5F53A

Nano-ring of cadmium ions coordinated by nvpizza2-s16s58
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
84
structure length
84
Chain Sequence
MFTGLNTPSGVAVDSAGTVYVTDHGNNRVVKLAAGSNTQTVLPFTGLNTPSGVAVDSAGTVYVTDHGNNRVVKLAAGSNTQTVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NVPIZZA2-S16S58
publication title A cadmium chloride ring created by a designed symmetrical protein
rcsb
molecule tags De novo protein
total genus 13
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2015-12-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.500 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 5f53A00
3WWBA 5F53A 3WWFA 4ZCNA 5CHBA 3WW7A
chains in the Genus database with same CATH superfamily
1W0KD 4Q7YA 2OQUA 3BTEE 2ZIQH 2A2XH 4AX9H 5C5OA 4UFEH 2QIQA 1P03A 1UW7A 2KZ4A 5FXLA 3LGVA 5DP5A 4Q4LA 2OC1A 2CHAB 2GD4B 3KYFA 2EI7A 1D4PB 1DXPA 2GZ8A 1GBFA 4WMEA 3TJUA 4FU8A 1QRZA 3KNXA 2XBXA 1O30A 4CRBA 2JH0D 2VH6A 1T4UH 2NU0E 3IITA 4I31A 1EKBB 4Y76A 3RU4D 1OKXA 2W6ID 4OS6A 4RI0A 1TPSA 1YLNA 1C5LH 3FOAA 1P2KA 3F2HA 5HM9A 3PROA 3QUMP 1GG6C 2FM2A 1KTTB 1RIWC 2BY9X 1TX8A 1NT1A 2G51A 4Z6AH 4E05H 3SJIA 1QR3E 1P2OA 1VCQA 2KCOA 1O5FH 1Y3VA 4BXSA 1LPKB 4CR9A 5EXNA 3Q00A 4Y79A 1TGCA 1Z8JB 3F9FA 3W1EA 1G9IE 4BAMB 3SU2A 1ETRH 1TOCB 1SPJA 2C8ZB 3NZIA 3OSYA 1HBTH 3WWBA 1VR1H 2PHBA 1NRRH 2F9OA 4Y71A 4DY7B 2HWLB 2VVVA 5EQRA 2Y6TA 1ZSKA 3A83A 1LVOA 5TJXA 4HFPB 3F9GA 1BTZA 1CE5A 1QBNA 2EA3A 1F0SA 3LPRA 2VIDA 4AFUA 4CHAC 4WY3A 2AMDA 5FPYA 4CH8B 1O3KA 1A5IA 3N7EA 2W7SA 1S83A 1TPAE 3QGNB 1Y3YA 2A2QH 3AAVA 1LPZB 3LKWA 1O3NA 3OTPA 3VB7A 1AWHB 1TAWA 1SQTA 3KHVA 2YOLA 5A0BA 1BB0B 2BY5X 3VEQB 1H8HD 1FV9A 2V35A 3AK5A 1GCTB 3LGTA 1JIMA 1BBRH 1C4U2 1GDNA 1RTFB 4X1RU 2RCEA 3EQ0H 4TWYA 4MG3A 3NK8A 1EAWA 1WUNH 3TJNA 1EB2A 1LVMA 3L6PA 1YPEH 1KXFA 1H8ED 1RFNA 2TRMA 1GL1A 3U69H 4CREA 4U2WA 1XVMA 1SKYE 2YNAA 3MHWU 2IJD1 1LHFH 1SBWA 4BOHA 1WCZA 3TGJE 3RLYH 3ZVCA 1DWCH 5L2YH 1OYTH 4LZ4B 1EPTC 1ZHPA 2STBE 2UUJB 2BQ6B 4BXWA 1MCTA 1HAHH 1V2QT 1GJ6A 3LOXA 5JB9S 1SLUB 3KN2A 1QFKH 1GBIA 1UTNA 3QLPH 1CHOF 1W8BH 4AFSA 1H4WA 2RFKC 1P06A 3LU9B 2R3UA 1GVLA 3NRLA 2OC0A 3H7TA 4YOGA 3P8OA 2XC0A 3UTUH 2M5TA 1XXDA 2ZFPH 1P01A 3C1KA 4MTBA 2VGCB 1O2XA 1O36A 1PPHE 3SNAA 1SL3A 3ZZCA 5GWZA 2ZFFH 3KQEA 5EG4A 3E90B 3O8RA 2Y5HA 2M2AA 3IG6B 1W12U 3T27A 4Y0ZE 4B75A 1TFXA 2FTLE 4JYTA 4A1VA 2W5EA 1EAIA 2G8TA 1X7AC 2AGIX 1QGFA 1T31A 1ZJDA 3BG4C 1CBWB 1BMAA 4BTUB 2A4RA 2XTTB 3RXGA 3RU4E 1C5PA 1LHCH 1FMGA 3VB3A 3U8OH 1E38B 2WV9A 3T29A 4RSPA 1GHZA 1O2UA 3ODDA 1Z8GA 3F0OA 2SGPE 1TNGA 3DFJA 3PO1B 2ZPQA 1O2HA 1C5VA 2Z9GA 1C5NH 3RDZA 3M37A 1GI5A 5IK2D 2J94A 2QA9E 5F03A 3B23B 3EYDA 1ZGIA 1DANH 1PJPA 4OS7A 4P02A 4X6PA 3A86A 1FJSA 1O5EH 2F43B 3MH7A 3MH5A 1KXEA 1IQIA 4O3TA 4TSFD 1T4VH 1P3CA 3LDXH 1TLDA 3FP8E 2OUAA 1F0RA 3D62A 3KGPA 3LH1A 2B5TB 3A7YA 2K1QA 4M9FA 4VGCC 4TY6A 8ESTE 2BY7X 5AVDA 3WWFA 4NA8A 4CBNA 2J97A 3DSPA 1PQAA 1GVZA 2G4UA 1C2MA 3QO6A 2PTNA 1MTSA 3ZVBA 3M35A 1WTHD 2KCPA 4R0IA 2ZKSA 1FXYA 1ABIH 1K1NA 2WUBA 1BDAA 2PSXA 2ZTYA 4AORA 2AMPA 4FXGH 2G55A 5ABWA 4JZEH 1LVYA 1GVKB 3MU4A 1PQ8A 2Y80A 1B5GH 2BHGA 2J98A 5JBTA 2B9LA 2ZQ1A 1C5QA 5E0HA 2D1JA 3RXLA 2A7JA 5EODA 1H1BA 3TJOA 4CR5A 1HJAB 3VB5A 4CH2B 3FP7E 4X1PU 1HFDA 1TABE 1EAUA 4NGAH 2Q6DA 3EDXB 1K1IA 2IN2A 3ATMA 1VITG 4M7GA 2J38A 1V2OT 2P8OB 3RC4A 3GY6A 2BM2A 4ASHA 1HAVB 1RTKA 2ZDLA 1C2FA 4TWWA 3BN9A 3U1JB 1RS0A 3SNDA 1S6HA 3MO6A 2Z6BD 4I33A 1NTPA 2VWOA 1QHRB 1ZLRA 3TNTA 1THRH 2NWNA 1SC8U 1G37A 2J98B 3KQ5A 1LQDB 1FDPA 3RXUA 4NWKA 5F6MA 1DFPA 5CDFE 3MYWA 1Z7KA 1G2MA 4MNYA 1Z71A 4ABEA 1DDJA 2D26C 3OYPA 4F55A 1LKBA 2A4QA 2F3CE 2RG3A 5FPSA 3P6ZB 4DURA 5E2OA 1O5AB 1GMDG 3MI4A 3O8BA 1KYNA 1IQKA 4ZKOU 3M3TA 1UTKA 2Z3DA 1YC0A 1K1LA 3ENSB 2A32A 4Q7ZA 3ZZ8A 1GJBB 3HATH 5F8XA 3A84A 3RXVA 4E7RG 3RMMH 5C1XA 5JBCS 4TY7A 1PPGE 1E36B 3I29A 5C0UA 2FZZA 1UK3A 4B2BA 2BXTH 3M3SA 3RXDA 1B0FA 4D76A 2FOHA 2GT7A 1XM1A 1GBCA 2V6NA 1D3PB 3E0PB 2BZAA 5GCHG 5J4SA 2HNTC 2Z7FE 1O2TA 1Y3UA 2JKHA 1F0TA 3ZZBA 3MU1A 4WVPE 1ZR0A 2V3HH 4BAQB 3LGYA 3SBKA 2GCTC 1FNIA 1YPHC 3O8CA 4AB9A 4Y7BA 3T5FH 1WU1A 2OBOA 1BRBE 2ZCHP 1O5BB 4NIYA 4LXBH 3V3MA 3MU5A 1S81A 1BMLA 3P8FA 1WAYB 2ZQ2A 1BOQA 3SUFA 1C2KA 1ELAA 1Y5AT 3PB1E 4JYUH 4BANB 3DUXH 2HLCA 2R2MB 1EFRD 1LHDH 4K8BA 3SZEA 3KQCA 1C5ZB 2BDAA 4D7GA 1O2JA 1P3EA 1TX6A 4U32A 4DGJA 1B7XB 1GHXH 3A7XA 4TPIZ 1NY22 1MKXH 1BA8B 1SGDE 1OS8A 3SUDA 1KLIH 2FIRH 1ELEE 1UHBA 2QF5A 3RU4T 1ACBE 1GHVH 1S85A 1AE8H 4CRFA 1QA7A 1E1RD 1J15A 4JMYA 4K1TA 1A2CH 2BYAX 2OTVA 4D7FA 2A4GA 1J14A 2A4OA 3SYJA 2VIWA 2ZU3A 4B1TA 1QJ7B 2H5CA 1AFQB 8GCHG 3FP6E 1THPB 1OX1A 2ZFRH 3PMJA 2PR3A 4FUIA 2BVSH 1UTOA 1P9SA 5EXMA 3UQVA 1A5GH 1TMBH 2GP9B 1C4V2 4UFFH 5LGOA 1TGSZ 2LP6A 4NA9H 1LO6A 2XCFA 2FOAA 4J2YB 1ELGA 1COWD 1OSSA 2TGDA 2PUXB 2P94A 3BTME 2O8MA 3SU3A 2OBQA 3VGCC 3VB4A 2KX4A 1TNLA 1DM4B 2VVCA 1GPZA 1GDUA 1FUJA 1GJ4H 3QZRA 1GMCF 3GY7A 2G4TA 3V7TA 1FY5A 3W94A 1YCPK 5AFYH 1WQSA 1FQ3A 7GCHF 2XXLA 4YLUA 2SGEE 1KXBA 3BIVH 2C3SA 1A0HB 1EZXC 1P05A 1Y5BT 2IPHA 2WPMS 5EOKA 3OAAD 1QB6A 1B0EA 2CXVA 2H2ZA 4D9QA 2BD9A 3SV6A 1GL0E 1ESAA 2SNVA 1FY4A 5DSFA 1T8OA 4KTUA 2JH5D 3RXOA 1XUKA 3S7KB 3SGBE 2GX4A 1OHHD 2WYGA 1GI0A 3SUEA 1IQNA 2AHME 6CHAC 2O8TA 1MD8A 3EAJA 5EJ1A 1SGTA 2GGVB 2BTCE 1JIRA 4IN1A 2Z3CA 4Q63A 5GPIB 3NUMA 2QXGA 1IAUA 1P2IA 1Z1JA 3QGJA 3KL6A 5TCCA 1MTWA 1O2MA 4Z1MD 2ZHQH 1FY8E 3F0PA 1SSXA 3ZV8A 4MPXA 1DX5M 4JZIA 1UCYK 4YESB 2SGFE 4NWLA 1AO5A 1ZPZA 1ANEA 1KLJH 5HMAA 4THNH 2ZDMA 1S0QA 4X8UH 1PPBH 1PPZA 2BLQA 4Y11E 1VITF 2WPJS 3SNBA 3E16B 1AUTC 1BQYA 4ACBA 1IQMA 1E1QD 1O2SA 2XCNA 1MBMA 1TBRH 1FI8A 1TE0A 4B2CA 3R0FA 2HPPH 4O9VA 3MNCA 3NCLA 1DSTA 2FOFA 3SJKA 2BOKA 2A5IA 3SV2H 3RXKA 1NFYA 5ESTE 1ESBA 3F6UH 2O9QA 4OGXA 4FUEA 4ISNA 4UFGH 3LJOA 1BUIA 3EA9A 1L2EA 3NXPA 3GOVB 2QGRA 3V0XA 3FO8D 3LGIA 1HYLA 4ZAEA 1HV7A 1MAYA 3UOUA 3UREA 3A87A 4B73A 1A61H 3GCOA 1C1TA 1O2GH 2FS9A 3U28C 1AVXA 2G81E 3S9AA 1H8IH 2BVRH 2FX4A 3HPTB 1MTNB 1DT2A 3UWIA 2OCVB 4X2YA 1QBVH 3GDUA 1G30B 3A8BA 1GBMA 1KXDA 4K69A 1HLTH 2ODQA 5GDSH 2QAAA 3R3GB 4GUXA 5DK1A 1H8DH 1O3GA 2QXJA 1MTVA 4MDSA 3Q76A 2FLBH 5GCHF 5C5NA 1Z1IA 3F3BA 1SGFA 1S6FA 4Y8ZA 4GHTA 3PMHB 2VH0A 5EGMA 1ZRKA 4ZKSU 2BDCA 4INLA 3LC5A 3IWMA 2Q1JA 1ELCA 1H9LB 5TCAA 4SGBE 1SI5H 1O3MA 3UQOA 3KEEA 1P11E 4AG1A 2W3KA 3RP2A 2GMTC 2BMGB 1NRNH 2WHXA 4O3UA 3P70B 3S0NA 1JXPA 1DLKB 1P10A 2BD4A 1AE5A 2UWPA 2BZ6H 1E79D 3OEHD 1FY3A 1BJUA 2FDAA 4UE7H 3QX5H 2KM0A 3LONA 3HGNA 2FP7B 3RMLH 1ANBA 2V0BA 2KFWA 1DY8A 2ZU1A 4LZ1H 1CQQA 3UR6A 1GI1A 3NWUA 5BPEA 1HCGA 1UTJA 1V2JT 1WSSH 3M7UA 5GIBA 1C1QA 3EE0B 1PYTC 3GDSA 4FUDA 1YYY1 3T25A 2AMQA 2GKVE 2F9BH 2ZGJA 1QB9A 2BLOA 2GV7A 1O31A 3LIWA 4A7IB 2F91A 2F9UA 1K1MA 3OFND 4MNVA 2EI8A 5LPFA 5G4BA 1UVTH 1NRSH 1GBLA 1Y59T 3TK6A 4GLYA 1BMFD 4FVBA 4MNXA 8GCHF 2UUFB 1GI9B 4X8VH 1QJ6B 4YLQH 4H42U 4LOYH 1F0UA 1YPGH 2B0FA 3GS9A 1HIAB 5C3NA 1CA8B 1OP0A 1VITH 1M9UA 4B74A 1AGJA 3GY2A 5EJZA 1F5LA 1K1PA 5DP7A 1ZHRA 4AFZA 4I8KA 1SLXB 1QBOA 4OS2A 3U8RH 3RXTA 1QL7A 3ZZ6A 2XBWA 1F5KU 3F9HA 4ABGA 3UY9A 4A1XA 3ZVAA 1AWFH 1MBQA 2K8IA 3SU4A 2SNWA 1HXEH 3Q77A 1WDIA 5PTPA 2ZP0H 3RXJA 2BDYA 2A45B 1ZRBA 3GY4A 2Q6GA 3GY5A 2P3TB 1MUEB 1G3BA 1C5RA 1LDTT 4ZH8A 1O3OA 4NFEA 1EB1H 3MO9A 1J17T 2BY6X 5FHTA 1BIOA 1D3DB 1CO7E 1P2QA 4DCDA 1BTWA 1V2RT 1C5UA 1G3DA 1GG6B 4PROA 4YXWD 3SOSA 2ZCKP 4ZROA 3M5NA 1CGJE 1VJ9U 3MU0A 5F53A 1CBWC 2ANKH 5HIYA 3ZZDA 1V2VT 1G36A 1P04A 3BV9B 2HNTE 4XD7D 2V3MA 2CN0H 1AB9C 3BTHE 1BBRE 1DUEA 1Z8IB 1W7GH 1ZJKA 3UNRA 2XC5A 4JZDH 4ASUD 1YPHE 1LHGH 1IQJA 2JETC 2WPKS 2FYQA 3MOCA 4UDWH 3GISB 1GBTA 1DSUA 1JMOH 1AKSB 1ZTJA 1VCWA 1L4ZA 5FX6A 2AGGX 3ZZAA 1KLTA 1V3XA 1XUFA 1TMUH 1UTMA 2PKSB 1ZGVA 3M5MA 2I6QA 1O2WA 1YKTA 5L2ZH 4U30A 3T26A 1CVWH 1WTGH 4CHAB 1YLCA 3ELAH 5AFZH 5DP8A 4ABDA 2O8WA 3SORA 1UTLM 2JJ2D 4GVUA 4XBCA 1SLWB 2ILNA 1MKWH 1YF4A 3LT3A 4KGAA 3ZIAD 1O39A 1ANCA 3SQEE 4ABIA 1HAOH 1INCA 1O2RA 4AOQA 2VB0A 2FESH 1O2QA 1TA6A 4YOJA 4YOIA 1UVSH 2AH4X 4K1EA 3A88A 5C0TA 3B8JA 3FVFB 1C1MA 1QQ4A 4CRDA 3L3TA 5DPAA 3BTTE 1CT4E 1HAGE 2HVXA 2WPDD 1GMCG 1HAZB 3BSQA 1S84A 1NFXA 4NSYA 1HJAC 2FPZA 1EPTB 4JK5A 7GCHG 4I8GA 4ABAA 1HJ8A 4ZMAH 3PV5A 1DXWA 5B6OA 1IQFA 5DP9A 4AYYB 2J4IA 2R2WU 1G3CA 5T1VA 2P8OC 5KEDA 1NROH 1N1LA 2GZ7A 1GCDA 3PMBB 1ID5H 3CS0A 1BTPA 4NSVA 2DE8A 2AEIH 3ZVEA 1TNIA 4YZUA 1O3PB 5GXPA 2P59A 2TBSA 1HRTH 4UEHH 3M5LA 1EJMA 1O2YA 1NU7B 2UWLA 1HB0B 5DN6D 1HAVA 3UFAA 4Q80A 1BMMH 1C2EA 2D8WA 1IQGA 3FKSD 1V2UT 3C27B 3SNCA 3AW0A 1F7ZA 3ATLA 1PYTD 3I78A 3BEIB 4JZFH 2R0KA 4XOJA 3RXFA 5GJ4B 1P57B 2ZZUH 1WOFA 3AAUA 1QIXB 4AB8A 3TLOA 2W7UA 2P93A 3BG8A 5C17A 3N99A 1KXAA 2C90B 1C2HA 2EI6A 1ZTLA 2VIVA 3HK3B 2ANWA 5T6DA 1ZTKA 3E0NB 5EQSA 1SOZA 1MKWK 3JZ1B 1GJ8B 1A7SA 3LGWA 3OY5U 4BAOB 6LPRA 1HPGA 2F9PA 3GY8A 2G52A 1SGCA 3OY6U 5I25A 3OEED 3P8GA 3A8AA 1N8OC 1GDQA 1EJNA 1VKYA 4X8TH 2THFB 2BD7A 2YMSB 2G5NA 1O3DA 5JYIA 3SV7A 1NO9H 1XUHA 3H7OA 3Q3YA 1KTSB 1H9HE 4ZHAA 5HYOA 1FX0B 1XUJA 1GJDB 1JRSA 1O3AA 1OWEA 2AYWA 2G00A 2OQ5A 4RKJB 1BRCE 3QZQA 3CS7A 1K21H 1CU1A 1SFQB 4HGCA 1DE7H 2QF3A 3U1IB 1XKAC 1GGDC 1OP2A 3BEFB 3SV8A 4KP0A 1QRWA 1AZZA 1ZZZA 3TGKE 2H9TH 1NC6A 2ZFQH 2O8LA 3D49H 1O32A 1RJXB 2FODA 1L0ZA 2VJ1A 1O2OA 1QB1A 1T32A 2WINI 3Q3KA 5K7RA 1O5DH 1HAYB 4WMFA 3PWBA 5T3HA 1P2MA 3AASA 1D6WA 1FLEE 2F9VA 1MU6B 2AFQB 1UTQA 1YBWA 2FOCA 3GCTF 1TX7A 5DP3A 5H4IB 5A8XA 2P95A 3DFLA 2JIZD 2A7HA 1TBQH 3PM3A 3E1XB 1YGCH 1CA0C 4OM9A 4IS5A 1HNEE 2CJIA 2J34A 1OXGA 1YCPH 1O2VA 3PLKA 1C9PA 1P02A 1JRTA 2ZECA 2FTMA 2FX6A 3RXMA 1A1RA 1HUTH 2FOGA 3N7DA 1F5RA 1GHWH 1WV7H 4KTSA 3URCA 3BF6H 4AZ2B 1ARCA 1GBKA 3P17H 4O97A 4KKDA 4AC9A 2ZPSA 4ISHH 1O3FA 1OWJA 5A8ZA 1TWXB 3GCNA 1D6RA 2Z9LA 3VB6A 1GBAA 2ZCLP 1C2LA 2ZGHA 1C5OH 1P09A 3F9EA 3BEUA 1SLVB 1GI2A 4A1TA 3SJOA 2G5VA 4ABFA 3ZZ5A 1ELDE 1HAIH 1MCVA 1KSNA 1QQUA 2XRCA 3RXCA 2VINA 3S9BA 1V2KT 2KAIB 2PGQB 1A3EH 1EASA 4K3JA 1O37A 3STJA 1VJAU 2OLGA 1WBGB 3RMOH 5LPRA 4B2AA 1NZQH 2BDIA 1DVAH 1C5YB 1V2LT 3SGAE 1BTHH 1Z6JH 1UCYH 4OGYA 2CMYA 1PPFE 5DGJA 3WW7A 1UMAH 3QK1A 3GCHC 1QNJA 1XKBC 4AGKA 4CBOA 1O2ZA 3LJJA 5C67A 3KQDA 4H6SB 1SHYA 2A5AA 3A7ZA 3OTJE 4YTAA 1ELTA 3SJ8A 3E91A 1C5SA 3DA9B 2TGPZ 3SI3H 1HDTH 1QRXA 6GCHF 3TIUA 2GCHF 1HXFH 4KELA 1FAKH 5A0AE 4FU9A 1IQHA 4X6NA 1T8MA 2Z9KA 1T8LA 2H1UA 3M7TA 1AVGH 3PLPA 2Z3EA 3ZYEA 2BD3A 2ZEBA 2BOHB 1J8AA 1L1GA 3UOPA 2FOBA 1E35B 3HGPA 1W0JD 1XUIA 2TGTA 3SHCH 4UFDH 4A92A 5HXFA 1MQ6A 3PLBA 1O2NA 2W6JD 3MNBA 4NZLA 4F4OC 2STAE 2VVUA 1QZ8A 4JZ1A 3B9FH 1C4Y2 1V2ST 4FETA 1GMHG 1H9IE 2PTCE 3SUGA 1MMJN 1SFIA 2QE7D 2SGDE 2A7CA 5HIZA 5T6FA 3ATIA 4JCNA 2KCYA 4IC6A 3SJ9A 4A6LA 5FX5A 4MNWA 1K1OA 3ZZ7A 3RC5A 1W7XH 4SGAE 2XNIA 4X2XA 3FFGA 3Q3XA 1HGTH 1SGEE 1JOUB 1HAXB 1L4DA 4Y0YE 4WF8A 5A0CA 2QXHA 1TNKA 3TK9A 1O3LA 3RXBA 3VXEH 1O3EA 4NCYA 5EIYA 4CRAA 1CSOE 4CRCA 1SGPE 1V2MT 5B6LA 4IGDA 1OPHB 3FZDA 4IC5A 1C1RA 1VGCB 1C5XB 1BTYA 1EX3A 1MTNC 1U6QA 2QF0A 1GJ5H 1TNJA 2VWNA 3E6PH 1LPGB 2ODYB 4FVDA 3VGCB 4D9RA 1YPLH 4AG2A 4IMZA 3TPIZ 6ESTA 1TQ0B 2PFEA 2WSSD 2BDGA 4NG9H 5I46H 1HJ9A 3LGUA 1Y8TA 2Y5FA 2ZU2A 5EPYA 2V7QD 1XVOA 4AFQA 1C2GA 4A5TS 3OE7D 1EP6A 2ZWLH 3S9CA 1C2JA 3BTDE 2F9NA 3UIRA 1W2KH 4K1SA 4NIXA 1L1NA 5CMXH 3BTFE 1V2TT 2CHAC 3N7OA 2OXSA 1GJ9B 1MU8B 5DP4A 2D2DA 2GDEH 1BHXF 1EJAA 3T2NA 2FYRA 2Y7XA 2QC2A 4F49A 4K8YA 3AVZA 3M36A 2WPLS 1AD8H 5FL7D 4AYVB 9ESTA 1WXRA 2EQNA 5FAHA 4P00A 1ESTA 1S5SA 4IBLH 4NZQA 5FBEA 2GVFA 4DIHH 2EEKA 1SOTA 6CHAB 3RXRA 1NU9A 3TH4H 1DWEH 4XE4A 3U8TH 5DG6A 5LPEA 2FOEA 3A8CA 1E37B 4JYVH 1RTLA 2HOBA 1SQRA 2AGEX 2HNTF 1AHTH 2B7DH 2FI4E 1BRUP 2BX3A 4TPYA 2P3FH 1C1SA 1LKAA 1W13U 4GHQA 2R3YA 1F92A 2BVXH 2IJOB 3ZV9A 2GJGA 4BAHB 4DT7B 4ZUHA 1ELFA 4JK6A 1TRYA 1C1PA 1QA0A 5DJ7A 2SFAA 1DPOA 1OP8A 1GI4A 4RT1A 1P9UA 1GBBA 2RA0A 3MTYA 1C5TA 1XMNB 5CHAB 2CF8H 2PSYA 2W26A 2L6OA 2ZFTA 2LELA 4GCHF 1AMHA 1AY6H 1TNHA 5JBBS 1FPCH 1TIOA 5SGAE 1FZZA 1S6LA 1O34A 4ACAA 1D3TB 3TVJB 5JDUB 3KIDU 5JB8S 1HIAA 2Q6FA 1JBUH 1TGTA 4I86A 5E2PA 1J16A 3RC6A 4AN7A 2OC7A 1O5GH 4XFQA 1C1WH 2L74A 2BLWA 1O0DH 3SV9A 1KDQB 4ZHLU 2OP9A 2R9PA 3SU5A 1YP9A 1GCTC 4CRGA 1SG8B 1W3CA 4BTIB 3NPSA 1ZOMA 4E06H 3H09A 4YT7H 1DUAA 1UK2A 3MMGA 2VIOA 1C1OA 2GDDA 3QWCH 5A8YA 1SGRE 3BTWE 4HI3A 1O38A 2F4LA 2XYAA 4J1YA 1ZSJA 2UWOA 1BITA 1SQOA 2GTBA 1RGQA 2Y7ZA 3M7QA 4DW2U 5L6NH 1DLEA 3ESTA 4NIWA 2J92A 4INHA 1DS2E 1LVBA 4AGJA 1FY1A 3ATWA 3UWJH 1EQ9A 2QF4A 3UNSA 3P92A 1WYKA 2VU8E 5FCKA 1C9TA 4NA7A 4INKA 2YNBA 4HTCH 2ZO3H 5KECA 1BT7A 3SHAH 5FBIA 2ASUB 1P2NA 5ESBA 5DO4H 1T7CA 3DSOA 2GT8A 2FXRA 4TYDA 2OC8A 3UNQA 1G2LA 4X6OA 4ZKRU 4ABBA 4X2VA 5IYTA 3VFEA 1EP5A 3GICB 5HM2A 2GMTB 8LPRA 2C8XB 1DOJA 1EAXA 3FN8A 3W95A 3UAIC 2PKSC 4MPUA 2VGCC 4ZXYH 1BTUA 5F8TA 1AZ8A 2PW8H 3GCTG 3HKIB 2BQWB 5FCRA 3KF2A 1JWTA 2OINA 1ZMLA 2H5DA 3G01A 1ETTH 4GPGA 1TQ7B 1NRPH 3PYHA 4ZKNU 1GBHA 2OK5A 4Q2KA 4K60A 1RIWB 1CGIE 5A2MH 3TK5A 1AKSA 2ZTZA 1GHBF 1QTFA 1XXFA 4B6EA 1GMHF 3FZZA 3A8DA 2ZC9H 1GHAF 2DE9A 4K5ZA 1VCPA 2ANYA 3MNSA 5DP6A 1K28D 3PRDA 2ALPA 4BAKB 3A89A 3MWIU 4X8SH 2BQ7B 3PO1C 1YM0A 4O03A 4I32A 1YY3A 2EC9H 1PPEE 1Z8RA 4I8HA 1TPOA 2PGBB 1A0JA 3H5CB 2HGTH 3P8NA 3FAOA 3TITA 3UUZA 1GI3A 2Y81A 2CV3A 1SVPA 3EE7A 1BCUH 2XWAA 1FPHH 2ODPA 3F68H 4HZHA 8KME2 1Q2WA 2BX4A 4Y7AA 1K2I1 1L1JA 3MO3A 1EPTA 1PQ7A 2PV9B 3GYMA 3M61U 3K6ZA 3SU1A 4WH8A 1ARBA 1UVUH 1UK4A 3KQBA 1ETSH 4H6TA 1GJCB 2PKAA 3NKKA 1TYNA 1CGHA 4DT4A 2WPIS 2NU2E 3OU0A 1OOKB 1FIWA 1KMHB 1GI7B 1SQAA 4MPVA 1Y3WA 3UR9A 1BZXE 1W0YH 1GHYH 2VWMA 5E0JA 1PQ5A 3K6YA 2NU1E 1EOLA 6GCHG 1A46H 1NPMA 2GCHG 3QTVH 1WQVH 2PUQH 2ZTXA 4MQAA 1BJVA 1NESE 2H6MA 1MZDA 2A5KA 4X1QU 3EA8A 1RXPA 3CNRA 3M3VA 3M5OA 3MU8A 2XWBI 4DIIH 4OS4A 9LPRA 4B71A 1GBEA 4XBBA 1V6DA 4FUCA 2PKAB 1A0LA 1QURH 3STIA 2ZA5A 2JJ1D 2Y5GA 4ZHMU 1DY9A 1FIZA 1XUGA 2FO9A 2P16A 1BBRK 2K0QA 1AB9B 1EZSC 3QTOH 1V2NT 2C4FH 3RXPA 3GY3A 1TB6H 2JETB 4NFFA 2YMSC 1F2SE 4D8NA 2UUYA 5T6GA 5IDKA 2A1DB 1OWDA 5EQQA 4F48B 2EY4C 1NFUA 3V12A 1QCPA 2KCAA 4GSOA 2LPRA 3O8DA 3HKJB 2Z94A 2LNCA 2Z9JA 5JBAS 3S69A 2B8OH 1YLDA 1DITH 1ELBA 3TNSA 1GJ7B 2Y82A 1VZQH 2ZHWH 1NBMD 3SQHE 4R8TB 1DICA 1SGNE 4I8LA 1GBDA 4Y8YA 2ZI2H 1ZMNA 4Q7XA 1C5MD 3BG4B 1RD3B 2PWXA 2HLDD 3RLWH 3DHKH 3K2UA 4YO9A 3ZZ3A 3ZZ4A 4Z0KA 5J4QA 1ZSLA 1C1VH 5HGGA 2C93B 5KGOA 3KYGA 2WUCA 1ZHMA 1C2DA 2JH6D 4FUFA 1TGNA 1P8VC 5FPTA 2FS8A 3F2FA 2CK3D 3RM0H 1ELVA 3ZVFA 2SGQE 2J5UA 3SU0A 3QDZB 4RKOB 4IW4E 2RA3A 2IOTA 3CP7A 2J2UA 4X6MA 2NU4E 2QCYA 3BTKE 1BTXA 1NN6A 2BD5A 3RXHA 5C2ZA 1AU8A 4VGCB 1LMWB 2AERH 1AI8H 4XSKU 2DUCA 4X2WA 1C1UH 4BTTB 1AFEH 1EATA 2BDHA 3PTNA 1LQEA 3ZZ9A 1BRAA 1SGIB 5K0HA 1THSH 4ISIH 1E34B 1P2JA 2FLRH 2I6SA 2GZ9A 3SZNA 1TRMA 1LHEH 2QYIA 1TMTH 2ZDAH 5EU8A 5E0GA 1DWDH 3PMAB 3TH2H 3CENA 2XBYA 1O2IA 2RDEA 7ESTE 2BY8X 5EW1H 3RXIA 1FN6A 4Y10E 2W3IA 4MLFB 2VNTA 4MVNA 4ABHA 4E7NA 2BDBA 1O3JA 4YT6H 3RXAA 3SNEA 5EW2H 2VIQA 2QXIA 2ZU5A 1AFQC 1UVPA 2XW9A 4ISOA 4H4FA 3ZYDA 4I7YH 2H9EH 3LC3A 2KAIA 1O3CA 1N6YA 1EZQA 1EXFA 1TBZH 2TGAA 4GAWA 2F83A 2HRVA 2ZU4A 1CHGA 3PRBA 4GCHG 1SHHB 2OD3B 3BTGE 3GDVA 3JZ2B 1N8OB 1O3BA 1QJ1B 1RRKA 2AIPA 3RXEA 3A80A 3PV2A 1TALA 1ZYOA 2PP6A 1Z6EA 1LCYA 3VXFH 5BRRE 2BB4A 5E8EH 5C1YA 3K9XB 2TPIZ 2CGAA 2FOMB 1G3EA 1SR5C 2JDID 1NRQH 2WV4A 2XC4A 2ZDKA 1UTPA 1MABB 1A4WH 1PFXC 1Y5UT 1GGDB 3S7HB 2XOKD 3DT0H 2ESTE 3D23A 1EZUC 4BNRA 1YWUA 2H9HA 2J9NA 2Z9IA 4WJG2 2AIQA 2R0LA 2TIOA 1BHXB 2SGAA 2ZGBH 2BD2A 1A5HA 3A7TA 1DWBH 3A82A 1ABJH 1C2IA 3A81A 4DJZB 2FMJA 1FONA 1Q3XA 2BXUH 2RDLA 4IN2A 1Q31A 2VBCA 3I77A 1G32B 2FWWA 3WY8A 2XNDD 1UO6A 3SW2B 1W14U 1NBME 1P0SH 3RMNH 2CF9H 1GWAA 4FUBA 4WXIA 3TU7H 1KY9A 1K9OE 1AIXH 1C5WB 1IHTH 1KIGH 1N6XA 1OWKA 3URDA 1TPPA 4KTCA 3SI4H 3RXQA 4ZCNA 2C8YB 3F1SB 1MH0A 2AS9A 4K2YA 2FEQH 2VWLA 3PV4A 1CA0B 2NU3E 4FUGA 2J95A 2GCTB 1T8NA 1O35A 1YCPM 2ZHEH 3HK6B 4TT3D 3ZVGA 3DCLA 1NS3A 2XBVA 4ISLA 4FUHA 3L33A 5DKMA 1FAXA 2FI3E 1EOJA 1K1JA 1SGYE 1ZMJA 1UCYE 2YMSD 4XRNA 4IMQA 1V2PT 1GJAB 1VGCC 4WH6A 1ZPCA 5EXLA 1NM6A 4WXVA 1GBJA 3F2GA 1PPCE 2ZF0H 2ZHFH 1UHBB 1S82A 3SGQE 2ZG0H 3TJVA 2ZPRA 5ETXA 3SU6A 4FU7A 1OYQA 4X0WU 2ULLA 3UPEA 4DVAU 3T28A 5C94A 1GHBG 4DOQA 5HKKD 2ZHDA 3SO3A 1MQ5A 3QN7A 1AVWA 1GHAG 4OS1A 1O5CB 3RXSA 2PLXA 3MQKC 1AQ7A 1IHSH 1IQLA 1O3IA 1W0ZU 2A31A 1ZPBA 4B76A 3DD2H 3ATKA 2FI5E 4B6FA 1K0HA 1SMFE 1CT2E 4MPWA 5EJLA 3P95A 1A3BH 1MTUA 5EPNA 5L30H 2HPQH 5AF9H 3RM2H 3MH6A 2WZQA 2ZGXH 1EUFA 1MZAA 1FN8A 2ZFSA 2O8UA 5JPMH 3GCHB 3FANA 3T62A 1UJ1A 4XBDA 3TH3H 3VPKA 1O2LA 3SN8A 3KCGH 3LH3A 5C1UA 2BLVA 1TOMH 2UUKB 1MKXK 1GI6A 4LK4A 3TGIE 1OWHA 1ORFA 3ITIA 1QY6A 4ABJA 1YPKH 1CHOG 1MAXA 4FOUC 4X1SU 3VG8A 1V2WT 4YM9A 7KMEH 4ZXXH 1O2PA 2GV6A 3A7VA 4Y6DA 1NFWA 1CT0E 1O33A 2ZDNA 4U01A 5GNDA 1SGQE 3UB0A 1TONA 3PWCA 3A85A 1AUJA 4RN6A 1YPJH 3A7WA 4FUJA 3V13A 1SB1H 1W10U 1ANDA 2WPHS 1O2KA 3EA7A 5LH8A 3RUOA 5CHAC 1O3HA 1P12E 3D65E 2ZNKH 3OX7U 1QL9A 3K65B 1SGFG 3DSGA 4WMDA 1OWIA 2C8WB 4DG4A 1UVOA 3MNXA 5F8ZA 3E3TA 5CE1A 3BTQE 5CHBA 3GYLB 2P3UB 2HALA 3BIUH 1XX9A 3ODFA 2WYJA 3U9AH 1J9CH 7LPRA 2KR7A 2ZDVH 1TRNA 2HVYB 2V3OH 2IPQX 1C1NA 5AHGH 3MFJA 4OS5A 4UONA 1D9IA 3EGKH 4HG6A 3PTBA 1GMDF 2WV5A 2ALVA 3U98H 4UD9H 4RT0A 1IOEA 2QN5T 2QV1A 2VIPA 4XDEA 2QY0B 4ESTE 1IQEA 4NIVA 1AN1E 1HAPH 3MH4A 1QL8A 1E0FD 5A09A 1D3QB 4Y8XA 2ZGCA 1Y3XA 2BD8A 1BMNH 1KDQA 2ANMH 5C20A 1GI8B 1TGBA 3ZVDA 4X1NU 1MD7A 4I8JA 1YPMH 1LTOA 1W11U 4QT8C 3E8LA 1S0RA 3AW1A 4WWYA 1KXCA 1TA2A 2A0QB 1K22H
chains in the Genus database with same CATH topology
1W0KD 4TSFD 3H09A 5EPYA 4B73A 2V7QD 5C0TA 3L6PA 3OE7D 1H8ED 5C0UA 2FOMB 2JDID 4M9FA 1CU1A 2K1QA 2F4LA 2KZ4A 1MABB 3U1IB 4A1XA 1SKYE 4Q4LA 2OC1A 5FPTA 2IJD1 2XOKD 3WWFA 2WPDD 2K8IA 1RGQA 3DSPA 3F2FA 3SU1A 4WH8A 3SU4A 1DXPA 3SV8A 2CK3D 3OAAD 3KNXA 3VG8A 4DT4A 2J5UA 2QF4A 3SV6A 3LOXA 3PV5A 2KCPA 5FL7D 5DSFA 4I31A 3SU0A 1KMHB 3O8CA 1DXWA 2W6ID 4RI0A 1WXRA 4U01A 3KN2A 5GNDA 3FOAA 2VBCA 5T1VA 3F2HA 1OHHD 2OBOA 3F3BA 3UB0A 1N1LA 2GVFA 1BT7A 2XNDD 3SUEA 5ESBA 1NBME 2FM2A 2AHME 3DSOA 4YXWD 4TYDA 1W0JD 2F9VA 2OC8A 3SUFA 2GGVB 3NRLA 2P59A 1RTLA 2OC0A 4Q63A 5GPIB 3P8OA 5H4IB 3M5NA 4A92A 3M5LA 3M5OA 3KEEA 4KTCA 2JIZD 5F53A 4ZCNA 1EFRD 2W6JD 4K8BA 3SZEA 2KCOA 2WHXA 4OM9A 4B71A 3FN8A 4Z1MD 1JXPA 5DN6D 4TT3D 2IJOB 1E79D 1NS3A 3DCLA 3OEHD 4FETA 3SUGA 2QE7D 2KM0A 3F0PA 3FKSD 3KF2A 2JJ1D 2OINA 2FP7B 3LONA 1A1RA 4XD7D 3RC4A 3W1EA 3SUDA 1DY9A 3E90B 3N7DA 2YMSD 4NWLA 2KCYA 5CHBA 2M2AA 2K0QA 3SU2A 3O8RA 2KFWA 2OK5A 1DY8A 4WH6A 4B75A 3U1JB 2QF5A 4A1VA 4ASUD 3RC5A 3F2GA 5GJ4B 1E1RD 4JMYA 4I33A 2XNIA 4B6EA 2KR7A 2YMSC 3WWBA 2A4GA 5C17A 5IDKA 3N99A 5EQRA 4WF8A 3SYJA 1E1QD 2L6OA 5EQQA 5ETXA 3SU6A 2LELA 5EQSA 2XCNA 4NWKA 2A4RA 3M5MA 5CDFE 5HKKD 2WV9A 2KCAA 2F9UA 3PRDA 4A1TA 3O8DA 3OYPA 4F55A 2QV1A 2A4QA 5B6LA 1S6LA 3F0OA 3OFND 5FPSA 3PRBA 5FPYA 1NBMD 3OEED 2JJ2D 2XCFA 3N7EA 4I32A 1BMFD 4R8TB 4B6FA 4B76A 1COWD 3O8BA 3RC6A 5IK2D 5EPNA 2OC7A 3LKWA 2O8MA 3OTPA 2YMSB 3PV2A 3EYDA 3GS9A 3ZIAD 3SU3A 2OBQA 3SV7A 3SV9A 2WZQA 3P8NA 2YOLA 3FO8D 4B74A 2HLDD 1H8HD 2WSSD 3SU5A 3AK5A 2F43B 1W3CA 1FX0B 3WW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WWB A;  5F53 A;  3WWF A;  4ZCN A;  5CHB A;  3WW7 A; 
#chains in the Genus database with same CATH topology
 1W0K D;  4Q7Y A;  2OQU A;  3BTE E;  2ZIQ H;  2A2X H;  4AX9 H;  5C5O A;  4UFE H;  2QIQ A;  1P03 A;  1UW7 A;  2KZ4 A;  5FXL A;  3LGV A;  5DP5 A;  4Q4L A;  2OC1 A;  2CHA B;  2GD4 B;  3KYF A;  2EI7 A;  1D4P B;  1DXP A;  2GZ8 A;  1GBF A;  4WME A;  3TJU A;  4FU8 A;  1QRZ A;  3KNX A;  2XBX A;  1O30 A;  4CRB A;  2JH0 D;  2VH6 A;  1T4U H;  2NU0 E;  3IIT A;  4I31 A;  1EKB B;  4Y76 A;  3RU4 D;  1OKX A;  2W6I D;  4OS6 A;  4RI0 A;  1TPS A;  1YLN A;  1C5L H;  3FOA A;  1P2K A;  3F2H A;  5HM9 A;  3PRO A;  3QUM P;  1GG6 C;  2FM2 A;  1KTT B;  1RIW C;  2BY9 X;  1TX8 A;  1NT1 A;  2G51 A;  4Z6A H;  4E05 H;  3SJI A;  1QR3 E;  1P2O A;  1VCQ A;  2KCO A;  1O5F H;  1Y3V A;  4BXS A;  1LPK B;  4CR9 A;  5EXN A;  3Q00 A;  4Y79 A;  1TGC A;  1Z8J B;  3F9F A;  3W1E A;  1G9I E;  4BAM B;  3SU2 A;  1ETR H;  1TOC B;  1SPJ A;  2C8Z B;  3NZI A;  3OSY A;  1HBT H;  3WWB A;  1VR1 H;  2PHB A;  1NRR H;  2F9O A;  4Y71 A;  4DY7 B;  2HWL B;  2VVV A;  5EQR A;  2Y6T A;  1ZSK A;  3A83 A;  1LVO A;  5TJX A;  4HFP B;  3F9G A;  1BTZ A;  1CE5 A;  1QBN A;  2EA3 A;  1F0S A;  3LPR A;  2VID A;  4AFU A;  4CHA C;  4WY3 A;  2AMD A;  5FPY A;  4CH8 B;  1O3K A;  1A5I A;  3N7E A;  2W7S A;  1S83 A;  1TPA E;  3QGN B;  1Y3Y A;  2A2Q H;  3AAV A;  1LPZ B;  3LKW A;  1O3N A;  3OTP A;  3VB7 A;  1AWH B;  1TAW A;  1SQT A;  3KHV A;  2YOL A;  5A0B A;  1BB0 B;  2BY5 X;  3VEQ B;  1H8H D;  1FV9 A;  2V35 A;  3AK5 A;  1GCT B;  3LGT A;  1JIM A;  1BBR H;  1C4U 2;  1GDN A;  1RTF B;  4X1R U;  2RCE A;  3EQ0 H;  4TWY A;  4MG3 A;  3NK8 A;  1EAW A;  1WUN H;  3TJN A;  1EB2 A;  1LVM A;  3L6P A;  1YPE H;  1KXF A;  1H8E D;  1RFN A;  2TRM A;  1GL1 A;  3U69 H;  4CRE A;  4U2W A;  1XVM A;  1SKY E;  2YNA A;  3MHW U;  2IJD 1;  1LHF H;  1SBW A;  4BOH A;  1WCZ A;  3TGJ E;  3RLY H;  3ZVC A;  1DWC H;  5L2Y H;  1OYT H;  4LZ4 B;  1EPT C;  1ZHP A;  2STB E;  2UUJ B;  2BQ6 B;  4BXW A;  1MCT A;  1HAH H;  1V2Q T;  1GJ6 A;  3LOX A;  5JB9 S;  1SLU B;  3KN2 A;  1QFK H;  1GBI A;  1UTN A;  3QLP H;  1CHO F;  1W8B H;  4AFS A;  1H4W A;  2RFK C;  1P06 A;  3LU9 B;  2R3U A;  1GVL A;  3NRL A;  2OC0 A;  3H7T A;  4YOG A;  3P8O A;  2XC0 A;  3UTU H;  2M5T A;  1XXD A;  2ZFP H;  1P01 A;  3C1K A;  4MTB A;  2VGC B;  1O2X A;  1O36 A;  1PPH E;  3SNA A;  1SL3 A;  3ZZC A;  5GWZ A;  2ZFF H;  3KQE A;  5EG4 A;  3E90 B;  3O8R A;  2Y5H A;  2M2A A;  3IG6 B;  1W12 U;  3T27 A;  4Y0Z E;  4B75 A;  1TFX A;  2FTL E;  4JYT A;  4A1V A;  2W5E A;  1EAI A;  2G8T A;  1X7A C;  2AGI X;  1QGF A;  1T31 A;  1ZJD A;  3BG4 C;  1CBW B;  1BMA A;  4BTU B;  2A4R A;  2XTT B;  3RXG A;  3RU4 E;  1C5P A;  1LHC H;  1FMG A;  3VB3 A;  3U8O H;  1E38 B;  2WV9 A;  3T29 A;  4RSP A;  1GHZ A;  1O2U A;  3ODD A;  1Z8G A;  3F0O A;  2SGP E;  1TNG A;  3DFJ A;  3PO1 B;  2ZPQ A;  1O2H A;  1C5V A;  2Z9G A;  1C5N H;  3RDZ A;  3M37 A;  1GI5 A;  5IK2 D;  2J94 A;  2QA9 E;  5F03 A;  3B23 B;  3EYD A;  1ZGI A;  1DAN H;  1PJP A;  4OS7 A;  4P02 A;  4X6P A;  3A86 A;  1FJS A;  1O5E H;  2F43 B;  3MH7 A;  3MH5 A;  1KXE A;  1IQI A;  4O3T A;  4TSF D;  1T4V H;  1P3C A;  3LDX H;  1TLD A;  3FP8 E;  2OUA A;  1F0R A;  3D62 A;  3KGP A;  3LH1 A;  2B5T B;  3A7Y A;  2K1Q A;  4M9F A;  4VGC C;  4TY6 A;  8EST E;  2BY7 X;  5AVD A;  3WWF A;  4NA8 A;  4CBN A;  2J97 A;  3DSP A;  1PQA A;  1GVZ A;  2G4U A;  1C2M A;  3QO6 A;  2PTN A;  1MTS A;  3ZVB A;  3M35 A;  1WTH D;  2KCP A;  4R0I A;  2ZKS A;  1FXY A;  1ABI H;  1K1N A;  2WUB A;  1BDA A;  2PSX A;  2ZTY A;  4AOR A;  2AMP A;  4FXG H;  2G55 A;  5ABW A;  4JZE H;  1LVY A;  1GVK B;  3MU4 A;  1PQ8 A;  2Y80 A;  1B5G H;  2BHG A;  2J98 A;  5JBT A;  2B9L A;  2ZQ1 A;  1C5Q A;  5E0H A;  2D1J A;  3RXL A;  2A7J A;  5EOD A;  1H1B A;  3TJO A;  4CR5 A;  1HJA B;  3VB5 A;  4CH2 B;  3FP7 E;  4X1P U;  1HFD A;  1TAB E;  1EAU A;  4NGA H;  2Q6D A;  3EDX B;  1K1I A;  2IN2 A;  3ATM A;  1VIT G;  4M7G A;  2J38 A;  1V2O T;  2P8O B;  3RC4 A;  3GY6 A;  2BM2 A;  4ASH A;  1HAV B;  1RTK A;  2ZDL A;  1C2F A;  4TWW A;  3BN9 A;  3U1J B;  1RS0 A;  3SND A;  1S6H A;  3MO6 A;  2Z6B D;  4I33 A;  1NTP A;  2VWO A;  1QHR B;  1ZLR A;  3TNT A;  1THR H;  2NWN A;  1SC8 U;  1G37 A;  2J98 B;  3KQ5 A;  1LQD B;  1FDP A;  3RXU A;  4NWK A;  5F6M A;  1DFP A;  5CDF E;  3MYW A;  1Z7K A;  1G2M A;  4MNY A;  1Z71 A;  4ABE A;  1DDJ A;  2D26 C;  3OYP A;  4F55 A;  1LKB A;  2A4Q A;  2F3C E;  2RG3 A;  5FPS A;  3P6Z B;  4DUR A;  5E2O A;  1O5A B;  1GMD G;  3MI4 A;  3O8B A;  1KYN A;  1IQK A;  4ZKO U;  3M3T A;  1UTK A;  2Z3D A;  1YC0 A;  1K1L A;  3ENS B;  2A32 A;  4Q7Z A;  3ZZ8 A;  1GJB B;  3HAT H;  5F8X A;  3A84 A;  3RXV A;  4E7R G;  3RMM H;  5C1X A;  5JBC S;  4TY7 A;  1PPG E;  1E36 B;  3I29 A;  5C0U A;  2FZZ A;  1UK3 A;  4B2B A;  2BXT H;  3M3S A;  3RXD A;  1B0F A;  4D76 A;  2FOH A;  2GT7 A;  1XM1 A;  1GBC A;  2V6N A;  1D3P B;  3E0P B;  2BZA A;  5GCH G;  5J4S A;  2HNT C;  2Z7F E;  1O2T A;  1Y3U A;  2JKH A;  1F0T A;  3ZZB A;  3MU1 A;  4WVP E;  1ZR0 A;  2V3H H;  4BAQ B;  3LGY A;  3SBK A;  2GCT C;  1FNI A;  1YPH C;  3O8C A;  4AB9 A;  4Y7B A;  3T5F H;  1WU1 A;  2OBO A;  1BRB E;  2ZCH P;  1O5B B;  4NIY A;  4LXB H;  3V3M A;  3MU5 A;  1S81 A;  1BML A;  3P8F A;  1WAY B;  2ZQ2 A;  1BOQ A;  3SUF A;  1C2K A;  1ELA A;  1Y5A T;  3PB1 E;  4JYU H;  4BAN B;  3DUX H;  2HLC A;  2R2M B;  1EFR D;  1LHD H;  4K8B A;  3SZE A;  3KQC A;  1C5Z B;  2BDA A;  4D7G A;  1O2J A;  1P3E A;  1TX6 A;  4U32 A;  4DGJ A;  1B7X B;  1GHX H;  3A7X A;  4TPI Z;  1NY2 2;  1MKX H;  1BA8 B;  1SGD E;  1OS8 A;  3SUD A;  1KLI H;  2FIR H;  1ELE E;  1UHB A;  2QF5 A;  3RU4 T;  1ACB E;  1GHV H;  1S85 A;  1AE8 H;  4CRF A;  1QA7 A;  1E1R D;  1J15 A;  4JMY A;  4K1T A;  1A2C H;  2BYA X;  2OTV A;  4D7F A;  2A4G A;  1J14 A;  2A4O A;  3SYJ A;  2VIW A;  2ZU3 A;  4B1T A;  1QJ7 B;  2H5C A;  1AFQ B;  8GCH G;  3FP6 E;  1THP B;  1OX1 A;  2ZFR H;  3PMJ A;  2PR3 A;  4FUI A;  2BVS H;  1UTO A;  1P9S A;  5EXM A;  3UQV A;  1A5G H;  1TMB H;  2GP9 B;  1C4V 2;  4UFF H;  5LGO A;  1TGS Z;  2LP6 A;  4NA9 H;  1LO6 A;  2XCF A;  2FOA A;  4J2Y B;  1ELG A;  1COW D;  1OSS A;  2TGD A;  2PUX B;  2P94 A;  3BTM E;  2O8M A;  3SU3 A;  2OBQ A;  3VGC C;  3VB4 A;  2KX4 A;  1TNL A;  1DM4 B;  2VVC A;  1GPZ A;  1GDU A;  1FUJ A;  1GJ4 H;  3QZR A;  1GMC F;  3GY7 A;  2G4T A;  3V7T A;  1FY5 A;  3W94 A;  1YCP K;  5AFY H;  1WQS A;  1FQ3 A;  7GCH F;  2XXL A;  4YLU A;  2SGE E;  1KXB A;  3BIV H;  2C3S A;  1A0H B;  1EZX C;  1P05 A;  1Y5B T;  2IPH A;  2WPM S;  5EOK A;  3OAA D;  1QB6 A;  1B0E A;  2CXV A;  2H2Z A;  4D9Q A;  2BD9 A;  3SV6 A;  1GL0 E;  1ESA A;  2SNV A;  1FY4 A;  5DSF A;  1T8O A;  4KTU A;  2JH5 D;  3RXO A;  1XUK A;  3S7K B;  3SGB E;  2GX4 A;  1OHH D;  2WYG A;  1GI0 A;  3SUE A;  1IQN A;  2AHM E;  6CHA C;  2O8T A;  1MD8 A;  3EAJ A;  5EJ1 A;  1SGT A;  2GGV B;  2BTC E;  1JIR A;  4IN1 A;  2Z3C A;  4Q63 A;  5GPI B;  3NUM A;  2QXG A;  1IAU A;  1P2I A;  1Z1J A;  3QGJ A;  3KL6 A;  5TCC A;  1MTW A;  1O2M A;  4Z1M D;  2ZHQ H;  1FY8 E;  3F0P A;  1SSX A;  3ZV8 A;  4MPX A;  1DX5 M;  4JZI A;  1UCY K;  4YES B;  2SGF E;  4NWL A;  1AO5 A;  1ZPZ A;  1ANE A;  1KLJ H;  5HMA A;  4THN H;  2ZDM A;  1S0Q A;  4X8U H;  1PPB H;  1PPZ A;  2BLQ A;  4Y11 E;  1VIT F;  2WPJ S;  3SNB A;  3E16 B;  1AUT C;  1BQY A;  4ACB A;  1IQM A;  1E1Q D;  1O2S A;  2XCN A;  1MBM A;  1TBR H;  1FI8 A;  1TE0 A;  4B2C A;  3R0F A;  2HPP H;  4O9V A;  3MNC A;  3NCL A;  1DST A;  2FOF A;  3SJK A;  2BOK A;  2A5I A;  3SV2 H;  3RXK A;  1NFY A;  5EST E;  1ESB A;  3F6U H;  2O9Q A;  4OGX A;  4FUE A;  4ISN A;  4UFG H;  3LJO A;  1BUI A;  3EA9 A;  1L2E A;  3NXP A;  3GOV B;  2QGR A;  3V0X A;  3FO8 D;  3LGI A;  1HYL A;  4ZAE A;  1HV7 A;  1MAY A;  3UOU A;  3URE A;  3A87 A;  4B73 A;  1A61 H;  3GCO A;  1C1T A;  1O2G H;  2FS9 A;  3U28 C;  1AVX A;  2G81 E;  3S9A A;  1H8I H;  2BVR H;  2FX4 A;  3HPT B;  1MTN B;  1DT2 A;  3UWI A;  2OCV B;  4X2Y A;  1QBV H;  3GDU A;  1G30 B;  3A8B A;  1GBM A;  1KXD A;  4K69 A;  1HLT H;  2ODQ A;  5GDS H;  2QAA A;  3R3G B;  4GUX A;  5DK1 A;  1H8D H;  1O3G A;  2QXJ A;  1MTV A;  4MDS A;  3Q76 A;  2FLB H;  5GCH F;  5C5N A;  1Z1I A;  3F3B A;  1SGF A;  1S6F A;  4Y8Z A;  4GHT A;  3PMH B;  2VH0 A;  5EGM A;  1ZRK A;  4ZKS U;  2BDC A;  4INL A;  3LC5 A;  3IWM A;  2Q1J A;  1ELC A;  1H9L B;  5TCA A;  4SGB E;  1SI5 H;  1O3M A;  3UQO A;  3KEE A;  1P11 E;  4AG1 A;  2W3K A;  3RP2 A;  2GMT C;  2BMG B;  1NRN H;  2WHX A;  4O3U A;  3P70 B;  3S0N A;  1JXP A;  1DLK B;  1P10 A;  2BD4 A;  1AE5 A;  2UWP A;  2BZ6 H;  1E79 D;  3OEH D;  1FY3 A;  1BJU A;  2FDA A;  4UE7 H;  3QX5 H;  2KM0 A;  3LON A;  3HGN A;  2FP7 B;  3RML H;  1ANB A;  2V0B A;  2KFW A;  1DY8 A;  2ZU1 A;  4LZ1 H;  1CQQ A;  3UR6 A;  1GI1 A;  3NWU A;  5BPE A;  1HCG A;  1UTJ A;  1V2J T;  1WSS H;  3M7U A;  5GIB A;  1C1Q A;  3EE0 B;  1PYT C;  3GDS A;  4FUD A;  1YYY 1;  3T25 A;  2AMQ A;  2GKV E;  2F9B H;  2ZGJ A;  1QB9 A;  2BLO A;  2GV7 A;  1O31 A;  3LIW A;  4A7I B;  2F91 A;  2F9U A;  1K1M A;  3OFN D;  4MNV A;  2EI8 A;  5LPF A;  5G4B A;  1UVT H;  1NRS H;  1GBL A;  1Y59 T;  3TK6 A;  4GLY A;  1BMF D;  4FVB A;  4MNX A;  8GCH F;  2UUF B;  1GI9 B;  4X8V H;  1QJ6 B;  4YLQ H;  4H42 U;  4LOY H;  1F0U A;  1YPG H;  2B0F A;  3GS9 A;  1HIA B;  5C3N A;  1CA8 B;  1OP0 A;  1VIT H;  1M9U A;  4B74 A;  1AGJ A;  3GY2 A;  5EJZ A;  1F5L A;  1K1P A;  5DP7 A;  1ZHR A;  4AFZ A;  4I8K A;  1SLX B;  1QBO A;  4OS2 A;  3U8R H;  3RXT A;  1QL7 A;  3ZZ6 A;  2XBW A;  1F5K U;  3F9H A;  4ABG A;  3UY9 A;  4A1X A;  3ZVA A;  1AWF H;  1MBQ A;  2K8I A;  3SU4 A;  2SNW A;  1HXE H;  3Q77 A;  1WDI A;  5PTP A;  2ZP0 H;  3RXJ A;  2BDY A;  2A45 B;  1ZRB A;  3GY4 A;  2Q6G A;  3GY5 A;  2P3T B;  1MUE B;  1G3B A;  1C5R A;  1LDT T;  4ZH8 A;  1O3O A;  4NFE A;  1EB1 H;  3MO9 A;  1J17 T;  2BY6 X;  5FHT A;  1BIO A;  1D3D B;  1CO7 E;  1P2Q A;  4DCD A;  1BTW A;  1V2R T;  1C5U A;  1G3D A;  1GG6 B;  4PRO A;  4YXW D;  3SOS A;  2ZCK P;  4ZRO A;  3M5N A;  1CGJ E;  1VJ9 U;  3MU0 A;  5F53 A;  1CBW C;  2ANK H;  5HIY A;  3ZZD A;  1V2V T;  1G36 A;  1P04 A;  3BV9 B;  2HNT E;  4XD7 D;  2V3M A;  2CN0 H;  1AB9 C;  3BTH E;  1BBR E;  1DUE A;  1Z8I B;  1W7G H;  1ZJK A;  3UNR A;  2XC5 A;  4JZD H;  4ASU D;  1YPH E;  1LHG H;  1IQJ A;  2JET C;  2WPK S;  2FYQ A;  3MOC A;  4UDW H;  3GIS B;  1GBT A;  1DSU A;  1JMO H;  1AKS B;  1ZTJ A;  1VCW A;  1L4Z A;  5FX6 A;  2AGG X;  3ZZA A;  1KLT A;  1V3X A;  1XUF A;  1TMU H;  1UTM A;  2PKS B;  1ZGV A;  3M5M A;  2I6Q A;  1O2W A;  1YKT A;  5L2Z H;  4U30 A;  3T26 A;  1CVW H;  1WTG H;  4CHA B;  1YLC A;  3ELA H;  5AFZ H;  5DP8 A;  4ABD A;  2O8W A;  3SOR A;  1UTL M;  2JJ2 D;  4GVU A;  4XBC A;  1SLW B;  2ILN A;  1MKW H;  1YF4 A;  3LT3 A;  4KGA A;  3ZIA D;  1O39 A;  1ANC A;  3SQE E;  4ABI A;  1HAO H;  1INC A;  1O2R A;  4AOQ A;  2VB0 A;  2FES H;  1O2Q A;  1TA6 A;  4YOJ A;  4YOI A;  1UVS H;  2AH4 X;  4K1E A;  3A88 A;  5C0T A;  3B8J A;  3FVF B;  1C1M A;  1QQ4 A;  4CRD A;  3L3T A;  5DPA A;  3BTT E;  1CT4 E;  1HAG E;  2HVX A;  2WPD D;  1GMC G;  1HAZ B;  3BSQ A;  1S84 A;  1NFX A;  4NSY A;  1HJA C;  2FPZ A;  1EPT B;  4JK5 A;  7GCH G;  4I8G A;  4ABA A;  1HJ8 A;  4ZMA H;  3PV5 A;  1DXW A;  5B6O A;  1IQF A;  5DP9 A;  4AYY B;  2J4I A;  2R2W U;  1G3C A;  5T1V A;  2P8O C;  5KED A;  1NRO H;  1N1L A;  2GZ7 A;  1GCD A;  3PMB B;  1ID5 H;  3CS0 A;  1BTP A;  4NSV A;  2DE8 A;  2AEI H;  3ZVE A;  1TNI A;  4YZU A;  1O3P B;  5GXP A;  2P59 A;  2TBS A;  1HRT H;  4UEH H;  3M5L A;  1EJM A;  1O2Y A;  1NU7 B;  2UWL A;  1HB0 B;  5DN6 D;  1HAV A;  3UFA A;  4Q80 A;  1BMM H;  1C2E A;  2D8W A;  1IQG A;  3FKS D;  1V2U T;  3C27 B;  3SNC A;  3AW0 A;  1F7Z A;  3ATL A;  1PYT D;  3I78 A;  3BEI B;  4JZF H;  2R0K A;  4XOJ A;  3RXF A;  5GJ4 B;  1P57 B;  2ZZU H;  1WOF A;  3AAU A;  1QIX B;  4AB8 A;  3TLO A;  2W7U A;  2P93 A;  3BG8 A;  5C17 A;  3N99 A;  1KXA A;  2C90 B;  1C2H A;  2EI6 A;  1ZTL A;  2VIV A;  3HK3 B;  2ANW A;  5T6D A;  1ZTK A;  3E0N B;  5EQS A;  1SOZ A;  1MKW K;  3JZ1 B;  1GJ8 B;  1A7S A;  3LGW A;  3OY5 U;  4BAO B;  6LPR A;  1HPG A;  2F9P A;  3GY8 A;  2G52 A;  1SGC A;  3OY6 U;  5I25 A;  3OEE D;  3P8G A;  3A8A A;  1N8O C;  1GDQ A;  1EJN A;  1VKY A;  4X8T H;  2THF B;  2BD7 A;  2YMS B;  2G5N A;  1O3D A;  5JYI A;  3SV7 A;  1NO9 H;  1XUH A;  3H7O A;  3Q3Y A;  1KTS B;  1H9H E;  4ZHA A;  5HYO A;  1FX0 B;  1XUJ A;  1GJD B;  1JRS A;  1O3A A;  1OWE A;  2AYW A;  2G00 A;  2OQ5 A;  4RKJ B;  1BRC E;  3QZQ A;  3CS7 A;  1K21 H;  1CU1 A;  1SFQ B;  4HGC A;  1DE7 H;  2QF3 A;  3U1I B;  1XKA C;  1GGD C;  1OP2 A;  3BEF B;  3SV8 A;  4KP0 A;  1QRW A;  1AZZ A;  1ZZZ A;  3TGK E;  2H9T H;  1NC6 A;  2ZFQ H;  2O8L A;  3D49 H;  1O32 A;  1RJX B;  2FOD A;  1L0Z A;  2VJ1 A;  1O2O A;  1QB1 A;  1T32 A;  2WIN I;  3Q3K A;  5K7R A;  1O5D H;  1HAY B;  4WMF A;  3PWB A;  5T3H A;  1P2M A;  3AAS A;  1D6W A;  1FLE E;  2F9V A;  1MU6 B;  2AFQ B;  1UTQ A;  1YBW A;  2FOC A;  3GCT F;  1TX7 A;  5DP3 A;  5H4I B;  5A8X A;  2P95 A;  3DFL A;  2JIZ D;  2A7H A;  1TBQ H;  3PM3 A;  3E1X B;  1YGC H;  1CA0 C;  4OM9 A;  4IS5 A;  1HNE E;  2CJI A;  2J34 A;  1OXG A;  1YCP H;  1O2V A;  3PLK A;  1C9P A;  1P02 A;  1JRT A;  2ZEC A;  2FTM A;  2FX6 A;  3RXM A;  1A1R A;  1HUT H;  2FOG A;  3N7D A;  1F5R A;  1GHW H;  1WV7 H;  4KTS A;  3URC A;  3BF6 H;  4AZ2 B;  1ARC A;  1GBK A;  3P17 H;  4O97 A;  4KKD A;  4AC9 A;  2ZPS A;  4ISH H;  1O3F A;  1OWJ A;  5A8Z A;  1TWX B;  3GCN A;  1D6R A;  2Z9L A;  3VB6 A;  1GBA A;  2ZCL P;  1C2L A;  2ZGH A;  1C5O H;  1P09 A;  3F9E A;  3BEU A;  1SLV B;  1GI2 A;  4A1T A;  3SJO A;  2G5V A;  4ABF A;  3ZZ5 A;  1ELD E;  1HAI H;  1MCV A;  1KSN A;  1QQU A;  2XRC A;  3RXC A;  2VIN A;  3S9B A;  1V2K T;  2KAI B;  2PGQ B;  1A3E H;  1EAS A;  4K3J A;  1O37 A;  3STJ A;  1VJA U;  2OLG A;  1WBG B;  3RMO H;  5LPR A;  4B2A A;  1NZQ H;  2BDI A;  1DVA H;  1C5Y B;  1V2L T;  3SGA E;  1BTH H;  1Z6J H;  1UCY H;  4OGY A;  2CMY A;  1PPF E;  5DGJ A;  3WW7 A;  1UMA H;  3QK1 A;  3GCH C;  1QNJ A;  1XKB C;  4AGK A;  4CBO A;  1O2Z A;  3LJJ A;  5C67 A;  3KQD A;  4H6S B;  1SHY A;  2A5A A;  3A7Z A;  3OTJ E;  4YTA A;  1ELT A;  3SJ8 A;  3E91 A;  1C5S A;  3DA9 B;  2TGP Z;  3SI3 H;  1HDT H;  1QRX A;  6GCH F;  3TIU A;  2GCH F;  1HXF H;  4KEL A;  1FAK H;  5A0A E;  4FU9 A;  1IQH A;  4X6N A;  1T8M A;  2Z9K A;  1T8L A;  2H1U A;  3M7T A;  1AVG H;  3PLP A;  2Z3E A;  3ZYE A;  2BD3 A;  2ZEB A;  2BOH B;  1J8A A;  1L1G A;  3UOP A;  2FOB A;  1E35 B;  3HGP A;  1W0J D;  1XUI A;  2TGT A;  3SHC H;  4UFD H;  4A92 A;  5HXF A;  1MQ6 A;  3PLB A;  1O2N A;  2W6J D;  3MNB A;  4NZL A;  4F4O C;  2STA E;  2VVU A;  1QZ8 A;  4JZ1 A;  3B9F H;  1C4Y 2;  1V2S T;  4FET A;  1GMH G;  1H9I E;  2PTC E;  3SUG A;  1MMJ N;  1SFI A;  2QE7 D;  2SGD E;  2A7C A;  5HIZ A;  5T6F A;  3ATI A;  4JCN A;  2KCY A;  4IC6 A;  3SJ9 A;  4A6L A;  5FX5 A;  4MNW A;  1K1O A;  3ZZ7 A;  3RC5 A;  1W7X H;  4SGA E;  2XNI A;  4X2X A;  3FFG A;  3Q3X A;  1HGT H;  1SGE E;  1JOU B;  1HAX B;  1L4D A;  4Y0Y E;  4WF8 A;  5A0C A;  2QXH A;  1TNK A;  3TK9 A;  1O3L A;  3RXB A;  3VXE H;  1O3E A;  4NCY A;  5EIY A;  4CRA A;  1CSO E;  4CRC A;  1SGP E;  1V2M T;  5B6L A;  4IGD A;  1OPH B;  3FZD A;  4IC5 A;  1C1R A;  1VGC B;  1C5X B;  1BTY A;  1EX3 A;  1MTN C;  1U6Q A;  2QF0 A;  1GJ5 H;  1TNJ A;  2VWN A;  3E6P H;  1LPG B;  2ODY B;  4FVD A;  3VGC B;  4D9R A;  1YPL H;  4AG2 A;  4IMZ A;  3TPI Z;  6EST A;  1TQ0 B;  2PFE A;  2WSS D;  2BDG A;  4NG9 H;  5I46 H;  1HJ9 A;  3LGU A;  1Y8T A;  2Y5F A;  2ZU2 A;  5EPY A;  2V7Q D;  1XVO A;  4AFQ A;  1C2G A;  4A5T S;  3OE7 D;  1EP6 A;  2ZWL H;  3S9C A;  1C2J A;  3BTD E;  2F9N A;  3UIR A;  1W2K H;  4K1S A;  4NIX A;  1L1N A;  5CMX H;  3BTF E;  1V2T T;  2CHA C;  3N7O A;  2OXS A;  1GJ9 B;  1MU8 B;  5DP4 A;  2D2D A;  2GDE H;  1BHX F;  1EJA A;  3T2N A;  2FYR A;  2Y7X A;  2QC2 A;  4F49 A;  4K8Y A;  3AVZ A;  3M36 A;  2WPL S;  1AD8 H;  5FL7 D;  4AYV B;  9EST A;  1WXR A;  2EQN A;  5FAH A;  4P00 A;  1EST A;  1S5S A;  4IBL H;  4NZQ A;  5FBE A;  2GVF A;  4DIH H;  2EEK A;  1SOT A;  6CHA B;  3RXR A;  1NU9 A;  3TH4 H;  1DWE H;  4XE4 A;  3U8T H;  5DG6 A;  5LPE A;  2FOE A;  3A8C A;  1E37 B;  4JYV H;  1RTL A;  2HOB A;  1SQR A;  2AGE X;  2HNT F;  1AHT H;  2B7D H;  2FI4 E;  1BRU P;  2BX3 A;  4TPY A;  2P3F H;  1C1S A;  1LKA A;  1W13 U;  4GHQ A;  2R3Y A;  1F92 A;  2BVX H;  2IJO B;  3ZV9 A;  2GJG A;  4BAH B;  4DT7 B;  4ZUH A;  1ELF A;  4JK6 A;  1TRY A;  1C1P A;  1QA0 A;  5DJ7 A;  2SFA A;  1DPO A;  1OP8 A;  1GI4 A;  4RT1 A;  1P9U A;  1GBB A;  2RA0 A;  3MTY A;  1C5T A;  1XMN B;  5CHA B;  2CF8 H;  2PSY A;  2W26 A;  2L6O A;  2ZFT A;  2LEL A;  4GCH F;  1AMH A;  1AY6 H;  1TNH A;  5JBB S;  1FPC H;  1TIO A;  5SGA E;  1FZZ A;  1S6L A;  1O34 A;  4ACA A;  1D3T B;  3TVJ B;  5JDU B;  3KID U;  5JB8 S;  1HIA A;  2Q6F A;  1JBU H;  1TGT A;  4I86 A;  5E2P A;  1J16 A;  3RC6 A;  4AN7 A;  2OC7 A;  1O5G H;  4XFQ A;  1C1W H;  2L74 A;  2BLW A;  1O0D H;  3SV9 A;  1KDQ B;  4ZHL U;  2OP9 A;  2R9P A;  3SU5 A;  1YP9 A;  1GCT C;  4CRG A;  1SG8 B;  1W3C A;  4BTI B;  3NPS A;  1ZOM A;  4E06 H;  3H09 A;  4YT7 H;  1DUA A;  1UK2 A;  3MMG A;  2VIO A;  1C1O A;  2GDD A;  3QWC H;  5A8Y A;  1SGR E;  3BTW E;  4HI3 A;  1O38 A;  2F4L A;  2XYA A;  4J1Y A;  1ZSJ A;  2UWO A;  1BIT A;  1SQO A;  2GTB A;  1RGQ A;  2Y7Z A;  3M7Q A;  4DW2 U;  5L6N H;  1DLE A;  3EST A;  4NIW A;  2J92 A;  4INH A;  1DS2 E;  1LVB A;  4AGJ A;  1FY1 A;  3ATW A;  3UWJ H;  1EQ9 A;  2QF4 A;  3UNS A;  3P92 A;  1WYK A;  2VU8 E;  5FCK A;  1C9T A;  4NA7 A;  4INK A;  2YNB A;  4HTC H;  2ZO3 H;  5KEC A;  1BT7 A;  3SHA H;  5FBI A;  2ASU B;  1P2N A;  5ESB A;  5DO4 H;  1T7C A;  3DSO A;  2GT8 A;  2FXR A;  4TYD A;  2OC8 A;  3UNQ A;  1G2L A;  4X6O A;  4ZKR U;  4ABB A;  4X2V A;  5IYT A;  3VFE A;  1EP5 A;  3GIC B;  5HM2 A;  2GMT B;  8LPR A;  2C8X B;  1DOJ A;  1EAX A;  3FN8 A;  3W95 A;  3UAI C;  2PKS C;  4MPU A;  2VGC C;  4ZXY H;  1BTU A;  5F8T A;  1AZ8 A;  2PW8 H;  3GCT G;  3HKI B;  2BQW B;  5FCR A;  3KF2 A;  1JWT A;  2OIN A;  1ZML A;  2H5D A;  3G01 A;  1ETT H;  4GPG A;  1TQ7 B;  1NRP H;  3PYH A;  4ZKN U;  1GBH A;  2OK5 A;  4Q2K A;  4K60 A;  1RIW B;  1CGI E;  5A2M H;  3TK5 A;  1AKS A;  2ZTZ A;  1GHB F;  1QTF A;  1XXF A;  4B6E A;  1GMH F;  3FZZ A;  3A8D A;  2ZC9 H;  1GHA F;  2DE9 A;  4K5Z A;  1VCP A;  2ANY A;  3MNS A;  5DP6 A;  1K28 D;  3PRD A;  2ALP A;  4BAK B;  3A89 A;  3MWI U;  4X8S H;  2BQ7 B;  3PO1 C;  1YM0 A;  4O03 A;  4I32 A;  1YY3 A;  2EC9 H;  1PPE E;  1Z8R A;  4I8H A;  1TPO A;  2PGB B;  1A0J A;  3H5C B;  2HGT H;  3P8N A;  3FAO A;  3TIT A;  3UUZ A;  1GI3 A;  2Y81 A;  2CV3 A;  1SVP A;  3EE7 A;  1BCU H;  2XWA A;  1FPH H;  2ODP A;  3F68 H;  4HZH A;  8KME 2;  1Q2W A;  2BX4 A;  4Y7A A;  1K2I 1;  1L1J A;  3MO3 A;  1EPT A;  1PQ7 A;  2PV9 B;  3GYM A;  3M61 U;  3K6Z A;  3SU1 A;  4WH8 A;  1ARB A;  1UVU H;  1UK4 A;  3KQB A;  1ETS H;  4H6T A;  1GJC B;  2PKA A;  3NKK A;  1TYN A;  1CGH A;  4DT4 A;  2WPI S;  2NU2 E;  3OU0 A;  1OOK B;  1FIW A;  1KMH B;  1GI7 B;  1SQA A;  4MPV A;  1Y3W A;  3UR9 A;  1BZX E;  1W0Y H;  1GHY H;  2VWM A;  5E0J A;  1PQ5 A;  3K6Y A;  2NU1 E;  1EOL A;  6GCH G;  1A46 H;  1NPM A;  2GCH G;  3QTV H;  1WQV H;  2PUQ H;  2ZTX A;  4MQA A;  1BJV A;  1NES E;  2H6M A;  1MZD A;  2A5K A;  4X1Q U;  3EA8 A;  1RXP A;  3CNR A;  3M3V A;  3M5O A;  3MU8 A;  2XWB I;  4DII H;  4OS4 A;  9LPR A;  4B71 A;  1GBE A;  4XBB A;  1V6D A;  4FUC A;  2PKA B;  1A0L A;  1QUR H;  3STI A;  2ZA5 A;  2JJ1 D;  2Y5G A;  4ZHM U;  1DY9 A;  1FIZ A;  1XUG A;  2FO9 A;  2P16 A;  1BBR K;  2K0Q A;  1AB9 B;  1EZS C;  3QTO H;  1V2N T;  2C4F H;  3RXP A;  3GY3 A;  1TB6 H;  2JET B;  4NFF A;  2YMS C;  1F2S E;  4D8N A;  2UUY A;  5T6G A;  5IDK A;  2A1D B;  1OWD A;  5EQQ A;  4F48 B;  2EY4 C;  1NFU A;  3V12 A;  1QCP A;  2KCA A;  4GSO A;  2LPR A;  3O8D A;  3HKJ B;  2Z94 A;  2LNC A;  2Z9J A;  5JBA S;  3S69 A;  2B8O H;  1YLD A;  1DIT H;  1ELB A;  3TNS A;  1GJ7 B;  2Y82 A;  1VZQ H;  2ZHW H;  1NBM D;  3SQH E;  4R8T B;  1DIC A;  1SGN E;  4I8L A;  1GBD A;  4Y8Y A;  2ZI2 H;  1ZMN A;  4Q7X A;  1C5M D;  3BG4 B;  1RD3 B;  2PWX A;  2HLD D;  3RLW H;  3DHK H;  3K2U A;  4YO9 A;  3ZZ3 A;  3ZZ4 A;  4Z0K A;  5J4Q A;  1ZSL A;  1C1V H;  5HGG A;  2C93 B;  5KGO A;  3KYG A;  2WUC A;  1ZHM A;  1C2D A;  2JH6 D;  4FUF A;  1TGN A;  1P8V C;  5FPT A;  2FS8 A;  3F2F A;  2CK3 D;  3RM0 H;  1ELV A;  3ZVF A;  2SGQ E;  2J5U A;  3SU0 A;  3QDZ B;  4RKO B;  4IW4 E;  2RA3 A;  2IOT A;  3CP7 A;  2J2U A;  4X6M A;  2NU4 E;  2QCY A;  3BTK E;  1BTX A;  1NN6 A;  2BD5 A;  3RXH A;  5C2Z A;  1AU8 A;  4VGC B;  1LMW B;  2AER H;  1AI8 H;  4XSK U;  2DUC A;  4X2W A;  1C1U H;  4BTT B;  1AFE H;  1EAT A;  2BDH A;  3PTN A;  1LQE A;  3ZZ9 A;  1BRA A;  1SGI B;  5K0H A;  1THS H;  4ISI H;  1E34 B;  1P2J A;  2FLR H;  2I6S A;  2GZ9 A;  3SZN A;  1TRM A;  1LHE H;  2QYI A;  1TMT H;  2ZDA H;  5EU8 A;  5E0G A;  1DWD H;  3PMA B;  3TH2 H;  3CEN A;  2XBY A;  1O2I A;  2RDE A;  7EST E;  2BY8 X;  5EW1 H;  3RXI A;  1FN6 A;  4Y10 E;  2W3I A;  4MLF B;  2VNT A;  4MVN A;  4ABH A;  4E7N A;  2BDB A;  1O3J A;  4YT6 H;  3RXA A;  3SNE A;  5EW2 H;  2VIQ A;  2QXI A;  2ZU5 A;  1AFQ C;  1UVP A;  2XW9 A;  4ISO A;  4H4F A;  3ZYD A;  4I7Y H;  2H9E H;  3LC3 A;  2KAI A;  1O3C A;  1N6Y A;  1EZQ A;  1EXF A;  1TBZ H;  2TGA A;  4GAW A;  2F83 A;  2HRV A;  2ZU4 A;  1CHG A;  3PRB A;  4GCH G;  1SHH B;  2OD3 B;  3BTG E;  3GDV A;  3JZ2 B;  1N8O B;  1O3B A;  1QJ1 B;  1RRK A;  2AIP A;  3RXE A;  3A80 A;  3PV2 A;  1TAL A;  1ZYO A;  2PP6 A;  1Z6E A;  1LCY A;  3VXF H;  5BRR E;  2BB4 A;  5E8E H;  5C1Y A;  3K9X B;  2TPI Z;  2CGA A;  2FOM B;  1G3E A;  1SR5 C;  2JDI D;  1NRQ H;  2WV4 A;  2XC4 A;  2ZDK A;  1UTP A;  1MAB B;  1A4W H;  1PFX C;  1Y5U T;  1GGD B;  3S7H B;  2XOK D;  3DT0 H;  2EST E;  3D23 A;  1EZU C;  4BNR A;  1YWU A;  2H9H A;  2J9N A;  2Z9I A;  4WJG 2;  2AIQ A;  2R0L A;  2TIO A;  1BHX B;  2SGA A;  2ZGB H;  2BD2 A;  1A5H A;  3A7T A;  1DWB H;  3A82 A;  1ABJ H;  1C2I A;  3A81 A;  4DJZ B;  2FMJ A;  1FON A;  1Q3X A;  2BXU H;  2RDL A;  4IN2 A;  1Q31 A;  2VBC A;  3I77 A;  1G32 B;  2FWW A;  3WY8 A;  2XND D;  1UO6 A;  3SW2 B;  1W14 U;  1NBM E;  1P0S H;  3RMN H;  2CF9 H;  1GWA A;  4FUB A;  4WXI A;  3TU7 H;  1KY9 A;  1K9O E;  1AIX H;  1C5W B;  1IHT H;  1KIG H;  1N6X A;  1OWK A;  3URD A;  1TPP A;  4KTC A;  3SI4 H;  3RXQ A;  4ZCN A;  2C8Y B;  3F1S B;  1MH0 A;  2AS9 A;  4K2Y A;  2FEQ H;  2VWL A;  3PV4 A;  1CA0 B;  2NU3 E;  4FUG A;  2J95 A;  2GCT B;  1T8N A;  1O35 A;  1YCP M;  2ZHE H;  3HK6 B;  4TT3 D;  3ZVG A;  3DCL A;  1NS3 A;  2XBV A;  4ISL A;  4FUH A;  3L33 A;  5DKM A;  1FAX A;  2FI3 E;  1EOJ A;  1K1J A;  1SGY E;  1ZMJ A;  1UCY E;  2YMS D;  4XRN A;  4IMQ A;  1V2P T;  1GJA B;  1VGC C;  4WH6 A;  1ZPC A;  5EXL A;  1NM6 A;  4WXV A;  1GBJ A;  3F2G A;  1PPC E;  2ZF0 H;  2ZHF H;  1UHB B;  1S82 A;  3SGQ E;  2ZG0 H;  3TJV A;  2ZPR A;  5ETX A;  3SU6 A;  4FU7 A;  1OYQ A;  4X0W U;  2ULL A;  3UPE A;  4DVA U;  3T28 A;  5C94 A;  1GHB G;  4DOQ A;  5HKK D;  2ZHD A;  3SO3 A;  1MQ5 A;  3QN7 A;  1AVW A;  1GHA G;  4OS1 A;  1O5C B;  3RXS A;  2PLX A;  3MQK C;  1AQ7 A;  1IHS H;  1IQL A;  1O3I A;  1W0Z U;  2A31 A;  1ZPB A;  4B76 A;  3DD2 H;  3ATK A;  2FI5 E;  4B6F A;  1K0H A;  1SMF E;  1CT2 E;  4MPW A;  5EJL A;  3P95 A;  1A3B H;  1MTU A;  5EPN A;  5L30 H;  2HPQ H;  5AF9 H;  3RM2 H;  3MH6 A;  2WZQ A;  2ZGX H;  1EUF A;  1MZA A;  1FN8 A;  2ZFS A;  2O8U A;  5JPM H;  3GCH B;  3FAN A;  3T62 A;  1UJ1 A;  4XBD A;  3TH3 H;  3VPK A;  1O2L A;  3SN8 A;  3KCG H;  3LH3 A;  5C1U A;  2BLV A;  1TOM H;  2UUK B;  1MKX K;  1GI6 A;  4LK4 A;  3TGI E;  1OWH A;  1ORF A;  3ITI A;  1QY6 A;  4ABJ A;  1YPK H;  1CHO G;  1MAX A;  4FOU C;  4X1S U;  3VG8 A;  1V2W T;  4YM9 A;  7KME H;  4ZXX H;  1O2P A;  2GV6 A;  3A7V A;  4Y6D A;  1NFW A;  1CT0 E;  1O33 A;  2ZDN A;  4U01 A;  5GND A;  1SGQ E;  3UB0 A;  1TON A;  3PWC A;  3A85 A;  1AUJ A;  4RN6 A;  1YPJ H;  3A7W A;  4FUJ A;  3V13 A;  1SB1 H;  1W10 U;  1AND A;  2WPH S;  1O2K A;  3EA7 A;  5LH8 A;  3RUO A;  5CHA C;  1O3H A;  1P12 E;  3D65 E;  2ZNK H;  3OX7 U;  1QL9 A;  3K65 B;  1SGF G;  3DSG A;  4WMD A;  1OWI A;  2C8W B;  4DG4 A;  1UVO A;  3MNX A;  5F8Z A;  3E3T A;  5CE1 A;  3BTQ E;  5CHB A;  3GYL B;  2P3U B;  2HAL A;  3BIU H;  1XX9 A;  3ODF A;  2WYJ A;  3U9A H;  1J9C H;  7LPR A;  2KR7 A;  2ZDV H;  1TRN A;  2HVY B;  2V3O H;  2IPQ X;  1C1N A;  5AHG H;  3MFJ A;  4OS5 A;  4UON A;  1D9I A;  3EGK H;  4HG6 A;  3PTB A;  1GMD F;  2WV5 A;  2ALV A;  3U98 H;  4UD9 H;  4RT0 A;  1IOE A;  2QN5 T;  2QV1 A;  2VIP A;  4XDE A;  2QY0 B;  4EST E;  1IQE A;  4NIV A;  1AN1 E;  1HAP H;  3MH4 A;  1QL8 A;  1E0F D;  5A09 A;  1D3Q B;  4Y8X A;  2ZGC A;  1Y3X A;  2BD8 A;  1BMN H;  1KDQ A;  2ANM H;  5C20 A;  1GI8 B;  1TGB A;  3ZVD A;  4X1N U;  1MD7 A;  4I8J A;  1YPM H;  1LTO A;  1W11 U;  4QT8 C;  3E8L A;  1S0R A;  3AW1 A;  4WWY A;  1KXC A;  1TA2 A;  2A0Q B;  1K22 H; 
#chains in the Genus database with same CATH homology
 1W0K D;  4TSF D;  3H09 A;  5EPY A;  4B73 A;  2V7Q D;  5C0T A;  3L6P A;  3OE7 D;  1H8E D;  5C0U A;  2FOM B;  2JDI D;  4M9F A;  1CU1 A;  2K1Q A;  2F4L A;  2KZ4 A;  1MAB B;  3U1I B;  4A1X A;  1SKY E;  4Q4L A;  2OC1 A;  5FPT A;  2IJD 1;  2XOK D;  3WWF A;  2WPD D;  2K8I A;  1RGQ A;  3DSP A;  3F2F A;  3SU1 A;  4WH8 A;  3SU4 A;  1DXP A;  3SV8 A;  2CK3 D;  3OAA D;  3KNX A;  3VG8 A;  4DT4 A;  2J5U A;  2QF4 A;  3SV6 A;  3LOX A;  3PV5 A;  2KCP A;  5FL7 D;  5DSF A;  4I31 A;  3SU0 A;  1KMH B;  3O8C A;  1DXW A;  2W6I D;  4RI0 A;  1WXR A;  4U01 A;  3KN2 A;  5GND A;  3FOA A;  2VBC A;  5T1V A;  3F2H A;  1OHH D;  2OBO A;  3F3B A;  3UB0 A;  1N1L A;  2GVF A;  1BT7 A;  2XND D;  3SUE A;  5ESB A;  1NBM E;  2FM2 A;  2AHM E;  3DSO A;  4YXW D;  4TYD A;  1W0J D;  2F9V A;  2OC8 A;  3SUF A;  2GGV B;  3NRL A;  2P59 A;  1RTL A;  2OC0 A;  4Q63 A;  5GPI B;  3P8O A;  5H4I B;  3M5N A;  4A92 A;  3M5L A;  3M5O A;  3KEE A;  4KTC A;  2JIZ D;  5F53 A;  4ZCN A;  1EFR D;  2W6J D;  4K8B A;  3SZE A;  2KCO A;  2WHX A;  4OM9 A;  4B71 A;  3FN8 A;  4Z1M D;  1JXP A;  5DN6 D;  4TT3 D;  2IJO B;  1E79 D;  1NS3 A;  3DCL A;  3OEH D;  4FET A;  3SUG A;  2QE7 D;  2KM0 A;  3F0P A;  3FKS D;  3KF2 A;  2JJ1 D;  2OIN A;  2FP7 B;  3LON A;  1A1R A;  4XD7 D;  3RC4 A;  3W1E A;  3SUD A;  1DY9 A;  3E90 B;  3N7D A;  2YMS D;  4NWL A;  2KCY A;  5CHB A;  2M2A A;  2K0Q A;  3SU2 A;  3O8R A;  2KFW A;  2OK5 A;  1DY8 A;  4WH6 A;  4B75 A;  3U1J B;  2QF5 A;  4A1V A;  4ASU D;  3RC5 A;  3F2G A;  5GJ4 B;  1E1R D;  4JMY A;  4I33 A;  2XNI A;  4B6E A;  2KR7 A;  2YMS C;  3WWB A;  2A4G A;  5C17 A;  5IDK A;  3N99 A;  5EQR A;  4WF8 A;  3SYJ A;  1E1Q D;  2L6O A;  5EQQ A;  5ETX A;  3SU6 A;  2LEL A;  5EQS A;  2XCN A;  4NWK A;  2A4R A;  3M5M A;  5CDF E;  5HKK D;  2WV9 A;  2KCA A;  2F9U A;  3PRD A;  4A1T A;  3O8D A;  3OYP A;  4F55 A;  2QV1 A;  2A4Q A;  5B6L A;  1S6L A;  3F0O A;  3OFN D;  5FPS A;  3PRB A;  5FPY A;  1NBM D;  3OEE D;  2JJ2 D;  2XCF A;  3N7E A;  4I32 A;  1BMF D;  4R8T B;  4B6F A;  4B76 A;  1COW D;  3O8B A;  3RC6 A;  5IK2 D;  5EPN A;  2OC7 A;  3LKW A;  2O8M A;  3OTP A;  2YMS B;  3PV2 A;  3EYD A;  3GS9 A;  3ZIA D;  3SU3 A;  2OBQ A;  3SV7 A;  3SV9 A;  2WZQ A;  3P8N A;  2YOL A;  3FO8 D;  4B74 A;  2HLD D;  1H8H D;  2WSS D;  3SU5 A;  3AK5 A;  2F43 B;  1W3C A;  1FX0 B;  3WW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...