5DGJA

1.0a resolution structure of norovirus 3cl protease in complex an oxadiazole-based, cell permeable macrocyclic (20-mer) inhibitor
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
175
structure length
168
Chain Sequence
HHAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIASMRIQGRLVHGQSGMLLTGANAKGMDLGDCGAPYVHKRGNDWVVCGVHAAATNTVVCAVQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords 3C-LIKE PROTEASE
publication title Oxadiazole-Based Cell Permeable Macrocyclic Transition State Inhibitors of Norovirus 3CL Protease.
pubmed doi rcsb
source organism Norwalk virus
total genus 41
structure length 168
sequence length 175
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5dgjA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5dgjA01
2AMPA 3E0PB 2VWOA 1UVUH 1KLJH 3PLKA 4IGDA 4XBBA 5EW2H 1C2FA 1VJAU 1DOJA 1MD7A 2PW8H 2VIWA 3ZVEA 1PYTC 2Z9GA 3BTWE 4CRAA 1PJPA 2YOLA 1D4PB 1Y59T 4OS2A 4YZUA 1B0FA 2J2UA 1T7CA 2QF3A 4FUFA 2XXLA 2HRVA 4WJG2 5JPMH 4TY7A 3PTNA 3LGVA 1O3DA 5E0GA 1EPTC 1HAVB 4MNWA 5A0AE 3QZQA 1NFWA 4AOQA 3RU4E 1C1PA 2ALPA 5DPAA 3RM0H 1OXGA 1YPGH 4K5ZA 1WQVH 3M7QA 2F9NA 1O3PB 2XWBI 1DY8A 1J14A 2ZDLA 1NRQH 1QB6A 4GLYA 1UK2A 4Y79A 1GI2A 2A0QB 3A7XA 3SUDA 2SGPE 3STIA 2G8TA 1O2PA 2A5IA 2ZC9H 3DUXH 2FOHA 2FOMB 5E2OA 1IHTH 2ZHQH 5AFYH 2P94A 1KY9A 4ZHLU 1C1OA 1TPSA 2STAE 1FV9A 2BDIA 1QNJA 1EB2A 1AFEH 1ZGIA 4X6PA 4AGKA 3SU4A 2ZTYA 1W10U 1QRZA 4B75A 2AGIX 3P17H 2QYIA 1K1MA 1GGDC 2R3UA 1EUFA 1FUJA 2VIQA 2JETB 3GCNA 2P93A 2R2WU 1W0ZU 4XDEA 5ABWA 1F5RA 3FANA 1TNIA 3S69A 1A5IA 1O2QA 2WPHS 3UNRA 2WV4A 1HUTH 2H9TH 5F8ZA 4I31A 1O2IA 1XUHA 3A80A 1HJ9A 3QDZB 2J9NA 3PMAB 1LHGH 1O34A 5HMAA 1OWHA 1OOKB 2GZ8A 7ESTE 1AKSB 1G2LA 1Y3YA 1VJ9U 5K0HA 1UHBA 1JIMA 2PGBB 4Y6DA 2UWLA 1A1RA 5E2PA 1BRCE 3DD2H 4YOJA 4FXGH 1O2SA 4GPGA 3T29A 1DICA 3P8NA 1QL9A 3FP6E 2QA9E 2BDAA 5A0CA 1BA8B 1ELBA 1HNEE 3KF2A 1W11U 2FODA 5EQQA 5EPYA 5C1XA 2GCHF 5EQSA 2TBSA 1ZHRA 1OS8A 2PUXB 3BEFB 1GBCA 4O3TA 1GBJA 1FI8A 2BY9X 2FZZA 1Y3WA 3PMJA 1TGSZ 1XXFA 1BBRH 2H5DA 4YO9A 1C5RA 1C5SA 3U8TH 1YPEH 2ANWA 5CHAC 5T6DA 3UY9A 3LH1A 2OXSA 4JYVH 1YCPM 1NN6A 3UFAA 2FS8A 1SL3A 3QGNB 6GCHG 3Q76A 5DO4H 1ZMJA 2ANYA 3LPRA 4D76A 3PO1C 2G00A 4A6LA 1TYNA 4I8HA 3F9GA 1A5HA 3ZZDA 2A1DB 3RXGA 4NGAH 4CRBA 3LGWA 2NU3E 2CF9H 2Z9KA 3GY4A 2Z9JA 4FUGA 1ZRBA 3Q00A 5L2YH 4UD9H 3GY6A 4SGBE 1PPEE 3M61U 1NROH 1O2YA 1C5XB 1S82A 4CHAB 2O8TA 1B7XB 3UOUA 1EASA 4FUEA 1SGFA 3SGAE 4BAKB 3ODFA 5C1UA 4IN2A 1CVWH 1GHVH 1KIGH 1DUAA 1ELAA 1GCTB 1ZRKA 1TQ7B 4YT7H 2BLOA 3NXPA 1O3JA 3OU0A 3ATMA 1EKBB 2Q1JA 2B0FA 1D3TB 3I78A 2NU2E 5FXLA 4CH2B 2KAIB 4FU7A 1GJ8B 5EPNA 4JK6A 4FUDA 1SOZA 3SHCH 3LONA 1IHSH 1SGYE 1AY6H 1GMCG 1T32A 2LPRA 2ZFFH 1MTNB 3BTEE 5C2ZA 1C5OH 1GI3A 4K1TA 2ZEBA 3FP7E 4NCYA 4YT6H 3ZZBA 1W12U 5J4QA 5JBBS 4NZQA 1YP9A 1GHBG 3ZVAA 4ABBA 3ATKA 1QJ1B 2PKAA 1L1NA 1O38A 1QJ7B 3IITA 4INKA 3UR9A 3TK5A 7KMEH 4YESB 1W13U 1T4VH 3M3TA 1U6QA 5CE1A 4Y0ZE 4CRGA 5EXNA 1INCA 2QF0A 1O31A 2VH0A 3M36A 3PM3A 1O5BB 1ZSLA 2FDAA 1LMWB 1RTLA 1YCPH 4AYYB 4ZMAH 1PPCE 1ZPCA 4TY6A 1QQ4A 1BB0B 2C90B 3GY5A 5E0JA 4Y76A 3SNBA 5G4BA 2OBOA 2BD4A 4IW4E 4WH8A 3PWCA 1NO9H 1AFQC 2BYAX 3OX7U 5GCHF 2ESTE 4GHTA 1K9OE 5ETXA 1J9CH 2A2QH 1KTSB 2WV5A 1LCYA 1LHDH 3LJJA 1HRTH 5GIBA 1SC8U 1GJ6A 4AB9A 4AG1A 3BTQE 4NA8A 3RLWH 4FUIA 4DGJA 5HYOA 2Z3DA 1TOCB 3AAVA 1D3DB 2CMYA 1QA0A 1YYY1 1TNHA 2HPQH 1O35A 1Y3UA 3W95A 2AYWA 2O8MA 2BDYA 1FAKH 1ELVA 4A92A 4A5TS 5A8ZA 2VVUA 3NUMA 3ZVCA 5DP3A 1ABJH 1NTPA 1BTXA 1W7XH 4X2YA 3RC6A 1EPTA 1JMOH 3MYWA 4K3JA 5SGAE 1O2JA 3KCGH 5EW1H 1NY22 3VB4A 1O3GA 2C8WB 5JBAS 1SMFE 1K22H 4PROA 1P02A 4FU9A 3BF6H 3SU2A 2PHBA 3MO6A 1SLWB 1TRNA 3MHWU 3A8AA 3AVZA 3LT3A 3BTGE 4IC5A 1C5LH 4XSKU 2BDGA 2VWLA 1ZJDA 4AX9H 2FTLE 2EC9H 1C5ZB 3C27B 1V2LT 2A31A 1Q3XA 2H9EH 5EU8A 2TRMA 1LPZB 2OC1A 5K7RA 1BTZA 3RXAA 3U9AH 5T6FA 1ZHPA 3ZZ8A 2OC8A 1QBVH 1M9UA 4WH6A 1QL7A 3ZVDA 3ZYDA 3T28A 1TPOA 5CHAB 1AIXH 3QTOH 2TIOA 1BTHH 2AH4X 2R0LA 3SV9A 3QTVH 3K65B 5EXLA 1EZXC 1IQGA 1NFUA 1YPMH 1HAGE 8KME2 1TWXB 2OC7A 3P92A 3PO1B 1Z7KA 4D9RA 3S9AA 3B23B 1DS2E 2B7DH 2WPIS 1BMNH 4LK4A 2G81E 4ZUHA 2A4GA 1DXPA 3U69H 1O3FA 1OKXA 1BQYA 1TLDA 1TNJA 3QN7A 1F5LA 3SN8A 1HFDA 1V2RT 1J16A 4FUJA 1CE5A 2AMDA 2Y5GA 1SQTA 2CHAC 1MCVA 2GGVB 3PWBA 3D49H 1XUKA 1EAWA 1WTGH 1RS0A 1TGBA 8GCHF 2G4UA 1BITA 5DP7A 2FS9A 2Z7FE 1SLUB 2K1QA 1EP5A 2ZPQA 3K6YA 3L3TA 2QN5T 5DG6A 1SPJA 2BVXH 1SR5C 1LPGB 2A7CA 2ILNA 4H6SB 1EXFA 1OPHB 2ZHDA 2C8YB 2ZI2H 1PQ8A 1IQEA 3A7VA 1SGIB 1UVPA 1ZYOA 1O3KA 1S81A 2A5KA 5F8XA 1A61H 2GZ9A 1GJ7B 1MBQA 3UR6A 1TA6A 1GL0E 4ABIA 1O5AB 1VITG 2FLBH 1V2NT 2JH0D 4AFUA 2ZU2A 3UQVA 3TGIE 1PFXC 1DXWA 1O2MA 3ZVBA 1F0RA 3MMGA 3Q3KA 1GJDB 1OWEA 1HCGA 4MPXA 1GHWH 4Y8XA 4B74A 2NU1E 2SNVA 1XVMA 4KP0A 5H4IB 2THFB 5FPTA 3ATIA 1LHCH 3M3SA 1W8BH 4ISLA 4F4OC 1AI8H 2I6SA 1CU1A 2GTBA 2CJIA 1O2LA 2STBE 1AUJA 1XX9A 4IMQA 4FUCA 3GCHC 4ISOA 4I7YH 1F0SA 1TAWA 3ZZCA 2I6QA 2VWMA 1C2IA 5EOKA 1RFNA 3LDXH 2B9LA 1E35B 2FMJA 4K8BA 1ZTKA 1AFQB 2ULLA 4KGAA 3E8LA 1WYKA 2GDDA 5HGGA 1QBOA 3LH3A 3RXJA 1WAYB 5LPFA 1BZXE 2RCEA 1D6WA 3M7TA 3RM2H 1P01A 2IOTA 3SI4H 1RJXB 2PGQB 3TVJB 2Z9LA 1UVOA 5DP8A 2XRCA 3D23A 5GXPA 1MTSA 1DPOA 3Q3YA 3SUFA 1MTWA 4X1SU 1JOUB 1N6YA 1GI0A 1NFXA 2ZO3H 5C5NA 1XUGA 2AIPA 1QA7A 1XUFA 1AZZA 1V2QT 5FCKA 1IQFA 1QQUA 2OQUA 4NA7A 1C4V2 1LVMA 1CHOF 1O2NA 2C4FH 4X8VH 1K1OA 4BAOB 3E91A 3LGIA 3LC5A 4ZROA 1KSNA 1GMHG 3U8OH 2F9PA 1HJAB 1GBMA 3ZYEA 5JDUB 4Q7YA 1GJ9B 1GMDG 2Y80A 2FI3E 3CS0A 3T5FH 4OS7A 3S9CA 1UCYE 4X1NU 4BXSA 1FN6A 2FIRH 1O5FH 2V35A 5FX5A 4NWLA 2A4QA 1ZHMA 3GY3A 4CH8B 1THPB 1H4WA 1THRH 3BTKE 2FP7B 2VWNA 1CGIE 3GISB 1TOMH 1P9UA 1FY4A 1Z8IB 1UMAH 3TU7H 2BVRH 2A5AA 1P05A 1SGRE 4A1VA 1EB1H 4BNRA 4CHAC 1ESBA 1J15A 3PLPA 3RXMA 1HAPH 3BIVH 5AFZH 4YOIA 1GBAA 3NCLA 3ZZ6A 1HAZB 4ABEA 3E0NB 1SLXB 1RD3B 1ZJKA 1SQOA 5GPIB 4IS5A 4WVPE 1WQSA 2B8OH 3SUEA 1GBTA 3ATWA 1SFIA 4NIYA 2F83A 4UFEH 2AMQA 3KQDA 1YF4A 4ABHA 5A8XA 1TRYA 2Z3CA 3DFJA 2J4IA 1ZSKA 3VB5A 4AZ2B 2WPKS 4Q7XA 3PYHA 1OP2A 1O2RA 2TPIZ 1CT0E 1HAHH 3NWUA 1SB1H 1EZSC 3P8GA 2ZNKH 4DIHH 3V7TA 5FHTA 2CHAB 3MU4A 1BHXF 1BDAA 2P59A 2VVCA 1NRNH 1S6FA 3EAJA 3HGPA 1HAIH 4MTBA 3CENA 2XC5A 1OYQA 1IQIA 1EAXA 1AWFH 2VNTA 1AWHB 3ESTA 4MNXA 2FYQA 4OGYA 2VGCC 1C2JA 4DOQA 4E7RG 5DP9A 1MZDA 1NU7B 4ZXXH 3VFEA 5I46H 1O3CA 1C1MA 4AB8A 1C2KA 2PKSC 3CS7A 1BTWA 1O36A 4Y7AA 3MTYA 1DSTA 3S9BA 1CGHA 1BJVA 1P2OA 1DUEA 1BCUH 2WPLS 1B5GH 1VZQH 4NSVA 4JMYA 1FIZA 1TBZH 1UTOA 2BD8A 1HDTH 1O5EH 3V13A 4Y0YE 1QURH 4XFQA 1P9SA 2AGEX 3T26A 1P03A 4O97A 4D7GA 2QCYA 1QY6A 1NC6A 1KXDA 3GICB 3HGNA 2DE8A 2QGRA 2QY0B 1Y5UT 1GBKA 1O3HA 1AGJA 1LQDB 1UVTH 5PTPA 3ELAH 1S6HA 2ZHEH 1W3CA 5EXMA 2G4TA 3UNSA 1BT7A 3D65E 1N6XA 1GCDA 1Z1JA 4U32A 3O8DA 3GYMA 1SFQB 1T8LA 3GCHB 1D3PB 2NWNA 1TX6A 3IG6B 2O8LA 3SUGA 3F6UH 2QIQA 7GCHF 1Z6JH 5IYTA 1GVKB 2BLQA 1AU8A 4Q7ZA 1AUTC 1GI1A 1HAVA 1V6DA 2FI4E 3F68H 3P70B 3A88A 1L4DA 2YNAA 3UWJH 1GG6C 3EA8A 5A8YA 1C5YB 3EE0B 3C1KA 1TNKA 3OY6U 3MO9A 1QJ6B 1QTFA 1MZAA 3A7ZA 2VJ1A 3RUOA 1Z1IA 3VPKA 1YPHE 3AW1A 1HXFH 1G36A 1O32A 1OWDA 2A4RA 4NIXA 2F9BH 2GDEH 4U2WA 1K21H 3SNCA 3H7OA 5FX6A 1C2HA 3SV7A 1YPLH 1AVGH 2FM2A 1P09A 4RN6A 1J17T 1RGQA 1XXDA 3SNAA 3M7UA 2ZQ1A 1C5WB 1TFXA 3VXEH 1Y3XA 1QBNA 3O8CA 1DT2A 1P57B 5T3HA 3U8RH 1C1RA 1W14U 1P8VC 3D62A 3KHVA 2W3KA 4ZAEA 2XCNA 4UEHH 4MG3A 1LO6A 1WV7H 3QUMP 5AF9H 4ISHH 1RXPA 3MU5A 5F6MA 1O3NA 3MI4A 2J94A 3TH4H 4WWYA 2HGTH 4KELA 4D9QA 1AKSA 1F92A 3KL6A 1NESE 1FMGA 2VVVA 3FVFB 3ZZ3A 1LQEA 2ZDMA 3TH2H 2F91A 1KXFA 4O3UA 2ANMH 5GDSH 5HM9A 3M5LA 1YPHC 5CMXH 1GHYH 2HNTF 2M5TA 2PSYA 3M5OA 4ZXYH 3URCA 2BTCE 4HFPB 4LZ1H 2GCHG 2XBVA 4X2VA 1XKAC 3B9FH 2FEQH 3EA9A 3M5MA 1GBHA 3BSQA 1BOQA 1C1QA 4WMFA 3PTBA 1VCPA 4M7GA 4WY3A 2H9HA 3SI3H 1OP8A 2ZDNA 3DT0H 3QZRA 1SGDE 4MPUA 1ZPBA 1GBLA 1TE0A 1KDQB 1DE7H 2RDLA 1BRAA 2AFQB 1D3QB 1MAXA 4K8YA 2HNTE 3GDSA 1L0ZA 5DP6A 3TLOA 4I8LA 3MU8A 1N1LA 1DWCH 2XWAA 2ZFSA 3QWCH 5FBIA 3PV4A 4X8TH 2GMTB 3MFJA 1PPGE 3TJOA 2UWOA 3TJVA 1C2GA 2BQWB 3KEEA 4R8TB 1V2TT 2QV1A 4NSYA 1UCYK 1Z8RA 1AHTH 1SGPE 1AD8H 1C9PA 2P16A 3GYLB 1UVSH 4JZFH 3KIDU 4UDWH 4I32A 1A3EH 2VGCB 1G2MA 3S7KB 2ZFPH 4TWYA 2J95A 5HXFA 1DLEA 1TIOA 1AE8H 5DP4A 1NRSH 1C5PA 4MLFB 1JRSA 2Y7ZA 2PKSB 1FJSA 1YPJH 3TNTA 4DURA 4FU8A 1PPZA 2PLXA 4VGCC 4ABDA 2ZGBH 2A4OA 1EJAA 1NRRH 1P2NA 5DKMA 1HYLA 1AN1E 1IOEA 3SQEE 1MAYA 2KAIA 1TMUH 1MBMA 2FYRA 3RMLH 4UFGH 1O39A 2BX3A 3ZZ7A 2UUYA 1FY3A 3MNCA 3V12A 1UTNA 4MDSA 3SO3A 4B71A 2H2ZA 1SVPA 2W7SA 1W2KH 4MNVA 5EQRA 4OS5A 2FLRH 1O2WA 1TABE 3GCTF 2W5EA 1TNLA 3KNXA 1P2QA 3FZZA 3RP2A 2ASUB 1Q2WA 3Q3XA 1ELEE 1AZ8A 2GV7A 1YPKH 4H42U 4Y71A 1HJAC 1C1UH 3SJ8A 5F03A 3RMNH 1HBTH 8LPRA 2FOAA 1T8OA 1GG6B 4XOJA 1H9IE 1FXYA 1QFKH 1KLTA 4K69A 2A2XH 2IPHA 3MH4A 5GCHG 3SJ9A 3V3MA 4BXWA 2QAAA 1PPFE 1BTYA 1GI5A 2A7HA 2FI5E 4JYTA 1VGCB 4ZKOU 2YNBA 2ZZUH 1XUIA 1DX5M 3A86A 2ALVA 1SGTA 1BMLA 3MNXA 5FBEA 1A5GH 1GDNA 4K60A 4WMDA 2AERH 1MUEB 2PSXA 4K2YA 5DJ7A 4Y8ZA 1AB9B 1C1TA 3U1JB 1L1JA 1P2JA 3KGPA 2QXHA 4X6OA 1KTTB 4BANB 3U98H 1G3CA 1BJUA 2FX6A 3F9HA 4H6TA 2FOFA 5BPEA 1Z6EA 2BVSH 3A89A 1EJMA 1F7ZA 5ESTE 1DVAH 1TQ0B 3PMHB 3ZZ9A 1VITH 3M3VA 4ZKRU 2BQ7B 4B2AA 1HIAB 4I8KA 2ZA5A 3P8OA 2BY5X 3GY8A 2CGAA 3ODDA 1HXEH 1P12E 1C4U2 3RXTA 2Y5FA 3FAOA 1GJBB 1ANEA 1A0LA 1F2SE 3SBKA 3MO3A 1P0SH 2RA0A 1EQ9A 1O2HA 2D2DA 1RIWB 2ZDKA 4GCHF 2OLGA 2WPJS 2ZCLP 5L30H 4D7FA 1XKBC 4NFFA 1ZOMA 3UPEA 2XNIA 2O8UA 1QCPA 4Y10E 4B2CA 1NFYA 1KXEA 3TPIZ 1SGCA 1Z8JB 5FPSA 2GP9B 2OD3B 2EI6A 3BG4C 4NIWA 1MH0A 4JYUH 1AMHA 4MQAA 1H9LB 4E06H 3HKIB 3I77A 3TJNA 2A45B 1MCTA 5LGOA 4ISIH 2UUFB 1FPCH 1SG8B 1LKBA 4DJZB 3P95A 3RXRA 1FPHH 2BB4A 3TITA 1DY9A 2ZTXA 1GVZA 1KXBA 2ZWLH 1V2PT 4JZDH 1H8DH 1O5GH 4LOYH 1E0FD 4U30A 4YOGA 1EATA 3QO6A 2IJOB 3DHKH 2ZHFH 1O37A 4CRCA 1KXCA 2TGDA 1NZQH 5AVDA 4CRFA 4X2XA 1WCZA 3SU5A 1E37B 2VINA 4UONA 1SGQE 4THNH 1GHZA 1UK4A 1UJ1A 5A09A 2WYGA 3RU4D 4GCHG 3SU0A 3MOCA 1C5QA 1EOJA 2EI7A 3MH5A 4I8GA 3TH3H 3RXEA 2R2MB 4X1QU 8GCHG 1D9IA 4NIVA 3A84A 3SZNA 3P8FA 2QC2A 1FNIA 1GJ5H 1BRUP 5FPYA 4RSPA 1OP0A 5EG4A 4VGCB 3RMOH 2ZCKP 1ESAA 2TGPZ 2V0BA 2R3YA 2O9QA 1A2CH 1SGFG 1SQAA 3ZV8A 1EP6A 1CBWC 1O3OA 2BY7X 1TNGA 1UCYH 1O2ZA 4HTCH 1FN8A 1QGFA 2ZFRH 1ZMLA 3H7TA 1TPPA 2ZU5A 1DDJA 3UWIA 1V2WT 4I8JA 5EODA 2Y5HA 3HK3B 1RRKA 2WINI 3ATLA 1K1LA 2QXGA 1V2MT 3L6PA 3MU0A 1SHYA 1D6RA 1P3CA 3LC3A 5DGJA 3RXFA 1O5CB 1P2MA 1WSSH 5JBTA 2C8ZB 2P3TB 3W94A 1BTUA 2ZGJA 3V0XA 4Y7BA 1T4UH 2UUKB 2BXUH 2H5CA 1JBUH 2CXVA 1GJAB 1GHAF 1MTVA 2RG3A 2B5TB 2EI8A 2BOHB 3LKWA 3RXUA 3PLBA 3SV6A 1XM1A 2GT8A 4X8UH 3RXLA 3F1SB 4LXBH 2DUCA 2ZCHP 3VB7A 2R0KA 2ZQ2A 1MQ6A 1BTPA 2G52A 1WTHD 3SGQE 1NRPH 3FP8E 4AFSA 1Y5BT 2OUAA 3RXSA 4AFZA 3JZ2B 2XW9A 2SNWA 3A7YA 2BXTH 1SGNE 1C1VH 1HAOH 2FO9A 1O0DH 2XC0A 1H8IH 4FUHA 1O2UA 1HJ8A 2HOBA 3WY8A 4FVDA 4KTUA 3O8BA 3NK8A 1C5MD 3RXOA 2BMGB 5LH8A 1XUJA 1PPBH 4E7NA 1CHOG 2BQ6B 3HATH 2LNCA 4JZEH 1YGCH 5FCRA 3VGCB 3MNSA 1EAUA 2FESH 2HVXA 4H4FA 1GBEA 2Q6DA 2Z6BD 3BTDE 3KQCA 1CA8B 2Y82A 7LPRA 2Q6FA 5A2MH 3UTUH 1O3EA 3GY7A 1TGCA 4X1RU 2C3SA 1GHAG 4INLA 1K28D 4AG2A 4DVAU 1TPAE 4ASHA 4X6MA 3RXKA 4ABJA 1BUIA 2NU4E 4UFFH 3M37A 3K2UA 1TMBH 2GVFA 4E05H 1CT2E 1O30A 3LJOA 2GMTC 1YBWA 2ZGHA 4KTCA 3N7OA 1JXPA 2R9PA 3SHAH 3DA9B 2IN2A 2CF8H 1CO7E 4BAQB 2FXRA 3BG4B 2HPPH 1A7SA 3RXHA 3EDXB 1IQNA 4X1PU 4TPYA 1UTKA 1EJNA 1LKAA 2FOCA 5LPEA 4OS6A 2BDCA 4GVUA 1UTQA 1V2OT 3SNDA 1NU9A 4MPVA 4XE4A 2Z94A 1ELGA 1C2DA 1J8AA 3A85A 4R0IA 3UREA 1O3IA 2FOGA 1UHBB 3UOPA 1GDUA 1LPKB 3G01A 4J1YA 1GI9B 1LVBA 2SGAA 1S84A 3AW0A 3ITIA 2BD5A 3E3TA 1K1IA 1QL8A 3A8DA 5T6GA 4QT8C 3AAUA 1T8MA 1CGJE 2VU8E 3OSYA 1GHXH 2WUBA 1LVYA 2PR3A 3LGUA 2VH6A 5JB8S 2EA3A 1XVOA 1IQLA 1EZUC 2ODPA 2SGQE 3OYPA 5FAHA 3RDZA 2GD4B 1P2KA 1YKTA 1GBIA 3RXPA 1C5TA 2D26C 3ZZ4A 4BAMB 4DIIH 2P8OC 1RTKA 4TPIZ 3VB6A 1Y8TA 4A7IB 4ZHAA 4ABFA 4U01A 2QXIA 2XBWA 4WXIA 3VXFH 2BM2A 1C1WH 3UQOA 2PV9B 2BY6X 3KQBA 2OP9A 3SNEA 1Y3VA 4GSOA 3JZ1B 2C93B 1K1NA 1OWJA 1CBWB 1DWDH 3CP7A 2GCTB 3A83A 1HAXB 3LU9B 9LPRA 2H6MA 1C5UA 1ANDA 6GCHF 1NT1A 1PQ7A 1HGTH 1G3DA 1ETRH 1VGCC 2ZHWH 1O5DH 4YM9A 4UFDH 1MQ5A 3HPTB 2FWWA 1GBFA 2ZDVH 3T25A 3RXQA 1C2LA 1LTOA 1YLCA 2OC0A 1AB9C 2ZDAH 3A7TA 2GX4A 1ORFA 4I33A 3K6ZA 2SGDE 4TWWA 1CQQA 3SJKA 4NFEA 3PB1E 3SV8A 2JH5D 1AVXA 1QB9A 2RA3A 3FFGA 1TBRH 5E0HA 7GCHG 3OTJE 4UE7H 3A8CA 4BAHB 3IWMA 1W0YH 2FOEA 5L6NH 2AGGX 2FTMA 1ID5H 3T27A 3RXDA 1ELTA 1MU8B 5LPRA 2BY8X 3LIWA 2BOKA 2W7UA 1N8OC 1O2KA 2BHGA 1FIWA 1GMCF 3SQHE 3RC5A 3UIRA 5C67A 1ACBE 2BD7A 1A4WH 1BRBE 2SGFE 4X0WU 1RIWC 4WMEA 2PKAB 1ZR0A 2TGAA 3MH7A 1A0JA 4WF8A 1F0TA 1GHBF 5HM2A 3EA7A 4IN1A 1ARCA 2CN0H 3ZZ5A 1G30B 2XCFA 4O9VA 2XYAA 4Q80A 2G5NA 2VIVA 4CR5A 2A32A 1DITH 4OS1A 3O8RA 4IBLH 1L2EA 1UTMA 1JIRA 3K9XB 3ZV9A 1DANH 1K2I1 1DLKB 1OWKA 1TX7A 4CREA 3R3GB 1EOLA 1S85A 2ZU4A 2UUJB 4FUBA 2Q6GA 2PTCE 3NPSA 1ANBA 1C1SA 1FLEE 1BBRE 3SOSA 4CR9A 1GI6A 1C4Y2 1ETSH 2VIPA 1C9TA 4F49A 2H1UA 4JK5A 1P11E 2ODQA 3E1XB 4B73A 1NM6A 4JZIA 4HGCA 1ARBA 3BN9A 2OINA 1LHEH 1S0QA 3MNBA 2EEKA 4CBOA 2GKVE 1CSOE 1YC0A 1O33A 2F9UA 2G5VA 3GCOA 2V3OH 2P95A 3KN2A 2PFEA 1EAIA 1HAYB 1KXAA 1SBWA 1WU1A 1PQAA 2BDHA 8ESTE 3ZVFA 3SJOA 1O2TA 2VIDA 1FAXA 2C8XB 1GI4A 1AVWA 3RU4T 3NKKA 2AEIH 3B8JA 3NZIA 1SLVB 4ZH8A 5L2ZH 4KTSA 3BTME 1KLIH 2J34A 2D1JA 3SU1A 2DE9A 2GZ7A 1THSH 4Q2KA 2UWPA 1GDQA 2ODYB 1GI7B 1O3AA 1EPTB 2VIOA 2OQ5A 2PUQH 1OWIA 4XBDA 1HV7A 1VR1H 1FY1A 2FPZA 4BTTB 3A7WA 5GJ4B 1K1JA 1DWEH 4WXVA 1IQKA 1MKWK 3R0FA 3UNQA 1C2MA 1OYTH 3VEQB 1Z8GA 3U1IB 2WPMS 4AGJA 2HNTC 1W7GH 5TJXA 3A82A 1O2GH 4DW2U 3A87A 3FZDA 1KDQA 1DWBH 1WBGB 2WYJA 5C3NA 5B6OA 1A0HB 2G51A 2PWXA 2Z9IA 2OTVA 4GHQA 1Q31A 3F9EA 3GOVB 4AYVB 1P10A 1C5VA 3HKJB 1LDTT 2ZECA 1ZZZA 1C2EA 2P8OB 3TK6A 4BTUB 2ZKSA 1F0UA 2ZTZA 3S0NA 1G37A 1T31A 5C5OA 1GGDB 1FZZA 1MTUA 3Q77A 1AE5A 4K1SA 2J38A 1RTFB 3RXCA 1CA0C 2J92A 3MH6A 2D8WA 5EGMA 3E90B 1XMNB 1O3LA 1MKXK 4RKJB 2A7JA 2BLWA 5DP5A 4B76A 2XTTB 1UTJA 1BHXB 3MWIU 3PMBB 4GAWA 1GL1A 1L1GA 2G55A 1TONA 3EGKH 3S7HB 6ESTA 3ZZAA 4B1TA 3GDUA 1O2OA 1MD8A 1V3XA 5BRRE 4YLQH 4DG4A 1FQ3A 3TJUA 1DSUA 2V3HH 3STJA 3DFLA 1O3MA 5A0BA 2Y7XA 4LZ4B 1ZPZA 1NPMA 3GCTG 1V2ST 5C1YA 2F9OA 1DFPA 5I25A 1ELFA 6CHAC 4ISNA 2BZ6H 1B0EA 1FONA 2CV3A 4TYDA 4A1TA 1ANCA 2HLCA 3VGCC 3KQEA 1L4ZA 3AASA 2SGEE 2ZGCA 2ZPSA 3SW2B 4MVNA 1H9HE 4ABAA 1IQHA 1ETTH 2ZF0H 1ZSJA 2XBYA 4CBNA 4SGAE 1O2XA 1C1NA 1N8OB 4INHA 3SORA 1C5NH 1E38B 3QGJA 1ZMNA 1GBBA 2PTNA 3RXBA 1NS3A 1QHRB 1HPGA 1A3BH 3UUZA 1PYTD 1BIOA 1VCQA 1CHGA 2HWLB 1VITF 1LHFH 4IC6A 1GJ4H 2ZU3A 4FVBA 2F9VA 3SJIA 1E36B 3EQ0H 2ZG0H 1MMJN 1TA2A 1WUNH 1FY5A 2F3CE 1G32B 1YLDA 4J2YB 1EX3A 1Z71A 2HALA 1TX8A 3LGYA 2ZGXH 5ESBA 2BLVA 1GPZA 3RLYH 3SV2H 5JYIA 1X7AC 3GY2A 2P3FH 2SFAA 1S5SA 2Z3EA 2BD3A 3EYDA 4ABGA 1UTLM 1G9IE 5JB9S 4DT7B 5JBCS 1K1PA 2W3IA 1E34B 1TGNA 1HIAA 1ZLRA 3RMMH 1G3BA 2V6NA 3QLPH 4JCNA 2VB0A 1YM0A 4NWKA 2W26A 1A46H 4D8NA 2O8WA 2ZPRA 3L33A 1HLTH 1WOFA 1P06A 5DK1A 1Y5AT 1S0RA 3SU6A 4JZ1A 3PROA 3OY5U 3LGTA 1V2KT 4MPWA 2Y6TA 9ESTA 4AN7A 1V2UT 4DY7B 1P3EA 5F8TA 1UTPA 1ZTJA 1T8NA 3P6ZB 4AORA 2TGTA 2FOBA 1TMTH 2JETC 1P04A 3QK1A 4NZLA 4BOHA 4ZHMU 3M5NA 1GMHF 4GUXA 6LPRA 4CRDA 2BDBA 1QIXB 1P2IA 1GMDF 1IQMA 2GCTC 3MU1A 1AQ7A 5C20A 5IDKA 2NU0E 4OS4A 2AIQA 3HK6B 3BEIB 4Y11E 1QR3E 3I29A 5TCCA 1O2VA 3URDA 4Y8YA 2ZFQH 3A8BA 4X8SH 3RXIA 1BBRK 2AS9A 2BD9A 4O03A 1PPHE 1HB0B 4AFQA 4NG9H 3E16B 2ZP0H 2JKHA 4A1XA 1GWAA 4XBCA 4HZHA 3ENSB 4DCDA 1GVLA 4X6NA 1QB1A 3RC4A 1ELDE 1V2VT 3TIUA 2BX4A 3TGJE 1ZTLA 4ZKNU 1CA0B 4K1EA 1GI8B 3T2NA 1MKWH 3QX5H 2ZFTA 5AHGH 5GWZA 3BG8A 4HI3A 1BMAA 1V2JT 1IAUA 3M35A 4NA9H 4BTIB 2GT7A 1IQJA 1GJCB 5E8EH 3BTHE 3ZVGA 1OX1A 1JRTA 1TALA 4ZKSU 2JH6D 4Z0KA 1FY8E 4RKOB 1DM4B 2ZIQH 1GBDA 4OGXA 1ELCA 4YLUA 3T62A 3LOXA 1S83A 1TGTA 1SI5H 3GDVA 3F9FA 3E6PH 2GV6A 2OCVB 4B2BA 1QRWA 1O3BA 1ESTA 1EZQA 1SGEE 2BZAA 3SU3A 4MNYA 3TNSA 3H5CB 1TRMA 2P3UB 3BEUA 1TB6H 3RXVA 1SHHB 1VCWA 4X2WA 3TGKE 4ESTE 3SGBE 2WUCA 3VB3A 6CHAB 1MKXH 1QRXA 1LVOA 3BV9B 3BTTE 2FX4A 1KYNA 2ANKH 3A81A 3BIUH 1ZGVA 1F5KU 4IMZA 4YTAA 2ZU1A 1CT4E 3BTFE 1H1BA 1UO6A 2XC4A 1GCTC 1UK3A 1PQ5A 1SSXA 1AO5A 1MU6B 2OBQA 1BMMH 1JWTA 2BD2A 1G3EA 4KKDA 1SOTA 5J4SA 4Z6AH 2QXJA 1ABIH 1TBQH 1OSSA 2Y81A 5TCAA 1YCPK 2XBXA 3TK9A 1FDPA 1MTNC
chains in the Genus database with same CATH superfamily
2AMPA 3E0PB 5CHBA 2VWOA 1UVUH 1KLJH 3PLKA 4IGDA 4XBBA 5EW2H 1C2FA 1VJAU 5C17A 1DOJA 1MD7A 2PW8H 2VIWA 3ZVEA 1PYTC 2Z9GA 2HVYB 3BTWE 4CRAA 1PJPA 2YOLA 1D4PB 1Y59T 4OS2A 5T1VA 4YZUA 1B0FA 2J2UA 1T7CA 2QF3A 4FUFA 2XXLA 2HRVA 4WJG2 5JPMH 4TY7A 3PTNA 3LGVA 1O3DA 5E0GA 1EPTC 1HAVB 4MNWA 5A0AE 3QZQA 1NFWA 4AOQA 3RU4E 1C1PA 2ALPA 5DPAA 3RM0H 1OXGA 1YPGH 4K5ZA 1WQVH 3M7QA 2F9NA 1O3PB 2XWBI 1DY8A 1J14A 2ZDLA 1NRQH 1QB6A 1WXRA 4GLYA 1UK2A 4Y79A 1GI2A 2A0QB 3A7XA 3SUDA 2SGPE 3STIA 2G8TA 1O2PA 2A5IA 2ZC9H 3DUXH 2FOHA 2FOMB 5E2OA 1IHTH 2ZHQH 5AFYH 2P94A 1KY9A 4ZHLU 1C1OA 1TPSA 2STAE 1FV9A 2BDIA 1QNJA 1EB2A 1AFEH 1ZGIA 4X6PA 4AGKA 3SU4A 2ZTYA 1W10U 1QRZA 4B75A 2AGIX 3P17H 2YMSB 2QYIA 1K1MA 1GGDC 2R3UA 1EUFA 1FUJA 2VIQA 2JETB 3GCNA 2P93A 2R2WU 1W0ZU 4XDEA 5ABWA 3F0PA 1F5RA 3FANA 5EJ1A 1TNIA 3S69A 1A5IA 1O2QA 2WPHS 3UNRA 2WV4A 1HUTH 2H9TH 5F8ZA 4I31A 1O2IA 1XUHA 3A80A 1HJ9A 3QDZB 2J9NA 3PMAB 1LHGH 1O34A 5HMAA 1OWHA 1OOKB 5KECA 2GZ8A 7ESTE 1AKSB 1G2LA 1Y3YA 1VJ9U 5K0HA 1UHBA 1JIMA 2PGBB 4Y6DA 2UWLA 1A1RA 5E2PA 5FL7D 1BRCE 3DD2H 4YOJA 4FXGH 1O2SA 4GPGA 3T29A 1DICA 3P8NA 1QL9A 3FP6E 2QA9E 2BDAA 5A0CA 1BA8B 1ELBA 1HNEE 3KF2A 1W11U 2FODA 5EQQA 5EPYA 5C1XA 2GCHF 5EQSA 2TBSA 1ZHRA 4B6EA 1OS8A 2PUXB 3BEFB 1GBCA 4O3TA 1GBJA 1FI8A 2BY9X 2FZZA 1Y3WA 3PMJA 1TGSZ 1XXFA 1BBRH 2H5DA 4YO9A 1C5RA 1C5SA 3U8TH 1YPEH 2ANWA 5CHAC 5T6DA 3UY9A 3LH1A 2OXSA 4JYVH 1YCPM 1NN6A 3UFAA 2FS8A 1SL3A 3QGNB 3N7EA 6GCHG 3Q76A 5DO4H 1ZMJA 2ANYA 3LPRA 4D76A 3PO1C 2G00A 4A6LA 1TYNA 4I8HA 3F9GA 1A5HA 3ZZDA 3FO8D 2A1DB 3RXGA 2PP6A 4NGAH 4CRBA 3LGWA 2NU3E 2CF9H 2Z9KA 3GY4A 2Z9JA 4FUGA 1ZRBA 3Q00A 5KGOA 5L2YH 4UD9H 3GY6A 4SGBE 1PPEE 3M61U 1NROH 1O2YA 1C5XB 1S82A 4CHAB 2O8TA 1B7XB 3UOUA 1EASA 4FUEA 1SGFA 3SGAE 4BAKB 3ODFA 5C1UA 4IN2A 1CVWH 1GHVH 1KIGH 1DUAA 1ELAA 1GCTB 1ZRKA 1TQ7B 4YT7H 2BLOA 3NXPA 1O3JA 3OU0A 3ATMA 4F48B 1EKBB 2Q1JA 2B0FA 3WW7A 1D3TB 3I78A 2NU2E 1VKYA 5FXLA 4CH2B 2JDID 2KAIB 4FU7A 1GJ8B 5EPNA 4JK6A 4FUDA 1SOZA 3SHCH 3LONA 1IHSH 1SGYE 1AY6H 1GMCG 1T32A 2LPRA 2ZFFH 1MTNB 3BTEE 5C2ZA 1C5OH 1GI3A 4K1TA 2ZEBA 3FP7E 4NCYA 4YT6H 2YMSD 3ZZBA 1W12U 5J4QA 5JBBS 4NZQA 1YP9A 1GHBG 3ZVAA 3VG8A 4ABBA 3ATKA 1QJ1B 2PKAA 1L1NA 1O38A 1QJ7B 3IITA 4INKA 3UR9A 3TK5A 7KMEH 4YESB 1W13U 1T4VH 3M3TA 1U6QA 5CE1A 4Y0ZE 4CRGA 5EXNA 1INCA 2QF0A 1O31A 2VH0A 3M36A 3PM3A 1O5BB 1ZSLA 2FDAA 1LMWB 1RTLA 1YCPH 4AYYB 4ZMAH 1PPCE 1ZPCA 4TY6A 1QQ4A 1BB0B 2C90B 3GY5A 5E0JA 4Y76A 3SNBA 5G4BA 1WDIA 2BD4A 2OBOA 4IW4E 1FX0B 4WH8A 3PWCA 1NO9H 1AFQC 2BYAX 3OX7U 5GCHF 2ESTE 4GHTA 1K9OE 5ETXA 1J9CH 2A2QH 1KTSB 2WV5A 1LCYA 1LHDH 3LJJA 1HRTH 5GIBA 1SC8U 1GJ6A 4AB9A 4AG1A 1BMFD 3BTQE 4NA8A 3RLWH 4FUIA 4Q4LA 4DGJA 5HYOA 2Z3DA 1TOCB 3AAVA 1D3DB 3SYJA 2CMYA 3EE7A 1QA0A 1YYY1 1TNHA 2HPQH 1O35A 1Y3UA 3W95A 2AYWA 2O8MA 2KCPA 2BDYA 1FAKH 1ELVA 3CNRA 4A92A 4A5TS 5A8ZA 2VVUA 3NUMA 3ZVCA 5DP3A 1ABJH 1NTPA 1BTXA 1W7XH 2QF4A 4X2YA 3RC6A 1EPTA 1JMOH 3MYWA 4K3JA 5SGAE 1O2JA 3KCGH 5EW1H 1NY22 3VB4A 1O3GA 2C8WB 5JBAS 1SMFE 1K22H 4PROA 1P02A 3N7DA 3GS9A 4FU9A 3BF6H 1OHHD 3SU2A 2PHBA 3MO6A 1SLWB 1TRNA 3MHWU 3A8AA 3AVZA 3LT3A 3BTGE 4IC5A 1C5LH 3U28C 4XSKU 2BDGA 2VWLA 4HG6A 1ZJDA 4AX9H 2FTLE 2EC9H 1C5ZB 3C27B 1V2LT 2A31A 1Q3XA 2H9EH 5EU8A 2TRMA 1LPZB 2OC1A 5K7RA 1BTZA 3RXAA 3U9AH 5T6FA 1ZHPA 3ZZ8A 2OC8A 2KCAA 1QBVH 1M9UA 4WH6A 1QL7A 3ZVDA 3ZYDA 3T28A 2OK5A 1TPOA 5CHAB 4ACBA 1AIXH 3QTOH 2TIOA 1BTHH 2AH4X 2R0LA 3SV9A 3QTVH 3K65B 5EXLA 1EZXC 1IQGA 1NFUA 1YPMH 1HAGE 8KME2 1TWXB 2OC7A 3P92A 3PO1B 1Z7KA 4D9RA 3S9AA 3OTPA 3B23B 1DS2E 3DSGA 1KMHB 2B7DH 2WPIS 1BMNH 4LK4A 2G81E 4ZUHA 2A4GA 1DXPA 3U69H 1O3FA 1OKXA 1BQYA 1TLDA 1TNJA 3QN7A 1F5LA 3SN8A 1HFDA 1V2RT 1J16A 4FUJA 1CE5A 2AMDA 2Y5GA 2J97A 1SQTA 2CHAC 1MCVA 2GGVB 3PWBA 3D49H 1XUKA 1EAWA 1WTGH 1RS0A 1TGBA 8GCHF 2G4UA 1BITA 5DP7A 5C94A 2FS9A 3FOAA 2Z7FE 1SLUB 2K1QA 1EP5A 2ZPQA 3K6YA 3L3TA 2QN5T 5DG6A 2KCOA 1SPJA 1SR5C 1LPGB 2A7CA 2BVXH 2ILNA 4H6SB 1EXFA 1OPHB 2ZHDA 3OE7D 2C8YB 2ZI2H 1PQ8A 2W6ID 1IQEA 3A7VA 1SGIB 1UVPA 1ZYOA 1O3KA 1S81A 2A5KA 3DSPA 5F8XA 1A61H 2GZ9A 1GJ7B 1MBQA 3UR6A 1TA6A 1GL0E 4ABIA 1O5AB 1VITG 2FLBH 1V2NT 2JH0D 4AFUA 2ZU2A 3UQVA 3TGIE 1PFXC 1DXWA 1O2MA 3ZVBA 1F0RA 3MMGA 3Q3KA 1GJDB 1OWEA 2QE7D 1HCGA 4MPXA 1GHWH 4Y8XA 4B74A 2NU1E 2SNVA 1XVMA 4KP0A 5H4IB 2THFB 5FPTA 3ATIA 1LHCH 3M3SA 1W8BH 4ISLA 4F4OC 1AI8H 2I6SA 1CU1A 2GTBA 2CJIA 1O2LA 2STBE 1AUJA 1XX9A 4IMQA 4FUCA 3GCHC 1E1RD 4ISOA 4I7YH 1F0SA 1TAWA 3ZZCA 2I6QA 2VWMA 1C2IA 5EOKA 1RFNA 3LDXH 2JJ1D 2B9LA 1E35B 2FMJA 4K8BA 1ZTKA 1AFQB 2ULLA 4KGAA 3E8LA 1WYKA 2GDDA 5HGGA 1QBOA 3LH3A 3RXJA 1WAYB 5LPFA 1BZXE 2RCEA 1D6WA 3M7TA 3RM2H 1P01A 2IOTA 3SI4H 1RJXB 2PGQB 3TVJB 2Z9LA 1UVOA 5DP8A 2XRCA 3D23A 5GXPA 1MTSA 1DPOA 2W6JD 3Q3YA 3SUFA 1MTWA 4X1SU 1JOUB 1N6YA 1GI0A 1NFXA 2ZO3H 5C5NA 1XUGA 2AIPA 1QA7A 1XUFA 1AZZA 1V2QT 5FCKA 1IQFA 1QQUA 2OQUA 4NA7A 1C4V2 1LVMA 1CHOF 1O2NA 2C4FH 4X8VH 1K1OA 4BAOB 3E91A 3LGIA 3LC5A 4ZROA 1KSNA 1GMHG 3U8OH 2F9PA 1HJAB 1GBMA 3ZYEA 5JDUB 4Q7YA 1GJ9B 1GMDG 2Y80A 2FI3E 3CS0A 3T5FH 4OS7A 3S9CA 1UCYE 4P00A 4X1NU 4BXSA 1FN6A 2FIRH 1O5FH 2V35A 5FX5A 4NWLA 2A4QA 3F0OA 1ZHMA 3GY3A 4CH8B 1THPB 1H4WA 1THRH 3BTKE 2FP7B 2VWNA 1CGIE 3GISB 1TOMH 3OEHD 1P9UA 1FY4A 1Z8IB 1UMAH 3TU7H 2BVRH 2A5AA 1P05A 1SGRE 4A1VA 1EB1H 3OEED 4BNRA 4CHAC 1ESBA 1J15A 3PLPA 3RXMA 1HAPH 3BIVH 5AFZH 4YOIA 1GBAA 3NCLA 3ZZ6A 1HAZB 4ABEA 3E0NB 1SLXB 1RD3B 1ZJKA 1SQOA 5GPIB 4IS5A 4WVPE 1WQSA 5HIYA 2B8OH 3SUEA 1GBTA 3ATWA 1SFIA 2GJGA 2F83A 4NIYA 4UFEH 2AMQA 3KQDA 1YF4A 3FN8A 4ABHA 1NBME 1TRYA 5A8XA 2Z3CA 3DFJA 2J4IA 1ZSKA 3VB5A 4AZ2B 2WPKS 4Q7XA 3PYHA 1OP2A 1O2RA 3NRLA 2TPIZ 1CT0E 1HAHH 3NWUA 1SB1H 1EZSC 3P8GA 2ZNKH 4DIHH 3V7TA 2RDEA 5FHTA 2CHAB 3MU4A 1BHXF 1BDAA 2P59A 2VVCA 1NRNH 1S6FA 3EAJA 3HGPA 1HAIH 4MTBA 3CENA 2XC5A 1OYQA 1IQIA 1EAXA 1AWFH 2VNTA 1AWHB 3W1EA 3ESTA 4MNXA 2FYQA 2QF5A 4OGYA 2VGCC 4AC9A 1C2JA 4DOQA 2WPDD 4E7RG 5DP9A 1MZDA 1NU7B 4ZXXH 3VFEA 5I46H 1O3CA 1SQRA 1C1MA 3MQKC 4AB8A 1C2KA 2PKSC 3CS7A 1BTWA 1O36A 4Y7AA 3MTYA 1DSTA 3S9BA 1CGHA 1BJVA 1P2OA 1DUEA 1BCUH 2WPLS 1B5GH 1VZQH 4NSVA 2LELA 4JMYA 1FIZA 1TBZH 1UTOA 2BD8A 4P02A 1HDTH 1O5EH 3V13A 4Y0YE 1QURH 4XFQA 1P9SA 2AGEX 3PRDA 3T26A 1P03A 4O97A 4D7GA 2QCYA 1QY6A 1NC6A 1KXDA 3GICB 3HGNA 2DE8A 2QGRA 2QY0B 1Y5UT 1GBKA 3WWFA 1O3HA 1AGJA 1LQDB 1UVTH 5PTPA 3ELAH 1S6HA 2ZHEH 1W3CA 5EXMA 2G4TA 3UNSA 1BT7A 3D65E 1N6XA 1GCDA 1Z1JA 4U32A 3O8DA 3GYMA 1SFQB 1T8LA 3GCHB 1D3PB 2NWNA 1TX6A 3IG6B 2O8LA 3SUGA 3F6UH 2QIQA 7GCHF 1Z6JH 5IYTA 1GVKB 2BLQA 1AU8A 4Q7ZA 1AUTC 1GI1A 1HAVA 1V6DA 2FI4E 3F68H 3P70B 3A88A 1L4DA 2YNAA 3UWJH 1GG6C 3EA8A 5A8YA 1C5YB 3EE0B 3C1KA 1TNKA 3OY6U 3MO9A 1QJ6B 1QTFA 1MZAA 3A7ZA 2VJ1A 3RUOA 1Z1IA 3VPKA 1YPHE 3AW1A 1HXFH 1G36A 1O32A 1OWDA 2A4RA 4NIXA 2F9BH 2GDEH 4U2WA 1K21H 3SNCA 3H7OA 5FX6A 1C2HA 3SV7A 1YPLH 1AVGH 2FM2A 4DT4A 1P09A 4RN6A 1J17T 1RGQA 1XXDA 3SNAA 3M7UA 2ZQ1A 1C5WB 1TFXA 3VXEH 1Y3XA 1QBNA 1YWUA 3O8CA 5EIYA 1DT2A 1COWD 1P57B 5T3HA 3U8RH 1C1RA 1W14U 1P8VC 3D62A 3KHVA 2W3KA 3F2FA 4ZAEA 2XCNA 4UEHH 4MG3A 1LO6A 1WV7H 3QUMP 2VBCA 5AF9H 4ISHH 1RXPA 3MU5A 5F6MA 1O3NA 3MI4A 2J94A 1UW7A 3TH4H 4WWYA 2HGTH 4KELA 4D9QA 1AKSA 1F92A 3KL6A 1NESE 1FMGA 2VVVA 3FVFB 3ZZ3A 1E1QD 1LQEA 2ZDMA 1S6LA 3KYFA 3TH2H 2F91A 1KXFA 4O3UA 2ANMH 5GDSH 5HM9A 2WSSD 2KM0A 2IPQX 3M5LA 1YPHC 5CMXH 1GHYH 2HNTF 2M5TA 2PSYA 3M5OA 4ZXYH 3URCA 2BTCE 4HFPB 4LZ1H 2GCHG 2XBVA 4X2VA 1XKAC 3B9FH 2FEQH 3EA9A 3M5MA 1GBHA 3BSQA 1BOQA 1C1QA 4WMFA 3PTBA 1VCPA 4M7GA 4WY3A 2H9HA 3SI3H 1OP8A 2ZDNA 3DT0H 3QZRA 1SGDE 4MPUA 1ZPBA 1GBLA 1TE0A 1KDQB 1DE7H 2RDLA 1BRAA 2AFQB 1D3QB 1MAXA 4K8YA 2HNTE 3GDSA 1L0ZA 5DP6A 3TLOA 4I8LA 3MU8A 1N1LA 1DWCH 2XWAA 2ZFSA 3QWCH 5FBIA 3PV4A 4X8TH 2GMTB 3MFJA 1PPGE 3TJOA 2K0QA 2UWOA 3TJVA 1C2GA 2BQWB 3KEEA 4R8TB 1V2TT 5DN6D 2QV1A 4NSYA 1UCYK 1Z8RA 1AHTH 1SGPE 1AD8H 1C9PA 2P16A 3GYLB 1UVSH 4JZFH 3KIDU 4UDWH 4I32A 1A3EH 2VGCB 1G2MA 3S7KB 2ZFPH 4FOUC 4TWYA 2J95A 5HXFA 1DLEA 1TIOA 1AE8H 5DP4A 1NRSH 1C5PA 4MLFB 1JRSA 2Y7ZA 2PKSB 1FJSA 2F43B 1YPJH 3TNTA 4DURA 4FU8A 5HKKD 1PPZA 2PLXA 4VGCC 4ABDA 2ZGBH 2A4OA 1EJAA 1SKYE 1NRRH 1P2NA 5DKMA 2J98B 1HYLA 1EFRD 1AN1E 1IOEA 3SQEE 1MAYA 2KAIA 1TMUH 1MBMA 2FYRA 3RMLH 4UFGH 1O39A 2BX3A 2WHXA 3ZZ7A 2UUYA 1FY3A 3MNCA 3V12A 1UTNA 4MDSA 3SO3A 4B71A 2H2ZA 1SVPA 2W7SA 1W2KH 4MNVA 5EQRA 4OS5A 2FLRH 1O2WA 1TABE 3GCTF 2W5EA 2M2AA 1TNLA 3KNXA 1P2QA 3FZZA 3RP2A 2ASUB 1Q2WA 3N99A 3Q3XA 1ELEE 1AZ8A 2GV7A 1YPKH 4H42U 4Y71A 1HJAC 1C1UH 3SJ8A 5F03A 3RMNH 1HBTH 8LPRA 2FOAA 1T8OA 1GG6B 4XOJA 1H9IE 1FXYA 1QFKH 1KLTA 4K69A 2A2XH 2IPHA 3MH4A 5GCHG 3SJ9A 3V3MA 4BXWA 2QAAA 1PPFE 1BTYA 1GI5A 2A7HA 2FI5E 4JYTA 1VGCB 4ZKOU 2YNBA 2ZZUH 1XUIA 1DX5M 3A86A 2ALVA 1SGTA 1BMLA 3MNXA 5FBEA 1A5GH 3SZEA 1GDNA 4K60A 4WMDA 2AERH 1MUEB 2PSXA 4K2YA 5DJ7A 4Y8ZA 1AB9B 1C1TA 3U1JB 1L1JA 1P2JA 3KGPA 2QXHA 3F2HA 4X6OA 1KTTB 4BANB 3U98H 1G3CA 1BJUA 4M9FA 2FX6A 3F9HA 4H6TA 2FOFA 5BPEA 1Z6EA 2BVSH 3A89A 1EJMA 1F7ZA 5ESTE 1DVAH 1TQ0B 3PMHB 3ZZ9A 1VITH 3M3VA 4ZKRU 2BQ7B 4B2AA 1HIAB 2HLDD 4I8KA 2ZA5A 3P8OA 2BY5X 3GY8A 2CGAA 3ODDA 1HXEH 5GNDA 1P12E 1C4U2 3RXTA 1W0JD 2Y5FA 3FAOA 1GJBB 3WWBA 1ANEA 1A0LA 1F2SE 3SBKA 3MO3A 1P0SH 2RA0A 1EQ9A 1O2HA 2EY4C 2D2DA 1RIWB 2ZDKA 4GCHF 2OLGA 2WPJS 2ZCLP 5L30H 4D7FA 1XKBC 4NFFA 5EJZA 1ZOMA 3UPEA 2XNIA 2O8UA 2IJD1 1QCPA 4Y10E 4B2CA 1NFYA 1KXEA 3TPIZ 1SGCA 1Z8JB 5FPSA 2GP9B 5F53A 4RT0A 2OD3B 2EI6A 3BG4C 4NIWA 1MH0A 4JYUH 1AMHA 4MQAA 1H9LB 5C0TA 4E06H 3ZIAD 3HKIB 3I77A 3TJNA 2A45B 1MCTA 5LGOA 4ISIH 2UUFB 1FPCH 1SG8B 1LKBA 4DJZB 3P95A 3RXRA 1FPHH 2BB4A 3TITA 1DY9A 2ZTXA 1GVZA 1KXBA 2ZWLH 1V2PT 4JZDH 1H8DH 1O5GH 4LOYH 1E0FD 4U30A 4YOGA 1EATA 3QO6A 2IJOB 3DHKH 2ZHFH 1O37A 4CRCA 1KXCA 2TGDA 1NZQH 5AVDA 4CRFA 4X2XA 1WCZA 3SU5A 1E37B 2EQNA 2VINA 4UONA 1SGQE 4THNH 1GHZA 1UK4A 1UJ1A 4RT1A 5A09A 2WYGA 3RU4D 4GCHG 3SU0A 3MOCA 1C5QA 1EOJA 2EI7A 3MH5A 4I8GA 3TH3H 3RXEA 2R2MB 4X1QU 8GCHG 1D9IA 4NIVA 3A84A 3SZNA 3P8FA 2QC2A 1FNIA 2KCYA 1GJ5H 1BRUP 5FPYA 4RSPA 1OP0A 5EG4A 4VGCB 3RMOH 2ZCKP 1ESAA 2TGPZ 2V0BA 2KZ4A 2R3YA 2O9QA 1A2CH 1SGFG 1SQAA 3ZV8A 1EP6A 1CBWC 1O3OA 2BY7X 1TNGA 1UCYH 4ASUD 1QZ8A 1O2ZA 3FKSD 4HTCH 1FN8A 1QGFA 2ZFRH 1ZMLA 3H7TA 1TPPA 2ZU5A 1DDJA 3UWIA 1V2WT 4I8JA 5EODA 2Y5HA 3HK3B 1RRKA 2WINI 3ATLA 1K1LA 2QXGA 1V2MT 3L6PA 3MU0A 2LP6A 1SHYA 1D6RA 1P3CA 3LC3A 5DGJA 3RXFA 1O5CB 1P2MA 1WSSH 5JBTA 2C8ZB 2P3TB 3W94A 2K8IA 1BTUA 2ZGJA 3V0XA 4Y7BA 1T4UH 2UUKB 2BXUH 2H5CA 3F2GA 1JBUH 2CXVA 1GJAB 1GHAF 1MTVA 2RG3A 2B5TB 2EI8A 2BOHB 3LKWA 3RXUA 3PLBA 3SV6A 1XM1A 2GT8A 4X8UH 3RXLA 3F1SB 4LXBH 2DUCA 2ZCHP 3VB7A 2R0KA 2ZQ2A 1MQ6A 1BTPA 2G52A 1WTHD 3SGQE 1NRPH 3FP8E 4AFSA 1Y5BT 2OUAA 3RXSA 4AFZA 3JZ2B 2XW9A 1W0KD 2SNWA 3A7YA 2BXTH 1SGNE 1C1VH 1HAOH 2FO9A 1O0DH 2XC0A 1H8IH 4FUHA 1O2UA 1HJ8A 2HOBA 3WY8A 4FVDA 4KTUA 3O8BA 3NK8A 1C5MD 3RXOA 2BMGB 5LH8A 1XUJA 1PPBH 4E7NA 1CHOG 2BQ6B 3HATH 2LNCA 4JZEH 1YGCH 5FCRA 3VGCB 3MNSA 1EAUA 2FESH 2HVXA 4H4FA 1GBEA 2Q6DA 2Z6BD 3BTDE 3KQCA 1CA8B 2Y82A 7LPRA 2Q6FA 5A2MH 3UTUH 1O3EA 3GY7A 1TGCA 4X1RU 2C3SA 1GHAG 4INLA 1K28D 4AG2A 4DVAU 1TPAE 4ASHA 4X6MA 3RXKA 4ABJA 1BUIA 2NU4E 4UFFH 3M37A 3K2UA 1TMBH 2GVFA 4E05H 1CT2E 1O30A 3LJOA 4ZCNA 2GMTC 1YBWA 2ZGHA 4KTCA 3N7OA 1JXPA 2R9PA 3SHAH 3DA9B 2IN2A 2CF8H 1CO7E 4BAQB 2FXRA 3BG4B 2HPPH 1A7SA 3RXHA 3EDXB 1IQNA 4X1PU 4TPYA 1UTKA 1EJNA 1LKAA 2FOCA 5LPEA 4OS6A 2RFKC 2BDCA 4GVUA 1UTQA 1V2OT 4RI0A 3SNDA 1NU9A 1H8HD 4MPVA 4XE4A 2Z94A 1ELGA 1C2DA 1J8AA 3A85A 4R0IA 3UREA 1O3IA 2FOGA 1UHBB 3UOPA 1GDUA 1LPKB 3G01A 4J1YA 5B6LA 1GI9B 1LVBA 2SGAA 1S84A 3AW0A 3ITIA 2BD5A 3E3TA 1K1IA 1QL8A 3A8DA 3PRBA 5T6GA 4QT8C 3AAUA 1T8MA 1CGJE 2VU8E 3OSYA 3PV2A 1GHXH 2WUBA 1LVYA 2PR3A 3LGUA 2VH6A 5JB8S 2EA3A 1XVOA 1IQLA 1EZUC 2ODPA 2SGQE 3OYPA 5FAHA 3RDZA 2GD4B 1P2KA 1YKTA 3OAAD 1YY3A 1GBIA 4FETA 3RXPA 1C5TA 2D26C 3ZZ4A 4BAMB 4DIIH 2P8OC 1RTKA 4TPIZ 3VB6A 1Y8TA 4A7IB 4ZHAA 4ABFA 4U01A 2QXIA 2XBWA 4WXIA 3VXFH 2BM2A 1C1WH 3UQOA 4ACAA 2PV9B 2BY6X 3KQBA 2OP9A 3SNEA 1Y3VA 4GSOA 3JZ1B 2C93B 1K1NA 1OWJA 1CBWB 1DWDH 3CP7A 2GCTB 3A83A 1HAXB 3LU9B 9LPRA 2H6MA 1C5UA 1ANDA 6GCHF 1NT1A 1PQ7A 1HGTH 1G3DA 1ETRH 2JJ2D 1VGCC 2ZHWH 1O5DH 4YM9A 4UFDH 1MQ5A 3HPTB 2FWWA 1GBFA 2ZDVH 3T25A 3RXQA 1C2LA 1LTOA 1YLCA 2OC0A 1AB9C 2ZDAH 3A7TA 2GX4A 1ORFA 4I33A 3K6ZA 2SGDE 4TWWA 1CQQA 3SJKA 4NFEA 3PB1E 3SV8A 2JH5D 1AVXA 1QB9A 2RA3A 3FFGA 1TBRH 5E0HA 7GCHG 3OTJE 4UE7H 3A8CA 4BAHB 3IWMA 1W0YH 2FOEA 5L6NH 2AGGX 2FTMA 1ID5H 3T27A 3RXDA 1ELTA 1MU8B 5LPRA 2BY8X 3LIWA 5KEDA 2BOKA 2W7UA 1N8OC 1O2KA 2BHGA 1FIWA 1GMCF 3SQHE 3RC5A 3UIRA 5C67A 2XOKD 1ACBE 2BD7A 1A4WH 1BRBE 2SGFE 4X0WU 1RIWC 4WMEA 2PKAB 1ZR0A 2TGAA 3MH7A 1A0JA 4WF8A 1F0TA 1GHBF 5HM2A 3EA7A 4IN1A 1ARCA 2CN0H 3ZZ5A 1G30B 2XCFA 4O9VA 2XYAA 4Q80A 2G5NA 2VIVA 4CR5A 2A32A 1DITH 4OS1A 3O8RA 4IBLH 1L2EA 1UTMA 4F55A 1JIRA 3K9XB 3ZV9A 1DANH 1K2I1 1DLKB 1OWKA 1TX7A 4CREA 3R3GB 1EOLA 1S85A 2ZU4A 2UUJB 4FUBA 2Q6GA 2PTCE 3NPSA 1ANBA 2JIZD 1C1SA 1K0HA 1FLEE 1BBRE 4TSFD 3SOSA 4CR9A 1GI6A 1C4Y2 1ETSH 2VIPA 1C9TA 4F49A 2H1UA 4JK5A 1P11E 2ODQA 3E1XB 4B73A 1NM6A 4JZIA 4HGCA 1ARBA 3BN9A 2OINA 1LHEH 1S0QA 3MNBA 2EEKA 4CBOA 2GKVE 1CSOE 1YC0A 1O33A 2F9UA 2G5VA 3GCOA 2V3OH 2P95A 3KN2A 2PFEA 1EAIA 3UAIC 1HAYB 1KXAA 1SBWA 1WU1A 1PQAA 2BDHA 8ESTE 3ZVFA 3SJOA 1O2TA 2VIDA 1FAXA 5IK2D 2C8XB 1GI4A 1AVWA 3RU4T 3NKKA 2AEIH 3B8JA 3NZIA 1SLVB 4ZH8A 2L74A 5L2ZH 4KTSA 3BTME 1MABB 1KLIH 2J34A 2D1JA 3SU1A 2DE9A 2GZ7A 1THSH 4Q2KA 2UWPA 1GDQA 2ODYB 1GI7B 1O3AA 1EPTB 2VIOA 2OQ5A 2PUQH 1OWIA 4XBDA 1HV7A 1VR1H 1FY1A 1E79D 2FPZA 4BTTB 3A7WA 5GJ4B 1K1JA 1DWEH 4WXVA 1IQKA 1MKWK 3R0FA 3UNQA 1C2MA 1OYTH 3VEQB 1Z8GA 3U1IB 2WPMS 4AGJA 2HNTC 1W7GH 5TJXA 3A82A 1O2GH 4DW2U 3A87A 3FZDA 1KDQA 1DWBH 1WBGB 2WYJA 5C3NA 5B6OA 5C0UA 1A0HB 2G51A 2PWXA 2Z9IA 2OTVA 4GHQA 1Q31A 3F9EA 3GOVB 4AYVB 1P10A 1C5VA 3HKJB 1LDTT 2ZECA 1ZZZA 1C2EA 2P8OB 3TK6A 4BTUB 3KYGA 2ZKSA 1F0UA 2ZTZA 3S0NA 1G37A 1T31A 5C5OA 1GGDB 1FZZA 1MTUA 3Q77A 1AE5A 4K1SA 2J38A 1RTFB 2L6OA 3KQ5A 3RXCA 1CA0C 2J92A 3MH6A 2D8WA 5HIZA 5EGMA 3E90B 1XMNB 1O3LA 1MKXK 2XNDD 2A7JA 2BLWA 4RKJB 5DP5A 4B76A 2XTTB 1UTJA 3PV5A 1BHXB 3MWIU 3PMBB 4GAWA 1GL1A 5DSFA 1L1GA 5CDFE 2G55A 1TONA 2F4LA 3UB0A 3EGKH 3S7HB 2J98A 6ESTA 3ZZAA 4B1TA 3GDUA 1O2OA 1MD8A 1V3XA 5BRRE 4YLQH 4DG4A 1FQ3A 2WV9A 3TJUA 1DSUA 2V3HH 3STJA 3DFLA 1O3MA 5A0BA 2Y7XA 4LZ4B 1ZPZA 1NPMA 3GCTG 1V2ST 5C1YA 2F9OA 1DFPA 5I25A 1ELFA 1H8ED 6CHAC 4ISNA 2BZ6H 2AHME 1B0EA 1FONA 2CV3A 4TYDA 4A1TA 1ANCA 2HLCA 3VGCC 3KQEA 1L4ZA 3AASA 2SGEE 2ZGCA 2ZPSA 4XRNA 3SW2B 4MVNA 1H9HE 4ABAA 1IQHA 4YXWD 1ETTH 2ZF0H 1ZSJA 2XBYA 4CBNA 4SGAE 1O2XA 1C1NA 1N8OB 4INHA 3SORA 1C5NH 4B6FA 1E38B 3QGJA 1YLNA 1ZMNA 2V7QD 1GBBA 2KR7A 2PTNA 3RXBA 1NS3A 1QHRB 1HPGA 1A3BH 3UUZA 1PYTD 1BIOA 1VCQA 1CHGA 2HWLB 1VITF 1LHFH 4IC6A 1GJ4H 2ZU3A 4FVBA 3AK5A 2F9VA 3SJIA 1E36B 4TT3D 3EQ0H 2ZG0H 1MMJN 1NBMD 1TA2A 1WUNH 1FY5A 2F3CE 1G32B 1YLDA 4J2YB 1EX3A 1Z71A 2HALA 1TX8A 3LGYA 2ZGXH 5ESBA 2BLVA 1GPZA 3RLYH 3SV2H 5JYIA 1X7AC 3GY2A 2P3FH 2SFAA 1S5SA 2Z3EA 2BD3A 3EYDA 2J5UA 4ABGA 1UTLM 1G9IE 5JB9S 4DT7B 5JBCS 1K1PA 2W3IA 1E34B 1TGNA 1HIAA 1ZLRA 3RMMH 1G3BA 2V6NA 3QLPH 4JCNA 2VB0A 1YM0A 4NWKA 2W26A 1A46H 4D8NA 2O8WA 2KFWA 2ZPRA 3L33A 1HLTH 1WOFA 3F3BA 1P06A 5DK1A 1Y5AT 1S0RA 3SU6A 4JZ1A 3PROA 3OY5U 3LGTA 3H09A 1V2KT 4MPWA 2Y6TA 3OFND 9ESTA 4AN7A 1V2UT 4DY7B 1P3EA 5F8TA 1UTPA 2YMSC 1ZTJA 1T8NA 3P6ZB 4AORA 2TGTA 2FOBA 1TMTH 2JETC 1P04A 3QK1A 4NZLA 4BOHA 4ZHMU 3M5NA 1GMHF 4GUXA 5EJLA 4Q63A 2WZQA 6LPRA 4CRDA 2BDBA 1QIXB 1P2IA 1GMDF 1IQMA 2GCTC 3MU1A 1AQ7A 5C20A 5IDKA 2NU0E 4OS4A 2AIQA 3HK6B 3BEIB 4Y11E 1QR3E 3I29A 5TCCA 1O2VA 3URDA 4Y8YA 2ZFQH 3A8BA 4X8SH 3DCLA 3RXIA 1BBRK 2AS9A 2BD9A 4O03A 1PPHE 1HB0B 4AFQA 4NG9H 3E16B 2ZP0H 2JKHA 4A1XA 1GWAA 4XBCA 4HZHA 3ENSB 4DCDA 1GVLA 4X6NA 1QB1A 3RC4A 1ELDE 1V2VT 3TIUA 2BX4A 3TGJE 1ZTLA 4ZKNU 1CA0B 4K1EA 1GI8B 3T2NA 1MKWH 3QX5H 2ZFTA 5AHGH 5GWZA 3BG8A 4HI3A 1BMAA 1V2JT 1IAUA 3M35A 4NA9H 4BTIB 2KX4A 2GT7A 1IQJA 1GJCB 5E8EH 3BTHE 3ZVGA 1OX1A 1JRTA 1TALA 4ZKSU 2JH6D 4I86A 2V3MA 1FY8E 4Z0KA 4RKOB 1DM4B 2ZIQH 1GBDA 4OGXA 1ELCA 4YLUA 3T62A 3LOXA 1S83A 1TGTA 1SI5H 3GDVA 3F9FA 3E6PH 2GV6A 2OCVB 4XD7D 4B2BA 1QRWA 1O3BA 1ESTA 1EZQA 1SGEE 2BZAA 3SU3A 4MNYA 3TNSA 3H5CB 3DSOA 1TRMA 2P3UB 3BEUA 1TB6H 3RXVA 4Z1MD 1SHHB 1VCWA 4X2WA 3TGKE 4ESTE 3SGBE 2WUCA 3VB3A 6CHAB 1MKXH 1QRXA 1LVOA 3BV9B 3BTTE 2FX4A 1KYNA 2ANKH 3A81A 3BIUH 1ZGVA 1F5KU 4IMZA 4YTAA 2ZU1A 1CT4E 3BTFE 1H1BA 1UO6A 2XC4A 1GCTC 1UK3A 1PQ5A 1SSXA 1AO5A 1MU6B 2OBQA 1BMMH 1JWTA 2BD2A 1G3EA 4OM9A 4KKDA 1SOTA 5J4SA 4Z6AH 2QXJA 1ABIH 1TBQH 2CK3D 1OSSA 2Y81A 5TCAA 1YCPK 2XBXA 3TK9A 1FDPA 1MTNC
chains in the Genus database with same CATH topology
2AMPA 3E0PB 2VWOA 1UVUH 1KLJH 3PLKA 4IGDA 4XBBA 5EW2H 1C2FA 1VJAU 1DOJA 1MD7A 2PW8H 2VIWA 3ZVEA 1PYTC 2Z9GA 3BTWE 4CRAA 1PJPA 2YOLA 1D4PB 1Y59T 4OS2A 4YZUA 1B0FA 2J2UA 1T7CA 2QF3A 4FUFA 2XXLA 2HRVA 4WJG2 5JPMH 4TY7A 3PTNA 3LGVA 1O3DA 5E0GA 1EPTC 1HAVB 4MNWA 5A0AE 3QZQA 1NFWA 4AOQA 3RU4E 1C1PA 2ALPA 5DPAA 3RM0H 1OXGA 1YPGH 4K5ZA 1WQVH 3M7QA 2F9NA 1O3PB 2XWBI 1DY8A 1J14A 2ZDLA 1NRQH 1QB6A 4GLYA 1UK2A 4Y79A 1GI2A 2A0QB 3A7XA 3SUDA 2SGPE 3STIA 2G8TA 1O2PA 2A5IA 2ZC9H 3DUXH 2FOHA 2FOMB 5E2OA 1IHTH 2ZHQH 5AFYH 2P94A 1KY9A 4ZHLU 1C1OA 1TPSA 2STAE 1FV9A 2BDIA 1QNJA 1EB2A 1AFEH 1ZGIA 4X6PA 4AGKA 3SU4A 2ZTYA 1W10U 1QRZA 4B75A 2AGIX 3P17H 2QYIA 1K1MA 1GGDC 2R3UA 1EUFA 1FUJA 2VIQA 2JETB 3GCNA 2P93A 2R2WU 1W0ZU 4XDEA 5ABWA 1F5RA 3FANA 1TNIA 3S69A 1A5IA 1O2QA 2WPHS 3UNRA 2WV4A 1HUTH 2H9TH 5F8ZA 4I31A 1O2IA 1XUHA 3A80A 1HJ9A 3QDZB 2J9NA 3PMAB 1LHGH 1O34A 5HMAA 1OWHA 1OOKB 2GZ8A 7ESTE 1AKSB 1G2LA 1Y3YA 1VJ9U 5K0HA 1UHBA 1JIMA 2PGBB 4Y6DA 2UWLA 1A1RA 5E2PA 1BRCE 3DD2H 4YOJA 4FXGH 1O2SA 4GPGA 3T29A 1DICA 3P8NA 1QL9A 3FP6E 2QA9E 2BDAA 5A0CA 1BA8B 1ELBA 1HNEE 3KF2A 1W11U 2FODA 5EQQA 5EPYA 5C1XA 2GCHF 5EQSA 2TBSA 1ZHRA 1OS8A 2PUXB 3BEFB 1GBCA 4O3TA 1GBJA 1FI8A 2BY9X 2FZZA 1Y3WA 3PMJA 1TGSZ 1XXFA 1BBRH 2H5DA 4YO9A 1C5RA 1C5SA 3U8TH 1YPEH 2ANWA 5CHAC 5T6DA 3UY9A 3LH1A 2OXSA 4JYVH 1YCPM 1NN6A 3UFAA 2FS8A 1SL3A 3QGNB 6GCHG 3Q76A 5DO4H 1ZMJA 2ANYA 3LPRA 4D76A 3PO1C 2G00A 4A6LA 1TYNA 4I8HA 3F9GA 1A5HA 3ZZDA 2A1DB 3RXGA 4NGAH 4CRBA 3LGWA 2NU3E 2CF9H 2Z9KA 3GY4A 2Z9JA 4FUGA 1ZRBA 3Q00A 5L2YH 4UD9H 3GY6A 4SGBE 1PPEE 3M61U 1NROH 1O2YA 1C5XB 1S82A 4CHAB 2O8TA 1B7XB 3UOUA 1EASA 4FUEA 1SGFA 3SGAE 4BAKB 3ODFA 5C1UA 4IN2A 1CVWH 1GHVH 1KIGH 1DUAA 1ELAA 1GCTB 1ZRKA 1TQ7B 4YT7H 2BLOA 3NXPA 1O3JA 3OU0A 3ATMA 1EKBB 2Q1JA 2B0FA 1D3TB 3I78A 2NU2E 5FXLA 4CH2B 2KAIB 4FU7A 1GJ8B 5EPNA 4JK6A 4FUDA 1SOZA 3SHCH 3LONA 1IHSH 1SGYE 1AY6H 1GMCG 1T32A 2LPRA 2ZFFH 1MTNB 3BTEE 5C2ZA 1C5OH 1GI3A 4K1TA 2ZEBA 3FP7E 4NCYA 4YT6H 3ZZBA 1W12U 5J4QA 5JBBS 4NZQA 1YP9A 1GHBG 3ZVAA 4ABBA 3ATKA 1QJ1B 2PKAA 1L1NA 1O38A 1QJ7B 3IITA 4INKA 3UR9A 3TK5A 7KMEH 4YESB 1W13U 1T4VH 3M3TA 1U6QA 5CE1A 4Y0ZE 4CRGA 5EXNA 1INCA 2QF0A 1O31A 2VH0A 3M36A 3PM3A 1O5BB 1ZSLA 2FDAA 1LMWB 1RTLA 1YCPH 4AYYB 4ZMAH 1PPCE 1ZPCA 4TY6A 1QQ4A 1BB0B 2C90B 3GY5A 5E0JA 4Y76A 3SNBA 5G4BA 2OBOA 2BD4A 4IW4E 4WH8A 3PWCA 1NO9H 1AFQC 2BYAX 3OX7U 5GCHF 2ESTE 4GHTA 1K9OE 5ETXA 1J9CH 2A2QH 1KTSB 2WV5A 1LCYA 1LHDH 3LJJA 1HRTH 5GIBA 1SC8U 1GJ6A 4AB9A 4AG1A 3BTQE 4NA8A 3RLWH 4FUIA 4DGJA 5HYOA 2Z3DA 1TOCB 3AAVA 1D3DB 2CMYA 1QA0A 1YYY1 1TNHA 2HPQH 1O35A 1Y3UA 3W95A 2AYWA 2O8MA 2BDYA 1FAKH 1ELVA 4A92A 4A5TS 5A8ZA 2VVUA 3NUMA 3ZVCA 5DP3A 1ABJH 1NTPA 1BTXA 1W7XH 4X2YA 3RC6A 1EPTA 1JMOH 3MYWA 4K3JA 5SGAE 1O2JA 3KCGH 5EW1H 1NY22 3VB4A 1O3GA 2C8WB 5JBAS 1SMFE 1K22H 4PROA 1P02A 4FU9A 3BF6H 3SU2A 2PHBA 3MO6A 1SLWB 1TRNA 3MHWU 3A8AA 3AVZA 3LT3A 3BTGE 4IC5A 1C5LH 4XSKU 2BDGA 2VWLA 1ZJDA 4AX9H 2FTLE 2EC9H 1C5ZB 3C27B 1V2LT 2A31A 1Q3XA 2H9EH 5EU8A 2TRMA 1LPZB 2OC1A 5K7RA 1BTZA 3RXAA 3U9AH 5T6FA 1ZHPA 3ZZ8A 2OC8A 1QBVH 1M9UA 4WH6A 1QL7A 3ZVDA 3ZYDA 3T28A 1TPOA 5CHAB 1AIXH 3QTOH 2TIOA 1BTHH 2AH4X 2R0LA 3SV9A 3QTVH 3K65B 5EXLA 1EZXC 1IQGA 1NFUA 1YPMH 1HAGE 8KME2 1TWXB 2OC7A 3P92A 3PO1B 1Z7KA 4D9RA 3S9AA 3B23B 1DS2E 2B7DH 2WPIS 1BMNH 4LK4A 2G81E 4ZUHA 2A4GA 1DXPA 3U69H 1O3FA 1OKXA 1BQYA 1TLDA 1TNJA 3QN7A 1F5LA 3SN8A 1HFDA 1V2RT 1J16A 4FUJA 1CE5A 2AMDA 2Y5GA 1SQTA 2CHAC 1MCVA 2GGVB 3PWBA 3D49H 1XUKA 1EAWA 1WTGH 1RS0A 1TGBA 8GCHF 2G4UA 1BITA 5DP7A 2FS9A 2Z7FE 1SLUB 2K1QA 1EP5A 2ZPQA 3K6YA 3L3TA 2QN5T 5DG6A 1SPJA 2BVXH 1SR5C 1LPGB 2A7CA 2ILNA 4H6SB 1EXFA 1OPHB 2ZHDA 2C8YB 2ZI2H 1PQ8A 1IQEA 3A7VA 1SGIB 1UVPA 1ZYOA 1O3KA 1S81A 2A5KA 5F8XA 1A61H 2GZ9A 1GJ7B 1MBQA 3UR6A 1TA6A 1GL0E 4ABIA 1O5AB 1VITG 2FLBH 1V2NT 2JH0D 4AFUA 2ZU2A 3UQVA 3TGIE 1PFXC 1DXWA 1O2MA 3ZVBA 1F0RA 3MMGA 3Q3KA 1GJDB 1OWEA 1HCGA 4MPXA 1GHWH 4Y8XA 4B74A 2NU1E 2SNVA 1XVMA 4KP0A 5H4IB 2THFB 5FPTA 3ATIA 1LHCH 3M3SA 1W8BH 4ISLA 4F4OC 1AI8H 2I6SA 1CU1A 2GTBA 2CJIA 1O2LA 2STBE 1AUJA 1XX9A 4IMQA 4FUCA 3GCHC 4ISOA 4I7YH 1F0SA 1TAWA 3ZZCA 2I6QA 2VWMA 1C2IA 5EOKA 1RFNA 3LDXH 2B9LA 1E35B 2FMJA 4K8BA 1ZTKA 1AFQB 2ULLA 4KGAA 3E8LA 1WYKA 2GDDA 5HGGA 1QBOA 3LH3A 3RXJA 1WAYB 5LPFA 1BZXE 2RCEA 1D6WA 3M7TA 3RM2H 1P01A 2IOTA 3SI4H 1RJXB 2PGQB 3TVJB 2Z9LA 1UVOA 5DP8A 2XRCA 3D23A 5GXPA 1MTSA 1DPOA 3Q3YA 3SUFA 1MTWA 4X1SU 1JOUB 1N6YA 1GI0A 1NFXA 2ZO3H 5C5NA 1XUGA 2AIPA 1QA7A 1XUFA 1AZZA 1V2QT 5FCKA 1IQFA 1QQUA 2OQUA 4NA7A 1C4V2 1LVMA 1CHOF 1O2NA 2C4FH 4X8VH 1K1OA 4BAOB 3E91A 3LGIA 3LC5A 4ZROA 1KSNA 1GMHG 3U8OH 2F9PA 1HJAB 1GBMA 3ZYEA 5JDUB 4Q7YA 1GJ9B 1GMDG 2Y80A 2FI3E 3CS0A 3T5FH 4OS7A 3S9CA 1UCYE 4X1NU 4BXSA 1FN6A 2FIRH 1O5FH 2V35A 5FX5A 4NWLA 2A4QA 1ZHMA 3GY3A 4CH8B 1THPB 1H4WA 1THRH 3BTKE 2FP7B 2VWNA 1CGIE 3GISB 1TOMH 1P9UA 1FY4A 1Z8IB 1UMAH 3TU7H 2BVRH 2A5AA 1P05A 1SGRE 4A1VA 1EB1H 4BNRA 4CHAC 1ESBA 1J15A 3PLPA 3RXMA 1HAPH 3BIVH 5AFZH 4YOIA 1GBAA 3NCLA 3ZZ6A 1HAZB 4ABEA 3E0NB 1SLXB 1RD3B 1ZJKA 1SQOA 5GPIB 4IS5A 4WVPE 1WQSA 2B8OH 3SUEA 1GBTA 3ATWA 1SFIA 4NIYA 2F83A 4UFEH 2AMQA 3KQDA 1YF4A 4ABHA 5A8XA 1TRYA 2Z3CA 3DFJA 2J4IA 1ZSKA 3VB5A 4AZ2B 2WPKS 4Q7XA 3PYHA 1OP2A 1O2RA 2TPIZ 1CT0E 1HAHH 3NWUA 1SB1H 1EZSC 3P8GA 2ZNKH 4DIHH 3V7TA 5FHTA 2CHAB 3MU4A 1BHXF 1BDAA 2P59A 2VVCA 1NRNH 1S6FA 3EAJA 3HGPA 1HAIH 4MTBA 3CENA 2XC5A 1OYQA 1IQIA 1EAXA 1AWFH 2VNTA 1AWHB 3ESTA 4MNXA 2FYQA 4OGYA 2VGCC 1C2JA 4DOQA 4E7RG 5DP9A 1MZDA 1NU7B 4ZXXH 3VFEA 5I46H 1O3CA 1C1MA 4AB8A 1C2KA 2PKSC 3CS7A 1BTWA 1O36A 4Y7AA 3MTYA 1DSTA 3S9BA 1CGHA 1BJVA 1P2OA 1DUEA 1BCUH 2WPLS 1B5GH 1VZQH 4NSVA 4JMYA 1FIZA 1TBZH 1UTOA 2BD8A 1HDTH 1O5EH 3V13A 4Y0YE 1QURH 4XFQA 1P9SA 2AGEX 3T26A 1P03A 4O97A 4D7GA 2QCYA 1QY6A 1NC6A 1KXDA 3GICB 3HGNA 2DE8A 2QGRA 2QY0B 1Y5UT 1GBKA 1O3HA 1AGJA 1LQDB 1UVTH 5PTPA 3ELAH 1S6HA 2ZHEH 1W3CA 5EXMA 2G4TA 3UNSA 1BT7A 3D65E 1N6XA 1GCDA 1Z1JA 4U32A 3O8DA 3GYMA 1SFQB 1T8LA 3GCHB 1D3PB 2NWNA 1TX6A 3IG6B 2O8LA 3SUGA 3F6UH 2QIQA 7GCHF 1Z6JH 5IYTA 1GVKB 2BLQA 1AU8A 4Q7ZA 1AUTC 1GI1A 1HAVA 1V6DA 2FI4E 3F68H 3P70B 3A88A 1L4DA 2YNAA 3UWJH 1GG6C 3EA8A 5A8YA 1C5YB 3EE0B 3C1KA 1TNKA 3OY6U 3MO9A 1QJ6B 1QTFA 1MZAA 3A7ZA 2VJ1A 3RUOA 1Z1IA 3VPKA 1YPHE 3AW1A 1HXFH 1G36A 1O32A 1OWDA 2A4RA 4NIXA 2F9BH 2GDEH 4U2WA 1K21H 3SNCA 3H7OA 5FX6A 1C2HA 3SV7A 1YPLH 1AVGH 2FM2A 1P09A 4RN6A 1J17T 1RGQA 1XXDA 3SNAA 3M7UA 2ZQ1A 1C5WB 1TFXA 3VXEH 1Y3XA 1QBNA 3O8CA 1DT2A 1P57B 5T3HA 3U8RH 1C1RA 1W14U 1P8VC 3D62A 3KHVA 2W3KA 4ZAEA 2XCNA 4UEHH 4MG3A 1LO6A 1WV7H 3QUMP 5AF9H 4ISHH 1RXPA 3MU5A 5F6MA 1O3NA 3MI4A 2J94A 3TH4H 4WWYA 2HGTH 4KELA 4D9QA 1AKSA 1F92A 3KL6A 1NESE 1FMGA 2VVVA 3FVFB 3ZZ3A 1LQEA 2ZDMA 3TH2H 2F91A 1KXFA 4O3UA 2ANMH 5GDSH 5HM9A 3M5LA 1YPHC 5CMXH 1GHYH 2HNTF 2M5TA 2PSYA 3M5OA 4ZXYH 3URCA 2BTCE 4HFPB 4LZ1H 2GCHG 2XBVA 4X2VA 1XKAC 3B9FH 2FEQH 3EA9A 3M5MA 1GBHA 3BSQA 1BOQA 1C1QA 4WMFA 3PTBA 1VCPA 4M7GA 4WY3A 2H9HA 3SI3H 1OP8A 2ZDNA 3DT0H 3QZRA 1SGDE 4MPUA 1ZPBA 1GBLA 1TE0A 1KDQB 1DE7H 2RDLA 1BRAA 2AFQB 1D3QB 1MAXA 4K8YA 2HNTE 3GDSA 1L0ZA 5DP6A 3TLOA 4I8LA 3MU8A 1N1LA 1DWCH 2XWAA 2ZFSA 3QWCH 5FBIA 3PV4A 4X8TH 2GMTB 3MFJA 1PPGE 3TJOA 2UWOA 3TJVA 1C2GA 2BQWB 3KEEA 4R8TB 1V2TT 2QV1A 4NSYA 1UCYK 1Z8RA 1AHTH 1SGPE 1AD8H 1C9PA 2P16A 3GYLB 1UVSH 4JZFH 3KIDU 4UDWH 4I32A 1A3EH 2VGCB 1G2MA 3S7KB 2ZFPH 4TWYA 2J95A 5HXFA 1DLEA 1TIOA 1AE8H 5DP4A 1NRSH 1C5PA 4MLFB 1JRSA 2Y7ZA 2PKSB 1FJSA 1YPJH 3TNTA 4DURA 4FU8A 1PPZA 2PLXA 4VGCC 4ABDA 2ZGBH 2A4OA 1EJAA 1NRRH 1P2NA 5DKMA 1HYLA 1AN1E 1IOEA 3SQEE 1MAYA 2KAIA 1TMUH 1MBMA 2FYRA 3RMLH 4UFGH 1O39A 2BX3A 3ZZ7A 2UUYA 1FY3A 3MNCA 3V12A 1UTNA 4MDSA 3SO3A 4B71A 2H2ZA 1SVPA 2W7SA 1W2KH 4MNVA 5EQRA 4OS5A 2FLRH 1O2WA 1TABE 3GCTF 2W5EA 1TNLA 3KNXA 1P2QA 3FZZA 3RP2A 2ASUB 1Q2WA 3Q3XA 1ELEE 1AZ8A 2GV7A 1YPKH 4H42U 4Y71A 1HJAC 1C1UH 3SJ8A 5F03A 3RMNH 1HBTH 8LPRA 2FOAA 1T8OA 1GG6B 4XOJA