4ZKSU

The crystal structure of upain-1-w3a in complex with inactive upa (upa-s195a) at ph7.4
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
246
structure length
246
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDAGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Urokinase-type plasminogen activator
publication title The crystal structure of mupain-1-IG in complex with murinised human uPA at pH7.4
rcsb
source organism Homo sapiens
total genus 58
structure length 246
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2015-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4zksU02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4zksU01
1W11U 3P92A 1ABJH 2PV9B 1Y8TA 3SU4A 3ZZ7A 2GT7A 1SB1H 2BLVA 1UVOA 2GCTC 2ZP0H 5E0GA 5JDUB 1OS8A 3T28A 1QL9A 2XRCA 2FMJA 2WYGA 3TNSA 1GG6C 1LQDB 2CJIA 1QURH 3E91A 1PQ7A 2OUAA 5DP4A 2F9NA 2ZHQH 3K2UA 3HPTB 3PROA 1ZHPA 3M7UA 1P2OA 3PM3A 2PSYA 1YBWA 1GJ8B 3GDSA 1IQIA 1IQGA 2FPZA 1HFDA 1K1MA 5GCHF 5B6OA 6LPRA 2UUYA 2RDLA 2BVXH 3SGBE 1H8DH 5IDKA 2GDDA 4DIIH 1JIMA 1LVOA 1C5ZB 2XTTB 5A8ZA 4LZ1H 2A4OA 5GJ4B 2PKSB 1WOFA 2BDAA 2W7UA 4Y10E 1FV9A 2ZGBH 2H1UA 1GMDG 3KCGH 1MTNC 2C90B 4H6TA 1CU1A 2XCFA 1L2EA 2AIPA 2ZECA 1AE5A 3TK9A 4AN7A 3A7WA 4WH8A 1QQUA 1YCPM 1YPKH 1GI6A 2JKHA 4TWWA 4U2WA 4AG1A 1LDTT 2Z94A 1RIWC 1ZPBA 2ZCHP 3TNTA 1WBGB 3F68H 5AVDA 2UUKB 2BXTH 2BDYA 2ZGXH 3ZZBA 3T26A 5EXMA 3ZVCA 1BMLA 2A7JA 2BDGA 2BY8X 4WY3A 1GMHG 1UCYK 5FX5A 1FN8A 3C27B 2M5TA 2A2QH 1C5LH 1OP2A 5ETXA 1HLTH 2PKAB 4MTBA 2G81E 3PLKA 1ETRH 3NPSA 2IOTA 2XNIA 2D1JA 1O2KA 4A92A 3RU4T 3V3MA 2FYRA 4K1TA 2WYJA 4AFQA 1E35B 2XCNA 1A3BH 4I7YH 1BTUA 2UWOA 1RRKA 2HLCA 2BVSH 4DVAU 1NFWA 2SGFE 1YPLH 1GBLA 3TJVA 1S0RA 2BMGB 1O2HA 5JBBS 4BXSA 2TGAA 1WQVH 4UONA 2ALVA 3KF2A 3VB5A 2VGCB 1GBEA 2Y6TA 2RG3A 1ARBA 3P8OA 1AMHA 4HGCA 4NA9H 3TGJE 1AB9C 1FDPA 3NCLA 3FANA 4NA8A 4CH2B 2FWWA 4BNRA 2ZPSA 3L33A 1GI7B 4I8JA 3ESTA 4Q2KA 2H5DA 1S85A 4ESTE 1V2KT 3UWIA 1BMNH 2LNCA 1W3CA 3LGIA 3A88A 1AZZA 2JH0D 4LK4A 2QCYA 1AUTC 2HGTH 1GBFA 2G5NA 1AVWA 2BLWA 1SBWA 1BDAA 3GY5A 2G00A 3RMMH 1HAGE 3RXFA 1IHTH 1MKXK 4GCHF 4Z0KA 4DCDA 2J34A 1ZHMA 3ZVDA 1HV7A 3M3SA 4K8BA 4AFSA 8ESTE 3DFLA 1T8OA 2OLGA 5H4IB 3MFJA 3DD2H 1BITA 2FX4A 3RU4E 1DLKB 5K7RA 1GMHF 3BG4B 1TWXB 7GCHG 1Y5UT 1SGQE 4Y8XA 1ESAA 4M7GA 1F5RA 1BT7A 4Y7AA 3M61U 3SU6A 3STIA 1INCA 1LHDH 2RCEA 4BAOB 2R0LA 4AG2A 1J9CH 4ABAA 1D6RA 1GHXH 1TLDA 3SJ9A 2DE8A 1DANH 4ABFA 3MU5A 4U30A 2OINA 1MQ5A 3TPIZ 1CT0E 1TPPA 4IC6A 1P0SH 4GVUA 1P02A 3GY8A 1UTJA 2FIRH 2GCHG 4X1QU 1CGHA 2VJ1A 3RXDA 1BTZA 2QXJA 1AVGH 5JBCS 1QRWA 1GJ6A 1PYTD 1SI5H 2Y5GA 4YT6H 2A4GA 1BJUA 1S6FA 2EI6A 5EU8A 1GGDB 1C1UH 2C8WB 4FUBA 5JPMH 1VJ9U 2H5CA 4X6OA 3BTQE 5T6FA 1O5DH 3T62A 2CN0H 2FOGA 2EEKA 4DG4A 4RSPA 2HPPH 1EB1H 1NC6A 3ZZ8A 2P3FH 1ANBA 1IQJA 3TH2H 5EQRA 1FPHH 1O3NA 2HPQH 7ESTE 1YPEH 4MG3A 4K2YA 1TBZH 1FAKH 1YCPK 2QV1A 2BOHB 3S9BA 1UVSH 1C5TA 4I8HA 1D3QB 4WMDA 1C5VA 1J14A 4JCNA 1AN1E 2VB0A 1RFNA 4CREA 5ESTE 2BY7X 3SUDA 1TAWA 3F9GA 3SU0A 5J4QA 1X7AC 3LT3A 4ABGA 4AOQA 3A7VA 3RXOA 1YKTA 3TLOA 3RXMA 2FM2A 2FOBA 1QB6A 2LPRA 4MNYA 1THPB 5DP7A 1GJ7B 3E1XB 1EXFA 2ZWLH 3OX7U 1CHOG 4CHAC 1UMAH 2YNBA 1EZXC 1K2I1 1TGNA 2P95A 2K1QA 4GUXA 1LCYA 2ZO3H 2HOBA 2GD4B 1P06A 3LU9B 1QY6A 1L1NA 4KTSA 1CA0C 1O3IA 1MU6B 2GCHF 1GDUA 3UQOA 1ZMLA 3RXTA 2FOHA 1GBDA 1AKSB 1CBWC 2P3UB 4FUEA 1P04A 3LKWA 5SGAE 3ZV8A 1GHBG 1QRXA 5HXFA 1TOCB 4BAHB 3GY7A 2O8UA 1C2JA 3F9HA 1ZTJA 2XBWA 4SGBE 2R3YA 4JZ1A 1HAPH 5JB9S 5EQQA 1O3GA 1FIZA 1ETTH 3LGYA 4NIXA 2BDIA 4D76A 1ZTLA 1DFPA 4X6MA 3URDA 4B76A 1TPOA 1P57B 1XUGA 1ELGA 2FODA 1P2IA 1Z8GA 2ZNKH 4ABIA 3E0NB 1VITF 1ZMJA 1M9UA 2ZG0H 2Y5HA 4Y0YE 4O03A 4Y79A 1J8AA 1HCGA 3E6PH 1N6XA 1TRNA 2Y82A 1DOJA 3I29A 4FUIA 4MNVA 5G4BA 3RMNH 1HRTH 1QL7A 3DFJA 3ATLA 3O8CA 8GCHG 1GBMA 3P8NA 1DS2E 6CHAB 1GHVH 4A5TS 1CHOF 1GBCA 2FZZA 1BTWA 3MU8A 2PWXA 1AIXH 1BJVA 1THSH 1C5RA 1IQMA 1GBBA 1UK3A 2A7HA 3A8AA 4INLA 4O3UA 5E0JA 1KIGH 1LHEH 2BY6X 3SO3A 5C3NA 2GZ9A 4NIYA 2ILNA 2ZU2A 5AF9H 3A7XA 1P05A 1C1VH 5EG4A 3RC4A 1GCTC 2FDAA 1V2RT 2FOFA 3MWIU 3A84A 5GWZA 3GCHB 3TK6A 4ABEA 1GHBF 1UK4A 1AU8A 4WWYA 1D3PB 2VVCA 1H4WA 3W94A 1WQSA 5HMAA 3RXRA 3SI4H 3SJ8A 3EA9A 3FAOA 1K9OE 1OWHA 1FMGA 4GPGA 3SHCH 1A5GH 1CO7E 2Z9GA 1HAHH 3K6YA 1PPHE 2ZCLP 1HDTH 4NG9H 1O3HA 4NFEA 2ZDAH 1NFUA 1FJSA 2WPLS 3AVZA 1O5AB 5DP6A 4ZUHA 3V7TA 5JBAS 2F3CE 3AW0A 5LPRA 2Z3DA 4CRBA 1TNLA 2FS8A 1MZDA 1F0SA 1MTWA 3QLPH 1GI1A 1O3DA 3GOVB 3A7YA 1NU9A 1O35A 3AAUA 1WTHD 1V2TT 1N1LA 3A85A 5JB8S 2UUJB 2WV5A 3QX5H 3SUFA 4IGDA 5FBEA 2JETB 1GHYH 1O3EA 2O8TA 3W95A 2O9QA 2A31A 1DWCH 4AYYB 2ZU4A 3U8OH 4Q7XA 5A0BA 3TGIE 1QJ1B 2UWLA 1DXPA 1XVMA 2QF0A 4OS2A 4D9RA 2ZKSA 2ZQ1A 3T27A 1EPTB 3P8FA 1HAXB 4Q7ZA 3RDZA 1Y59T 1OKXA 1UO6A 3ZV9A 4DY7B 1TMBH 1O3OA 1W14U 2O8MA 3A87A 1GBAA 2WPMS 3KQCA 2VWMA 1O36A 1SLXB 4ZKNU 1SLWB 3SNCA 4CRCA 1K1JA 4X1SU 1CGIE 3SJKA 3KQBA 1KXDA 2BY9X 3V13A 2QAAA 3BTME 1QBVH 2J95A 2VNTA 3BEUA 2Y7ZA 4RKJB 4X2XA 1O3JA 1RGQA 3TH4H 1QA0A 1Z6EA 2P16A 1SGEE 5L30H 2ANMH 3F9EA 3PMJA 1FY5A 1O2QA 3BEFB 1DX5M 4XBCA 4YESB 1ZLRA 1TPSA 4YTAA 4D9QA 3FZDA 1UTMA 1O2JA 1GHAG 2ZU1A 1UVPA 1SSXA 3CENA 4E06H 1DICA 2VIVA 1ZZZA 1O5GH 2BD9A 1HJAC 3SV2H 1RS0A 1QB1A 3GCNA 4FXGH 3DA9B 2BZ6H 2G55A 2W3KA 1K22H 1MMJN 4WXVA 4VGCB 1G37A 1V2JT 2FTLE 3M5MA 1PQAA 2Y80A 1TA6A 3GDUA 1CT2E 4K8YA 2BLQA 4X8VH 4FU8A 3HATH 5FCRA 4XE4A 2FLBH 1OWEA 1C2DA 2H2ZA 1NRSH 1Z8RA 3KQDA 4B2BA 2AEIH 2GMTB 2NU2E 1CSOE 1HB0B 1Y3XA 1FONA 1ANEA 1L0ZA 3PMHB 1GJ5H 4UFEH 1LKAA 2TGDA 4R8TB 2WUCA 3QO6A 5T6DA 2AGEX 1GJ4H 1ID5H 3M7QA 5E2PA 3ZVBA 1PPGE 3BTGE 1GG6B 2BD2A 1TIOA 3QDZB 2OD3B 1C5OH 3AAVA 1Z8IB 1OXGA 3RXEA 1AKSA 2DE9A 1SFIA 1O2OA 1ZRKA 1O34A 3TITA 1BRAA 2PUXB 1YLCA 5CE1A 3EDXB 2HNTF 1LPGB 1HAVB 3S7KB 5GPIB 4E05H 1OP8A 1LPKB 1GBIA 2A4QA 1MCTA 1WUNH 1YM0A 3NK8A 3PTNA 3ZVAA 4OS6A 4SGAE 1PQ8A 1GCDA 5T3HA 2G8TA 2ZCKP 4DGJA 1GHAF 2BD8A 2BLOA 1XVOA 3EGKH 1EAWA 1WTGH 5ESBA 1QQ4A 1MTNB 5F03A 3P95A 2PLXA 3MU1A 1ZSLA 3T25A 1P9SA 3GY4A 4H42U 1QL8A 1NM6A 5F8ZA 4O97A 4CBOA 2VWLA 4I33A 1AWFH 1QBNA 3MNSA 2PGBB 2J94A 3LONA 1MZAA 3P17H 2ESTE 1AGJA 1XXDA 3PMAB 1F7ZA 1Q31A 1MQ6A 1WAYB 1SQTA 1C1MA 2C93B 2TIOA 4FUCA 1UJ1A 1W0ZU 4KGAA 1MBMA 2FESH 2XC0A 3SU1A 1TONA 2H9TH 1O2WA 4I31A 4BTIB 1CGJE 3Q00A 1EJAA 3FVFB 1YCPH 2FEQH 3H7TA 2BDCA 1IQEA 4GCHG 1NRRH 1H9LB 2A32A 1XM1A 4AFZA 3O8BA 4HI3A 3UPEA 3LC5A 1TMUH 1P3CA 4UD9H 2KAIA 2OC0A 1O2RA 2OC1A 1SGFG 2C8YB 3TVJB 1C1PA 4YZUA 4MDSA 4CRDA 7KMEH 4OGYA 3WY8A 2ZZUH 1C2LA 3RXKA 1DWBH 3UY9A 2ZFQH 1VCPA 2IN2A 1FI8A 2BY5X 3SJIA 4X6PA 1QIXB 1SGCA 2PUQH 4K69A 1O3MA 1T31A 2VU8E 2AIQA 3RXBA 1DT2A 1G30B 3SW2B 5C1YA 2OC8A 2B0FA 1EAXA 1S0QA 3A89A 3QGJA 4Q7YA 3PMBB 5E0HA 1G3BA 2IJOB 1C1QA 1XX9A 1B0EA 1UTLM 4I32A 3DHKH 3HK6B 4Y7BA 2ZC9H 1QGFA 8KME2 1P3EA 3M36A 3SGQE 3NUMA 1TBQH 3A8CA 2R2MB 2SGQE 4BXWA 2ZF0H 3OTJE 4Y8YA 3LGTA 2AGGX 1IAUA 5LPEA 3KHVA 2A7CA 2ALPA 1O39A 3PYHA 2YOLA 1W7XH 3VGCB 2Z3CA 3SQEE 4KTCA 5DK1A 3LDXH 1EKBB 1PPCE 1C1OA 2D26C 1EOLA 4FUDA 5AFZH 1JRSA 2F9OA 2WPHS 3QGNB 2TGTA 1LVYA 5GDSH 1EPTA 4AFUA 1DE7H 2FOMB 2V35A 8LPRA 4ZKOU 3EQ0H 1G3EA 4X1PU 3JZ1B 1C4U2 5FPSA 1HBTH 2BYAX 1ANCA 4YOJA 1HIAA 2BDHA 1XUKA 2VGCC 1SC8U 1VJAU 3Q3YA 1C1TA 3SNBA 2XBXA 3MU0A 3UFAA 2Z9IA 1C2KA 4CR9A 1HAIH 2CGAA 4X2YA 3LC3A 1RTLA 2PW8H 1L4DA 2SGEE 2QXHA 1GI5A 3RXUA 3RXGA 4OGXA 1TQ7B 3ZVEA 1AFEH 1SGTA 1O2XA 2AH4X 3MOCA 3UREA 1W13U 4NSYA 3VFEA 5EGMA 1SGYE 1YPJH 2YNAA 3ZZ4A 2BQ6B 1HXFH 3MNXA 2A2XH 2I6QA 1GMCG 1JWTA 2FTMA 5EQSA 2OTVA 2OXSA 2ZTYA 2PFEA 4ISHH 3PO1B 4NCYA 1BA8B 1JOUB 3MI4A 2GTBA 4WXIA 3RXCA 3BG4C 2VWNA 1SOZA 1GJBB 5I46H 1A3EH 3RM0H 1JIRA 3OU0A 2H9EH 3EYDA 1PPZA 4Y8ZA 1PYTC 2Q1JA 2SFAA 3EA7A 9LPRA 3A8DA 4FU7A 1YPGH 1O2ZA 2ZPQA 1ESTA 2QN5T 4CBNA 4ZHMU 1OYTH 1KXEA 1QNJA 1ELBA 1K1IA 3UIRA 1W2KH 4B71A 4YM9A 1T4VH 1Q3XA 3FP7E 4D7GA 1B7XB 5JYIA 1TA2A 5EXNA 5AFYH 2R2WU 3A86A 3RC5A 2FYQA 4MPWA 1GI4A 1TNKA 2H6MA 4NZQA 5TJXA 1C4V2 3B9FH 1SQAA 1ESBA 1IHSH 1C2EA 1A2CH 1IQFA 1C2MA 2GP9B 2VH6A 1K21H 4NIWA 3LH3A 1C1NA 5EXLA 2SGPE 5DJ7A 2XBYA 1ELFA 4OS1A 2J4IA 2A45B 4XDEA 1VITG 2WPIS 5C5NA 1OX1A 2ZDKA 4FUFA 3H7OA 1HAVA 1BTHH 1YPHE 2FLRH 1NY22 2HVXA 1YPHC 1IQLA 2F83A 2ZQ2A 1FPCH 3A83A 2ZA5A 1FY1A 1GGDC 1C5XB 2V6NA 1IOEA 3KEEA 4TY7A 4BAMB 4LOYH 1V2MT 1ZSKA 1V2ST 5BPEA 2XWBI 1GJAB 3F6UH 2G52A 4IW4E 1AFQC 2TGPZ 1GMCF 1ZJDA 4WF8A 4YOIA 3HGPA 4R0IA 1TABE 1T8LA 3C1KA 3G01A 1HAOH 1J17T 1GJCB 2A5AA 4DJZB 3CS7A 1QB9A 4IC5A 3ZVFA 1EJNA 1BZXE 1CT4E 1S6HA 2JH6D 3RXJA 3UUZA 1H1BA 2W26A 3A8BA 1YPMH 1QJ6B 1UHBB 1F92A 3OY6U 4MLFB 5A09A 1XUHA 1SGFA 3RXPA 1C5MD 3ZZ6A 2DUCA 3PLBA 1SPJA 5HM9A 1Y3YA 3QTOH 2O8LA 1S5SA 1TNJA 4B75A 3MYWA 3SU3A 1W7GH 1BRUP 3Q76A 2GX4A 1XKAC 5HYOA 1D9IA 3EE0B 1GJ9B 4MQAA 4K5ZA 5FPYA 1Z7KA 1TGBA 1MD8A 3I77A 4JZIA 1DPOA 1THRH 1PPEE 3KN2A 5LH8A 3BTHE 1P9UA 4TWYA 1GI3A 1GI0A 4NA7A 1L4ZA 2PGQB 3UOUA 1O3AA 1IQKA 2HWLB 2W5EA 3NXPA 5CHAB 3K9XB 1UTQA 3GY6A 1OSSA 1EZSC 2F91A 3HKJB 2BXUH 3U9AH 2VH0A 2XC4A 1NZQH 3T29A 1EX3A 1TFXA 1ETSH 2GDEH 2ZFFH 3RMOH 1G36A 4IBLH 1ELVA 4AZ2B 1L1GA 1SHHB 2PKAA 2P59A 1V2LT 5EOKA 1ELEE 2NU3E 4XSKU 3M5LA 4IMQA 3VB4A 1O31A 2Z6BD 3SNAA 1TNGA 2J38A 3Q3KA 1V6DA 3QTVH 2ODYB 4AB8A 3SU2A 1GPZA 1B5GH 1P2NA 4X1NU 1D3DB 1KTTB 1VGCB 4OS4A 2AMDA 1Z1IA 5C5OA 4U32A 1LQEA 3VB6A 5A8YA 1O38A 3SV7A 4NFFA 1C5WB 2WINI 4BTUB 1N8OB 1NESE 4NWKA 5LGOA 3FFGA 2BQWB 1OYQA 2ZTXA 3E3TA 2EI7A 3SN8A 1EATA 3S9CA 3LOXA 4LZ4B 3NWUA 1A61H 1BMAA 1O2TA 4KKDA 2PR3A 3MO3A 6CHAC 1BQYA 1P09A 2D2DA 3O8DA 2O8WA 3QZRA 1NRQH 3GY3A 2XYAA 2QXIA 1S84A 2BVRH 1C9PA 1O2YA 1DY9A 3CP7A 3PB1E 4X8UH 2VIQA 4CRAA 3A7ZA 1UVUH 1TNIA 1U6QA 4O9VA 3A82A 1C1WH 1FNIA 3SBKA 3VEQB 5C67A 1PPBH 2FO9A 4F4OC 4UFGH 2FOAA 1O2GH 1RJXB 1TX8A 1O3BA 3K6ZA 4KP0A 3M5NA 1YYY1 3ODDA 2G4TA 1RXPA 2GKVE 1GDQA 3GDVA 4YLQH 4Q80A 3UNQA 1CA8B 1ZTKA 4ZROA 1G3DA 3LIWA 4J1YA 3SQHE 2QXGA 4JMYA 4E7NA 1C5UA 2BDBA 2ODPA 3RXIA 1JMOH 1BHXB 1EASA 3KIDU 1IQNA 1FXYA 2ZIQH 5GIBA 2PSXA 3PLPA 1O3LA 1EZQA 1XKBC 2AERH 1GBHA 1DVAH 1V2OT 1ZOMA 2Z3EA 4DT7B 3BIVH 2BD7A 1VCQA 1BIOA 2F9VA 1LHGH 3KGPA 4K3JA 1BBRE 4WVPE 3BTKE 5EW1H 2B9LA 3VXEH 1ARCA 1SLUB 3DUXH 3M3VA 3V12A 2JETC 2C4FH 3ATKA 3QN7A 1A0JA 2FX6A 2P8OB 2WPJS 1WU1A 1C4Y2 1EUFA 1ORFA 4AYVB 1WCZA 2HNTC 3OY5U 4B74A 1C5YB 4IS5A 1E0FD 1TX6A 4WMFA 2W7SA 1D4PB 4XBDA 5TCAA 4HTCH 1TGCA 4UDWH 1C5NH 2UWPA 2ANWA 1RD3B 1OWJA 1FLEE 1ELCA 1EPTC 2R9PA 4TY6A 1OWDA 1UVTH 1Y3WA 1TBRH 4INHA 1MTVA 1OWIA 4ISIH 2GZ7A 1L1JA 2QGRA 1P8VC 1Y5BT 3S69A 2NU0E 3ZZDA 5IYTA 1WV7H 2Q6GA 3HK3B 1AZ8A 1QBOA 1UK2A 1A5IA 3MHWU 4YLUA 5C20A 4GLYA 4IN2A 4OS5A 3UR9A 3TH3H 2A5KA 5A2MH 1MU8B 3MH5A 1MKWH 1F5LA 4H4FA 1LMWB 2B7DH 1KLTA 1V3XA 3D65E 3AW1A 4Y76A 5A0AE 2BB4A 3QK1A 1G32B 2J2UA 2BHGA 5L2YH 1LVBA 1BBRH 3PWCA 2GCTB 2A5IA 1GHWH 1O2SA 4BTTB 1FZZA 1GI9B 1GWAA 4FUGA 3K65B 1P11E 1F2SE 5DO4H 3KL6A 1P2QA 2UUFB 4VGCC 2Q6FA 3L6PA 1UHBA 1O5EH 1MH0A 1G9IE 1FUJA 1SGDE 3D49H 3MNBA 2FI4E 5DP5A 4X6NA 1QJ7B 1BTYA 1KDQB 1IQHA 2V0BA 1GBKA 1JRTA 1O37A 1A4WH 1ELAA 1TQ0B 1BHXF 1K1LA 3D23A 1QR3E 4MVNA 3ENSB 4NWLA 1LTOA 1KXFA 2WUBA 3M35A 1P2MA 4ABBA 1AO5A 1W10U 4YT7H 2ASUB 2ODQA 2EA3A 2G5VA 1DSTA 1QHRB 3ZYEA 2AMQA 1YC0A 2QF3A 1EAIA 2OP9A 1DUAA 2EC9H 3LGWA 4JK5A 3ZZ3A 3P6ZB 4KELA 2P94A 4ZXXH 1C5QA 1ANDA 1WYKA 5FPTA 3LJJA 3VB3A 4A1XA 1A0HB 1Z1JA 1ZGVA 2CXVA 4ZKRU 5CMXH 2FS9A 1TE0A 2CHAC 3ZZAA 1LVMA 1RIWB 3MO6A 3M5OA 1SHYA 3F1SB 3ATIA 5DG6A 2CF9H 1XXFA 1TRMA 2ZHFH 1NFXA 3UNSA 4TPYA 2FOEA 2V3HH 3EAJA 2TRMA 1T8MA 4ASHA 1A46H 1MBQA 2EI8A 2ZDVH 1O2IA 1NU7B 1FY4A 4ZHLU 1KXBA 2HALA 3RXQA 7LPRA 2NU1E 2BX3A 2BX4A 5A8XA 2C8ZB 2VVUA 3E16B 2OC7A 1S81A 3UOPA 1AQ7A 1Y3UA 1ZHRA 2ZFPH 1T8NA 2XBVA 2OBQA 2AGIX 4X2VA 3SORA 3QUMP 1A5HA 3TK5A 4XFQA 4A6LA 1O3KA 2PKSC 1AWHB 2J9NA 3RXAA 1B0FA 4LXBH 1A7SA 3U69H 3N7OA 1HJ9A 1SR5C 2OQ5A 4K1SA 1A1RA 2F9PA 1UTNA 2VINA 3NZIA 1AB9B 4UFFH 3TIUA 1SGRE 1O2NA 4OS7A 1OP0A 5LPFA 1YP9A 2H9HA 5DGJA 3U1JB 4GAWA 4ABHA 3ZZCA 1O2VA 4CH8B 2QIQA 4UE7H 1C5SA 3SNDA 4MNWA 1EQ9A 1VCWA 4A7IB 3SZNA 3BTEE 5FAHA 2G4UA 3R0FA 1Q2WA 1TOMH 1MCVA 2Z9JA 5J4SA 1NT1A 2BQ7B 3LGUA 4INKA 1P2KA 2ZDLA 2RA3A 1BUIA 1UTPA 4MPXA 3GICB 2ZU3A 1A0LA 2FI5E 2SGDE 1UTKA 1NROH 4NIVA 2QA9E 4Y11E 3P8GA 1BOQA 3B8JA 5GXPA 4ZMAH 1MAXA 1XUJA 1OOKB 1O2UA 4A1VA 4K1EA 1T7CA 1DWEH 2R3UA 3JZ2B 3QZQA 2A4RA 4JYTA 4TPIZ 1CE5A 1FAXA 4HZHA 3U8TH 4D8NA 4JZDH 3MH6A 1MKWK 1GMDF 3GY2A 2OQUA 4FVBA 5JBTA 1EOJA 1MTSA 3ZZ9A 1G2MA 4BAQB 3Q3XA 3UNRA 3MU4A 1BBRK 3U98H 2C3SA 1KXAA 1PPFE 2F9UA 3T2NA 2RA0A 3DT0H 1PFXC 3BF6H 1VZQH 2BZAA 5FXLA 3VB7A 2XW9A 3TJOA 3SV8A 3RU4D 2ZI2H 1RTKA 2TPIZ 1NPMA 2NU4E 2NWNA 3ZYDA 1SGIB 1HPGA 3L3TA 3VGCC 2D8WA 2Y5FA 2HRVA 1ACBE 1C2IA 2A0QB 3E8LA 1ZPZA 2R0KA 4JK6A 2BD3A 1O0DH 1BB0B 4AGJA 1ZRBA 3GCOA 6GCHG 1NN6A 4BANB 3MNCA 1GBJA 1O2MA 1NRNH 5DP9A 1O3FA 3FZZA 4IMZA 1HUTH 1F0TA 3M7TA 2AMPA 2P3TB 1DDJA 3BIUH 1HAYB 2ZGCA 2Q6DA 2F9BH 4YO9A 1W0YH 4DURA 3BTFE 3URCA 1T4UH 1KY9A 1EB2A 1EP5A 1NS3A 4AGKA 1V2UT 3E90B 3SV9A 1C2HA 3ATMA 3OSYA 2ZDMA 1FN6A 1C2GA 5EPNA 4E7RG 2A1DB 3R3GB 4ZKSU 1AHTH 5A0CA 3M37A 4ABJA 1HYLA 2ZHDA 2JH5D 2VIWA 2ZTZA 3S7HB 1D6WA 2CV3A 1SG8B 2B8OH 1NTPA 3B23B 5HGGA 1H9IE 2BOKA 3PO1C 3PTBA 1EJMA 1QFKH 4CHAB 2STAE 1TPAE 4YOGA 1MD7A 4RKOB 1BRCE 4A1TA 1AFQB 1CQQA 3HGNA 5DKMA 3TU7H 1AUJA 3GYMA 1RTFB 1GVKB 1KDQA 1CA0B 2FXRA 3CS0A 2FP7B 3LGVA 3MH7A 2ZFRH 1GHZA 2V3OH 2GZ8A 2AS9A 1TGSZ 1E34B 1ZMNA 1SOTA 1XMNB 3PV4A 3F9FA 1CBWB 4AB9A 2VIPA 2IPHA 2XC5A 4FU9A 7GCHF 3SV6A 1DUEA 4AORA 3T5FH 2ANKH 4GHTA 4JZFH 1C1SA 4IN1A 5HM2A 4GSOA 3BN9A 1O32A 2ZU5A 6GCHF 3HKIB 5K0HA 1SGPE 3SUEA 3TJUA 4JYUH 3BEIB 2SGAA 1KYNA 1NFYA 1O5FH 4MNXA 2ULLA 4CRGA 2ZEBA 1Z6JH 2ZHWH 4X0WU 1Y5AT 1HAZB 1KTSB 4WJG2 1GL1A 1P03A 3SOSA 3P70B 2GVFA 2QY0B 1H9HE 3SGAE 4J2YB 3LPRA 1ZSJA 1FIWA 4TYDA 1K28D 5C1UA 3RC6A 2VIOA 4HFPB 3BTDE 2WPKS 4NZLA 2GV7A 2SNVA 3Q77A 2BTCE 1HJ8A 3MH4A 1QTFA 1HXEH 1AY6H 1V2NT 3H5CB 1MUEB 1E37B 1VITH 1TALA 1KSNA 5DP8A 1EAUA 1YGCH 1EZUC 3FP6E 5DP3A 1MAYA 1YLDA 4RN6A 5T6GA 1QRZA 1K1PA 3QWCH 5E2OA 1ZPCA 3RLWH 3UQVA 4AX9H 1F0RA 5EODA 5I25A 1OWKA 4X8TH 3I78A 1C2FA 1ZGIA 2CMYA 1DLEA 3MTYA 3A7TA 3ITIA 3RMLH 3UTUH 1O3CA 5FBIA 4I8KA 1GCTB 2ZGJA 1NRPH 2WV4A 3SHAH 3E0PB 3MO9A 3RXHA 4X8SH 2PHBA 2QC2A 3GCTG 4FVDA 1XUFA 1SVPA 1D3TB 1OPHB 3RXLA 1DWDH 2Z7FE 1S82A 4Z6AH 1GI2A 3M3TA 1C5PA 2Y7XA 3BV9B 5AHGH 2BD5A 4FUHA 3KNXA 1GDNA 4MPVA 4ZAEA 5CHAC 2OCVB 1BCUH 1TMTH 2ZPRA 5TCCA 6ESTA 2VVVA 3ELAH 1ELDE 4DIHH 4B1TA 1DXWA 2PTNA 1TX7A 2C8XB 1FY8E 1ZJKA 1GVLA 1W8BH 5BRRE 1Y3VA 2AFQB 4Y71A 3BG8A 2Z9LA 4B2AA 1T32A 2KAIB 4ZH8A 2TBSA 1GL0E 4DOQA 4I8LA 1TB6H 4ZHAA 1NO9H 1C9TA 4NSVA 1ZR0A 4JYVH 1O30A 4X2WA 3GISB 1CHGA 1UCYE 1VR1H 4O3TA 4UFDH 4Y0ZE 1AE8H 1DSUA 1HGTH 1FY3A 1O5BB 4QT8C 1PJPA 1P10A 1VGCC 1DY8A 1V2PT 1E38B 1EP6A 2FI3E 1FQ3A 2CF8H 3RLYH 5ABWA 1ABIH 1SGNE 4BAKB 1SQOA 3ZVGA 5L2ZH 1F5KU 1N8OC 1PQ5A 1CVWH 3RXVA 3GCHC 5L6NH 3A80A 3IWMA 1V2WT 1O2PA 2ZFTA 3SU5A 4CR5A 1KLIH 1S83A 1HNEE 1SL3A 3NKKA 1LPZB 2ZFSA 5FX6A 1G3CA 2SNWA 4FUJA 3BTTE 1W12U 3GCTF 4KTUA 3FP8E 1V2VT 1GBTA 2GT8A 1TNHA 5EPYA 4DW2U 8GCHF 2Y81A 4THNH 1BTXA 4UEHH 1KXCA 1Z8JB 5PTPA 1MTUA 1SLVB 1N6YA 1BRBE 2W3IA 3U1IB 1AVXA 3ZZ5A 5E8EH 1LO6A 2B5TB 4K60A 2ANYA 3EA8A 3V0XA 3IG6B 5FHTA 1UCYH 1HJAB 3SNEA 3O8RA 1YF4A 1UTOA 1Z71A 3UR6A 1GVZA 4F49A 1QA7A 2HNTE 1TGTA 1K1OA 1SFQB 3LJOA 4X1RU 1V2QT 3IITA 1HIAB 1O3PB 1O5CB 2ZHEH 4GHQA 2FOCA 3KQEA 4WH6A 4BOHA 1DM4B 1LHFH 2XWAA 1ZYOA 1ELTA 5C2ZA 1P2JA 4XOJA 4ISNA 3BTWE 4ZXYH 1BMMH 3RUOA 5EW2H 1JXPA 1KLJH 3S9AA 1XUIA 1F0UA 1H8IH 1SMFE 3MMGA 5DPAA 4D7FA 3GYLB 4I8GA 1G2LA 4XBBA 4ISOA 1JBUH 1TRYA 3BSQA 2J92A 3AASA 1LHCH 1LKBA 4Y6DA 4B73A 4NGAH 4U01A 5C1XA 1P01A 5GCHG 3UWJH 2P8OC 1C1RA 3PWBA 1GJDB 1J16A 4ISLA 9ESTA 2I6SA 1GI8B 5F8XA 3STJA 4ABDA 4CRFA 1K1NA 4H6SB 2BD4A 1E36B 1P12E 1AI8H 3OYPA 5F6MA 2P93A 2PTCE 2GGVB 1O2LA 3ODFA 1MKXH 3ATWA 3SJOA 3S0NA 3A81A 4JZEH 2G51A 3TGKE 3RXSA 1J15A 3VXFH 1QCPA 2BM2A 2VWOA 4WMEA 3RP2A 3SUGA 2QYIA 2XXLA 2ZGHA 4PROA 3RM2H 1TYNA 3TJNA 1O33A 2ZDNA 5F8TA 2THFB 2GV6A 1AD8H 5FCKA 1BTPA 2VIDA 4B2CA 2AYWA 2STBE 2CHAB 3D62A 3SI3H 4MPUA 1DITH 2GMTC 3VPKA 3LH1A 3U8RH 2Z9KA 2OBOA 1WSSH
chains in the Genus database with same CATH superfamily
1W11U 3P92A 1ABJH 2PV9B 1Y8TA 3SU4A 3ZZ7A 2HVYB 2GT7A 1SB1H 2BLVA 1UVOA 2GCTC 2ZP0H 5E0GA 5JDUB 1OS8A 3T28A 1QL9A 2XRCA 2FMJA 2WYGA 3TNSA 1GG6C 1LQDB 2CJIA 1QURH 3E91A 1PQ7A 2OUAA 5DP4A 2F9NA 2ZHQH 3K2UA 3HPTB 3PROA 1ZHPA 3M7UA 1P2OA 3PM3A 2F4LA 2PSYA 1YBWA 1GJ8B 4FOUC 3GDSA 1IQIA 1IQGA 2FPZA 1HFDA 3PV5A 1K1MA 5GCHF 5B6OA 6LPRA 2UUYA 2RDLA 2BVXH 3SGBE 1H8DH 5IDKA 2GDDA 4DIIH 1JIMA 1H8ED 1LVOA 1C5ZB 2XTTB 5A8ZA 4LZ1H 2A4OA 5GJ4B 2PKSB 1WOFA 1WDIA 2BDAA 2W7UA 4Y10E 1FV9A 2ZGBH 2H1UA 1GMDG 3KCGH 2YMSC 1MTNC 2C90B 4H6TA 1CU1A 2XCFA 1L2EA 2AIPA 2ZECA 1AE5A 3TK9A 4AN7A 3A7WA 4WH8A 1QQUA 1YCPM 1YPKH 1GI6A 2JKHA 4TWWA 4U2WA 4AG1A 1LDTT 2Z94A 1RIWC 1ZPBA 2ZCHP 3TNTA 1WBGB 3F68H 5AVDA 2UUKB 2RFKC 2BXTH 2BDYA 2ZGXH 3ZZBA 3T26A 5EXMA 3ZVCA 1BMLA 2A7JA 2BDGA 2BY8X 4WY3A 1GMHG 1UCYK 5FX5A 3OTPA 1FN8A 3C27B 2M5TA 2A2QH 1C5LH 1OP2A 5ETXA 1HLTH 2PKAB 4MTBA 2G81E 2CK3D 3PLKA 1ETRH 3NPSA 2IOTA 2XNIA 2D1JA 1O2KA 4A92A 3RU4T 3V3MA 2FYRA 1YLNA 4K1TA 2WYJA 4AFQA 4ZCNA 1E35B 2XCNA 1A3BH 4I7YH 1BTUA 2UWOA 1RRKA 2HLCA 2BVSH 4DVAU 5IK2D 1NFWA 2SGFE 1YPLH 1GBLA 3TJVA 2V3MA 1S0RA 2BMGB 1O2HA 2PP6A 5JBBS 4BXSA 2TGAA 1WQVH 4UONA 2ALVA 3KF2A 3VB5A 2VGCB 1GBEA 2Y6TA 2RG3A 1ARBA 3P8OA 1K0HA 1AMHA 4HGCA 4FETA 4NA9H 3TGJE 1AB9C 1FDPA 3NCLA 3FANA 4NA8A 3F2HA 4CH2B 2FWWA 4BNRA 2ZPSA 3L33A 1GI7B 4I8JA 3ESTA 4Q2KA 2H5DA 1S85A 4ESTE 1V2KT 3UWIA 1BMNH 2LNCA 1W3CA 3LGIA 3A88A 1AZZA 2JH0D 4LK4A 2QCYA 1AUTC 2HGTH 1GBFA 2G5NA 1AVWA 2BLWA 1SBWA 1BDAA 3GY5A 2G00A 3RMMH 1HAGE 3RXFA 1IHTH 1MKXK 4GCHF 4Z0KA 4DCDA 2J34A 1ZHMA 3ZVDA 1HV7A 3M3SA 4K8BA 4AFSA 8ESTE 3DFLA 1T8OA 2OLGA 5H4IB 3MFJA 3DD2H 1BITA 2FX4A 3RU4E 2WZQA 1DLKB 5K7RA 1GMHF 3BG4B 5KECA 1TWXB 7GCHG 1Y5UT 1SGQE 4Y8XA 2JIZD 1ESAA 4M7GA 1F5RA 3UB0A 1BT7A 4Y7AA 3M61U 3SU6A 3STIA 1INCA 1LHDH 2RCEA 4BAOB 2R0LA 4AG2A 1J9CH 4ABAA 1D6RA 1GHXH 1TLDA 3SJ9A 2KCOA 2DE8A 1DANH 4ABFA 3MU5A 4U30A 2OINA 1MQ5A 3TPIZ 1CT0E 1TPPA 2RDEA 4IC6A 1P0SH 4GVUA 4M9FA 1P02A 3GY8A 1UTJA 2FIRH 2GCHG 4X1QU 1CGHA 2VJ1A 3RXDA 1BTZA 2QXJA 1AVGH 5JBCS 1QRWA 1GJ6A 1PYTD 1SI5H 2QF5A 2Y5GA 4YT6H 2A4GA 1BJUA 1S6FA 2J98A 2EI6A 5EU8A 1GGDB 5GNDA 1C1UH 2C8WB 4YXWD 4FUBA 5JPMH 1VJ9U 2H5CA 4X6OA 3BTQE 5T6FA 1O5DH 3T62A 2CN0H 2FOGA 2EEKA 4DG4A 4RSPA 2HPPH 1EB1H 1NC6A 3ZZ8A 2P3FH 1ANBA 1IQJA 3OEHD 3TH2H 5EQRA 1FPHH 1WXRA 3F0PA 1O3NA 2HPQH 7ESTE 1YPEH 4MG3A 4K2YA 1TBZH 1KMHB 1FAKH 1YCPK 2QV1A 2BOHB 3S9BA 1E1QD 1UVSH 1C5TA 4I8HA 1D3QB 4WMDA 1C5VA 1J14A 4JCNA 1AN1E 1E1RD 2VB0A 1RFNA 4CREA 5ESTE 2BY7X 3SUDA 1TAWA 3F9GA 3SU0A 2JDID 3OEED 5J4QA 1X7AC 3LT3A 4ABGA 4AOQA 3A7VA 3RXOA 1YKTA 3TLOA 3RXMA 2FM2A 2FOBA 1QB6A 2LPRA 4MNYA 1THPB 5DP7A 1GJ7B 3E1XB 1EXFA 2ZWLH 3OX7U 1CHOG 4CHAC 1UMAH 2YNBA 1EZXC 1K2I1 1TGNA 2P95A 2K1QA 4GUXA 2LELA 1LCYA 2ZO3H 2HOBA 2GD4B 1P06A 3LU9B 1QY6A 1L1NA 4KTSA 1CA0C 1O3IA 1MU6B 2GCHF 1GDUA 3UQOA 1ZMLA 3RXTA 2FOHA 1GBDA 1AKSB 1CBWC 2P3UB 4FUEA 1P04A 3LKWA 5SGAE 3ZV8A 1GHBG 1QRXA 5HXFA 1TOCB 3UAIC 4BAHB 3GY7A 2O8UA 1C2JA 3F9HA 1ZTJA 2XNDD 2XBWA 4SGBE 2R3YA 4JZ1A 1HAPH 5JB9S 5EQQA 1O3GA 1FIZA 1ETTH 3LGYA 4NIXA 2BDIA 4D76A 1ZTLA 1DFPA 4X6MA 3URDA 4B76A 1TPOA 2QE7D 1P57B 1XUGA 1ELGA 2FODA 1P2IA 1Z8GA 2ZNKH 4ABIA 3E0NB 1VITF 1ZMJA 1M9UA 2ZG0H 2Y5HA 4Y0YE 4O03A 4Y79A 1J8AA 1HCGA 2W6JD 3E6PH 1N6XA 1TRNA 2Y82A 1DOJA 3I29A 4FUIA 4MNVA 5G4BA 3RMNH 1HRTH 1QL7A 3DFJA 3ATLA 3O8CA 8GCHG 1GBMA 3P8NA 1VKYA 1DS2E 6CHAB 1GHVH 4A5TS 1CHOF 1GBCA 2FZZA 1BTWA 3MU8A 3N7DA 2PWXA 2OK5A 1AIXH 1BJVA 1THSH 1C5RA 1IQMA 1GBBA 1UK3A 2A7HA 3A8AA 4INLA 5DN6D 4O3UA 5E0JA 1KIGH 1LHEH 1UW7A 2BY6X 3SO3A 5C3NA 2GZ9A 4NIYA 2ILNA 2ZU2A 5AF9H 3A7XA 5HIZA 1P05A 1C1VH 5EG4A 3RC4A 1GCTC 2FDAA 1V2RT 2FOFA 3MWIU 3A84A 5GWZA 3GCHB 3TK6A 4ABEA 1GHBF 1SKYE 1AU8A 1UK4A 4WWYA 1D3PB 2VVCA 1H4WA 3PV2A 3W94A 1BMFD 1WQSA 5HMAA 3RXRA 3SI4H 3SJ8A 3EA9A 3FAOA 1K9OE 1OWHA 1FMGA 4GPGA 3SHCH 1A5GH 1CO7E 2EQNA 2Z9GA 1HAHH 3K6YA 1PPHE 2ZCLP 1HDTH 4NG9H 1O3HA 4NFEA 2ZDAH 1NFUA 1FJSA 2WPLS 3AVZA 1O5AB 5DP6A 4ZUHA 3V7TA 5JBAS 2F3CE 2JJ2D 3AW0A 5LPRA 2Z3DA 4CRBA 1TNLA 2FS8A 1MZDA 1F0SA 1MTWA 3PRBA 3QLPH 1GI1A 1O3DA 3GOVB 3A7YA 1NU9A 1O35A 3AAUA 1WTHD 5DSFA 1V2TT 1N1LA 3A85A 5JB8S 2UUJB 5FL7D 2WV5A 3QX5H 3SUFA 4IGDA 5FBEA 2JETB 1GHYH 1O3EA 2O8TA 3W95A 2O9QA 5T1VA 2A31A 1DWCH 4AYYB 2ZU4A 3U8OH 4Q7XA 5A0BA 3TGIE 1QJ1B 4I86A 2UWLA 1DXPA 1XVMA 1EFRD 2QF0A 4OS2A 4D9RA 2KR7A 2ZKSA 2ZQ1A 3T27A 1EPTB 3P8FA 1HAXB 4Q7ZA 3RDZA 1Y59T 1OKXA 1UO6A 3ZV9A 4DY7B 3F2FA 1TMBH 1O3OA 1W14U 2O8MA 3A87A 1GBAA 2WPMS 3KQCA 2VWMA 1O36A 1SLXB 4ZKNU 1SLWB 3SNCA 4CRCA 1K1JA 4X1SU 1CGIE 3SJKA 3KQBA 1KXDA 2BY9X 3V13A 2QAAA 3BTME 1QBVH 2J5UA 2J95A 2VNTA 3BEUA 2Y7ZA 4RKJB 4X2XA 1O3JA 1RGQA 3TH4H 1QA0A 1Z6EA 2P16A 1SGEE 4F55A 5L30H 2ANMH 3F9EA 3PMJA 1FY5A 1O2QA 3BEFB 1DX5M 4XBCA 4YESB 1ZLRA 1TPSA 4YTAA 4D9QA 3FZDA 1UTMA 1O2JA 1GHAG 2ZU1A 1UVPA 1SSXA 3CENA 4E06H 1DICA 2LP6A 2VIVA 1ZZZA 1O5GH 2BD9A 1HJAC 3SV2H 1RS0A 1QB1A 2KCPA 5EJLA 3GCNA 4FXGH 3DA9B 2BZ6H 2G55A 2W3KA 1K22H 1MMJN 4WXVA 4VGCB 1G37A 1V2JT 2FTLE 3M5MA 1PQAA 2Y80A 1TA6A 3GDUA 1CT2E 4K8YA 2BLQA 4X8VH 4FU8A 3HATH 5FCRA 4XE4A 2FLBH 1OWEA 1C2DA 2H2ZA 1NRSH 1Z8RA 3KQDA 4B2BA 2AEIH 2GMTB 2NU2E 1CSOE 1HB0B 1Y3XA 1FONA 1ANEA 1L0ZA 3PMHB 1GJ5H 4UFEH 1LKAA 2TGDA 4R8TB 2WUCA 3QO6A 5T6DA 2AGEX 1GJ4H 1ID5H 3M7QA 5E2PA 3ZVBA 1PPGE 3BTGE 1GG6B 2BD2A 4ACAA 4Q4LA 2IJD1 1TIOA 3QDZB 2OD3B 1C5OH 3AAVA 1Z8IB 1E79D 1OXGA 3RXEA 1AKSA 3DSOA 2DE9A 1SFIA 1O2OA 1ZRKA 1O34A 3TITA 1BRAA 2PUXB 1YLCA 5CE1A 3EDXB 2HNTF 1LPGB 1HAVB 3S7KB 5GPIB 4E05H 1OP8A 1LPKB 1GBIA 2A4QA 1MCTA 1WUNH 1YM0A 3NK8A 3PTNA 1SQRA 3ZVAA 4OS6A 4SGAE 1PQ8A 1GCDA 5T3HA 2G8TA 2ZCKP 4DGJA 1GHAF 2BD8A 1QZ8A 2BLOA 1XVOA 3EGKH 1EAWA 1WTGH 5ESBA 1QQ4A 1MTNB 5F03A 3P95A 2PLXA 3MU1A 1ZSLA 3T25A 1P9SA 3GY4A 4H42U 1QL8A 1NM6A 5F8ZA 4O97A 4CBOA 2VWLA 4I33A 1AWFH 1QBNA 3MNSA 2PGBB 2J94A 3LONA 1MZAA 3P17H 2ESTE 1AGJA 1XXDA 3PMAB 1F7ZA 1Q31A 1MQ6A 1WAYB 1SQTA 1C1MA 2C93B 2TIOA 4FUCA 1UJ1A 1W0ZU 4KGAA 1MBMA 2FESH 2XC0A 3SU1A 1TONA 2H9TH 1O2WA 4I31A 4BTIB 1CGJE 3Q00A 1EJAA 3FVFB 1YCPH 2FEQH 3H7TA 2BDCA 1IQEA 4GCHG 1NRRH 1H9LB 2A32A 1XM1A 1NBMD 4AFZA 3O8BA 4HI3A 3UPEA 3LC5A 1TMUH 1P3CA 4UD9H 2KAIA 2OC0A 1O2RA 2OC1A 1SGFG 2C8YB 3TVJB 1C1PA 4YZUA 4MDSA 4CRDA 2GJGA 7KMEH 4OGYA 3WY8A 1FX0B 2ZZUH 1C2LA 3RXKA 1DWBH 3UY9A 2ZFQH 1VCPA 2IN2A 1FI8A 2BY5X 3SJIA 4X6PA 1QIXB 1SGCA 2PUQH 4K69A 1O3MA 1T31A 2VU8E 2AIQA 3RXBA 2AHME 1DT2A 1G30B 5C94A 3SW2B 5C1YA 2OC8A 2B0FA 1EAXA 5C0TA 1S0QA 3A89A 3QGJA 4Q7YA 3PMBB 5E0HA 1G3BA 2IJOB 1C1QA 1XX9A 1B0EA 1UTLM 4I32A 3DHKH 5HKKD 3HK6B 4Y7BA 2ZC9H 1QGFA 3CNRA 8KME2 1P3EA 3M36A 3SGQE 3NUMA 1TBQH 3A8CA 2R2MB 2SGQE 4BXWA 2ZF0H 3OTJE 4Y8YA 3LGTA 2AGGX 1IAUA 5LPEA 3KHVA 2A7CA 2ALPA 3F2GA 1O39A 3PYHA 2YOLA 1W7XH 3VGCB 2Z3CA 3SQEE 4KTCA 5DK1A 3LDXH 1EKBB 1PPCE 1C1OA 2D26C 1EOLA 4FUDA 5AFZH 1JRSA 2F9OA 2WPHS 3QGNB 2TGTA 1LVYA 5GDSH 1EPTA 4AFUA 1DE7H 2FOMB 2V35A 4RT0A 8LPRA 4ZKOU 3EQ0H 1G3EA 4X1PU 3JZ1B 1C4U2 5FPSA 1HBTH 2BYAX 1ANCA 4YOJA 1HIAA 2BDHA 1XUKA 2VGCC 1YWUA 1SC8U 1VJAU 3Q3YA 1C1TA 3SNBA 2XBXA 3MU0A 3UFAA 2Z9IA 1C2KA 4CR9A 1HAIH 2CGAA 4X2YA 3LC3A 1RTLA 2PW8H 2J97A 1L4DA 2SGEE 2QXHA 1GI5A 3RXUA 3RXGA 4OGXA 1TQ7B 3ZVEA 1AFEH 1SGTA 1O2XA 2AH4X 3MOCA 3UREA 1W13U 4NSYA 3VFEA 5EGMA 1SGYE 1YPJH 2KCAA 2YNAA 3ZZ4A 2BQ6B 1HXFH 3MNXA 2A2XH 2I6QA 1GMCG 1JWTA 2FTMA 5EQSA 2OTVA 2OXSA 2ZTYA 2PFEA 4ISHH 3PO1B 4NCYA 1BA8B 1JOUB 3MI4A 2GTBA 3PRDA 4WXIA 3RXCA 3BG4C 2VWNA 3U28C 1SOZA 1GJBB 5I46H 1A3EH 3RM0H 1JIRA 3OU0A 2H9EH 3EYDA 1PPZA 4Y8ZA 1PYTC 2Q1JA 2SFAA 3EA7A 9LPRA 3A8DA 4OM9A 4FU7A 1YPGH 1O2ZA 2ZPQA 1ESTA 2QN5T 4CBNA 4ZHMU 1OYTH 1KXEA 1QNJA 1ELBA 1K1IA 3UIRA 1W2KH 4B71A 4YM9A 1T4VH 1Q3XA 3FP7E 4D7GA 1B7XB 5JYIA 1TA2A 5EXNA 3FKSD 5AFYH 2R2WU 3A86A 3RC5A 2FYQA 4MPWA 1GI4A 1TNKA 2H6MA 4NZQA 5TJXA 1C4V2 3B9FH 1SQAA 3EE7A 1ESBA 1IHSH 1C2EA 1A2CH 1IQFA 1C2MA 2GP9B 2VH6A 4P00A 1K21H 4NIWA 3LH3A 1C1NA 5EXLA 2SGPE 5DJ7A 2XBYA 1ELFA 4OS1A 2J4IA 2A45B 4XDEA 1VITG 2WPIS 5C5NA 1OX1A 2ZDKA 4FUFA 2K0QA 2VBCA 3H7OA 1HAVA 1BTHH 1YPHE 2FLRH 3KYFA 1NY22 2HVXA 1YPHC 1IQLA 2F83A 2ZQ2A 1FPCH 3A83A 2ZA5A 1FY1A 1GGDC 1C5XB 2V6NA 1IOEA 3KEEA 2XOKD 4TY7A 4LOYH 4BAMB 1V2MT 1ZSKA 1V2ST 5BPEA 2XWBI 1GJAB 2V7QD 3F6UH 2G52A 4IW4E 1AFQC 2TGPZ 1GMCF 1ZJDA 4WF8A 4YOIA 3HGPA 4R0IA 1TABE 1T8LA 3C1KA 3G01A 1HAOH 1J17T 1GJCB 2A5AA 4DJZB 3CS7A 1QB9A 4IC5A 3ZVFA 1EJNA 1BZXE 1CT4E 1S6HA 2JH6D 3RXJA 3UUZA 1H1BA 2W26A 3A8BA 1YPMH 1QJ6B 1UHBB 1F92A 3OY6U 4MLFB 5A09A 1XUHA 1SGFA 3RXPA 1C5MD 3ZZ6A 2DUCA 3PLBA 1SPJA 5HM9A 1Y3YA 3QTOH 2O8LA 1S5SA 1TNJA 4B75A 3MYWA 3SU3A 1W7GH 1BRUP 3Q76A 2GX4A 4TT3D 1XKAC 5HYOA 1D9IA 3EE0B 1GJ9B 4MQAA 4K5ZA 5FPYA 1Z7KA 1TGBA 1MD8A 3I77A 4JZIA 1DPOA 1THRH 1PPEE 3KN2A 5LH8A 3BTHE 1P9UA 4TWYA 1GI3A 1GI0A 4NA7A 1L4ZA 3OE7D 2PGQB 3UOUA 1O3AA 1IQKA 2HWLB 5HIYA 2W5EA 3NXPA 5CHAB 3K9XB 1UTQA 3GY6A 1OSSA 1EZSC 2F91A 3HKJB 2BXUH 3U9AH 2VH0A 2XC4A 1NZQH 3T29A 1EX3A 1TFXA 1ETSH 2GDEH 2ZFFH 3RMOH 1G36A 4IBLH 1ELVA 4AZ2B 1L1GA 1SHHB 2P59A 2PKAA 1V2LT 5EOKA 1ELEE 2NU3E 4XSKU 3M5LA 4IMQA 3VB4A 1O31A 2Z6BD 3SNAA 1TNGA 3WWBA 2J38A 3Q3KA 1V6DA 3QTVH 2ODYB 4AB8A 3SU2A 1GPZA 1B5GH 1P2NA 4X1NU 1YY3A 1D3DB 1KTTB 1VGCB 4OS4A 2AMDA 1Z1IA 5C5OA 4U32A 1LQEA 3VB6A 5A8YA 1O38A 3SV7A 4NFFA 1C5WB 2WINI 4BTUB 1OHHD 1N8OB 1NESE 4NWKA 5LGOA 3FFGA 2BQWB 2WV9A 1OYQA 2ZTXA 3E3TA 2EI7A 3SN8A 1EATA 3S9CA 3LOXA 4LZ4B 3NWUA 1A61H 3W1EA 1BMAA 1O2TA 4KKDA 2PR3A 3MO3A 6CHAC 1BQYA 1P09A 4ACBA 2D2DA 3O8DA 2O8WA 3QZRA 1NRQH 2WHXA 3GY3A 2KZ4A 2XYAA 2QXIA 1S84A 2BVRH 1C9PA 1O2YA 1DY9A 3CP7A 3PB1E 4X8UH 2VIQA 4CRAA 3A7ZA 1UVUH 1TNIA 1U6QA 4O9VA 3A82A 1C1WH 1FNIA 3SBKA 3VEQB 5C67A 1PPBH 2FO9A 4F4OC 4UFGH 2FOAA 1O2GH 1RJXB 1TX8A 1O3BA 3K6ZA 4KP0A 3M5NA 1YYY1 3ODDA 2G4TA 1RXPA 2GKVE 1GDQA 3GDVA 4YLQH 4Q80A 3UNQA 1CA8B 1ZTKA 4ZROA 1G3DA 3LIWA 4J1YA 3SQHE 2QXGA 4JMYA 4E7NA 1C5UA 2BDBA 2ODPA 3RXIA 5EIYA 1JMOH 4F48B 1BHXB 1EASA 3KIDU 1IQNA 1FXYA 2ZIQH 5GIBA 2PSXA 3PLPA 1O3LA 1EZQA 1XKBC 2AERH 1GBHA 1DVAH 1V2OT 1ZOMA 2Z3EA 4DT7B 3BIVH 2BD7A 1VCQA 1BIOA 2F9VA 1LHGH 3KGPA 4K3JA 1BBRE 4WVPE 3BTKE 5EW1H 2B9LA 3VXEH 1ARCA 1SLUB 3DUXH 3M3VA 4XRNA 3V12A 2JETC 2C4FH 3ATKA 3QN7A 1A0JA 2FX6A 2P8OB 2WPJS 1WU1A 1C4Y2 1EUFA 2L74A 1ORFA 4AYVB 1WCZA 2HNTC 3OY5U 4B74A 1C5YB 5B6LA 4IS5A 1E0FD 1TX6A 4WMFA 2W7SA 1D4PB 4XBDA 5TCAA 4HTCH 1TGCA 4UDWH 1C5NH 2UWPA 2ANWA 1RD3B 1OWJA 1FLEE 1ELCA 1EPTC 2R9PA 4HG6A 4TY6A 1OWDA 3OAAD 1UVTH 1Y3WA 1TBRH 4INHA 1MTVA 1OWIA 4ISIH 2GZ7A 1L1JA 2QGRA 1P8VC 4ASUD 1Y5BT 3S69A 2NU0E 3ZZDA 5IYTA 1WV7H 4RI0A 2Q6GA 3HK3B 1AZ8A 1QBOA 1UK2A 1A5IA 3MHWU 3FOAA 4YLUA 5C20A 3F0OA 4GLYA 4IN2A 4OS5A 3UR9A 3TH3H 2A5KA 5A2MH 1MU8B 3MH5A 1MKWH 5CDFE 1F5LA 4H4FA 1LMWB 2B7DH 1KLTA 1V3XA 2YMSB 3D65E 3AW1A 4Y76A 5A0AE 2BB4A 3QK1A 1G32B 2J2UA 2BHGA 5L2YH 1LVBA 1BBRH 3PWCA 2J98B 2GCTB 2A5IA 4B6EA 1GHWH 1O2SA 1MABB 4BTTB 1FZZA 1GI9B 1GWAA 4FUGA 3K65B 1P11E 1F2SE 5DO4H 3KL6A 1P2QA 2UUFB 3F3BA 4VGCC 2Q6FA 3L6PA 1UHBA 1O5EH 1MH0A 1G9IE 1FUJA 1SGDE 3D49H 3MNBA 2FI4E 5DP5A 4X6NA 1QJ7B 1BTYA 5C0UA 1KDQB 1IQHA 2V0BA 1GBKA 1JRTA 1O37A 3MQKC 1A4WH 1ELAA 1TQ0B 1BHXF 1K1LA 3D23A 3DSPA 1QR3E 4MVNA 2K8IA 3ENSB 4NWLA 1LTOA 1KXFA 2WUBA 3M35A 1P2MA 4ABBA 1AO5A 3WW7A 1W10U 4YT7H 2ASUB 2ODQA 2EA3A 4XD7D 2G5VA 1DSTA 1QHRB 3ZYEA 3DSGA 2AMQA 1YC0A 2QF3A 1EAIA 2OP9A 1DUAA 2EC9H 3LGWA 4JK5A 3ZZ3A 3P6ZB 4KELA 2P94A 4ZXXH 1C5QA 1ANDA 1WYKA 5FPTA 3LJJA 3VB3A 4A1XA 1A0HB 1Z1JA 1ZGVA 2CXVA 4ZKRU 5CMXH 2FS9A 1TE0A 2CHAC 3ZZAA 1LVMA 1RIWB 3MO6A 1W0JD 1SHYA 3M5OA 3F1SB 3ATIA 2JJ1D 2IPQX 5DG6A 2CF9H 1XXFA 1TRMA 2ZHFH 1NFXA 3UNSA 4TPYA 2FOEA 2V3HH 2WPDD 3EAJA 2TRMA 1T8MA 4ASHA 1A46H 1MBQA 2EI8A 2ZDVH 1O2IA 1NU7B 1FY4A 4ZHLU 1KXBA 2HALA 3FN8A 3RXQA 7LPRA 2NU1E 2BX3A 2BX4A 4TSFD 1NBME 5A8XA 2C8ZB 2VVUA 3E16B 2OC7A 3N7EA 1S81A 3UOPA 1AQ7A 1Y3UA 1ZHRA 2ZFPH 1T8NA 2XBVA 2OBQA 2AGIX 4X2VA 3SORA 3QUMP 1A5HA 3TK5A 4XFQA 4A6LA 1O3KA 2PKSC 1AWHB 2J9NA 3RXAA 1B0FA 4LXBH 1A7SA 3U69H 3N7OA 1HJ9A 1SR5C 2OQ5A 4K1SA 4AC9A 3SYJA 1A1RA 2F9PA 1UTNA 2HLDD 2VINA 3NRLA 3NZIA 1AB9B 4UFFH 3TIUA 1SGRE 1O2NA 2W6ID 4OS7A 1OP0A 5LPFA 1YP9A 2H9HA 5DGJA 3U1JB 4GAWA 4ABHA 3ZZCA 1O2VA 4CH8B 2QIQA 4UE7H 1C5SA 3SNDA 4MNWA 1EQ9A 1VCWA 4A7IB 3SZNA 3BTEE 5FAHA 2G4UA 3R0FA 1Q2WA 1TOMH 4Q63A 1MCVA 2Z9JA 5J4SA 1NT1A 2BQ7B 3LGUA 4INKA 1P2KA 2ZDLA 2RA3A 1BUIA 1UTPA 4MPXA 3GICB 2ZU3A 1A0LA 2FI5E 2SGDE 1UTKA 1NROH 4NIVA 2QA9E 4Y11E 3P8GA 1BOQA 3B8JA 5GXPA 4ZMAH 1MAXA 5F53A 1XUJA 1OOKB 1O2UA 4A1VA 4K1EA 1T7CA 1DWEH 2R3UA 3JZ2B 3QZQA 2A4RA 4JYTA 4TPIZ 1CE5A 2KFWA 1FAXA 4HZHA 3U8TH 3VG8A 4D8NA 4JZDH 3MH6A 1MKWK 1GMDF 3GY2A 2OQUA 4FVBA 5JBTA 1EOJA 1MTSA 3ZZ9A 1G2MA 4BAQB 3Q3XA 3UNRA 3MU4A 1BBRK 3U98H 2C3SA 1KXAA 1PPFE 2F9UA 3T2NA 2RA0A 3DT0H 1PFXC 3BF6H 1VZQH 2BZAA 5FXLA 3VB7A 2XW9A 5CHBA 3TJOA 3SV8A 3RU4D 2ZI2H 1RTKA 2TPIZ 1NPMA 2NU4E 2NWNA 3ZYDA 1SGIB 1HPGA 3L3TA 3VGCC 2D8WA 2Y5FA 2HRVA 1ACBE 1C2IA 2A0QB 3E8LA 1ZPZA 2R0KA 4JK6A 2BD3A 1O0DH 1BB0B 4AGJA 1ZRBA 3GCOA 6GCHG 1NN6A 4BANB 3MNCA 1GBJA 1O2MA 1NRNH 5DP9A 1O3FA 3FZZA 4IMZA 1HUTH 1F0TA 3M7TA 2AMPA 2P3TB 1DDJA 3BIUH 1HAYB 2KM0A 2ZGCA 3DCLA 2Q6DA 2F9BH 4YO9A 1W0YH 3WWFA 4DURA 3BTFE 3URCA 1T4UH 1KY9A 1EB2A 1EP5A 1NS3A 4AGKA 3GS9A 1V2UT 3E90B 3SV9A 1C2HA 3ATMA 3OSYA 2ZDMA 1FN6A 1C2GA 5EPNA 4E7RG 2A1DB 3R3GB 4ZKSU 1AHTH 5A0CA 3M37A 4ABJA 1HYLA 2ZHDA 2JH5D 2VIWA 2ZTZA 3S7HB 1D6WA 2CV3A 1SG8B 2B8OH 1NTPA 3B23B 5HGGA 5C17A 1H9IE 2BOKA 3PO1C 3PTBA 1EJMA 1QFKH 4CHAB 2STAE 1TPAE 4YOGA 1MD7A 4RKOB 1BRCE 4A1TA 1AFQB 1CQQA 3HGNA 5DKMA 3TU7H 1AUJA 2KX4A 3GYMA 1RTFB 1GVKB 1COWD 1KDQA 1CA0B 2FXRA 3CS0A 2FP7B 3LGVA 3MH7A 2ZFRH 3FO8D 1GHZA 2V3OH 2GZ8A 2AS9A 1TGSZ 1E34B 1ZMNA 1SOTA 1XMNB 3PV4A 3F9FA 1CBWB 4AB9A 2VIPA 2IPHA 2XC5A 4FU9A 3ZIAD 7GCHF 3SV6A 1DUEA 4AORA 3T5FH 2ANKH 4GHTA 4JZFH 1C1SA 4IN1A 5KEDA 3KYGA 5HM2A 4GSOA 3BN9A 1O32A 2ZU5A 6GCHF 3HKIB 5K0HA 1SGPE 3SUEA 3TJUA 4JYUH 3BEIB 2SGAA 1KYNA 1NFYA 1O5FH 4MNXA 2ULLA 4CRGA 2ZEBA 1Z6JH 2ZHWH 4X0WU 1Y5AT 1HAZB 1KTSB 4WJG2 1GL1A 1P03A 3SOSA 3P70B 2GVFA 2QY0B 1H9HE 3SGAE 4J2YB 3LPRA 1ZSJA 1FIWA 4TYDA 1K28D 2EY4C 5C1UA 3RC6A 2VIOA 4HFPB 3BTDE 2WPKS 4NZLA 2GV7A 2SNVA 3Q77A 2BTCE 1HJ8A 3MH4A 1QTFA 1HXEH 1AY6H 1V2NT 3H5CB 1MUEB 1E37B 1VITH 1TALA 1KSNA 5DP8A 1EAUA 1YGCH 1EZUC 3FP6E 5DP3A 1MAYA 1YLDA 4RN6A 5T6GA 1QRZA 1K1PA 3QWCH 5E2OA 1ZPCA 3RLWH 3N99A 3UQVA 4AX9H 1F0RA 5EODA 5I25A 1OWKA 4X8TH 3I78A 1C2FA 1ZGIA 2CMYA 1DLEA 3MTYA 3A7TA 3ITIA 3RMLH 3UTUH 4Z1MD 2QF4A 2KCYA 1O3CA 4DT4A 5FBIA 4I8KA 1GCTB 2ZGJA 1NRPH 2WV4A 3SHAH 3E0PB 3MO9A 3RXHA 4X8SH 2PHBA 2QC2A 3GCTG 4FVDA 3AK5A 1XUFA 1SVPA 1D3TB 1OPHB 3RXLA 1DWDH 2Z7FE 1S82A 4Z6AH 1GI2A 3M3TA 1C5PA 2Y7XA 3BV9B 5AHGH 2BD5A 4FUHA 3KNXA 1GDNA 4MPVA 4ZAEA 5CHAC 2OCVB 3KQ5A 1BCUH 1TMTH 2ZPRA 2L6OA 5TCCA 5EJ1A 6ESTA 2VVVA 3ELAH 1ELDE 4DIHH 4B1TA 1DXWA 2PTNA 1TX7A 4P02A 2C8XB 1FY8E 1ZJKA 1GVLA 1W8BH 5BRRE 1Y3VA 2AFQB 4Y71A 3BG8A 2M2AA 2Z9LA 4B2AA 1T32A 2KAIB 4ZH8A 2TBSA 1GL0E 4DOQA 4I8LA 4B6FA 1TB6H 4ZHAA 1NO9H 1C9TA 4NSVA 1ZR0A 4JYVH 1O30A 4X2WA 3GISB 1CHGA 1UCYE 1VR1H 4O3TA 4UFDH 4Y0ZE 1AE8H 1DSUA 1HGTH 1FY3A 1O5BB 5EJZA 4QT8C 1PJPA 1P10A 1VGCC 1DY8A 1V2PT 1E38B 1EP6A 2FI3E 1FQ3A 1S6LA 2WSSD 2CF8H 3RLYH 5ABWA 1ABIH 1SGNE 4BAKB 1SQOA 1H8HD 3ZVGA 5KGOA 5L2ZH 1F5KU 1N8OC 1PQ5A 1CVWH 3RXVA 3GCHC 5L6NH 3A80A 3IWMA 1V2WT 1O2PA 2ZFTA 3SU5A 4CR5A 1KLIH 1S83A 1HNEE 1SL3A 3NKKA 1LPZB 2ZFSA 5FX6A 1G3CA 2SNWA 4FUJA 3BTTE 1W12U 3GCTF 4KTUA 3FP8E 1V2VT 1GBTA 2GT8A 1TNHA 5EPYA 4DW2U 8GCHF 2Y81A 4THNH 1BTXA 4UEHH 4RT1A 1KXCA 1Z8JB 5PTPA 1MTUA 1SLVB 1N6YA 1BRBE 2W3IA 3U1IB 1AVXA 3ZZ5A 5E8EH 1LO6A 2B5TB 4K60A 2ANYA 3EA8A 3V0XA 3IG6B 5FHTA 1UCYH 1HJAB 3SNEA 3O8RA 1YF4A 1UTOA 3H09A 1Z71A 3UR6A 1GVZA 4F49A 1QA7A 2HNTE 1TGTA 1K1OA 1SFQB 3LJOA 4X1RU 1V2QT 3IITA 1HIAB 1O3PB 1O5CB 2ZHEH 4GHQA 2FOCA 3KQEA 4WH6A 4BOHA 1DM4B 1LHFH 2XWAA 1ZYOA 1ELTA 5C2ZA 1P2JA 4XOJA 4ISNA 3BTWE 4ZXYH 1BMMH 3RUOA 5EW2H 1JXPA 1KLJH 3S9AA 1XUIA 1F0UA 1H8IH 1SMFE 3MMGA 5DPAA 4D7FA 3GYLB 1W0KD 4I8GA 1G2LA 4XBBA 4ISOA 1JBUH 1TRYA 3BSQA 2J92A 3AASA 1LHCH 1LKBA 4Y6DA 4B73A 4NGAH 4U01A 5C1XA 1P01A 5GCHG 3UWJH 2P8OC 1C1RA 3PWBA 1GJDB 2F43B 1J16A 4ISLA 9ESTA 2I6SA 1GI8B 5F8XA 3STJA 4ABDA 4CRFA 1K1NA 4H6SB 2BD4A 1E36B 1P12E 1AI8H 3OYPA 5F6MA 2P93A 2PTCE 2GGVB 1O2LA 3OFND 3ODFA 1MKXH 3ATWA 3SJOA 3S0NA 3A81A 4JZEH 2G51A 3TGKE 3RXSA 1J15A 3VXFH 1QCPA 2BM2A 2VWOA 4WMEA 3RP2A 3SUGA 2QYIA 2XXLA 2ZGHA 4PROA 3RM2H 1TYNA 3TJNA 1O33A 2ZDNA 5F8TA 2THFB 2GV6A 1AD8H 5FCKA 1BTPA 2VIDA 4B2CA 2AYWA 2STBE 2YMSD 2CHAB 3D62A 3SI3H 3SZEA 4MPUA 1DITH 2GMTC 3VPKA 3LH1A 3U8RH 2Z9KA 2OBOA 1WSSH
chains in the Genus database with same CATH topology
1W11U 3P92A 1ABJH 2PV9B 1Y8TA 3SU4A 3ZZ7A 2GT7A 1SB1H 2BLVA 1UVOA 2GCTC 2ZP0H 5E0GA 5JDUB 1OS8A 3T28A 1QL9A 2XRCA 2FMJA 2WYGA 3TNSA 1GG6C 1LQDB 2CJIA 1QURH 3E91A 1PQ7A 2OUAA 5DP4A 2F9NA 2ZHQH 3K2UA 3HPTB 3PROA 1ZHPA 3M7UA 1P2OA 3PM3A 2PSYA 1YBWA 1GJ8B 3GDSA 1IQIA 1IQGA 2FPZA 1HFDA 1K1MA 5GCHF 5B6OA 6LPRA 2UUYA 2RDLA 2BVXH 3SGBE 1H8DH 5IDKA 2GDDA 4DIIH 1JIMA 1LVOA 1C5ZB 2XTTB 5A8ZA 4LZ1H 2A4OA 5GJ4B 2PKSB 1WOFA 2BDAA 2W7UA 4Y10E 1FV9A 2ZGBH 2H1UA 1GMDG 3KCGH 1MTNC 2C90B 4H6TA 1CU1A 2XCFA 1L2EA 2AIPA 2ZECA 1AE5A 3TK9A 4AN7A 3A7WA 4WH8A 1QQUA 1YCPM 1YPKH 1GI6A 2JKHA 4TWWA 4U2WA 4AG1A 1LDTT 2Z94A 1RIWC 1ZPBA 2ZCHP 3TNTA 1WBGB 3F68H 5AVDA 2UUKB 2BXTH 2BDYA 2ZGXH 3ZZBA 3T26A 5EXMA 3ZVCA 1BMLA 2A7JA 2BDGA 2BY8X 4WY3A 1GMHG 1UCYK 5FX5A 1FN8A 3C27B 2M5TA 2A2QH 1C5LH 1OP2A 5ETXA 1HLTH 2PKAB 4MTBA 2G81E 3PLKA 1ETRH 3NPSA 2IOTA 2XNIA 2D1JA 1O2KA 4A92A 3RU4T 3V3MA 2FYRA 4K1TA 2WYJA 4AFQA 1E35B 2XCNA 1A3BH 4I7YH 1BTUA 2UWOA 1RRKA 2HLCA 2BVSH 4DVAU 1NFWA 2SGFE 1YPLH 1GBLA 3TJVA 1S0RA 2BMGB 1O2HA 5JBBS 4BXSA 2TGAA 1WQVH 4UONA 2ALVA 3KF2A 3VB5A 2VGCB 1GBEA 2Y6TA 2RG3A 1ARBA 3P8OA 1AMHA 4HGCA 4NA9H 3TGJE 1AB9C 1FDPA 3NCLA 3FANA 4NA8A 4CH2B 2FWWA 4BNRA 2ZPSA 3L33A 1GI7B 4I8JA 3ESTA 4Q2KA 2H5DA 1S85A 4ESTE 1V2KT 3UWIA 1BMNH 2LNCA 1W3CA 3LGIA 3A88A 1AZZA 2JH0D 4LK4A 2QCYA 1AUTC 2HGTH 1GBFA 2G5NA 1AVWA 2BLWA 1SBWA 1BDAA 3GY5A 2G00A 3RMMH 1HAGE 3RXFA 1IHTH 1MKXK 4GCHF 4Z0KA 4DCDA 2J34A 1ZHMA 3ZVDA 1HV7A 3M3SA 4K8BA 4AFSA 8ESTE 3DFLA 1T8OA 2OLGA 5H4IB 3MFJA 3DD2H 1BITA 2FX4A 3RU4E 1DLKB 5K7RA 1GMHF 3BG4B 1TWXB 7GCHG 1Y5UT 1SGQE 4Y8XA 1ESAA 4M7GA 1F5RA 1BT7A 4Y7AA 3M61U 3SU6A 3STIA 1INCA 1LHDH 2RCEA 4BAOB 2R0LA 4AG2A 1J9CH 4ABAA 1D6RA 1GHXH 1TLDA 3SJ9A 2DE8A 1DANH 4ABFA 3MU5A 4U30A 2OINA 1MQ5A 3TPIZ 1CT0E 1TPPA 4IC6A 1P0SH 4GVUA 1P02A 3GY8A 1UTJA 2FIRH 2GCHG 4X1QU 1CGHA 2VJ1A 3RXDA 1BTZA 2QXJA 1AVGH 5JBCS 1QRWA 1GJ6A 1PYTD 1SI5H 2Y5GA 4YT6H 2A4GA 1BJUA 1S6FA 2EI6A 5EU8A 1GGDB 1C1UH 2C8WB 4FUBA 5JPMH 1VJ9U 2H5CA 4X6OA 3BTQE 5T6FA 1O5DH 3T62A 2CN0H 2FOGA 2EEKA 4DG4A 4RSPA 2HPPH 1EB1H 1NC6A 3ZZ8A 2P3FH 1ANBA 1IQJA 3TH2H 5EQRA 1FPHH 1O3NA 2HPQH 7ESTE 1YPEH 4MG3A 4K2YA 1TBZH 1FAKH 1YCPK 2QV1A 2BOHB 3S9BA 1UVSH 1C5TA 4I8HA 1D3QB 4WMDA 1C5VA 1J14A 4JCNA 1AN1E 2VB0A 1RFNA 4CREA 5ESTE 2BY7X 3SUDA 1TAWA 3F9GA 3SU0A 5J4QA 1X7AC 3LT3A 4ABGA 4AOQA 3A7VA 3RXOA 1YKTA 3TLOA 3RXMA 2FM2A 2FOBA 1QB6A 2LPRA 4MNYA 1THPB 5DP7A 1GJ7B 3E1XB 1EXFA 2ZWLH 3OX7U 1CHOG 4CHAC 1UMAH 2YNBA 1EZXC 1K2I1 1TGNA 2P95A 2K1QA 4GUXA 1LCYA 2ZO3H 2HOBA 2GD4B 1P06A 3LU9B 1QY6A 1L1NA 4KTSA 1CA0C 1O3IA 1MU6B 2GCHF 1GDUA 3UQOA 1ZMLA 3RXTA 2FOHA 1GBDA 1AKSB 1CBWC 2P3UB 4FUEA 1P04A 3LKWA 5SGAE 3ZV8A 1GHBG 1QRXA 5HXFA 1TOCB 4BAHB 3GY7A 2O8UA 1C2JA 3F9HA 1ZTJA 2XBWA 4SGBE 2R3YA 4JZ1A 1HAPH 5JB9S 5EQQA 1O3GA 1FIZA 1ETTH 3LGYA 4NIXA 2BDIA 4D76A 1ZTLA 1DFPA 4X6MA 3URDA 4B76A 1TPOA 1P57B 1XUGA 1ELGA 2FODA 1P2IA 1Z8GA 2ZNKH 4ABIA 3E0NB 1VITF 1ZMJA 1M9UA 2ZG0H 2Y5HA 4Y0YE 4O03A 4Y79A 1J8AA 1HCGA 3E6PH 1N6XA 1TRNA 2Y82A 1DOJA 3I29A 4FUIA 4MNVA 5G4BA 3RMNH 1HRTH 1QL7A 3DFJA 3ATLA 3O8CA 8GCHG 1GBMA 3P8NA 1DS2E 6CHAB 1GHVH 4A5TS 1CHOF 1GBCA 2FZZA 1BTWA 3MU8A 2PWXA 1AIXH 1BJVA 1THSH 1C5RA 1IQMA 1GBBA 1UK3A 2A7HA 3A8AA 4INLA 4O3UA 5E0JA 1KIGH 1LHEH 2BY6X 3SO3A 5C3NA 2GZ9A 4NIYA 2ILNA 2ZU2A 5AF9H 3A7XA 1P05A 1C1VH 5EG4A 3RC4A 1GCTC 2FDAA 1V2RT 2FOFA 3MWIU 3A84A 5GWZA 3GCHB 3TK6A 4ABEA 1GHBF 1UK4A 1AU8A 4WWYA 1D3PB 2VVCA 1H4WA 3W94A 1WQSA 5HMAA 3RXRA 3SI4H 3SJ8A 3EA9A 3FAOA 1K9OE 1OWHA 1FMGA 4GPGA 3SHCH 1A5GH 1CO7E 2Z9GA 1HAHH 3K6YA 1PPHE 2ZCLP 1HDTH 4NG9H 1O3HA 4NFEA 2ZDAH 1NFUA 1FJSA 2WPLS 3AVZA 1O5AB 5DP6A 4ZUHA 3V7TA 5JBAS 2F3CE 3AW0A 5LPRA 2Z3DA 4CRBA 1TNLA 2FS8A 1MZDA 1F0SA 1MTWA 3QLPH 1GI1A 1O3DA 3GOVB 3A7YA 1NU9A 1O35A 3AAUA 1WTHD 1V2TT 1N1LA 3A85A 5JB8S 2UUJB 2WV5A 3QX5H 3SUFA 4IGDA 5FBEA 2JETB 1GHYH 1O3EA 2O8TA 3W95A 2O9QA 2A31A 1DWCH 4AYYB 2ZU4A 3U8OH 4Q7XA 5A0BA 3TGIE 1QJ1B 2UWLA 1DXPA 1XVMA 2QF0A 4OS2A 4D9RA 2ZKSA 2ZQ1A 3T27A 1EPTB 3P8FA 1HAXB 4Q7ZA 3RDZA 1Y59T 1OKXA 1UO6A 3ZV9A 4DY7B 1TMBH 1O3OA 1W14U 2O8MA 3A87A 1GBAA 2WPMS 3KQCA 2VWMA 1O36A 1SLXB 4ZKNU 1SLWB 3SNCA 4CRCA 1K1JA 4X1SU 1CGIE 3SJKA 3KQBA 1KXDA 2BY9X 3V13A 2QAAA 3BTME 1QBVH 2J95A 2VNTA 3BEUA 2Y7ZA 4RKJB 4X2XA 1O3JA 1RGQA 3TH4H 1QA0A 1Z6EA 2P16A 1SGEE 5L30H 2ANMH 3F9EA 3PMJA 1FY5A 1O2QA 3BEFB 1DX5M 4XBCA 4YESB 1ZLRA 1TPSA 4YTAA 4D9QA 3FZDA 1UTMA 1O2JA 1GHAG 2ZU1A 1UVPA 1SSXA 3CENA 4E06H 1DICA 2VIVA 1ZZZA 1O5GH 2BD9A 1HJAC 3SV2H 1RS0A 1QB1A 3GCNA 4FXGH 3DA9B 2BZ6H 2G55A 2W3KA 1K22H 1MMJN 4WXVA 4VGCB 1G37A 1V2JT 2FTLE 3M5MA 1PQAA 2Y80A 1TA6A 3GDUA 1CT2E 4K8YA 2BLQA 4X8VH 4FU8A 3HATH 5FCRA 4XE4A 2FLBH 1OWEA 1C2DA 2H2ZA 1NRSH 1Z8RA 3KQDA 4B2BA 2AEIH 2GMTB 2NU2E 1CSOE 1HB0B 1Y3XA 1FONA 1ANEA 1L0ZA 3PMHB 1GJ5H 4UFEH 1LKAA 2TGDA 4R8TB 2WUCA 3QO6A 5T6DA 2AGEX 1GJ4H 1ID5H 3M7QA 5E2PA 3ZVBA 1PPGE 3BTGE 1GG6B 2BD2A 1TIOA 3QDZB 2OD3B 1C5OH 3AAVA 1Z8IB 1OXGA 3RXEA 1AKSA 2DE9A 1SFIA 1O2OA 1ZRKA 1O34A 3TITA 1BRAA 2PUXB 1YLCA 5CE1A 3EDXB 2HNTF 1LPGB 1HAVB 3S7KB 5GPIB 4E05H 1OP8A 1LPKB 1GBIA 2A4QA 1MCTA 1WUNH 1YM0A 3NK8A 3PTNA 3ZVAA 4OS6A 4SGAE 1PQ8A 1GCDA 5T3HA 2G8TA 2ZCKP 4DGJA 1GHAF 2BD8A 2BLOA 1XVOA 3EGKH 1EAWA 1WTGH 5ESBA 1QQ4A 1MTNB 5F03A 3P95A 2PLXA 3MU1A 1ZSLA 3T25A 1P9SA 3GY4A 4H42U 1QL8A 1NM6A 5F8ZA 4O97A 4CBOA 2VWLA 4I33A 1AWFH 1QBNA 3MNSA 2PGBB 2J94A 3LONA 1MZAA 3P17H 2ESTE 1AGJA 1XXDA 3PMAB 1F7ZA 1Q31A 1MQ6A 1WAYB 1SQTA 1C1MA 2C93B 2TIOA 4FUCA 1UJ1A 1W0ZU 4KGAA 1MBMA 2FESH 2XC0A 3SU1A 1TONA 2H9TH 1O2WA 4I31A 4BTIB 1CGJE 3Q00A 1EJAA 3FVFB 1YCPH 2FEQH 3H7TA 2BDCA 1IQEA 4GCHG 1NRRH 1H9LB 2A32A 1XM1A 4AFZA 3O8BA 4HI3A 3UPEA 3LC5A 1TMUH 1P3CA 4UD9H 2KAIA 2OC0A 1O2RA 2OC1A 1SGFG 2C8YB 3TVJB 1C1PA 4YZUA 4MDSA 4CRDA 7KMEH 4OGYA 3WY8A 2ZZUH 1C2LA 3RXKA 1DWBH 3UY9A 2ZFQH 1VCPA 2IN2A 1FI8A 2BY5X 3SJIA 4X6PA 1QIXB 1SGCA 2PUQH 4K69A 1O3MA 1T31A 2VU8E 2AIQA 3RXBA 1DT2A 1G30B 3SW2B 5C1YA 2OC8A 2B0FA 1EAXA 1S0QA 3A89A 3QGJA 4Q7YA 3PMBB 5E0HA 1G3BA 2IJOB 1C1QA 1XX9A 1B0EA 1UTLM 4I32A 3DHKH 3HK6B 4Y7BA 2ZC9H 1QGFA 8KME2 1P3EA 3M36A 3SGQE 3NUMA 1TBQH 3A8CA 2R2MB 2SGQE 4BXWA 2ZF0H 3OTJE 4Y8YA 3LGTA 2AGGX 1IAUA 5LPEA 3KHVA 2A7CA 2ALPA 1O39A 3PYHA 2YOLA 1W7XH 3VGCB 2Z3CA 3SQEE 4KTCA 5DK1A 3LDXH 1EKBB 1PPCE 1C1OA 2D26C 1EOLA 4FUDA 5AFZH 1JRSA 2F9OA 2WPHS 3QGNB 2TGTA 1LVYA 5GDSH 1EPTA 4AFUA 1DE7H 2FOMB 2V35A 8LPRA 4ZKOU 3EQ0H 1G3EA 4X1PU 3JZ1B 1C4U2 5FPSA 1HBTH 2BYAX 1ANCA 4YOJA 1HIAA 2BDHA 1XUKA 2VGCC 1SC8U 1VJAU 3Q3YA 1C1TA 3SNBA 2XBXA 3MU0A 3UFAA 2Z9IA 1C2KA 4CR9A 1HAIH 2CGAA 4X2YA 3LC3A 1RTLA 2PW8H 1L4DA 2SGEE 2QXHA 1GI5A 3RXUA 3RXGA 4OGXA 1TQ7B 3ZVEA 1AFEH 1SGTA 1O2XA 2AH4X 3MOCA 3UREA 1W13U 4NSYA 3VFEA 5EGMA 1SGYE 1YPJH 2YNAA 3ZZ4A 2BQ6B 1HXFH 3MNXA 2A2XH 2I6QA 1GMCG 1JWTA 2FTMA 5EQSA 2OTVA 2OXSA 2ZTYA 2PFEA 4ISHH 3PO1B 4NCYA 1BA8B 1JOUB 3MI4A 2GTBA 4WXIA 3RXCA 3BG4C 2VWNA 1SOZA 1GJBB 5I46H 1A3EH 3RM0H 1JIRA 3OU0A 2H9EH 3EYDA 1PPZA 4Y8ZA 1PYTC 2Q1JA 2SFAA 3EA7A 9LPRA 3A8DA 4FU7A 1YPGH 1O2ZA 2ZPQA 1ESTA 2QN5T 4CBNA 4ZHMU 1OYTH 1KXEA 1QNJA 1ELBA 1K1IA 3UIRA 1W2KH 4B71A 4YM9A 1T4VH 1Q3XA 3FP7E 4D7GA 1B7XB 5JYIA 1TA2A 5EXNA 5AFYH 2R2WU 3A86A 3RC5A 2FYQA 4MPWA 1GI4A 1TNKA 2H6MA 4NZQA 5TJXA 1C4V2 3B9FH 1SQAA 1ESBA 1IHSH 1C2EA 1A2CH 1IQFA 1C2MA 2GP9B 2VH6A 1K21H 4NIWA 3LH3A 1C1NA 5EXLA 2SGPE 5DJ7A 2XBYA 1ELFA 4OS1A 2J4IA 2A45B 4XDEA 1VITG 2WPIS 5C5NA 1OX1A 2ZDKA 4FUFA 3H7OA 1HAVA 1BTHH 1YPHE 2FLRH 1NY22 2HVXA 1YPHC 1IQLA 2F83A 2ZQ2A 1FPCH 3A83A 2ZA5A 1FY1A 1GGDC 1C5XB 2V6NA 1IOEA 3KEEA 4TY7A 4BAMB 4LOYH 1V2MT 1ZSKA 1V2ST 5BPEA 2XWBI 1GJAB 3F6UH 2G52A 4IW4E 1AFQC 2TGPZ 1GMCF 1ZJDA 4WF8A 4YOIA 3HGPA 4R0IA 1TABE 1T8LA 3C1KA 3G01A 1HAOH 1J17T 1GJCB 2A5AA 4DJZB 3CS7A 1QB9A 4IC5A 3ZVFA 1EJNA 1BZXE 1CT4E 1S6HA 2JH6D 3RXJA 3UUZA 1H1BA 2W26A 3A8BA 1YPMH 1QJ6B 1UHBB 1F92A 3OY6U 4MLFB 5A09A 1XUHA 1SGFA 3RXPA 1C5MD