5F53A

Nano-ring of cadmium ions coordinated by nvpizza2-s16s58
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
84
structure length
84
Chain Sequence
b'MFTGLNTPSGVAVDSAGTVYVTDHGNNRVVKLAAGSNTQTVLPFTGLNTPSGVAVDSAGTVYVTDHGNNRVVKLAAGSNTQTVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NVPIZZA2-S16S58
publication title A cadmium chloride ring created by a designed symmetrical protein
rcsb
molecule tags De novo protein
total genus 13
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2015-12-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.500 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 5f53A00
4ZCNA 3WW7A 3WWBA 5CHBA 3WWFA 5F53A
chains in the Genus database with same CATH superfamily
5EQRA 3EGKH 1XX9A 1H9IE 1QHRB 4RSPA 2TIOA 3LOXA 2D2DA 2WV9A 1P8VC 3DSGA 5AFZH 2G5VA 2CF9H 1ZRBA 2BD2A 1LKAA 1ARCA 9ESTA 3SGQE 2BMGB 4IS5A 1B5GH 1AGJA 1OPHB 1TPAE 2ZDMA 2W6ID 4P02A 4E7RG 2UUKB 2BQWB 1BTUA 2IPQX 1O5GH 4JZEH 2H6MA 3QTOH 1GDNA 4OM9A 2SGDE 2STAE 2UUFB 3DA9B 1QB1A 1YCPK 3QZQA 3S0NA 1RTLA 4BTTB 1FY5A 5L2YH 4GHTA 1RIWC 4K5ZA 3MNBA 1MMJN 1F0UA 2PKAA 2SGFE 4XOJA 1HAXB 4BAOB 5TJXA 4B71A 2NU4E 1AB9B 2V3OH 1RRKA 5L2ZH 1CGIE 1D9IA 1KXEA 3A8CA 1MTNB 2A31A 5DK1A 3UWIA 1BHXF 3RXOA 3UWJH 3KYGA 3BTWE 3NXPA 1V2ST 4TY7A 4OS6A 1QNJA 2VVUA 2A4RA 1S5SA 1EX3A 1MCTA 1DWBH 2XOKD 1H8ED 4FU9A 1SOZA 1G3EA 1ZGIA 2BD4A 4NCYA 1NROH 1FX0B 3BF6H 1G36A 2RA3A 3LGUA 1Y5BT 1ZGVA 4OS7A 1Z1JA 1P3CA 2FOEA 4CREA 1W14U 1EB1H 1LTOA 1WU1A 1AHTH 2WPLS 1O3GA 1P05A 3EA9A 1O36A 3ZIAD 1AVGH 1L0ZA 2V3MA 3GS9A 1O32A 5JYIA 2Y7XA 1ZSJA 3OY6U 4LOYH 1V2WT 1Z6JH 1D6RA 1Z8IB 3NRLA 1GI9B 2XCNA 7GCHG 3KEEA 3ZZ3A 1VITF 1GBHA 1SGPE 2VIDA 1NO9H 2FMJA 1BJVA 1ZYOA 4MPVA 1FZZA 1K21H 1ETRH 1UK2A 4YOGA 3C1KA 2EI6A 2Z3CA 4CRGA 4X8SH 4KTUA 3LJJA 2BYAX 1A3EH 2ZECA 1GJ6A 3RMLH 4JK5A 1WAYB 2HPPH 7KMEH 1IQIA 2D1JA 1VKYA 2LP6A 3BEIB 1GBTA 4SGAE 1CT4E 1QZ8A 2H9HA 2CGAA 3D65E 3PMAB 3S7HB 1PPFE 2LELA 4YLQH 5DGJA 1TGSZ 2R2MB 5DP3A 2BLOA 4I33A 2H9EH 1L4DA 1O2WA 3FP7E 3SV7A 2I6SA 2VVCA 4JZ1A 1V2LT 2C90B 3NZIA 2ZFFH 1S84A 3GISB 2VU8E 4I8GA 4YLUA 1GL1A 2P94A 1NRNH 5TCAA 1GI3A 4JYTA 3OEED 1SHYA 2A5AA 4B6EA 2YMSC 4I8HA 3VXEH 1MTNC 3ZZBA 1T8LA 2LNCA 4AFUA 1DWEH 4X2WA 4K2YA 4ABFA 3SQHE 5DP9A 3I77A 3H5CB 4DT4A 1AU8A 1EFRD 1NFWA 3S9BA 2F91A 1EOLA 4ZHMU 4NZLA 1J17T 3CP7A 2RG3A 5ABWA 3LJOA 4IW4E 1AVWA 2WSSD 4NIWA 1FPCH 4JZIA 1HNEE 4ESTE 1S83A 3PLPA 2WV4A 4F55A 2QXIA 1O2UA 3ZV8A 2FYRA 2M5TA 2Z9LA 3DSPA 4ABEA 3ATLA 3VB7A 1GI4A 1K1PA 3DFLA 1CHOF 1OWEA 1GBKA 3SNBA 2GDEH 2JH6D 1MKXH 3FO8D 1ELVA 5E0HA 3PTNA 1KTTB 3TNTA 3FKSD 4IMQA 5CHBA 2Z7FE 4DOQA 1SBWA 2FI5E 1P9UA 2GCTC 3BTTE 3RXQA 3S9AA 2Q6DA 1NESE 2AFQB 1Z6EA 3LU9B 1ZR0A 3VB3A 2ZDAH 2AMQA 2OC8A 1TBQH 1T8OA 1HAZB 1T31A 1TFXA 2R9PA 4AYVB 3FFGA 1HDTH 1PQAA 1TMUH 3VG8A 2ZU5A 6ESTA 1MBMA 4JCNA 1DX5M 5K7RA 1ZSKA 1FY3A 1JMOH 5AHGH 1FLEE 1E0FD 2ANMH 5EJLA 2BY8X 2F9NA 2BDAA 1VGCC 4VGCB 1F7ZA 1O2OA 1CHGA 5J4QA 1GG6B 2HNTC 2F9BH 3F3BA 4CRFA 2J34A 3UQOA 1QRXA 1Z8GA 3RXKA 2FIRH 4XE4A 4RT0A 4O3TA 2KAIB 1W13U 4NIVA 1D6WA 4MNVA 1F0TA 1O2HA 2PV9B 1K22H 1HXEH 5F6MA 3FZZA 2BVSH 2OUAA 3CS7A 1YBWA 2GCHF 2AGGX 1VR1H 1H8IH 3GCTF 1MBQA 1OHHD 3RC6A 5C2ZA 3TGKE 1WCZA 1GHBF 3MOCA 1F2SE 1G37A 4H6SB 2WYGA 1GBDA 2SFAA 2ZHEH 3RLWH 2JJ1D 1TNJA 2XC4A 3EA7A 4WY3A 1QL9A 1QBNA 4I8KA 4MNWA 1QA0A 1A7SA 1JRTA 4ISHH 1GHYH 2H1UA 2HWLB 3K9XB 1CVWH 4FUCA 2OQUA 4FUEA 4Q63A 4BANB 2Y81A 1BQYA 3BEUA 2P16A 3RXUA 2XRCA 1L2EA 2AIQA 2VJ1A 4K8YA 4MDSA 3ZZ6A 2V35A 1IQJA 4OGXA 4ABHA 1TBZH 2J92A 1OXGA 4SGBE 1O3CA 2I6QA 2ALVA 2V7QD 1HFDA 3PWCA 1MZAA 5CHAB 4ZXXH 1AMHA 1MU6B 3KYFA 1O2PA 3V3MA 2BD8A 1H9HE 2FP7B 4JK6A 1NBMD 1B0EA 3RP2A 1HJAB 2XW9A 2ZI2H 5C1UA 2ANYA 1QY6A 2WPIS 1UJ1A 4HG6A 2B9LA 1TNKA 1FNIA 1GDUA 1K9OE 2AGEX 2XBWA 1FMGA 4WXIA 3SBKA 3VB5A 1Z71A 1XKAC 1BTXA 4WH8A 5DP7A 3VGCB 1SFQB 1Y3YA 4BTUB 2Z9KA 1PYTC 1F5KU 5DP6A 1V6DA 2Y6TA 5DP4A 4JMYA 3TVJB 1GJ8B 1J15A 3MI4A 2PR3A 1ZOMA 2AH4X 2B5TB 1SGYE 1O2VA 1W3CA 4OS2A 3L3TA 4D8NA 1C5PA 4ZKSU 1XUKA 1NPMA 2C8YB 1XVMA 4F4OC 3MH5A 1SG8B 3UPEA 4X1QU 1RS0A 1DY8A 1G30B 3UR6A 2YMSD 3HGNA 2W3KA 2ZHQH 1NM6A 1C5RA 2BLVA 1NRPH 2NU0E 1CT2E 3P70B 3QTVH 4B74A 5A0CA 5EJ1A 5F8ZA 1TIOA 3NCLA 1O5AB 4TSFD 1FDPA 3LGYA 1NBME 2ZNKH 4DCDA 3T5FH 3ZVAA 2UUYA 4RT1A 3U69H 1SI5H 1NFYA 1TPOA 1W0YH 2BD7A 1FXYA 1GMHG 2OP9A 2OC1A 1P0SH 1ARBA 3P8NA 2XTTB 5C0TA 1RFNA 4Q7ZA 4WMDA 2JETB 1K1OA 2QC2A 4X1SU 1Y3WA 3IITA 3KQDA 1E1QD 1O3OA 1HAPH 1VCQA 5CMXH 3U1IB 1FI8A 2J4IA 1AIXH 1C2IA 4CRBA 2P8OB 1PJPA 2BZ6H 3PV2A 2C3SA 1FN8A 1JOUB 3TIUA 5DJ7A 1GHXH 2KAIA 2ZC9H 4CRAA 4ZCNA 5LPRA 3M35A 4ZKNU 3M3SA 1QURH 1BTHH 2Y80A 4INHA 1HYLA 1C2MA 1LHCH 3P17H 2GT7A 4K1SA 4ZROA 1YPHC 1VCPA 4HZHA 5E8EH 3F9FA 2VWOA 1ZJDA 3RC5A 5FX5A 2RCEA 1WQVH 3SI4H 3FP6E 1EASA 3RU4T 1GI8B 2ZU2A 3FP8E 1AN1E 5F53A 2JKHA 3M36A 1LPKB 3SUFA 1MQ5A 2Z9JA 2GV6A 2BX3A 1O5BB 4JYVH 1CA8B 2ULLA 5EOKA 1TGCA 3PMHB 4AORA 1WTHD 2AMDA 3SNAA 2ZCLP 2FTMA 3SNDA 4ASHA 4DIIH 2EQNA 2Y82A 2VIWA 4OS4A 4A92A 1TALA 1ZLRA 3RUOA 3K2UA 1CA0B 2HPQH 3E16B 3SI3H 1MU8B 2ZU1A 2IJOB 1UCYE 3U8OH 3Q77A 1F0RA 2W26A 3A7VA 3UFAA 1O3MA 1WSSH 1DOJA 3KCGH 5EU8A 4FUDA 1OWJA 3HK3B 3KGPA 4TPYA 1A5HA 1O34A 1O2YA 1WOFA 5C20A 4BAQB 4X6MA 1SGIB 1C5MD 3DD2H 1DLEA 2ZIQH 1EJAA 4J2YB 2BY7X 4WXVA 5JBAS 2A7HA 3NK8A 3VFEA 2P95A 3VB6A 1SLVB 3F68H 1RTKA 5FPYA 2QXGA 1TB6H 1C2EA 2PLXA 2ZFPH 2NWNA 4B2AA 4TPIZ 4WMEA 1GHZA 2P8OC 1HB0B 3UNRA 2HNTE 1ZHRA 2G00A 1A61H 4DJZB 2BVRH 1VJAU 1C2KA 2NU1E 2VGCB 1K1JA 3ELAH 1YPJH 2JIZD 1KYNA 3AK5A 1F5LA 1ESAA 2XXLA 1SGQE 4HI3A 2WHXA 3GCNA 2BDYA 1SC8U 5J4SA 5A8YA 1D3DB 1HPGA 1LCYA 2QIQA 2ZHDA 2FLBH 2VIQA 2QXHA 3TPIZ 3ZZ8A 1AY6H 1O3IA 1C1NA 1OS8A 1NTPA 1C9PA 2ZCHP 1ANCA 4X8VH 1KMHB 1CBWB 5T3HA 4JYUH 2EI8A 4GVUA 3A87A 2A4OA 1O3AA 1C1RA 3G01A 3MU1A 1FONA 4Y6DA 1DDJA 1YC0A 1DUEA 1QQUA 1Z8JB 1O31A 1FY4A 1PYTD 1P01A 1GJ7B 1V2RT 3M5MA 1O2MA 1CA0C 2VIOA 2ZGCA 1K2I1 4ABBA 3S9CA 3BSQA 3RDZA 3RM2H 3EQ0H 2EI7A 3TH2H 2AIPA 3ATMA 4TT3D 4ZKOU 2FI4E 1SQAA 5T6FA 1LVYA 3PROA 1MABB 1RXPA 3W95A 1WXRA 2A7CA 2TRMA 4WMFA 6GCHF 4A1XA 2TGAA 2CK3D 3OEHD 3E3TA 3HKJB 2WUCA 1UTPA 1V2KT 4ABIA 2ZFTA 2J94A 3HKIB 3R3GB 2FO9A 3UOPA 1FN6A 3SJ9A 1TE0A 1C1SA 2C4FH 5PTPA 1MTWA 3MNXA 1ZZZA 4O3UA 1BRCE 3F1SB 3LH3A 1ESTA 1PPHE 1ETSH 1YCPM 1C2LA 3V0XA 2UUJB 3SJ8A 4DW2U 2HLDD 1TNIA 1AKSB 4KTCA 1IQEA 2PWXA 5LPEA 1O37A 3DUXH 1NT1A 2ZTXA 5F8TA 3M3TA 1NU9A 1LQDB 1FIZA 4ISOA 2OBQA 5C1YA 5GCHG 1RTFB 4BTIB 4AG2A 3SORA 1UTQA 1V2NT 2A5IA 1GHVH 1ELBA 1S0QA 1H8HD 1GVKB 2F9UA 1TAWA 3SU5A 3L6PA 2G4TA 1XMNB 3BTGE 1HAOH 4K1EA 1G3CA 1DITH 1TX7A 1FY1A 2C8ZB 2PUXB 4IN1A 2QYIA 2BDCA 5KGOA 1GGDB 1GCTB 4FUBA 2QE7D 5GDSH 5L6NH 2FI3E 2ZGHA 1BMAA 3QN7A 2FS9A 4E7NA 1GMHF 4FOUC 4ISNA 2OXSA 4AB8A 2ZTYA 1C1OA 1B0FA 1HAHH 1QIXB 1SQRA 1DY9A 1BMLA 5EIYA 1LMWB 1W0KD 4JZDH 1O5EH 2BHGA 1FJSA 1AWHB 4A6LA 3OTJE 2IOTA 4FXGH 3MO9A 3PRBA 1GBCA 2FOGA 3ZZ9A 2OINA 3NUMA 2F43B 1O2KA 3TU7H 4X6PA 1V2MT 1Z7KA 1U6QA 2KM0A 5IYTA 4ZHLU 2CXVA 1S0RA 3RXMA 5DO4H 1GJBB 4H6TA 1UHBB 4CH8B 1MTSA 2ZTZA 1OOKB 1UK4A 3M5NA 2ZZUH 3SV9A 3GY8A 3PLKA 3GYLB 3EE0B 4Q80A 3UUZA 2FTLE 1P2JA 1C5UA 3GY2A 2A5KA 5JB8S 3NPSA 1AE8H 4GUXA 3H09A 1O3FA 3N7EA 2C8WB 3AW0A 4LK4A 2ZPSA 4QT8C 2A4GA 1GMCG 2L6OA 2ZDKA 1DE7H 3BTDE 1H8DH 4B75A 1C5TA 3MH7A 3ESTA 2EC9H 2HVYB 1C5WB 1YPHE 2F9VA 3PO1B 2KFWA 1A4WH 3D23A 1EATA 2YNAA 4AYYB 1HV7A 4YXWD 4O97A 1TABE 1IQFA 2FM2A 5GJ4B 2PP6A 3RXCA 3A89A 4KELA 5JBTA 1O3HA 3BG4B 2BY9X 5EG4A 2HGTH 1NS3A 5A8XA 5T6DA 2ZEBA 1P9SA 1DLKB 4AOQA 2ESTE 1TRYA 3LC5A 3P92A 3ENSB 3T27A 3IG6B 2QA9E 1T8MA 3LDXH 4X2YA 4INLA 1TMBH 3M7UA 1GCTC 4NA9H 1AB9C 2DUCA 1TA2A 1O3BA 3WWBA 4D7GA 1G3DA 1YY3A 1CQQA 2G4UA 2W5EA 4ACBA 2BLWA 1DSTA 1ELAA 3UREA 2XBXA 3UAIC 3HK6B 1ORFA 1ZPBA 4NA8A 4XD7D 1EB2A 1ABIH 3UTUH 4CRCA 3BTQE 3QUMP 5EXMA 3A7XA 1COWD 2FZZA 2XWAA 2JH0D 3PV4A 3O8CA 2QF0A 4ACAA 1HXFH 5GIBA 3LIWA 3OU0A 1BTWA 3A80A 2W7UA 2FEQH 1C5OH 1MUEB 1C4Y2 5FPSA 1MD8A 2IN2A 1AKSA 3SU0A 2L74A 3M37A 5EJZA 3FZDA 1BUIA 6CHAB 1AO5A 3Q76A 1EKBB 2O9QA 5DP8A 1G2MA 3HGPA 2XBYA 3VPKA 1RD3B 4X2VA 2GJGA 1LVOA 1SLXB 3SU2A 3TJVA 1OX1A 3MTYA 1MH0A 1QGFA 3PO1C 1UTJA 2F9OA 1GPZA 2W6JD 4GSOA 4TWYA 3F0OA 1CU1A 4I32A 5AF9H 5FXLA 2GDDA 3SGAE 1X7AC 5G4BA 1C1TA 1O3KA 1UVSH 1YYY1 1DANH 1GI0A 1N8OB 4GCHG 4MTBA 4NFFA 3LT3A 3GCHB 2ZU3A 4I31A 3SU1A 4NWLA 3KQBA 4Y0YE 1GI5A 3F6UH 2ZA5A 3NWUA 3F0PA 2ZDNA 3OTPA 5GWZA 1GHAG 2ODQA 3Q3KA 2CMYA 1V3XA 1C2HA 3KIDU 2AMPA 1ZPZA 1PPEE 1Q2WA 2QCYA 1THPB 3SV6A 1O3LA 1GBLA 1QRZA 3OX7U 3V12A 1MKXK 2AYWA 2BDBA 2ZFRH 4Q7XA 3JZ2B 8GCHG 1FV9A 4R8TB 1EAWA 1UHBA 4DURA 2A0QB 1UTMA 1O35A 3LGIA 4X8UH 3D62A 1HJ9A 1K1LA 2DE8A 5HMAA 2A32A 4K3JA 1C1VH 1KXAA 3Q00A 1BRBE 1O2XA 1QB9A 2R0KA 2Z3DA 5TCCA 2OQ5A 4MPXA 2VH6A 1QBOA 3KF2A 1GBAA 2VWLA 3TJOA 1GBBA 2P3UB 1S81A 2G5NA 3ZZCA 1AFEH 5EQSA 2G51A 4A1TA 2AERH 3BTME 2OLGA 1ELFA 1TYNA 3FVFB 6CHAC 2GD4B 3B23B 3P8GA 1TRMA 2TGDA 2FLRH 1Y5AT 5DG6A 5FBEA 1XUHA 3A8BA 4K8BA 2K0QA 5EQQA 1XXDA 4AFQA 1IOEA 5AFYH 1GVLA 1BTZA 4Q2KA 3SJKA 3SV8A 1SB1H 1ZHPA 1T7CA 1W0ZU 2BOHB 1SLWB 4IC5A 2FS8A 3I29A 3SHCH 3E90B 4IN2A 1MQ6A 3GDVA 4IC6A 2HVXA 3ODFA 2WINI 4WH6A 3SNCA 1YLDA 1N8OC 4ZHAA 1C5LH 1P2IA 1O3DA 4VGCC 5DP5A 4OGYA 1LHFH 1Y8TA 1DS2E 5KECA 3S69A 1GG6C 1TRNA 3I78A 1A46H 4UD9H 1XUGA 2A2QH 1K1NA 2GMTB 1HIAB 4KGAA 5IDKA 4IMZA 1K1MA 2ZDVH 4ZAEA 1P2MA 3CENA 2FWWA 4P00A 1P57B 2B7DH 2IPHA 1TPPA 2VBCA 2J38A 5A8ZA 3KQCA 1BRAA 1TBRH 4MQAA 3MU5A 1ZMJA 1TPSA 3R0FA 1AQ7A 1JRSA 1QJ7B 1T32A 1ZRKA 1PQ7A 7GCHF 1HJ8A 2XBVA 1EAUA 4GAWA 1O0DH 2XNDD 4B2BA 3TNSA 1THRH 5EW2H 1ZTLA 1BMFD 1H9LB 5C17A 4O03A 3SJOA 1Y3VA 4E06H 2NU3E 4U30A 1ZHMA 2FOCA 4KTSA 4K1TA 5DN6D 3A7ZA 2FESH 4YT6H 1Y5UT 3H7TA 1G2LA 2GTBA 1QA7A 1K28D 3E1XB 2PSYA 1C5ZB 5FPTA 2ANKH 4U01A 2BD9A 2ALPA 3QGNB 1PPCE 2J97A 2ZHWH 3SZNA 1DM4B 1TNHA 3RLYH 1MKWH 3RMNH 1TGNA 3PTBA 4AGJA 5KEDA 3UB0A 1DWDH 3M7TA 4I7YH 1VJ9U 1WUNH 1HAGE 4Z1MD 3TK6A 4UEHH 1HGTH 3BV9B 5CHAC 5GXPA 3SOSA 1Q31A 1IQMA 5I25A 3U8RH 1XKBC 1GBJA 4BAMB 1SMFE 2VB0A 3E0PB 1O2GH 4F48B 1HJAC 1CO7E 1EQ9A 2Y5HA 3LGWA 2PKSB 3RXEA 4X1NU 3O8RA 1C2FA 1GI7B 1AE5A 1O2ZA 3AAVA 5ESBA 2FOFA 1JXPA 1LHDH 4BNRA 2OK5A 1AFQB 3RXDA 4CR5A 3BTEE 2GMTC 3VGCC 2QGRA 1BBRE 4A5TS 3A83A 5E0GA 7LPRA 3UQVA 2OCVB 2GX4A 3TH3H 4M9FA 5FL7D 1TOMH 2BXUH 2QV1A 4XRNA 1O2QA 3MYWA 4OS1A 4X1PU 4AFSA 3UNSA 3GY7A 3WW7A 1AUTC 1OYTH 1SVPA 4XDEA 1S82A 1UVPA 2KCOA 1GJCB 2BDGA 1YF4A 2H9TH 1LKBA 3O8DA 2VIVA 3F9EA 3WY8A 1H4WA 4WWYA 1QTFA 2BD5A 4YESB 3SYJA 4D76A 4THNH 4AC9A 3PYHA 3MH4A 2FOBA 3JZ1B 1LVBA 1O2NA 3QO6A 1OP2A 4KP0A 5EPNA 1ZMLA 1FIWA 2BX4A 3MFJA 1A0LA 1ANBA 5EXNA 4JZFH 4MPUA 5C0UA 1TLDA 2K8IA 1EZSC 4CHAB 1OYQA 4ISLA 4IBLH 1O33A 5F8XA 1HAVB 2Q1JA 1LPGB 3OY5U 1C2GA 3RXGA 5ESTE 1K1IA 1ZJKA 3MNCA 2HALA 3RXFA 2KCPA 1GDQA 4CR9A 3Q3XA 1TGBA 3PRDA 1KXCA 4IGDA 2FOAA 3GY5A 1BZXE 1Y59T 2AHME 2JETC 2ZWLH 2KCYA 2XC0A 3F2FA 4NIYA 1TWXB 1V2OT 4AB9A 3N7DA 1BBRH 3KL6A 1P2NA 3TK9A 3LH1A 1HLTH 3LGVA 1C1PA 1MD7A 4NG9H 2PTCE 1GBIA 1SGEE 2IJD1 2ZQ1A 3SNEA 1BOQA 1UTOA 3ZV9A 4X8TH 2R3YA 3ODDA 5GPIB 2CN0H 3GY4A 2Z3EA 4WVPE 3ATWA 1ESBA 1GJ9B 3ZYEA 8GCHF 4UFFH 4XFQA 3T26A 1QJ6B 1NRRH 3FAOA 3EA8A 4MG3A 5DKMA 3RXRA 3SUEA 2PKSC 2PGQB 4HGCA 3KQEA 5FX6A 4DIHH 1LPZB 1SKYE 1A1RA 3PB1E 2WPHS 2PTNA 1ELDE 1UCYH 2EA3A 3RU4D 4AGKA 1GL0E 2FODA 2WPDD 1GI6A 1GBEA 2WUBA 2ZG0H 3B8JA 5LPFA 4XBCA 1QFKH 2BQ7B 1PPBH 3A8DA 3U28C 3MQKC 1SGCA 1NRQH 4NWKA 2GZ9A 2CJIA 1LDTT 4CBNA 1O39A 1RIWB 2VNTA 5B6OA 1C5VA 1O2TA 2QF4A 1P03A 4AZ2B 1OWKA 2QXJA 1GMDG 1TONA 2ZFQH 1BBRK 4X2XA 4CHAC 3DSOA 3D49H 3RXLA 4Z0KA 1TX6A 1NRSH 3QGJA 1P04A 1WBGB 1YM0A 1OWHA 4D9RA 1D3QB 1ELCA 2O8WA 2O8UA 3TJUA 1C2JA 4FU8A 1D3TB 1EZUC 1DPOA 3K6ZA 1G3BA 1HBTH 1P2KA 1TX8A 2KR7A 1BIOA 3W94A 1XUFA 1O2IA 1SPJA 2TBSA 3SU6A 3A82A 3RU4E 3ZZDA 2XCFA 4RKOB 1UCYK 2OD3B 3SV2H 1IQLA 2O8TA 3GICB 5A0BA 3PMBB 1EP5A 4FUHA 1HAYB 1ETTH 1MTUA 3B9FH 4D7FA 2P93A 1W0JD 3GY6A 4E05H 3MO6A 3FN8A 2VGCC 4PROA 3ZVDA 1ZMNA 2ZFSA 2GCHG 1IHTH 3M7QA 3FOAA 3GCTG 1CSOE 4TYDA 5BPEA 2GZ7A 3Q3YA 1A3BH 1GHBG 2FXRA 4YZUA 2P3TB 4NGAH 1V2UT 1GVZA 1V2PT 4Z6AH 1AZ8A 5EODA 5HIYA 2Z9GA 4FUFA 1Q3XA 3TGIE 1DXPA 1OP8A 3PV5A 4BAHB 3BIVH 2M2AA 4YOIA 3VB4A 1IAUA 1K0HA 3K6YA 4Y8YA 1WV7H 2UWLA 1CBWC 1P02A 2K1QA 1EAIA 4Y7AA 1NU7B 1L1NA 1ELGA 3M5OA 1HAVA 4I8JA 3RXJA 1EJMA 2BLQA 1E79D 1BRUP 2BD3A 3IWMA 3RXSA 2R3UA 1DUAA 2A7JA 4MPWA 4XBDA 2ZF0H 3E8LA 3TH4H 4MNXA 1IQHA 4WF8A 2CV3A 2BOKA 1T8NA 2YMSB 1M9UA 2H5CA 3SU3A 5E0JA 1C5SA 1QRWA 2GZ8A 4FUJA 3RC4A 1KLTA 2WPMS 1O3EA 3N7OA 8KME2 2OC0A 2R0LA 3H7OA 5EXLA 2P59A 1O3PB 3KNXA 2ZGJA 3URDA 3QZRA 4UDWH 1PQ8A 1MCVA 5E2OA 3BN9A 1TQ0B 2UWOA 4ISIH 4B6FA 3GCOA 1XXFA 1NY22 1DFPA 1OSSA 1UVUH 3VXFH 1W10U 1J16A 1DSUA 3RXIA 1SL3A 2Y5FA 8LPRA 1GJ4H 3RXVA 1V2TT 1Y3UA 5FCRA 2SNVA 3TLOA 3A7TA 1E36B 1DWCH 2C8XB 4R0IA 1EJNA 2W3IA 1E37B 2ZPRA 3TITA 3BTHE 2XC5A 3QWCH 2Q6GA 4CBOA 1W7GH 2ZGBH 3RXBA 5A0AE 5ETXA 2GCTB 3RXTA 4GLYA 1UTLM 3P8FA 4RI0A 4I8LA 1S85A 1NC6A 1VCWA 2RA0A 1O2LA 2LPRA 4X6NA 4ZH8A 2JJ2D 3DT0H 1GGDC 2F3CE 4FUIA 4DGJA 1BMMH 1UO6A 3ZVBA 1QL7A 1XUIA 3RMMH 2SNWA 1VGCB 3MH6A 4KKDA 1FPHH 1RGQA 2A4QA 3E6PH 1BMNH 2QAAA 4AG1A 2WPJS 3BEFB 3T62A 1KIGH 3LONA 4Y76A 3GOVB 1V2QT 4Q4LA 1HRTH 2J98B 1LO6A 1EP6A 1GHWH 3A7YA 4CRDA 3P6ZB 4XBBA 1Z8RA 4FVBA 2DE9A 2TPIZ 1AI8H 4H42U 1DVAH 1O3JA 1T4VH 1QBVH 2A45B 3DCLA 4F49A 2BTCE 2GKVE 3SHAH 3GDSA 1JBUH 1S6FA 2GV7A 2V3HH 1XM1A 3MO3A 4B73A 1D4PB 1HCGA 5FHTA 2SGQE 3P8OA 1BB0B 3SJIA 2VIPA 1SGRE 3BIUH 4B2CA 1KTSB 3PM3A 1BCUH 5HGGA 2FYQA 1PPZA 4LXBH 4UFDH 2H5DA 1P06A 2Y5GA 2AGIX 2RDLA 2R2WU 1L4ZA 2VWMA 3MU8A 1BJUA 2WPKS 4Y7BA 1ZTJA 1ELEE 1QL8A 1C5NH 2BQ6B 3SZEA 2TGPZ 2STBE 2V6NA 4U32A 2KX4A 3URCA 2FX6A 1HAIH 2BZAA 4ZXYH 2JH5D 1N6XA 3UOUA 3BG4C 3DHKH 1B7XB 2QF3A 3MU4A 1GMDF 2RDEA 3QLPH 2HNTF 3VEQB 2OBOA 4HFPB 1ID5H 3CNRA 3QDZB 4RKJB 2PFEA 1UTKA 4AFZA 3T29A 1V2JT 2G8TA 1AVXA 5A09A 1TQ7B 2GGVB 1BTYA 4Y79A 1O5FH 2GP9B 3HPTB 1C1UH 1J14A 4XSKU 5AVDA 2ASUB 1E1RD 4Y8ZA 1BITA 2VH0A 1KXFA 1GBMA 5DPAA 4Y8XA 2A2XH 5C67A 4X1RU 2NU2E 3BG8A 1SHHB 1W11U 3FANA 4B76A 1DXWA 1TGTA 5BRRE 1YLCA 2PSXA 2D26C 2PW8H 2SGAA 1ACBE 2Q6FA 1QB6A 1IQGA 3P95A 2FOMB 4YTAA 3ZVCA 2O8LA 1KY9A 1YPGH 2SGEE 2D8WA 3ZZAA 1XUJA 1SGFA 1OP0A 5HM2A 1JWTA 5GCHF 1YGCH 1EUFA 3K65B 4H4FA 1AWFH 3ATIA 3E91A 4BAKB 3A84A 1KDQB 5E2PA 4MVNA 3U8TH 2V0BA 1YPEH 1EAXA 2Z6BD 1INCA 4HTCH 2BVXH 1F5RA 3SUGA 2HOBA 4FU7A 3ZZ7A 7ESTE 5A2MH 3M5LA 1ELTA 4UFGH 3RXAA 4FUGA 1ABJH 1A0HB 2Z94A 2PHBA 1FY8E 3UR9A 1EXFA 3RMOH 4YT7H 1OWIA 2WV5A 3EE7A 4NZQA 3U98H 3GCHC 5FAHA 1O38A 3OAAD 2SGPE 4NSVA 1EZXC 3PLBA 1KLIH 2BDHA 3ZZ5A 3EDXB 1KXDA 4AN7A 2PGBB 4ZUHA 3MWIU 1FUJA 1T4UH 2GT8A 3T28A 2VVVA 2J2UA 3NKKA 2ZPQA 3A7WA 3PWBA 1BDAA 2TGTA 2J98A 1KLJH 1F0SA 1O2SA 5JBCS 3LGTA 3UY9A 3U9AH 6GCHG 2VINA 1E38B 2BY5X 3A8AA 5F03A 4A7IB 5DSFA 5GNDA 1FAKH 2YNBA 5SGAE 1P2QA 4ABAA 1IQNA 3M3VA 1SQOA 1YP9A 3W1EA 1TNLA 3KQ5A 1GMCF 1FAXA 2ZP0H 3BTFE 3AVZA 3STIA 3UIRA 1J8AA 1O5CB 5I46H 1AZZA 2CHAB 3SN8A 1TMTH 2G52A 4YO9A 1EZQA 1GBFA 4Y10E 2G55A 5JB9S 1HUTH 2ODPA 5T1VA 1ZTKA 5EGMA 3ZVFA 4DG4A 2JDID 1O3NA 1NZQH 2ZHFH 3MNSA 4B1TA 1O30A 3TGJE 2EY4C 2C93B 2WZQA 1MAXA 2ODYB 3ZZ4A 2AS9A 1O5DH 4ABDA 2F4LA 4ABGA 1CGJE 1O2JA 1YPMH 1AUJA 2ZDLA 3LKWA 3EYDA 2QN5T 5FBIA 1H1BA 2RFKC 4BXSA 3U1JB 1C4V2 6LPRA 1FQ3A 2FDAA 1GCDA 2XWBI 3STJA 1QQ4A 4Q7YA 5C3NA 1C5QA 3TK5A 1IQKA 2FOHA 1PQ5A 1BA8B 1E35B 3T2NA 5B6LA 3OYPA 5C5NA 4TY6A 3QX5H 1EPTB 1V2VT 1C1QA 2HLCA 2ZKSA 4M7GA 2J5UA 3SO3A 2BB4A 1BT7A 5T6GA 3F9GA 1TA6A 2ZGXH 1A0JA 1A2CH 1LVMA 1TNGA 2OC7A 1UTNA 1N1LA 5FCKA 2AEIH 3S7KB 3CS0A 1A5IA 3E0NB 1GJDB 3PMJA 1G32B 2FPZA 5CDFE 1YKTA 1W7XH 4MLFB 4YOJA 1RJXB 3ITIA 3RM0H 3GDUA 3A86A 1ANDA 3A88A 3LC3A 3ZVGA 3A81A 1QR3E 1E34B 1LHEH 5JDUB 4NSYA 3GYMA 1YPKH 1THSH 1YPLH 1XVOA 2BM2A 4Y71A 3TJNA 3F9HA 1P3EA 1G9IE 1SGDE 4Y0ZE 3RXPA 1BTPA 1WQSA 4ASUD 3WWFA 3SW2B 3F2GA 5JPMH 1DT2A 1MKWK 3KHVA 4D9QA 1A5GH 2CHAC 2PUQH 4MNYA 1WDIA 1VITG 1PFXC 5JBBS 1GJ5H 1KDQA 4UFEH 1O2RA 3V13A 1WYKA 1NFUA 1TOCB 3M61U 4I86A 1MAYA 3LPRA 2UWPA 3EAJA 4A1VA 1SSXA 1VITH 9LPRA 4GCHF 4U2WA 1GI2A 2ILNA 1DICA 1SGNE 2PKAB 2VWNA 5K0HA 2ZQ2A 4BOHA 2ANWA 1CGHA 3F2HA 3N99A 5L30H 5C5OA 4X6OA 1NN6A 2XNIA 4DT7B 5HXFA 1IHSH 2KCAA 1C9TA 1C5YB 3KN2A 4ABJA 1EOJA 1GHAF 1CT0E 3A85A 1P11E 1UK3A 3AASA 2Z9IA 1CE5A 4Y11E 3T25A 4GPGA 2F9PA 3V7TA 2P3FH 2W7SA 4DVAU 4LZ1H 4BXWA 1HIAA 1C4U2 1ANEA 3GY3A 4NIXA 3ZYDA 4UONA 1P2OA 1EPTC 4OS5A 5CE1A 2B0FA 3O8BA 2Y7ZA 1S6LA 1SR5C 2H2ZA 3OFND 1JIMA 1KSNA 1UVOA 1F92A 1MZDA 1ZSLA 2BY6X 1S6HA 1SLUB 1WTGH 1Y3XA 2B8OH 3HATH 5HYOA 1AFQC 4NFEA 1SGFG 1W8BH 1SFIA 1ZPCA 2BXTH 1LHGH 2QY0B 3C27B 2ZCKP 4UE7H 1NFXA 1CHOG 4AX9H 5LH8A 4K60A 2WYJA 1UW7A 1MTVA 3UNQA 1P12E 2ZU4A 3SGBE 3SU4A 4INKA 3OE7D 5HIZA 1UMAH 2O8MA 2YOLA 5EW1H 3ATKA 2A1DB 2G81E 1D3PB 1C2DA 1J9CH 1OKXA 5HKKD 1Z1IA 1GWAA 1PPGE 4GHQA 4O9VA 4X0WU 3SQEE 1QCPA 1UVTH 1W2KH 1LQEA 2F83A 1N6YA 2GVFA 4WJG2 2KZ4A 1P10A 4ZKRU 1GI1A 2EEKA 3QK1A 1KXBA 3OSYA 3MMGA 1YLNA 4TWWA 1YWUA 1L1JA 3ZVEA 2QF5A 1P09A 4NA7A 3AAUA 1C1MA 1YCPH 2CF8H 3RXHA 1QJ1B 3MHWU 3DFJA 4K69A 5HM9A 2XYAA 5LGOA 5IK2D 1C1WH 3L33A 2THFB 1EPTA 4FETA 1SGTA 1W12U 4CH2B 3SUDA 4DY7B 5C94A 2BDIA 2OTVA 1AD8H 2J95A 2ZO3H 3AW1A 4FVDA 1L1GA 1GJAB 1VZQH 2FX4A 1JIRA 5EPYA 3MU0A 1SOTA 2J9NA 1BHXB 1C5XB 5H4IB 1SQTA 1OWDA 4ZMAH 8ESTE 4LZ4B 5C1XA 4RN6A 4YM9A 4J1YA 2HRVA 3BTKE
chains in the Genus database with same CATH topology
5EQRA 2F4LA 2WPDD 3O8RA 3M5NA 3SV9A 3LKWA 3E90B 3M5OA 4TT3D 4JMYA 5ESBA 3EYDA 3LOXA 1JXPA 3U1JB 1E79D 3SU2A 2OK5A 2WV9A 3F3BA 4WH6A 1MABB 4A92A 1WXRA 3DCLA 3H09A 2W6JD 3O8BA 1S6LA 3F0OA 1CU1A 2IJOB 3N7EA 1W3CA 4I32A 4A1XA 4M9FA 5FL7D 2CK3D 3OFND 2A4GA 2QV1A 3OEHD 4NWKA 4WF8A 4B73A 2LELA 2L6OA 2W6ID 3P8OA 4B75A 2YMSB 4I33A 3WW7A 3SUGA 3SU3A 3SV7A 5B6LA 3OYPA 2QF4A 2F9VA 2KCOA 3RC4A 4OM9A 1DY8A 2KFWA 3M5LA 5IDKA 2OC0A 2YMSD 3O8DA 2P59A 2J5UA 3KNXA 1BT7A 4YXWD 1OHHD 1RTLA 3RC6A 3SYJA 3DSOA 2FM2A 3OEED 4I31A 4B74A 4B6EA 2OC7A 4Q4LA 1N1LA 2YMSC 5GJ4B 4NWLA 3SU1A 4TSFD 4B6FA 5EPNA 1NBME 2HLDD 4KTCA 3SU4A 2JJ1D 3F0PA 3OTPA 2VBCA 4B71A 3OE7D 5CDFE 5C0UA 1NS3A 2K8IA 5FPYA 4DT4A 2OC1A 1EFRD 3OAAD 2O8MA 2YOLA 2OBQA 5HKKD 3P8NA 2KR7A 3SV6A 3SZEA 5C0TA 4Q63A 3SU6A 2WSSD 2XNDD 1E1QD 4R8TB 2XCFA 1H8HD 2GVFA 2F9UA 2KCPA 2OBOA 3U1IB 4F55A 2KZ4A 3SU5A 3L6PA 3WWBA 3PRDA 2JIZD 4ASUD 1BMFD 2A4RA 5C17A 3DSPA 5ETXA 3WWFA 3AK5A 3F2GA 5DSFA 5GNDA 2WHXA 1W0JD 2AHME 3PV2A 4RI0A 5DN6D 2KCYA 3F2FA 2XOKD 2GGVB 1H8ED 3FN8A 2QF5A 2QE7D 3FO8D 4ZCNA 3N7DA 3FKSD 5CHBA 3KF2A 3W1EA 4XD7D 1FX0B 3FOAA 5FPTA 2V7QD 2IJD1 4TYDA 4U01A 4A1VA 1DY9A 1E1RD 1W0KD 5GPIB 5IK2D 2JJ2D 1COWD 2OC8A 5EQSA 4A1TA 4FETA 3O8CA 3SUDA 3UB0A 3RC5A 2FP7B 1KMHB 1NBMD 3ZIAD 4B76A 1DXWA 3GS9A 4Z1MD 1DXPA 3PRBA 5EPYA 3PV5A 5T1VA 3F2HA 3N99A 3SUEA 1RGQA 4K8BA 2JDID 2K0QA 2A4QA 2OINA 5EQQA 5H4IB 2XNIA 3VG8A 5F53A 2F43B 2M2AA 2KCAA 3NRLA 5FPSA 2XCNA 2WZQA 3KEEA 3KN2A 2FOMB 3SUFA 3SV8A 1SKYE 3SU0A 3LONA 1A1RA 2KM0A 3M5MA 4WH8A 2K1QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZCN A;  3WW7 A;  3WWB A;  5CHB A;  3WWF A;  5F53 A; 
#chains in the Genus database with same CATH topology
 5EQR A;  3EGK H;  1XX9 A;  1H9I E;  1QHR B;  4RSP A;  2TIO A;  3LOX A;  2D2D A;  2WV9 A;  1P8V C;  3DSG A;  5AFZ H;  2G5V A;  2CF9 H;  1ZRB A;  2BD2 A;  1LKA A;  1ARC A;  9EST A;  3SGQ E;  2BMG B;  4IS5 A;  1B5G H;  1AGJ A;  1OPH B;  1TPA E;  2ZDM A;  2W6I D;  4P02 A;  4E7R G;  2UUK B;  2BQW B;  1BTU A;  2IPQ X;  1O5G H;  4JZE H;  2H6M A;  3QTO H;  1GDN A;  4OM9 A;  2SGD E;  2STA E;  2UUF B;  3DA9 B;  1QB1 A;  1YCP K;  3QZQ A;  3S0N A;  1RTL A;  4BTT B;  1FY5 A;  5L2Y H;  4GHT A;  1RIW C;  4K5Z A;  3MNB A;  1MMJ N;  1F0U A;  2PKA A;  2SGF E;  4XOJ A;  1HAX B;  4BAO B;  5TJX A;  4B71 A;  2NU4 E;  1AB9 B;  2V3O H;  1RRK A;  5L2Z H;  1CGI E;  1D9I A;  1KXE A;  3A8C A;  1MTN B;  2A31 A;  5DK1 A;  3UWI A;  1BHX F;  3RXO A;  3UWJ H;  3KYG A;  3BTW E;  3NXP A;  1V2S T;  4TY7 A;  4OS6 A;  1QNJ A;  2VVU A;  2A4R A;  1S5S A;  1EX3 A;  1MCT A;  1DWB H;  2XOK D;  1H8E D;  4FU9 A;  1SOZ A;  1G3E A;  1ZGI A;  2BD4 A;  4NCY A;  1NRO H;  1FX0 B;  3BF6 H;  1G36 A;  2RA3 A;  3LGU A;  1Y5B T;  1ZGV A;  4OS7 A;  1Z1J A;  1P3C A;  2FOE A;  4CRE A;  1W14 U;  1EB1 H;  1LTO A;  1WU1 A;  1AHT H;  2WPL S;  1O3G A;  1P05 A;  3EA9 A;  1O36 A;  3ZIA D;  1AVG H;  1L0Z A;  2V3M A;  3GS9 A;  1O32 A;  5JYI A;  2Y7X A;  1ZSJ A;  3OY6 U;  4LOY H;  1V2W T;  1Z6J H;  1D6R A;  1Z8I B;  3NRL A;  1GI9 B;  2XCN A;  7GCH G;  3KEE A;  3ZZ3 A;  1VIT F;  1GBH A;  1SGP E;  2VID A;  1NO9 H;  2FMJ A;  1BJV A;  1ZYO A;  4MPV A;  1FZZ A;  1K21 H;  1ETR H;  1UK2 A;  4YOG A;  3C1K A;  2EI6 A;  2Z3C A;  4CRG A;  4X8S H;  4KTU A;  3LJJ A;  2BYA X;  1A3E H;  2ZEC A;  1GJ6 A;  3RML H;  4JK5 A;  1WAY B;  2HPP H;  7KME H;  1IQI A;  2D1J A;  1VKY A;  2LP6 A;  3BEI B;  1GBT A;  4SGA E;  1CT4 E;  1QZ8 A;  2H9H A;  2CGA A;  3D65 E;  3PMA B;  3S7H B;  1PPF E;  2LEL A;  4YLQ H;  5DGJ A;  1TGS Z;  2R2M B;  5DP3 A;  2BLO A;  4I33 A;  2H9E H;  1L4D A;  1O2W A;  3FP7 E;  3SV7 A;  2I6S A;  2VVC A;  4JZ1 A;  1V2L T;  2C90 B;  3NZI A;  2ZFF H;  1S84 A;  3GIS B;  2VU8 E;  4I8G A;  4YLU A;  1GL1 A;  2P94 A;  1NRN H;  5TCA A;  1GI3 A;  4JYT A;  3OEE D;  1SHY A;  2A5A A;  4B6E A;  2YMS C;  4I8H A;  3VXE H;  1MTN C;  3ZZB A;  1T8L A;  2LNC A;  4AFU A;  1DWE H;  4X2W A;  4K2Y A;  4ABF A;  3SQH E;  5DP9 A;  3I77 A;  3H5C B;  4DT4 A;  1AU8 A;  1EFR D;  1NFW A;  3S9B A;  2F91 A;  1EOL A;  4ZHM U;  4NZL A;  1J17 T;  3CP7 A;  2RG3 A;  5ABW A;  3LJO A;  4IW4 E;  1AVW A;  2WSS D;  4NIW A;  1FPC H;  4JZI A;  1HNE E;  4EST E;  1S83 A;  3PLP A;  2WV4 A;  4F55 A;  2QXI A;  1O2U A;  3ZV8 A;  2FYR A;  2M5T A;  2Z9L A;  3DSP A;  4ABE A;  3ATL A;  3VB7 A;  1GI4 A;  1K1P A;  3DFL A;  1CHO F;  1OWE A;  1GBK A;  3SNB A;  2GDE H;  2JH6 D;  1MKX H;  3FO8 D;  1ELV A;  5E0H A;  3PTN A;  1KTT B;  3TNT A;  3FKS D;  4IMQ A;  5CHB A;  2Z7F E;  4DOQ A;  1SBW A;  2FI5 E;  1P9U A;  2GCT C;  3BTT E;  3RXQ A;  3S9A A;  2Q6D A;  1NES E;  2AFQ B;  1Z6E A;  3LU9 B;  1ZR0 A;  3VB3 A;  2ZDA H;  2AMQ A;  2OC8 A;  1TBQ H;  1T8O A;  1HAZ B;  1T31 A;  1TFX A;  2R9P A;  4AYV B;  3FFG A;  1HDT H;  1PQA A;  1TMU H;  3VG8 A;  2ZU5 A;  6EST A;  1MBM A;  4JCN A;  1DX5 M;  5K7R A;  1ZSK A;  1FY3 A;  1JMO H;  5AHG H;  1FLE E;  1E0F D;  2ANM H;  5EJL A;  2BY8 X;  2F9N A;  2BDA A;  1VGC C;  4VGC B;  1F7Z A;  1O2O A;  1CHG A;  5J4Q A;  1GG6 B;  2HNT C;  2F9B H;  3F3B A;  4CRF A;  2J34 A;  3UQO A;  1QRX A;  1Z8G A;  3RXK A;  2FIR H;  4XE4 A;  4RT0 A;  4O3T A;  2KAI B;  1W13 U;  4NIV A;  1D6W A;  4MNV A;  1F0T A;  1O2H A;  2PV9 B;  1K22 H;  1HXE H;  5F6M A;  3FZZ A;  2BVS H;  2OUA A;  3CS7 A;  1YBW A;  2GCH F;  2AGG X;  1VR1 H;  1H8I H;  3GCT F;  1MBQ A;  1OHH D;  3RC6 A;  5C2Z A;  3TGK E;  1WCZ A;  1GHB F;  3MOC A;  1F2S E;  1G37 A;  4H6S B;  2WYG A;  1GBD A;  2SFA A;  2ZHE H;  3RLW H;  2JJ1 D;  1TNJ A;  2XC4 A;  3EA7 A;  4WY3 A;  1QL9 A;  1QBN A;  4I8K A;  4MNW A;  1QA0 A;  1A7S A;  1JRT A;  4ISH H;  1GHY H;  2H1U A;  2HWL B;  3K9X B;  1CVW H;  4FUC A;  2OQU A;  4FUE A;  4Q63 A;  4BAN B;  2Y81 A;  1BQY A;  3BEU A;  2P16 A;  3RXU A;  2XRC A;  1L2E A;  2AIQ A;  2VJ1 A;  4K8Y A;  4MDS A;  3ZZ6 A;  2V35 A;  1IQJ A;  4OGX A;  4ABH A;  1TBZ H;  2J92 A;  1OXG A;  4SGB E;  1O3C A;  2I6Q A;  2ALV A;  2V7Q D;  1HFD A;  3PWC A;  1MZA A;  5CHA B;  4ZXX H;  1AMH A;  1MU6 B;  3KYF A;  1O2P A;  3V3M A;  2BD8 A;  1H9H E;  2FP7 B;  4JK6 A;  1NBM D;  1B0E A;  3RP2 A;  1HJA B;  2XW9 A;  2ZI2 H;  5C1U A;  2ANY A;  1QY6 A;  2WPI S;  1UJ1 A;  4HG6 A;  2B9L A;  1TNK A;  1FNI A;  1GDU A;  1K9O E;  2AGE X;  2XBW A;  1FMG A;  4WXI A;  3SBK A;  3VB5 A;  1Z71 A;  1XKA C;  1BTX A;  4WH8 A;  5DP7 A;  3VGC B;  1SFQ B;  1Y3Y A;  4BTU B;  2Z9K A;  1PYT C;  1F5K U;  5DP6 A;  1V6D A;  2Y6T A;  5DP4 A;  4JMY A;  3TVJ B;  1GJ8 B;  1J15 A;  3MI4 A;  2PR3 A;  1ZOM A;  2AH4 X;  2B5T B;  1SGY E;  1O2V A;  1W3C A;  4OS2 A;  3L3T A;  4D8N A;  1C5P A;  4ZKS U;  1XUK A;  1NPM A;  2C8Y B;  1XVM A;  4F4O C;  3MH5 A;  1SG8 B;  3UPE A;  4X1Q U;  1RS0 A;  1DY8 A;  1G30 B;  3UR6 A;  2YMS D;  3HGN A;  2W3K A;  2ZHQ H;  1NM6 A;  1C5R A;  2BLV A;  1NRP H;  2NU0 E;  1CT2 E;  3P70 B;  3QTV H;  4B74 A;  5A0C A;  5EJ1 A;  5F8Z A;  1TIO A;  3NCL A;  1O5A B;  4TSF D;  1FDP A;  3LGY A;  1NBM E;  2ZNK H;  4DCD A;  3T5F H;  3ZVA A;  2UUY A;  4RT1 A;  3U69 H;  1SI5 H;  1NFY A;  1TPO A;  1W0Y H;  2BD7 A;  1FXY A;  1GMH G;  2OP9 A;  2OC1 A;  1P0S H;  1ARB A;  3P8N A;  2XTT B;  5C0T A;  1RFN A;  4Q7Z A;  4WMD A;  2JET B;  1K1O A;  2QC2 A;  4X1S U;  1Y3W A;  3IIT A;  3KQD A;  1E1Q D;  1O3O A;  1HAP H;  1VCQ A;  5CMX H;  3U1I B;  1FI8 A;  2J4I A;  1AIX H;  1C2I A;  4CRB A;  2P8O B;  1PJP A;  2BZ6 H;  3PV2 A;  2C3S A;  1FN8 A;  1JOU B;  3TIU A;  5DJ7 A;  1GHX H;  2KAI A;  2ZC9 H;  4CRA A;  4ZCN A;  5LPR A;  3M35 A;  4ZKN U;  3M3S A;  1QUR H;  1BTH H;  2Y80 A;  4INH A;  1HYL A;  1C2M A;  1LHC H;  3P17 H;  2GT7 A;  4K1S A;  4ZRO A;  1YPH C;  1VCP A;  4HZH A;  5E8E H;  3F9F A;  2VWO A;  1ZJD A;  3RC5 A;  5FX5 A;  2RCE A;  1WQV H;  3SI4 H;  3FP6 E;  1EAS A;  3RU4 T;  1GI8 B;  2ZU2 A;  3FP8 E;  1AN1 E;  5F53 A;  2JKH A;  3M36 A;  1LPK B;  3SUF A;  1MQ5 A;  2Z9J A;  2GV6 A;  2BX3 A;  1O5B B;  4JYV H;  1CA8 B;  2ULL A;  5EOK A;  1TGC A;  3PMH B;  4AOR A;  1WTH D;  2AMD A;  3SNA A;  2ZCL P;  2FTM A;  3SND A;  4ASH A;  4DII H;  2EQN A;  2Y82 A;  2VIW A;  4OS4 A;  4A92 A;  1TAL A;  1ZLR A;  3RUO A;  3K2U A;  1CA0 B;  2HPQ H;  3E16 B;  3SI3 H;  1MU8 B;  2ZU1 A;  2IJO B;  1UCY E;  3U8O H;  3Q77 A;  1F0R A;  2W26 A;  3A7V A;  3UFA A;  1O3M A;  1WSS H;  1DOJ A;  3KCG H;  5EU8 A;  4FUD A;  1OWJ A;  3HK3 B;  3KGP A;  4TPY A;  1A5H A;  1O34 A;  1O2Y A;  1WOF A;  5C20 A;  4BAQ B;  4X6M A;  1SGI B;  1C5M D;  3DD2 H;  1DLE A;  2ZIQ H;  1EJA A;  4J2Y B;  2BY7 X;  4WXV A;  5JBA S;  2A7H A;  3NK8 A;  3VFE A;  2P95 A;  3VB6 A;  1SLV B;  3F68 H;  1RTK A;  5FPY A;  2QXG A;  1TB6 H;  1C2E A;  2PLX A;  2ZFP H;  2NWN A;  4B2A A;  4TPI Z;  4WME A;  1GHZ A;  2P8O C;  1HB0 B;  3UNR A;  2HNT E;  1ZHR A;  2G00 A;  1A61 H;  4DJZ B;  2BVR H;  1VJA U;  1C2K A;  2NU1 E;  2VGC B;  1K1J A;  3ELA H;  1YPJ H;  2JIZ D;  1KYN A;  3AK5 A;  1F5L A;  1ESA A;  2XXL A;  1SGQ E;  4HI3 A;  2WHX A;  3GCN A;  2BDY A;  1SC8 U;  5J4S A;  5A8Y A;  1D3D B;  1HPG A;  1LCY A;  2QIQ A;  2ZHD A;  2FLB H;  2VIQ A;  2QXH A;  3TPI Z;  3ZZ8 A;  1AY6 H;  1O3I A;  1C1N A;  1OS8 A;  1NTP A;  1C9P A;  2ZCH P;  1ANC A;  4X8V H;  1KMH B;  1CBW B;  5T3H A;  4JYU H;  2EI8 A;  4GVU A;  3A87 A;  2A4O A;  1O3A A;  1C1R A;  3G01 A;  3MU1 A;  1FON A;  4Y6D A;  1DDJ A;  1YC0 A;  1DUE A;  1QQU A;  1Z8J B;  1O31 A;  1FY4 A;  1PYT D;  1P01 A;  1GJ7 B;  1V2R T;  3M5M A;  1O2M A;  1CA0 C;  2VIO A;  2ZGC A;  1K2I 1;  4ABB A;  3S9C A;  3BSQ A;  3RDZ A;  3RM2 H;  3EQ0 H;  2EI7 A;  3TH2 H;  2AIP A;  3ATM A;  4TT3 D;  4ZKO U;  2FI4 E;  1SQA A;  5T6F A;  1LVY A;  3PRO A;  1MAB B;  1RXP A;  3W95 A;  1WXR A;  2A7C A;  2TRM A;  4WMF A;  6GCH F;  4A1X A;  2TGA A;  2CK3 D;  3OEH D;  3E3T A;  3HKJ B;  2WUC A;  1UTP A;  1V2K T;  4ABI A;  2ZFT A;  2J94 A;  3HKI B;  3R3G B;  2FO9 A;  3UOP A;  1FN6 A;  3SJ9 A;  1TE0 A;  1C1S A;  2C4F H;  5PTP A;  1MTW A;  3MNX A;  1ZZZ A;  4O3U A;  1BRC E;  3F1S B;  3LH3 A;  1EST A;  1PPH E;  1ETS H;  1YCP M;  1C2L A;  3V0X A;  2UUJ B;  3SJ8 A;  4DW2 U;  2HLD D;  1TNI A;  1AKS B;  4KTC A;  1IQE A;  2PWX A;  5LPE A;  1O37 A;  3DUX H;  1NT1 A;  2ZTX A;  5F8T A;  3M3T A;  1NU9 A;  1LQD B;  1FIZ A;  4ISO A;  2OBQ A;  5C1Y A;  5GCH G;  1RTF B;  4BTI B;  4AG2 A;  3SOR A;  1UTQ A;  1V2N T;  2A5I A;  1GHV H;  1ELB A;  1S0Q A;  1H8H D;  1GVK B;  2F9U A;  1TAW A;  3SU5 A;  3L6P A;  2G4T A;  1XMN B;  3BTG E;  1HAO H;  4K1E A;  1G3C A;  1DIT H;  1TX7 A;  1FY1 A;  2C8Z B;  2PUX B;  4IN1 A;  2QYI A;  2BDC A;  5KGO A;  1GGD B;  1GCT B;  4FUB A;  2QE7 D;  5GDS H;  5L6N H;  2FI3 E;  2ZGH A;  1BMA A;  3QN7 A;  2FS9 A;  4E7N A;  1GMH F;  4FOU C;  4ISN A;  2OXS A;  4AB8 A;  2ZTY A;  1C1O A;  1B0F A;  1HAH H;  1QIX B;  1SQR A;  1DY9 A;  1BML A;  5EIY A;  1LMW B;  1W0K D;  4JZD H;  1O5E H;  2BHG A;  1FJS A;  1AWH B;  4A6L A;  3OTJ E;  2IOT A;  4FXG H;  3MO9 A;  3PRB A;  1GBC A;  2FOG A;  3ZZ9 A;  2OIN A;  3NUM A;  2F43 B;  1O2K A;  3TU7 H;  4X6P A;  1V2M T;  1Z7K A;  1U6Q A;  2KM0 A;  5IYT A;  4ZHL U;  2CXV A;  1S0R A;  3RXM A;  5DO4 H;  1GJB B;  4H6T A;  1UHB B;  4CH8 B;  1MTS A;  2ZTZ A;  1OOK B;  1UK4 A;  3M5N A;  2ZZU H;  3SV9 A;  3GY8 A;  3PLK A;  3GYL B;  3EE0 B;  4Q80 A;  3UUZ A;  2FTL E;  1P2J A;  1C5U A;  3GY2 A;  2A5K A;  5JB8 S;  3NPS A;  1AE8 H;  4GUX A;  3H09 A;  1O3F A;  3N7E A;  2C8W B;  3AW0 A;  4LK4 A;  2ZPS A;  4QT8 C;  2A4G A;  1GMC G;  2L6O A;  2ZDK A;  1DE7 H;  3BTD E;  1H8D H;  4B75 A;  1C5T A;  3MH7 A;  3EST A;  2EC9 H;  2HVY B;  1C5W B;  1YPH E;  2F9V A;  3PO1 B;  2KFW A;  1A4W H;  3D23 A;  1EAT A;  2YNA A;  4AYY B;  1HV7 A;  4YXW D;  4O97 A;  1TAB E;  1IQF A;  2FM2 A;  5GJ4 B;  2PP6 A;  3RXC A;  3A89 A;  4KEL A;  5JBT A;  1O3H A;  3BG4 B;  2BY9 X;  5EG4 A;  2HGT H;  1NS3 A;  5A8X A;  5T6D A;  2ZEB A;  1P9S A;  1DLK B;  4AOQ A;  2EST E;  1TRY A;  3LC5 A;  3P92 A;  3ENS B;  3T27 A;  3IG6 B;  2QA9 E;  1T8M A;  3LDX H;  4X2Y A;  4INL A;  1TMB H;  3M7U A;  1GCT C;  4NA9 H;  1AB9 C;  2DUC A;  1TA2 A;  1O3B A;  3WWB A;  4D7G A;  1G3D A;  1YY3 A;  1CQQ A;  2G4U A;  2W5E A;  4ACB A;  2BLW A;  1DST A;  1ELA A;  3URE A;  2XBX A;  3UAI C;  3HK6 B;  1ORF A;  1ZPB A;  4NA8 A;  4XD7 D;  1EB2 A;  1ABI H;  3UTU H;  4CRC A;  3BTQ E;  3QUM P;  5EXM A;  3A7X A;  1COW D;  2FZZ A;  2XWA A;  2JH0 D;  3PV4 A;  3O8C A;  2QF0 A;  4ACA A;  1HXF H;  5GIB A;  3LIW A;  3OU0 A;  1BTW A;  3A80 A;  2W7U A;  2FEQ H;  1C5O H;  1MUE B;  1C4Y 2;  5FPS A;  1MD8 A;  2IN2 A;  1AKS A;  3SU0 A;  2L74 A;  3M37 A;  5EJZ A;  3FZD A;  1BUI A;  6CHA B;  1AO5 A;  3Q76 A;  1EKB B;  2O9Q A;  5DP8 A;  1G2M A;  3HGP A;  2XBY A;  3VPK A;  1RD3 B;  4X2V A;  2GJG A;  1LVO A;  1SLX B;  3SU2 A;  3TJV A;  1OX1 A;  3MTY A;  1MH0 A;  1QGF A;  3PO1 C;  1UTJ A;  2F9O A;  1GPZ A;  2W6J D;  4GSO A;  4TWY A;  3F0O A;  1CU1 A;  4I32 A;  5AF9 H;  5FXL A;  2GDD A;  3SGA E;  1X7A C;  5G4B A;  1C1T A;  1O3K A;  1UVS H;  1YYY 1;  1DAN H;  1GI0 A;  1N8O B;  4GCH G;  4MTB A;  4NFF A;  3LT3 A;  3GCH B;  2ZU3 A;  4I31 A;  3SU1 A;  4NWL A;  3KQB A;  4Y0Y E;  1GI5 A;  3F6U H;  2ZA5 A;  3NWU A;  3F0P A;  2ZDN A;  3OTP A;  5GWZ A;  1GHA G;  2ODQ A;  3Q3K A;  2CMY A;  1V3X A;  1C2H A;  3KID U;  2AMP A;  1ZPZ A;  1PPE E;  1Q2W A;  2QCY A;  1THP B;  3SV6 A;  1O3L A;  1GBL A;  1QRZ A;  3OX7 U;  3V12 A;  1MKX K;  2AYW A;  2BDB A;  2ZFR H;  4Q7X A;  3JZ2 B;  8GCH G;  1FV9 A;  4R8T B;  1EAW A;  1UHB A;  4DUR A;  2A0Q B;  1UTM A;  1O35 A;  3LGI A;  4X8U H;  3D62 A;  1HJ9 A;  1K1L A;  2DE8 A;  5HMA A;  2A32 A;  4K3J A;  1C1V H;  1KXA A;  3Q00 A;  1BRB E;  1O2X A;  1QB9 A;  2R0K A;  2Z3D A;  5TCC A;  2OQ5 A;  4MPX A;  2VH6 A;  1QBO A;  3KF2 A;  1GBA A;  2VWL A;  3TJO A;  1GBB A;  2P3U B;  1S81 A;  2G5N A;  3ZZC A;  1AFE H;  5EQS A;  2G51 A;  4A1T A;  2AER H;  3BTM E;  2OLG A;  1ELF A;  1TYN A;  3FVF B;  6CHA C;  2GD4 B;  3B23 B;  3P8G A;  1TRM A;  2TGD A;  2FLR H;  1Y5A T;  5DG6 A;  5FBE A;  1XUH A;  3A8B A;  4K8B A;  2K0Q A;  5EQQ A;  1XXD A;  4AFQ A;  1IOE A;  5AFY H;  1GVL A;  1BTZ A;  4Q2K A;  3SJK A;  3SV8 A;  1SB1 H;  1ZHP A;  1T7C A;  1W0Z U;  2BOH B;  1SLW B;  4IC5 A;  2FS8 A;  3I29 A;  3SHC H;  3E90 B;  4IN2 A;  1MQ6 A;  3GDV A;  4IC6 A;  2HVX A;  3ODF A;  2WIN I;  4WH6 A;  3SNC A;  1YLD A;  1N8O C;  4ZHA A;  1C5L H;  1P2I A;  1O3D A;  4VGC C;  5DP5 A;  4OGY A;  1LHF H;  1Y8T A;  1DS2 E;  5KEC A;  3S69 A;  1GG6 C;  1TRN A;  3I78 A;  1A46 H;  4UD9 H;  1XUG A;  2A2Q H;  1K1N A;  2GMT B;  1HIA B;  4KGA A;  5IDK A;  4IMZ A;  1K1M A;  2ZDV H;  4ZAE A;  1P2M A;  3CEN A;  2FWW A;  4P00 A;  1P57 B;  2B7D H;  2IPH A;  1TPP A;  2VBC A;  2J38 A;  5A8Z A;  3KQC A;  1BRA A;  1TBR H;  4MQA A;  3MU5 A;  1ZMJ A;  1TPS A;  3R0F A;  1AQ7 A;  1JRS A;  1QJ7 B;  1T32 A;  1ZRK A;  1PQ7 A;  7GCH F;  1HJ8 A;  2XBV A;  1EAU A;  4GAW A;  1O0D H;  2XND D;  4B2B A;  3TNS A;  1THR H;  5EW2 H;  1ZTL A;  1BMF D;  1H9L B;  5C17 A;  4O03 A;  3SJO A;  1Y3V A;  4E06 H;  2NU3 E;  4U30 A;  1ZHM A;  2FOC A;  4KTS A;  4K1T A;  5DN6 D;  3A7Z A;  2FES H;  4YT6 H;  1Y5U T;  3H7T A;  1G2L A;  2GTB A;  1QA7 A;  1K28 D;  3E1X B;  2PSY A;  1C5Z B;  5FPT A;  2ANK H;  4U01 A;  2BD9 A;  2ALP A;  3QGN B;  1PPC E;  2J97 A;  2ZHW H;  3SZN A;  1DM4 B;  1TNH A;  3RLY H;  1MKW H;  3RMN H;  1TGN A;  3PTB A;  4AGJ A;  5KED A;  3UB0 A;  1DWD H;  3M7T A;  4I7Y H;  1VJ9 U;  1WUN H;  1HAG E;  4Z1M D;  3TK6 A;  4UEH H;  1HGT H;  3BV9 B;  5CHA C;  5GXP A;  3SOS A;  1Q31 A;  1IQM A;  5I25 A;  3U8R H;  1XKB C;  1GBJ A;  4BAM B;  1SMF E;  2VB0 A;  3E0P B;  1O2G H;  4F48 B;  1HJA C;  1CO7 E;  1EQ9 A;  2Y5H A;  3LGW A;  2PKS B;  3RXE A;  4X1N U;  3O8R A;  1C2F A;  1GI7 B;  1AE5 A;  1O2Z A;  3AAV A;  5ESB A;  2FOF A;  1JXP A;  1LHD H;  4BNR A;  2OK5 A;  1AFQ B;  3RXD A;  4CR5 A;  3BTE E;  2GMT C;  3VGC C;  2QGR A;  1BBR E;  4A5T S;  3A83 A;  5E0G A;  7LPR A;  3UQV A;  2OCV B;  2GX4 A;  3TH3 H;  4M9F A;  5FL7 D;  1TOM H;  2BXU H;  2QV1 A;  4XRN A;  1O2Q A;  3MYW A;  4OS1 A;  4X1P U;  4AFS A;  3UNS A;  3GY7 A;  3WW7 A;  1AUT C;  1OYT H;  1SVP A;  4XDE A;  1S82 A;  1UVP A;  2KCO A;  1GJC B;  2BDG A;  1YF4 A;  2H9T H;  1LKB A;  3O8D A;  2VIV A;  3F9E A;  3WY8 A;  1H4W A;  4WWY A;  1QTF A;  2BD5 A;  4YES B;  3SYJ A;  4D76 A;  4THN H;  4AC9 A;  3PYH A;  3MH4 A;  2FOB A;  3JZ1 B;  1LVB A;  1O2N A;  3QO6 A;  1OP2 A;  4KP0 A;  5EPN A;  1ZML A;  1FIW A;  2BX4 A;  3MFJ A;  1A0L A;  1ANB A;  5EXN A;  4JZF H;  4MPU A;  5C0U A;  1TLD A;  2K8I A;  1EZS C;  4CHA B;  1OYQ A;  4ISL A;  4IBL H;  1O33 A;  5F8X A;  1HAV B;  2Q1J A;  1LPG B;  3OY5 U;  1C2G A;  3RXG A;  5EST E;  1K1I A;  1ZJK A;  3MNC A;  2HAL A;  3RXF A;  2KCP A;  1GDQ A;  4CR9 A;  3Q3X A;  1TGB A;  3PRD A;  1KXC A;  4IGD A;  2FOA A;  3GY5 A;  1BZX E;  1Y59 T;  2AHM E;  2JET C;  2ZWL H;  2KCY A;  2XC0 A;  3F2F A;  4NIY A;  1TWX B;  1V2O T;  4AB9 A;  3N7D A;  1BBR H;  3KL6 A;  1P2N A;  3TK9 A;  3LH1 A;  1HLT H;  3LGV A;  1C1P A;  1MD7 A;  4NG9 H;  2PTC E;  1GBI A;  1SGE E;  2IJD 1;  2ZQ1 A;  3SNE A;  1BOQ A;  1UTO A;  3ZV9 A;  4X8T H;  2R3Y A;  3ODD A;  5GPI B;  2CN0 H;  3GY4 A;  2Z3E A;  4WVP E;  3ATW A;  1ESB A;  1GJ9 B;  3ZYE A;  8GCH F;  4UFF H;  4XFQ A;  3T26 A;  1QJ6 B;  1NRR H;  3FAO A;  3EA8 A;  4MG3 A;  5DKM A;  3RXR A;  3SUE A;  2PKS C;  2PGQ B;  4HGC A;  3KQE A;  5FX6 A;  4DIH H;  1LPZ B;  1SKY E;  1A1R A;  3PB1 E;  2WPH S;  2PTN A;  1ELD E;  1UCY H;  2EA3 A;  3RU4 D;  4AGK A;  1GL0 E;  2FOD A;  2WPD D;  1GI6 A;  1GBE A;  2WUB A;  2ZG0 H;  3B8J A;  5LPF A;  4XBC A;  1QFK H;  2BQ7 B;  1PPB H;  3A8D A;  3U28 C;  3MQK C;  1SGC A;  1NRQ H;  4NWK A;  2GZ9 A;  2CJI A;  1LDT T;  4CBN A;  1O39 A;  1RIW B;  2VNT A;  5B6O A;  1C5V A;  1O2T A;  2QF4 A;  1P03 A;  4AZ2 B;  1OWK A;  2QXJ A;  1GMD G;  1TON A;  2ZFQ H;  1BBR K;  4X2X A;  4CHA C;  3DSO A;  3D49 H;  3RXL A;  4Z0K A;  1TX6 A;  1NRS H;  3QGJ A;  1P04 A;  1WBG B;  1YM0 A;  1OWH A;  4D9R A;  1D3Q B;  1ELC A;  2O8W A;  2O8U A;  3TJU A;  1C2J A;  4FU8 A;  1D3T B;  1EZU C;  1DPO A;  3K6Z A;  1G3B A;  1HBT H;  1P2K A;  1TX8 A;  2KR7 A;  1BIO A;  3W94 A;  1XUF A;  1O2I A;  1SPJ A;  2TBS A;  3SU6 A;  3A82 A;  3RU4 E;  3ZZD A;  2XCF A;  4RKO B;  1UCY K;  2OD3 B;  3SV2 H;  1IQL A;  2O8T A;  3GIC B;  5A0B A;  3PMB B;  1EP5 A;  4FUH A;  1HAY B;  1ETT H;  1MTU A;  3B9F H;  4D7F A;  2P93 A;  1W0J D;  3GY6 A;  4E05 H;  3MO6 A;  3FN8 A;  2VGC C;  4PRO A;  3ZVD A;  1ZMN A;  2ZFS A;  2GCH G;  1IHT H;  3M7Q A;  3FOA A;  3GCT G;  1CSO E;  4TYD A;  5BPE A;  2GZ7 A;  3Q3Y A;  1A3B H;  1GHB G;  2FXR A;  4YZU A;  2P3T B;  4NGA H;  1V2U T;  1GVZ A;  1V2P T;  4Z6A H;  1AZ8 A;  5EOD A;  5HIY A;  2Z9G A;  4FUF A;  1Q3X A;  3TGI E;  1DXP A;  1OP8 A;  3PV5 A;  4BAH B;  3BIV H;  2M2A A;  4YOI A;  3VB4 A;  1IAU A;  1K0H A;  3K6Y A;  4Y8Y A;  1WV7 H;  2UWL A;  1CBW C;  1P02 A;  2K1Q A;  1EAI A;  4Y7A A;  1NU7 B;  1L1N A;  1ELG A;  3M5O A;  1HAV A;  4I8J A;  3RXJ A;  1EJM A;  2BLQ A;  1E79 D;  1BRU P;  2BD3 A;  3IWM A;  3RXS A;  2R3U A;  1DUA A;  2A7J A;  4MPW A;  4XBD A;  2ZF0 H;  3E8L A;  3TH4 H;  4MNX A;  1IQH A;  4WF8 A;  2CV3 A;  2BOK A;  1T8N A;  2YMS B;  1M9U A;  2H5C A;  3SU3 A;  5E0J A;  1C5S A;  1QRW A;  2GZ8 A;  4FUJ A;  3RC4 A;  1KLT A;  2WPM S;  1O3E A;  3N7O A;  8KME 2;  2OC0 A;  2R0L A;  3H7O A;  5EXL A;  2P59 A;  1O3P B;  3KNX A;  2ZGJ A;  3URD A;  3QZR A;  4UDW H;  1PQ8 A;  1MCV A;  5E2O A;  3BN9 A;  1TQ0 B;  2UWO A;  4ISI H;  4B6F A;  3GCO A;  1XXF A;  1NY2 2;  1DFP A;  1OSS A;  1UVU H;  3VXF H;  1W10 U;  1J16 A;  1DSU A;  3RXI A;  1SL3 A;  2Y5F A;  8LPR A;  1GJ4 H;  3RXV A;  1V2T T;  1Y3U A;  5FCR A;  2SNV A;  3TLO A;  3A7T A;  1E36 B;  1DWC H;  2C8X B;  4R0I A;  1EJN A;  2W3I A;  1E37 B;  2ZPR A;  3TIT A;  3BTH E;  2XC5 A;  3QWC H;  2Q6G A;  4CBO A;  1W7G H;  2ZGB H;  3RXB A;  5A0A E;  5ETX A;  2GCT B;  3RXT A;  4GLY A;  1UTL M;  3P8F A;  4RI0 A;  4I8L A;  1S85 A;  1NC6 A;  1VCW A;  2RA0 A;  1O2L A;  2LPR A;  4X6N A;  4ZH8 A;  2JJ2 D;  3DT0 H;  1GGD C;  2F3C E;  4FUI A;  4DGJ A;  1BMM H;  1UO6 A;  3ZVB A;  1QL7 A;  1XUI A;  3RMM H;  2SNW A;  1VGC B;  3MH6 A;  4KKD A;  1FPH H;  1RGQ A;  2A4Q A;  3E6P H;  1BMN H;  2QAA A;  4AG1 A;  2WPJ S;  3BEF B;  3T62 A;  1KIG H;  3LON A;  4Y76 A;  3GOV B;  1V2Q T;  4Q4L A;  1HRT H;  2J98 B;  1LO6 A;  1EP6 A;  1GHW H;  3A7Y A;  4CRD A;  3P6Z B;  4XBB A;  1Z8R A;  4FVB A;  2DE9 A;  2TPI Z;  1AI8 H;  4H42 U;  1DVA H;  1O3J A;  1T4V H;  1QBV H;  2A45 B;  3DCL A;  4F49 A;  2BTC E;  2GKV E;  3SHA H;  3GDS A;  1JBU H;  1S6F A;  2GV7 A;  2V3H H;  1XM1 A;  3MO3 A;  4B73 A;  1D4P B;  1HCG A;  5FHT A;  2SGQ E;  3P8O A;  1BB0 B;  3SJI A;  2VIP A;  1SGR E;  3BIU H;  4B2C A;  1KTS B;  3PM3 A;  1BCU H;  5HGG A;  2FYQ A;  1PPZ A;  4LXB H;  4UFD H;  2H5D A;  1P06 A;  2Y5G A;  2AGI X;  2RDL A;  2R2W U;  1L4Z A;  2VWM A;  3MU8 A;  1BJU A;  2WPK S;  4Y7B A;  1ZTJ A;  1ELE E;  1QL8 A;  1C5N H;  2BQ6 B;  3SZE A;  2TGP Z;  2STB E;  2V6N A;  4U32 A;  2KX4 A;  3URC A;  2FX6 A;  1HAI H;  2BZA A;  4ZXY H;  2JH5 D;  1N6X A;  3UOU A;  3BG4 C;  3DHK H;  1B7X B;  2QF3 A;  3MU4 A;  1GMD F;  2RDE A;  3QLP H;  2HNT F;  3VEQ B;  2OBO A;  4HFP B;  1ID5 H;  3CNR A;  3QDZ B;  4RKJ B;  2PFE A;  1UTK A;  4AFZ A;  3T29 A;  1V2J T;  2G8T A;  1AVX A;  5A09 A;  1TQ7 B;  2GGV B;  1BTY A;  4Y79 A;  1O5F H;  2GP9 B;  3HPT B;  1C1U H;  1J14 A;  4XSK U;  5AVD A;  2ASU B;  1E1R D;  4Y8Z A;  1BIT A;  2VH0 A;  1KXF A;  1GBM A;  5DPA A;  4Y8X A;  2A2X H;  5C67 A;  4X1R U;  2NU2 E;  3BG8 A;  1SHH B;  1W11 U;  3FAN A;  4B76 A;  1DXW A;  1TGT A;  5BRR E;  1YLC A;  2PSX A;  2D26 C;  2PW8 H;  2SGA A;  1ACB E;  2Q6F A;  1QB6 A;  1IQG A;  3P95 A;  2FOM B;  4YTA A;  3ZVC A;  2O8L A;  1KY9 A;  1YPG H;  2SGE E;  2D8W A;  3ZZA A;  1XUJ A;  1SGF A;  1OP0 A;  5HM2 A;  1JWT A;  5GCH F;  1YGC H;  1EUF A;  3K65 B;  4H4F A;  1AWF H;  3ATI A;  3E91 A;  4BAK B;  3A84 A;  1KDQ B;  5E2P A;  4MVN A;  3U8T H;  2V0B A;  1YPE H;  1EAX A;  2Z6B D;  1INC A;  4HTC H;  2BVX H;  1F5R A;  3SUG A;  2HOB A;  4FU7 A;  3ZZ7 A;  7EST E;  5A2M H;  3M5L A;  1ELT A;  4UFG H;  3RXA A;  4FUG A;  1ABJ H;  1A0H B;  2Z94 A;  2PHB A;  1FY8 E;  3UR9 A;  1EXF A;  3RMO H;  4YT7 H;  1OWI A;  2WV5 A;  3EE7 A;  4NZQ A;  3U98 H;  3GCH C;  5FAH A;  1O38 A;  3OAA D;  2SGP E;  4NSV A;  1EZX C;  3PLB A;  1KLI H;  2BDH A;  3ZZ5 A;  3EDX B;  1KXD A;  4AN7 A;  2PGB B;  4ZUH A;  3MWI U;  1FUJ A;  1T4U H;  2GT8 A;  3T28 A;  2VVV A;  2J2U A;  3NKK A;  2ZPQ A;  3A7W A;  3PWB A;  1BDA A;  2TGT A;  2J98 A;  1KLJ H;  1F0S A;  1O2S A;  5JBC S;  3LGT A;  3UY9 A;  3U9A H;  6GCH G;  2VIN A;  1E38 B;  2BY5 X;  3A8A A;  5F03 A;  4A7I B;  5DSF A;  5GND A;  1FAK H;  2YNB A;  5SGA E;  1P2Q A;  4ABA A;  1IQN A;  3M3V A;  1SQO A;  1YP9 A;  3W1E A;  1TNL A;  3KQ5 A;  1GMC F;  1FAX A;  2ZP0 H;  3BTF E;  3AVZ A;  3STI A;  3UIR A;  1J8A A;  1O5C B;  5I46 H;  1AZZ A;  2CHA B;  3SN8 A;  1TMT H;  2G52 A;  4YO9 A;  1EZQ A;  1GBF A;  4Y10 E;  2G55 A;  5JB9 S;  1HUT H;  2ODP A;  5T1V A;  1ZTK A;  5EGM A;  3ZVF A;  4DG4 A;  2JDI D;  1O3N A;  1NZQ H;  2ZHF H;  3MNS A;  4B1T A;  1O30 A;  3TGJ E;  2EY4 C;  2C93 B;  2WZQ A;  1MAX A;  2ODY B;  3ZZ4 A;  2AS9 A;  1O5D H;  4ABD A;  2F4L A;  4ABG A;  1CGJ E;  1O2J A;  1YPM H;  1AUJ A;  2ZDL A;  3LKW A;  3EYD A;  2QN5 T;  5FBI A;  1H1B A;  2RFK C;  4BXS A;  3U1J B;  1C4V 2;  6LPR A;  1FQ3 A;  2FDA A;  1GCD A;  2XWB I;  3STJ A;  1QQ4 A;  4Q7Y A;  5C3N A;  1C5Q A;  3TK5 A;  1IQK A;  2FOH A;  1PQ5 A;  1BA8 B;  1E35 B;  3T2N A;  5B6L A;  3OYP A;  5C5N A;  4TY6 A;  3QX5 H;  1EPT B;  1V2V T;  1C1Q A;  2HLC A;  2ZKS A;  4M7G A;  2J5U A;  3SO3 A;  2BB4 A;  1BT7 A;  5T6G A;  3F9G A;  1TA6 A;  2ZGX H;  1A0J A;  1A2C H;  1LVM A;  1TNG A;  2OC7 A;  1UTN A;  1N1L A;  5FCK A;  2AEI H;  3S7K B;  3CS0 A;  1A5I A;  3E0N B;  1GJD B;  3PMJ A;  1G32 B;  2FPZ A;  5CDF E;  1YKT A;  1W7X H;  4MLF B;  4YOJ A;  1RJX B;  3ITI A;  3RM0 H;  3GDU A;  3A86 A;  1AND A;  3A88 A;  3LC3 A;  3ZVG A;  3A81 A;  1QR3 E;  1E34 B;  1LHE H;  5JDU B;  4NSY A;  3GYM A;  1YPK H;  1THS H;  1YPL H;  1XVO A;  2BM2 A;  4Y71 A;  3TJN A;  3F9H A;  1P3E A;  1G9I E;  1SGD E;  4Y0Z E;  3RXP A;  1BTP A;  1WQS A;  4ASU D;  3WWF A;  3SW2 B;  3F2G A;  5JPM H;  1DT2 A;  1MKW K;  3KHV A;  4D9Q A;  1A5G H;  2CHA C;  2PUQ H;  4MNY A;  1WDI A;  1VIT G;  1PFX C;  5JBB S;  1GJ5 H;  1KDQ A;  4UFE H;  1O2R A;  3V13 A;  1WYK A;  1NFU A;  1TOC B;  3M61 U;  4I86 A;  1MAY A;  3LPR A;  2UWP A;  3EAJ A;  4A1V A;  1SSX A;  1VIT H;  9LPR A;  4GCH F;  4U2W A;  1GI2 A;  2ILN A;  1DIC A;  1SGN E;  2PKA B;  2VWN A;  5K0H A;  2ZQ2 A;  4BOH A;  2ANW A;  1CGH A;  3F2H A;  3N99 A;  5L30 H;  5C5O A;  4X6O A;  1NN6 A;  2XNI A;  4DT7 B;  5HXF A;  1IHS H;  2KCA A;  1C9T A;  1C5Y B;  3KN2 A;  4ABJ A;  1EOJ A;  1GHA F;  1CT0 E;  3A85 A;  1P11 E;  1UK3 A;  3AAS A;  2Z9I A;  1CE5 A;  4Y11 E;  3T25 A;  4GPG A;  2F9P A;  3V7T A;  2P3F H;  2W7S A;  4DVA U;  4LZ1 H;  4BXW A;  1HIA A;  1C4U 2;  1ANE A;  3GY3 A;  4NIX A;  3ZYD A;  4UON A;  1P2O A;  1EPT C;  4OS5 A;  5CE1 A;  2B0F A;  3O8B A;  2Y7Z A;  1S6L A;  1SR5 C;  2H2Z A;  3OFN D;  1JIM A;  1KSN A;  1UVO A;  1F92 A;  1MZD A;  1ZSL A;  2BY6 X;  1S6H A;  1SLU B;  1WTG H;  1Y3X A;  2B8O H;  3HAT H;  5HYO A;  1AFQ C;  4NFE A;  1SGF G;  1W8B H;  1SFI A;  1ZPC A;  2BXT H;  1LHG H;  2QY0 B;  3C27 B;  2ZCK P;  4UE7 H;  1NFX A;  1CHO G;  4AX9 H;  5LH8 A;  4K60 A;  2WYJ A;  1UW7 A;  1MTV A;  3UNQ A;  1P12 E;  2ZU4 A;  3SGB E;  3SU4 A;  4INK A;  3OE7 D;  5HIZ A;  1UMA H;  2O8M A;  2YOL A;  5EW1 H;  3ATK A;  2A1D B;  2G81 E;  1D3P B;  1C2D A;  1J9C H;  1OKX A;  5HKK D;  1Z1I A;  1GWA A;  1PPG E;  4GHQ A;  4O9V A;  4X0W U;  3SQE E;  1QCP A;  1UVT H;  1W2K H;  1LQE A;  2F83 A;  1N6Y A;  2GVF A;  4WJG 2;  2KZ4 A;  1P10 A;  4ZKR U;  1GI1 A;  2EEK A;  3QK1 A;  1KXB A;  3OSY A;  3MMG A;  1YLN A;  4TWW A;  1YWU A;  1L1J A;  3ZVE A;  2QF5 A;  1P09 A;  4NA7 A;  3AAU A;  1C1M A;  1YCP H;  2CF8 H;  3RXH A;  1QJ1 B;  3MHW U;  3DFJ A;  4K69 A;  5HM9 A;  2XYA A;  5LGO A;  5IK2 D;  1C1W H;  3L33 A;  2THF B;  1EPT A;  4FET A;  1SGT A;  1W12 U;  4CH2 B;  3SUD A;  4DY7 B;  5C94 A;  2BDI A;  2OTV A;  1AD8 H;  2J95 A;  2ZO3 H;  3AW1 A;  4FVD A;  1L1G A;  1GJA B;  1VZQ H;  2FX4 A;  1JIR A;  5EPY A;  3MU0 A;  1SOT A;  2J9N A;  1BHX B;  1C5X B;  5H4I B;  1SQT A;  1OWD A;  4ZMA H;  8EST E;  4LZ4 B;  5C1X A;  4RN6 A;  4YM9 A;  4J1Y A;  2HRV A;  3BTK E; 
#chains in the Genus database with same CATH homology
 5EQR A;  2F4L A;  2WPD D;  3O8R A;  3M5N A;  3SV9 A;  3LKW A;  3E90 B;  3M5O A;  4TT3 D;  4JMY A;  5ESB A;  3EYD A;  3LOX A;  1JXP A;  3U1J B;  1E79 D;  3SU2 A;  2OK5 A;  2WV9 A;  3F3B A;  4WH6 A;  1MAB B;  4A92 A;  1WXR A;  3DCL A;  3H09 A;  2W6J D;  3O8B A;  1S6L A;  3F0O A;  1CU1 A;  2IJO B;  3N7E A;  1W3C A;  4I32 A;  4A1X A;  4M9F A;  5FL7 D;  2CK3 D;  3OFN D;  2A4G A;  2QV1 A;  3OEH D;  4NWK A;  4WF8 A;  4B73 A;  2LEL A;  2L6O A;  2W6I D;  3P8O A;  4B75 A;  2YMS B;  4I33 A;  3WW7 A;  3SUG A;  3SU3 A;  3SV7 A;  5B6L A;  3OYP A;  2QF4 A;  2F9V A;  2KCO A;  3RC4 A;  4OM9 A;  1DY8 A;  2KFW A;  3M5L A;  5IDK A;  2OC0 A;  2YMS D;  3O8D A;  2P59 A;  2J5U A;  3KNX A;  1BT7 A;  4YXW D;  1OHH D;  1RTL A;  3RC6 A;  3SYJ A;  3DSO A;  2FM2 A;  3OEE D;  4I31 A;  4B74 A;  4B6E A;  2OC7 A;  4Q4L A;  1N1L A;  2YMS C;  5GJ4 B;  4NWL A;  3SU1 A;  4TSF D;  4B6F A;  5EPN A;  1NBM E;  2HLD D;  4KTC A;  3SU4 A;  2JJ1 D;  3F0P A;  3OTP A;  2VBC A;  4B71 A;  3OE7 D;  5CDF E;  5C0U A;  1NS3 A;  2K8I A;  5FPY A;  4DT4 A;  2OC1 A;  1EFR D;  3OAA D;  2O8M A;  2YOL A;  2OBQ A;  5HKK D;  3P8N A;  2KR7 A;  3SV6 A;  3SZE A;  5C0T A;  4Q63 A;  3SU6 A;  2WSS D;  2XND D;  1E1Q D;  4R8T B;  2XCF A;  1H8H D;  2GVF A;  2F9U A;  2KCP A;  2OBO A;  3U1I B;  4F55 A;  2KZ4 A;  3SU5 A;  3L6P A;  3WWB A;  3PRD A;  2JIZ D;  4ASU D;  1BMF D;  2A4R A;  5C17 A;  3DSP A;  5ETX A;  3WWF A;  3AK5 A;  3F2G A;  5DSF A;  5GND A;  2WHX A;  1W0J D;  2AHM E;  3PV2 A;  4RI0 A;  5DN6 D;  2KCY A;  3F2F A;  2XOK D;  2GGV B;  1H8E D;  3FN8 A;  2QF5 A;  2QE7 D;  3FO8 D;  4ZCN A;  3N7D A;  3FKS D;  5CHB A;  3KF2 A;  3W1E A;  4XD7 D;  1FX0 B;  3FOA A;  5FPT A;  2V7Q D;  2IJD 1;  4TYD A;  4U01 A;  4A1V A;  1DY9 A;  1E1R D;  1W0K D;  5GPI B;  5IK2 D;  2JJ2 D;  1COW D;  2OC8 A;  5EQS A;  4A1T A;  4FET A;  3O8C A;  3SUD A;  3UB0 A;  3RC5 A;  2FP7 B;  1KMH B;  1NBM D;  3ZIA D;  4B76 A;  1DXW A;  3GS9 A;  4Z1M D;  1DXP A;  3PRB A;  5EPY A;  3PV5 A;  5T1V A;  3F2H A;  3N99 A;  3SUE A;  1RGQ A;  4K8B A;  2JDI D;  2K0Q A;  2A4Q A;  2OIN A;  5EQQ A;  5H4I B;  2XNI A;  3VG8 A;  5F53 A;  2F43 B;  2M2A A;  2KCA A;  3NRL A;  5FPS A;  2XCN A;  2WZQ A;  3KEE A;  3KN2 A;  2FOM B;  3SUF A;  3SV8 A;  1SKY E;  3SU0 A;  3LON A;  1A1R A;  2KM0 A;  3M5M A;  4WH8 A;  2K1Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...