2KZ4A

Solution structure of protein sf1141 from shigella flexneri 2a, northeast structural genomics consortium (nesg) target sft2
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
112
structure length
112
Chain Sequence
MNIGRLRDRITIQTLKQTRDITGEILETWEDGHTLWASVNMVSSKEAISSGAELAIGTVRIWIRYRKDINATSRIKVSTGPLAGRVLNIIGQPLPDAARTRLEILCREGAEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative head-tail adaptor
publication title Solution structure of protein SF1141 from Shigella flexneri 2a
rcsb
source organism Shigella flexneri
molecule tags Structural genomics, unknown function
total genus 11
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2010-06-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.270 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2kz4A00
2KZ4A 2KCAA
chains in the Genus database with same CATH superfamily
3GDVA 1FUJA 1XUKA 3MH6A 2FYRA 1EZXC 3N7OA 2J98A 2YMSB 3ATLA 1BRBE 2CJIA 1YPKH 4DW2U 1BTHH 4Q7XA 1K1OA 2ANMH 3ODFA 4JK5A 2ZG0H 1K1NA 3GISB 1SGPE 3O8CA 1G3CA 2GJGA 4CRAA 3TH2H 1YYY1 1O3GA 2VWMA 3F0PA 2BD3A 1C9PA 1TRYA 4JZDH 1ZJDA 1IQLA 4CRFA 4AB9A 1FLEE 4AFSA 1THPB 2HGTH 3QWCH 1PQ7A 1K22H 4FUIA 2UWOA 2ZFTA 3S9BA 3MHWU 3LH1A 1V2VT 3ZV9A 1DY9A 3C27B 1EPTC 2AS9A 2VNTA 2ZFPH 5JBTA 3MQKC 1OP0A 1ZJKA 1O32A 4TY6A 1DOJA 2V3MA 2ZGJA 2BDIA 5F8XA 4MTBA 1QJ1B 3SN8A 1QBVH 1BHXF 3ZYEA 1P03A 1GDQA 4MQAA 4TSFD 1O38A 1BTUA 5C20A 1DANH 1B5GH 4NSYA 1UVSH 1V2ST 2WPKS 1Y59T 4UFFH 5C5OA 4B75A 2KAIB 1GHYH 2A2XH 3SUGA 1SGTA 4XSKU 2CXVA 1C2HA 2QXIA 2GMTB 5J4QA 4I8GA 1U6QA 2ZU5A 3F6UH 2NU2E 3E90B 1WBGB 1CGHA 2ZTZA 1AD8H 1TBZH 4B2BA 1G32B 1O3EA 2OBOA 2BMGB 1C5RA 2XNIA 1DWEH 5T1VA 3RXIA 4ZMAH 4Q80A 1TLDA 1FY3A 3MU5A 1A0HB 2HLCA 1W11U 1GI4A 2Z3DA 2FESH 2JIZD 3D49H 5C1XA 1AVXA 4BTUB 1O2HA 4RSPA 3GY8A 1C1QA 1C1RA 4ISOA 1L1JA 1UK2A 4M7GA 5DJ7A 3SORA 1C1VH 2H2ZA 3D62A 1H8HD 2JH6D 1O3JA 2C8WB 1LHEH 2GT8A 4I7YH 3NXPA 3SU0A 4BAMB 4NFFA 4ZH8A 3P8GA 1SQOA 5EXNA 1SLWB 1ZSLA 5A09A 2ANKH 2DE8A 4M9FA 1GCDA 2JETC 1NPMA 3PYHA 1F0UA 1OPHB 2H6MA 1QNJA 2F9PA 3MH7A 1YGCH 1Y5BT 2CK3D 1O3NA 2OBQA 2KCAA 4NWLA 5DP9A 5G4BA 2FI4E 1ZRBA 2AMQA 4KGAA 4JYUH 5EU8A 2C8YB 3RXBA 1HDTH 4RT1A 5TJXA 1DSTA 3P70B 1P8VC 3GY6A 4DGJA 3D65E 2FP7B 4R8TB 4Y10E 1BUIA 3M7TA 4ABJA 1UTOA 1T32A 1F0TA 3N99A 1O2UA 4AFZA 4DVAU 3ZZ3A 4Y79A 3RXDA 3RXMA 1DPOA 3BEIB 3DSOA 4X2YA 2AGGX 5C2ZA 2BY8X 1H8DH 4NIXA 1GBMA 1XX9A 4ESTE 3UR9A 1CA8B 2SNVA 4NIWA 1EPTB 1S0RA 1TA2A 2AYWA 1NESE 1MZDA 3ENSB 3UY9A 2OTVA 1O2YA 5A8YA 2OLGA 2OQUA 3H09A 1QJ6B 3VPKA 1Z8RA 3M37A 5AVDA 3UNQA 2Q6DA 3LONA 1C5OH 5A2MH 2Z3EA 4ABEA 3ZZCA 2SGDE 1FQ3A 1AU8A 1SGCA 1GI5A 1NTPA 1P0SH 3O8RA 3S7KB 2ZDKA 1T4UH 3RC5A 1AQ7A 1YM0A 3DD2H 4FUFA 5F8ZA 1PQ5A 1O3FA 4MLFB 1QA0A 4WH8A 2AH4X 2Y6TA 4ZHMU 3F9EA 2PGBB 2BD7A 4B2AA 2B5TB 5DK1A 1WDIA 3QLPH 3AAVA 3QK1A 1VJAU 1O35A 1P2MA 2VIPA 4U2WA 3KYFA 3T2NA 1NRRH 3QDZB 3UAIC 1P01A 1SL3A 1O2NA 1NRQH 1TB6H 2C93B 3R0FA 8ESTE 1D4PB 1ZHMA 2VIWA 3F2HA 2H1UA 1QIXB 1GBDA 1SGFA 1C2GA 4E05H 4A1TA 4YOGA 2F9UA 4X8SH 2P3TB 1GBHA 1RRKA 1EOJA 5LGOA 1O2TA 1IQFA 1ELGA 1O2JA 4B6FA 2ASUB 1G3EA 1C2MA 2HVYB 1SI5H 2JETB 2ZGBH 5GNDA 4OS1A 2SGEE 4ZKRU 3A86A 4NA8A 1F0SA 2J2UA 3SNAA 1L1NA 1GBJA 1YPGH 1WAYB 2SFAA 5GDSH 1RFNA 4A5TS 2XBXA 1CHOF 1TPPA 1NN6A 2W26A 4O9VA 5L6NH 3RXCA 1F5KU 4I8HA 1JIRA 3A88A 4A92A 1GJAB 2ZGCA 1Y3UA 4LZ1H 1TPSA 2FLRH 1GHZA 1SG8B 2ZTXA 3RXOA 3VB3A 4CBOA 2Y82A 1LHFH 1Z6EA 3GICB 1IQGA 8LPRA 5DGJA 4NIVA 1EX3A 2PSXA 1MABB 1SGEE 3RC4A 3TK6A 1ACBE 1C5YB 4NA7A 3A7VA 1KXAA 3PMHB 3FVFB 1V2TT 2W5EA 4P02A 3TH3H 3EA7A 3U8OH 3LC5A 3VXEH 1Y3YA 2B0FA 2ZF0H 2ZP0H 2FI3E 1Z8GA 2GCHG 3SJOA 1H8ED 3LC3A 1ELEE 1MTSA 1LPGB 3M3VA 1O3HA 2W7SA 1YWUA 3RU4T 2LELA 4Y7BA 5FBEA 3ZVDA 2FTMA 1S6FA 4FUEA 1C5LH 1WCZA 1P11E 2TPIZ 1ZYOA 2FPZA 3GCHC 2P3FH 2KCPA 4I8KA 1GI1A 3DA9B 2HWLB 4MPUA 1KXEA 2SGFE 1YLNA 2SGPE 1YCPK 4UFEH 3BTQE 1GBLA 2NU1E 2FOHA 3GYLB 5T6DA 4HFPB 2ZCHP 3PV2A 2XXLA 4X0WU 2Z3CA 5DP5A 1HB0B 2Z9IA 1BB0B 2O8TA 4HG6A 1FAXA 2R0KA 1C2JA 1BMNH 1ID5H 1O5DH 2K0QA 3ATKA 4FU7A 4P00A 1GHBF 4B2CA 1LVMA 1NROH 5CHBA 4YLUA 4FXGH 2V0BA 1W0YH 1C2FA 3U28C 1GHAG 1O3IA 5DP8A 3QTOH 2OC7A 2EI6A 2P95A 1A3BH 4FUDA 5C1YA 3EYDA 2BLWA 2ILNA 4NIYA 5T3HA 1AZZA 4YO9A 1TNGA 1CGJE 1VITG 7GCHF 1GBBA 3M5OA 1XUFA 3ZZ6A 1C5ZB 3SV7A 1A1RA 1UVOA 1GJ8B 2EQNA 1VGCC 1OS8A 1HAGE 2W3IA 3FKSD 1IAUA 2Z9JA 5L2YH 1HCGA 2PHBA 3QGJA 3GY4A 3BTGE 4AYYB 1L4ZA 5T6FA 4CRGA 1XUHA 1ARBA 2J95A 4ZCNA 1FDPA 4FU8A 1TOMH 4O03A 2GTBA 1QRXA 2XNDD 1UW7A 1SGFG 1IQHA 1E1QD 1OX1A 3UREA 3Q3KA 4ZXYH 1KIGH 1ZZZA 8GCHF 2V6NA 2I6QA 5GCHF 5FPSA 4VGCC 4TPIZ 1P3CA 5DKMA 3BG4C 1P2KA 3TGIE 4FU9A 1SFIA 1NS3A 5EODA 4K60A 1GL1A 2H5CA 1WU1A 3QN7A 1NFWA 1MZAA 5E0GA 1J14A 3RXRA 1XUJA 1KLJH 2OQ5A 3K65B 1YCPM 3Q76A 2PFEA 2WPIS 1GJ7B 1W0KD 1THRH 3SU5A 2F9BH 1Y8TA 2JJ1D 2ZDNA 3RXEA 1GVZA 2Z94A 1O36A 1D9IA 2Z7FE 2FOFA 3S69A 1HRTH 3S0NA 3GCHB 4FETA 1BIOA 2OC8A 2Y7XA 3PWBA 1TX8A 4TWWA 1PPBH 2BVSH 2Y5FA 1Y5AT 3U1IB 4X8TH 3PB1E 4AX9H 1A0LA 1FI8A 1W13U 2R0LA 1W14U 1GG6C 2M2AA 1IHTH 4NA9H 4XD7D 1ELDE 1T31A 1AVWA 5EG4A 2GX4A 4WH6A 3FFGA 1GJ9B 1TGBA 1PQAA 4XBDA 1S0QA 2CF9H 1GMHG 7ESTE 1V2PT 1Y3VA 4IN1A 4Q2KA 2A5KA 1OWHA 1C5VA 1ABIH 1DWCH 5SGAE 3VGCC 3NZIA 2ZZUH 2PKAA 6GCHF 2IPHA 1QBOA 2ZPSA 2KZ4A 2B9LA 1N6XA 1HAPH 4Q63A 4CRCA 2Q1JA 3BTEE 1EZQA 4YOJA 5JB8S 4DIIH 3CS7A 3GCTG 1L4DA 1AKSB 1PPZA 1GMDF 1GGDC 1BTPA 4Y8YA 5GWZA 1VGCB 2PW8H 3MNCA 1CT4E 1FXYA 4ABGA 1C1MA 3EDXB 2AIQA 5E8EH 1QCPA 1P9SA 1GBCA 2DUCA 4IMZA 4H6SB 2GDDA 1MAYA 1TNHA 1VCWA 3U8RH 1MTUA 1Z8JB 2C8ZB 5FHTA 3KN2A 3SNBA 1DY8A 2A4OA 1HIAB 2L74A 1E36B 5DO4H 1O0DH 2G51A 1C2LA 3BIVH 4GHTA 1ESAA 1Z7KA 1GHWH 1G3DA 1EFRD 3FP7E 4VGCB 4KTSA 3BG4B 2OC0A 1UCYH 2QV1A 3F3BA 3P6ZB 5HYOA 3SZEA 1Y3XA 1PPGE 1ANBA 2VWNA 2G4TA 3EQ0H 4X6NA 1Y5UT 1MAXA 2R2WU 2ZDVH 1O3LA 1ELCA 1LPKB 2FEQH 2ZFSA 3DHKH 3MO9A 1MD8A 1QGFA 1ZRKA 1AWHB 3KIDU 3VG8A 3ZVAA 1P10A 1G37A 3LPRA 3A7ZA 4H6TA 2ZKSA 1TMUH 2JKHA 1QZ8A 1TYNA 4X1NU 3E91A 4WY3A 4LK4A 4F55A 2J4IA 1K1LA 4UDWH 1GG6B 1GHBG 1SVPA 2JDID 3UOPA 2WV5A 1AFEH 4ISLA 3RLYH 4Y11E 2A4RA 5KECA 2ANWA 2KAIA 4F4OC 3RP2A 1FY4A 3FZDA 3VGCB 3GS9A 3A83A 2ZFQH 7GCHG 3LGVA 4NFEA 4WJG2 1V2KT 2BTCE 3SV8A 1JWTA 1UHBB 3AVZA 4CHAC 2GVFA 2AEIH 3FO8D 1GI8B 1ZMNA 3BIUH 3TIUA 1D3DB 1GI0A 1NU9A 2A7CA 2WPHS 4K1SA 2BDAA 1GJCB 2QN5T 2BD4A 1QB6A 4DG4A 3TK5A 1RS0A 1GI7B 1GGDB 3A8BA 3OE7D 1SGDE 1YLCA 3OSYA 4IW4E 3P8OA 3TGJE 3K9XB 1TGNA 2WUCA 2QC2A 2VH6A 2WV4A 2ZCLP 2C4FH 4ACAA 3TITA 2AHME 3EE0B 1ZPZA 2KCYA 3RLWH 2TIOA 1GI2A 1GPZA 5JBBS 1TX6A 2BLOA 5B6OA 3U8TH 1KTSB 2VBCA 3LT3A 8GCHG 1WV7H 4X2VA 1AGJA 2GT7A 1ZLRA 4INLA 5GCHG 3T25A 1HLTH 3SJ9A 1WTGH 2VIQA 1BOQA 2G81E 4KELA 1TGTA 2CGAA 2FOEA 4DJZB 1P02A 5FCRA 3QTVH 2KCOA 3VFEA 5A8ZA 1SLVB 3LOXA 1O2LA 1TX7A 1MMJN 1LPZB 1W0JD 3PRDA 2FXRA 4ABIA 2OCVB 2R3UA 3GOVB 1S6HA 3A82A 1QQUA 3EE7A 3KNXA 2C3SA 4AGJA 5HMAA 2WV9A 1FIZA 1UK4A 1A4WH 4U01A 1WOFA 3TNTA 1ZTLA 3WW7A 4WMFA 1HFDA 3MNBA 4BAKB 1B0FA 1TQ0B 1OKXA 2PUQH 4GCHF 1GI3A 2G5NA 1TMTH 1H9IE 1VR1H 1YPEH 3CP7A 1UVUH 3GY5A 3PM3A 5IYTA 1HGTH 1TOCB 1H1BA 3T29A 2CHAC 1V3XA 4U30A 3MH4A 1EPTA 2ZHQH 1XMNB 1P57B 3QX5H 5I46H 2CF8H 1H9LB 2LNCA 5EQQA 2Z9GA 2Z9LA 3JZ2B 1HXEH 5EXMA 3SU4A 3T26A 1C5WB 2P3UB 1QL7A 1GMCG 3SUEA 1BBRH 3UTUH 3H5CB 2FOMB 4XBCA 3HGNA 3M36A 5EXLA 2J98B 1GMDG 4K8YA 1LVYA 1V2QT 1QTFA 1X7AC 4I8LA 4AORA 4CHAB 1V2UT 4O3UA 2IJD1 4DY7B 1DVAH 3AAUA 1SFQB 1TONA 2HNTE 4GAWA 3RXLA 1C2EA 1T8MA 3GY7A 5C1UA 2D26C 1EAXA 5CDFE 1ABJH 3DSGA 3T28A 1DICA 1SGQE 5DG6A 4XE4A 1DT2A 1BJVA 3E0NB 1A46H 1V2RT 1ARCA 2GZ7A 2FYQA 4DCDA 1A5HA 1LKAA 3NKKA 4ZKOU 1E0FD 3C1KA 2IJOB 2J94A 1GWAA 3PV5A 4K8BA 1UVTH 2A0QB 1D3PB 4NCYA 4BTTB 2B7DH 3SV9A 2BYAX 3E3TA 5JBCS 3UWJH 3SJKA 3ZVBA 3IWMA 3OU0A 1P3EA 3HKIB 2ZGXH 5EJ1A 5FCKA 3MTYA 3HPTB 2VH0A 1PPHE 2D8WA 4B74A 1SLUB 3W1EA 3DCLA 1F5RA 2ZDAH 6ESTA 1ELAA 5EOKA 4FOUC 3SOSA 4NSVA 1C4Y2 1MKWK 1O3CA 4AOQA 1ZPBA 1W7XH 3L3TA 1O2RA 2A45B 2KM0A 3TU7H 1AO5A 1C5MD 2WSSD 1O3AA 3MFJA 5DPAA 4TWYA 1MBMA 2GV7A 2CMYA 3A8CA 1C1TA 1O2ZA 3F9GA 4Z1MD 1EJMA 3MYWA 1GI6A 2P94A 5TCAA 2O8UA 1V2NT 6CHAC 1ETSH 4ZUHA 3SYJA 4ZXXH 1UMAH 5FXLA 4HTCH 3VXFH 5JYIA 1EZSC 1AMHA 2CHAB 2ZA5A 3MNXA 4JYVH 1JBUH 4RKJB 3RXKA 3ESTA 1EQ9A 1TBRH 1TIOA 1EZUC 2BDGA 2QY0B 3VB6A 3UB0A 3UIRA 3OEHD 1TBQH 1LHGH 1C4U2 2Z9KA 1RIWC 4MNXA 1MQ5A 3UWIA 4A1XA 1SC8U 1TPOA 5C0TA 1LVOA 1OXGA 1ANDA 7LPRA 5EPNA 1MU6B 2DE9A 3SV2H 3BV9B 5HM2A 3LDXH 3S9AA 4JZFH 3HK3B 4FUGA 1CVWH 1MTVA 2V3HH 1YPHE 2A31A 5E2OA 3F1SB 1OWDA 1S85A 3SU3A 1ZMLA 1M9UA 1QY6A 2Y5HA 4X6PA 4ZKNU 1IHSH 3T62A 1PYTC 5F6MA 1SGRE 3P8FA 3U69H 1T8LA 3WY8A 4ACBA 9LPRA 2OK5A 5ABWA 9ESTA 1ZHPA 3F9FA 1O2IA 2J38A 5IK2D 2QXGA 1ZTKA 2B8OH 3N7EA 3ZZBA 1WQSA 2BDCA 1NZQH 4MVNA 1OWEA 4YM9A 1MKXH 4YESB 1NFUA 4I8JA 1ESTA 1AE5A 3KGPA 1J16A 2PR3A 3E16B 2BY9X 3OEED 1O31A 1EATA 1SLXB 2NU0E 1TNIA 1G9IE 1GJ5H 1AZ8A 1G2MA 1V2LT 2ULLA 3BEFB 3G01A 3RXFA 1HAHH 1AY6H 3FOAA 3DFLA 1C9TA 5B6LA 1OWKA 5DP4A 2VIOA 4NZLA 4ISIH 1CHGA 4ZHLU 1BITA 5T6GA 2XTTB 2GCTC 2WPDD 2WINI 5J4SA 2UWLA 5EPYA 3GCOA 4GCHG 4TPYA 1YPHC 3FAOA 4CR5A 4SGAE 3KQCA 1C5TA 3SW2B 3FN8A 1O5BB 1AE8H 2GGVB 1RXPA 1E38B 4GVUA 4ZAEA 5C94A 1HXFH 1O3KA 4ABHA 2ZGHA 4OS6A 4DT4A 3L6PA 6CHAB 4RI0A 1ZHRA 1QFKH 1C5UA 2VGCC 3M5LA 2FZZA 1E37B 1P12E 3NUMA 3M3TA 3RC6A 3HKJB 3ZVCA 2JJ2D 1XKAC 1FONA 1Q31A 1SR5C 3RMNH 1TNLA 4GPGA 5FX5A 3SHCH 1KY9A 1J8AA 1RIWB 1SBWA 2WPLS 2EI7A 3QO6A 1F0RA 2BOHB 4FUBA 2PGQB 4SGBE 5FX6A 4I86A 1BMMH 1ZSJA 4CREA 1W7GH 1A2CH 2XC5A 1QJ7B 2V35A 4IN2A 2ZHDA 1UTJA 3ZYDA 2O8LA 1P2IA 4QT8C 1ELBA 1ZMJA 1TQ7B 2A5AA 3VEQB 1WUNH 1SMFE 1T7CA 4KP0A 5A0BA 3F9HA 3SJ8A 3TK9A 2WYJA 3VB7A 2NU4E 4ISNA 1JIMA 4XFQA 3SUFA 4DT7B 3A80A 1DWBH 3ATIA 4Y71A 5A0CA 1WYKA 4X2WA 1P04A 4LOYH 2EI8A 1ZR0A 4UONA 4DURA 1V2MT 1W3CA 2KFWA 1SKYE 2UUYA 4I31A 2Q6GA 3M7UA 2XW9A 1PFXC 2TBSA 1GJBB 2GZ9A 1VKYA 1KTTB 2HOBA 3MI4A 3GY2A 4UD9H 3MU8A 1HYLA 1FIWA 1HAVB 4FUHA 4ISHH 3OTJE 1YY3A 2BDHA 2FMJA 1NO9H 2ZCKP 2AMDA 1EJNA 1YP9A 3A85A 1AKSA 1O2WA 1UTPA 1BTYA 1GVLA 1TGCA 4Y0YE 4IS5A 5GIBA 4CH2B 4E7NA 2UUFB 2BX3A 2QXJA 4K2YA 1Z71A 1DE7H 1S81A 1IQMA 2F83A 2A2QH 2ALPA 4INHA 4DOQA 1D3TB 1T8OA 5HM9A 4Y8XA 2Y80A 3MO3A 1T8NA 1DITH 2J9NA 1N8OC 4OM9A 1GI9B 2BD9A 1P09A 4XOJA 4Q7YA 1CU1A 2JH5D 1GDUA 2HVXA 1HIAA 2ZDLA 1GBIA 2VGCB 3JZ1B 1XXDA 2A4GA 3B23B 2CV3A 1EP6A 2ZU3A 4WXIA 1E35B 1G36A 4ASHA 3UNSA 2PLXA 1SHYA 2BD2A 5HIYA 4GHQA 2FWWA 3MU4A 4CRBA 1HAYB 1DFPA 2VINA 2LP6A 5L30H 1O3BA 1ETRH 1A7SA 3TNSA 2ODQA 2XBYA 3E8LA 3PV4A 3W95A 2BZ6H 3NPSA 1GVKB 4IBLH 1JMOH 3RMOH 1GHVH 3A84A 3LU9B 1MBQA 4AG1A 1JOUB 2BD8A 4R0IA 2UUKB 4B73A 1YCPH 3BTTE 4JMYA 1P9UA 4K3JA 2H5DA 2ZU4A 1OWIA 1CHOG 3PTNA 3RDZA 3V3MA 1Z8IB 1PJPA 1ZOMA 3O8DA 3RXHA 2NWNA 2TGTA 2VU8E 4Y0ZE 4UE7H 4X6MA 4OS4A 2Q6FA 3BTFE 3QUMP 1SB1H 3RXJA 1S6LA 1ELTA 1H8IH 2ZNKH 3STIA 1INCA 1UJ1A 2BY6X 3M5MA 3OAAD 2D2DA 2A4QA 1DLKB 1C1NA 4MDSA 1PYTD 2XC0A 1WQVH 1FJSA 4MPXA 5IDKA 3SU6A 2QXHA 2XYAA 1DLEA 3I78A 3LJJA 5DP7A 3SGAE 2F4LA 3KHVA 1TAWA 2BXTH 5JB9S 1GCTC 2YMSC 4KTUA 5E2PA 1QB9A 5E0HA 3D23A 2PUXB 3OFND 2ZIQH 3V7TA 4OS2A 3Q77A 1B7XB 1GBKA 1SOTA 2TGPZ 4D9QA 5LH8A 3PLKA 3KYGA 4I32A 3LGIA 4X1RU 4K5ZA 2VVUA 1S84A 3LGUA 1O5GH 2FX6A 2HLDD 1C1OA 4AYVB 1C1UH 1EAUA 3TH4H 1HAOH 2VWLA 3MO6A 1N8OB 2BVXH 1FX0B 5GJ4B 1EB1H 2HRVA 1EASA 2KR7A 1O2KA 1SQTA 2GD4B 1DXPA 2GP9B 3KQDA 4FUJA 2BQWB 4CBNA 1O2PA 1NRNH 4TYDA 1MH0A 1CSOE 1CT2E 2IPQX 3RXSA 1SQRA 3FZZA 1DWDH 2FOCA 1S5SA 4JYTA 2ZTYA 1PPFE 4BXWA 1A3EH 1BRCE 2UUJB 2G5VA 1E79D 4JK6A 1AWFH 1BTZA 1QA7A 3MMGA 1LO6A 4A6LA 1V6DA 2TGAA 4K69A 1UVPA 3VB4A 1CGIE 3GY3A 2PKAB 3F2FA 1Z1IA 2AMPA 5JDUB 1ELFA 1CA0C 3DSPA 4FVDA 4YOIA 1K1PA 4AZ2B 4J2YB 3GCNA 2XCNA 5GXPA 3M5NA 1NFXA 1O3MA 3PMJA 5K7RA 1F7ZA 4HI3A 4MPVA 4IC5A 1FV9A 4XDEA 2OC1A 4Y6DA 1FZZA 2ODPA 2ZPQA 4D9RA 3U98H 2ZEBA 4JZEH 1GDNA 1O2XA 3SNCA 4TY7A 1O3PB 4ABBA 3ZZAA 1XUGA 4BTIB 1UK3A 2VJ1A 3SQHE 1J17T 1LKBA 1FNIA 3RUOA 1YPLH 3UR6A 4MNWA 5DP3A 3SQEE 5AFZH 1NC6A 1K0HA 1GCTB 5I25A 2A7HA 2FS8A 1V2OT 1YPMH 3BEUA 4MG3A 5DSFA 3ZZ7A 4DIHH 1SHHB 1O2GH 2O8WA 3AW0A 1EXFA 3S7HB 3ZZ9A 2G00A 2QE7D 1C1PA 1WTHD 1JRTA 2QF5A 2H9TH 1SPJA 4BOHA 5K0HA 3H7OA 5EJZA 2HPQH 1XKBC 1DSUA 1AUTC 4ZHAA 1KDQB 1VZQH 2P59A 1THSH 2YOLA 1CBWC 1HBTH 3I29A 1C5SA 1W12U 3HK6B 2QCYA 2RA3A 4U32A 4H4FA 3RXTA 1A0JA 3RU4E 3AK5A 2THFB 3WWBA 1L0ZA 4ABDA 3RXQA 1WSSH 1JXPA 3NWUA 1NBMD 1AB9C 4HZHA 4AN7A 1BTWA 1RTFB 2TRMA 2UWPA 2BOKA 2BY7X 1IQJA 3B8JA 3PO1C 3EA8A 1ZGVA 2XOKD 2G4UA 3N7DA 1LHCH 3SJIA 4TT3D 1XVMA 4FUCA 2VWOA 3P8NA 3HGPA 4E06H 6GCHG 1LHDH 2PKSC 1IQIA 1O5EH 1TALA 2GCHF 3NK8A 1O5CB 2XRCA 1F92A 3BF6H 1G3BA 3A89A 3UQOA 2WUBA 1Q3XA 4AFQA 1OP2A 4D7FA 2F9VA 1CA0B 1KXCA 2QIQA 5AF9H 2K8IA 1N6YA 2G8TA 3P95A 1O33A 1W2KH 2FOBA 3WWFA 5EW2H 5AHGH 1BRAA 1QHRB 3AW1A 2SGAA 3E1XB 1CQQA 2JH0D 3CNRA 1P05A 1TNKA 2Y81A 1C1WH 1FPHH 1D6RA 1GBEA 3EA9A 3RXUA 6LPRA 1TPAE 4KTCA 2RFKC 4JZIA 3OX7U 2Z6BD 1W8BH 3RMMH 1E34B 4AC9A 4BXSA 5AFYH 5EGMA 1ETTH 3W94A 3V0XA 1UTNA 1L2EA 1CO7E 3LGWA 3MU0A 5FBIA 4RT0A 5A8XA 1IQKA 1QR3E 5TCCA 1ZPCA 2ZECA 4B6EA 5LPRA 2SNWA 2BQ7B 3SGBE 1MKXK 1BJUA 1O2OA 2FOGA 4ABAA 3EGKH 1SSXA 2BZAA 1NT1A 5E0JA 4D8NA 4FVBA 1GHAF 1BZXE 5BRRE 1Y3WA 1PPEE 2QF4A 3GDSA 4Z0KA 2ZQ1A 4WVPE 1O2VA 1BTXA 2BLQA 3M7QA 3F68H 4X8UH 3RMLH 3SUDA 1VITF 2FIRH 2FX4A 3UQVA 3PROA 2R2MB 1P06A 2VB0A 2J97A 2BXUH 2YMSD 3K2UA 1O37A 5FPYA 5HIZA 1B0EA 3MU1A 3TLOA 2Y5GA 4CRDA 1Q2WA 1UCYE 2VIVA 3H7TA 2RDEA 5C67A 1GJDB 2O8MA 3IITA 2HNTF 1F2SE 5LPEA 1RTKA 1VCPA 1CBWB 8KME2 2AFQB 1JRSA 1EAIA 1KXFA 2BLVA 2HNTC 3DT0H 5HXFA 1GJ6A 1MTNC 2F9OA 1FMGA 4Y8ZA 1A5GH 1AB9B 2EY4C 2BM2A 1UTKA 1BA8B 4CR9A 1ESBA 3PO1B 1E1RD 3SHAH 3FP6E 1BHXB 4J1YA 3SNDA 4ZKSU 3UUZA 1K1IA 4Z6AH 5HKKD 1N1LA 5CHAC 2WPJS 4WMEA 4AB8A 4GUXA 2A1DB 2PKSB 1TRMA 3SI4H 1SQAA 2RDLA 3K6ZA 1HJAC 2ANYA 1KXBA 1GBAA 1P2OA 3A87A 5EJLA 5CMXH 1K1MA 1D3QB 3A7WA 3TGKE 1KXDA 5F8TA 1RGQA 2F91A 2F9NA 3LKWA 1FY1A 2L6OA 3TVJB 2FLBH 2PV9B 1YPJH 3LGYA 4ZROA 3KL6A 4D76A 3A8DA 1C2IA 2YNBA 2BHGA 1K28D 1C2DA 2EA3A 1KLIH 1BMAA 5C0UA 2CN0H 1EAWA 1P2QA 2YNAA 2OP9A 3URDA 3UNRA 4UFGH 2AERH 1NM6A 2QF3A 3SU2A 1F5LA 2BVRH 1IQNA 1SGYE 1P2JA 2RG3A 4YT7H 1ZTJA 2QAAA 3MH5A 3UOUA 1GMHF 4X1QU 1XUIA 3ZVEA 3FANA 1ZGIA 5HGGA 1AHTH 2BD5A 1GJ4H 2OXSA 2QA9E 1O2SA 1AFQC 2ZPRA 2W6ID 2J5UA 1O34A 1K9OE 1EOLA 1ANEA 1PPCE 2AGEX 1TFXA 2D1JA 2Y7ZA 2GV6A 3ATMA 1OYQA 3GCTF 5L2ZH 2SGQE 1C5NH 4RN6A 2BQ6B 2XBVA 2H9EH 2PP6A 5F53A 4WWYA 5KEDA 2G55A 3OYPA 3GYMA 4OS5A 4YZUA 4X6OA 1FN8A 3TJOA 1OOKB 3RXPA 1BCUH 4MNYA 3S9CA 1O2MA 1T4VH 3UFAA 3BG8A 3RXAA 1GL0E 1YC0A 2ZQ2A 3LGTA 3P92A 2C8XB 1YBWA 3OY5U 2GKVE 1MTNB 4BAHB 1HAVA 5EIYA 3A8AA 3U9AH 1MKWH 2AGIX 1W0ZU 2C90B 4NG9H 1EKBB 4NZQA 3SO3A 1C4V2 2O9QA 3HATH 1Z1JA 2BY5X 4X1SU 3NCLA 3T5FH 3PRBA 4E7RG 5C5NA 4K1EA 2PSYA 1ANCA 5JBAS 1HJ9A 2RCEA 5CHAB 3Q3YA 2WZQA 3QZRA 4Y7AA 4ABFA 4WMDA 3P17H 2FS9A 4GLYA 3ZZDA 3M3SA 2G52A 1HJAB 3A7XA 2ZHEH 3RXVA 1OSSA 3TJNA 1HNEE 1LCYA 2ZHFH 3QZQA 4NGAH 5KGOA 1HJ8A 4F49A 1C5XB 2M5TA 1BBRE 3BTME 2FM2A 1NBME 3E0PB 4B1TA 5PTPA 5GPIB 3U1JB 1OHHD 2BX4A 2PTCE 3KF2A 4H42U 1LQEA 4OGXA 1TE0A 3LIWA 1BT7A 2FDAA 3SGQE 1EUFA 3SNEA 3I77A 1ELVA 1O3DA 3KQEA 1ZSKA 3PMAB 1C5QA 1EP5A 2P16A 1QQ4A 1XXFA 5LPFA 1HAXB 2KX4A 2V3OH 2R9PA 1MCVA 1MD7A 2A5IA 3AASA 2P93A 1AIXH 3B9FH 4OGYA 1BMFD 2ODYB 3ATWA 1UO6A 3URCA 4A1VA 1AFQB 2ZI2H 3BTKE 1FPCH 3BTHE 3RU4D 4BANB 1VCQA 2ZU2A 2BDBA 2QYIA 1HPGA 3BSQA 1UTLM 5EQRA 2AIPA 4X1PU 3ZVGA 2ZC9H 2ZWLH 3PLPA 1QBNA 1XM1A 3RM2H 2ZO3H 2FO9A 1OP8A 2GCTB 1J9CH 4B76A 1HV7A 1AUJA 4WXVA 1S82A 1TABE 1LMWB 1FY5A 1UCYK 2HALA 4X2XA 3T27A 5ESBA 4LXBH 1HAIH 1MCTA 7KMEH 3KCGH 4Q7ZA 4YXWD 2STAE 3BTDE 2PTNA 2ZFRH 4AGKA 1WXRA 3A7YA 2VVVA 1QRZA 3A81A 1MQ6A 1QRWA 2QF0A 3RXGA 3MWIU 2IN2A 3DUXH 5ETXA 3ZV8A 1TMBH 3ELAH 3MNSA 1AN1E 4AG2A 2LPRA 1NRSH 1DXWA 1K21H 1RD3B 1QB1A 1EB2A 1P2NA 2HPPH 3OTPA 2F43B 4IC6A 3ITIA 2ZFFH 1BMLA 2EC9H 4Q4LA 1LDTT 1TRNA 4THNH 3M61U 2VVCA 1ORFA 4RKOB 3SV6A 5FL7D 1QL8A 3GDUA 5H4IB 3SZNA 3F0OA 2ALVA 3TPIZ 1SOZA 4K1TA 3M35A 3ZZ5A 2GZ8A 3FP8E 2PWXA 3PMBB 1G30B 2BB4A 3O8BA 3LH3A 1MTWA 4INKA 4F48B 1DUAA 2P8OC 1FY8E 1O2QA 1DS2E 2WHXA 5F03A 2OINA 4ASUD 1XVOA 2GDEH 4O97A 3KQBA 1OWJA 1TA6A 3PTBA 1VITH 5JPMH 3SU1A 3R3GB 2OUAA 1S83A 1EJAA 4Y76A 3IG6B 1IQEA 2W6JD 1NRPH 3EAJA 1AVGH 4JCNA 5FPTA 1GMCF 4MPWA 4AFUA 1UHBA 1HUTH 4UEHH 1A5IA 1MUEB 1OYTH 4IMQA 1O3OA 4BNRA 3VB5A 2V7QD 3STJA 1LVBA 1BRUP 1J15A 2OD3B 3KEEA 1TNJA 2QGRA 1RTLA 1A61H 1FAKH 2FODA 2IOTA 1O5FH 4LZ4B 1KLTA 1KMHB 2XWAA 2K1QA 2VIDA 2R3YA 1NY22 1YLDA 4XRNA 3TJUA 3ZIAD 2ESTE 1DX5M 1NFYA 3OY6U 1YKTA 4OS7A 2BDYA 5CE1A 1H4WA 1W10U 5EQSA 1PQ8A 3L33A 4BAOB 1DM4B 1K1JA 4XBBA 5DN6D 2WYGA 2ZHWH 4X8VH 1COWD 3F2GA 4UFDH 1YF4A 1Z6JH 5BPEA 3A7TA 4IGDA 3ZVFA 3E6PH 4CH8B 4YT6H 5A0AE 1VJ9U 4B71A 2FI5E 3BN9A 3TJVA 5FAHA 1GBTA 2STBE 2FTLE 3PLBA 5C17A 1TGSZ 3Q3XA 4YTAA 1KYNA 1BDAA 1L1GA 1V2WT 1O39A 1CT0E 1FN6A 2ZU1A 1C5PA 2H9HA 1G2LA 3SI3H 3LJOA 1CE5A 1D6WA 1LTOA 1K2I1 2XWBI 3ZZ4A 3UPEA 3SBKA 3ODDA 2ZDMA 1TWXB 2W3KA 2NU3E 1V2JT 1UTQA 2WPMS 1AI8H 1QL9A 1GHXH 1C1SA 2J92A 2EEKA 1KDQA 1DDJA 2W7UA 1QURH 5EW1H 3PWCA 3RM0H 1IOEA 3CENA 1LQDB 2A7JA 4MNVA 4BAQB 2GMTC 1GBFA 4I33A 3KQ5A 3QGNB 3ZZ8A 1NU7B 2F3CE 1BBRK 1KSNA 2A32A 3BTWE 3MOCA 4YLQH 3V13A 4D7GA 5ESTE 1HAZB 4PROA 2TGDA 1H9HE 1O5AB 3K6YA 3V12A 1DUEA 2P8OB 2RA0A 4A7IB 2XCFA 4KKDA 1SGNE 1MU8B 4HGCA 3DFJA 3CS0A 3Q00A 1BQYA 4O3TA 3NRLA 1UTMA 5C3NA 1SGIB 2J34A 2XBWA 4JZ1A 2XC4A 2FOAA 2I6SA 4NWKA 4WF8A 5DP6A 1C2KA 1RJXB 4GSOA 1O30A
chains in the Genus database with same CATH topology
4OM9A 2YMSD 4M9FA 5FPYA 2K0QA 4WH6A 3M5LA 5EQRA 4B6FA 1FX0B 2P59A 2YMSB 2YOLA 1CU1A 2V7QD 5GJ4B 3RC6A 2JDID 3KEEA 2CK3D 5EQQA 2A4GA 2KR7A 1RTLA 5F53A 2O8MA 2JJ2D 2OBQA 3OEHD 5CHBA 5GNDA 1DXPA 2KCAA 3OYPA 4NWLA 3SU4A 2A4RA 4B76A 1KMHB 2K1QA 2OC7A 4TYDA 4A1XA 3AK5A 5C0TA 2KZ4A 3WWBA 3O8CA 3ZIAD 5EPNA 1JXPA 3EYDA 3GS9A 4Q63A 1NBMD 5ESBA 3UB0A 3F0PA 3SUEA 5EQSA 3SV8A 2FOMB 4YXWD 5DN6D 2GVFA 3M5OA 3FO8D 1COWD 2FP7B 4R8TB 3F2GA 1E79D 3SV7A 1A1RA 4A92A 1WXRA 2XOKD 3N7DA 3FKSD 1E1RD 2IJD1 3N99A 4TT3D 3SU3A 4B71A 3F2FA 3OE7D 3P8NA 1DY9A 5C17A 5HKKD 5ETXA 1N1LA 3PRBA 3DSOA 3P8OA 4B73A 5CDFE 3SUFA 4ZCNA 3DSPA 4JMYA 1MABB 2OK5A 2WZQA 3RC4A 2AHME 2F9VA 1DXWA 2KCYA 2K8IA 3O8DA 3WWFA 2XNDD 2XCNA 3OTPA 3KN2A 2F43B 4TSFD 2IJOB 5IK2D 4K8BA 3PV5A 1DY8A 1E1QD 3H09A 3N7EA 3M5NA 4Q4LA 2VBCA 1RGQA 3SV9A 1S6LA 3LKWA 1W3CA 3LONA 2L6OA 2KFWA 1SKYE 3M5MA 3OAAD 4B75A 2OC1A 4I31A 2A4QA 5FL7D 5FPSA 5H4IB 3SV6A 2FM2A 1NBME 3O8RA 3F0OA 1EFRD 5IDKA 3SU6A 3OEED 1H8ED 3SUGA 3RC5A 1NS3A 4I33A 4KTCA 2OC0A 5GPIB 2QV1A 3U1JB 3F3BA 1OHHD 3KF2A 3SZEA 2KCOA 2F4LA 4WH8A 3LOXA 4B74A 3W1EA 1W0JD 2LELA 3PRDA 5C0UA 3E90B 3DCLA 3O8BA 3FOAA 1W0KD 2YMSC 1BT7A 2OBOA 5B6LA 3SU5A 2XNIA 3KNXA 2JJ1D 5T1VA 2WHXA 2OINA 4ASUD 3SU2A 2WV9A 3OFND 2KM0A 2KCPA 4U01A 2WPDD 4B6EA 2JIZD 2XCFA 5DSFA 2WSSD 3WW7A 5EPYA 4FETA 3SU1A 3VG8A 2OC8A 4I32A 3NRLA 2QE7D 1BMFD 4Z1MD 1H8HD 3FN8A 3F2HA 2W6JD 3U1IB 2QF5A 2GGVB 2W6ID 2J5UA 4A1TA 4A1VA 2QF4A 2F9UA 3SYJA 2HLDD 3SU0A 4WF8A 3PV2A 4NWKA 2M2AA 5FPTA 4DT4A 4F55A 3L6PA 3SUDA 4XD7D 4RI0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KZ4 A;  2KCA A; 
#chains in the Genus database with same CATH topology
 3GDV A;  1FUJ A;  1XUK A;  3MH6 A;  2FYR A;  1EZX C;  3N7O A;  2J98 A;  2YMS B;  3ATL A;  1BRB E;  2CJI A;  1YPK H;  4DW2 U;  1BTH H;  4Q7X A;  1K1O A;  2ANM H;  3ODF A;  4JK5 A;  2ZG0 H;  1K1N A;  3GIS B;  1SGP E;  3O8C A;  1G3C A;  2GJG A;  4CRA A;  3TH2 H;  1YYY 1;  1O3G A;  2VWM A;  3F0P A;  2BD3 A;  1C9P A;  1TRY A;  4JZD H;  1ZJD A;  1IQL A;  4CRF A;  4AB9 A;  1FLE E;  4AFS A;  1THP B;  2HGT H;  3QWC H;  1PQ7 A;  1K22 H;  4FUI A;  2UWO A;  2ZFT A;  3S9B A;  3MHW U;  3LH1 A;  1V2V T;  3ZV9 A;  1DY9 A;  3C27 B;  1EPT C;  2AS9 A;  2VNT A;  2ZFP H;  5JBT A;  3MQK C;  1OP0 A;  1ZJK A;  1O32 A;  4TY6 A;  1DOJ A;  2V3M A;  2ZGJ A;  2BDI A;  5F8X A;  4MTB A;  1QJ1 B;  3SN8 A;  1QBV H;  1BHX F;  3ZYE A;  1P03 A;  1GDQ A;  4MQA A;  4TSF D;  1O38 A;  1BTU A;  5C20 A;  1DAN H;  1B5G H;  4NSY A;  1UVS H;  1V2S T;  2WPK S;  1Y59 T;  4UFF H;  5C5O A;  4B75 A;  2KAI B;  1GHY H;  2A2X H;  3SUG A;  1SGT A;  4XSK U;  2CXV A;  1C2H A;  2QXI A;  2GMT B;  5J4Q A;  4I8G A;  1U6Q A;  2ZU5 A;  3F6U H;  2NU2 E;  3E90 B;  1WBG B;  1CGH A;  2ZTZ A;  1AD8 H;  1TBZ H;  4B2B A;  1G32 B;  1O3E A;  2OBO A;  2BMG B;  1C5R A;  2XNI A;  1DWE H;  5T1V A;  3RXI A;  4ZMA H;  4Q80 A;  1TLD A;  1FY3 A;  3MU5 A;  1A0H B;  2HLC A;  1W11 U;  1GI4 A;  2Z3D A;  2FES H;  2JIZ D;  3D49 H;  5C1X A;  1AVX A;  4BTU B;  1O2H A;  4RSP A;  3GY8 A;  1C1Q A;  1C1R A;  4ISO A;  1L1J A;  1UK2 A;  4M7G A;  5DJ7 A;  3SOR A;  1C1V H;  2H2Z A;  3D62 A;  1H8H D;  2JH6 D;  1O3J A;  2C8W B;  1LHE H;  2GT8 A;  4I7Y H;  3NXP A;  3SU0 A;  4BAM B;  4NFF A;  4ZH8 A;  3P8G A;  1SQO A;  5EXN A;  1SLW B;  1ZSL A;  5A09 A;  2ANK H;  2DE8 A;  4M9F A;  1GCD A;  2JET C;  1NPM A;  3PYH A;  1F0U A;  1OPH B;  2H6M A;  1QNJ A;  2F9P A;  3MH7 A;  1YGC H;  1Y5B T;  2CK3 D;  1O3N A;  2OBQ A;  2KCA A;  4NWL A;  5DP9 A;  5G4B A;  2FI4 E;  1ZRB A;  2AMQ A;  4KGA A;  4JYU H;  5EU8 A;  2C8Y B;  3RXB A;  1HDT H;  4RT1 A;  5TJX A;  1DST A;  3P70 B;  1P8V C;  3GY6 A;  4DGJ A;  3D65 E;  2FP7 B;  4R8T B;  4Y10 E;  1BUI A;  3M7T A;  4ABJ A;  1UTO A;  1T32 A;  1F0T A;  3N99 A;  1O2U A;  4AFZ A;  4DVA U;  3ZZ3 A;  4Y79 A;  3RXD A;  3RXM A;  1DPO A;  3BEI B;  3DSO A;  4X2Y A;  2AGG X;  5C2Z A;  2BY8 X;  1H8D H;  4NIX A;  1GBM A;  1XX9 A;  4EST E;  3UR9 A;  1CA8 B;  2SNV A;  4NIW A;  1EPT B;  1S0R A;  1TA2 A;  2AYW A;  1NES E;  1MZD A;  3ENS B;  3UY9 A;  2OTV A;  1O2Y A;  5A8Y A;  2OLG A;  2OQU A;  3H09 A;  1QJ6 B;  3VPK A;  1Z8R A;  3M37 A;  5AVD A;  3UNQ A;  2Q6D A;  3LON A;  1C5O H;  5A2M H;  2Z3E A;  4ABE A;  3ZZC A;  2SGD E;  1FQ3 A;  1AU8 A;  1SGC A;  1GI5 A;  1NTP A;  1P0S H;  3O8R A;  3S7K B;  2ZDK A;  1T4U H;  3RC5 A;  1AQ7 A;  1YM0 A;  3DD2 H;  4FUF A;  5F8Z A;  1PQ5 A;  1O3F A;  4MLF B;  1QA0 A;  4WH8 A;  2AH4 X;  2Y6T A;  4ZHM U;  3F9E A;  2PGB B;  2BD7 A;  4B2A A;  2B5T B;  5DK1 A;  1WDI A;  3QLP H;  3AAV A;  3QK1 A;  1VJA U;  1O35 A;  1P2M A;  2VIP A;  4U2W A;  3KYF A;  3T2N A;  1NRR H;  3QDZ B;  3UAI C;  1P01 A;  1SL3 A;  1O2N A;  1NRQ H;  1TB6 H;  2C93 B;  3R0F A;  8EST E;  1D4P B;  1ZHM A;  2VIW A;  3F2H A;  2H1U A;  1QIX B;  1GBD A;  1SGF A;  1C2G A;  4E05 H;  4A1T A;  4YOG A;  2F9U A;  4X8S H;  2P3T B;  1GBH A;  1RRK A;  1EOJ A;  5LGO A;  1O2T A;  1IQF A;  1ELG A;  1O2J A;  4B6F A;  2ASU B;  1G3E A;  1C2M A;  2HVY B;  1SI5 H;  2JET B;  2ZGB H;  5GND A;  4OS1 A;  2SGE E;  4ZKR U;  3A86 A;  4NA8 A;  1F0S A;  2J2U A;  3SNA A;  1L1N A;  1GBJ A;  1YPG H;  1WAY B;  2SFA A;  5GDS H;  1RFN A;  4A5T S;  2XBX A;  1CHO F;  1TPP A;  1NN6 A;  2W26 A;  4O9V A;  5L6N H;  3RXC A;  1F5K U;  4I8H A;  1JIR A;  3A88 A;  4A92 A;  1GJA B;  2ZGC A;  1Y3U A;  4LZ1 H;  1TPS A;  2FLR H;  1GHZ A;  1SG8 B;  2ZTX A;  3RXO A;  3VB3 A;  4CBO A;  2Y82 A;  1LHF H;  1Z6E A;  3GIC B;  1IQG A;  8LPR A;  5DGJ A;  4NIV A;  1EX3 A;  2PSX A;  1MAB B;  1SGE E;  3RC4 A;  3TK6 A;  1ACB E;  1C5Y B;  4NA7 A;  3A7V A;  1KXA A;  3PMH B;  3FVF B;  1V2T T;  2W5E A;  4P02 A;  3TH3 H;  3EA7 A;  3U8O H;  3LC5 A;  3VXE H;  1Y3Y A;  2B0F A;  2ZF0 H;  2ZP0 H;  2FI3 E;  1Z8G A;  2GCH G;  3SJO A;  1H8E D;  3LC3 A;  1ELE E;  1MTS A;  1LPG B;  3M3V A;  1O3H A;  2W7S A;  1YWU A;  3RU4 T;  2LEL A;  4Y7B A;  5FBE A;  3ZVD A;  2FTM A;  1S6F A;  4FUE A;  1C5L H;  1WCZ A;  1P11 E;  2TPI Z;  1ZYO A;  2FPZ A;  3GCH C;  2P3F H;  2KCP A;  4I8K A;  1GI1 A;  3DA9 B;  2HWL B;  4MPU A;  1KXE A;  2SGF E;  1YLN A;  2SGP E;  1YCP K;  4UFE H;  3BTQ E;  1GBL A;  2NU1 E;  2FOH A;  3GYL B;  5T6D A;  4HFP B;  2ZCH P;  3PV2 A;  2XXL A;  4X0W U;  2Z3C A;  5DP5 A;  1HB0 B;  2Z9I A;  1BB0 B;  2O8T A;  4HG6 A;  1FAX A;  2R0K A;  1C2J A;  1BMN H;  1ID5 H;  1O5D H;  2K0Q A;  3ATK A;  4FU7 A;  4P00 A;  1GHB F;  4B2C A;  1LVM A;  1NRO H;  5CHB A;  4YLU A;  4FXG H;  2V0B A;  1W0Y H;  1C2F A;  3U28 C;  1GHA G;  1O3I A;  5DP8 A;  3QTO H;  2OC7 A;  2EI6 A;  2P95 A;  1A3B H;  4FUD A;  5C1Y A;  3EYD A;  2BLW A;  2ILN A;  4NIY A;  5T3H A;  1AZZ A;  4YO9 A;  1TNG A;  1CGJ E;  1VIT G;  7GCH F;  1GBB A;  3M5O A;  1XUF A;  3ZZ6 A;  1C5Z B;  3SV7 A;  1A1R A;  1UVO A;  1GJ8 B;  2EQN A;  1VGC C;  1OS8 A;  1HAG E;  2W3I A;  3FKS D;  1IAU A;  2Z9J A;  5L2Y H;  1HCG A;  2PHB A;  3QGJ A;  3GY4 A;  3BTG E;  4AYY B;  1L4Z A;  5T6F A;  4CRG A;  1XUH A;  1ARB A;  2J95 A;  4ZCN A;  1FDP A;  4FU8 A;  1TOM H;  4O03 A;  2GTB A;  1QRX A;  2XND D;  1UW7 A;  1SGF G;  1IQH A;  1E1Q D;  1OX1 A;  3URE A;  3Q3K A;  4ZXY H;  1KIG H;  1ZZZ A;  8GCH F;  2V6N A;  2I6Q A;  5GCH F;  5FPS A;  4VGC C;  4TPI Z;  1P3C A;  5DKM A;  3BG4 C;  1P2K A;  3TGI E;  4FU9 A;  1SFI A;  1NS3 A;  5EOD A;  4K60 A;  1GL1 A;  2H5C A;  1WU1 A;  3QN7 A;  1NFW A;  1MZA A;  5E0G A;  1J14 A;  3RXR A;  1XUJ A;  1KLJ H;  2OQ5 A;  3K65 B;  1YCP M;  3Q76 A;  2PFE A;  2WPI S;  1GJ7 B;  1W0K D;  1THR H;  3SU5 A;  2F9B H;  1Y8T A;  2JJ1 D;  2ZDN A;  3RXE A;  1GVZ A;  2Z94 A;  1O36 A;  1D9I A;  2Z7F E;  2FOF A;  3S69 A;  1HRT H;  3S0N A;  3GCH B;  4FET A;  1BIO A;  2OC8 A;  2Y7X A;  3PWB A;  1TX8 A;  4TWW A;  1PPB H;  2BVS H;  2Y5F A;  1Y5A T;  3U1I B;  4X8T H;  3PB1 E;  4AX9 H;  1A0L A;  1FI8 A;  1W13 U;  2R0L A;  1W14 U;  1GG6 C;  2M2A A;  1IHT H;  4NA9 H;  4XD7 D;  1ELD E;  1T31 A;  1AVW A;  5EG4 A;  2GX4 A;  4WH6 A;  3FFG A;  1GJ9 B;  1TGB A;  1PQA A;  4XBD A;  1S0Q A;  2CF9 H;  1GMH G;  7EST E;  1V2P T;  1Y3V A;  4IN1 A;  4Q2K A;  2A5K A;  1OWH A;  1C5V A;  1ABI H;  1DWC H;  5SGA E;  3VGC C;  3NZI A;  2ZZU H;  2PKA A;  6GCH F;  2IPH A;  1QBO A;  2ZPS A;  2KZ4 A;  2B9L A;  1N6X A;  1HAP H;  4Q63 A;  4CRC A;  2Q1J A;  3BTE E;  1EZQ A;  4YOJ A;  5JB8 S;  4DII H;  3CS7 A;  3GCT G;  1L4D A;  1AKS B;  1PPZ A;  1GMD F;  1GGD C;  1BTP A;  4Y8Y A;  5GWZ A;  1VGC B;  2PW8 H;  3MNC A;  1CT4 E;  1FXY A;  4ABG A;  1C1M A;  3EDX B;  2AIQ A;  5E8E H;  1QCP A;  1P9S A;  1GBC A;  2DUC A;  4IMZ A;  4H6S B;  2GDD A;  1MAY A;  1TNH A;  1VCW A;  3U8R H;  1MTU A;  1Z8J B;  2C8Z B;  5FHT A;  3KN2 A;  3SNB A;  1DY8 A;  2A4O A;  1HIA B;  2L74 A;  1E36 B;  5DO4 H;  1O0D H;  2G51 A;  1C2L A;  3BIV H;  4GHT A;  1ESA A;  1Z7K A;  1GHW H;  1G3D A;  1EFR D;  3FP7 E;  4VGC B;  4KTS A;  3BG4 B;  2OC0 A;  1UCY H;  2QV1 A;  3F3B A;  3P6Z B;  5HYO A;  3SZE A;  1Y3X A;  1PPG E;  1ANB A;  2VWN A;  2G4T A;  3EQ0 H;  4X6N A;  1Y5U T;  1MAX A;  2R2W U;  2ZDV H;  1O3L A;  1ELC A;  1LPK B;  2FEQ H;  2ZFS A;  3DHK H;  3MO9 A;  1MD8 A;  1QGF A;  1ZRK A;  1AWH B;  3KID U;  3VG8 A;  3ZVA A;  1P10 A;  1G37 A;  3LPR A;  3A7Z A;  4H6T A;  2ZKS A;  1TMU H;  2JKH A;  1QZ8 A;  1TYN A;  4X1N U;  3E91 A;  4WY3 A;  4LK4 A;  4F55 A;  2J4I A;  1K1L A;  4UDW H;  1GG6 B;  1GHB G;  1SVP A;  2JDI D;  3UOP A;  2WV5 A;  1AFE H;  4ISL A;  3RLY H;  4Y11 E;  2A4R A;  5KEC A;  2ANW A;  2KAI A;  4F4O C;  3RP2 A;  1FY4 A;  3FZD A;  3VGC B;  3GS9 A;  3A83 A;  2ZFQ H;  7GCH G;  3LGV A;  4NFE A;  4WJG 2;  1V2K T;  2BTC E;  3SV8 A;  1JWT A;  1UHB B;  3AVZ A;  4CHA C;  2GVF A;  2AEI H;  3FO8 D;  1GI8 B;  1ZMN A;  3BIU H;  3TIU A;  1D3D B;  1GI0 A;  1NU9 A;  2A7C A;  2WPH S;  4K1S A;  2BDA A;  1GJC B;  2QN5 T;  2BD4 A;  1QB6 A;  4DG4 A;  3TK5 A;  1RS0 A;  1GI7 B;  1GGD B;  3A8B A;  3OE7 D;  1SGD E;  1YLC A;  3OSY A;  4IW4 E;  3P8O A;  3TGJ E;  3K9X B;  1TGN A;  2WUC A;  2QC2 A;  2VH6 A;  2WV4 A;  2ZCL P;  2C4F H;  4ACA A;  3TIT A;  2AHM E;  3EE0 B;  1ZPZ A;  2KCY A;  3RLW H;  2TIO A;  1GI2 A;  1GPZ A;  5JBB S;  1TX6 A;  2BLO A;  5B6O A;  3U8T H;  1KTS B;  2VBC A;  3LT3 A;  8GCH G;  1WV7 H;  4X2V A;  1AGJ A;  2GT7 A;  1ZLR A;  4INL A;  5GCH G;  3T25 A;  1HLT H;  3SJ9 A;  1WTG H;  2VIQ A;  1BOQ A;  2G81 E;  4KEL A;  1TGT A;  2CGA A;  2FOE A;  4DJZ B;  1P02 A;  5FCR A;  3QTV H;  2KCO A;  3VFE A;  5A8Z A;  1SLV B;  3LOX A;  1O2L A;  1TX7 A;  1MMJ N;  1LPZ B;  1W0J D;  3PRD A;  2FXR A;  4ABI A;  2OCV B;  2R3U A;  3GOV B;  1S6H A;  3A82 A;  1QQU A;  3EE7 A;  3KNX A;  2C3S A;  4AGJ A;  5HMA A;  2WV9 A;  1FIZ A;  1UK4 A;  1A4W H;  4U01 A;  1WOF A;  3TNT A;  1ZTL A;  3WW7 A;  4WMF A;  1HFD A;  3MNB A;  4BAK B;  1B0F A;  1TQ0 B;  1OKX A;  2PUQ H;  4GCH F;  1GI3 A;  2G5N A;  1TMT H;  1H9I E;  1VR1 H;  1YPE H;  3CP7 A;  1UVU H;  3GY5 A;  3PM3 A;  5IYT A;  1HGT H;  1TOC B;  1H1B A;  3T29 A;  2CHA C;  1V3X A;  4U30 A;  3MH4 A;  1EPT A;  2ZHQ H;  1XMN B;  1P57 B;  3QX5 H;  5I46 H;  2CF8 H;  1H9L B;  2LNC A;  5EQQ A;  2Z9G A;  2Z9L A;  3JZ2 B;  1HXE H;  5EXM A;  3SU4 A;  3T26 A;  1C5W B;  2P3U B;  1QL7 A;  1GMC G;  3SUE A;  1BBR H;  3UTU H;  3H5C B;  2FOM B;  4XBC A;  3HGN A;  3M36 A;  5EXL A;  2J98 B;  1GMD G;  4K8Y A;  1LVY A;  1V2Q T;  1QTF A;  1X7A C;  4I8L A;  4AOR A;  4CHA B;  1V2U T;  4O3U A;  2IJD 1;  4DY7 B;  1DVA H;  3AAU A;  1SFQ B;  1TON A;  2HNT E;  4GAW A;  3RXL A;  1C2E A;  1T8M A;  3GY7 A;  5C1U A;  2D26 C;  1EAX A;  5CDF E;  1ABJ H;  3DSG A;  3T28 A;  1DIC A;  1SGQ E;  5DG6 A;  4XE4 A;  1DT2 A;  1BJV A;  3E0N B;  1A46 H;  1V2R T;  1ARC A;  2GZ7 A;  2FYQ A;  4DCD A;  1A5H A;  1LKA A;  3NKK A;  4ZKO U;  1E0F D;  3C1K A;  2IJO B;  2J94 A;  1GWA A;  3PV5 A;  4K8B A;  1UVT H;  2A0Q B;  1D3P B;  4NCY A;  4BTT B;  2B7D H;  3SV9 A;  2BYA X;  3E3T A;  5JBC S;  3UWJ H;  3SJK A;  3ZVB A;  3IWM A;  3OU0 A;  1P3E A;  3HKI B;  2ZGX H;  5EJ1 A;  5FCK A;  3MTY A;  3HPT B;  2VH0 A;  1PPH E;  2D8W A;  4B74 A;  1SLU B;  3W1E A;  3DCL A;  1F5R A;  2ZDA H;  6EST A;  1ELA A;  5EOK A;  4FOU C;  3SOS A;  4NSV A;  1C4Y 2;  1MKW K;  1O3C A;  4AOQ A;  1ZPB A;  1W7X H;  3L3T A;  1O2R A;  2A45 B;  2KM0 A;  3TU7 H;  1AO5 A;  1C5M D;  2WSS D;  1O3A A;  3MFJ A;  5DPA A;  4TWY A;  1MBM A;  2GV7 A;  2CMY A;  3A8C A;  1C1T A;  1O2Z A;  3F9G A;  4Z1M D;  1EJM A;  3MYW A;  1GI6 A;  2P94 A;  5TCA A;  2O8U A;  1V2N T;  6CHA C;  1ETS H;  4ZUH A;  3SYJ A;  4ZXX H;  1UMA H;  5FXL A;  4HTC H;  3VXF H;  5JYI A;  1EZS C;  1AMH A;  2CHA B;  2ZA5 A;  3MNX A;  4JYV H;  1JBU H;  4RKJ B;  3RXK A;  3EST A;  1EQ9 A;  1TBR H;  1TIO A;  1EZU C;  2BDG A;  2QY0 B;  3VB6 A;  3UB0 A;  3UIR A;  3OEH D;  1TBQ H;  1LHG H;  1C4U 2;  2Z9K A;  1RIW C;  4MNX A;  1MQ5 A;  3UWI A;  4A1X A;  1SC8 U;  1TPO A;  5C0T A;  1LVO A;  1OXG A;  1AND A;  7LPR A;  5EPN A;  1MU6 B;  2DE9 A;  3SV2 H;  3BV9 B;  5HM2 A;  3LDX H;  3S9A A;  4JZF H;  3HK3 B;  4FUG A;  1CVW H;  1MTV A;  2V3H H;  1YPH E;  2A31 A;  5E2O A;  3F1S B;  1OWD A;  1S85 A;  3SU3 A;  1ZML A;  1M9U A;  1QY6 A;  2Y5H A;  4X6P A;  4ZKN U;  1IHS H;  3T62 A;  1PYT C;  5F6M A;  1SGR E;  3P8F A;  3U69 H;  1T8L A;  3WY8 A;  4ACB A;  9LPR A;  2OK5 A;  5ABW A;  9EST A;  1ZHP A;  3F9F A;  1O2I A;  2J38 A;  5IK2 D;  2QXG A;  1ZTK A;  2B8O H;  3N7E A;  3ZZB A;  1WQS A;  2BDC A;  1NZQ H;  4MVN A;  1OWE A;  4YM9 A;  1MKX H;  4YES B;  1NFU A;  4I8J A;  1EST A;  1AE5 A;  3KGP A;  1J16 A;  2PR3 A;  3E16 B;  2BY9 X;  3OEE D;  1O31 A;  1EAT A;  1SLX B;  2NU0 E;  1TNI A;  1G9I E;  1GJ5 H;  1AZ8 A;  1G2M A;  1V2L T;  2ULL A;  3BEF B;  3G01 A;  3RXF A;  1HAH H;  1AY6 H;  3FOA A;  3DFL A;  1C9T A;  5B6L A;  1OWK A;  5DP4 A;  2VIO A;  4NZL A;  4ISI H;  1CHG A;  4ZHL U;  1BIT A;  5T6G A;  2XTT B;  2GCT C;  2WPD D;  2WIN I;  5J4S A;  2UWL A;  5EPY A;  3GCO A;  4GCH G;  4TPY A;  1YPH C;  3FAO A;  4CR5 A;  4SGA E;  3KQC A;  1C5T A;  3SW2 B;  3FN8 A;  1O5B B;  1AE8 H;  2GGV B;  1RXP A;  1E38 B;  4GVU A;  4ZAE A;  5C94 A;  1HXF H;  1O3K A;  4ABH A;  2ZGH A;  4OS6 A;  4DT4 A;  3L6P A;  6CHA B;  4RI0 A;  1ZHR A;  1QFK H;  1C5U A;  2VGC C;  3M5L A;  2FZZ A;  1E37 B;  1P12 E;  3NUM A;  3M3T A;  3RC6 A;  3HKJ B;  3ZVC A;  2JJ2 D;  1XKA C;  1FON A;  1Q31 A;  1SR5 C;  3RMN H;  1TNL A;  4GPG A;  5FX5 A;  3SHC H;  1KY9 A;  1J8A A;  1RIW B;  1SBW A;  2WPL S;  2EI7 A;  3QO6 A;  1F0R A;  2BOH B;  4FUB A;  2PGQ B;  4SGB E;  5FX6 A;  4I86 A;  1BMM H;  1ZSJ A;  4CRE A;  1W7G H;  1A2C H;  2XC5 A;  1QJ7 B;  2V35 A;  4IN2 A;  2ZHD A;  1UTJ A;  3ZYD A;  2O8L A;  1P2I A;  4QT8 C;  1ELB A;  1ZMJ A;  1TQ7 B;  2A5A A;  3VEQ B;  1WUN H;  1SMF E;  1T7C A;  4KP0 A;  5A0B A;  3F9H A;  3SJ8 A;  3TK9 A;  2WYJ A;  3VB7 A;  2NU4 E;  4ISN A;  1JIM A;  4XFQ A;  3SUF A;  4DT7 B;  3A80 A;  1DWB H;  3ATI A;  4Y71 A;  5A0C A;  1WYK A;  4X2W A;  1P04 A;  4LOY H;  2EI8 A;  1ZR0 A;  4UON A;  4DUR A;  1V2M T;  1W3C A;  2KFW A;  1SKY E;  2UUY A;  4I31 A;  2Q6G A;  3M7U A;  2XW9 A;  1PFX C;  2TBS A;  1GJB B;  2GZ9 A;  1VKY A;  1KTT B;  2HOB A;  3MI4 A;  3GY2 A;  4UD9 H;  3MU8 A;  1HYL A;  1FIW A;  1HAV B;  4FUH A;  4ISH H;  3OTJ E;  1YY3 A;  2BDH A;  2FMJ A;  1NO9 H;  2ZCK P;  2AMD A;  1EJN A;  1YP9 A;  3A85 A;  1AKS A;  1O2W A;  1UTP A;  1BTY A;  1GVL A;  1TGC A;  4Y0Y E;  4IS5 A;  5GIB A;  4CH2 B;  4E7N A;  2UUF B;  2BX3 A;  2QXJ A;  4K2Y A;  1Z71 A;  1DE7 H;  1S81 A;  1IQM A;  2F83 A;  2A2Q H;  2ALP A;  4INH A;  4DOQ A;  1D3T B;  1T8O A;  5HM9 A;  4Y8X A;  2Y80 A;  3MO3 A;  1T8N A;  1DIT H;  2J9N A;  1N8O C;  4OM9 A;  1GI9 B;  2BD9 A;  1P09 A;  4XOJ A;  4Q7Y A;  1CU1 A;  2JH5 D;  1GDU A;  2HVX A;  1HIA A;  2ZDL A;  1GBI A;  2VGC B;  3JZ1 B;  1XXD A;  2A4G A;  3B23 B;  2CV3 A;  1EP6 A;  2ZU3 A;  4WXI A;  1E35 B;  1G36 A;  4ASH A;  3UNS A;  2PLX A;  1SHY A;  2BD2 A;  5HIY A;  4GHQ A;  2FWW A;  3MU4 A;  4CRB A;  1HAY B;  1DFP A;  2VIN A;  2LP6 A;  5L30 H;  1O3B A;  1ETR H;  1A7S A;  3TNS A;  2ODQ A;  2XBY A;  3E8L A;  3PV4 A;  3W95 A;  2BZ6 H;  3NPS A;  1GVK B;  4IBL H;  1JMO H;  3RMO H;  1GHV H;  3A84 A;  3LU9 B;  1MBQ A;  4AG1 A;  1JOU B;  2BD8 A;  4R0I A;  2UUK B;  4B73 A;  1YCP H;  3BTT E;  4JMY A;  1P9U A;  4K3J A;  2H5D A;  2ZU4 A;  1OWI A;  1CHO G;  3PTN A;  3RDZ A;  3V3M A;  1Z8I B;  1PJP A;  1ZOM A;  3O8D A;  3RXH A;  2NWN A;  2TGT A;  2VU8 E;  4Y0Z E;  4UE7 H;  4X6M A;  4OS4 A;  2Q6F A;  3BTF E;  3QUM P;  1SB1 H;  3RXJ A;  1S6L A;  1ELT A;  1H8I H;  2ZNK H;  3STI A;  1INC A;  1UJ1 A;  2BY6 X;  3M5M A;  3OAA D;  2D2D A;  2A4Q A;  1DLK B;  1C1N A;  4MDS A;  1PYT D;  2XC0 A;  1WQV H;  1FJS A;  4MPX A;  5IDK A;  3SU6 A;  2QXH A;  2XYA A;  1DLE A;  3I78 A;  3LJJ A;  5DP7 A;  3SGA E;  2F4L A;  3KHV A;  1TAW A;  2BXT H;  5JB9 S;  1GCT C;  2YMS C;  4KTU A;  5E2P A;  1QB9 A;  5E0H A;  3D23 A;  2PUX B;  3OFN D;  2ZIQ H;  3V7T A;  4OS2 A;  3Q77 A;  1B7X B;  1GBK A;  1SOT A;  2TGP Z;  4D9Q A;  5LH8 A;  3PLK A;  3KYG A;  4I32 A;  3LGI A;  4X1R U;  4K5Z A;  2VVU A;  1S84 A;  3LGU A;  1O5G H;  2FX6 A;  2HLD D;  1C1O A;  4AYV B;  1C1U H;  1EAU A;  3TH4 H;  1HAO H;  2VWL A;  3MO6 A;  1N8O B;  2BVX H;  1FX0 B;  5GJ4 B;  1EB1 H;  2HRV A;  1EAS A;  2KR7 A;  1O2K A;  1SQT A;  2GD4 B;  1DXP A;  2GP9 B;  3KQD A;  4FUJ A;  2BQW B;  4CBN A;  1O2P A;  1NRN H;  4TYD A;  1MH0 A;  1CSO E;  1CT2 E;  2IPQ X;  3RXS A;  1SQR A;  3FZZ A;  1DWD H;  2FOC A;  1S5S A;  4JYT A;  2ZTY A;  1PPF E;  4BXW A;  1A3E H;  1BRC E;  2UUJ B;  2G5V A;  1E79 D;  4JK6 A;  1AWF H;  1BTZ A;  1QA7 A;  3MMG A;  1LO6 A;  4A6L A;  1V6D A;  2TGA A;  4K69 A;  1UVP A;  3VB4 A;  1CGI E;  3GY3 A;  2PKA B;  3F2F A;  1Z1I A;  2AMP A;  5JDU B;  1ELF A;  1CA0 C;  3DSP A;  4FVD A;  4YOI A;  1K1P A;  4AZ2 B;  4J2Y B;  3GCN A;  2XCN A;  5GXP A;  3M5N A;  1NFX A;  1O3M A;  3PMJ A;  5K7R A;  1F7Z A;  4HI3 A;  4MPV A;  4IC5 A;  1FV9 A;  4XDE A;  2OC1 A;  4Y6D A;  1FZZ A;  2ODP A;  2ZPQ A;  4D9R A;  3U98 H;  2ZEB A;  4JZE H;  1GDN A;  1O2X A;  3SNC A;  4TY7 A;  1O3P B;  4ABB A;  3ZZA A;  1XUG A;  4BTI B;  1UK3 A;  2VJ1 A;  3SQH E;  1J17 T;  1LKB A;  1FNI A;  3RUO A;  1YPL H;  3UR6 A;  4MNW A;  5DP3 A;  3SQE E;  5AFZ H;  1NC6 A;  1K0H A;  1GCT B;  5I25 A;  2A7H A;  2FS8 A;  1V2O T;  1YPM H;  3BEU A;  4MG3 A;  5DSF A;  3ZZ7 A;  4DIH H;  1SHH B;  1O2G H;  2O8W A;  3AW0 A;  1EXF A;  3S7H B;  3ZZ9 A;  2G00 A;  2QE7 D;  1C1P A;  1WTH D;  1JRT A;  2QF5 A;  2H9T H;  1SPJ A;  4BOH A;  5K0H A;  3H7O A;  5EJZ A;  2HPQ H;  1XKB C;  1DSU A;  1AUT C;  4ZHA A;  1KDQ B;  1VZQ H;  2P59 A;  1THS H;  2YOL A;  1CBW C;  1HBT H;  3I29 A;  1C5S A;  1W12 U;  3HK6 B;  2QCY A;  2RA3 A;  4U32 A;  4H4F A;  3RXT A;  1A0J A;  3RU4 E;  3AK5 A;  2THF B;  3WWB A;  1L0Z A;  4ABD A;  3RXQ A;  1WSS H;  1JXP A;  3NWU A;  1NBM D;  1AB9 C;  4HZH A;  4AN7 A;  1BTW A;  1RTF B;  2TRM A;  2UWP A;  2BOK A;  2BY7 X;  1IQJ A;  3B8J A;  3PO1 C;  3EA8 A;  1ZGV A;  2XOK D;  2G4U A;  3N7D A;  1LHC H;  3SJI A;  4TT3 D;  1XVM A;  4FUC A;  2VWO A;  3P8N A;  3HGP A;  4E06 H;  6GCH G;  1LHD H;  2PKS C;  1IQI A;  1O5E H;  1TAL A;  2GCH F;  3NK8 A;  1O5C B;  2XRC A;  1F92 A;  3BF6 H;  1G3B A;  3A89 A;  3UQO A;  2WUB A;  1Q3X A;  4AFQ A;  1OP2 A;  4D7F A;  2F9V A;  1CA0 B;  1KXC A;  2QIQ A;  5AF9 H;  2K8I A;  1N6Y A;  2G8T A;  3P95 A;  1O33 A;  1W2K H;  2FOB A;  3WWF A;  5EW2 H;  5AHG H;  1BRA A;  1QHR B;  3AW1 A;  2SGA A;  3E1X B;  1CQQ A;  2JH0 D;  3CNR A;  1P05 A;  1TNK A;  2Y81 A;  1C1W H;  1FPH H;  1D6R A;  1GBE A;  3EA9 A;  3RXU A;  6LPR A;  1TPA E;  4KTC A;  2RFK C;  4JZI A;  3OX7 U;  2Z6B D;  1W8B H;  3RMM H;  1E34 B;  4AC9 A;  4BXS A;  5AFY H;  5EGM A;  1ETT H;  3W94 A;  3V0X A;  1UTN A;  1L2E A;  1CO7 E;  3LGW A;  3MU0 A;  5FBI A;  4RT0 A;  5A8X A;  1IQK A;  1QR3 E;  5TCC A;  1ZPC A;  2ZEC A;  4B6E A;  5LPR A;  2SNW A;  2BQ7 B;  3SGB E;  1MKX K;  1BJU A;  1O2O A;  2FOG A;  4ABA A;  3EGK H;  1SSX A;  2BZA A;  1NT1 A;  5E0J A;  4D8N A;  4FVB A;  1GHA F;  1BZX E;  5BRR E;  1Y3W A;  1PPE E;  2QF4 A;  3GDS A;  4Z0K A;  2ZQ1 A;  4WVP E;  1O2V A;  1BTX A;  2BLQ A;  3M7Q A;  3F68 H;  4X8U H;  3RML H;  3SUD A;  1VIT F;  2FIR H;  2FX4 A;  3UQV A;  3PRO A;  2R2M B;  1P06 A;  2VB0 A;  2J97 A;  2BXU H;  2YMS D;  3K2U A;  1O37 A;  5FPY A;  5HIZ A;  1B0E A;  3MU1 A;  3TLO A;  2Y5G A;  4CRD A;  1Q2W A;  1UCY E;  2VIV A;  3H7T A;  2RDE A;  5C67 A;  1GJD B;  2O8M A;  3IIT A;  2HNT F;  1F2S E;  5LPE A;  1RTK A;  1VCP A;  1CBW B;  8KME 2;  2AFQ B;  1JRS A;  1EAI A;  1KXF A;  2BLV A;  2HNT C;  3DT0 H;  5HXF A;  1GJ6 A;  1MTN C;  2F9O A;  1FMG A;  4Y8Z A;  1A5G H;  1AB9 B;  2EY4 C;  2BM2 A;  1UTK A;  1BA8 B;  4CR9 A;  1ESB A;  3PO1 B;  1E1R D;  3SHA H;  3FP6 E;  1BHX B;  4J1Y A;  3SND A;  4ZKS U;  3UUZ A;  1K1I A;  4Z6A H;  5HKK D;  1N1L A;  5CHA C;  2WPJ S;  4WME A;  4AB8 A;  4GUX A;  2A1D B;  2PKS B;  1TRM A;  3SI4 H;  1SQA A;  2RDL A;  3K6Z A;  1HJA C;  2ANY A;  1KXB A;  1GBA A;  1P2O A;  3A87 A;  5EJL A;  5CMX H;  1K1M A;  1D3Q B;  3A7W A;  3TGK E;  1KXD A;  5F8T A;  1RGQ A;  2F91 A;  2F9N A;  3LKW A;  1FY1 A;  2L6O A;  3TVJ B;  2FLB H;  2PV9 B;  1YPJ H;  3LGY A;  4ZRO A;  3KL6 A;  4D76 A;  3A8D A;  1C2I A;  2YNB A;  2BHG A;  1K28 D;  1C2D A;  2EA3 A;  1KLI H;  1BMA A;  5C0U A;  2CN0 H;  1EAW A;  1P2Q A;  2YNA A;  2OP9 A;  3URD A;  3UNR A;  4UFG H;  2AER H;  1NM6 A;  2QF3 A;  3SU2 A;  1F5L A;  2BVR H;  1IQN A;  1SGY E;  1P2J A;  2RG3 A;  4YT7 H;  1ZTJ A;  2QAA A;  3MH5 A;  3UOU A;  1GMH F;  4X1Q U;  1XUI A;  3ZVE A;  3FAN A;  1ZGI A;  5HGG A;  1AHT H;  2BD5 A;  1GJ4 H;  2OXS A;  2QA9 E;  1O2S A;  1AFQ C;  2ZPR A;  2W6I D;  2J5U A;  1O34 A;  1K9O E;  1EOL A;  1ANE A;  1PPC E;  2AGE X;  1TFX A;  2D1J A;  2Y7Z A;  2GV6 A;  3ATM A;  1OYQ A;  3GCT F;  5L2Z H;  2SGQ E;  1C5N H;  4RN6 A;  2BQ6 B;  2XBV A;  2H9E H;  2PP6 A;  5F53 A;  4WWY A;  5KED A;  2G55 A;  3OYP A;  3GYM A;  4OS5 A;  4YZU A;  4X6O A;  1FN8 A;  3TJO A;  1OOK B;  3RXP A;  1BCU H;  4MNY A;  3S9C A;  1O2M A;  1T4V H;  3UFA A;  3BG8 A;  3RXA A;  1GL0 E;  1YC0 A;  2ZQ2 A;  3LGT A;  3P92 A;  2C8X B;  1YBW A;  3OY5 U;  2GKV E;  1MTN B;  4BAH B;  1HAV A;  5EIY A;  3A8A A;  3U9A H;  1MKW H;  2AGI X;  1W0Z U;  2C90 B;  4NG9 H;  1EKB B;  4NZQ A;  3SO3 A;  1C4V 2;  2O9Q A;  3HAT H;  1Z1J A;  2BY5 X;  4X1S U;  3NCL A;  3T5F H;  3PRB A;  4E7R G;  5C5N A;  4K1E A;  2PSY A;  1ANC A;  5JBA S;  1HJ9 A;  2RCE A;  5CHA B;  3Q3Y A;  2WZQ A;  3QZR A;  4Y7A A;  4ABF A;  4WMD A;  3P17 H;  2FS9 A;  4GLY A;  3ZZD A;  3M3S A;  2G52 A;  1HJA B;  3A7X A;  2ZHE H;  3RXV A;  1OSS A;  3TJN A;  1HNE E;  1LCY A;  2ZHF H;  3QZQ A;  4NGA H;  5KGO A;  1HJ8 A;  4F49 A;  1C5X B;  2M5T A;  1BBR E;  3BTM E;  2FM2 A;  1NBM E;  3E0P B;  4B1T A;  5PTP A;  5GPI B;  3U1J B;  1OHH D;  2BX4 A;  2PTC E;  3KF2 A;  4H42 U;  1LQE A;  4OGX A;  1TE0 A;  3LIW A;  1BT7 A;  2FDA A;  3SGQ E;  1EUF A;  3SNE A;  3I77 A;  1ELV A;  1O3D A;  3KQE A;  1ZSK A;  3PMA B;  1C5Q A;  1EP5 A;  2P16 A;  1QQ4 A;  1XXF A;  5LPF A;  1HAX B;  2KX4 A;  2V3O H;  2R9P A;  1MCV A;  1MD7 A;  2A5I A;  3AAS A;  2P93 A;  1AIX H;  3B9F H;  4OGY A;  1BMF D;  2ODY B;  3ATW A;  1UO6 A;  3URC A;  4A1V A;  1AFQ B;  2ZI2 H;  3BTK E;  1FPC H;  3BTH E;  3RU4 D;  4BAN B;  1VCQ A;  2ZU2 A;  2BDB A;  2QYI A;  1HPG A;  3BSQ A;  1UTL M;  5EQR A;  2AIP A;  4X1P U;  3ZVG A;  2ZC9 H;  2ZWL H;  3PLP A;  1QBN A;  1XM1 A;  3RM2 H;  2ZO3 H;  2FO9 A;  1OP8 A;  2GCT B;  1J9C H;  4B76 A;  1HV7 A;  1AUJ A;  4WXV A;  1S82 A;  1TAB E;  1LMW B;  1FY5 A;  1UCY K;  2HAL A;  4X2X A;  3T27 A;  5ESB A;  4LXB H;  1HAI H;  1MCT A;  7KME H;  3KCG H;  4Q7Z A;  4YXW D;  2STA E;  3BTD E;  2PTN A;  2ZFR H;  4AGK A;  1WXR A;  3A7Y A;  2VVV A;  1QRZ A;  3A81 A;  1MQ6 A;  1QRW A;  2QF0 A;  3RXG A;  3MWI U;  2IN2 A;  3DUX H;  5ETX A;  3ZV8 A;  1TMB H;  3ELA H;  3MNS A;  1AN1 E;  4AG2 A;  2LPR A;  1NRS H;  1DXW A;  1K21 H;  1RD3 B;  1QB1 A;  1EB2 A;  1P2N A;  2HPP H;  3OTP A;  2F43 B;  4IC6 A;  3ITI A;  2ZFF H;  1BML A;  2EC9 H;  4Q4L A;  1LDT T;  1TRN A;  4THN H;  3M61 U;  2VVC A;  1ORF A;  4RKO B;  3SV6 A;  5FL7 D;  1QL8 A;  3GDU A;  5H4I B;  3SZN A;  3F0O A;  2ALV A;  3TPI Z;  1SOZ A;  4K1T A;  3M35 A;  3ZZ5 A;  2GZ8 A;  3FP8 E;  2PWX A;  3PMB B;  1G30 B;  2BB4 A;  3O8B A;  3LH3 A;  1MTW A;  4INK A;  4F48 B;  1DUA A;  2P8O C;  1FY8 E;  1O2Q A;  1DS2 E;  2WHX A;  5F03 A;  2OIN A;  4ASU D;  1XVO A;  2GDE H;  4O97 A;  3KQB A;  1OWJ A;  1TA6 A;  3PTB A;  1VIT H;  5JPM H;  3SU1 A;  3R3G B;  2OUA A;  1S83 A;  1EJA A;  4Y76 A;  3IG6 B;  1IQE A;  2W6J D;  1NRP H;  3EAJ A;  1AVG H;  4JCN A;  5FPT A;  1GMC F;  4MPW A;  4AFU A;  1UHB A;  1HUT H;  4UEH H;  1A5I A;  1MUE B;  1OYT H;  4IMQ A;  1O3O A;  4BNR A;  3VB5 A;  2V7Q D;  3STJ A;  1LVB A;  1BRU P;  1J15 A;  2OD3 B;  3KEE A;  1TNJ A;  2QGR A;  1RTL A;  1A61 H;  1FAK H;  2FOD A;  2IOT A;  1O5F H;  4LZ4 B;  1KLT A;  1KMH B;  2XWA A;  2K1Q A;  2VID A;  2R3Y A;  1NY2 2;  1YLD A;  4XRN A;  3TJU A;  3ZIA D;  2EST E;  1DX5 M;  1NFY A;  3OY6 U;  1YKT A;  4OS7 A;  2BDY A;  5CE1 A;  1H4W A;  1W10 U;  5EQS A;  1PQ8 A;  3L33 A;  4BAO B;  1DM4 B;  1K1J A;  4XBB A;  5DN6 D;  2WYG A;  2ZHW H;  4X8V H;  1COW D;  3F2G A;  4UFD H;  1YF4 A;  1Z6J H;  5BPE A;  3A7T A;  4IGD A;  3ZVF A;  3E6P H;  4CH8 B;  4YT6 H;  5A0A E;  1VJ9 U;  4B71 A;  2FI5 E;  3BN9 A;  3TJV A;  5FAH A;  1GBT A;  2STB E;  2FTL E;  3PLB A;  5C17 A;  1TGS Z;  3Q3X A;  4YTA A;  1KYN A;  1BDA A;  1L1G A;  1V2W T;  1O39 A;  1CT0 E;  1FN6 A;  2ZU1 A;  1C5P A;  2H9H A;  1G2L A;  3SI3 H;  3LJO A;  1CE5 A;  1D6W A;  1LTO A;  1K2I 1;  2XWB I;  3ZZ4 A;  3UPE A;  3SBK A;  3ODD A;  2ZDM A;  1TWX B;  2W3K A;  2NU3 E;  1V2J T;  1UTQ A;  2WPM S;  1AI8 H;  1QL9 A;  1GHX H;  1C1S A;  2J92 A;  2EEK A;  1KDQ A;  1DDJ A;  2W7U A;  1QUR H;  5EW1 H;  3PWC A;  3RM0 H;  1IOE A;  3CEN A;  1LQD B;  2A7J A;  4MNV A;  4BAQ B;  2GMT C;  1GBF A;  4I33 A;  3KQ5 A;  3QGN B;  3ZZ8 A;  1NU7 B;  2F3C E;  1BBR K;  1KSN A;  2A32 A;  3BTW E;  3MOC A;  4YLQ H;  3V13 A;  4D7G A;  5EST E;  1HAZ B;  4PRO A;  2TGD A;  1H9H E;  1O5A B;  3K6Y A;  3V12 A;  1DUE A;  2P8O B;  2RA0 A;  4A7I B;  2XCF A;  4KKD A;  1SGN E;  1MU8 B;  4HGC A;  3DFJ A;  3CS0 A;  3Q00 A;  1BQY A;  4O3T A;  3NRL A;  1UTM A;  5C3N A;  1SGI B;  2J34 A;  2XBW A;  4JZ1 A;  2XC4 A;  2FOA A;  2I6S A;  4NWK A;  4WF8 A;  5DP6 A;  1C2K A;  1RJX B;  4GSO A;  1O30 A; 
#chains in the Genus database with same CATH homology
 4OM9 A;  2YMS D;  4M9F A;  5FPY A;  2K0Q A;  4WH6 A;  3M5L A;  5EQR A;  4B6F A;  1FX0 B;  2P59 A;  2YMS B;  2YOL A;  1CU1 A;  2V7Q D;  5GJ4 B;  3RC6 A;  2JDI D;  3KEE A;  2CK3 D;  5EQQ A;  2A4G A;  2KR7 A;  1RTL A;  5F53 A;  2O8M A;  2JJ2 D;  2OBQ A;  3OEH D;  5CHB A;  5GND A;  1DXP A;  2KCA A;  3OYP A;  4NWL A;  3SU4 A;  2A4R A;  4B76 A;  1KMH B;  2K1Q A;  2OC7 A;  4TYD A;  4A1X A;  3AK5 A;  5C0T A;  2KZ4 A;  3WWB A;  3O8C A;  3ZIA D;  5EPN A;  1JXP A;  3EYD A;  3GS9 A;  4Q63 A;  1NBM D;  5ESB A;  3UB0 A;  3F0P A;  3SUE A;  5EQS A;  3SV8 A;  2FOM B;  4YXW D;  5DN6 D;  2GVF A;  3M5O A;  3FO8 D;  1COW D;  2FP7 B;  4R8T B;  3F2G A;  1E79 D;  3SV7 A;  1A1R A;  4A92 A;  1WXR A;  2XOK D;  3N7D A;  3FKS D;  1E1R D;  2IJD 1;  3N99 A;  4TT3 D;  3SU3 A;  4B71 A;  3F2F A;  3OE7 D;  3P8N A;  1DY9 A;  5C17 A;  5HKK D;  5ETX A;  1N1L A;  3PRB A;  3DSO A;  3P8O A;  4B73 A;  5CDF E;  3SUF A;  4ZCN A;  3DSP A;  4JMY A;  1MAB B;  2OK5 A;  2WZQ A;  3RC4 A;  2AHM E;  2F9V A;  1DXW A;  2KCY A;  2K8I A;  3O8D A;  3WWF A;  2XND D;  2XCN A;  3OTP A;  3KN2 A;  2F43 B;  4TSF D;  2IJO B;  5IK2 D;  4K8B A;  3PV5 A;  1DY8 A;  1E1Q D;  3H09 A;  3N7E A;  3M5N A;  4Q4L A;  2VBC A;  1RGQ A;  3SV9 A;  1S6L A;  3LKW A;  1W3C A;  3LON A;  2L6O A;  2KFW A;  1SKY E;  3M5M A;  3OAA D;  4B75 A;  2OC1 A;  4I31 A;  2A4Q A;  5FL7 D;  5FPS A;  5H4I B;  3SV6 A;  2FM2 A;  1NBM E;  3O8R A;  3F0O A;  1EFR D;  5IDK A;  3SU6 A;  3OEE D;  1H8E D;  3SUG A;  3RC5 A;  1NS3 A;  4I33 A;  4KTC A;  2OC0 A;  5GPI B;  2QV1 A;  3U1J B;  3F3B A;  1OHH D;  3KF2 A;  3SZE A;  2KCO A;  2F4L A;  4WH8 A;  3LOX A;  4B74 A;  3W1E A;  1W0J D;  2LEL A;  3PRD A;  5C0U A;  3E90 B;  3DCL A;  3O8B A;  3FOA A;  1W0K D;  2YMS C;  1BT7 A;  2OBO A;  5B6L A;  3SU5 A;  2XNI A;  3KNX A;  2JJ1 D;  5T1V A;  2WHX A;  2OIN A;  4ASU D;  3SU2 A;  2WV9 A;  3OFN D;  2KM0 A;  2KCP A;  4U01 A;  2WPD D;  4B6E A;  2JIZ D;  2XCF A;  5DSF A;  2WSS D;  3WW7 A;  5EPY A;  4FET A;  3SU1 A;  3VG8 A;  2OC8 A;  4I32 A;  3NRL A;  2QE7 D;  1BMF D;  4Z1M D;  1H8H D;  3FN8 A;  3F2H A;  2W6J D;  3U1I B;  2QF5 A;  2GGV B;  2W6I D;  2J5U A;  4A1T A;  4A1V A;  2QF4 A;  2F9U A;  3SYJ A;  2HLD D;  3SU0 A;  4WF8 A;  3PV2 A;  4NWK A;  2M2A A;  5FPT A;  4DT4 A;  4F55 A;  3L6P A;  3SUD A;  4XD7 D;  4RI0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...