTB 3QGJA 4WY3A 1MUEB 1Y3WA 3SJ8A 4KELA 4O9VA 4X6NA 1LHEH 2BM2A 1NFWA 1QB6A 4I86A 3RXMA 1P2OA 1UO6A 1O33A 1C5QA 2XCFA 3M5NA 4AOQA 4ZAEA 2EA3A 1OP8A 2ZDVH 3RXKA 2HALA 5E0JA 2RFKC 1C2HA 3TJVA 1AB9C 3E0NB 3ZZBA 1CBWC 2Y7ZA 1QRXA 1MBQA 1YY3A 4TYDA 4JZFH 2FOHA 3BTWE 3T29A 2QE7D 3S7HB 4JK6A 1EB1H 5EXLA 3TH2H 1GMCF 1UCYE 4MVNA 1SR5C 1QJ6B 2ZTXA 1ARBA 4ISIH 3RDZA 4BAOB 1UHBB 1IQJA 2OC1A 2ANMH 2VIVA 1O37A 3UNQA 4TY7A 2P93A 4UDWH 5FX6A 4F4OC 1KYNA 4F55A 1GI6A 1E79D 5GWZA 3GCHC 1A1RA 1WAYB 2KCPA 1NBME 1UTNA 1K1OA 3E91A 1B5GH 1JRTA 3T26A 1MD7A 1O2KA 1FV9A 1KXBA 4CR5A 5CE1A 5GJ4B 5JBTA 1XX9A 4ZHAA 1W10U 4IN2A 1VJ9U 1C2DA 1P2MA 1IOEA 1XKBC 3AK5A 3SQEE 3STIA 3OEHD 4BAHB 4ABDA 1W0ZU 1XUIA 2R2MB 2PTNA 1C5SA 1GHBF 2G81E 3B9FH 3HK6B 4XFQA 1AQ7A 5GIBA 3K9XB 1DSTA 1GVLA 1YCPK 2KCAA 2W3KA 3RMMH 3TK9A 1S6FA 3DUXH 3PTBA 3S69A 4FETA 5HM9A 1GI4A 2FI3E 2CGAA 2A5KA 2I6SA 1RIWB 1G3DA 1K21H 2BDYA 2W6JD 4TT3D 2C4FH 4Y8XA 4ABBA 4UFEH 2FLBH 1LPZB 1NM6A 3CS7A 4NIYA 1L2EA 1P04A 5E0HA 3IWMA 1HYLA 1ELDE 1CT4E 2VIOA 1G32B 1K2I1 1O2RA 3FVFB 3RXBA 3S7KB 2SNVA 1WQVH 1AVGH 4X8VH 1GBMA 2ANWA 3BG8A 3M7TA 4NSVA 3RU4E 3URDA 3BEFB 1UTOA 3UFAA 1CHOG 4DG4A 1PPFE 1EJAA 2UUFB 4AFSA 2BDBA 2UWOA 1LCYA 2KZ4A 1XKAC 1O3KA 3UWIA 3A82A 1KXAA 2UWPA 1VITG 4Q80A 3M36A 1BJUA 1TGNA 1VZQH 1GBCA 2FXRA 1B0FA 1GG6B 4ESTE 1YM0A 1K9OE 1P03A 1YGCH 4ABJA 4SGBE 1O38A 2KM0A 1QJ1B 4MPVA 3DFJA 1EP6A 4LZ4B 3MU8A 3UOPA 5HKKD 3UQVA 1FPCH 1C5MD 1WBGB 2ZA5A 1L4ZA 3PV4A 4UFDH 2GV7A 3RC5A 1PYTD 1EZUC 4K60A 1W7XH 1GBAA 1YPLH 1MBMA 3VB5A 1L1NA 3LJJA 2GMTC 4I8JA 4X2VA 1ELBA 1CT0E 2V6NA 1L4DA 5AHGH 1GBIA 1FIWA 2A4OA 3V7TA 4YOIA 1CT2E 1E1QD 3RXQA 1BQYA 1JBUH 3E6PH 1AE8H 1AGJA 1Z8GA 3M35A 2ZFTA 4ABAA 1O3PB 1YLNA 4YLUA 4BAQB 2FEQH 4MPWA 2A7CA 3PWBA 5E0GA 1SL3A 1GMCG 2WPLS 1C2JA 3F9HA 4Q63A 1SFQB 2FYQA 3LGTA 4CHAC 1AUJA 3VG8A 4R8TB 3SYJA 2HNTE 1T8NA 3UB0A 1QGFA 4FUFA 1Y3VA 1C2LA 1K1NA 3PLKA 4GSOA 1LHDH 1ETSH 4ABHA 5ESTE 3F6UH 4TSFD 3U8TH 4WXVA 1NTPA 4WH8A 3ATLA 1O2GH 4CBOA 3VGCB 1TNHA 4AG1A 1GMHF 1J15A 2BMGB 1F0RA 1GI0A 1ZSKA 3E1XB 3EAJA 1SGNE 3LC5A 2JH0D 1UTKA 1C1TA 1E37B 1O3JA 4AN7A 4ACAA 1O2PA 2HPPH 1D9IA 4AFQA 2BY7X 2BY5X 3M3TA 1GBFA 1FUJA 2CHAC 1LQEA 2ZC9H 3QZRA 3UREA 2J34A 5C20A 3RXUA 2QF4A 1GHBG 1GCTC 2VWLA 4Y76A 3VB6A 1W11U 3UOUA 3F2GA 4X2YA 2H9TH 2BOKA 1QHRB 4YO9A 2Q6FA 1O3MA 1V2TT 4P00A 1SG8B 4D7FA 1IQGA 1RXPA 2TIOA 2J94A 1C2EA 1T31A 2PKAB 2HNTF 1HXEH 3M7QA 3AW1A 1S83A 1GDUA 4NG9H 4WH6A 5C0UA 1L0ZA 1P2JA 1FONA 2C8YB 2XBWA 1JRSA 4CRBA 1ABJH 2V3HH 1VCWA 1G3BA 1GMDG 3P8GA 1SKYE 2O8TA 7ESTE 3DSPA 5EXNA 3RU4D 5HGGA 1C5NH 5DGJA 1UVTH 1O2XA 3SZEA 1A3EH 3QTOH 1N6XA 3I29A 1KLJH 1IQEA 3MH5A 1SC8U 2W3IA 3BSQA 5JB9S 2TPIZ 2Y5FA 4OS6A 3HPTB 4D8NA 3H7OA 2SGFE 2ZNKH 3GOVB 5T3HA 5AF9H 3GCTF 4J2YB 2ZHFH 3SI4H 5C94A 2ZU3A 4DCDA 2ESTE 2BY9X 2JJ2D 1N6YA 3OTJE 1SLXB 3SGQE 2ZFSA 2UUJB 2BDGA 1V2ST 1LPKB 3ESTA 4BOHA 1SVPA 1F0UA 3KQ5A 1SLUB 1ANEA 3PROA 3SO3A 2TGDA 1YCPM 4VGCB 1GI7B 1HAYB 1EOJA 2KAIB 4INLA 2BLWA 1G30B 1DWCH 1A0LA 2GZ7A 2OP9A 1TABE 2V35A 1HAZB 1OWJA 1OYTH 1H9LB 4YESB 7GCHF 5TCCA 1C2IA 3FO8D 5FX5A 4X2WA 3UY9A 1QB9A 3SV8A 3Q00A 3T2NA 1MTUA 3DCLA 3GICB 1ZSLA 3KHVA 3DHKH 4K1TA 5EOKA 2BYAX 4NA9H 4Q2KA 2ZFQH 5EW2H 2GT8A 2SGEE 2ZKSA 1P09A 3OFND 2IN2A 1FY3A 2FI5E 3ZVGA 2ZCKP 2BD8A 3ATMA 2FOFA 1VGCC 1BRAA 3LONA 1CGIE 5GDSH 1KTSB 1GBJA 4CREA 3V12A 1P9UA 3HGPA 1GJ4H 3KF2A 1NZQH 2IJD1 1DE7H 1O3EA 2QXIA 1N8OC 1FIZA 1ZYOA 1CA0B 2AMDA 2FO9A 3D65E 1BT7A 3ZZ3A 5EJLA 1C5WB 3SN8A 1EZQA 1GI3A 1V2OT 1GMHG 2VIPA 1V2PT 1GJDB 1GJ6A 4Q7XA 5JDUB 1OX1A 2ZPQA 2P3TB 1PQ8A 1K1IA 2EEKA 1O34A 2GZ8A 1LHCH 1T8MA 5F6MA 1WTHD 1EKBB 2W6ID 2A2QH 2OQ5A 4CRFA 1TMBH 3OTPA 2ZECA 1CO7E 1OXGA 2KFWA 2VINA 1QL8A 1BMLA 3CS0A 3QDZB 1C2GA 2WINI 2PGQB 4U2WA 1C1MA 5FAHA 3LGIA 1C1RA 1V2NT 3FZDA 1TYNA 4JZEH 3TVJB 3NPSA 1A5HA 1DUEA 1ZR0A 1QNJA 1AB9B 4TWYA 3FKSD 4FU8A 1EQ9A 2R3UA 1YPHE 1AUTC 3G01A 1HAPH 3STJA 1CA8B 2ILNA 3SHAH 4HZHA 2BD4A 1WOFA 3F0PA 5HMAA 3M3SA 1DS2E 3PWCA 2CF8H 2OLGA 8GCHG 1G2MA 2ZU1A 1IQHA 1GJ9B 5HIYA 1GJ8B 3S9AA 1FX0B 5DN6D 1NPMA 3MYWA 1QCPA 1SBWA 1GBDA 1QRZA 2BQ7B 3GCHB 3PYHA 1INCA 1MU6B 5GCHG 3F0OA 1E35B 1TBQH 1FLEE 4X1RU 1P01A 4B71A 1T4UH 1HPGA 1SQOA 3BV9B 1EAUA 1GGDC 1Z1JA 3P70B 1EB2A 1ELEE 1SGDE 2FPZA 1BTWA 2JIZD 3GS9A 4GAWA 1FY1A 1RJXB 4YTAA 2PUXB 3OU0A 3TU7H 4FUGA 2OD3B 3MU4A 1FAKH 3RMNH 2LPRA 2GDDA 3SV9A 1XUGA 6CHAC 1AIXH 3ELAH 1EFRD 1HAVA 4IBLH 1EPTC 1O2ZA 2ZGJA 2M5TA 4NGAH 1HBTH 3PV2A 3QGNB 1TA2A 2KCYA 2BB4A 4DURA 1OWHA 3MHWU 1ETRH 3GDVA 1FXYA 1DSUA 1DY9A 2STBE 4YOGA 1O2LA 7GCHG 2A4GA 4CRGA 1EATA 3BF6H 5K0HA 3MFJA 1TAWA 7KMEH 3NK8A 4Y0ZE 4ZXXH 1F0TA 2ZDMA 1QBOA 4ABIA 2O8UA 5JBCS 3KGPA 2ODPA 3TGKE 1QBVH 1TLDA 1WCZA 5CHAC 2ZEBA 2DE9A 3GY5A 2B8OH 2A5AA 1C5ZB 3NWUA 2O8MA 3LGUA 1MZAA 3LGWA 1ORFA 3FOAA 1W2KH 2FYRA 1HAOH 1O2UA 2A0QB 1ZGIA 5B6LA 5DP8A 5A09A 1GI2A 4ZH8A 1DWEH 3UNSA 1E0FD 3PO1C 4DGJA 2TGPZ 1KXDA 1NRSH 1NY22 1P11E 2UUKB 1B0EA 2PHBA 4FUBA 4INKA 2ZDNA 3SUFA 1PQAA 2CN0H 1YLDA 2Q1JA 1E38B 1YBWA 5L2YH 1ID5H 1LKBA 3U8RH 2L6OA 1P12E 3NRLA 2OK5A 5ETXA 3GYLB 2W26A 4OS4A 4DT4A 3VFEA 2P3FH 1A5GH 3RXVA 2GMTB 3MH4A 1BDAA 4CR9A 4NFEA 4JYVH 4I31A 2BD3A 2AS9A 5AFZH 4I32A 4CRAA 4A5TS 5DJ7A 5KGOA 1UTPA 5BPEA 1DOJA 3ITIA 2FI4E 4AYYB 1C5OH 1TX8A 1D6WA 3GY3A 2Y5GA 1S84A 5IYTA 1IQLA 3UWJH 3BEUA 1TRMA 3BTDE 1DVAH 3T62A 1SI5H 4BANB 1ZTJA 3UIRA 1A0HB 1SQAA 1VKYA 3VPKA 2RDEA 5L2ZH 3U98H 1ACBE 2Y82A 3F68H 1QURH 4JK5A 3RC6A 1HFDA 3N7DA 4GUXA 4AORA 1A0JA 4JYUH 3M3VA 3A8AA 4ZKNU 3KYGA 3F1SB 1O2WA 1TONA 4NIVA 4E7NA 1AN1E 1EJNA 1O5CB 1FY5A 1OS8A 1DY8A 3H5CB 2HLCA 1ESAA 2G00A 1Y3XA 5EQRA 3MH7A 3E90B 2BD2A 1BUIA 2PR3A 3N99A 4NIWA 3KQDA 4X0WU 1TBRH 2G55A 2FMJA 1IAUA 2XBYA 4XE4A 1EZSC 2BY6X 2CHAB 4H42U 2F43B 3TLOA 1MH0A 2LP6A 1LMWB 5AVDA 2ZQ1A 2ZHDA 4FXGH 1GBEA 1MQ5A 1WUNH 2BHGA 5CDFE 4Z1MD 1P3EA 5LPRA 2VWMA 1LPGB 2JKHA 1SOZA 4DOQA 2ODQA 2EI6A 2IPQX 2BX4A 3RXJA 1EOLA 4A1TA 2ZP0H 2VJ1A 4BTUB 3K6ZA 1C1OA 1TPSA 1LVYA 2QXHA 3KN2A 1JMOH 3SBKA 1O5GH 4BNRA 2J5UA 2NU2E 4YT6H 5C2ZA 1O5EH 3A7ZA 4ZXYH 2K1QA 3EQ0H 4OGXA 1TPPA 2D1JA 4X1PU 1HLTH 4WMEA 4ABEA 1KSNA 3ZVAA 3A83A 2GCHF 2H5CA 2VVUA 5DP5A 1OYQA 1NS3A 4M9FA 1J8AA 2NU4E 2QF3A 3U69H 4JZDH 3KL6A 1GHXH 1O3HA 5T1VA 1RTKA 1ESBA 2ZF0H 4IS5A 1COWD 2CV3A 1DLKB 1UHBA 2GJGA 1QRWA 3NXPA 4KP0A 4B76A 5FBEA 4Z6AH 5A8XA 1GBTA 2VNTA 4MDSA 3Q77A 4MQAA 2CK3D 4TPIZ 3RXCA 3M5MA 3PV5A 1TNJA 2BVXH 4UFGH 1DWDH 1BRBE 4HG6A 2Z9LA 2WPMS 1EUFA 1WU1A 1MKWK 2H2ZA 1W12U 1DX5M 5JBBS 3UPEA 3M5OA 4FVDA 3GY8A 5JB8S 3SU4A 1TRNA 1FZZA 3PM3A 1ZHPA 1UMAH 2GX4A 1QA0A 5HM2A 1UCYH 2VBCA 2H5DA 3BTFE 1YC0A 3VXFH 1GHWH 1T7CA 1ZPZA 3SW2B 1O2IA 3DT0H 3LH1A 1HNEE 1E34B 1SMFE 3TH3H 3RXOA 1OP2A 1A3BH 1O5FH 1VGCB 3N7OA 3OY6U 5JBAS 1O2MA 4HI3A 3ATKA 4X6PA 5CHBA 1YF4A 3GISB 2L74A 1ZGVA 3PLPA 5AFYH 5FPSA 1N8OB 3T5FH 5EU8A 1BTYA 3ENSB 2KR7A 3RXPA 2R3YA 3MU1A 2G52A 4IC5A 2FOBA 3MNXA 2ZHQH 3ZZ8A 4BAKB 3LDXH 1NFYA 3QN7A 3U9AH 1BIOA 1ZRBA 4ABGA 1J17T 1SGFA 1SGRE 1UVUH 4X1SU 1IQNA 3HGNA 3NKKA 1MTSA 2O9QA 1GBBA 2YMSC 3AVZA 4WXIA 2ZFFH 1TX7A 2BZAA 3OEED 4UE7H 1C2MA 1ZPBA 2A1DB 1LTOA 4OGYA 3QX5H 3P8OA 1GBLA 1TGCA 2VGCC 2HOBA 2QF5A 3R0FA 1EASA 1O2VA 2J92A 4XBBA 1KXEA 1PJPA 2IPHA 1LHFH 5F8TA 1MD8A 4NSYA
chains in the Genus database with same CATH topology
1GJCB 1GCDA 4DIIH 1QL9A 5DP9A 1HJAC 4YM9A 4Y11E 2J4IA 1YPMH 5EGMA 2BVSH 1BMNH 3HATH 5E8EH 1H4WA 3EE0B 2XC4A 2ZGBH 1DM4B 3T27A 4AGKA 1C5RA 2F9UA 2BLQA 1YPGH 1C5YB 1MCTA 2B0FA 1WTGH 4DIHH 1BA8B 1DDJA 3S9BA 2JH5D 3O8CA 2RG3A 1BBRE 2OC8A 2VVCA 3GY2A 1UVSH 2AGIX 3MOCA 1PPCE 4D9QA 4MNYA 2GCHG 1ABIH 5TJXA 4BTIB 5EPNA 2WV4A 3ZZAA 4SGAE 2QYIA 3A85A 3SU0A 1DFPA 1MU8B 2Y5HA 3TJNA 3VB4A 3TK6A 1XUKA 1NO9H 1AKSB 3SHCH 5DPAA 2HGTH 1Y3YA 2TGTA 1UTQA 5F03A 1D3TB 3NCLA 2RCEA 3E8LA 1UCYK 2FTMA 2ZZUH 6GCHF 2VWOA 3KQEA 4IW4E 2PFEA 1LDTT 2ZTZA 4AGJA 3SNCA 4B2CA 2CXVA 4AG2A 1C9TA 1AKSA 1O32A 2TRMA 2AERH 3AAUA 2YNAA 4Z0KA 3RLYH 2QV1A 4IC6A 3MU0A 3M37A 4JZ1A 1AI8H 2F3CE 3SV6A 4X8UH 3PMHB 4GVUA 1NRNH 3BTKE 3ZYDA 1AU8A 4ZROA 1W0YH 1O30A 5CHAB 1WQSA 1MKXH 4DJZB 2P95A 1FY4A 5BRRE 1THSH 2PKAA 9ESTA 1C1NA 1D6RA 1CHGA 5T6DA 1G37A 3PO1B 4ZKSU 2ZWLH 2F9NA 3BIUH 4K69A 5A8YA 4BXWA 4FUCA 2F9BH 3A7WA 3GY6A 2C93B 3JZ2B 3LOXA 3ZZ7A 4XBCA 1C4U2 3KQBA 1XVMA 1BRCE 4Y10E 1FPHH 3A84A 3ATIA 5J4SA 3NUMA 1PQ7A 2WYGA 4CRDA 4KGAA 2OUAA 1EX3A 1ZOMA 4ZHLU 1BMAA 2UWLA 1GI9B 4ISHH 2O8WA 5C1UA 1C5LH 1T8LA 2H9EH 5GPIB 1TNGA 4HFPB 1QJ7B 1ZMJA 2IJOB 1SB1H 3TNSA 1ZJDA 2Z3CA 3HK3B 2OINA 1OWDA 1NRRH 1C1PA 1DICA 1SGCA 1ESTA 1KXFA 2SGDE 1K1PA 2KAIA 5FCRA 1IHTH 1ZPCA 1QY6A 1SPJA 2FLRH 2Q6DA 1BZXE 2BVRH 2Z3DA 4O03A 1SGYE 1P2QA 1ZSJA 3ODFA 4FU7A 1ELCA 2VIWA 4B2BA 1O2OA 1O3DA 2FWWA 1T4VH 3ZVBA 5JPMH 2XYAA 1ANCA 3SV7A 1SFIA 2BDCA 4WJG2 1MTNC 3BIVH 2THFB 2C90B 1FAXA 4D76A 3SUEA 1ELFA 1QFKH 1GJAB 4K1EA 3ZVEA 3B8JA 3DFLA 1K1JA 4JCNA 1ZZZA 4GCHF 3RXLA 4XSKU 2ZGCA 2GV6A 4A92A 1J9CH 2J9NA 2Z3EA 3GDSA 4ZUHA 2LNCA 1OWEA 1BTZA 3LGVA 1O2QA 3GCNA 3ZZ9A 3BN9A 1AD8H 3RXFA 1CE5A 2ZO3H 6GCHG 2BQWB 1CBWB 5EXMA 1ELVA 1MCVA 3P8NA 3BG4C 4KTUA 4INHA 3O8DA 1SGEE 1P8VC 5A8ZA 1F5KU 3SUDA 1MKXK 3RP2A 2ODYB 2FOAA 2QXJA 4E7RG 3PMBB 1THRH 1P05A 1H9IE 3ZVFA 1AWFH 2P3UB 2B5TB 3D23A 3Q3XA 1GVZA 1AHTH 1O2YA 3UR9A 3UUZA 2AGGX 2G51A 3B23B 1SGIB 1GI5A 1NRQH 2FOMB 3OX7U 1TNLA 1DANH 1O2NA 2QAAA 5DP3A 1P2KA 2AEIH 3SUGA 3F9FA 1MTVA 2Z6BD 2VB0A 2XTTB 2JETC 2QF0A 3AASA 1D3DB 2ZU2A 3SNEA 3RLWH 4NFFA 3P92A 1ZJKA 4OS2A 2XBVA 3GCTG 3ZZ5A 2G4TA 3D62A 2Y6TA 1O5DH 1KY9A 1GHZA 1K1MA 3VB3A 2OXSA 3QLPH 1BTXA 1XXDA 1YPEH 2PSXA 3K6YA 3KCGH 1AO5A 1PQ5A 1O3IA 1YPHC 3A86A 1GHYH 2EI8A 2H1UA 1DLEA 1RS0A 2FOCA 2G5NA 1EXFA 1D4PB 2A4RA 4FUEA 2Z9KA 4HTCH 2I6QA 4D9RA 2AIPA 1BTPA 2WUBA 4AZ2B 4BXSA 1TIOA 3HKIB 3C1KA 2J2UA 2RDLA 4MG3A 2SFAA 2FZZA 1H1BA 5EW1H 4ZHMU 1HV7A 4Y79A 1Z71A 2F9OA 4I8GA 2HPQH 3TGJE 4YT7H 5L30H 1VJAU 4CH8B 1GBKA 1V2VT 1Q3XA 2ZGXH 2EI7A 1X7AC 3SJ9A 3A7VA 3TGIE 3GY7A 1S6HA 2AH4X 3SOSA 3TJUA 2H6MA 2W7SA 1NESE 1W14U 5FBIA 4FU9A 1SGFG 1V2WT 2A45B 2SGPE 3MH6A 1ANDA 1SSXA 2HRVA 4Y71A 3SNBA 2ZIQH 3ZZDA 4DY7B 1O3GA 2QC2A 3E3TA 3S0NA 2OTVA 3UTUH 1RTFB 2C8ZB 1A4WH 1FN8A 2QXGA 1C1SA 1W13U 2ZGHA 2QY0B 3EYDA 3FP8E 2BXUH 1QR3E 1TE0A 3QUMP 2XXLA 1O3OA 5E2PA 5EODA 1T32A 3MO9A 3RU4T 3QTVH 1XVOA 5HYOA 1DUAA 2ZG0H 4GCHG 3RXEA 1ANBA 1DXWA 4O97A 3MO6A 1H8IH 3RUOA 1C2FA 1C1WH 4K8BA 3A7XA 1Y5AT 2C3SA 3KIDU 2FS8A 3TJOA 3M5LA 3MWIU 1GL1A 1UTMA 2R0LA 5I46H 2B9LA 3IG6B 3PTNA 4X6OA 1ZLRA 1FJSA 3ZVCA 1HJAB 4I8KA 4IN1A 5T6FA 3TPIZ 3UQOA 2VIQA 1HAGE 4FUHA 5CMXH 1C9PA 4MNWA 1TGSZ 1O3AA 2BD5A 3BEIB 2NWNA 2XW9A 1YYY1 1TGTA 2JH6D 1HAHH 2CMYA 5TCAA 1O36A 4YLQH 2BD7A 4CHAB 1P2IA 3V0XA 4DVAU 3DD2H 6ESTA 1KLTA 5H4IB 1DWBH 2QN5T 1BITA 1HJ9A 1O39A 5B6OA 4U30A 3RXGA 1ZMLA 1NN6A 2GP9B 2FX4A 3FZZA 3OSYA 4LK4A 4RN6A 3QK1A 1P10A 5PTPA 8KME2 1UTJA 3MNCA 2FP7B 3BTEE 1VITF 1G3CA 3ZYEA 2A2XH 4OS1A 1ELTA 2ZI2H 3HKJB 1ZMNA 1IQKA 1TALA 1PPEE 5F8ZA 1Z1IA 2BXTH 5DP4A 2ZU5A 3O8RA 1C5PA 1AWHB 3A88A 1FMGA 5I25A 2STAE 3UR6A 1GCTB 5LH8A 1KTTB 2Y81A 3L6PA 1P3CA 1XMNB 4X1NU 1O5AB 1BOQA 4THNH 2BD9A 2R0KA 1EAWA 2VH0A 3ODDA 4YOJA 3SZNA 2ALVA 4DT7B 3RC4A 1YLCA 1NT1A 1HAIH 1C5UA 1HCGA 4U01A 2F91A 4OS7A 1GDQA 1P9SA 1Z8IB 1BMMH 2AMQA 1Y3UA 2D26C 5FHTA 3URCA 3RXSA 2VWNA 3RXAA 2ANYA 2A5IA 1C4Y2 3SJKA 3VEQB 3MNSA 1BRUP 3EA7A 4AFUA 1OWKA 1TA6A 4WVPE 1FI8A 1M9UA 1NC6A 1HXFH 1PYTC 1GWAA 3MNBA 3MU5A 2FM2A 1F5RA 4XOJA 4GHQA 2PGBB 1PPHE 4B2AA 2PKSC 2FX6A 1A7SA 1ZTLA 1SGPE 3P95A 4CH2B 2C8WB 1O5BB 1MAXA 3P6ZB 1T8OA 3EDXB 1TX6A 1O31A 3P8FA 4JZIA 4B73A 2RA0A 1QL7A 3PLBA 1TPAE 1RTLA 1CU1A 1PFXC 1WV7H 2ANKH 4KTCA 1S85A 2YOLA 1TWXB 1JIMA 1YPJH 2OC7A 1YPKH 3GYMA 5C5OA 1P57B 1V3XA 4QT8C 4PROA 4O3UA 2GT7A 4FUDA 1W3CA 1OP0A 4IMQA 3M61U 2A7HA 3PMAB 1AFEH 1RGQA 2Y7XA 3RMLH 3SNDA 2WPIS 4A1XA 1FN6A 1GJBB 5DKMA 4NIXA 1TMTH 4BAMB 1TGBA 4KTSA 3GY4A 3P17H 5DK1A 1V2JT 3SJOA 1HRTH 2BDAA 1GMDF 4CRCA 5IDKA 4K3JA 2A31A 1K28D 1P2NA 1FQ3A 5FXLA 3FP7E 1Z8JB 4H6TA 1QTFA 4ISOA 3O8BA 4KKDA 1CGJE 1V2RT 2TBSA 4A1VA 4WF8A 1THPB 3RM0H 1A46H 2XWBI 4AFZA 1MTNB 2ZHWH 1EP5A 1V2UT 3C27B 1S0RA 4ISNA 2PTCE 1E36B 2F9PA 4RKJB 1ZHRA 2GKVE 1IQIA 1GDNA 4H6SB 1GPZA 1V6DA 3ZZ6A 1LVBA 2WPJS 3A80A 4NWLA 2P8OC 1QB1A 2GGVB 1JIRA 1HJ8A 1C5XB 1IQMA 1Q31A 2HVXA 1GL0E 3E16B 5A0BA 1Y59T 4K1SA 2W5EA 3BG4B 3BTQE 1WSSH 4MLFB 4XBDA 1VCQA 1HAXB 5EPYA 1TPOA 3ZZ4A 2WV5A 4BTTB 1FDPA 1K22H 4ISLA 2SGAA 2Q6GA 1OPHB 2Y80A 2DE8A 4CBNA 5C67A 4A6LA 2XRCA 4HGCA 2Z94A 4E06H 4E05H 3LKWA 1TNKA 2FOEA 2NU0E 1S82A 3M7UA 1KIGH 8ESTE 1O0DH 2PW8H 3U1IB 1AY6H 1TBZH 3PMJA 2ALPA 5ESBA 1C1VH 2FESH 2UUYA 3FP6E 5A0CA 1A5IA 4WMFA 1C2KA 2HWLB 3EGKH 4DW2U 4NWKA 1GGDB 2JETB 2NU3E 2J38A 2BDHA 3JZ1B 3RXTA 1UK4A 1OOKB 3ZV9A 1TNIA 1AFQC 3GDUA 5T6GA 2ZQ2A 1ZRKA 4NZQA 4ASHA 1BCUH 2BQ6B 1Z7KA 1G36A 1V2KT 1ELGA 1LKAA 2NU1E 3SU2A 5LPFA 1QA7A 1C5TA 3LT3A 4WWYA 2BTCE 3A8DA 6CHAB 2GCTC 4ABFA 4O3TA 1EPTB 4R0IA 2RA3A 3F9EA 1ZTKA 3CP7A 3SORA 4Q7YA 2H9HA 3FANA 1HIAB 1PPBH 1YKTA 3SU5A 1XUJA 5SGAE 4GPGA 1ARCA 2HNTC 5HXFA 1TRYA 1O3FA 4A7IB 3V3MA 1GVKB 4RSPA 3EA8A 4Y0YE 3TIUA 2YNBA 1DPOA 2WPKS 1NU9A 3AW0A 3D49H 2FTLE 4GHTA 4AB8A 1HB0B 3LIWA 1EPTA 1LVOA 4F49A 2C8XB 5FPTA 1J14A 5F8XA 1BBRH 1CGHA 4J1YA 5DO4H 4I7YH 1TQ0B 5A0AE 5LPEA 1TQ7B 8LPRA 1HIAA 8GCHF 5A2MH 2O8LA 4Y6DA 3T28A 4MPXA 4NZLA 1P0SH 1H8DH 1NFUA 2BX3A 4I8LA 1MAYA 5GCHF 2P16A 1SHYA 1VCPA 4MNXA 1V2QT 1L1JA 1PPZA 5G4BA 2AYWA 1S5SA 5C1YA 2BZ6H 1CQQA 3KEEA 5J4QA 3RXRA 1QIXB 3UNRA 1NFXA 4RKOB 3V13A 1FY8E 2J95A 1MQ6A 1G9IE 4OS5A 3RMOH 3IITA 1UTLM 2A4QA 2ULLA 2WPHS 3WY8A 2ZTYA 5E2OA 4X2XA 3LJOA 2D8WA 2ZCHP 4K2YA 1BHXB 4FUIA 4NA8A 2SNWA 1P02A 1RIWC 9LPRA 1Y5UT 2DUCA 1JXPA 3FFGA 4Y8YA 4NA7A 3OYPA 1TFXA 1A61H 3TITA 4FVBA 2ZPSA 1C1QA 1DITH 3SU6A 5C1XA 1FNIA 1N1LA 4FUJA 1VR1H 3A81A 1J16A 1ETTH 2P94A 2ZU4A 4MNVA 3NZIA 4GLYA 3BTGE 4B1TA 2PWXA 3A7YA 1SQTA 4B75A 2BLOA 2XBXA 1GJ7B 2PV9B 4X8TH 1ZHMA 2AGEX 2VU8E 4AB9A 3SGBE 3MMGA 1JWTA 4B74A 4TPYA 1O2JA 1O3CA 2ASUB 2QGRA 3MO3A 1V2LT 3A7TA 4UONA 1SOTA 1B7XB 1C1UH 2A7JA 1GG6C 2OBQA 2GDEH 4K5ZA 3U8OH 4Y8ZA 2PUQH 1O2TA 4K8YA 4JMYA 1YP9A 1NROH 5C3NA 1JOUB 1V2MT 3RXIA 2XCNA 2G4UA 4UEHH 1L1GA 3K65B 3TH4H 1QQ4A 4MTBA 3S9CA 3SGAE 1AVXA 1GBHA 4ZMAH 1KDQB 3ATWA 3MTYA 2Z9IA 1AVWA 3FAOA 1D3QB 1LO6A 3R3GB 1BBRK 1P06A 1IQFA 1O3LA 3L33A 1XUHA 2VH6A 1SLWB 1F0SA 3GCOA 3SU3A 1MTWA 2FIRH 3SQHE 1O2SA 4I33A 1C4V2 4TY6A 3CENA 4M7GA 3TNTA 3W95A 2FS9A 1G3EA 3BTME 3VXEH 1TOMH 3F9GA 3Q3KA 3ZZCA 5LGOA 4LXBH 3KQCA 1C5VA 5DP7A 1NU7B 2FDAA 3LGYA 1RD3B 1O3NA 1KDQA 1GI1A 2QA9E 1Y5BT 1SGTA 1Z6JH 4X8SH 1O2HA 1LVMA 2F83A 1TOCB 1Y8TA 4UD9H 3A8CA 2PKSB 2V3OH 1MZDA 1ELAA 1GHAF 1EAXA 1HAVB 2ZHEH 5EQQA 1AZZA 1BTUA 4ZKOU 1XM1A 3SI3H 3VGCC 4I8HA 1HUTH 4IMZA 1W8BH 3E0PB 1TMUH 4LZ1H 1UVOA 1QBNA 2WUCA 3RXHA 1F2SE 3VB7A 1RRKA 1SHHB 1SGQE 1UK3A 1XUFA 4MPUA 3RXDA 1AZ8A 4NCYA 2ZPRA 2BY8X 5EQSA 1KXCA 3QO6A 3PB1E 4Y7AA 2PSYA 3SJIA 3ZVDA 1U6QA 2GZ9A 3QZQA 2GVFA 2OQUA 4WMDA 1F7ZA 3SNAA 3MI4A 2TGAA 2GD4B 4JYTA 2Z7FE 3I78A 6LPRA 2R2WU 1LQDB 3H7TA 2VIDA 2XC5A 1O3BA 5C5NA 1WYKA 1G2LA 3I77A 3SU1A 1OWIA 1BTHH 1XXFA 1CSOE 2PLXA 2V0BA 1Z6EA 4LOYH 5L6NH 1GHVH 1IHSH 2OC0A 2Z9JA 1GJ5H 1BJVA 1EJMA 2ZFRH 3TK5A 2ZFPH 1AE5A 4U32A 2CF9H