5F53A

Nano-ring of cadmium ions coordinated by nvpizza2-s16s58
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
84
structure length
84
Chain Sequence
MFTGLNTPSGVAVDSAGTVYVTDHGNNRVVKLAAGSNTQTVLPFTGLNTPSGVAVDSAGTVYVTDHGNNRVVKLAAGSNTQTVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A cadmium chloride ring created by a designed symmetrical protein
rcsb
molecule tags De novo protein
molecule keywords NVPIZZA2-S16S58
total genus 13
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2015-12-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.500 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 5f53A00
5CHBA 3WW7A 3WWFA 5F53A 4ZCNA 3WWBA
chains in the Genus database with same CATH superfamily
4Z6AH 5EU8A 1UVPA 2ANMH 2ZU5A 1TNIA 4GHTA 3SUDA 1VKYA 3PMJA 3KNXA 3QWCH 2ASUB 4K8BA 3UAIC 3PM3A 5HMAA 1O0DH 3H5CB 3UNSA 2BY5X 5DGJA 3RXTA 1G3CA 1HAVB 1D9IA 1HJAB 1TMTH 2A7JA 3P70B 1GBDA 2W6ID 1HAIH 2HWLB 1FY8E 4SGAE 1YP9A 1N8OB 2WPJS 1NRNH 3SU6A 1F0TA 5LH8A 4AC9A 3LGYA 1ZSJA 1DWCH 5CHAB 3TH3H 2UUYA 1S83A 1FPHH 5HM9A 5A0BA 5AF9H 1KXAA 1QB9A 5I46H 3NRLA 2ZEBA 3BN9A 1LHFH 5L6NH 2CXVA 3LGTA 1MQ6A 4JZEH 4B2AA 3AW1A 4B2BA 1PPZA 1LKAA 2WZQA 3M5LA 5DSFA 3GY4A 4X6NA 2BY6X 2GCHF 3TJUA 1U6QA 1WTGH 1D3PB 1Z8IB 2V35A 4I7YH 1DANH 4MNVA 1XUIA 6LPRA 1C4V2 2ZU4A 3MFJA 3PMAB 1F0SA 1BTUA 2SGQE 1A0LA 1EP5A 1K28D 3SBKA 1DSUA 5PTPA 5GCHF 3SUGA 4R0IA 4BAKB 2BDAA 5JDUB 4ISIH 3A8DA 1P0SH 2P3TB 1LPKB 4TPIZ 1LQDB 1D6WA 3W94A 1W13U 1W3CA 5FPTA 1C5YB 3SZNA 1XX9A 1ZPBA 1NRPH 7GCHF 3RMMH 3IITA 2BDBA 1O2HA 1T4UH 2GCTC 1HAOH 5EQSA 1F5RA 4OS2A 3TK9A 4NIXA 3OFND 1Y5UT 2VWOA 7ESTE 1FN8A 3K9XB 2DUCA 1O5EH 4NIYA 1AGJA 4ZCNA 5ESBA 3OTJE 2KCOA 1EPTA 3RXJA 2QV1A 1NESE 1EX3A 2PSYA 2D26C 1V2OT 2EC9H 1EAWA 3EA7A 1C2IA 2C93B 1O2MA 4K3JA 1N1LA 2XWAA 3D62A 2NWNA 2BDYA 4B6FA 1IQGA 4P02A 4BANB 3MU5A 3BTKE 2VJ1A 1RFNA 2WSSD 3EYDA 4CHAC 1HXEH 1EAIA 1A7SA 1XUGA 2FOHA 2BD5A 5HIYA 2Y5FA 4E7RG 1TBZH 1L2EA 2UWLA 3GY2A 4UONA 3F2GA 1RGQA 1AWFH 2KR7A 3RXAA 1GVLA 3OEED 3ZYEA 4B6EA 3MHWU 2H9HA 5EXLA 1YPGH 2ZWLH 2RG3A 1CBWC 2I6QA 2QF0A 3OE7D 2ZTZA 1OWHA 1UTMA 2HALA 4AOQA 3BEFB 1ZMJA 2HNTF 2VH6A 5ESTE 4E05H 5EG4A 4A5TS 3A7VA 1W0ZU 4RKJB 2D2DA 2QXHA 1QGFA 1P3CA 1SC8U 2G8TA 5F03A 4JYTA 1O2LA 3A7YA 3BTGE 3RU4D 2J98A 1O3AA 2ZPRA 2GJGA 2BYAX 1H9IE 4YZUA 4O03A 1C1OA 3MNBA 1VJAU 1DOJA 4H6SB 2C4FH 2OC0A 2PKAA 2PLXA 1C5UA 2XRCA 1GMCF 5EJZA 2BM2A 1O3GA 5AHGH 1UCYK 1W0YH 4LZ1H 4XBBA 4IMZA 4ZHAA 2KCYA 4INHA 1FY4A 3QLPH 2H5DA 1Y3XA 4M9FA 1OWIA 1XM1A 5TCCA 2FTLE 4A7IB 1P2IA 1QL7A 4CH2B 1C5SA 1WYKA 3Q3YA 5L2ZH 4IN1A 1TRNA 1MKXH 1W0KD 1F0RA 4DY7B 3QUMP 1OWDA 3SNBA 1T32A 3TIUA 1C1WH 4K5ZA 4CRGA 2VVUA 2ZFRH 4MPWA 2Z3EA 3FZDA 3IG6B 1MAYA 2W26A 3PTNA 4A1XA 1O2VA 3NK8A 4OS7A 1T8NA 4DT7B 2XTTB 3RDZA 3RXGA 1KLIH 1GCTB 2WV4A 4FUJA 1QURH 1TNLA 2ZGHA 5JB9S 1V2VT 1O33A 4NG9H 4OS1A 1V2TT 4Y11E 3KQCA 1OP0A 1THSH 4KKDA 1WQSA 1Z1JA 3OY5U 1G3BA 1GBMA 2XWBI 3FP6E 1A3EH 1JMOH 5FPSA 2RFKC 1Q31A 2FOEA 4KP0A 3SJ9A 1GBFA 5IDKA 3PB1E 1EB2A 2P93A 4I31A 4YOGA 1PYTD 4FUDA 1GL0E 2JH0D 1TNHA 2ZGXH 1YCPH 3MQKC 5T6FA 2A45B 1MZAA 2B9LA 2STAE 1NTPA 4K60A 2FTMA 3F1SB 2XYAA 2AEIH 1Z71A 1YPJH 2ZKSA 1ZPZA 1QTFA 4TPYA 1KXDA 3SNDA 1P2JA 1O35A 1C1VH 1J8AA 4KGAA 1CGIE 3SJKA 2IJOB 4RI0A 1P2KA 3PROA 2CHAC 1O5BB 1ACBE 1D3DB 2LELA 2V0BA 2WPIS 1DE7H 1LQEA 1MTUA 2QA9E 2HGTH 3PRBA 3S9BA 1GHBG 3QGJA 2ZU2A 3T25A 4IBLH 1NO9H 4F4OC 1UTNA 1ELBA 2ZFSA 2AS9A 1SG8B 2GCHG 1TAWA 3NCLA 1WOFA 1GI4A 1P09A 1FV9A 2FS9A 4MLFB 3ZVGA 3URCA 4GCHG 1ZOMA 2F9NA 2C8XB 2WUBA 1QB1A 2AMPA 4YT6H 3ZV8A 2JJ2D 2AIQA 5DP8A 2G51A 1BTPA 4ISHH 5GPIB 2PP6A 1H9HE 3LT3A 2ZHEH 1PQ5A 3NZIA 1L1JA 3PMBB 1THRH 3BTDE 1MTSA 4OS6A 3E1XB 4D76A 2B5TB 1PPEE 2SGEE 3KYFA 1EZQA 3T2NA 4B2CA 1Z8GA 3EA8A 1BMMH 1HAVA 1SQAA 1O39A 2QGRA 1OX1A 1O5FH 1O2UA 4ABHA 3BG8A 1KDQB 2VWMA 1JWTA 1MU8B 4FU8A 5DK1A 1BZXE 1FY5A 4KTSA 4Y7BA 1C9PA 1GJ5H 2BOHB 3GICB 2ZDMA 3RXBA 4ABGA 2CV3A 1AB9C 3I77A 4OGXA 3HATH 2VWLA 1LHGH 1OYQA 5AFYH 2XOKD 5GXPA 2HNTC 2FPZA 2YNAA 3U69H 2A7CA 1BIOA 3ZYDA 1A0HB 1TABE 2P8OB 2THFB 3HPTB 1QCPA 5F6MA 2F4LA 1HXFH 2PR3A 1COWD 1O2GH 2ANYA 2W5EA 3CENA 3CNRA 4I86A 1V2RT 2C90B 3PV4A 1FIZA 2JJ1D 2TGTA 2FIRH 2PV9B 3BTEE 3LGWA 1G9IE 1KTSB 2PUQH 2EEKA 3MNCA 1TX6A 2PUXB 1H9LB 3RXFA 2ZQ2A 2FX6A 4DGJA 1KLJH 1O2IA 2Z9LA 2BQ6B 4Q7ZA 1MD7A 2Q6FA 2JH5D 2NU2E 1K21H 2QY0B 4NSVA 2WHXA 4ZHLU 2TBSA 3STJA 1QFKH 1FXYA 5H4IB 4X1NU 3PV2A 4BTUB 4AZ2B 1GCDA 1GMDG 1T7CA 1W14U 3RXHA 1P10A 2VIOA 3K65B 1ZHPA 1O3CA 1L1NA 4Q63A 1AE8H 3SU4A 5C0TA 5A0CA 4OGYA 4I32A 3SOSA 1CVWH 4GCHF 2AIPA 2ZO3H 4CRFA 1A46H 2ZTYA 3RMNH 1TA2A 1ZTKA 3HKJB 5DKMA 1O3LA 3S69A 2J9NA 1DM4B 1CU1A 2FM2A 2WPDD 1C2DA 4RSPA 1RXPA 2RA3A 1KXCA 1XKAC 2Z6BD 4YLQH 2QF4A 3S7HB 3DFLA 3ZZBA 2WPLS 3TK5A 2J2UA 3PRDA 4IMQA 9LPRA 5FBIA 1IOEA 1MD8A 3D49H 1D4PB 1O2KA 1UJ1A 1O3MA 3Q3XA 3LGVA 4KTCA 1EOJA 5A8ZA 4IS5A 3F0OA 2D8WA 1WBGB 1ZPCA 2GV6A 1YY3A 4TY7A 3P92A 4FU9A 2DE9A 4UFDH 3SJIA 1W7GH 1CHOF 3E0NB 1ABIH 2HVXA 2P3UB 4JZ1A 5JPMH 1GMDF 1WTHD 1P06A 5EPNA 1EJAA 3RXIA 1ZRKA 3SUFA 2KM0A 4DVAU 3AVZA 1ELCA 1XVOA 4FUEA 1BJUA 1CT2E 3GS9A 1HV7A 3JZ1B 3MO6A 3UREA 1S6FA 1SGNE 5AFZH 3UTUH 1O2WA 3ZZ6A 1V2NT 2QCYA 1H1BA 4AYVB 4I8HA 2WPHS 1GBCA 4U32A 3N99A 2BDGA 1UVOA 1TYNA 2ZU1A 1H8IH 2ESTE 1TPAE 2ZHDA 4BAOB 3FN8A 1HJ9A 3GY6A 1DWBH 1SR5C 3RXPA 3GDSA 4CR5A 1C2MA 3U28C 1B0FA 3RXRA 1ETRH 1AUTC 2A0QB 1DWEH 3DD2H 1P2MA 1S84A 1ESAA 3GCNA 4JK6A 3QX5H 4UFEH 2PTCE 3RLYH 4GHQA 1GJ7B 5JBTA 3T27A 4DIIH 2JH6D 2A7HA 1BMLA 2AGEX 3KQ5A 1GHAF 2HPQH 1MKXK 1TPSA 1GJ8B 1SL3A 1ZMNA 1S6LA 1WUNH 2FYQA 2YMSD 5L2YH 2Z9IA 5HKKD 3ZVEA 2XNDD 3Q77A 1YYY1 1ZMLA 2KAIB 1C2GA 2GGVB 2BLOA 2VH0A 4FU7A 3HGNA 3SUEA 3A81A 4I8GA 4ESTE 2OC1A 4BTIB 3GOVB 1BRBE 1C2EA 3UOUA 2ZU3A 3R3GB 4YTAA 2GT8A 4D9QA 1AZ8A 3OAAD 1HLTH 4GPGA 2BQWB 1W12U 2A2QH 2XC5A 1TNKA 4R8TB 3MU0A 1IQIA 1HBTH 5C94A 1BCUH 2R3UA 3RU4E 1YWUA 4IC6A 2ZPSA 1OP2A 3ODDA 1Z1IA 4D8NA 1DS2E 3F9EA 1PJPA 1AWHB 1A61H 1FONA 3TNSA 1TNJA 3UB0A 1EQ9A 2W7UA 4DOQA 3AK5A 3PV5A 4OS5A 3GYMA 9ESTA 2BDCA 1GBAA 3Q00A 2F3CE 1P02A 3RMLH 1SI5H 1NU9A 4ABIA 3D65E 2PW8H 3KQBA 5AVDA 1TALA 1PQ7A 1QA0A 1MTVA 1GI5A 1O2JA 3MU4A 2GZ8A 5EIYA 1KLTA 1AVWA 1P03A 1QQ4A 1ZHRA 1BRAA 4HFPB 1O3JA 1F5KU 1GCTC 2WYGA 2YNBA 3Q3KA 1RD3B 3PLBA 1O34A 1ABJH 1FIWA 1K1IA 1QBNA 3HK3B 2EY4C 3L3TA 2FEQH 1XVMA 3V13A 2A4RA 4Y0YE 1KXFA 1UVTH 3MO3A 3UFAA 3F2FA 4CH8B 1O30A 3RXQA 2VVVA 2J38A 1NT1A 1L4ZA 1OPHB 1CQQA 1DY9A 3ZVCA 2GTBA 1W2KH 2ZP0H 4MPUA 1IQNA 1XMNB 3STIA 1ZJKA 3RC6A 4YESB 1EASA 3LKWA 1KSNA 3C1KA 2OC7A 3ZZ9A 4X6MA 3V7TA 3HK6B 1ANEA 1IAUA 3ZVBA 4AORA 1SHHB 2ZCLP 3E91A 4OM9A 1HNEE 1K1OA 1SGDE 2PWXA 1E37B 1MMJN 3M7QA 4FUHA 3P8NA 2BHGA 3E16B 2Z9KA 1WDIA 1SLVB 1QNJA 5CDFE 2FWWA 3SV7A 1NPMA 3EAJA 1GHXH 1QB6A 1NY22 3FP8E 2FOCA 2V6NA 3GY5A 4MQAA 2ZDLA 3VXEH 1OP8A 2VNTA 3A7XA 1AN1E 2XC4A 1VCQA 4TY6A 3BV9B 4XOJA 2H1UA 3SNEA 3LJJA 1G2LA 3ODFA 1HIAA 2Z3DA 1CA0C 2ODYB 1YC0A 1YLNA 5LPFA 2XCFA 1A2CH 2GDEH 4KTUA 2BLVA 1YGCH 3MI4A 1INCA 4X2YA 3MYWA 2ZGCA 3RU4T 2A2XH 5A8YA 1TA6A 1UTJA 4AFZA 3V0XA 1E38B 2JETB 3MU8A 3VG8A 1DDJA 4NA7A 1BUIA 1TNGA 2C3SA 4A1VA 1K2I1 4ACBA 1QQUA 1BTHH 3MNXA 3ATIA 2FP7B 1C5MD 2FI3E 2P8OC 3O8DA 4XSKU 4ZKRU 1TBRH 1LHCH 3RXMA 3RXOA 2Z7FE 2B8OH 2GX4A 3MNSA 5BRRE 2ZF0H 1HDTH 1O3OA 2J34A 4ABJA 3F6UH 1SFQB 3CS7A 1Y3YA 1VITH 2CK3D 4UDWH 4CBOA 4K69A 3A7ZA 4CR9A 1JBUH 1BMFD 1EOLA 2Y80A 4F55A 1DLEA 4I33A 3SYJA 2VU8E 1SLXB 1A5IA 3E3TA 1YF4A 4A6LA 1G3EA 2BB4A 3DFJA 1AE5A 4JK5A 3RM2H 1TGCA 2F91A 1K9OE 4ZAEA 1UK3A 2ZFPH 1UCYH 4X8UH 3QZRA 4H4FA 4HG6A 3VXFH 2OLGA 4NCYA 3VB4A 2AGIX 2XCNA 3MO9A 3H7TA 2BD4A 2RDLA 1BHXF 1SGIB 1CSOE 3H7OA 4Z1MD 1N6XA 1TQ7B 4FXGH 1PYTC 1DLKB 1SOTA 4YLUA 1AFQC 1CBWB 1ZRBA 3TITA 2BDHA 1DPOA 2VIPA 1ZJDA 3GDUA 3SO3A 1FY3A 3RXDA 1CT0E 1EKBB 1T4VH 2ZDAH 2ZHWH 4TWYA 1NFYA 1EAXA 3EE7A 1C5ZB 1RTFB 3TVJB 1MTNC 1TWXB 1YPHE 3QZQA 3NXPA 3KGPA 3TJNA 1NU7B 1GMHF 2C8YB 1WV7H 1BHXB 4VGCC 3RC4A 3GCTF 4ASUD 2TRMA 4GAWA 1K0HA 1CA8B 1P12E 1AZZA 3TPIZ 2CHAB 1ESBA 2BOKA 1UTLM 1O2ZA 3PMHB 4MPXA 4NA9H 2PFEA 1AB9B 1TPOA 1UVSH 3BTTE 2BVSH 1DSTA 1C5VA 1ZTLA 2PKSB 1RIWC 4ZH8A 1O2OA 3TK6A 1D3TB 1FJSA 4BAQB 2EQNA 1SPJA 1J15A 2BTCE 2BMGB 2BLWA 2TIOA 3MTYA 2ZA5A 2QXGA 1ELDE 4J2YB 2B7DH 3SHAH 1Y5BT 4X2VA 4LOYH 1PPFE 4AG1A 1O3HA 6CHAB 5K7RA 2ZI2H 2R2MB 3I29A 2G4UA 3QN7A 6CHAC 3S7KB 1ETSH 4ABEA 1QY6A 1TX7A 4BNRA 2LP6A 3PYHA 3LC3A 4Y10E 4E7NA 3FZZA 1MCTA 1NBME 2P59A 1TGNA 4Q7YA 1GJCB 1SGPE 5T1VA 1NN6A 1OKXA 4MNWA 3VB7A 1PPCE 5F53A 3ZZ8A 4I8LA 1NS3A 4UEHH 2BD2A 8GCHF 3FVFB 1ARBA 3ENSB 3V12A 2ZFQH 4X2WA 3NUMA 1XUJA 1W11U 1L0ZA 1PPBH 5DP5A 3D23A 3QO6A 1C5LH 1HAXB 2J95A 1C1PA 1O36A 2RCEA 1K1NA 2H9TH 1ANBA 2BY9X 5E8EH 1O2YA 1Q3XA 1DXWA 1AKSB 1WAYB 5IYTA 1V2MT 2QF3A 1H4WA 3BSQA 3VB3A 1G2MA 4TYDA 1LTOA 1DITH 4DW2U 3TU7H 1BTYA 1RIWB 2FX4A 3B8JA 2W7SA 1Z8RA 2VB0A 3O8BA 2XC0A 4XRNA 4H42U 2O8UA 2QAAA 5SGAE 1LCYA 2JETC 3SNAA 2VIWA 1GHYH 1SSXA 4CREA 1TRMA 1SGTA 1EB1H 1LDTT 3TGJE 1WCZA 3SHCH 3LJOA 3SGAE 4M7GA 5E0GA 1KXBA 2FO9A 1AFQB 1BA8B 5FHTA 3WY8A 3ZZCA 1CE5A 2SFAA 3KIDU 3N7EA 3F9FA 1AUJA 1ELFA 1ZR0A 2CN0H 1Y59T 3PTBA 4FUBA 5B6LA 5EXMA 2BX3A 2GV7A 1S0RA 1J14A 1SLUB 1O37A 4CRDA 1VGCC 2F9VA 3KQDA 4B75A 1RTLA 1H8DH 2BQ7B 3GCOA 1O2XA 2BZ6H 2IPQX 3PLKA 1A3BH 4ABAA 1ETTH 1TB6H 1S85A 2CJIA 1S5SA 1C5PA 4U30A 3ZZ4A 2VBCA 2OXSA 1LVBA 3A7WA 2ZFTA 4HZHA 5EOKA 1Z7KA 3OTPA 1GPZA 4X1PU 1VR1H 3RLWH 2A5AA 1EJMA 3GY8A 4DT4A 2FLRH 1V2LT 3SU2A 4B76A 5KECA 1JIRA 1OS8A 3GCHB 2D1JA 1AI8H 1N6YA 2G52A 2ZTXA 1V2JT 1QRXA 3SZEA 2ZDNA 1YPLH 1W0JD 1TQ0B 1UK4A 1GI8B 2Q6GA 3PWCA 1O38A 1TFXA 4BXWA 1GHVH 1IQFA 1CA0B 2HLDD 1GI0A 1X7AC 5EJ1A 2BXTH 5G4BA 2A31A 5EPYA 2ZDVH 5JBCS 1MZDA 4JCNA 2KX4A 3IWMA 2FLBH 1NC6A 3ZZ3A 2GCTB 2Q1JA 1GMCG 1Y3WA 2EI7A 3I78A 6GCHF 1O3KA 3A88A 4CRAA 2Y5HA 3ZVAA 1P57B 1ANDA 3SNCA 1P04A 3SV8A 1C5RA 3BF6H 1OOKB 4XDEA 1T8OA 3P6ZB 4D7FA 2FODA 3E90B 4Y8XA 4CRBA 1FPCH 3RUOA 3LGUA 3SW2B 1ZHMA 1EZSC 5HXFA 3MH7A 1SMFE 3JZ2B 4DJZB 2FS8A 5C1UA 3A87A 3GY3A 3QTVH 1QRWA 1HRTH 3SU3A 3ZZDA 2TGAA 3WWFA 5F8ZA 3U8TH 2V3OH 4WMDA 2BY8X 2BVRH 1MU6B 1F92A 2Y7XA 1VCPA 5DJ7A 1C4Y2 1T31A 1V2KT 4ZXYH 1QL8A 2OTVA 3TJVA 1GMHG 1H8HD 3TLOA 3RXEA 2O9QA 4BOHA 2F83A 1YPKH 1C9TA 2VGCC 2FOMB 1TIOA 2FI5E 4Q7XA 1HFDA 3A84A 3A8CA 2M5TA 2ZCHP 3VGCC 1UMAH 1TE0A 4U01A 4NFFA 2HLCA 1GG6B 2PSXA 3GDVA 1EXFA 1GI9B 4Y71A 1ZSLA 1CO7E 1EJNA 1UTQA 1GG6C 2B0FA 5HYOA 2XBVA 2AHME 1AKSA 1QR3E 4VGCB 2GMTB 1P2QA 3DSGA 4K2YA 1MTNB 1HUTH 1UTOA 1FX0B 1ELGA 1QRZA 2Z9JA 1XKBC 1GVKB 5FCKA 1EPTB 5DP4A 4ABFA 1HYLA 3TGKE 5FAHA 5EQQA 3RXVA 5A09A 1AHTH 3BTWE 4MDSA 1C1RA 2K1QA 1HB0B 3HGPA 1QJ6B 4O97A 2QF5A 2RA0A 3FANA 4ACAA 4FUIA 5E0HA 1SB1H 1GGDC 3GCTG 1TLDA 1Z8JB 1GDQA 2HPPH 2C8ZB 2A1DB 2VVCA 3SORA 1GI2A 1P05A 1V2UT 3S9CA 2CF8H 3F0PA 4DURA 2F9BH 1MH0A 3M3TA 1K1MA 2TGPZ 3UWIA 3PO1B 1KXEA 1A5HA 4AB8A 4GSOA 4JYVH 3WW7A 4CRCA 5HIZA 1S6HA 2SGPE 1GL1A 2SGFE 5E2OA 3ZZ7A 1IHTH 1HJ8A 2NU0E 2P95A 3RP2A 1WXRA 4X8SH 2ALVA 2R9PA 3BTHE 1LVMA 3DHKH 3UUZA 4B74A 5C17A 3SU1A 1W8BH 5A0AE 1C1MA 2FOGA 2OD3B 2JIZD 2PKAB 1DUAA 1GBJA 1NZQH 1GBLA 1GBBA 3VB5A 5GJ4B 2BVXH 1HAYB 4Y8ZA 1HGTH 1IQLA 1AVGH 2UWOA 3UR9A 1AFEH 3BG4C 3SGQE 1VZQH 2A5IA 1C1TA 3VPKA 4KELA 1WU1A 5IK2D 1E1QD 4JYUH 2OUAA 4HTCH 5ETXA 5DPAA 1P11E 1RTKA 3ATMA 4NZLA 5C3NA 3R0FA 5DN6D 3MWIU 2O8WA 2QYIA 1MTWA 2YMSB 3UNRA 3T26A 3DA9B 1NRSH 5JYIA 2J4IA 1QZ8A 5EQRA 1ZSKA 1O3NA 3TH4H 2F9PA 4Z0KA 1G32B 1RRKA 3T29A 5LPEA 2ZC9H 2W3IA 3P8GA 4NFEA 2CF9H 1DVAH 1GVZA 1LPZB 1SOZA 1ESTA 2A32A 4JZFH 3EE0B 1GJBB 4XBCA 3B9FH 2F9UA 1BTWA 1Q2WA 1V2PT 4ISLA 3T62A 1CGHA 5CE1A 2OBQA 1O2RA 1EUFA 3TNTA 5T6GA 3ZIAD 4SGBE 1Y3UA 3RXLA 1UVUH 2JDID 4UD9H 4NIVA 6ESTA 1YPEH 2FMJA 3F2HA 2ULLA 2ZNKH 1J16A 3KHVA 4YOJA 2G4TA 3S9AA 1ELEE 1O5AB 4AN7A 4XFQA 1DFPA 4NGAH 1P2OA 3A82A 5CMXH 2AMQA 3RXKA 3T28A 1F7ZA 1LO6A 3ZVFA 1BB0B 1GBIA 2RDEA 3ZZ5A 6GCHG 2VIDA 1SGEE 4AFQA 1HPGA 1BMAA 3F9HA 1C5QA 2PGBB 1KTTB 4X8TH 1AVXA 1TX8A 1P8VC 2BY7X 1YCPK 3MH6A 5L30H 1O3IA 5CHAC 3OX7U 1CHOG 2FDAA 3EQ0H 2Z94A 4X6PA 1Z6EA 1GI1A 3BIVH 2O8LA 1OWJA 2P16A 1E34B 1TMBH 5DP7A 4AYYB 4IC5A 5I25A 3SV6A 1W7XH 1TGTA 4FUFA 1O3DA 1QJ7B 5C20A 3OY6U 5A8XA 2OQ5A 1HAPH 2BD3A 1EZUC 2WPKS 5JBBS 4NWKA 2BXUH 5HGGA 2M2AA 5DP3A 1JOUB 1GBHA 4NSYA 1VITG 3PO1C 3SGBE 1EAUA 5EW1H 2OQUA 5DO4H 3DT0H 1BMNH 3AAVA 1K1PA 1Y3VA 4D9RA 3AAUA 1AIXH 1C1SA 1G36A 1GBTA 2H6MA 1AO5A 1QBVH 2TGDA 4NA8A 1BRCE 2FZZA 1EP6A 4NIWA 3UWJH 3M7UA 2EA3A 1OYTH 3F3BA 2QN5T 1H8ED 3VB6A 1Y5AT 1O3EA 5A2MH 2FESH 2AGGX 2FOFA 2WINI 3U8RH 3BIUH 2BD8A 2HRVA 2YMSC 2R0KA 1NROH 3AASA 3ATWA 4CHAB 2Y6TA 1ZYOA 2ANKH 2W6JD 4UE7H 4UFGH 8LPRA 3ZZAA 4Q2KA 4WH8A 2ZZUH 1VGCB 1MBMA 4ZHMU 1E36B 1T8LA 3PLPA 4O9VA 1E0FD 1K1LA 2UUKB 2YOLA 2AMDA 3AW0A 3EDXB 2G00A 3LH1A 5EW2H 2OCVB 3SU0A 2IJD1 2G55A 1P01A 4A1TA 2NU3E 1SGQE 2ODQA 2STBE 2TPIZ 2ODPA 4DIHH 3GYLB 1AY6H 1KYNA 1ELTA 1IQKA 1O2QA 3SJ8A 2NU4E 1D6RA 3KN2A 3VEQB 4IN2A 4MNXA 3LONA 1G30B 3SQEE 3UQVA 1DY8A 1K22H 2OBOA 2ZPQA 2WV9A 2NU1E 2V3MA 2ILNA 5KGOA 4AGJA 1VJ9U 4RKOB 2QXIA 1ELAA 1C5NH 1O3FA 1GJAB 2VIQA 3RXCA 4LZ4B 3CS0A 2WUCA 2L6OA 1GGDB 2GP9B 3MU1A 3RM0H 4RN6A 2SNWA 2LPRA 3SV9A 5C5OA 4ZXXH 2JKHA 4TSFD 4BXSA 5KEDA 3B23B 3BTQE 4DCDA 1YLDA 4HI3A 2ZHFH 2BX4A 3BTME 1SGFG 1GJ6A 5FCRA 3KYGA 3UQOA 1JIMA 4P00A 4UFFH 3UY9A 1GI6A 4Q80A 4XE4A 3M7TA 2AYWA 2L74A 5EGMA 5JB8S 3M61U 5JBAS 1HJAC 4WMFA 1C5WB 2R3YA 3FP7E 3TJOA 1F0UA 1M9UA 1QHRB 2VWNA 2HVYB 3P95A 1OWKA 2FYRA 4FVBA 8ESTE 3RXUA 4XD7D 1MKWK 2O8MA 2ZCKP 4X1SU 3ITIA 3A89A 2FXRA 1E79D 3M5OA 3M5NA 1UHBB 1KDQA 1O2TA 3TGIE 2KAIA 4ABBA 4ZKSU 2Z9GA 1T8MA 1GWAA 5FX5A 5C2ZA 1XXDA 3SQHE 1XUFA 1C2KA 1V2ST 2EI8A 3GCHC 4YM9A 1FMGA 4AGKA 4F48B 1C1UH 5TCAA 2SNVA 3A83A 2H2ZA 4JMYA 1GI3A 2QC2A 2G5VA 5GWZA 1LVOA 2J98B 1VITF 1AMHA 5F8XA 2Y82A 3BTFE 1HAGE 2KZ4A 3M37A 4YOIA 1GDUA 1RS0A 1O3BA 3W95A 1FAXA 1P9SA 1MUEB 1S81A 4XBDA 1LHEH 2UUJB 2GZ7A 3LOXA 4X2XA 2P94A 1ANCA 1SBWA 1TOCB 1GJ9B 1OHHD 1FUJA 1ZGVA 4WVPE 2PKSC 5J4QA 1SHYA 3LGIA 1IQMA 1WQVH 3E8LA 2PGQB 1BBRH 4TWWA 3KQEA 1UW7A 1HAHH 3P17H 3W1EA 1EPTC 1TRYA 5K0HA 3KEEA 4B1TA 2Z3CA 3QGNB 4DG4A 3RMOH 2SGDE 1FN6A 4ABDA 1NBMD 3LC5A 2Y5GA 3C27B 1BQYA 3KL6A 4GUXA 5E2PA 5DG6A 3RXSA 5C0UA 2ZG0H 1IHSH 1TGSZ 1ZTJA 4IGDA 1S0QA 2Y81A 4HGCA 1AD8H 1IQEA 5EJLA 2FOAA 1EATA 1B7XB 2XBYA 1GHAG 2HOBA 4OS4A 1A0JA 3M3SA 1N8OC 1SLWB 4QT8C 5LPRA 1SVPA 1C5TA 5T3HA 2KCAA 1SKYE 2WPMS 2AERH 1ELVA 1FLEE 4GLYA 4ISOA 3OU0A 1V2WT 3L6PA 3EA9A 4WF8A 2BZAA 3BEUA 2BD7A 1O2NA 2CGAA 1MCVA 4H6TA 1QBOA 2WYJA 5GNDA 4JZDH 2Q6DA 3VGCB 3DSPA 2LNCA 4Y6DA 1Y8TA 4IW4E 5GIBA 3ZVDA 4GVUA 4FETA 2BD9A 1KY9A 3QDZB 5GDSH 3HKIB 1VCWA 1W10U 2HNTE 2XBWA 3LIWA 1LKBA 1UCYE 5EXNA 1QJ1B 1SGFA 2XNIA 3QTOH 3M35A 1LVYA 1S82A 3MH4A 3SI4H 2R0LA 2V7QD 4MG3A 4Y8YA 4JZIA 3H09A 1C1QA 1BTXA 1QIXB 1TONA 1J9CH 2O8TA 1UTKA 1TGBA 1TOMH 5E0JA 3MOCA 3SI3H 1SQTA 4X1RU 3T5FH 3ELAH 4AFUA 1DX5M 3U1JB 2ZECA 1V6DA 3DCLA 2QIQA 3LDXH 1E1RD 2ZQ1A 4AX9H 1KMHB 1D3QB 4MVNA 2DE8A 1C2FA 4K1SA 2ANWA 1JRSA 1JRTA 1P3EA 4I8KA 4O3TA 2BDIA 4AFSA 3U1IB 1SQOA 1FZZA 2SGAA 2PTNA 3K6ZA 4U2WA 3TH2H 1BOQA 2VIVA 1C5XB 1YLCA 4WJG2 1C1NA 3UOPA 3E6PH 3URDA 3E0PB 4X8VH 1YPHC 5C1YA 2IOTA 1MQ5A 1C2HA 1MAXA 4X1QU 3SN8A 4YO9A 1BBRK 4RT1A 4ZKOU 1XUHA 2XW9A 3A7TA 4K1TA 4Q4LA 1B5GH 3BG4B 2GKVE 1SGYE 7KMEH 1FQ3A 1GHBF 1JXPA 1GDNA 1NFXA 4MTBA 1O5DH 1GBKA 2G5NA 2ZGJA 1GJ4H 3LU9B 2A4GA 4E06H 3PWBA 1P2NA 3OYPA 1THPB 1DT2A 3KCGH 3VFEA 2OINA 5CHBA 1O31A 5FX6A 1FI8A 1GI7B 2V3HH 1QL9A 5C5NA 1PFXC 2KCPA 1FY1A 1NFWA 2W3KA 1LHDH 1WSSH 3ATKA 4WY3A 1E35B 1L4DA 2A4QA 1O5GH 4TT3D 4THNH 4AB9A 1A1RA 4F49A 4ZKNU 7GCHG 4Y7AA 1EFRD 1FDPA 3Q76A 5BPEA 3K2UA 5T6DA 1K1JA 1B0EA 1NRRH 3A8AA 2OC8A 1OWEA 1NM6A 4ZMAH 1BDAA 4ISNA 4LXBH 1TPPA 1MABB 3MH5A 4LK4A 1IQHA 3U98H 1CGJE 1P9UA 2H5CA 3P8OA 1NRQH 5GCHG 1NFUA 5F8TA 1TMUH 1O3PB 3SJOA 4I8JA 5FL7D 2Y7ZA 2A5KA 4K8YA 4BTTB 5ABWA 1DXPA 4X6OA 3UPEA 1HCGA 4INLA 4K1EA 3DSOA 3WWBA 1C2JA 3U9AH 1ZZZA 2ZDKA 2VINA 3ZV9A 3OEHD 2OP9A 1UK2A 1PPHE 1ID5H 2J5UA 3G01A 3GISB 8GCHG 2GVFA 2J92A 1BRUP 1BTZA 5FPYA 1V3XA 1YPMH 3SV2H 1HIAB 3A8BA 1BITA 1YCPM 2AFQB 1SGCA 5HM2A 3F9GA 3O8RA 5EODA 2K0QA 2VGCB 5C67A 2GMTC 3UNQA 4J1YA 2GDDA 4ZROA 3U8OH 4WMEA 2QXJA 1G37A 3UR6A 1DWDH 4NZQA 4AG2A 2A4OA 5FBEA 3FO8D 2ZFFH 1PQ8A 2XBXA 1L1GA 2QE7D 1FNIA 3M36A 1C4U2 1GBEA 1LPGB 4RT0A 2F9OA 3UIRA 3M5MA 2UUFB 1DICA 5TJXA 1FAKH 8KME2 1F5LA 2ZHQH 1ARCA 1KIGH 2EI6A 3P8FA 3OSYA 4PROA 1QA7A 1GHZA 2R2WU 4O3UA 2C8WB 4ZUHA 3V3MA 1XUKA 4FUCA 3LH3A 3S0NA 1BBRE 3SU5A 2BLQA 3MMGA 1PPGE 1UO6A 2FOBA 1XXFA 2J94A 7LPRA 3L33A 2I6SA 3K6YA 3GY7A 2UWPA 4BAMB 2IPHA 1O5CB 1OXGA 4WXIA 1DUEA 4WWYA 3ESTA 4ASHA 3FAOA 1AU8A 3LPRA 4WXVA 1ZLRA 1MBQA 1A5GH 2FI4E 3FKSD 5DP9A 3ATLA 1RJXB 3EGKH 5DP6A 5B6OA 2G81E 1F2SE 2PHBA 2H9EH 3FOAA 1LMWB 4B71A 3A80A 4MPVA 1A4WH 1J17T 3F68H 1G3DA 1PQAA 2OK5A 2ZGBH 3CP7A 4D7GA 1AQ7A 1CHGA 4B73A 2GZ9A 2KFWA 4FUGA 4BAHB 1SQRA 4INKA 2F43B 3DUXH 1YBWA 4FOUC 2GT7A 1OSSA 1TBQH 1HAZB 2P3FH 3A85A 4WH6A 4Y0ZE 3N7DA 1IQJA 2ALPA 4FVDA 1SGRE 3A86A 2IN2A 1O2PA 4Y79A 1MKWH 1V2QT 1Z6JH 4YXWD 5J4SA 1BT7A 5C1XA 3NKKA 1YM0A 4A92A 3NPSA 5LGOA 4MNYA 2J97A 1C2LA 2ZIQH 4X0WU 4Y76A 2CMYA 1O2SA 3QK1A 1UTPA 1YKTA 3O8CA 1ZGIA 1C5OH 2GD4B 3FFGA 1UHBA 3N7OA 4YT7H 5FXLA 1EZXC 2WV5A 1CT4E 3NWUA 3KF2A 4NWLA 1SFIA 1GJDB 1ORFA 2XXLA 1GHWH 3RC5A 3M3VA 1O32A 3BEIB 2AH4X 2K8IA 4CBNA 1BJVA
chains in the Genus database with same CATH topology
2L6OA 4Q4LA 3SU3A 5GJ4B 3F0OA 3WWFA 2WSSD 3EYDA 3SV9A 3M5MA 2XCFA 4TSFD 1JXPA 3SUDA 3SV6A 3KNXA 4K8BA 2XOKD 3UB0A 5IK2D 3N7EA 3AK5A 1E1QD 2A4GA 3PV5A 5EPNA 2F4LA 1SKYE 2KCAA 4NWKA 3F2GA 3OYPA 5ETXA 3SUFA 1RGQA 2KM0A 3VG8A 1COWD 1H8HD 2KR7A 4A1VA 4ASUD 3SU5A 2W6ID 5B6LA 2OINA 5CHBA 2M2AA 3OEED 3L6PA 4WF8A 5FPSA 5DN6D 4B6EA 3GS9A 2YMSB 2FOMB 2JJ1D 2KCPA 3SU6A 5IDKA 2FP7B 3OE7D 3O8DA 4U01A 4I31A 2A4QA 4TT3D 5GNDA 2F9VA 4XD7D 3DSPA 5EQRA 2O8MA 1A1RA 4B75A 5C0UA 1RTLA 2AHME 3N99A 1EFRD 1E79D 3M5OA 3NRLA 3M5NA 4FETA 2CK3D 3FKSD 2OC8A 1FX0B 3FOAA 3FN8A 2WZQA 1MABB 1BMFD 3M5LA 2IJOB 2A4RA 2VBCA 4RI0A 5DSFA 4B71A 3P8OA 4I33A 3SYJA 3F3BA 4F55A 2XNIA 2WHXA 5EQQA 1H8ED 2P59A 1NBME 2LELA 3F2FA 2OK5A 2V7QD 2F9UA 5H4IB 3OTPA 2K1QA 3PV2A 5T1VA 4DT4A 5FL7D 4B73A 5F53A 2YMSC 3PRBA 2KFWA 3SU2A 4B76A 2OBQA 2QF5A 3H09A 1DY9A 1NS3A 2F43B 1DXPA 2OC0A 2W6JD 4Q63A 3SUGA 3ZIAD 4WH8A 3SU4A 3SZEA 5C0TA 4JMYA 2JDID 3DSOA 3RC6A 3WWBA 1S6LA 4I32A 3N7DA 1W0JD 2XCNA 2YOLA 2YMSD 4WH6A 5HKKD 2KCYA 3F2HA 3LKWA 3OEHD 3SU0A 2KZ4A 2XNDD 2OC7A 2IJD1 5FPTA 1W3CA 4Z1MD 4A1TA 3F0PA 2J5UA 2JJ2D 4M9FA 2GGVB 2GVFA 3LOXA 3U1JB 2HLDD 3DCLA 4YXWD 1E1RD 1BT7A 5FPYA 5GPIB 1DXWA 1OHHD 3SUEA 5EPYA 3KN2A 4A92A 4OM9A 1KMHB 5EQSA 1CU1A 2FM2A 2WPDD 1W0KD 2OC1A 3LONA 4TYDA 4B6FA 3OFND 3P8NA 3U1IB 3O8CA 3WW7A 3O8RA 1DY8A 2K0QA 2OBOA 2QF4A 4ZCNA 5ESBA 2KCOA 3O8BA 3W1EA 2WV9A 2QV1A 5CDFE 3PRDA 3SV8A 3KF2A 3SV7A 1WXRA 3OAAD 3KEEA 4NWLA 4A1XA 3E90B 4R8TB 3RC5A 1NBMD 4B74A 5C17A 3SU1A 3FO8D 2JIZD 4KTCA 3RC4A 1N1LA 2K8IA 2QE7D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CHB A;  3WW7 A;  3WWF A;  5F53 A;  4ZCN A;  3WWB A; 
#chains in the Genus database with same CATH topology
 4Z6A H;  5EU8 A;  1UVP A;  2ANM H;  2ZU5 A;  1TNI A;  4GHT A;  3SUD A;  1VKY A;  3PMJ A;  3KNX A;  3QWC H;  2ASU B;  4K8B A;  3UAI C;  3PM3 A;  5HMA A;  1O0D H;  3H5C B;  3UNS A;  2BY5 X;  5DGJ A;  3RXT A;  1G3C A;  1HAV B;  1D9I A;  1HJA B;  1TMT H;  2A7J A;  3P70 B;  1GBD A;  2W6I D;  1HAI H;  2HWL B;  1FY8 E;  4SGA E;  1YP9 A;  1N8O B;  2WPJ S;  1NRN H;  3SU6 A;  1F0T A;  5LH8 A;  4AC9 A;  3LGY A;  1ZSJ A;  1DWC H;  5CHA B;  3TH3 H;  2UUY A;  1S83 A;  1FPH H;  5HM9 A;  5A0B A;  5AF9 H;  1KXA A;  1QB9 A;  5I46 H;  3NRL A;  2ZEB A;  3BN9 A;  1LHF H;  5L6N H;  2CXV A;  3LGT A;  1MQ6 A;  4JZE H;  4B2A A;  3AW1 A;  4B2B A;  1PPZ A;  1LKA A;  2WZQ A;  3M5L A;  5DSF A;  3GY4 A;  4X6N A;  2BY6 X;  2GCH F;  3TJU A;  1U6Q A;  1WTG H;  1D3P B;  1Z8I B;  2V35 A;  4I7Y H;  1DAN H;  4MNV A;  1XUI A;  6LPR A;  1C4V 2;  2ZU4 A;  3MFJ A;  3PMA B;  1F0S A;  1BTU A;  2SGQ E;  1A0L A;  1EP5 A;  1K28 D;  3SBK A;  1DSU A;  5PTP A;  5GCH F;  3SUG A;  4R0I A;  4BAK B;  2BDA A;  5JDU B;  4ISI H;  3A8D A;  1P0S H;  2P3T B;  1LPK B;  4TPI Z;  1LQD B;  1D6W A;  3W94 A;  1W13 U;  1W3C A;  5FPT A;  1C5Y B;  3SZN A;  1XX9 A;  1ZPB A;  1NRP H;  7GCH F;  3RMM H;  3IIT A;  2BDB A;  1O2H A;  1T4U H;  2GCT C;  1HAO H;  5EQS A;  1F5R A;  4OS2 A;  3TK9 A;  4NIX A;  3OFN D;  1Y5U T;  2VWO A;  7EST E;  1FN8 A;  3K9X B;  2DUC A;  1O5E H;  4NIY A;  1AGJ A;  4ZCN A;  5ESB A;  3OTJ E;  2KCO A;  1EPT A;  3RXJ A;  2QV1 A;  1NES E;  1EX3 A;  2PSY A;  2D26 C;  1V2O T;  2EC9 H;  1EAW A;  3EA7 A;  1C2I A;  2C93 B;  1O2M A;  4K3J A;  1N1L A;  2XWA A;  3D62 A;  2NWN A;  2BDY A;  4B6F A;  1IQG A;  4P02 A;  4BAN B;  3MU5 A;  3BTK E;  2VJ1 A;  1RFN A;  2WSS D;  3EYD A;  4CHA C;  1HXE H;  1EAI A;  1A7S A;  1XUG A;  2FOH A;  2BD5 A;  5HIY A;  2Y5F A;  4E7R G;  1TBZ H;  1L2E A;  2UWL A;  3GY2 A;  4UON A;  3F2G A;  1RGQ A;  1AWF H;  2KR7 A;  3RXA A;  1GVL A;  3OEE D;  3ZYE A;  4B6E A;  3MHW U;  2H9H A;  5EXL A;  1YPG H;  2ZWL H;  2RG3 A;  1CBW C;  2I6Q A;  2QF0 A;  3OE7 D;  2ZTZ A;  1OWH A;  1UTM A;  2HAL A;  4AOQ A;  3BEF B;  1ZMJ A;  2HNT F;  2VH6 A;  5EST E;  4E05 H;  5EG4 A;  4A5T S;  3A7V A;  1W0Z U;  4RKJ B;  2D2D A;  2QXH A;  1QGF A;  1P3C A;  1SC8 U;  2G8T A;  5F03 A;  4JYT A;  1O2L A;  3A7Y A;  3BTG E;  3RU4 D;  2J98 A;  1O3A A;  2ZPR A;  2GJG A;  2BYA X;  1H9I E;  4YZU A;  4O03 A;  1C1O A;  3MNB A;  1VJA U;  1DOJ A;  4H6S B;  2C4F H;  2OC0 A;  2PKA A;  2PLX A;  1C5U A;  2XRC A;  1GMC F;  5EJZ A;  2BM2 A;  1O3G A;  5AHG H;  1UCY K;  1W0Y H;  4LZ1 H;  4XBB A;  4IMZ A;  4ZHA A;  2KCY A;  4INH A;  1FY4 A;  3QLP H;  2H5D A;  1Y3X A;  4M9F A;  1OWI A;  1XM1 A;  5TCC A;  2FTL E;  4A7I B;  1P2I A;  1QL7 A;  4CH2 B;  1C5S A;  1WYK A;  3Q3Y A;  5L2Z H;  4IN1 A;  1TRN A;  1MKX H;  1W0K D;  1F0R A;  4DY7 B;  3QUM P;  1OWD A;  3SNB A;  1T32 A;  3TIU A;  1C1W H;  4K5Z A;  4CRG A;  2VVU A;  2ZFR H;  4MPW A;  2Z3E A;  3FZD A;  3IG6 B;  1MAY A;  2W26 A;  3PTN A;  4A1X A;  1O2V A;  3NK8 A;  4OS7 A;  1T8N A;  4DT7 B;  2XTT B;  3RDZ A;  3RXG A;  1KLI H;  1GCT B;  2WV4 A;  4FUJ A;  1QUR H;  1TNL A;  2ZGH A;  5JB9 S;  1V2V T;  1O33 A;  4NG9 H;  4OS1 A;  1V2T T;  4Y11 E;  3KQC A;  1OP0 A;  1THS H;  4KKD A;  1WQS A;  1Z1J A;  3OY5 U;  1G3B A;  1GBM A;  2XWB I;  3FP6 E;  1A3E H;  1JMO H;  5FPS A;  2RFK C;  1Q31 A;  2FOE A;  4KP0 A;  3SJ9 A;  1GBF A;  5IDK A;  3PB1 E;  1EB2 A;  2P93 A;  4I31 A;  4YOG A;  1PYT D;  4FUD A;  1GL0 E;  2JH0 D;  1TNH A;  2ZGX H;  1YCP H;  3MQK C;  5T6F A;  2A45 B;  1MZA A;  2B9L A;  2STA E;  1NTP A;  4K60 A;  2FTM A;  3F1S B;  2XYA A;  2AEI H;  1Z71 A;  1YPJ H;  2ZKS A;  1ZPZ A;  1QTF A;  4TPY A;  1KXD A;  3SND A;  1P2J A;  1O35 A;  1C1V H;  1J8A A;  4KGA A;  1CGI E;  3SJK A;  2IJO B;  4RI0 A;  1P2K A;  3PRO A;  2CHA C;  1O5B B;  1ACB E;  1D3D B;  2LEL A;  2V0B A;  2WPI S;  1DE7 H;  1LQE A;  1MTU A;  2QA9 E;  2HGT H;  3PRB A;  3S9B A;  1GHB G;  3QGJ A;  2ZU2 A;  3T25 A;  4IBL H;  1NO9 H;  4F4O C;  1UTN A;  1ELB A;  2ZFS A;  2AS9 A;  1SG8 B;  2GCH G;  1TAW A;  3NCL A;  1WOF A;  1GI4 A;  1P09 A;  1FV9 A;  2FS9 A;  4MLF B;  3ZVG A;  3URC A;  4GCH G;  1ZOM A;  2F9N A;  2C8X B;  2WUB A;  1QB1 A;  2AMP A;  4YT6 H;  3ZV8 A;  2JJ2 D;  2AIQ A;  5DP8 A;  2G51 A;  1BTP A;  4ISH H;  5GPI B;  2PP6 A;  1H9H E;  3LT3 A;  2ZHE H;  1PQ5 A;  3NZI A;  1L1J A;  3PMB B;  1THR H;  3BTD E;  1MTS A;  4OS6 A;  3E1X B;  4D76 A;  2B5T B;  1PPE E;  2SGE E;  3KYF A;  1EZQ A;  3T2N A;  4B2C A;  1Z8G A;  3EA8 A;  1BMM H;  1HAV A;  1SQA A;  1O39 A;  2QGR A;  1OX1 A;  1O5F H;  1O2U A;  4ABH A;  3BG8 A;  1KDQ B;  2VWM A;  1JWT A;  1MU8 B;  4FU8 A;  5DK1 A;  1BZX E;  1FY5 A;  4KTS A;  4Y7B A;  1C9P A;  1GJ5 H;  2BOH B;  3GIC B;  2ZDM A;  3RXB A;  4ABG A;  2CV3 A;  1AB9 C;  3I77 A;  4OGX A;  3HAT H;  2VWL A;  1LHG H;  1OYQ A;  5AFY H;  2XOK D;  5GXP A;  2HNT C;  2FPZ A;  2YNA A;  3U69 H;  2A7C A;  1BIO A;  3ZYD A;  1A0H B;  1TAB E;  2P8O B;  2THF B;  3HPT B;  1QCP A;  5F6M A;  2F4L A;  1HXF H;  2PR3 A;  1COW D;  1O2G H;  2ANY A;  2W5E A;  3CEN A;  3CNR A;  4I86 A;  1V2R T;  2C90 B;  3PV4 A;  1FIZ A;  2JJ1 D;  2TGT A;  2FIR H;  2PV9 B;  3BTE E;  3LGW A;  1G9I E;  1KTS B;  2PUQ H;  2EEK A;  3MNC A;  1TX6 A;  2PUX B;  1H9L B;  3RXF A;  2ZQ2 A;  2FX6 A;  4DGJ A;  1KLJ H;  1O2I A;  2Z9L A;  2BQ6 B;  4Q7Z A;  1MD7 A;  2Q6F A;  2JH5 D;  2NU2 E;  1K21 H;  2QY0 B;  4NSV A;  2WHX A;  4ZHL U;  2TBS A;  3STJ A;  1QFK H;  1FXY A;  5H4I B;  4X1N U;  3PV2 A;  4BTU B;  4AZ2 B;  1GCD A;  1GMD G;  1T7C A;  1W14 U;  3RXH A;  1P10 A;  2VIO A;  3K65 B;  1ZHP A;  1O3C A;  1L1N A;  4Q63 A;  1AE8 H;  3SU4 A;  5C0T A;  5A0C A;  4OGY A;  4I32 A;  3SOS A;  1CVW H;  4GCH F;  2AIP A;  2ZO3 H;  4CRF A;  1A46 H;  2ZTY A;  3RMN H;  1TA2 A;  1ZTK A;  3HKJ B;  5DKM A;  1O3L A;  3S69 A;  2J9N A;  1DM4 B;  1CU1 A;  2FM2 A;  2WPD D;  1C2D A;  4RSP A;  1RXP A;  2RA3 A;  1KXC A;  1XKA C;  2Z6B D;  4YLQ H;  2QF4 A;  3S7H B;  3DFL A;  3ZZB A;  2WPL S;  3TK5 A;  2J2U A;  3PRD A;  4IMQ A;  9LPR A;  5FBI A;  1IOE A;  1MD8 A;  3D49 H;  1D4P B;  1O2K A;  1UJ1 A;  1O3M A;  3Q3X A;  3LGV A;  4KTC A;  1EOJ A;  5A8Z A;  4IS5 A;  3F0O A;  2D8W A;  1WBG B;  1ZPC A;  2GV6 A;  1YY3 A;  4TY7 A;  3P92 A;  4FU9 A;  2DE9 A;  4UFD H;  3SJI A;  1W7G H;  1CHO F;  3E0N B;  1ABI H;  2HVX A;  2P3U B;  4JZ1 A;  5JPM H;  1GMD F;  1WTH D;  1P06 A;  5EPN A;  1EJA A;  3RXI A;  1ZRK A;  3SUF A;  2KM0 A;  4DVA U;  3AVZ A;  1ELC A;  1XVO A;  4FUE A;  1BJU A;  1CT2 E;  3GS9 A;  1HV7 A;  3JZ1 B;  3MO6 A;  3URE A;  1S6F A;  1SGN E;  5AFZ H;  3UTU H;  1O2W A;  3ZZ6 A;  1V2N T;  2QCY A;  1H1B A;  4AYV B;  4I8H A;  2WPH S;  1GBC A;  4U32 A;  3N99 A;  2BDG A;  1UVO A;  1TYN A;  2ZU1 A;  1H8I H;  2EST E;  1TPA E;  2ZHD A;  4BAO B;  3FN8 A;  1HJ9 A;  3GY6 A;  1DWB H;  1SR5 C;  3RXP A;  3GDS A;  4CR5 A;  1C2M A;  3U28 C;  1B0F A;  3RXR A;  1ETR H;  1AUT C;  2A0Q B;  1DWE H;  3DD2 H;  1P2M A;  1S84 A;  1ESA A;  3GCN A;  4JK6 A;  3QX5 H;  4UFE H;  2PTC E;  3RLY H;  4GHQ A;  1GJ7 B;  5JBT A;  3T27 A;  4DII H;  2JH6 D;  2A7H A;  1BML A;  2AGE X;  3KQ5 A;  1GHA F;  2HPQ H;  1MKX K;  1TPS A;  1GJ8 B;  1SL3 A;  1ZMN A;  1S6L A;  1WUN H;  2FYQ A;  2YMS D;  5L2Y H;  2Z9I A;  5HKK D;  3ZVE A;  2XND D;  3Q77 A;  1YYY 1;  1ZML A;  2KAI B;  1C2G A;  2GGV B;  2BLO A;  2VH0 A;  4FU7 A;  3HGN A;  3SUE A;  3A81 A;  4I8G A;  4EST E;  2OC1 A;  4BTI B;  3GOV B;  1BRB E;  1C2E A;  3UOU A;  2ZU3 A;  3R3G B;  4YTA A;  2GT8 A;  4D9Q A;  1AZ8 A;  3OAA D;  1HLT H;  4GPG A;  2BQW B;  1W12 U;  2A2Q H;  2XC5 A;  1TNK A;  4R8T B;  3MU0 A;  1IQI A;  1HBT H;  5C94 A;  1BCU H;  2R3U A;  3RU4 E;  1YWU A;  4IC6 A;  2ZPS A;  1OP2 A;  3ODD A;  1Z1I A;  4D8N A;  1DS2 E;  3F9E A;  1PJP A;  1AWH B;  1A61 H;  1FON A;  3TNS A;  1TNJ A;  3UB0 A;  1EQ9 A;  2W7U A;  4DOQ A;  3AK5 A;  3PV5 A;  4OS5 A;  3GYM A;  9EST A;  2BDC A;  1GBA A;  3Q00 A;  2F3C E;  1P02 A;  3RML H;  1SI5 H;  1NU9 A;  4ABI A;  3D65 E;  2PW8 H;  3KQB A;  5AVD A;  1TAL A;  1PQ7 A;  1QA0 A;  1MTV A;  1GI5 A;  1O2J A;  3MU4 A;  2GZ8 A;  5EIY A;  1KLT A;  1AVW A;  1P03 A;  1QQ4 A;  1ZHR A;  1BRA A;  4HFP B;  1O3J A;  1F5K U;  1GCT C;  2WYG A;  2YNB A;  3Q3K A;  1RD3 B;  3PLB A;  1O34 A;  1ABJ H;  1FIW A;  1K1I A;  1QBN A;  3HK3 B;  2EY4 C;  3L3T A;  2FEQ H;  1XVM A;  3V13 A;  2A4R A;  4Y0Y E;  1KXF A;  1UVT H;  3MO3 A;  3UFA A;  3F2F A;  4CH8 B;  1O30 A;  3RXQ A;  2VVV A;  2J38 A;  1NT1 A;  1L4Z A;  1OPH B;  1CQQ A;  1DY9 A;  3ZVC A;  2GTB A;  1W2K H;  2ZP0 H;  4MPU A;  1IQN A;  1XMN B;  3STI A;  1ZJK A;  3RC6 A;  4YES B;  1EAS A;  3LKW A;  1KSN A;  3C1K A;  2OC7 A;  3ZZ9 A;  4X6M A;  3V7T A;  3HK6 B;  1ANE A;  1IAU A;  3ZVB A;  4AOR A;  1SHH B;  2ZCL P;  3E91 A;  4OM9 A;  1HNE E;  1K1O A;  1SGD E;  2PWX A;  1E37 B;  1MMJ N;  3M7Q A;  4FUH A;  3P8N A;  2BHG A;  3E16 B;  2Z9K A;  1WDI A;  1SLV B;  1QNJ A;  5CDF E;  2FWW A;  3SV7 A;  1NPM A;  3EAJ A;  1GHX H;  1QB6 A;  1NY2 2;  3FP8 E;  2FOC A;  2V6N A;  3GY5 A;  4MQA A;  2ZDL A;  3VXE H;  1OP8 A;  2VNT A;  3A7X A;  1AN1 E;  2XC4 A;  1VCQ A;  4TY6 A;  3BV9 B;  4XOJ A;  2H1U A;  3SNE A;  3LJJ A;  1G2L A;  3ODF A;  1HIA A;  2Z3D A;  1CA0 C;  2ODY B;  1YC0 A;  1YLN A;  5LPF A;  2XCF A;  1A2C H;  2GDE H;  4KTU A;  2BLV A;  1YGC H;  3MI4 A;  1INC A;  4X2Y A;  3MYW A;  2ZGC A;  3RU4 T;  2A2X H;  5A8Y A;  1TA6 A;  1UTJ A;  4AFZ A;  3V0X A;  1E38 B;  2JET B;  3MU8 A;  3VG8 A;  1DDJ A;  4NA7 A;  1BUI A;  1TNG A;  2C3S A;  4A1V A;  1K2I 1;  4ACB A;  1QQU A;  1BTH H;  3MNX A;  3ATI A;  2FP7 B;  1C5M D;  2FI3 E;  2P8O C;  3O8D A;  4XSK U;  4ZKR U;  1TBR H;  1LHC H;  3RXM A;  3RXO A;  2Z7F E;  2B8O H;  2GX4 A;  3MNS A;  5BRR E;  2ZF0 H;  1HDT H;  1O3O A;  2J34 A;  4ABJ A;  3F6U H;  1SFQ B;  3CS7 A;  1Y3Y A;  1VIT H;  2CK3 D;  4UDW H;  4CBO A;  4K69 A;  3A7Z A;  4CR9 A;  1JBU H;  1BMF D;  1EOL A;  2Y80 A;  4F55 A;  1DLE A;  4I33 A;  3SYJ A;  2VU8 E;  1SLX B;  1A5I A;  3E3T A;  1YF4 A;  4A6L A;  1G3E A;  2BB4 A;  3DFJ A;  1AE5 A;  4JK5 A;  3RM2 H;  1TGC A;  2F91 A;  1K9O E;  4ZAE A;  1UK3 A;  2ZFP H;  1UCY H;  4X8U H;  3QZR A;  4H4F A;  4HG6 A;  3VXF H;  2OLG A;  4NCY A;  3VB4 A;  2AGI X;  2XCN A;  3MO9 A;  3H7T A;  2BD4 A;  2RDL A;  1BHX F;  1SGI B;  1CSO E;  3H7O A;  4Z1M D;  1N6X A;  1TQ7 B;  4FXG H;  1PYT C;  1DLK B;  1SOT A;  4YLU A;  1AFQ C;  1CBW B;  1ZRB A;  3TIT A;  2BDH A;  1DPO A;  2VIP A;  1ZJD A;  3GDU A;  3SO3 A;  1FY3 A;  3RXD A;  1CT0 E;  1EKB B;  1T4V H;  2ZDA H;  2ZHW H;  4TWY A;  1NFY A;  1EAX A;  3EE7 A;  1C5Z B;  1RTF B;  3TVJ B;  1MTN C;  1TWX B;  1YPH E;  3QZQ A;  3NXP A;  3KGP A;  3TJN A;  1NU7 B;  1GMH F;  2C8Y B;  1WV7 H;  1BHX B;  4VGC C;  3RC4 A;  3GCT F;  4ASU D;  2TRM A;  4GAW A;  1K0H A;  1CA8 B;  1P12 E;  1AZZ A;  3TPI Z;  2CHA B;  1ESB A;  2BOK A;  1UTL M;  1O2Z A;  3PMH B;  4MPX A;  4NA9 H;  2PFE A;  1AB9 B;  1TPO A;  1UVS H;  3BTT E;  2BVS H;  1DST A;  1C5V A;  1ZTL A;  2PKS B;  1RIW C;  4ZH8 A;  1O2O A;  3TK6 A;  1D3T B;  1FJS A;  4BAQ B;  2EQN A;  1SPJ A;  1J15 A;  2BTC E;  2BMG B;  2BLW A;  2TIO A;  3MTY A;  2ZA5 A;  2QXG A;  1ELD E;  4J2Y B;  2B7D H;  3SHA H;  1Y5B T;  4X2V A;  4LOY H;  1PPF E;  4AG1 A;  1O3H A;  6CHA B;  5K7R A;  2ZI2 H;  2R2M B;  3I29 A;  2G4U A;  3QN7 A;  6CHA C;  3S7K B;  1ETS H;  4ABE A;  1QY6 A;  1TX7 A;  4BNR A;  2LP6 A;  3PYH A;  3LC3 A;  4Y10 E;  4E7N A;  3FZZ A;  1MCT A;  1NBM E;  2P59 A;  1TGN A;  4Q7Y A;  1GJC B;  1SGP E;  5T1V A;  1NN6 A;  1OKX A;  4MNW A;  3VB7 A;  1PPC E;  5F53 A;  3ZZ8 A;  4I8L A;  1NS3 A;  4UEH H;  2BD2 A;  8GCH F;  3FVF B;  1ARB A;  3ENS B;  3V12 A;  2ZFQ H;  4X2W A;  3NUM A;  1XUJ A;  1W11 U;  1L0Z A;  1PPB H;  5DP5 A;  3D23 A;  3QO6 A;  1C5L H;  1HAX B;  2J95 A;  1C1P A;  1O36 A;  2RCE A;  1K1N A;  2H9T H;  1ANB A;  2BY9 X;  5E8E H;  1O2Y A;  1Q3X A;  1DXW A;  1AKS B;  1WAY B;  5IYT A;  1V2M T;  2QF3 A;  1H4W A;  3BSQ A;  3VB3 A;  1G2M A;  4TYD A;  1LTO A;  1DIT H;  4DW2 U;  3TU7 H;  1BTY A;  1RIW B;  2FX4 A;  3B8J A;  2W7S A;  1Z8R A;  2VB0 A;  3O8B A;  2XC0 A;  4XRN A;  4H42 U;  2O8U A;  2QAA A;  5SGA E;  1LCY A;  2JET C;  3SNA A;  2VIW A;  1GHY H;  1SSX A;  4CRE A;  1TRM A;  1SGT A;  1EB1 H;  1LDT T;  3TGJ E;  1WCZ A;  3SHC H;  3LJO A;  3SGA E;  4M7G A;  5E0G A;  1KXB A;  2FO9 A;  1AFQ B;  1BA8 B;  5FHT A;  3WY8 A;  3ZZC A;  1CE5 A;  2SFA A;  3KID U;  3N7E A;  3F9F A;  1AUJ A;  1ELF A;  1ZR0 A;  2CN0 H;  1Y59 T;  3PTB A;  4FUB A;  5B6L A;  5EXM A;  2BX3 A;  2GV7 A;  1S0R A;  1J14 A;  1SLU B;  1O37 A;  4CRD A;  1VGC C;  2F9V A;  3KQD A;  4B75 A;  1RTL A;  1H8D H;  2BQ7 B;  3GCO A;  1O2X A;  2BZ6 H;  2IPQ X;  3PLK A;  1A3B H;  4ABA A;  1ETT H;  1TB6 H;  1S85 A;  2CJI A;  1S5S A;  1C5P A;  4U30 A;  3ZZ4 A;  2VBC A;  2OXS A;  1LVB A;  3A7W A;  2ZFT A;  4HZH A;  5EOK A;  1Z7K A;  3OTP A;  1GPZ A;  4X1P U;  1VR1 H;  3RLW H;  2A5A A;  1EJM A;  3GY8 A;  4DT4 A;  2FLR H;  1V2L T;  3SU2 A;  4B76 A;  5KEC A;  1JIR A;  1OS8 A;  3GCH B;  2D1J A;  1AI8 H;  1N6Y A;  2G52 A;  2ZTX A;  1V2J T;  1QRX A;  3SZE A;  2ZDN A;  1YPL H;  1W0J D;  1TQ0 B;  1UK4 A;  1GI8 B;  2Q6G A;  3PWC A;  1O38 A;  1TFX A;  4BXW A;  1GHV H;  1IQF A;  1CA0 B;  2HLD D;  1GI0 A;  1X7A C;  5EJ1 A;  2BXT H;  5G4B A;  2A31 A;  5EPY A;  2ZDV H;  5JBC S;  1MZD A;  4JCN A;  2KX4 A;  3IWM A;  2FLB H;  1NC6 A;  3ZZ3 A;  2GCT B;  2Q1J A;  1GMC G;  1Y3W A;  2EI7 A;  3I78 A;  6GCH F;  1O3K A;  3A88 A;  4CRA A;  2Y5H A;  3ZVA A;  1P57 B;  1AND A;  3SNC A;  1P04 A;  3SV8 A;  1C5R A;  3BF6 H;  1OOK B;  4XDE A;  1T8O A;  3P6Z B;  4D7F A;  2FOD A;  3E90 B;  4Y8X A;  4CRB A;  1FPC H;  3RUO A;  3LGU A;  3SW2 B;  1ZHM A;  1EZS C;  5HXF A;  3MH7 A;  1SMF E;  3JZ2 B;  4DJZ B;  2FS8 A;  5C1U A;  3A87 A;  3GY3 A;  3QTV H;  1QRW A;  1HRT H;  3SU3 A;  3ZZD A;  2TGA A;  3WWF A;  5F8Z A;  3U8T H;  2V3O H;  4WMD A;  2BY8 X;  2BVR H;  1MU6 B;  1F92 A;  2Y7X A;  1VCP A;  5DJ7 A;  1C4Y 2;  1T31 A;  1V2K T;  4ZXY H;  1QL8 A;  2OTV A;  3TJV A;  1GMH G;  1H8H D;  3TLO A;  3RXE A;  2O9Q A;  4BOH A;  2F83 A;  1YPK H;  1C9T A;  2VGC C;  2FOM B;  1TIO A;  2FI5 E;  4Q7X A;  1HFD A;  3A84 A;  3A8C A;  2M5T A;  2ZCH P;  3VGC C;  1UMA H;  1TE0 A;  4U01 A;  4NFF A;  2HLC A;  1GG6 B;  2PSX A;  3GDV A;  1EXF A;  1GI9 B;  4Y71 A;  1ZSL A;  1CO7 E;  1EJN A;  1UTQ A;  1GG6 C;  2B0F A;  5HYO A;  2XBV A;  2AHM E;  1AKS A;  1QR3 E;  4VGC B;  2GMT B;  1P2Q A;  3DSG A;  4K2Y A;  1MTN B;  1HUT H;  1UTO A;  1FX0 B;  1ELG A;  1QRZ A;  2Z9J A;  1XKB C;  1GVK B;  5FCK A;  1EPT B;  5DP4 A;  4ABF A;  1HYL A;  3TGK E;  5FAH A;  5EQQ A;  3RXV A;  5A09 A;  1AHT H;  3BTW E;  4MDS A;  1C1R A;  2K1Q A;  1HB0 B;  3HGP A;  1QJ6 B;  4O97 A;  2QF5 A;  2RA0 A;  3FAN A;  4ACA A;  4FUI A;  5E0H A;  1SB1 H;  1GGD C;  3GCT G;  1TLD A;  1Z8J B;  1GDQ A;  2HPP H;  2C8Z B;  2A1D B;  2VVC A;  3SOR A;  1GI2 A;  1P05 A;  1V2U T;  3S9C A;  2CF8 H;  3F0P A;  4DUR A;  2F9B H;  1MH0 A;  3M3T A;  1K1M A;  2TGP Z;  3UWI A;  3PO1 B;  1KXE A;  1A5H A;  4AB8 A;  4GSO A;  4JYV H;  3WW7 A;  4CRC A;  5HIZ A;  1S6H A;  2SGP E;  1GL1 A;  2SGF E;  5E2O A;  3ZZ7 A;  1IHT H;  1HJ8 A;  2NU0 E;  2P95 A;  3RP2 A;  1WXR A;  4X8S H;  2ALV A;  2R9P A;  3BTH E;  1LVM A;  3DHK H;  3UUZ A;  4B74 A;  5C17 A;  3SU1 A;  1W8B H;  5A0A E;  1C1M A;  2FOG A;  2OD3 B;  2JIZ D;  2PKA B;  1DUA A;  1GBJ A;  1NZQ H;  1GBL A;  1GBB A;  3VB5 A;  5GJ4 B;  2BVX H;  1HAY B;  4Y8Z A;  1HGT H;  1IQL A;  1AVG H;  2UWO A;  3UR9 A;  1AFE H;  3BG4 C;  3SGQ E;  1VZQ H;  2A5I A;  1C1T A;  3VPK A;  4KEL A;  1WU1 A;  5IK2 D;  1E1Q D;  4JYU H;  2OUA A;  4HTC H;  5ETX A;  5DPA A;  1P11 E;  1RTK A;  3ATM A;  4NZL A;  5C3N A;  3R0F A;  5DN6 D;  3MWI U;  2O8W A;  2QYI A;  1MTW A;  2YMS B;  3UNR A;  3T26 A;  3DA9 B;  1NRS H;  5JYI A;  2J4I A;  1QZ8 A;  5EQR A;  1ZSK A;  1O3N A;  3TH4 H;  2F9P A;  4Z0K A;  1G32 B;  1RRK A;  3T29 A;  5LPE A;  2ZC9 H;  2W3I A;  3P8G A;  4NFE A;  2CF9 H;  1DVA H;  1GVZ A;  1LPZ B;  1SOZ A;  1EST A;  2A32 A;  4JZF H;  3EE0 B;  1GJB B;  4XBC A;  3B9F H;  2F9U A;  1BTW A;  1Q2W A;  1V2P T;  4ISL A;  3T62 A;  1CGH A;  5CE1 A;  2OBQ A;  1O2R A;  1EUF A;  3TNT A;  5T6G A;  3ZIA D;  4SGB E;  1Y3U A;  3RXL A;  1UVU H;  2JDI D;  4UD9 H;  4NIV A;  6EST A;  1YPE H;  2FMJ A;  3F2H A;  2ULL A;  2ZNK H;  1J16 A;  3KHV A;  4YOJ A;  2G4T A;  3S9A A;  1ELE E;  1O5A B;  4AN7 A;  4XFQ A;  1DFP A;  4NGA H;  1P2O A;  3A82 A;  5CMX H;  2AMQ A;  3RXK A;  3T28 A;  1F7Z A;  1LO6 A;  3ZVF A;  1BB0 B;  1GBI A;  2RDE A;  3ZZ5 A;  6GCH G;  2VID A;  1SGE E;  4AFQ A;  1HPG A;  1BMA A;  3F9H A;  1C5Q A;  2PGB B;  1KTT B;  4X8T H;  1AVX A;  1TX8 A;  1P8V C;  2BY7 X;  1YCP K;  3MH6 A;  5L30 H;  1O3I A;  5CHA C;  3OX7 U;  1CHO G;  2FDA A;  3EQ0 H;  2Z94 A;  4X6P A;  1Z6E A;  1GI1 A;  3BIV H;  2O8L A;  1OWJ A;  2P16 A;  1E34 B;  1TMB H;  5DP7 A;  4AYY B;  4IC5 A;  5I25 A;  3SV6 A;  1W7X H;  1TGT A;  4FUF A;  1O3D A;  1QJ7 B;  5C20 A;  3OY6 U;  5A8X A;  2OQ5 A;  1HAP H;  2BD3 A;  1EZU C;  2WPK S;  5JBB S;  4NWK A;  2BXU H;  5HGG A;  2M2A A;  5DP3 A;  1JOU B;  1GBH A;  4NSY A;  1VIT G;  3PO1 C;  3SGB E;  1EAU A;  5EW1 H;  2OQU A;  5DO4 H;  3DT0 H;  1BMN H;  3AAV A;  1K1P A;  1Y3V A;  4D9R A;  3AAU A;  1AIX H;  1C1S A;  1G36 A;  1GBT A;  2H6M A;  1AO5 A;  1QBV H;  2TGD A;  4NA8 A;  1BRC E;  2FZZ A;  1EP6 A;  4NIW A;  3UWJ H;  3M7U A;  2EA3 A;  1OYT H;  3F3B A;  2QN5 T;  1H8E D;  3VB6 A;  1Y5A T;  1O3E A;  5A2M H;  2FES H;  2AGG X;  2FOF A;  2WIN I;  3U8R H;  3BIU H;  2BD8 A;  2HRV A;  2YMS C;  2R0K A;  1NRO H;  3AAS A;  3ATW A;  4CHA B;  2Y6T A;  1ZYO A;  2ANK H;  2W6J D;  4UE7 H;  4UFG H;  8LPR A;  3ZZA A;  4Q2K A;  4WH8 A;  2ZZU H;  1VGC B;  1MBM A;  4ZHM U;  1E36 B;  1T8L A;  3PLP A;  4O9V A;  1E0F D;  1K1L A;  2UUK B;  2YOL A;  2AMD A;  3AW0 A;  3EDX B;  2G00 A;  3LH1 A;  5EW2 H;  2OCV B;  3SU0 A;  2IJD 1;  2G55 A;  1P01 A;  4A1T A;  2NU3 E;  1SGQ E;  2ODQ A;  2STB E;  2TPI Z;  2ODP A;  4DIH H;  3GYL B;  1AY6 H;  1KYN A;  1ELT A;  1IQK A;  1O2Q A;  3SJ8 A;  2NU4 E;  1D6R A;  3KN2 A;  3VEQ B;  4IN2 A;  4MNX A;  3LON A;  1G30 B;  3SQE E;  3UQV A;  1DY8 A;  1K22 H;  2OBO A;  2ZPQ A;  2WV9 A;  2NU1 E;  2V3M A;  2ILN A;  5KGO A;  4AGJ A;  1VJ9 U;  4RKO B;  2QXI A;  1ELA A;  1C5N H;  1O3F A;  1GJA B;  2VIQ A;  3RXC A;  4LZ4 B;  3CS0 A;  2WUC A;  2L6O A;  1GGD B;  2GP9 B;  3MU1 A;  3RM0 H;  4RN6 A;  2SNW A;  2LPR A;  3SV9 A;  5C5O A;  4ZXX H;  2JKH A;  4TSF D;  4BXS A;  5KED A;  3B23 B;  3BTQ E;  4DCD A;  1YLD A;  4HI3 A;  2ZHF H;  2BX4 A;  3BTM E;  1SGF G;  1GJ6 A;  5FCR A;  3KYG A;  3UQO A;  1JIM A;  4P00 A;  4UFF H;  3UY9 A;  1GI6 A;  4Q80 A;  4XE4 A;  3M7T A;  2AYW A;  2L74 A;  5EGM A;  5JB8 S;  3M61 U;  5JBA S;  1HJA C;  4WMF A;  1C5W B;  2R3Y A;  3FP7 E;  3TJO A;  1F0U A;  1M9U A;  1QHR B;  2VWN A;  2HVY B;  3P95 A;  1OWK A;  2FYR A;  4FVB A;  8EST E;  3RXU A;  4XD7 D;  1MKW K;  2O8M A;  2ZCK P;  4X1S U;  3ITI A;  3A89 A;  2FXR A;  1E79 D;  3M5O A;  3M5N A;  1UHB B;  1KDQ A;  1O2T A;  3TGI E;  2KAI A;  4ABB A;  4ZKS U;  2Z9G A;  1T8M A;  1GWA A;  5FX5 A;  5C2Z A;  1XXD A;  3SQH E;  1XUF A;  1C2K A;  1V2S T;  2EI8 A;  3GCH C;  4YM9 A;  1FMG A;  4AGK A;  4F48 B;  1C1U H;  5TCA A;  2SNV A;  3A83 A;  2H2Z A;  4JMY A;  1GI3 A;  2QC2 A;  2G5V A;  5GWZ A;  1LVO A;  2J98 B;  1VIT F;  1AMH A;  5F8X A;  2Y82 A;  3BTF E;  1HAG E;  2KZ4 A;  3M37 A;  4YOI A;  1GDU A;  1RS0 A;  1O3B A;  3W95 A;  1FAX A;  1P9S A;  1MUE B;  1S81 A;  4XBD A;  1LHE H;  2UUJ B;  2GZ7 A;  3LOX A;  4X2X A;  2P94 A;  1ANC A;  1SBW A;  1TOC B;  1GJ9 B;  1OHH D;  1FUJ A;  1ZGV A;  4WVP E;  2PKS C;  5J4Q A;  1SHY A;  3LGI A;  1IQM A;  1WQV H;  3E8L A;  2PGQ B;  1BBR H;  4TWW A;  3KQE A;  1UW7 A;  1HAH H;  3P17 H;  3W1E A;  1EPT C;  1TRY A;  5K0H A;  3KEE A;  4B1T A;  2Z3C A;  3QGN B;  4DG4 A;  3RMO H;  2SGD E;  1FN6 A;  4ABD A;  1NBM D;  3LC5 A;  2Y5G A;  3C27 B;  1BQY A;  3KL6 A;  4GUX A;  5E2P A;  5DG6 A;  3RXS A;  5C0U A;  2ZG0 H;  1IHS H;  1TGS Z;  1ZTJ A;  4IGD A;  1S0Q A;  2Y81 A;  4HGC A;  1AD8 H;  1IQE A;  5EJL A;  2FOA A;  1EAT A;  1B7X B;  2XBY A;  1GHA G;  2HOB A;  4OS4 A;  1A0J A;  3M3S A;  1N8O C;  1SLW B;  4QT8 C;  5LPR A;  1SVP A;  1C5T A;  5T3H A;  2KCA A;  1SKY E;  2WPM S;  2AER H;  1ELV A;  1FLE E;  4GLY A;  4ISO A;  3OU0 A;  1V2W T;  3L6P A;  3EA9 A;  4WF8 A;  2BZA A;  3BEU A;  2BD7 A;  1O2N A;  2CGA A;  1MCV A;  4H6T A;  1QBO A;  2WYJ A;  5GND A;  4JZD H;  2Q6D A;  3VGC B;  3DSP A;  2LNC A;  4Y6D A;  1Y8T A;  4IW4 E;  5GIB A;  3ZVD A;  4GVU A;  4FET A;  2BD9 A;  1KY9 A;  3QDZ B;  5GDS H;  3HKI B;  1VCW A;  1W10 U;  2HNT E;  2XBW A;  3LIW A;  1LKB A;  1UCY E;  5EXN A;  1QJ1 B;  1SGF A;  2XNI A;  3QTO H;  3M35 A;  1LVY A;  1S82 A;  3MH4 A;  3SI4 H;  2R0L A;  2V7Q D;  4MG3 A;  4Y8Y A;  4JZI A;  3H09 A;  1C1Q A;  1BTX A;  1QIX B;  1TON A;  1J9C H;  2O8T A;  1UTK A;  1TGB A;  1TOM H;  5E0J A;  3MOC A;  3SI3 H;  1SQT A;  4X1R U;  3T5F H;  3ELA H;  4AFU A;  1DX5 M;  3U1J B;  2ZEC A;  1V6D A;  3DCL A;  2QIQ A;  3LDX H;  1E1R D;  2ZQ1 A;  4AX9 H;  1KMH B;  1D3Q B;  4MVN A;  2DE8 A;  1C2F A;  4K1S A;  2ANW A;  1JRS A;  1JRT A;  1P3E A;  4I8K A;  4O3T A;  2BDI A;  4AFS A;  3U1I B;  1SQO A;  1FZZ A;  2SGA A;  2PTN A;  3K6Z A;  4U2W A;  3TH2 H;  1BOQ A;  2VIV A;  1C5X B;  1YLC A;  4WJG 2;  1C1N A;  3UOP A;  3E6P H;  3URD A;  3E0P B;  4X8V H;  1YPH C;  5C1Y A;  2IOT A;  1MQ5 A;  1C2H A;  1MAX A;  4X1Q U;  3SN8 A;  4YO9 A;  1BBR K;  4RT1 A;  4ZKO U;  1XUH A;  2XW9 A;  3A7T A;  4K1T A;  4Q4L A;  1B5G H;  3BG4 B;  2GKV E;  1SGY E;  7KME H;  1FQ3 A;  1GHB F;  1JXP A;  1GDN A;  1NFX A;  4MTB A;  1O5D H;  1GBK A;  2G5N A;  2ZGJ A;  1GJ4 H;  3LU9 B;  2A4G A;  4E06 H;  3PWB A;  1P2N A;  3OYP A;  1THP B;  1DT2 A;  3KCG H;  3VFE A;  2OIN A;  5CHB A;  1O31 A;  5FX6 A;  1FI8 A;  1GI7 B;  2V3H H;  1QL9 A;  5C5N A;  1PFX C;  2KCP A;  1FY1 A;  1NFW A;  2W3K A;  1LHD H;  1WSS H;  3ATK A;  4WY3 A;  1E35 B;  1L4D A;  2A4Q A;  1O5G H;  4TT3 D;  4THN H;  4AB9 A;  1A1R A;  4F49 A;  4ZKN U;  7GCH G;  4Y7A A;  1EFR D;  1FDP A;  3Q76 A;  5BPE A;  3K2U A;  5T6D A;  1K1J A;  1B0E A;  1NRR H;  3A8A A;  2OC8 A;  1OWE A;  1NM6 A;  4ZMA H;  1BDA A;  4ISN A;  4LXB H;  1TPP A;  1MAB B;  3MH5 A;  4LK4 A;  1IQH A;  3U98 H;  1CGJ E;  1P9U A;  2H5C A;  3P8O A;  1NRQ H;  5GCH G;  1NFU A;  5F8T A;  1TMU H;  1O3P B;  3SJO A;  4I8J A;  5FL7 D;  2Y7Z A;  2A5K A;  4K8Y A;  4BTT B;  5ABW A;  1DXP A;  4X6O A;  3UPE A;  1HCG A;  4INL A;  4K1E A;  3DSO A;  3WWB A;  1C2J A;  3U9A H;  1ZZZ A;  2ZDK A;  2VIN A;  3ZV9 A;  3OEH D;  2OP9 A;  1UK2 A;  1PPH E;  1ID5 H;  2J5U A;  3G01 A;  3GIS B;  8GCH G;  2GVF A;  2J92 A;  1BRU P;  1BTZ A;  5FPY A;  1V3X A;  1YPM H;  3SV2 H;  1HIA B;  3A8B A;  1BIT A;  1YCP M;  2AFQ B;  1SGC A;  5HM2 A;  3F9G A;  3O8R A;  5EOD A;  2K0Q A;  2VGC B;  5C67 A;  2GMT C;  3UNQ A;  4J1Y A;  2GDD A;  4ZRO A;  3U8O H;  4WME A;  2QXJ A;  1G37 A;  3UR6 A;  1DWD H;  4NZQ A;  4AG2 A;  2A4O A;  5FBE A;  3FO8 D;  2ZFF H;  1PQ8 A;  2XBX A;  1L1G A;  2QE7 D;  1FNI A;  3M36 A;  1C4U 2;  1GBE A;  1LPG B;  4RT0 A;  2F9O A;  3UIR A;  3M5M A;  2UUF B;  1DIC A;  5TJX A;  1FAK H;  8KME 2;  1F5L A;  2ZHQ H;  1ARC A;  1KIG H;  2EI6 A;  3P8F A;  3OSY A;  4PRO A;  1QA7 A;  1GHZ A;  2R2W U;  4O3U A;  2C8W B;  4ZUH A;  3V3M A;  1XUK A;  4FUC A;  3LH3 A;  3S0N A;  1BBR E;  3SU5 A;  2BLQ A;  3MMG A;  1PPG E;  1UO6 A;  2FOB A;  1XXF A;  2J94 A;  7LPR A;  3L33 A;  2I6S A;  3K6Y A;  3GY7 A;  2UWP A;  4BAM B;  2IPH A;  1O5C B;  1OXG A;  4WXI A;  1DUE A;  4WWY A;  3EST A;  4ASH A;  3FAO A;  1AU8 A;  3LPR A;  4WXV A;  1ZLR A;  1MBQ A;  1A5G H;  2FI4 E;  3FKS D;  5DP9 A;  3ATL A;  1RJX B;  3EGK H;  5DP6 A;  5B6O A;  2G81 E;  1F2S E;  2PHB A;  2H9E H;  3FOA A;  1LMW B;  4B71 A;  3A80 A;  4MPV A;  1A4W H;  1J17 T;  3F68 H;  1G3D A;  1PQA A;  2OK5 A;  2ZGB H;  3CP7 A;  4D7G A;  1AQ7 A;  1CHG A;  4B73 A;  2GZ9 A;  2KFW A;  4FUG A;  4BAH B;  1SQR A;  4INK A;  2F43 B;  3DUX H;  1YBW A;  4FOU C;  2GT7 A;  1OSS A;  1TBQ H;  1HAZ B;  2P3F H;  3A85 A;  4WH6 A;  4Y0Z E;  3N7D A;  1IQJ A;  2ALP A;  4FVD A;  1SGR E;  3A86 A;  2IN2 A;  1O2P A;  4Y79 A;  1MKW H;  1V2Q T;  1Z6J H;  4YXW D;  5J4S A;  1BT7 A;  5C1X A;  3NKK A;  1YM0 A;  4A92 A;  3NPS A;  5LGO A;  4MNY A;  2J97 A;  1C2L A;  2ZIQ H;  4X0W U;  4Y76 A;  2CMY A;  1O2S A;  3QK1 A;  1UTP A;  1YKT A;  3O8C A;  1ZGI A;  1C5O H;  2GD4 B;  3FFG A;  1UHB A;  3N7O A;  4YT7 H;  5FXL A;  1EZX C;  2WV5 A;  1CT4 E;  3NWU A;  3KF2 A;  4NWL A;  1SFI A;  1GJD B;  1ORF A;  2XXL A;  1GHW H;  3RC5 A;  3M3V A;  1O32 A;  3BEI B;  2AH4 X;  2K8I A;  4CBN A;  1BJV A; 
#chains in the Genus database with same CATH homology
 2L6O A;  4Q4L A;  3SU3 A;  5GJ4 B;  3F0O A;  3WWF A;  2WSS D;  3EYD A;  3SV9 A;  3M5M A;  2XCF A;  4TSF D;  1JXP A;  3SUD A;  3SV6 A;  3KNX A;  4K8B A;  2XOK D;  3UB0 A;  5IK2 D;  3N7E A;  3AK5 A;  1E1Q D;  2A4G A;  3PV5 A;  5EPN A;  2F4L A;  1SKY E;  2KCA A;  4NWK A;  3F2G A;  3OYP A;  5ETX A;  3SUF A;  1RGQ A;  2KM0 A;  3VG8 A;  1COW D;  1H8H D;  2KR7 A;  4A1V A;  4ASU D;  3SU5 A;  2W6I D;  5B6L A;  2OIN A;  5CHB A;  2M2A A;  3OEE D;  3L6P A;  4WF8 A;  5FPS A;  5DN6 D;  4B6E A;  3GS9 A;  2YMS B;  2FOM B;  2JJ1 D;  2KCP A;  3SU6 A;  5IDK A;  2FP7 B;  3OE7 D;  3O8D A;  4U01 A;  4I31 A;  2A4Q A;  4TT3 D;  5GND A;  2F9V A;  4XD7 D;  3DSP A;  5EQR A;  2O8M A;  1A1R A;  4B75 A;  5C0U A;  1RTL A;  2AHM E;  3N99 A;  1EFR D;  1E79 D;  3M5O A;  3NRL A;  3M5N A;  4FET A;  2CK3 D;  3FKS D;  2OC8 A;  1FX0 B;  3FOA A;  3FN8 A;  2WZQ A;  1MAB B;  1BMF D;  3M5L A;  2IJO B;  2A4R A;  2VBC A;  4RI0 A;  5DSF A;  4B71 A;  3P8O A;  4I33 A;  3SYJ A;  3F3B A;  4F55 A;  2XNI A;  2WHX A;  5EQQ A;  1H8E D;  2P59 A;  1NBM E;  2LEL A;  3F2F A;  2OK5 A;  2V7Q D;  2F9U A;  5H4I B;  3OTP A;  2K1Q A;  3PV2 A;  5T1V A;  4DT4 A;  5FL7 D;  4B73 A;  5F53 A;  2YMS C;  3PRB A;  2KFW A;  3SU2 A;  4B76 A;  2OBQ A;  2QF5 A;  3H09 A;  1DY9 A;  1NS3 A;  2F43 B;  1DXP A;  2OC0 A;  2W6J D;  4Q63 A;  3SUG A;  3ZIA D;  4WH8 A;  3SU4 A;  3SZE A;  5C0T A;  4JMY A;  2JDI D;  3DSO A;  3RC6 A;  3WWB A;  1S6L A;  4I32 A;  3N7D A;  1W0J D;  2XCN A;  2YOL A;  2YMS D;  4WH6 A;  5HKK D;  2KCY A;  3F2H A;  3LKW A;  3OEH D;  3SU0 A;  2KZ4 A;  2XND D;  2OC7 A;  2IJD 1;  5FPT A;  1W3C A;  4Z1M D;  4A1T A;  3F0P A;  2J5U A;  2JJ2 D;  4M9F A;  2GGV B;  2GVF A;  3LOX A;  3U1J B;  2HLD D;  3DCL A;  4YXW D;  1E1R D;  1BT7 A;  5FPY A;  5GPI B;  1DXW A;  1OHH D;  3SUE A;  5EPY A;  3KN2 A;  4A92 A;  4OM9 A;  1KMH B;  5EQS A;  1CU1 A;  2FM2 A;  2WPD D;  1W0K D;  2OC1 A;  3LON A;  4TYD A;  4B6F A;  3OFN D;  3P8N A;  3U1I B;  3O8C A;  3WW7 A;  3O8R A;  1DY8 A;  2K0Q A;  2OBO A;  2QF4 A;  4ZCN A;  5ESB A;  2KCO A;  3O8B A;  3W1E A;  2WV9 A;  2QV1 A;  5CDF E;  3PRD A;  3SV8 A;  3KF2 A;  3SV7 A;  1WXR A;  3OAA D;  3KEE A;  4NWL A;  4A1X A;  3E90 B;  4R8T B;  3RC5 A;  1NBM D;  4B74 A;  5C17 A;  3SU1 A;  3FO8 D;  2JIZ D;  4KTC A;  3RC4 A;  1N1L A;  2K8I A;  2QE7 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...