5DGJA

1.0a resolution structure of norovirus 3cl protease in complex an oxadiazole-based, cell permeable macrocyclic (20-mer) inhibitor
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
175
structure length
168
Chain Sequence
HHAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIASMRIQGRLVHGQSGMLLTGANAKGMDLGDCGAPYVHKRGNDWVVCGVHAAATNTVVCAVQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-LIKE PROTEASE
publication title Oxadiazole-Based Cell Permeable Macrocyclic Transition State Inhibitors of Norovirus 3CL Protease.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Hydrolase/hydrolase inhibitor
total genus 41
structure length 168
sequence length 175
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5dgjA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5dgjA01
1C2KA 3TK9A 4ZKSU 1C4U2 1VZQH 3M7QA 4B2AA 3MU8A 3U69H 1ZTKA 1LPKB 1ELDE 4X2YA 2QF0A 4YESB 2JETC 5HM2A 1TNIA 2OC1A 5GJ4B 4FUJA 3KCGH 1MZAA 1V3XA 1CHOF 1AVGH 2ZDNA 2ZU2A 1CE5A 1HXFH 1MKXH 1O3LA 2W7UA 1O2OA 5TCAA 2ZTZA 1K28D 3A8BA 1SLUB 3MH6A 1ZPBA 4NIXA 2ILNA 2ZFPH 2BD2A 1A2CH 1LKAA 1GBHA 1QBVH 1ZRKA 1T4VH 3EYDA 1SR5C 1XXFA 4DJZB 4FVDA 1GI9B 3PLKA 2WPKS 1PPBH 3QTOH 1PQ7A 3GYLB 4Q7YA 4OS5A 1SVPA 1MKXK 2VWMA 2Q6FA 1PQ5A 1LCYA 1NU7B 2GCTB 4Q80A 2P3FH 2HRVA 4MPUA 3ZZ3A 1GJAB 3ZV9A 1INCA 2GDDA 3L3TA 1P10A 1W7XH 1NS3A 1W11U 1GI6A 3LU9B 2QXGA 1GHVH 4MNWA 3V7TA 3EAJA 4F4OC 5HXFA 1TGCA 5K7RA 2AMPA 1MTSA 1BB0B 2A5IA 2BLWA 4K60A 1O3GA 1QL9A 4BXWA 2P16A 3SJOA 1SGDE 3T62A 3MNCA 1MTUA 1GDQA 3IG6B 3KQBA 1CO7E 1IQEA 1KLJH 3P8GA 3NK8A 3UQOA 1O2WA 1BCUH 3V12A 5J4SA 2NU4E 1AZZA 4NSYA 2G4UA 3AAUA 4OS2A 1G36A 4B74A 1AD8H 2H9TH 1IQKA 1GI0A 3VB4A 1FY5A 3GY8A 1GMHG 2ZU5A 1WQVH 4KP0A 3BG4B 5PTPA 3UOUA 2QF3A 4D7GA 1EZQA 5EXMA 1O5GH 4D7FA 2SGPE 4I8LA 3K9XB 4JZEH 1O2GH 1CT4E 3V0XA 1W13U 1VJ9U 1O2XA 2GGVB 3RMMH 1O0DH 1UTKA 3M61U 1QHRB 3MTYA 2PUQH 2GZ9A 5E2PA 1NRSH 1WUNH 2FMJA 2Q6GA 3SU0A 1O2NA 8KME2 1C2FA 2AGGX 3U1JB 1MBMA 1C5VA 2ZFTA 1TQ7B 2Z7FE 1A0LA 4MNYA 2ZDVH 1QA7A 2BY7X 3C27B 5J4QA 1XM1A 3S9CA 4ISOA 1AQ7A 3BTTE 1C4V2 3BIUH 1ANDA 1EX3A 1NROH 3AVZA 1EB1H 3RDZA 1NTPA 2BYAX 3ODFA 1FY3A 2PUXB 1TX8A 4Y76A 1B5GH 5C67A 3GY7A 5E0HA 1KTTB 1O3DA 2VIQA 4DVAU 2VVCA 1QJ7B 1Z8RA 1O2ZA 1TWXB 6GCHG 1D9IA 1ELEE 3FZZA 3RXBA 4NFFA 1B0FA 2O8MA 9ESTA 4Y71A 3ZYDA 2D8WA 1O5DH 1BJUA 3BSQA 4K1TA 1C2MA 4HGCA 1Z1JA 1BTZA 3AW0A 3SUDA 4Y8XA 1D3QB 1CGJE 2GZ7A 3TGKE 9LPRA 1EB2A 1SSXA 2KAIB 4KKDA 1IHSH 1DXWA 3T2NA 1S6HA 3HPTB 1UTQA 1C2IA 1RS0A 3ZZ7A 3LC5A 4NZLA 2EI8A 2Y5HA 4GCHG 4LK4A 2OQ5A 1TGBA 3H7OA 2UUKB 5DP5A 1DVAH 2J9NA 4NG9H 1FAXA 1GDNA 3FAOA 2ZGXH 1C1RA 1G3BA 3F9GA 2B0FA 5FHTA 3STIA 1GCTC 3UNRA 4HI3A 3A86A 4OS7A 3KGPA 2WYJA 3GCHC 3RUOA 3LPRA 1MU8B 1O2YA 1TNGA 4DGJA 1C1SA 2PV9B 1TE0A 2XXLA 4DIIH 6GCHF 4GAWA 4U2WA 4WMFA 5EQQA 2BD7A 2IN2A 2ZHDA 1GBJA 2K1QA 1O3IA 2GV6A 1YPEH 1K1LA 2I6SA 5DG6A 1XUIA 2C3SA 4YT6H 1V2NT 4JZ1A 1E34B 3TK5A 1RTLA 5DP6A 2FI5E 3KEEA 2AERH 1AIXH 2D26C 2HPPH 2OTVA 2FTLE 4IMQA 1W0YH 2ZHEH 2HLCA 2A2QH 2ZPQA 3OTJE 3QTVH 4WY3A 4CH8B 4DIHH 2PKAA 4X2XA 5JDUB 2ZDLA 1S0RA 4GCHF 3RU4E 6LPRA 5T6FA 1K21H 2AYWA 4ABIA 1PYTC 4X6OA 2BY6X 1Z6JH 1NZQH 1SGYE 3ZVCA 1UVSH 3Q3KA 1YPLH 3AASA 4BAQB 3GDVA 1T7CA 1RTKA 1OYTH 1UCYH 3VB3A 1GJCB 2O9QA 5CHAC 1MTWA 4WVPE 2JH6D 5LPRA 3D23A 1C1QA 1C2DA 1OPHB 1O39A 1CGHA 3BEFB 1QB9A 5DKMA 1AWFH 1SC8U 2JKHA 1C4Y2 5A09A 2AMQA 3O8BA 2HOBA 4I8JA 3KQDA 3RXEA 1DANH 4CHAB 3R3GB 4WH8A 1UCYK 2OQUA 4UFEH 2F91A 3FZDA 2UWPA 3GDUA 3A88A 3I78A 1LDTT 1MCVA 2J95A 3ATLA 2DUCA 3W94A 1G9IE 4CRCA 1ETSH 3AW1A 1EPTB 1L4ZA 1MH0A 1IQGA 1L1NA 2CN0H 3Q3YA 1VITF 4CBOA 1KDQA 3EA7A 1WQSA 1ZSLA 3A8AA 1W12U 3CP7A 4NIYA 3UREA 3URCA 4BAMB 1AZ8A 2O8TA 3GOVB 1F7ZA 1ZTJA 3GY3A 1A3EH 1Q31A 3TGIE 1XMNB 1MAYA 2HGTH 2ZTYA 4OS1A 1TBZH 2PWXA 1TGTA 2BXUH 1HJ9A 1O3HA 1O5BB 1E35B 1O5CB 3BTWE 1ETTH 1QRZA 4ISIH 2IOTA 4X6NA 5EGMA 4JMYA 2HPQH 4CBNA 2VWOA 2CF8H 3PWCA 2P3TB 1GJBB 1HAOH 1P03A 1C2LA 2FTMA 4ZHLU 2FDAA 1MAXA 1CBWB 3UUZA 2WPLS 1A4WH 2A7JA 4K2YA 2VGCB 4M7GA 1V2TT 1SI5H 1C5SA 3MNBA 3UPEA 3VB7A 1XVMA 1HV7A 3ZZCA 1AKSB 1DLEA 2PKSC 3H7TA 4ISLA 4ZKNU 1ZMNA 2AS9A 3ZYEA 4A6LA 4NGAH 2W7SA 2PLXA 1IQMA 2ODPA 3S9BA 1O31A 3BTDE 3O8DA 1E0FD 1T4UH 1P06A 2A45B 1SGQE 2BY5X 4MG3A 3F6UH 3BF6H 5C1UA 1EAUA 4BTTB 1OWKA 3SU2A 3A80A 1D6RA 3MOCA 4U01A 4X1QU 1P57B 1Q3XA 4AB9A 1TBQH 3BTGE 1IQJA 1HAPH 4B71A 1IOEA 5A0CA 3B23B 3E0NB 3GDSA 1NFWA 2FIRH 4XOJA 1PPEE 3RM2H 3TJVA 1GPZA 1AO5A 4K5ZA 2Y5FA 1TALA 2FZZA 1DM4B 1ELFA 5C5OA 2TGPZ 4NZQA 1M9UA 1OWHA 3Q76A 2FPZA 2SGQE 1Z1IA 1THSH 1DUEA 2ZFSA 1GJ8B 2VIDA 3ZVFA 1K1NA 4FUEA 3MYWA 1E38B 1HLTH 1ANCA 1W7GH 5L6NH 2V6NA 5LGOA 1XKAC 4ABBA 1ARCA 2A0QB 1XUFA 4FU7A 4GSOA 1GL1A 3U8RH 1UHBA 1GI2A 1K1MA 4NIWA 4IC6A 8LPRA 3SBKA 4JZFH 2XBWA 1H9IE 3TH4H 2PSXA 3SV6A 1W14U 1FUJA 4J2YB 1C5YB 3SJ9A 1DFPA 4CR9A 4D9RA 1EAIA 4JZIA 2VIWA 5A0AE 1G37A 3PV4A 3NKKA 5A8ZA 2NU3E 1NESE 3E90B 4AFUA 1ZHRA 2QXIA 1A5IA 1GI1A 2ANMH 3U8OH 1NFYA 8GCHG 2PGQB 2F83A 1DX5M 2Z9KA 4X6MA 1C2HA 1FY8E 4ZXYH 2F9PA 3T29A 1GDUA 2Z94A 2HVXA 3UNSA 1YPKH 1FNIA 2FLBH 5EQRA 3TNTA 1JOUB 1YPJH 3TJUA 4QT8C 5F8XA 4WJG2 2CHAB 3ESTA 4HTCH 4IW4E 4ISHH 1CA0C 4ZHMU 2NU0E 1Z8JB 1OX1A 1O2HA 1TRYA 3QGNB 1MU6B 3SNEA 1F0TA 1HAXB 1Y5AT 1OWDA 3MU5A 4INLA 1CHGA 3V13A 2A5AA 1ELAA 1HFDA 1C2JA 1Y59T 3PO1B 2D2DA 2ZQ1A 1PJPA 2ANWA 1B0EA 1SGTA 2G8TA 1NFUA 2C8ZB 1KXDA 2ALPA 2W3KA 1DICA 1O2LA 3A87A 5T6GA 4Y0YE 4ZROA 3IITA 1FV9A 4HFPB 1RRKA 1KXEA 1UTJA 2ODQA 2V3OH 3M3SA 2ZCKP 2G51A 4FUHA 1O3KA 4MQAA 1J14A 1BT7A 3SI4H 1RIWC 4JZDH 3SNCA 2BMGB 1GBFA 3ODDA 2WUCA 1HAZB 2JH5D 2FOEA 3RXLA 2ZIQH 1KSNA 3SW2B 1GBDA 1BDAA 5T3HA 3GICB 1TOCB 3MMGA 4X6PA 2C8WB 3SV9A 2FI4E 4FUBA 2F9VA 4VGCB 2FOGA 1GHXH 3ZVAA 5FX6A 1S81A 3PMAB 1AI8H 3BEUA 4AZ2B 3I29A 5DPAA 1H4WA 4JYVH 1P0SH 2G00A 4WH6A 1JIRA 2BD4A 2BX4A 2UUYA 1GBBA 1GHZA 3SV8A 1P09A 1TPOA 1AN1E 2VWLA 1WSSH 2WUBA 1NRQH 2H9HA 1GG6B 4MPVA 3SU4A 2ODYB 1OXGA 4AOQA 1KXFA 1RD3B 1GJ6A 1BHXF 1BMLA 3ATWA 1HPGA 1FPCH 3M5NA 3UQVA 1YPHC 4AFQA 2STBE 5HYOA 1L1GA 1VGCC 2IPHA 2OBQA 3B8JA 2A31A 3OY6U 4CRBA 3TH2H 2Y7ZA 4R8TB 2SFAA 4ABAA 1ELTA 3SO3A 1THRH 3LC3A 4BXSA 2A7HA 1C1MA 1AFQC 3ZVGA 3SJKA 1YCPM 2OC7A 2ULLA 3T5FH 3A84A 3GISB 3O8RA 1SQAA 2BD9A 3BTEE 1JMOH 1PYTD 3M5LA 1ZGVA 4FU9A 1HDTH 1GGDC 3K6ZA 3LIWA 1HRTH 2R3YA 3PTNA 2ANYA 4YO9A 1O2SA 1S6FA 1L4DA 1GBAA 1UJ1A 4ABHA 1BZXE 2FOAA 5ABWA 2BLQA 1T8OA 2CJIA 1PQAA 3PTBA 3D49H 1K1OA 3QLPH 3K65B 3A7XA 3UWIA 3SN8A 1S0QA 2FX6A 4ABGA 4AG1A 2A4QA 3RP2A 2H5DA 5JB9S 3TH3H 2PTCE 3S7HB 1HYLA 2RDLA 4Z6AH 3M35A 1EJMA 1Y3WA 2BQ6B 1FDPA 1W3CA 1MTNB 2SGDE 3FP7E 3M5MA 1C1OA 1F0UA 1UVTH 1WU1A 1MZDA 3M5OA 4RN6A 3RXOA 4ZXXH 1W2KH 5CMXH 4Y10E 1YGCH 1SQOA 3VGCB 5AHGH 1HUTH 2TPIZ 4OS6A 5A0BA 3KQEA 5EXLA 2C8XB 1O2IA 5E2OA 3SU3A 4O3TA 3TK6A 4UD9H 1UK4A 3DFLA 3A7TA 3MU1A 1XVOA 2BVXH 1ESTA 3ITIA 1J17T 5BRRE 1D3PB 1JRSA 1HAVA 1TGSZ 2OXSA 2RCEA 4K1SA 4R0IA 2VNTA 1SFIA 3PROA 1Z8IB 2FOBA 4AORA 5F8TA 2FM2A 5JB8S 1G2MA 3SV7A 1TFXA 1ZZZA 2F9NA 5JBTA 2Z3CA 3W95A 4GLYA 3M36A 1GVLA 1MD7A 4IN1A 4TYDA 2R2WU 1BUIA 3SI3H 3ZZ9A 2R9PA 2B5TB 2V0BA 1DE7H 2FOFA 3QUMP 5JYIA 4OGYA 3U9AH 4MLFB 4Y79A 2BD3A 3SUEA 1H1BA 3DFJA 2A2XH 5L2ZH 3ATMA 4X1RU 4AN7A 5FX5A 5EG4A 1BMNH 1NT1A 1C5NH 4MDSA 2OINA 1DY8A 5ESBA 1UTMA 3Q3XA 2A4GA 1ZR0A 1HJAC 1DSTA 4DW2U 2H5CA 3SORA 1C5OH 5DO4H 2GMTC 3SUGA 4JK5A 2WV5A 3OU0A 1YM0A 1SOTA 5T6DA 1RJXB 1GI3A 4UFFH 2XCNA 4CRAA 3ENSB 1BTYA 3VFEA 2ZGJA 1K22H 3RMOH 3TPIZ 1DLKB 1LHDH 1QGFA 1ORFA 1ZSJA 1LVYA 1O37A 1TGNA 1O2KA 1V2MT 1G3CA 4DURA 4UEHH 1YYY1 5FXLA 5AFYH 3GY5A 5FPSA 3E16B 1O3FA 1TA6A 1AHTH 2J2UA 4AGKA 1GI8B 3BG8A 2DE8A 3GCOA 2HNTE 2JETB 1C5UA 5DK1A 1L0ZA 2QA9E 2BDYA 3E0PB 2BVSH 1N8OC 3CS7A 5FCRA 1FIZA 1GBCA 1OOKB 2AMDA 1LQDB 2ZEBA 4WXVA 4TPYA 4YLUA 2YOLA 3QZQA 1YC0A 2BTCE 4O97A 1C9PA 1H9LB 5EODA 1FY1A 1BRCE 2VU8E 2BHGA 3TU7H 4B73A 1HNEE 1CA8B 4H6TA 2YNBA 2XNIA 2FX4A 3HATH 5JBBS 1V2OT 2PHBA 4BTUB 1LKBA 2ZGBH 4UDWH 1SG8B 2GDEH 2UWLA 1C1VH 1OP8A 2LNCA 2Y5GA 4GVUA 1T31A 2EA3A 3Q77A 3VB5A 3OSYA 1FIWA 1T8MA 4YT7H 2GKVE 1BA8B 1G3DA 4JYUH 4YZUA 1SGCA 1C5PA 1KXCA 1TPSA 4FUDA 1C9TA 3T26A 3P17H 1O3OA 2F9UA 2Q1JA 4ABFA 3EE0B 1UO6A 3FVFB 4XDEA 2Y82A 1C5XB 1VITG 1WCZA 1QRWA 1L1JA 3RC6A 4MTBA 2FS9A 1GHBG 2P8OC 1SQTA 2QC2A 1XKBC 1AB9C 1C5LH 2J38A 1DY9A 3ZVDA 1K1IA 2QGRA 1TNKA 1AE8H 3LGIA 1O3MA 1O32A 1O3EA 1V2JT 1TRNA 4NA7A 3F9HA 5EU8A 2QAAA 1FMGA 1EZUC 4B76A 2A32A 1LHGH 3M3TA 1NY22 3DHKH 2OC0A 2PSYA 1AY6H 5H4IB 3TLOA 5C3NA 1NPMA 1BRBE 1GMDF 1NC6A 1BTUA 3FP8E 6CHAC 2BVRH 1K2I1 2ESTE 1EAWA 2QXJA 3MO3A 3ZZAA 1O5EH 2M5TA 1QQUA 1EXFA 2Z9IA 4ZHAA 1AKSA 3OY5U 2DE9A 1UTLM 2NU1E 1WAYB 2ZC9H 1KY9A 1Y3VA 3SGBE 3NXPA 4A7IB 4DG4A 3P95A 5DGJA 4ZUHA 2VINA 2XC5A 1O3CA 1YPGH 2C8YB 1C1WH 4BAOB 4NFEA 4FUIA 3ZZ4A 3N7OA 1PPCE 2NWNA 2SNWA 5JBCS 4X1PU 1GBTA 3DA9B 1GHBF 4DT7B 1D3TB 2O8LA 5A2MH 4JYTA 1O2JA 1O3AA 2ZFRH 1FZZA 1QJ6B 4IBLH 1BTPA 1P12E 1P02A 3ZV8A 4A1TA 1P2MA 1T32A 4X1NU 2GP9B 2XWAA 1A7SA 2ZNKH 1IQHA 2ZTXA 3U1IB 1WTGH 1HIAB 2W3IA 3MH5A 1AU8A 1FAKH 2Q6DA 1WYKA 3A81A 4MNXA 4A5TS 2FESH 1C1PA 1DUAA 1OWIA 2BXTH 1O33A 4X0WU 1HAYB 2BDGA 3RXTA 3SJ8A 1K9OE 2UUJB 2XYAA 3RU4T 1S82A 5DP9A 3A82A 4IC5A 2ZP0H 3HKJB 2OC8A 3RXRA 3FP6E 1V2LT 1BQYA 3RXMA 2QY0B 3LH3A 1GBMA 1CQQA 3KN2A 1YBWA 1AVXA 1ACBE 3BEIB 2PFEA 1EATA 3KIDU 7KMEH 1RTFB 3PLPA 2VH6A 4RKOB 1PPGE 1P2KA 4D8NA 2FYRA 2LPRA 1UTPA 1LVMA 1W10U 1O3JA 1BJVA 3RXUA 1A0HB 2A4OA 1THPB 3S69A 4IS5A 2AFQB 1GJ9B 5FAHA 1BRAA 1Y5UT 2J92A 5EPNA 1DITH 2EI7A 2ZU1A 3P8NA 1KLTA 2FLRH 2FS8A 1EAXA 1TNLA 2EI6A 3GCHB 3UWJH 1SGFA 4NA8A 1V2RT 3MU4A 2P94A 2ZQ2A 5E8EH 3RMNH 2O8UA 1EJNA 1ZHPA 3MFJA 1DPOA 2ZHWH 3A7YA 1DT2A 1A61H 2BDHA 5K0HA 4FUGA 4X8TH 2P93A 2FXRA 4OGXA 2QCYA 3KHVA 3ZVBA 1OYQA 3WY8A 1LMWB 1CVWH 3F68H 4U32A 3S9AA 4LZ4B 1YCPH 3LJJA 3BV9B 3A8CA 1N6XA 4AFZA 3BTFE 2GCTC 3VEQB 4ESTE 1V2WT 2CF9H 5C5NA 1IQFA 1Y3UA 2A4RA 3EQ0H 3U98H 4CR5A 3SV2H 2F9BH 2FP7B 5EQSA 5SGAE 2FOMB 4ZKOU 4NCYA 4CRGA 1J15A 1YLCA 1TNJA 1A0JA 1C5RA 1A1RA 1KXAA 1KYNA 2ZKSA 1YCPK 1UCYE 1TMBH 2BDCA 1GVKB 3SQEE 2G81E 4IGDA 4GUXA 3TJOA 2ZDAH 2BLVA 3B9FH 1P04A 2OCVB 4B2BA 3S7KB 3P8OA 1ELCA 1C5QA 5CHAB 5JPMH 2VH0A 5C2ZA 1HAIH 5DP8A 2G5NA 1O5FH 1WV7H 2PGBB 2VIVA 1CT2E 2CXVA 3KQCA 4SGAE 2PR3A 3M7UA 1FJSA 1ESBA 2XC0A 1GJ7B 2QN5T 4O9VA 2Y81A 4THNH 1E36B 1SGFG 3QX5H 1AE5A 5CE1A 2STAE 1Y8TA 1QTFA 3S0NA 1OSSA 1P2NA 4JCNA 1O3NA 1PFXC 3BG4C 3V3MA 1XX9A 2BD5A 4GPGA 1QNJA 1BMMH 2Z9JA 1YF4A 3QDZB 5GDSH 2VVVA 2C4FH 1UVOA 3G01A 4F49A 2ZECA 1L2EA 4BANB 1BBRH 3GY4A 2XCFA 1QFKH 1HAGE 3E3TA 1F2SE 4Y7AA 2GT7A 1GBLA 1HCGA 4BOHA 2TBSA 1ABIH 1WOFA 1LPGB 2VB0A 3M3VA 4Q7XA 4XFQA 3MH7A 3LGTA 3E1XB 3RC4A 1XUJA 1BIOA 1TX6A 1MQ5A 1SHHB 3UOPA 2AH4X 2FI3E 1WTHD 1CGIE 2QYIA 2ZFQH 3MNXA 4E7NA 3TIUA 6ESTA 3LGWA 3SHCH 1EOJA 2RA0A 1BBRK 2J4IA 4K8YA 1BTHH 5A8YA 1QL8A 3P92A 1F5RA 2QXHA 3KNXA 1NN6A 2ZPSA 1Z7KA 3LGUA 3SOSA 3DUXH 1JBUH 2GT8A 3GY6A 3UNQA 4UONA 1O34A 3UFAA 1O30A 1EJAA 4DOQA 3PMJA 1VR1H 2PTNA 3MWIU 5JBAS 2WPIS 4H4FA 3SU1A 1P9SA 1TMTH 1UHBB 3SZNA 1GJDB 1DDJA 2OP9A 3ZZ6A 1Z6EA 1F5KU 4MPXA 2QV1A 2J34A 4WMEA 1P3CA 4YOGA 2SNVA 1MUEB 1O5AB 1X7AC 2UWOA 7GCHF 5B6OA 4ZMAH 2PKSB 2RG3A 1O2PA 1U6QA 1ZGIA 1JRTA 2AIQA 1TOMH 2VIOA 1LO6A 3ELAH 4D9QA 3U8TH 2AGEX 1Z71A 5HM9A 3E91A 1DWBH 2D1JA 3BIVH 3L33A 2FWWA 1IAUA 3SQHE 2H6MA 5C1XA 1MTVA 4E7RG 4OS4A 1F0RA 4X2WA 4A92A 1GHYH 1MKWH 1XUGA 1KXBA 4Y0ZE 3ZZBA 2ANKH 1TQ0B 2GCHG 2R0LA 1K1JA 1SGPE 1SBWA 3RC5A 2A1DB 1EZXC 1DWEH 1LVBA 3LONA 4X8UH 5C20A 4O3UA 5I25A 4U30A 3M7TA 1VCWA 5AVDA 1C5TA 1MKWK 4D76A 5F03A 5TCCA 4AG2A 2BOHB 2QIQA 1FY4A 2ZZUH 5IDKA 1S5SA 3A8DA 4K1EA 2VWNA 5EXNA 5E0GA 4ZAEA 3RXDA 1SLWB 1K1PA 1V6DA 5BPEA 3HK3B 4KELA 2G5VA 3CENA 3PLBA 4FU8A 2NU2E 3FANA 4CRFA 2HWLB 3UIRA 1TRMA 4FUCA 1MCTA 1J8AA 4BAHB 3L6PA 1A5GH 4K3JA 1Z8GA 1PPZA 2XWBI 5GCHG 2Y6TA 2RA3A 1ZLRA 2GCHF 1JIMA 2H1UA 1V2QT 3F1SB 2OD3B 3FFGA 4KTUA 3TITA 5EOKA 2WINI 2KAIA 2BM2A 1OWJA 3RLWH 2H9EH 2TGAA 3C1KA 2A5KA 5ESTE 2AGIX 2BQWB 1PPHE 3RXVA 1ELVA 3RXCA 2A7CA 3LJOA 2TIOA 1W0ZU 1ANBA 1KIGH 3GCTG 1P2JA 4X2VA 1OS8A 2XTTB 1AFEH 4UFGH 4AYYB 4H6SB 1FPHH 7LPRA 1HGTH 4NSVA 1V2UT 2ZWLH 3RXIA 3MHWU 1Y5BT 1BBRE 1CA0B 1EUFA 1Y3YA 2Z9LA 1LPZB 4I7YH 4CHAC 1LQEA 4BTIB 2B8OH 3VPKA 3RXGA 3HGPA 1E37B 3NCLA 4ABJA 3RXPA 1QL7A 2GVFA 1ZPCA 3LOXA 5GXPA 3AAVA 5I46H 5GPIB 2FO9A 1BTWA 1OWEA 1GJ4H 4YOJA 1TIOA 1EPTC 1GI7B 3JZ2B 3LT3A 5GCHF 1NFXA 1MQ6A 1OP2A 2XBYA 5DP3A 4YOIA 1P11E 4UE7H 3RXJA 1LHFH 2SGAA 3BN9A 1TB6H 4K8BA 1C1NA 4I32A 4MPWA 3MI4A 4YLQH 1T8NA 1RIWB 1G32B 2V35A 2ZPRA 3MU0A 1VITH 1FONA 1GWAA 2TGDA 3LDXH 2ZG0H 4Y8YA 5DP4A 1TPAE 3RXFA 1WBGB 2W26A 1ZHMA 1GHAG 3GCTF 3MO6A 1GMHF 1O2VA 4ZKRU 1QRXA 4J1YA 3CS0A 1YLDA 4A1VA 1UK3A 4AX9H 2F9OA 2AIPA 1AVWA 1EKBB 2EC9H 2P95A 2BB4A 2HNTF 3LKWA 3OX7U 1ZPZA 1TYNA 2ZI2H 4FXGH 1KTSB 5C1YA 2WV4A 4I31A 1FN8A 4FUFA 3ATKA 1O2TA 1S85A 2XBXA 3TGJE 4NWKA 1QA0A 5FCKA 1VCQA 1DSUA 5EW1H 4Z0KA 1O35A 1CBWC 2XBVA 1GMCG 1ZTLA 3KL6A 1IQNA 2BY9X 3NPSA 5E0JA 3QK1A 2VGCC 3SUFA 2TGTA 1BMAA 1O2MA 1DWDH 1VGCB 1NM6A 1EP5A 2GV7A 1BRUP 3JZ1B 1SL3A 1ETRH 1TLDA 3RXKA 4Q2KA 2J94A 4K69A 3SJIA 1SGNE 1ZJKA 1GMDG 2B7DH 2R3UA 2XW9A 1DWCH 1HAVB 1YKTA 2IJOB 1XUKA 3BTQE 1EPTA 3ZZDA 5IYTA 3ZZ5A 3A85A 2ZHQH 1AFQB 1SB1H 1GHAF 1Q2WA 1SGIB 4AYVB 5F6MA 2ZO3H 1TA2A 3E8LA 7ESTE 5L2YH 4TWYA 1GGDB 1CT0E 1LHEH 1O2QA 3GCNA 4MVNA 4Y11E 1DXPA 2ZA5A 2P59A 4WF8A 4UFDH 1BITA 2R0KA 2GZ8A 3BTHE 1C5MD 4AB8A 1HIAA 3EGKH 1J16A 1H8IH 3A83A 1GL0E 1TMUH 4XBDA 2CV3A 1IQLA 3RXSA 1GMCF 3VXEH 1ZMLA 1ZRBA 2WPMS 3R0FA 3STJA 1YPHE 2YNAA 3IWMA 1PPFE 1QQ4A 2ZCLP 3A89A 5EPYA 3T25A 4FVBA 2XC4A 3RLYH 2CMYA 3EA9A 1C1TA 1HXEH 1P05A 2ZGHA 1N1LA 3T27A 1C2EA 3UR6A 1ZOMA 3K2UA 3GYMA 1V2PT 3VXFH 1ELBA 4GHTA 3SGAE 3D62A 5ETXA 3SNAA 1XUHA 2B9LA 3TJNA 1V2KT 2R2MB 1DS2E 4TY7A 4PROA 1QJ1B 1SLVB 1SGEE 1A5HA 3LH1A 2OLGA 1D4PB 1SPJA 3MNSA 2O8WA 1O36A 3GY2A 3UR9A 5GIBA 1SGRE 1CU1A 1CSOE 4WXIA 4IN2A 1FQ3A 1TONA 1HBTH 2ASUB 2VIPA 3HK6B 2BDBA 1O38A 1YPMH 4Y6DA 1O3PB 4NWLA 1J9CH 1QCPA 1D3DB 3PMBB 4E05H 2CHAC 1TABE 3DT0H 2BZ6H 2JH0D 5DJ7A 1TAWA 1FXYA 1G30B 4WMDA 2Z3DA 3Q00A 2ZU3A 1NRNH 4YM9A 4YTAA 4GHQA 3P8FA 1LVOA 5FBEA 3PO1C 1LHCH 1SMFE 2Y80A 1SOZA 2BDIA 2Z3EA 1HJAB 1LTOA 3URDA 3ATIA 2GMTB 1SFQB 1UMAH 4NIVA 1T8LA 1GHWH 1JXPA 2PKAB 1NO9H 3RXHA 2H2ZA 1NRRH 1IHTH 1GI5A 3RM0H 1GCDA 3TVJB 3UTUH 3K6YA 4AGJA 1ID5H 2I6QA 4B1TA 2PW8H 4I33A 5LH8A 2BOKA 4ISNA 4I8GA 1DOJA 1O2UA 4DY7B 1NRPH 2C93B 1ZSKA 1P9UA 3PMHB 3KF2A 3H5CB 5LPEA 1Y3XA 4Y7BA 3RU4D 4NA9H 2WPHS 4CH2B 1GBKA 2UUFB 1EP6A 1EZSC 4VGCC 5LPFA 3SU6A 4RKJB 1BOQA 4BNRA 5TJXA 3T28A 1BTXA 4TPIZ 1JWTA 1EOLA 2P3UB 1MBQA 1N6YA 1F0SA 1EASA 1TBRH 3QN7A 4INKA 1N8OB 3D65E 4JK6A 4ZH8A 3SHAH 3SNDA 1RGQA 2GD4B 2G52A 3BTME 3QGJA 1UVUH 1A3BH 3ZVEA 3EDXB 1MD8A 4XSKU 5G4BA 1ZJDA 4SGBE 4INHA 4I8HA 1GCTB 1GG6C 1P01A 3RMLH 1XXDA 1HJ8A 1EQ9A 3NWUA 1TX7A 4DCDA 4XBCA 1V2VT 4X8VH 3QWCH 4O03A 1P2OA 5FPTA 1F5LA 2SGFE 3QO6A 3HGNA 1C2GA 3NZIA 2BDAA 1AUTC 5GWZA 5DP7A 3M37A 1KDQB 1UTNA 3A7ZA 3F9EA 4TY6A 3TNSA 1GI4A 2BZAA 5EW2H 1GJ5H 1G2LA 2BY8X 2ZF0H 1UTOA 1AGJA 1UK2A 5A8XA 4LXBH 4X8SH 3LGVA 1OKXA 1P8VC 5L30H 3P6ZB 1G3EA 2OBOA 3SU5A 4Q7ZA 1S84A 2EEKA 4AFSA 1ZMJA 1ABJH 1HAHH 3A7VA 1KLIH 1OP0A 1QURH 1FN6A 3SGQE 1SLXB 3P70B 2P8OB 1C5ZB 5HGGA 1SHYA 1QBOA 1P2QA 3RXAA 1QB6A 1AB9B 1F92A 3OYPA 4MNVA 4LZ1H 1AWHB 2G55A 2FYQA 1QBNA 4CREA 3E6PH 3A7WA 1TPPA 1P3EA 2Z9GA 4B75A 3LGYA 4KTSA 1D6WA 1VCPA 4Y8ZA 1ESAA 2OUAA 3QZRA 2WYGA 4X1SU 4BAKB 1QIXB 2C90B 1O3BA 4XBBA 1H9HE 6CHAB 1IQIA 4ABEA 4LOYH 4KTCA 4HZHA 2ZDKA 3EA8A 3PB1E 5FBIA 4ABDA 1MTNC 1UVPA 1VJAU 2ZHFH 2V3HH 3PM3A 1W8BH 1V2ST 2G4TA 2VVUA 5AF9H 2F3CE 3NUMA 1GVZA 2HALA 2W5EA 3VGCC 3RXQA 2FEQH 2GTBA 1AUJA 2BD8A 2SGEE 2ZGCA 5HMAA 1MMJN 1HB0B 3VB6A 2THFB 3I77A 1QR3E 1QB1A 5AFZH 1YP9A 2FODA 2ZCHP 4WWYA 3PYHA 7GCHG 1S83A 1B7XB 3UY9A 1O2RA 4B2CA 1GBEA 1C1UH 2FOHA 1FI8A 2FOCA 1H8DH 1NU9A 4IMZA 1GBIA 1RFNA 5F8ZA 4RSPA 1ARBA 2HNTC 3PWBA 5FPYA 4XE4A 1RXPA 2GX4A 1CHOG 1P2IA 3DD2H 1A46H 4I8KA 2XRCA 4KGAA 2Y7XA 4A1XA 1ANEA 1AMHA 2Z6BD 4E06H 2BX3A 2ZU4A 2BLOA 4ASHA 2ALVA 2VJ1A 1PQ8A 1BHXB 1FLEE 2CGAA 2ZFFH 1ZYOA 2TRMA 3SNBA 3MH4A 1ELGA 8GCHF 3O8CA 4H42U 3BTKE 3ZZ8A 4CRDA 2WPJS 3F9FA 3MO9A 1C5WB 1TNHA 2AEIH 1QY6A 3HKIB 8ESTE 4TWWA 2BQ7B 2ZDMA
chains in the Genus database with same CATH superfamily
1C2KA 3TK9A 4ZKSU 1C4U2 1VZQH 3M7QA 4B2AA 3MU8A 3U69H 1ZTKA 1LPKB 1ELDE 4X2YA 2QF0A 4YESB 2JETC 3F2GA 5HM2A 1OHHD 1TNIA 2OC1A 5GJ4B 4FUJA 3KCGH 1MZAA 1V3XA 1CHOF 1AVGH 2ZDNA 2ZU2A 1CE5A 1HXFH 1MKXH 1O3LA 2W7UA 1O2OA 5TCAA 2ZTZA 1K28D 3A8BA 1SLUB 3MH6A 1ZPBA 4NIXA 2ILNA 2ZFPH 2BD2A 1A2CH 1LKAA 1GBHA 1QBVH 1ZRKA 1T4VH 3EYDA 1SR5C 1XXFA 4DJZB 4FVDA 1GI9B 3PLKA 2WPKS 1PPBH 3QTOH 1PQ7A 3GYLB 4Q7YA 4OS5A 1SVPA 1MKXK 2VWMA 2Q6FA 1PQ5A 1LCYA 1NU7B 2GCTB 4Q80A 2P3FH 2HRVA 4MPUA 3ZZ3A 1GJAB 3ZV9A 1INCA 2GDDA 3L3TA 1P10A 1W7XH 1NS3A 1W11U 1GI6A 3LU9B 2QXGA 1GHVH 4MNWA 3V7TA 3EAJA 4F4OC 5HXFA 1TGCA 2QF4A 5K7RA 2AMPA 1MTSA 1BB0B 2A5IA 2BLWA 4K60A 1O3GA 1QL9A 4BXWA 2LP6A 2P16A 3SJOA 1SGDE 3T62A 3MNCA 1MTUA 1GDQA 3IG6B 3KQBA 1CO7E 1IQEA 1KLJH 3P8GA 3NK8A 3UQOA 1O2WA 2AHME 1BCUH 3V12A 5J4SA 2NU4E 1AZZA 4NSYA 2CK3D 2G4UA 3AAUA 4OS2A 1G36A 4B74A 1AD8H 4RI0A 2H9TH 1IQKA 1GI0A 3VB4A 1FY5A 3GY8A 1GMHG 2ZU5A 1WQVH 4KP0A 3BG4B 3GS9A 5PTPA 3UOUA 2QF3A 4D7GA 1EZQA 5EXMA 1O5GH 4D7FA 2SGPE 4I8LA 3K9XB 4JZEH 1O2GH 4P00A 4F55A 1CT4E 3V0XA 1NBMD 1VJ9U 1W13U 1O2XA 2GGVB 3RMMH 3EE7A 1O0DH 1UTKA 3M61U 1YLNA 1QHRB 3MTYA 2PUQH 2GZ9A 5E2PA 1NRSH 1WUNH 2FMJA 2Q6GA 5F53A 3SU0A 1O2NA 8KME2 1C2FA 2AGGX 3DCLA 3U1JB 1MBMA 1C5VA 2ZFTA 1TQ7B 2Z7FE 1A0LA 4MNYA 2ZDVH 1QA7A 2BY7X 3C27B 5J4QA 1XM1A 3S9CA 4ISOA 1AQ7A 3BTTE 1C4V2 3BIUH 1ANDA 1EX3A 1NROH 3AVZA 3F2FA 1EB1H 3RDZA 1NTPA 2BYAX 3ODFA 1FY3A 2PUXB 1TX8A 4Y76A 1B5GH 5C67A 3GY7A 3N7DA 1KTTB 1O3DA 2VIQA 5E0HA 4DVAU 2VVCA 1QJ7B 1Z8RA 1O2ZA 1TWXB 6GCHG 1D9IA 1ELEE 3FZZA 3RXBA 4NFFA 2KFWA 1B0FA 2O8MA 9ESTA 4Y71A 3ZYDA 2D8WA 1O5DH 1BJUA 3BSQA 4K1TA 5EJLA 1C2MA 4HGCA 1Z1JA 1BTZA 3AW0A 3SUDA 4Y8XA 3F0OA 1D3QB 1CGJE 2GZ7A 3TGKE 9LPRA 1EB2A 1SSXA 2KAIB 4KKDA 1IHSH 1DXWA 3T2NA 1S6HA 3HPTB 1UTQA 1C2IA 1RS0A 1WXRA 3ZZ7A 3LC5A 4NZLA 2EI8A 2Y5HA 1SKYE 4GCHG 4LK4A 2OQ5A 1TGBA 3H7OA 2UUKB 4XRNA 5DP5A 1DVAH 2J9NA 3OAAD 4NG9H 1FAXA 1BMFD 1GDNA 2ZGXH 3FAOA 1C1RA 1G3BA 3F9GA 2B0FA 5FHTA 3STIA 1GCTC 3UNRA 4HI3A 3A86A 2JIZD 4OS7A 3KGPA 2WYJA 3GCHC 3RUOA 2EY4C 3LPRA 1MU8B 1O2YA 1TNGA 4DGJA 1C1SA 2PV9B 1TE0A 2XXLA 4DIIH 6GCHF 4GAWA 4U2WA 4WMFA 5EQQA 2BD7A 2IN2A 2ZHDA 1GBJA 2K1QA 1O3IA 2GV6A 1YPEH 1K1LA 2I6SA 5DG6A 1XUIA 2C3SA 4YT6H 2M2AA 1V2NT 4JZ1A 1E34B 3TK5A 1RTLA 5DP6A 2FI5E 3KEEA 2AERH 1AIXH 2D26C 2HPPH 2OTVA 2FTLE 4IMQA 1W0YH 2ZHEH 2HLCA 2A2QH 2ZPQA 3OTJE 3QTVH 4WY3A 4CH8B 4DIHH 2PKAA 4X2XA 5JDUB 2ZDLA 1S0RA 4GCHF 3RU4E 6LPRA 5T6FA 1K21H 2AYWA 4ASUD 4ABIA 1PYTC 4X6OA 2BY6X 1Z6JH 1NZQH 1SGYE 3ZVCA 1E1QD 1UVSH 3Q3KA 1YPLH 3AASA 4BAQB 3GDVA 2L6OA 1T7CA 1RTKA 1OYTH 1UCYH 3VB3A 1GJCB 2O9QA 5CHAC 1MTWA 4WVPE 2JH6D 5LPRA 3D23A 3MQKC 1C1QA 1C2DA 1OPHB 1O39A 1CGHA 2XOKD 3BEFB 1QB9A 5DKMA 1AWFH 4Q4LA 1SC8U 2JKHA 1C4Y2 5A09A 2AMQA 3O8BA 2HOBA 4I8JA 3KQDA 3RXEA 1DANH 4CHAB 3R3GB 4WH8A 1UCYK 2OQUA 4UFEH 2F91A 3FZDA 2UWPA 3GDUA 3A88A 3I78A 1LDTT 1MCVA 2J95A 3ATLA 2DUCA 3W94A 1G9IE 4CRCA 1ETSH 3AW1A 1EPTB 1L4ZA 1MH0A 1IQGA 1L1NA 2CN0H 3Q3YA 1VITF 2F4LA 4CBOA 1KDQA 3EA7A 1WQSA 1ZSLA 3A8AA 1W12U 3CP7A 4NIYA 3UREA 3URCA 4BAMB 1AZ8A 2V3MA 2O8TA 3GOVB 1F7ZA 1ZTJA 3GY3A 1A3EH 1Q31A 3TGIE 1XMNB 5C17A 1MAYA 2HGTH 2ZTYA 4OS1A 1TBZH 4B6FA 2PWXA 1TGTA 2BXUH 2W6JD 1HJ9A 1O3HA 1O5BB 1E35B 1O5CB 3BTWE 1ETTH 1QRZA 4ISIH 2IOTA 3DSPA 4X6NA 5EGMA 4JMYA 2HPQH 4CBNA 2VWOA 4RT0A 5HIYA 2CF8H 3PWCA 2JJ1D 2P3TB 1GJBB 1HAOH 1P03A 3FN8A 1C2LA 2FTMA 4ZHLU 2FDAA 1MAXA 1CBWB 3UUZA 2WPLS 1A4WH 2A7JA 4K2YA 2VGCB 4M7GA 1V2TT 1SI5H 1C5SA 3MNBA 3UPEA 3VB7A 1XVMA 1HV7A 3ZZCA 1AKSB 1DLEA 2PKSC 5KEDA 3H7TA 4ISLA 5KGOA 4ZKNU 1ZMNA 2AS9A 3ZYEA 4A6LA 4NGAH 2W7SA 2PLXA 1IQMA 2ODPA 3S9BA 1O31A 3BTDE 3O8DA 1E0FD 1T4UH 1P06A 2A45B 1SGQE 2BY5X 4MG3A 4DT4A 3F6UH 3BF6H 5C1UA 1EAUA 4BTTB 1OWKA 2JJ2D 3SU2A 3A80A 1D6RA 3MOCA 4U01A 4X1QU 1P57B 1Q3XA 4AB9A 1TBQH 3BTGE 1IQJA 1HAPH 4B71A 1IOEA 5A0CA 3B23B 3E0NB 3GDSA 1NFWA 2FIRH 4XOJA 1PPEE 3RM2H 3TJVA 1GPZA 1AO5A 4K5ZA 2Y5FA 1TALA 2FZZA 1DM4B 1ELFA 5C5OA 2TGPZ 4NZQA 1M9UA 1OWHA 3Q76A 2FPZA 2SGQE 1Z1IA 1THSH 1DUEA 2ZFSA 1GJ8B 3DSOA 2VIDA 1YWUA 3ZVFA 1K1NA 2WHXA 4FUEA 3MYWA 1E38B 1HLTH 2LELA 1ANCA 1W7GH 5L6NH 2V6NA 5LGOA 1XKAC 4ABBA 1ARCA 2A0QB 1XUFA 4FU7A 4GSOA 1GL1A 3U8RH 1UHBA 1GI2A 1K1MA 4NIWA 4IC6A 8LPRA 3SBKA 4JZFH 2XBWA 1H9IE 3TH4H 2PSXA 4M9FA 3SV6A 1W14U 1FUJA 4J2YB 1C5YB 3SJ9A 1DFPA 4CR9A 4D9RA 1EAIA 4JZIA 2VIWA 5A0AE 1G37A 3PV4A 4Z1MD 3NKKA 5A8ZA 2NU3E 1NESE 3E90B 4AFUA 1ZHRA 2QXIA 1A5IA 1GI1A 2ANMH 2J97A 3U8OH 1NFYA 8GCHG 2PGQB 1QZ8A 2F83A 1DX5M 2Z9KA 4X6MA 1C2HA 1FY8E 4ZXYH 2F9PA 3T29A 1GDUA 2Z94A 2HVXA 3UNSA 1YPKH 1FNIA 2FLBH 5EQRA 3TNTA 1JOUB 1YPJH 3TJUA 4QT8C 5F8XA 4WJG2 2CHAB 3ESTA 4HTCH 4IW4E 4ISHH 1CA0C 4ZHMU 2NU0E 1Z8JB 1OX1A 1O2HA 1TRYA 3QGNB 1MU6B 3SNEA 1F0TA 1HAXB 1Y5AT 1OWDA 3MU5A 4INLA 1CHGA 3V13A 2A5AA 1ELAA 2W6ID 1HFDA 1C2JA 1Y59T 3PO1B 2D2DA 2ZQ1A 1PJPA 2ANWA 1B0EA 1SGTA 2G8TA 1NFUA 2C8ZB 1KXDA 2ALPA 2W3KA 1DICA 1O2LA 3A87A 5T6GA 4Y0YE 4ZROA 3IITA 1FV9A 4HFPB 1RRKA 1KXEA 1UTJA 2ODQA 2V3OH 3M3SA 2ZCKP 3UB0A 2G51A 4FUHA 1O3KA 4MQAA 1J14A 1BT7A 3SI4H 1RIWC 4JZDH 3WWBA 3SNCA 2BMGB 4YXWD 1GBFA 3ODDA 2WUCA 1HAZB 2JH5D 2FOEA 3RXLA 2ZIQH 1KSNA 3SW2B 1GBDA 1BDAA 5T3HA 3GICB 3WW7A 1TOCB 3MMGA 4X6PA 2C8WB 3SV9A 2FI4E 4FUBA 2F9VA 4VGCB 3SYJA 2FOGA 1GHXH 3ZVAA 5FX6A 1S81A 3PMAB 1AI8H 3BEUA 4AZ2B 3I29A 5DPAA 1H4WA 4JYVH 1P0SH 2G00A 4WH6A 1JIRA 2BD4A 2BX4A 2UUYA 1GBBA 1GHZA 2IPQX 3SV8A 1P09A 1TPOA 1AN1E 2VWLA 1WSSH 2WUBA 1NRQH 2H9HA 1GG6B 4MPVA 3SU4A 2ODYB 5EJZA 1OXGA 1NBME 2PP6A 4AOQA 1KXFA 1H8ED 1RD3B 1GJ6A 1BHXF 1BMLA 3ATWA 1HPGA 1FPCH 3M5NA 3UQVA 1YPHC 4AFQA 2STBE 5HYOA 1L1GA 1VGCC 2IPHA 2OBQA 3B8JA 2A31A 3OY6U 4CRBA 3TH2H 2Y7ZA 4R8TB 2SFAA 4ABAA 1ELTA 3SO3A 1THRH 3LC3A 4BXSA 2A7HA 1C1MA 1AFQC 3ZVGA 3SJKA 1YCPM 4FOUC 2OC7A 2ULLA 3T5FH 3A84A 3GISB 3O8RA 1SQAA 2BD9A 3BTEE 1JMOH 1PYTD 3M5LA 1ZGVA 4FU9A 1HDTH 1GGDC 3K6ZA 3LIWA 1HRTH 2R3YA 3PTNA 2ANYA 4YO9A 1O2SA 1S6FA 1L4DA 1GBAA 1UJ1A 4ABHA 2WPDD 1BZXE 2FOAA 5ABWA 2BLQA 1T8OA 2CJIA 1PQAA 3PTBA 3D49H 1K1OA 3QLPH 3K65B 3A7XA 3UWIA 3SN8A 1S0QA 2FX6A 4ABGA 4AG1A 2A4QA 3RP2A 2H5DA 5JB9S 3TH3H 2PTCE 3S7HB 1HYLA 5EIYA 2RDLA 4Z6AH 2J98A 3M35A 1EJMA 1Y3WA 2BQ6B 1FDPA 1W3CA 1MTNB 2SGDE 3FP7E 3M5MA 1C1OA 1F0UA 1UVTH 1WU1A 1MZDA 3M5OA 4RN6A 3RXOA 4ZXXH 1W2KH 5CMXH 4Y10E 1YGCH 1SQOA 3VGCB 5AHGH 1HUTH 2TPIZ 4OS6A 5A0BA 3KQEA 5EXLA 2C8XB 1O2IA 5E2OA 3SU3A 4O3TA 3TK6A 4UD9H 1UK4A 3DFLA 3A7TA 3MU1A 4P02A 1XVOA 2BVXH 1ESTA 3ITIA 1J17T 5BRRE 1D3PB 1JRSA 1HAVA 1TGSZ 2OXSA 2RCEA 4K1SA 4R0IA 2VNTA 1SFIA 3PROA 1Z8IB 2FOBA 4AORA 5F8TA 2FM2A 5JB8S 1G2MA 3SV7A 1TFXA 1ZZZA 2F9NA 5JBTA 2Z3CA 3W95A 4GLYA 3M36A 1GVLA 1MD7A 4IN1A 4TYDA 2R2WU 1BUIA 3SI3H 3ZZ9A 2R9PA 2B5TB 2V0BA 1DE7H 2FOFA 3QUMP 5JYIA 4OGYA 3U9AH 4MLFB 5GNDA 2KM0A 2BD3A 4Y79A 3W1EA 3SUEA 1H1BA 3DFJA 2A2XH 5L2ZH 3ATMA 4X1RU 4AN7A 5FX5A 5EG4A 1BMNH 1NT1A 3ZIAD 1C5NH 4MDSA 2OINA 1DY8A 5ESBA 1UTMA 3Q3XA 1K0HA 2A4GA 1ZR0A 1HJAC 1DSTA 4DW2U 2H5CA 3SORA 1C5OH 5DO4H 2GMTC 3SUGA 4JK5A 2WV5A 3OU0A 1YM0A 1SOTA 5T6DA 2KR7A 1RJXB 1GI3A 4UFFH 2XCNA 4CRAA 3ENSB 1BTYA 3VFEA 2ZGJA 1K22H 3RMOH 3TPIZ 1DLKB 1LHDH 3UAIC 1QGFA 1ORFA 1ZSJA 1LVYA 1O37A 1TGNA 1O2KA 1V2MT 1G3CA 4DURA 4UEHH 1YYY1 5FXLA 5AFYH 3GY5A 5FPSA 3E16B 1O3FA 1TA6A 1AHTH 2J2UA 4AGKA 1W0JD 1GI8B 3BG8A 3CNRA 2DE8A 3GCOA 2HNTE 2JETB 1C5UA 5DK1A 1L0ZA 2QA9E 2BDYA 3E0PB 2BVSH 1N8OC 3CS7A 3PRDA 5FCRA 1FIZA 1GBCA 1OOKB 2AMDA 1LQDB 2ZEBA 4WXVA 4TPYA 2WZQA 2HLDD 4YLUA 2YOLA 3QZQA 1YC0A 2BTCE 4O97A 3SZEA 1C9PA 1H9LB 5EODA 1FY1A 1BRCE 2VU8E 2BHGA 3TU7H 4B73A 1HNEE 1CA8B 4H6TA 2YNBA 2XNIA 2FX4A 3HATH 5JBBS 1V2OT 5DN6D 2PHBA 4BTUB 1LKBA 2ZGBH 4UDWH 1SG8B 2GDEH 2UWLA 1C1VH 1OP8A 2LNCA 2Y5GA 4GVUA 1T31A 2EA3A 3Q77A 3VB5A 3OSYA 1FIWA 3DSGA 1T8MA 4YT7H 2GKVE 1BA8B 1G3DA 4JYUH 4YZUA 1SGCA 1C5PA 1KXCA 1TPSA 4FUDA 1C9TA 3T26A 3P17H 1O3OA 2F9UA 2Q1JA 4ABFA 3EE0B 1UO6A 3FVFB 4XDEA 2GJGA 2Y82A 1C5XB 1VITG 1WCZA 4Q63A 1QRWA 1L1JA 3RC6A 4MTBA 2FS9A 1GHBG 2K0QA 2P8OC 1SQTA 2QC2A 1XKBC 1AB9C 3OFND 1C5LH 2J38A 1DY9A 3ZVDA 1K1IA 2QGRA 1TNKA 1AE8H 3LGIA 1O3MA 1O32A 1O3EA 1V2JT 1TRNA 4NA7A 3F9HA 5EU8A 2QAAA 1FMGA 1EZUC 4B76A 2A32A 1LHGH 3M3TA 1NY22 3DHKH 2OC0A 2PSYA 1AY6H 5H4IB 3TLOA 5C3NA 2K8IA 1NPMA 1BRBE 1GMDF 1NC6A 1S6LA 1BTUA 1H8HD 3FP8E 6CHAC 2BVRH 1K2I1 2ESTE 1EAWA 2QXJA 3MO3A 3ZZAA 1O5EH 2M5TA 1QQUA 1EXFA 2Z9IA 4ZHAA 1AKSA 3OY5U 2DE9A 1UTLM 2NU1E 1W0KD 1WAYB 2ZC9H 2WSSD 1KY9A 1Y3VA 3SGBE 3NXPA 4A7IB 4DG4A 3VG8A 3P95A 5DGJA 4ZUHA 2VINA 2XC5A 1O3CA 1YPGH 2C8YB 1C1WH 4BAOB 4NFEA 4FUIA 3ZZ4A 3N7OA 1PPCE 2NWNA 2SNWA 5JBCS 4X1PU 1GBTA 3DA9B 1GHBF 4DT7B 1D3TB 2O8LA 5A2MH 4JYTA 1O2JA 1O3AA 2ZFRH 1FZZA 1QJ6B 4IBLH 1BTPA 1P12E 1P02A 3ZV8A 4A1TA 1P2MA 1T32A 4X1NU 2GP9B 2XWAA 1A7SA 2ZNKH 1IQHA 2ZTXA 3U1IB 3FKSD 1WTGH 2YMSC 1HIAB 2W3IA 3MH5A 1AU8A 1FAKH 2Q6DA 1WYKA 3A81A 4MNXA 4A5TS 2FESH 1C1PA 1DUAA 1OWIA 2BXTH 1O33A 4X0WU 1HAYB 2BDGA 3RXTA 3SJ8A 2KCAA 1K9OE 2UUJB 2XYAA 3RU4T 1S82A 5DP9A 3A82A 4IC5A 2ZP0H 3HKJB 5CHBA 2OC8A 2JDID 3RXRA 3FP6E 1V2LT 1BQYA 3F3BA 3RXMA 2QY0B 3LH3A 1GBMA 1CQQA 3KN2A 1YBWA 1WDIA 1AVXA 1ACBE 3BEIB 2PFEA 1EATA 3KIDU 7KMEH 1RTFB 3PLPA 2VH6A 4RKOB 1PPGE 5EJ1A 1P2KA 4D8NA 2FYRA 2LPRA 1UTPA 1LVMA 1W10U 1O3JA 1BJVA 3RXUA 1A0HB 2A4OA 5C0UA 1THPB 3S69A 4IS5A 2AFQB 1GJ9B 5FAHA 1BRAA 1Y5UT 2J92A 5EPNA 1DITH 2EI7A 2ZU1A 3P8NA 1KLTA 2FLRH 2FS8A 1EAXA 1TNLA 4XD7D 2EI6A 3GCHB 3UWJH 1SGFA 4NA8A 1V2RT 3MU4A 2P94A 2ZQ2A 5E8EH 3PV2A 3RMNH 2O8UA 1EJNA 1ZHPA 3MFJA 1DPOA 2ZHWH 3A7YA 1DT2A 1A61H 2BDHA 5K0HA 4FUGA 4X8TH 2P93A 2FXRA 3KYFA 4OGXA 2QCYA 3KHVA 3ZVBA 1OYQA 3WY8A 1LMWB 1CVWH 3F68H 4U32A 3S9AA 4LZ4B 1YCPH 3LJJA 3BV9B 3A8CA 1N6XA 4AFZA 3BTFE 2GCTC 3VEQB 4ESTE 4I86A 1V2WT 2CF9H 5C5NA 1IQFA 1Y3UA 2A4RA 3EQ0H 3U98H 4CR5A 3SV2H 2F9BH 2FP7B 5EQSA 4ZCNA 5SGAE 2IJD1 2FOMB 4ZKOU 4NCYA 4ACBA 4CRGA 1J15A 1YLCA 1TNJA 1A0JA 1C5RA 1A1RA 1KXAA 1KYNA 2ZKSA 1YCPK 1UCYE 1TMBH 2BDCA 1GVKB 3SQEE 2G81E 4IGDA 4GUXA 3TJOA 2ZDAH 2BLVA 3B9FH 1P04A 2OCVB 4B2BA 3S7KB 3P8OA 1ELCA 1C5QA 5CHAB 5JPMH 2VH0A 5C2ZA 1HAIH 1COWD 5DP8A 2G5NA 1O5FH 1WV7H 2PGBB 2VIVA 1CT2E 2CXVA 3KQCA 4SGAE 2PR3A 3M7UA 1FJSA 1ESBA 2XC0A 1GJ7B 2QN5T 4O9VA 2Y81A 4THNH 1E36B 1SGFG 3QX5H 1AE5A 5CE1A 2STAE 1Y8TA 1QTFA 3S0NA 1OSSA 1P2NA 4JCNA 1O3NA 1PFXC 3BG4C 3V3MA 1XX9A 2BD5A 4GPGA 1QNJA 1BMMH 2Z9JA 1YF4A 3QDZB 5GDSH 2VVVA 2C4FH 2L74A 1UVOA 3G01A 4F49A 2ZECA 1L2EA 4BANB 1BBRH 3GY4A 2XCFA 1QFKH 1HAGE 3E3TA 1F2SE 4Y7AA 1FX0B 2GT7A 1GBLA 3PV5A 1HCGA 4BOHA 2TBSA 1ABIH 1WOFA 1LPGB 2VB0A 3M3VA 4Q7XA 4XFQA 3MH7A 3LGTA 3E1XB 3RC4A 1XUJA 1BIOA 1TX6A 1MQ5A 1SHHB 3F2HA 2AH4X 3UOPA 2FI3E 1WTHD 1CGIE 2QYIA 2ZFQH 3MNXA 4E7NA 5C0TA 3TIUA 6ESTA 3LGWA 3SHCH 1EOJA 2RA0A 1BBRK 2J4IA 4K8YA 1BTHH 5A8YA 1QL8A 3P92A 1F5RA 2QXHA 3KNXA 2QE7D 1NN6A 2ZPSA 1Z7KA 2RDEA 3LGUA 3SOSA 3DUXH 1JBUH 2GT8A 3GY6A 3UNQA 4UONA 1O34A 3UFAA 1O30A 1EJAA 4DOQA 3PMJA 1VR1H 2PTNA 3MWIU 5JBAS 2WPIS 4H4FA 3SU1A 1P9SA 1TMTH 1UHBB 3SZNA 1E1RD 1GJDB 1DDJA 2OP9A 3ZZ6A 1Z6EA 1F5KU 4MPXA 2QV1A 2J34A 4WMEA 5T1VA 1P3CA 4YOGA 2SNVA 4ACAA 1MUEB 1O5AB 1X7AC 2UWOA 7GCHF 5B6OA 4ZMAH 2PKSB 2RG3A 1O2PA 1U6QA 1ZGIA 1JRTA 2AIQA 1TOMH 2VIOA 1LO6A 3ELAH 4D9QA 3U8TH 2AGEX 1Z71A 5HM9A 3E91A 1DWBH 2D1JA 3BIVH 3L33A 2FWWA 1IAUA 3SQHE 2H6MA 5C1XA 1MTVA 4E7RG 4OS4A 1F0RA 5HKKD 4X2WA 4A92A 1GHYH 1MKWH 1XUGA 1KXBA 4Y0ZE 3ZZBA 2ANKH 1TQ0B 2GCHG 5FL7D 2R0LA 1K1JA 1SGPE 2VBCA 1SBWA 3RC5A 2A1DB 1EZXC 5DSFA 1DWEH 1LVBA 3LONA 4X8UH 5C20A 4O3UA 2KCOA 5I25A 4U30A 3M7TA 1VCWA 5AVDA 1C5TA 1MKWK 4D76A 5F03A 5TCCA 4AG2A 2BOHB 2QIQA 1FY4A 2ZZUH 5IDKA 1S5SA 3A8DA 4K1EA 2VWNA 5EXNA 5E0GA 4ZAEA 3RXDA 1SLWB 1K1PA 1V6DA 3OTPA 5BPEA 3HK3B 4KELA 2G5VA 3CENA 3PLBA 4FU8A 2NU2E 3FANA 4CRFA 2HWLB 3UIRA 3NRLA 1TRMA 4FUCA 1MCTA 1J8AA 4BAHB 3L6PA 1A5GH 4K3JA 1Z8GA 1PPZA 2XWBI 5GCHG 2Y6TA 2RA3A 1ZLRA 2GCHF 1JIMA 2H1UA 1V2QT 3F1SB 2OD3B 3FFGA 4KTUA 3TITA 5EOKA 2WINI 2KAIA 2BM2A 1OWJA 4AC9A 3RLWH 2H9EH 2TGAA 3C1KA 2A5KA 5ESTE 2AGIX 2BQWB 1PPHE 3RXVA 1ELVA 3RXCA 2A7CA 3LJOA 2TIOA 1W0ZU 1ANBA 1KIGH 3GCTG 1P2JA 4X2VA 1OS8A 2XTTB 1AFEH 4UFGH 4AYYB 4H6SB 1FPHH 7LPRA 1HGTH 5IK2D 4NSVA 1V2UT 2J5UA 2ZWLH 3RXIA 3MHWU 1Y5BT 2YMSD 1BBRE 1CA0B 1EUFA 1Y3YA 2Z9LA 1LPZB 4HG6A 4I7YH 4CHAC 1LQEA 4BTIB 2B8OH 3VPKA 3RXGA 3HGPA 1E37B 1UW7A 3NCLA 4ABJA 3RXPA 1QL7A 2GVFA 1ZPCA 3LOXA 5GXPA 3AAVA 5I46H 5GPIB 2FO9A 5C94A 1BTWA 1OWEA 1GJ4H 4YOJA 1TIOA 1EPTC 1GI7B 3JZ2B 3LT3A 5GCHF 1NFXA 1MQ6A 1OP2A 2XBYA 5DP3A 4YOIA 1P11E 4UE7H 3RXJA 1LHFH 2SGAA 2KZ4A 3BN9A 1TB6H 4K8BA 1C1NA 4I32A 4MPWA 3MI4A 4YLQH 1T8NA 1RIWB 1G32B 2V35A 2ZPRA 3MU0A 1VITH 1FONA 1GWAA 2TGDA 3LDXH 2ZG0H 4Y8YA 5DP4A 1TPAE 3RXFA 1WBGB 2W26A 1ZHMA 3F0PA 2QF5A 1GHAG 3GCTF 3MO6A 1GMHF 1O2VA 4ZKRU 1QRXA 4J1YA 3CS0A 1YLDA 4A1VA 1UK3A 4AX9H 2F9OA 2AIPA 1AVWA 1EKBB 2EC9H 2P95A 2BB4A 2HNTF 3LKWA 3OX7U 1ZPZA 1TYNA 2ZI2H 4FXGH 1KTSB 5C1YA 2WV4A 4RT1A 2J98B 4I31A 1FN8A 4FUFA 3ATKA 1O2TA 1S85A 2XBXA 3PRBA 4OM9A 3TGJE 4NWKA 1QA0A 5FCKA 1VCQA 3OEED 1DSUA 5EW1H 4Z0KA 1O35A 1CBWC 2XBVA 1GMCG 1ZTLA 3KL6A 1IQNA 2BY9X 3NPSA 5E0JA 3QK1A 2VGCC 3SUFA 2TGTA 1BMAA 1O2MA 1DWDH 1VGCB 1NM6A 3H09A 1EP5A 2GV7A 1BRUP 3JZ1B 1SL3A 1ETRH 1TLDA 3RXKA 4Q2KA 2J94A 4K69A 3SJIA 1SGNE 1ZJKA 1GMDG 2B7DH 2R3UA 2XW9A 1DWCH 3FO8D 1HAVB 1YKTA 2IJOB 1XUKA 3BTQE 1EPTA 3ZZDA 5IYTA 3ZZ5A 3A85A 5HIZA 2ZHQH 1AFQB 1SB1H 1GHAF 1Q2WA 1SGIB 1MABB 4AYVB 5F6MA 2ZO3H 1EFRD 1TA2A 3E8LA 7ESTE 5L2YH 4TWYA 1GGDB 1CT0E 1LHEH 1O2QA 3GCNA 4MVNA 4Y11E 1VKYA 1DXPA 2ZA5A 2P59A 4WF8A 4UFDH 1BITA 2R0KA 2GZ8A 3BTHE 1C5MD 4AB8A 1HIAA 3EGKH 1J16A 1H8IH 3A83A 1GL0E 1TMUH 5KECA 4XBDA 2CV3A 1IQLA 3RXSA 1GMCF 3VXEH 1ZMLA 1ZRBA 2WPMS 2HVYB 3R0FA 3STJA 1YPHE 2YNAA 3IWMA 1PPFE 1QQ4A 2ZCLP 3A89A 5EPYA 3T25A 4FVBA 2XC4A 3RLYH 2CMYA 3EA9A 1C1TA 1HXEH 1P05A 2ZGHA 1N1LA 3T27A 1C2EA 3UR6A 1ZOMA 3K2UA 3GYMA 1V2PT 3VXFH 1ELBA 4GHTA 3SGAE 3D62A 5ETXA 3SNAA 1XUHA 2B9LA 3TJNA 3FOAA 1V2KT 2R2MB 1DS2E 4TY7A 2KCYA 4PROA 1QJ1B 1SLVB 1SGEE 1A5HA 3LH1A 1D4PB 1SPJA 2OLGA 3MNSA 2O8WA 1O36A 3GY2A 4B6EA 3UR9A 5GIBA 1SGRE 1CU1A 1CSOE 4WXIA 4IN2A 1FQ3A 1TONA 1HBTH 2ASUB 2VIPA 3HK6B 2BDBA 1O38A 1YPMH 1SQRA 4Y6DA 1O3PB 4NWLA 1J9CH 1QCPA 1D3DB 3PMBB 4E05H 2CHAC 1TABE 3DT0H 2BZ6H 2JH0D 5DJ7A 1TAWA 1FXYA 1G30B 2KCPA 4WMDA 2Z3DA 3Q00A 2ZU3A 1NRNH 4YM9A 4YTAA 4GHQA 3P8FA 1LVOA 5FBEA 3PO1C 1LHCH 1E79D 1SMFE 2Y80A 1SOZA 4TSFD 2BDIA 2Z3EA 1HJAB 1LTOA 3URDA 3ATIA 2GMTB 1SFQB 1KMHB 1UMAH 4NIVA 1T8LA 1GHWH 1JXPA 2PKAB 1NO9H 3RXHA 2H2ZA 1NRRH 1IHTH 1GI5A 3RM0H 1GCDA 3TVJB 3UTUH 3K6YA 4AGJA 1ID5H 2I6QA 4B1TA 2PW8H 4I33A 5LH8A 2BOKA 4ISNA 4I8GA 1DOJA 1O2UA 4DY7B 1NRPH 2C93B 1ZSKA 1P9UA 3PMHB 3KF2A 3H5CB 5LPEA 1Y3XA 4Y7BA 3RU4D 4NA9H 2WPHS 4CH2B 1GBKA 2UUFB 1EP6A 1EZSC 4VGCC 5LPFA 3SU6A 4RKJB 1BOQA 4BNRA 5TJXA 3T28A 1BTXA 4TPIZ 1JWTA 1EOLA 1MBQA 1N6YA 2P3UB 3N7EA 1F0SA 1EASA 1TBRH 3QN7A 4INKA 1N8OB 3D65E 4JK6A 4ZH8A 3SHAH 3SNDA 1RGQA 2GD4B 2G52A 3BTME 2KX4A 3QGJA 1UVUH 1A3BH 3ZVEA 3EDXB 1MD8A 4XSKU 5G4BA 1ZJDA 4SGBE 4INHA 4I8HA 4FETA 1GCTB 1GG6C 1P01A 3RMLH 1YY3A 1XXDA 1HJ8A 1EQ9A 3NWUA 1TX7A 4DCDA 4XBCA 1V2VT 4X8VH 2V7QD 3QWCH 4O03A 1P2OA 5FPTA 1F5LA 2SGFE 3QO6A 3HGNA 1C2GA 3NZIA 2BDAA 1AUTC 5GWZA 5DP7A 3M37A 1KDQB 1UTNA 3A7ZA 3F9EA 4TY6A 3TNSA 1GI4A 2BZAA 5EW2H 3KQ5A 1GJ5H 1G2LA 3WWFA 2BY8X 2ZF0H 1UTOA 1AGJA 1UK2A 5A8XA 4LXBH 4X8SH 3LGVA 1OKXA 1P8VC 5L30H 3P6ZB 1G3EA 2OBOA 3SU5A 4Q7ZA 1S84A 2EEKA 4AFSA 1ZMJA 1ABJH 3AK5A 5CDFE 1HAHH 3A7VA 1KLIH 1OP0A 1QURH 1FN6A 3SGQE 1SLXB 3P70B 2P8OB 1C5ZB 5HGGA 1SHYA 1QBOA 1P2QA 3RXAA 1QB6A 1AB9B 1F92A 3OYPA 4MNVA 4LZ1H 1AWHB 5B6LA 2G55A 3N99A 2FYQA 1QBNA 4CREA 3E6PH 3A7WA 1TPPA 2WV9A 1P3EA 2Z9GA 4B75A 3LGYA 4KTSA 1D6WA 1VCPA 4Y8ZA 1ESAA 2OUAA 3QZRA 2WYGA 4X1SU 4BAKB 1QIXB 2C90B 1O3BA 4XBBA 3OEHD 1H9HE 6CHAB 1IQIA 4ABEA 4LOYH 4KTCA 4HZHA 2ZDKA 3EA8A 3PB1E 5FBIA 4ABDA 1MTNC 1UVPA 1VJAU 2ZHFH 2V3HH 3PM3A 1W8BH 1V2ST 2G4TA 2VVUA 5AF9H 2F3CE 3NUMA 1GVZA 2HALA 2W5EA 3VGCC 3RXQA 2FEQH 4TT3D 2EQNA 2GTBA 1AUJA 2BD8A 2SGEE 2ZGCA 5HMAA 1MMJN 1HB0B 3VB6A 2THFB 3I77A 3OE7D 1QR3E 1QB1A 5AFZH 1YP9A 2FODA 2ZCHP 4WWYA 3PYHA 7GCHG 1S83A 1B7XB 3UY9A 1O2RA 3U28C 4B2CA 1GBEA 1C1UH 2FOHA 1FI8A 2FOCA 1H8DH 1NU9A 4IMZA 1GBIA 1RFNA 5F8ZA 4RSPA 1ARBA 2HNTC 3PWBA 5FPYA 2YMSB 4XE4A 1RXPA 2GX4A 1CHOG 1P2IA 3DD2H 1A46H 4I8KA 2XRCA 4F48B 4KGAA 2Y7XA 4A1XA 2RFKC 1ANEA 1AMHA 2Z6BD 4E06H 2BX3A 2ZU4A 2BLOA 4ASHA 2ALVA 2VJ1A 1PQ8A 1BHXB 1FLEE 2XNDD 2CGAA 2ZFFH 2F43B 1ZYOA 2TRMA 3SNBA 3MH4A 3KYGA 1ELGA 8GCHF 3O8CA 4H42U 3BTKE 3ZZ8A 4CRDA 2WPJS 2OK5A 3F9FA 3MO9A 1C5WB 1TNHA 2AEIH 1QY6A 3HKIB 8ESTE 4TWWA 2BQ7B 2ZDMA
chains in the Genus database with same CATH topology
1C2KA 3TK9A 4ZKSU 1C4U2 1VZQH 3M7QA 4B2AA 3MU8A 3U69H 1ZTKA 1LPKB 1ELDE 4X2YA 2QF0A 4YESB 2JETC 5HM2A 1TNIA 2OC1A 5GJ4B 4FUJA 3KCGH 1MZAA 1V3XA 1CHOF 1AVGH 2ZDNA 2ZU2A 1CE5A 1HXFH 1MKXH 1O3LA 2W7UA 1O2OA 5TCAA 2ZTZA 1K28D 3A8BA 1SLUB 3MH6A 1ZPBA 4NIXA 2ILNA 2ZFPH 2BD2A 1A2CH 1LKAA 1GBHA 1QBVH 1ZRKA 1T4VH 3EYDA 1SR5C 1XXFA 4DJZB 4FVDA 1GI9B 3PLKA 2WPKS 1PPBH 3QTOH 1PQ7A 3GYLB 4Q7YA 4OS5A 1SVPA 1MKXK 2VWMA 2Q6FA 1PQ5A 1LCYA 1NU7B 2GCTB 4Q80A 2P3FH 2HRVA 4MPUA 3ZZ3A 1GJAB 3ZV9A 1INCA 2GDDA 3L3TA 1P10A 1W7XH 1NS3A 1W11U 1GI6A 3LU9B 2QXGA 1GHVH 4MNWA 3V7TA 3EAJA 4F4OC 5HXFA 1TGCA 5K7RA 2AMPA 1MTSA 1BB0B 2A5IA 2BLWA 4K60A 1O3GA 1QL9A 4BXWA 2P16A 3SJOA 1SGDE 3T62A 3MNCA 1MTUA 1GDQA 3IG6B 3KQBA 1CO7E 1IQEA 1KLJH 3P8GA 3NK8A 3UQOA 1O2WA 1BCUH 3V12A 5J4SA 2NU4E 1AZZA 4NSYA 2G4UA 3AAUA 4OS2A 1G36A 4B74A 1AD8H 2H9TH 1IQKA 1GI0A 3VB4A 1FY5A 3GY8A 1GMHG 2ZU5A 1WQVH 4KP0A 3BG4B 5PTPA 3UOUA 2QF3A 4D7GA 1EZQA 5EXMA 1O5GH 4D7FA 2SGPE 4I8LA 3K9XB 4JZEH 1O2GH 1CT4E 3V0XA 1W13U 1VJ9U 1O2XA 2GGVB 3RMMH 1O0DH 1UTKA 3M61U 1QHRB 3MTYA 2PUQH 2GZ9A 5E2PA 1NRSH 1WUNH 2FMJA 2Q6GA 3SU0A 1O2NA 8KME2 1C2FA 2AGGX 3U1JB 1MBMA 1C5VA 2ZFTA 1TQ7B 2Z7FE 1A0LA 4MNYA 2ZDVH 1QA7A 2BY7X 3C27B 5J4QA 1XM1A 3S9CA 4ISOA 1AQ7A 3BTTE 1C4V2 3BIUH 1ANDA 1EX3A 1NROH 3AVZA 1EB1H 3RDZA 1NTPA 2BYAX 3ODFA 1FY3A 2PUXB 1TX8A 4Y76A 1B5GH 5C67A 3GY7A 5E0HA 1KTTB 1O3DA 2VIQA 4DVAU 2VVCA 1QJ7B 1Z8RA 1O2ZA 1TWXB 6GCHG 1D9IA 1ELEE 3FZZA 3RXBA 4NFFA 1B0FA 2O8MA 9ESTA 4Y71A 3ZYDA 2D8WA 1O5DH 1BJUA 3BSQA 4K1TA 1C2MA 4HGCA 1Z1JA 1BTZA 3AW0A 3SUDA 4Y8XA 1D3QB 1CGJE 2GZ7A 3TGKE 9LPRA 1EB2A 1SSXA 2KAIB 4KKDA 1IHSH 1DXWA 3T2NA 1S6HA 3HPTB 1UTQA 1C2IA 1RS0A 3ZZ7A 3LC5A 4NZLA 2EI8A 2Y5HA 4GCHG 4LK4A 2OQ5A 1TGBA 3H7OA 2UUKB 5DP5A 1DVAH 2J9NA 4NG9H 1FAXA 1GDNA 3FAOA 2ZGXH 1C1RA 1G3BA 3F9GA 2B0FA 5FHTA 3STIA 1GCTC 3UNRA 4HI3A 3A86A 4OS7A 3KGPA 2WYJA 3GCHC 3RUOA 3LPRA 1MU8B 1O2YA 1TNGA 4DGJA 1C1SA 2PV9B 1TE0A 2XXLA 4DIIH 6GCHF 4GAWA 4U2WA 4WMFA 5EQQA 2BD7A 2IN2A 2ZHDA 1GBJA 2K1QA 1O3IA 2GV6A 1YPEH 1K1LA 2I6SA 5DG6A 1XUIA 2C3SA 4YT6H 1V2NT 4JZ1A 1E34B 3TK5A 1RTLA 5DP6A 2FI5E 3KEEA 2AERH 1AIXH 2D26C 2HPPH 2OTVA 2FTLE 4IMQA 1W0YH 2ZHEH 2HLCA 2A2QH 2ZPQA 3OTJE 3QTVH 4WY3A 4CH8B 4DIHH 2PKAA 4X2XA 5JDUB 2ZDLA 1S0RA 4GCHF 3RU4E 6LPRA 5T6FA 1K21H 2AYWA 4ABIA 1PYTC 4X6OA 2BY6X 1Z6JH 1NZQH 1SGYE 3ZVCA 1UVSH 3Q3KA 1YPLH 3AASA 4BAQB 3GDVA 1T7CA 1RTKA 1OYTH 1UCYH 3VB3A 1GJCB 2O9QA 5CHAC 1MTWA 4WVPE 2JH6D 5LPRA 3D23A 1C1QA 1C2DA 1OPHB 1O39A 1CGHA 3BEFB 1QB9A 5DKMA 1AWFH 1SC8U 2JKHA 1C4Y2 5A09A 2AMQA 3O8BA 2HOBA 4I8JA 3KQDA 3RXEA 1DANH 4CHAB 3R3GB 4WH8A 1UCYK 2OQUA 4UFEH 2F91A 3FZDA 2UWPA 3GDUA 3A88A 3I78A 1LDTT 1MCVA 2J95A 3ATLA 2DUCA 3W94A 1G9IE 4CRCA 1ETSH 3AW1A 1EPTB 1L4ZA 1MH0A 1IQGA 1L1NA 2CN0H 3Q3YA 1VITF 4CBOA 1KDQA 3EA7A 1WQSA 1ZSLA 3A8AA 1W12U 3CP7A 4NIYA 3UREA 3URCA 4BAMB 1AZ8A 2O8TA 3GOVB 1F7ZA 1ZTJA 3GY3A 1A3EH 1Q31A 3TGIE 1XMNB 1MAYA 2HGTH 2ZTYA 4OS1A 1TBZH 2PWXA 1TGTA 2BXUH 1HJ9A 1O3HA 1O5BB 1E35B 1O5CB 3BTWE 1ETTH 1QRZA 4ISIH 2IOTA 4X6NA 5EGMA 4JMYA 2HPQH 4CBNA 2VWOA 2CF8H 3PWCA 2P3TB 1GJBB 1HAOH 1P03A 1C2LA 2FTMA 4ZHLU 2FDAA 1MAXA 1CBWB 3UUZA 2WPLS 1A4WH 2A7JA 4K2YA 2VGCB 4M7GA 1V2TT 1SI5H 1C5SA 3MNBA 3UPEA 3VB7A 1XVMA 1HV7A 3ZZCA 1AKSB 1DLEA 2PKSC 3H7TA 4ISLA 4ZKNU 1ZMNA 2AS9A 3ZYEA 4A6LA 4NGAH 2W7SA 2PLXA 1IQMA 2ODPA 3S9BA 1O31A 3BTDE 3O8DA 1E0FD 1T4UH 1P06A 2A45B 1SGQE 2BY5X 4MG3A 3F6UH 3BF6H 5C1UA 1EAUA 4BTTB 1OWKA 3SU2A 3A80A 1D6RA 3MOCA 4U01A 4X1QU 1P57B 1Q3XA 4AB9A 1TBQH 3BTGE 1IQJA 1HAPH 4B71A 1IOEA 5A0CA 3B23B 3E0NB 3GDSA 1NFWA 2FIRH 4XOJA 1PPEE 3RM2H 3TJVA 1GPZA 1AO5A 4K5ZA 2Y5FA 1TALA 2FZZA 1DM4B 1ELFA 5C5OA 2TGPZ 4NZQA 1M9UA 1OWHA 3Q76A 2FPZA 2SGQE 1Z1IA 1THSH 1DUEA 2ZFSA 1GJ8B 2VIDA 3ZVFA 1K1NA 4FUEA 3MYWA 1E38B 1HLTH 1ANCA 1W7GH 5L6NH 2V6NA 5LGOA 1XKAC 4ABBA 1ARCA 2A0QB 1XUFA 4FU7A 4GSOA 1GL1A 3U8RH 1UHBA 1GI2A 1K1MA 4NIWA 4IC6A 8LPRA 3SBKA 4JZFH 2XBWA 1H9IE 3TH4H 2PSXA 3SV6A 1W14U 1FUJA 4J2YB 1C5YB 3SJ9A 1DFPA 4CR9A 4D9RA 1EAIA 4JZIA 2VIWA 5A0AE 1G37A 3PV4A 3NKKA 5A8ZA 2NU3E 1NESE 3E90B 4AFUA 1ZHRA 2QXIA 1A5IA 1GI1A 2ANMH 3U8OH 1NFYA 8GCHG 2PGQB 2F83A 1DX5M 2Z9KA 4X6MA 1C2HA 1FY8E 4ZXYH 2F9PA 3T29A 1GDUA 2Z94A 2HVXA 3UNSA 1YPKH 1FNIA 2FLBH 5EQRA 3TNTA 1JOUB 1YPJH 3TJUA 4QT8C 5F8XA 4WJG2 2CHAB 3ESTA 4HTCH 4IW4E 4ISHH 1CA0C 4ZHMU 2NU0E 1Z8JB 1OX1A 1O2HA 1TRYA 3QGNB 1MU6B 3SNEA 1F0TA 1HAXB 1Y5AT 1OWDA 3MU5A 4INLA 1CHGA 3V13A 2A5AA 1ELAA 1HFDA 1C2JA 1Y59T 3PO1B 2D2DA 2ZQ1A 1PJPA 2ANWA 1B0EA 1SGTA 2G8TA 1NFUA 2C8ZB 1KXDA 2ALPA 2W3KA 1DICA 1O2LA 3A87A 5T6GA 4Y0YE 4ZROA 3IITA 1FV9A 4HFPB 1RRKA 1KXEA 1UTJA 2ODQA 2V3OH 3M3SA 2ZCKP 2G51A 4FUHA 1O3KA 4MQAA 1J14A 1BT7A 3SI4H 1RIWC 4JZDH 3SNCA 2BMGB 1GBFA 3ODDA 2WUCA 1HAZB 2JH5D 2FOEA 3RXLA 2ZIQH 1KSNA 3SW2B 1GBDA 1BDAA 5T3HA 3GICB 1TOCB 3MMGA 4X6PA 2C8WB 3SV9A 2FI4E 4FUBA 2F9VA 4VGCB 2FOGA 1GHXH 3ZVAA 5FX6A 1S81A 3PMAB 1AI8H 3BEUA 4AZ2B 3I29A 5DPAA 1H4WA 4JYVH 1P0SH 2G00A 4WH6A 1JIRA 2BD4A 2BX4A 2UUYA 1GBBA 1GHZA 3SV8A 1P09A 1TPOA 1AN1E 2VWLA 1WSSH 2WUBA 1NRQH 2H9HA 1GG6B 4MPVA 3SU4A 2ODYB 1OXGA 4AOQA 1KXFA 1RD3B 1GJ6A 1BHXF 1BMLA 3ATWA 1HPGA 1FPCH 3M5NA 3UQVA 1YPHC 4AFQA 2STBE 5HYOA 1L1GA 1VGCC 2IPHA 2OBQA 3B8JA 2A31A 3OY6U 4CRBA 3TH2H 2Y7ZA 4R8TB 2SFAA 4ABAA 1ELTA 3SO3A 1THRH 3LC3A 4BXSA 2A7HA 1C1MA 1AFQC 3ZVGA 3SJKA 1YCPM 2OC7A 2ULLA 3T5FH 3A84A 3GISB 3O8RA 1SQAA 2BD9A 3BTEE 1JMOH 1PYTD 3M5LA 1ZGVA 4FU9A 1HDTH 1GGDC 3K6ZA 3LIWA 1HRTH 2R3YA 3PTNA 2ANYA 4YO9A 1O2SA 1S6FA 1L4DA 1GBAA 1UJ1A 4ABHA 1BZXE 2FOAA 5ABWA 2BLQA 1T8OA 2CJIA 1PQAA 3PTBA 3D49H 1K1OA 3QLPH 3K65B 3A7XA 3UWIA 3SN8A 1S0QA 2FX6A 4ABGA 4AG1A 2A4QA 3RP2A 2H5DA 5JB9S 3TH3H 2PTCE 3S7HB 1HYLA 2RDLA 4Z6AH 3M35A 1EJMA 1Y3WA 2BQ6B 1FDPA 1W3CA 1MTNB 2SGDE 3FP7E 3M5MA 1C1OA 1F0UA 1UVTH 1WU1A 1MZDA 3M5OA 4RN6A 3RXOA 4ZXXH 1W2KH 5CMXH 4Y10E 1YGCH 1SQOA 3VGCB 5AHGH 1HUTH 2TPIZ 4OS6A 5A0BA 3KQEA 5EXLA 2C8XB 1O2IA 5E2OA 3SU3A 4O3TA 3TK6A 4UD9H 1UK4A 3DFLA 3A7TA 3MU1A 1XVOA 2BVXH 1ESTA 3ITIA 1J17T 5BRRE 1D3PB 1JRSA 1HAVA 1TGSZ 2OXSA 2RCEA 4K1SA 4R0IA 2VNTA 1SFIA 3PROA 1Z8IB 2FOBA 4AORA 5F8TA 2FM2A 5JB8S 1G2MA 3SV7A 1TFXA 1ZZZA 2F9NA 5JBTA 2Z3CA 3W95A 4GLYA 3M36A 1GVLA 1MD7A 4IN1A 4TYDA 2R2WU 1BUIA 3SI3H 3ZZ9A 2R9PA 2B5TB 2V0BA 1DE7H 2FOFA 3QUMP 5JYIA 4OGYA 3U9AH 4MLFB 4Y79A 2BD3A 3SUEA 1H1BA 3DFJA 2A2XH 5L2ZH 3ATMA 4X1RU 4AN7A 5FX5A 5EG4A 1BMNH 1NT1A 1C5NH 4MDSA 2OINA 1DY8A 5ESBA 1UTMA 3Q3XA 2A4GA 1ZR0A 1HJAC 1DSTA 4DW2U 2H5CA 3SORA 1C5OH 5DO4H 2GMTC 3SUGA 4JK5A 2WV5A 3OU0A 1YM0A 1SOTA 5T6DA 1RJXB 1GI3A 4UFFH 2XCNA 4CRAA 3ENSB 1BTYA 3VFEA 2ZGJA 1K22H 3RMOH 3TPIZ 1DLKB 1LHDH 1QGFA 1ORFA 1ZSJA 1LVYA 1O37A 1TGNA 1O2KA 1V2MT 1G3CA 4DURA 4UEHH 1YYY1 5FXLA 5AFYH 3GY5A 5FPSA 3E16B 1O3FA 1TA6A 1AHTH 2J2UA 4AGKA 1GI8B 3BG8A 2DE8A 3GCOA 2HNTE 2JETB 1C5UA 5DK1A 1L0ZA 2QA9E 2BDYA 3E0PB 2BVSH 1N8OC 3CS7A 5FCRA 1FIZA 1GBCA 1OOKB 2AMDA 1LQDB 2ZEBA 4WXVA 4TPYA 4YLUA 2YOLA 3QZQA 1YC0A 2BTCE 4O97A 1C9PA 1H9LB 5EODA 1FY1A 1BRCE 2VU8E 2BHGA 3TU7H 4B73A 1HNEE 1CA8B 4H6TA 2YNBA 2XNIA 2FX4A 3HATH 5JBBS 1V2OT 2PHBA 4BTUB 1LKBA 2ZGBH 4UDWH 1SG8B 2GDEH 2UWLA 1C1VH 1OP8A 2LNCA 2Y5GA 4GVUA 1T31A 2EA3A 3Q77A 3VB5A 3OSYA 1FIWA 1T8MA 4YT7H 2GKVE 1BA8B 1G3DA 4JYUH 4YZUA 1SGCA 1C5PA 1KXCA 1TPSA 4FUDA 1C9TA 3T26A 3P17H 1O3OA 2F9UA 2Q1JA 4ABFA 3EE0B 1UO6A 3FVFB 4XDEA 2Y82A 1C5XB 1VITG 1WCZA 1QRWA 1L1JA 3RC6A 4MTBA 2FS9A 1GHBG 2P8OC 1SQTA 2QC2A 1XKBC 1AB9C 1C5LH 2J38A 1DY9A 3ZVDA 1K1IA 2QGRA 1TNKA 1AE8H 3LGIA 1O3MA 1O32A 1O3EA 1V2JT 1TRNA 4NA7A 3F9HA 5EU8A 2QAAA 1FMGA 1EZUC 4B76A 2A32A 1LHGH 3M3TA 1NY22 3DHKH 2OC0A 2PSYA 1AY6H 5H4IB 3TLOA 5C3NA 1NPMA 1BRBE 1GMDF 1NC6A 1BTUA 3FP8E 6CHAC 2BVRH 1K2I1 2ESTE 1EAWA 2QXJA 3MO3A 3ZZAA 1O5EH 2M5TA 1QQUA 1EXFA 2Z9IA 4ZHAA 1AKSA 3OY5U 2DE9A 1UTLM 2NU1E 1WAYB 2ZC9H 1KY9A 1Y3VA 3SGBE 3NXPA 4A7IB 4DG4A 3P95A 5DGJA 4ZUHA 2VINA 2XC5A 1O3CA 1YPGH <