2BDBA

Porcine pancreatic elastase complexed with asn-pro-ile and ala-ala at ph 5.0
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Elastase-1
publication title Structural analyses on intermediates in serine protease catalysis
pubmed doi rcsb
total genus 61
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2005-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bdbA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bdbA01
2GCHG 2PGQB 1RIWB 3AAVA 3LGIA 4Y7AA 1IHTH 2ZG0H 3M7QA 3SQEE 1GBCA 1K9OE 1W0YH 2A0QB 3BG8A 2P8OC 2THFB 2FOMB 4VGCB 3SJ9A 6ESTA 3MMGA 2AMDA 1UHBB 1TA2A 2J2UA 1YF4A 1G37A 1GPZA 1N8OC 2BLOA 3ZVFA 1SLXB 1A0LA 3GY2A 4A7IB 1ZMLA 1FIWA 3GYMA 5LPRA 1BTWA 1SGNE 1O38A 4JYVH 1DPOA 2J9NA 2O8TA 2ZQ2A 1H9HE 2XC0A 1FLEE 1ZRKA 1QR3E 1TMUH 2ZCLP 2Q1JA 4SGBE 2VWMA 2HALA 3IG6B 3UOPA 1O2ZA 3NXPA 3DUXH 1V6DA 2ZDMA 2ZGXH 3RP2A 3TJVA 4IMQA 2C8ZB 5G4BA 3GOVB 1C5RA 2OTVA 3STIA 1F0SA 3ZZAA 3SU3A 2ZDNA 1OP8A 1N6XA 1UK2A 4WH6A 1C2KA 1LPZB 1SQOA 4BAHB 4CBOA 1MTUA 1TA6A 2FXRA 1ANCA 2BD9A 1G30B 1FN8A 1S6HA 3MNXA 1OSSA 1O5BB 4THNH 4K60A 1DDJA 1Z1JA 1G9IE 3S9AA 1A5HA 1P2MA 2BDCA 4NFEA 1A5IA 3URDA 1O2WA 4X2WA 1BIOA 2ZO3H 1Y3UA 2BY6X 4A5TS 1BJVA 4BNRA 1TNGA 1JIRA 1W0ZU 4MNYA 2KAIA 1AD8H 5ABWA 2VGCB 1CGIE 5HXFA 1V2RT 5J4QA 3W94A 1UVPA 1K1MA 3L33A 1FAKH 4ISOA 5I46H 3FP7E 1XVMA 1GL1A 1A2CH 1IQEA 4DOQA 4UONA 2TIOA 2BQ6B 1RFNA 4DURA 4DIIH 3JZ2B 5JBBS 4WXIA 3A8CA 1YPHC 3RXIA 1TGSZ 3DFJA 1SGRE 2P95A 5EPNA 3ELAH 1SVPA 4Y71A 1H8IH 1ESTA 1LHEH 1YCPM 1YP9A 4JK6A 2NU2E 1D3QB 3SJKA 1CO7E 3I78A 1O5CB 2BMGB 3SW2B 1B0EA 1VZQH 2B8OH 4NWKA 1ESBA 1XUJA 4LK4A 2OXSA 1LVBA 4KKDA 1GHYH 4GVUA 4KTSA 3MU0A 1QRWA 1GHAG 1V2LT 1NM6A 1OWIA 2QY0B 1C5TA 4DT7B 3QUMP 3LGTA 4ABGA 1HAVB 1C1TA 1SGYE 2GGVB 2A1DB 4CBNA 3DT0H 3JZ1B 3QDZB 5HYOA 1KLTA 1C2IA 1OS8A 3ENSB 1GMDF 4O03A 1O2KA 3ZZCA 5EW2H 2PUQH 1NFXA 1O3IA 1OKXA 4XE4A 1C2DA 4O9VA 1C1SA 1BRCE 1VCQA 1TMBH 1SGQE 3EAJA 3UPEA 6CHAB 1ZHMA 1SGFA 4BAOB 1MKXH 2ALPA 1P02A 2DE8A 2FTLE 3P6ZB 1EZUC 1VJ9U 4M7GA 1O3HA 3TK6A 1NT1A 2Y82A 3LOXA 5T3HA 3ZZDA 4AB9A 2BOHB 3SU5A 3MNCA 4Z0KA 3V13A 4YT6H 1UTOA 4K8BA 3I77A 1U6QA 2HGTH 1CHOF 5EOKA 1MAYA 1IAUA 3PV4A 3SHAH 1FMGA 3QZRA 3SNBA 1C5QA 4YOGA 1Y5UT 1O5EH 2F9NA 3BEIB 4MTBA 2FWWA 1QGFA 4ZH8A 4I33A 3RXQA 1P11E 3NZIA 4X1SU 1MTVA 5JBTA 5B6OA 1GBHA 1C5PA 2FM2A 2WPMS 1DY9A 1C9TA 1WSSH 2FI4E 2WPLS 4I7YH 1Q3XA 5LPFA 3RXMA 4AFZA 1P04A 2FOAA 2XCFA 4ABBA 4MNXA 3EA9A 2ZU2A 2WV4A 3A7VA 3LGWA 4TY7A 4AG1A 2UWOA 1CT4E 5EQRA 1TNLA 2FS8A 2RDLA 1L4ZA 1C5YB 3CENA 3TK5A 1P06A 1TAWA 5HM2A 2JH5D 4MPXA 2UUFB 1S82A 2G52A 2A32A 4XBBA 3KCGH 4ZHAA 1SOTA 2PV9B 3B23B 1ZRBA 2BDYA 2GP9B 4MNWA 4ABEA 1LVMA 4AYYB 1THPB 2YOLA 3E90B 3E0NB 3KN2A 1PQ5A 1Q2WA 2VINA 1GBDA 4YO9A 4GSOA 3A7XA 3M7TA 2J4IA 2CF9H 2WPKS 6GCHG 2V3HH 2J94A 1GJ8B 2HPPH 5FPSA 3Q3XA 5C67A 4XFQA 2A2XH 2BXUH 2XBYA 4SGAE 4K8YA 4BAMB 3WY8A 1SPJA 2EEKA 1EB2A 1AB9C 3O8CA 3VB7A 8KME2 1V2MT 2Z6BD 2O8LA 3FP8E 1NN6A 3ZZ6A 4OGYA 1A61H 1O2RA 5FBEA 1GBBA 3QZQA 3T25A 1SGEE 1GJ7B 1O2JA 1HAIH 1CA0C 3BN9A 1CSOE 1V3XA 1BITA 4DW2U 2F9UA 3F1SB 1SGPE 1PPBH 1EX3A 4D9RA 2HWLB 2ANYA 4I8KA 1G3DA 3ZV8A 1T4VH 1YKTA 1Z8RA 1EP5A 1ETSH 1NFWA 1MTNB 1VGCB 2O8MA 4Y76A 1XM1A 1BDAA 5C1XA 1O36A 3CP7A 2STAE 3MWIU 4CRFA 5T6GA 1BBRH 4GCHG 2TGTA 1TBZH 2HNTC 4X1QU 3P70B 3GCNA 2G8TA 1NC6A 3N7OA 2B5TB 1YLCA 1Z8GA 4LXBH 5JBCS 3ZVBA 2C4FH 4FXGH 1GHBG 1O3EA 2FYRA 5DJ7A 4XBDA 3LC3A 4NG9H 5A0BA 1P2IA 1BHXF 3S7KB 1GMHG 1W2KH 1SHYA 3E8LA 3PLKA 1HAHH 1G36A 4ISHH 1P3EA 4KELA 1YGCH 4NA8A 1C2EA 1JMOH 1QJ6B 1K1IA 3A7WA 4IC6A 3TPIZ 3UFAA 1O2HA 4YOJA 4FVBA 3SJ8A 4E7NA 2WPHS 3VB5A 3AASA 3SI3H 1WTHD 4X6NA 2BDAA 3PO1C 3GCOA 2R2WU 4B2AA 3U98H 1WAYB 1HXFH 4H6SB 5C3NA 2XW9A 2ZU1A 3U1JB 1RIWC 3QGJA 3RXVA 2A4RA 1J8AA 1GI0A 2OQUA 1OWEA 4VGCC 2ZC9H 4FUFA 1BHXB 1G3CA 1P2QA 2A4OA 2FO9A 1GL0E 1ZYOA 3M5MA 1GBKA 2IOTA 1K22H 2UWLA 2ZP0H 4K1SA 1LVOA 3BSQA 3FFGA 3RXSA 2BDBA 7GCHG 1HAYB 2GKVE 1P2JA 3RLYH 1GBLA 1TGCA 2PSYA 4U32A 2OUAA 2TGAA 1C5ZB 2XBWA 4LZ1H 3L6PA 2BXTH 4WXVA 5JB9S 2BYAX 4DIHH 3EE0B 5TJXA 3RXUA 4A6LA 1C1PA 3D49H 4ZUHA 1LKBA 3V3MA 5LGOA 3RMOH 4CRAA 4I8HA 1VITG 2FOEA 3TITA 4CRGA 2BD7A 3BF6H 1H1BA 1MAXA 4WMDA 2PTNA 4FU7A 1EJMA 1CT0E 4K1EA 1WTGH 1LHFH 2OBOA 1TX7A 3MFJA 2PR3A 1W13U 1SG8B 3HKIB 4FUGA 1EAWA 4FUHA 4LOYH 5EU8A 2QXGA 5DP6A 1P8VC 2W3KA 1CT2E 2O9QA 1KXEA 1FY5A 3S69A 3SNDA 2Q6FA 1AZ8A 4DGJA 4Y7BA 2ANKH 3QLPH 1NO9H 4YZUA 1GCTB 3SGQE 2ZFQH 1MH0A 2WINI 1UJ1A 1SQAA 4U2WA 1EPTA 1C1OA 2PSXA 2VGCC 5GCHG 1C5VA 1NZQH 2QV1A 2ZI2H 3FANA 3ITIA 4Y0ZE 4X1PU 1GJBB 1NRQH 1T32A 2FS9A 2FX6A 3UUZA 4ZAEA 2GD4B 2BHGA 5GWZA 1SBWA 1JIMA 5DP4A 1ELEE 3RXEA 2F9BH 5FX6A 2EA3A 4Y79A 1UK4A 1T8MA 3S0NA 1W14U 1TPPA 4XBCA 3P8FA 2ZA5A 2R3UA 2SGFE 2VH6A 1GG6B 4FVDA 1P05A 7LPRA 4NGAH 3GY6A 1UTLM 4WWYA 3RU4T 1S85A 3RXGA 4WF8A 1UTJA 4MLFB 1TWXB 2FTMA 2JETB 2A5IA 1AFEH 2CXVA 3KQEA 4CR5A 3MO6A 1O2GH 1P57B 5E0GA 3SGBE 2WYJA 1O5FH 3SU2A 1TPSA 3M7UA 3MH4A 3ATMA 3BIUH 1S81A 1ELVA 1ZSKA 4D7GA 1BB0B 1BMAA 2FLBH 4ZKSU 2IPHA 3VPKA 2GX4A 1SSXA 3TJUA 3RXPA 2H1UA 3NUMA 1C5SA 1P0SH 5CE1A 3LJOA 2DUCA 2QC2A 4I31A 3HATH 4K2YA 1BCUH 1O5DH 2GMTB 4AGKA 4UD9H 4RKOB 4A1TA 1DWBH 3GICB 2BX3A 2EI6A 5DP3A 6CHAC 4FU9A 1G2LA 1BJUA 5FPYA 3MHWU 1H4WA 1O34A 2AMQA 3TLOA 3P8OA 1DSTA 1SGFG 1ZZZA 2QXIA 1Y3WA 2ZFSA 1OWDA 1AMHA 3I29A 4BTTB 4Y10E 1LKAA 2QYIA 1GBJA 1GI5A 4AORA 1P10A 1C1NA 2O8WA 3ZV9A 3TNSA 1TRYA 2ZNKH 1NRNH 1VITH 3M5LA 2SGQE 1W7GH 4ZHMU 1E37B 1ZTLA 2G5VA 2R2MB 1IQFA 1D9IA 3SN8A 3LIWA 3UWIA 1WQSA 1S0QA 2Z3DA 1QCPA 1ZSLA 5K7RA 1QB1A 4MDSA 4U01A 2SGEE 2STBE 4Y11E 1AY6H 2ZEBA 2CMYA 1O2LA 3RXCA 1C5MD 1GHVH 2XTTB 1UTKA 2FODA 2FESH 2XC4A 5T6DA 4BTIB 3MH7A 1WUNH 3KF2A 1GCDA 3PWBA 4ZHLU 3K9XB 1DLKB 1F5RA 3T29A 3TK9A 1PQ7A 1SGDE 1TYNA 1QBNA 1OYTH 1Y5BT 1N1LA 4D7FA 5C5NA 1Z6JH 1KXBA 2ZZUH 2OC7A 3LC5A 4AOQA 3P92A 2BD4A 4MQAA 1QQ4A 2ZU5A 1CE5A 2AGEX 2A7JA 3A7TA 3MU1A 5TCCA 4ZKRU 2FI3E 4UFGH 2VB0A 4IBLH 3GCHB 2EI8A 1B0FA 2ZHQH 3RUOA 5IYTA 1ID5H 3F9FA 1LPGB 3BTDE 3MNSA 4TWYA 1GHXH 1W12U 1MZAA 3HK6B 1NFUA 4R0IA 4MPUA 5FAHA 1GVKB 2BDIA 1PYTC 2ZDVH 1S83A 2C90B 1ZHRA 1NU9A 4NZLA 3UNQA 2Z9JA 1CVWH 2G55A 1BMMH 5BPEA 2RG3A 1TBRH 1ELFA 1XKBC 4Z6AH 4JYTA 2A45B 1SLWB 1O2QA 2P3FH 4FUBA 3LGVA 3SUDA 4DVAU 2FX4A 1J14A 3VB4A 2BLWA 2Z94A 4CH8B 5EG4A 1MD7A 1V2QT 3E1XB 1ESAA 2A5AA 2CHAB 3TH4H 3LJJA 2OLGA 3M36A 4B75A 1MTNC 1EJAA 2PTCE 2NWNA 4XSKU 1VGCC 2Z9GA 4E06H 5L6NH 2W26A 1MU6B 1KYNA 1YPHE 2D8WA 2FOBA 7ESTE 5EQQA 1K2I1 3OY5U 2ODYB 1GI6A 2FZZA 2H5DA 2YNBA 4X8UH 1QY6A 1A1RA 1GGDB 4BANB 3RXJA 2XXLA 1Y8TA 2FOFA 4OS5A 5F8TA 1MKXK 2FPZA 4K5ZA 3VFEA 2BD3A 1OX1A 1E36B 4J2YB 3VXEH 1A3EH 5JB8S 2NU0E 3U8OH 1HAGE 3GDSA 1TLDA 3S9BA 4A1VA 1QL8A 1K1LA 2OP9A 1LVYA 1FV9A 1RXPA 4D9QA 1BMLA 1QQUA 3OTJE 4TY6A 1EPTB 2RA3A 2ZGHA 4XOJA 1ZPZA 1CHGA 5AFZH 1UTMA 3O8DA 1ZMJA 1C9PA 1BTHH 1ELDE 1G3BA 1QJ7B 3ZVAA 2GVFA 4J1YA 3AAUA 1SB1H 2BDGA 3SU6A 1TE0A 1AE8H 1DWCH 2C8YB 1TONA 4MPVA 4IS5A 5C5OA 3ZZ5A 2FOCA 2P93A 1GI1A 3Q00A 2IJOB 1ZTKA 2F3CE 1FUJA 2BTCE 2UWPA 1CBWC 2WUBA 1AVXA 1TGTA 3FZDA 4B2BA 1GMCF 2A7HA 2B7DH 3VB3A 2VVVA 1DICA 2OQ5A 3S7HB 3OSYA 3VGCB 2Y5HA 2FYQA 1RTKA 2PWXA 1AN1E 4FU8A 3A88A 3MI4A 4B73A 3E0PB 3PTBA 1EP6A 1RRKA 2BZ6H 3C1KA 1SFQB 4B76A 4TPYA 2QGRA 4KTUA 2F91A 5E8EH 4JCNA 2Z9LA 3O8RA 1UMAH 1FY1A 1L1NA 1BTYA 1DWDH 2C3SA 2TGDA 1H8DH 3BEUA 4ZROA 1XUFA 1UO6A 1KXFA 4Q80A 1GJDB 2VWNA 2CV3A 2H9EH 4BOHA 2AFQB 5IDKA 4ISLA 2CGAA 2B9LA 1P2OA 1P9SA 1L1JA 5A8XA 3ZZBA 3SU1A 1UCYH 2EC9H 2Y6TA 1O3MA 1PPEE 2JKHA 4R8TB 1GJCB 1YPMH 1Z7KA 5ESBA 4FUIA 3VEQB 2BD2A 3ATKA 1FPHH 1IOEA 3FZZA 2P3UB 1TALA 4A92A 1BTPA 3OYPA 1AKSB 5EGMA 3TGIE 1XX9A 6LPRA 1FNIA 1SC8U 1GCTC 1V2PT 1QRZA 2AERH 3E6PH 3A81A 1RTLA 1T8LA 4OGXA 2QCYA 1MU8B 1N8OB 1KXDA 1THSH 1JBUH 3M5NA 2QXJA 1FXYA 1OPHB 4X6PA 1UTPA 1O3PB 2ZHDA 3TIUA 4YT7H 5DP7A 4DY7B 4IN2A 2UUKB 3A82A 1PJPA 1MQ6A 2ZTXA 4OS4A 1YCPH 3TGKE 3U8RH 3F9HA 1XKAC 2AGGX 3U9AH 1GBTA 1OWHA 1Z8IB 3M35A 3SOSA 2ZGJA 1NRPH 2FLRH 8ESTE 5A2MH 1BMNH 1MCVA 4FUJA 1BBRK 1W8BH 1FZZA 5F03A 1BTXA 4GLYA 5TCAA 2GCTB 4CHAB 2XC5A 2WPJS 3D65E 2G51A 3PMHB 1GG6C 2B0FA 2ZFTA 1Z1IA 2ZHEH 5DGJA 2P16A 1W7XH 1TNKA 3F9EA 3CS0A 3P17H 3SORA 5PTPA 1FIZA 1GMDG 3BTTE 3PMAB 1KTTB 1O3BA 4ISIH 2V3OH 1TRNA 1UTQA 3URCA 2GTBA 4B74A 1A0HB 3L3TA 2ANWA 3RM2H 2PGBB 4HZHA 3T27A 2A5KA 1ZMNA 3TJNA 1O3FA 1VR1H 3DA9B 5JPMH 1S5SA 3RXLA 3GDUA 3T28A 4GPGA 4KGAA 1E35B 4IC5A 4JZFH 3SV7A 1DE7H 1V2KT 2ODPA 1Y3VA 3ATIA 4GUXA 4WVPE 9LPRA 2HNTE 2GMTC 3ATWA 1SGTA 2BDHA 1HV7A 2NU1E 2ZFFH 5GJ4B 3FP6E 2W3IA 5FCKA 3EGKH 3GY3A 1CHOG 1Y5AT 1ARCA 2Z9KA 3LGUA 1EATA 1INCA 1EOJA 1AQ7A 4DJZB 3U8TH 1E0FD 5F8ZA 2F9OA 3P95A 1GI8B 2KAIB 4A1XA 1AHTH 4TYDA 1CA8B 4AN7A 4BXWA 2ZU4A 1HAPH 2BY8X 2XYAA 3QK1A 1D6WA 5A0AE 2WYGA 5FHTA 4MNVA 4YTAA 1JOUB 3DD2H 2HOBA 1KLIH 1V2WT 1HIAA 2ZGBH 3SBKA 3SJIA 1F5LA 4WH8A 1XUKA 4DG4A 3ZVCA 2R9PA 1F92A 1C4U2 5E0HA 2SFAA 2ZWLH 1Y3YA 1O32A 3HGPA 1T7CA 3S9CA 2BVXH 5CHAB 3P8GA 1IHSH 1O39A 1PPCE 4NIVA 1B5GH 1GBFA 1HRTH 2RCEA 4ZXYH 3K6ZA 4JZ1A 1K28D 3OY6U 1WYKA 3ZZ9A 1TOCB 2PHBA 1EZQA 1MMJN 2ZIQH 3IWMA 4KP0A 2AH4X 3RXBA 1WOFA 3UQOA 3HKJB 2VIOA 5I25A 1GBIA 4MPWA 1NY22 3ATLA 1GDQA 4Y8YA 1NS3A 4I8LA 2BQWB 3BTGE 2XBVA 3QN7A 3KHVA 5DPAA 3ZVGA 1XUGA 2ILNA 3EQ0H 2ZPSA 5EODA 3TU7H 2QAAA 3HPTB 1YPGH 3MU4A 1GVZA 3A89A 3T26A 1MTWA 5DP9A 5F6MA 1O0DH 1ELGA 1TNHA 3LH3A 1O2VA 2J95A 4Q7ZA 1AIXH 2QF0A 1GJ5H 4ZKOU 1HFDA 2QN5T 1K21H 4NA9H 3UR6A 2BX4A 1QBOA 2R0KA 3TVJB 3T5FH 3AVZA 1MKWH 4Y0YE 1C1QA 1G2MA 1IQMA 1THRH 1VJAU 2GCHF 4FUEA 4Q2KA 2VVUA 2PLXA 3NWUA 1IQNA 1ELTA 3H7TA 3SZNA 1SOZA 1TOMH 2ZTYA 2G00A 1A7SA 5HMAA 2C8XB 1VCPA 2OC8A 1O2IA 1TQ0B 1KLJH 1O3CA 1V2TT 2W7UA 3CS7A 5FBIA 1LHCH 3F68H 4NA7A 1KDQA 1C4Y2 5DKMA 1DVAH 1HAVA 2NU3E 3RXHA 5E0JA 1P03A 1RS0A 1OOKB 2ZU3A 2P94A 1YLDA 4ASHA 1GVLA 5E2OA 1NPMA 3SO3A 1GGDC 2ZCKP 1GI2A 1LTOA 3BTKE 1TNIA 3LPRA 5JYIA 3Q76A 1O2TA 1Z6EA 2PW8H 4NWLA 1XUHA 3VXFH 4AFSA 1O2YA 3ZYDA 4YOIA 1C2LA 1A5GH 4ISNA 1K1OA 2VIQA 4K3JA 1D3TB 2VH0A 3RXFA 1D3DB 4X0WU 2UUJB 2VWOA 1NROH 3EA8A 5DP8A 3MNBA 2Z3CA 1EPTC 1IQKA 1KSNA 1TPAE 1ZSJA 4HFPB 4INHA 5T6FA 3A87A 1EZSC 1V2JT 1ZGIA 5ETXA 4CRDA 1J17T 1RTFB 1DY8A 1BZXE 1MD8A 2Y5FA 2HNTF 3BV9B 2QXHA 1TABE 1ELAA 1QURH 2BVSH 2H9TH 4JK5A 2W5EA 4X8VH 4CRBA 2Z9IA 2AEIH 3O8BA 1O37A 2ZF0H 5L2YH 4D8NA 1V2VT 3NK8A 1AVGH 3HGNA 2GDDA 3MH6A 1O2SA 1O2UA 2J38A 3MO9A 3QWCH 4JZIA 3VGCC 2GZ8A 1QTFA 5GPIB 5L30H 1HJ9A 1YPJH 1O2OA 3BTHE 1L1GA 1HLTH 2D1JA 3TGJE 1HBTH 1ZPBA 3RDZA 1H9LB 5EXMA 2OC0A 1SGIB 3QGNB 3ZYEA 3RXKA 3V7TA 1TQ7B 2I6QA 2BM2A 5DP5A 2TPIZ 1ANDA 2H6MA 4NCYA 1BTZA 3T62A 1GJ4H 3UY9A 3K65B 4OS6A 1GI7B 1BOQA 2PFEA 2V35A 1FONA 2F9VA 3C27B 1QA7A 1GHAF 1TGNA 3MO3A 2ZTZA 1N6YA 2GT7A 1FPCH 1JWTA 2FEQH 4AFUA 3SNCA 4HTCH 2BY9X 1SMFE 5FXLA 4ABIA 3H5CB 2OCVB 1DXWA 8LPRA 1GI4A 2BVRH 4JZEH 5C20A 1PQAA 1C5NH 1F7ZA 3QTVH 3M61U 4WJG2 2TGPZ 1F0RA 3KQBA 2A4GA 1AUTC 3RC5A 3V12A 2P3TB 1DT2A 4TPIZ 1C2MA 2ZCHP 2UUYA 1QNJA 2ZFPH 1V2OT 4AB8A 4Y8ZA 1YYY1 1HIAB 1MBQA 5A8ZA 3LH1A 5SGAE 1SI5H 1GJAB 1ZJKA 1C5UA 2EI7A 5C2ZA 3M5OA 1EOLA 2ZHFH 3RC6A 1PPHE 1SFIA 1AFQB 1HYLA 3PB1E 5AF9H 3BIVH 2AIQA 1A3BH 1S6FA 1AO5A 1L0ZA 3A83A 4BXSA 1TMTH 3FVFB 1QFKH 4DCDA 1IQLA 1TIOA 3BTME 3KIDU 3OU0A 3RC4A 2GCTC 4CHAC 1O3DA 4KTCA 1T31A 2Z7FE 1GJ6A 2WUCA 1DXPA 3R0FA 1AUJA 1WU1A 4MVNA 1T4UH 3UQVA 1BQYA 5AVDA 1ACBE 1ZHPA 3PWCA 3DFLA 1J9CH 1GDNA 1TBQH 4GAWA 3T2NA 1E38B 2BZAA 4CR9A 4X2YA 2ZDAH 3GY7A 1O2PA 2ANMH 1MQ5A 4UE7H 2CF8H 2F83A 2ZDLA 4X6MA 3U69H 2LPRA 2G4TA 1ETRH 1K1JA 1RJXB 4I8JA 3RMNH 1V2UT 1DFPA 2FOHA 1M9UA 1SLUB 3RMMH 1LQEA 2GZ7A 4I32A 5K0HA 3GY8A 3SV9A 4E05H 3MH5A 4FUDA 1FQ3A 4JZDH 1C5XB 2FP7B 1XXDA 4UFDH 1DITH 1F0UA 2CJIA 2HRVA 3PROA 1YM0A 1ANEA 1AZZA 1PPGE 1P3CA 3SQHE 1YC0A 3Q77A 2AMPA 1WV7H 1EXFA 1OP2A 2ZPQA 1HUTH 1GHWH 3SI4H 6GCHF 5C1UA 1O3LA 4X8SH 4ESTE 3ZVDA 1TPOA 5GDSH 1LHDH 1T8NA 1YPKH 1O33A 1MUEB 5JDUB 2H5CA 3BG4B 1P2NA 3Q3YA 2W7SA 3AW0A 1K1NA 4YLUA 1D4PB 1XVOA 4UDWH 4PROA 1DANH 1UVTH 3PMJA 5DK1A 3RXTA 1KDQB 5JBAS 1P2KA 4O3UA 4YLQH 1CGHA 1S0RA 5DG6A 1P09A 1FY4A 3SHCH 1PYTD 1FI8A 2PKSB 1YBWA 1UCYK 2K1QA 2ZDKA 1HDTH 3BTEE 5CHAC 2BQ7B 1OYQA 3UTUH 1C2HA 3UNRA 3UOUA 2VIDA 4HI3A 4D76A 4F4OC 1GBEA 2OC1A 1Y3XA 2TRMA 1O3JA 1ZJDA 3PTNA 5ESTE 5L2ZH 2H9HA 1ETTH 5EPYA 1O2NA 1YPLH 1AWHB 2ZHWH 2G5NA 3BEFB 1HJAB 1ORFA 2M5TA 3F9GA 4UFFH 2FOGA 1XXFA 2JH0D 4GCHF 4B71A 4JYUH 2ZGCA 4Y6DA 4ABAA 1SQTA 5HM9A 1KXAA 1O31A 2Z3EA 3UREA 1OP0A 1OWKA 3A8AA 1VCWA 1YCPK 1PFXC 4OS1A 1GHBF 4RSPA 1SLVB 2H2ZA 2P59A 4RN6A 3LONA 5A8YA 3MOCA 3KGPA 1AU8A 1GMHF 1JXPA 1EQ9A 1C4V2 1F5KU 1C5WB 1DX5M 1FN6A 1TGBA 1ANBA 4INLA 1MZDA 3MTYA 3SNAA 2SGDE 1KY9A 2BY7X 5EXNA 2P8OB 2VIVA 1QA0A 3K2UA 4IMZA 3ZZ7A 1BT7A 2FDAA 1O2XA 3E91A 1SR5C 3ZVEA 4BTUB 1W11U 3RXDA 1P01A 4ABFA 3SUEA 5C1YA 2BLQA 5EW1H 3UR9A 7KMEH 5GIBA 2Q6DA 1XMNB 3DHKH 5LPEA 4Q7YA 3SU0A 2XBXA 3V0XA 4X2XA 4NIWA 1LCYA 1C1MA 1C2GA 2QF3A 3RM0H 1O5AB 2D2DA 1EKBB 1YPEH 2SNWA 1QBVH 7GCHF 3ESTA 1C1VH 4NSVA 2NU4E 3A85A 1O3NA 2BB4A 2BY5X 4X6OA 1G32B 1CQQA 2AIPA 3SGAE 2VVCA 1TB6H 3PLPA 1IQIA 1HB0B 4ABDA 5A09A 2VIWA 1AWFH 2PKAA 1Q31A 1SHHB 2AS9A 3D62A 2HPQH 4CH2B 2GDEH 1O35A 3A86A 1EAIA 1ZR0A 4H6TA 1TX6A 4BAQB 2HLCA 1VITF 1AVWA 4B1TA 3RLWH 4O3TA 1V2ST 3P8NA 1P9UA 3SUGA 1OWJA 2JETC 3E16B 1IQHA 1GJ9B 3SV6A 1JRTA 8GCHF 4ZKNU 2GV6A 1SGCA 4H4FA 3UWJH 1J15A 4ZXXH 1ELBA 2G4UA 3GY4A 1FJSA 3UNSA 3QTOH 2XWAA 1C2FA 2JH6D 3LU9B 3VB6A 3F6UH 1HCGA 1UCYE 3GDVA 1JRSA 1NTPA 1HXEH 1NRRH 1GMCG 5GXPA 2I6SA 1IQJA 3LDXH 2Y5GA 2SGAA 1ZOMA 2ASUB 4MG3A 2HVXA 3EYDA 1LO6A 1QB6A 1O3KA 1LHGH 2A7CA 4FUCA 4WMFA 5GCHF 1UVOA 3RMLH 4O97A 2ESTE 3NCLA 4AYVB 4X1RU 1UHBA 1ARBA 1PPZA 5J4SA 4E7RG 1B7XB 1LDTT 1LMWB 4CRCA 2RA0A 2ZKSA 1DSUA 1L4DA 2AYWA 1F2SE 1LQDB 2ZQ1A 1F0TA 1D3PB 1DLEA 3KNXA 3W95A 3OX7U 3RU4E 5CMXH 3KQDA 1BRBE 4AX9H 5AHGH 2VNTA 3M3VA 1TRMA 3GCTF 2VU8E 2ZECA 3TH2H 4IN1A 5A0CA 1FDPA 2XCNA 1SL3A 1O2MA 2C93B 5FCRA 1O30A 1QB9A 2A31A 1DS2E 2J92A 2SNVA 2Y81A 4GHQA 1EJNA 1EUFA 3E3TA 3LKWA 1ABIH 2GZ9A 1X7AC 4INKA 3PMBB 3A8BA 4QT8C 4NIYA 4F49A 5E2PA 1MKWK 3LT3A 1V2NT 4ZMAH 2YNAA 1CBWB 3UIRA 3ODDA 4BAKB 2VJ1A 4ABJA 2DE9A 1ZGVA 2XNIA 1HNEE 3MU8A 4Y8XA 4YM9A 2ZFRH 5F8XA 4OS2A 3GCHC 1WBGB 2AGIX 1BTUA 2Y80A 4X2VA 1KIGH 1RGQA 4B2CA 2XWBI 1C1UH 1D6RA 2V6NA 1BBRE 1EASA 1ZLRA 3TH3H 1HGTH 4IW4E 4NIXA 1AFQC 1HPGA 1W10U 3ODFA 3H7OA 1QJ1B 3B8JA 3M37A 4RKJB 3SUFA 4U30A 1C1WH 5HGGA 3A7YA 1L2EA 1QIXB 3HK3B 3RXOA 3NKKA 3KEEA 1BRUP 4UEHH 2GT8A 1GDUA 1QRXA 8GCHG 1O5GH 4AGJA 3PM3A 4UFEH 2ULLA 5FPTA 1A0JA 2A4QA 2FI5E 1FY3A 5EXLA 3GY5A 4OS7A 2SGPE 1C5LH 1HJ8A 5EQSA 1HAZB 1K1PA 2FIRH 3NPSA 1A46H 4NSYA 2F9PA 1TFXA 2ZPRA 3AW1A 3SNEA 2FMJA 1GI9B 3FAOA 1IQGA 3BTWE 2BOKA 1UVUH 5DO4H 4AFQA 2QIQA 2CHAC 4XDEA 3RU4D 2QA9E 4AZ2B 1W3CA 2J34A 4K1TA 1GBAA 2D26C 3M3TA 1PQ8A 1DUAA 3G01A 1H9IE 4NZQA 1ABJH 1CGJE 2Q6GA 1ZPCA 2VIPA 3SV8A 2C8WB 3KQCA 3PYHA 2Y7XA 4AG2A 3QX5H 1NFYA 1NESE 1P12E 1T8OA 2ODQA 2BD5A 3ZZ3A 1E34B 1EB1H 1RD3B 5H4IB 3D23A 3BTFE 1QHRB 2G81E 1AI8H 2PUXB 1DM4B 1Z8JB 1EZXC 2GV7A 1GI3A 3RXAA 4ABHA 3QO6A 1AB9B 2Y7ZA 5BRRE 1OXGA 1C1RA 1NU7B 2IN2A 1EAUA 3STJA 1ZTJA 3A80A 4K69A 4IGDA 3MYWA 3BG4C 4I8GA 1O3GA 3TNTA 3GCTG 3LGYA 4WMEA 1CA0B 2BD8A 5AFYH 3U1IB 1C5OH 2OINA 3A84A 3SV2H 3RXRA 1MCTA 1TX8A 3GISB 5FX5A 4WY3A 2PKSC 1CU1A 2ALVA 2OBQA 3IITA 1PPFE 2V0BA 2PKAB 1FAXA 1GHZA 1G3EA 3R3GB 1BUIA 1BA8B 1TNJA 1UK3A 3M3SA 1C2JA 3EDXB 1Z71A 1UTNA 3ZZ8A 3TJOA 1NRSH 1WCZA 2XRCA 1DWEH 4TWWA 1HAXB 2CN0H 1AGJA 3B9FH 2BLVA 1HJAC 1FY8E 1QL9A 1GBMA 1AE5A 2A2QH 1LPKB 3K6YA 4Q7XA 1GWAA 1QL7A 1UVSH 1KXCA 2VWLA 3ZZ4A 4YESB 1DUEA 1AKSA 2LNCA 1MBMA 2R0LA 1EAXA 2WPIS 4CREA 2TBSA 2R3YA 2WV5A 1DOJA 4HGCA 3SJOA 3A7ZA 1S84A 3EA7A 3BTQE 3MU5A 5LH8A 2O8UA 1ELCA 1XUIA 1O3AA 4X8TH 3PLBA 3A8DA 1Y59T 1BRAA 1O3OA 4X1NU 1WQVH 4GHTA 1MTSA 9ESTA 4NFFA 1A4WH 1J16A 4H42U 4LZ4B 3KL6A 3Q3KA 1HAOH 4JMYA 3SU4A 3PO1B 3GYLB 2OD3B 1KTSB
chains in the Genus database with same CATH superfamily
2GCHG 2PGQB 1RIWB 3AAVA 3LGIA 4Y7AA 1IHTH 2ZG0H 3M7QA 3SQEE 1GBCA 1K9OE 1W0YH 2A0QB 3BG8A 2P8OC 2THFB 2FOMB 4VGCB 3SJ9A 6ESTA 3MMGA 2AMDA 1UHBB 1TA2A 2J2UA 1YF4A 1G37A 1GPZA 1N8OC 2BLOA 5DSFA 3ZVFA 1SLXB 1A0LA 3GY2A 4A7IB 1ZMLA 1FIWA 3GYMA 5LPRA 1BTWA 1SGNE 1O38A 4JYVH 1DPOA 2J9NA 2O8TA 2ZQ2A 1H9HE 2XC0A 1FLEE 3VG8A 1ZRKA 1QR3E 1TMUH 2ZCLP 2Q1JA 4SGBE 2VWMA 2HALA 3IG6B 3UOPA 1O2ZA 3NXPA 3DUXH 1V6DA 1VKYA 2ZDMA 2ZGXH 3RP2A 3TJVA 4IMQA 4Z1MD 3F3BA 2C8ZB 5G4BA 3GOVB 1C5RA 2OTVA 3STIA 1F0SA 3ZZAA 3SU3A 3DSOA 2ZDNA 1OP8A 1N6XA 1UK2A 4WH6A 1C2KA 1LPZB 1SQOA 4BAHB 4CBOA 1MTUA 1TA6A 2FXRA 1ANCA 2BD9A 1G30B 1FN8A 1S6HA 3MNXA 1OSSA 1O5BB 2KFWA 4THNH 4K60A 1DDJA 1Z1JA 1G9IE 3S9AA 1A5HA 2AHME 1P2MA 2BDCA 4NFEA 1A5IA 3URDA 1O2WA 4X2WA 1BIOA 2ZO3H 1Y3UA 2BY6X 4A5TS 4Q63A 1BJVA 4BNRA 1TNGA 1JIRA 1W0ZU 4MNYA 2KAIA 1AD8H 5ABWA 2VGCB 1CGIE 5HXFA 1V2RT 5J4QA 3W94A 1UVPA 1K1MA 3L33A 1FAKH 4ISOA 5I46H 3FP7E 1XVMA 1GL1A 1A2CH 1IQEA 4DOQA 4UONA 2TIOA 2BQ6B 1RFNA 4DURA 4DIIH 3JZ2B 5JBBS 1YLNA 4WXIA 3A8CA 1YPHC 3RXIA 1TGSZ 3DFJA 1SGRE 2P95A 5EPNA 3ELAH 1SVPA 4Y71A 1H8IH 1ESTA 1LHEH 1YCPM 1YP9A 4ACAA 4JK6A 1E1RD 2NU2E 1D3QB 3SJKA 1CO7E 3I78A 1O5CB 2BMGB 3SW2B 1B0EA 1VZQH 2B8OH 4NWKA 1ESBA 1XUJA 4LK4A 2OXSA 1LVBA 4KKDA 1GHYH 4GVUA 4KTSA 3MU0A 1QRWA 1GHAG 1V2LT 1NM6A 1OWIA 2QY0B 1C5TA 5C0UA 4DT7B 3QUMP 3LGTA 4ABGA 1HAVB 3OE7D 1C1TA 1SGYE 2GGVB 2A1DB 4CBNA 3DT0H 3JZ1B 3QDZB 5HYOA 1KLTA 5KECA 3PRBA 1C2IA 1OS8A 3ENSB 1GMDF 4O03A 1O2KA 3ZZCA 5EW2H 2PUQH 1NFXA 1O3IA 1OKXA 4XE4A 1C2DA 4O9VA 1C1SA 1BRCE 1VCQA 1TMBH 1SGQE 3EAJA 3UPEA 6CHAB 1ZHMA 1SGFA 4BAOB 1MKXH 2ALPA 2EY4C 1P02A 2DE8A 2FTLE 3P6ZB 1EZUC 1VJ9U 4M7GA 4TSFD 1O3HA 3TK6A 1NT1A 2Y82A 3LOXA 5T3HA 3ZZDA 5HIYA 4AB9A 2BOHB 3SU5A 3MNCA 4Z0KA 3V13A 4YT6H 1UTOA 4K8BA 3I77A 5C94A 1U6QA 2HGTH 1CHOF 5EOKA 1MAYA 1IAUA 3PV4A 3SHAH 1FMGA 3QZRA 3SNBA 1C5QA 4YOGA 1Y5UT 1O5EH 5CDFE 2F9NA 3BEIB 4MTBA 2FWWA 1QGFA 4ZH8A 4I33A 3RXQA 1P11E 3NZIA 4X1SU 1MTVA 5JBTA 5B6OA 1GBHA 1C5PA 2FM2A 2J98A 2WPMS 1DY9A 1C9TA 1WSSH 2FI4E 2WPLS 4I7YH 1Q3XA 5LPFA 3RXMA 4AFZA 1P04A 2FOAA 2XCFA 4ABBA 4MNXA 3EA9A 2ZU2A 2WV4A 3A7VA 3LGWA 4TY7A 4AG1A 2UWOA 1CT4E 5EQRA 1TNLA 2FS8A 2RDLA 4AC9A 1L4ZA 1C5YB 3CENA 3TK5A 1P06A 1TAWA 5HM2A 2JH5D 4MPXA 2UUFB 1S82A 2G52A 2WHXA 2A32A 2WPDD 4XBBA 3KCGH 4ZHAA 1SOTA 2PV9B 4M9FA 3B23B 1ZRBA 2BDYA 2GP9B 4MNWA 4ABEA 1LVMA 4AYYB 1THPB 2XOKD 2YOLA 2QE7D 3E90B 2V3MA 3E0NB 3KN2A 1PQ5A 1Q2WA 2VINA 1GBDA 4YO9A 4GSOA 3A7XA 3M7TA 2J4IA 2CF9H 2WPKS 6GCHG 4DT4A 2V3HH 2J94A 1GJ8B 2HPPH 5FPSA 3Q3XA 5C67A 4XFQA 2A2XH 2BXUH 2XBYA 4SGAE 4K8YA 3UAIC 4BAMB 3WY8A 1SPJA 2EEKA 1EB2A 1AB9C 3O8CA 3VB7A 8KME2 1V2MT 2Z6BD 2O8LA 3FP8E 1NN6A 3ZZ6A 4OGYA 1A61H 1O2RA 5FBEA 1GBBA 2KCAA 3QZQA 3T25A 1SGEE 1GJ7B 1O2JA 1HAIH 1CA0C 3BN9A 1CSOE 1V3XA 1BITA 4DW2U 4P00A 2F9UA 3F1SB 1SGPE 4OM9A 1PPBH 1EX3A 4D9RA 2HWLB 2ANYA 4I8KA 1G3DA 3ZV8A 1T4VH 1YKTA 1Z8RA 1EP5A 1ETSH 1NFWA 1MTNB 1VGCB 2O8MA 4Y76A 1XM1A 1BDAA 5C1XA 1O36A 3CP7A 2STAE 3MWIU 4CRFA 3OTPA 5T6GA 1BBRH 4GCHG 2TGTA 1TBZH 2HNTC 4X1QU 3P70B 3GCNA 2G8TA 1NC6A 3N7OA 1SQRA 2B5TB 1YLCA 1Z8GA 4LXBH 5JBCS 3ZVBA 2C4FH 4FXGH 1GHBG 1O3EA 2FYRA 5DJ7A 4XBDA 3LC3A 4NG9H 5A0BA 1P2IA 1BHXF 3S7KB 1GMHG 2EQNA 1W2KH 1SHYA 3E8LA 3PLKA 1HAHH 1G36A 4ISHH 1P3EA 4KELA 1YGCH 4NA8A 1C2EA 1JMOH 1QJ6B 1K1IA 3A7WA 4IC6A 3TPIZ 3UFAA 1O2HA 4YOJA 4FVBA 3SJ8A 4E7NA 4ZCNA 5DN6D 2WPHS 3PV2A 3VB5A 3AASA 5IK2D 3SI3H 1WTHD 4X6NA 2BDAA 3PO1C 3GCOA 2R2WU 4B2AA 3U98H 1WAYB 1HXFH 4H6SB 5C3NA 2XW9A 1FX0B 2ZU1A 3U1JB 1RIWC 3QGJA 3RXVA 2A4RA 1J8AA 1GI0A 2OQUA 1OWEA 4VGCC 2ZC9H 4FUFA 1BHXB 1G3CA 1P2QA 2A4OA 2FO9A 1GL0E 1ZYOA 3M5MA 1GBKA 2IOTA 1K22H 2UWLA 2ZP0H 4K1SA 1LVOA 3BSQA 3FFGA 3RXSA 2BDBA 7GCHG 1HAYB 2GKVE 1P2JA 5T1VA 3RLYH 1GBLA 1TGCA 2PSYA 4U32A 2OUAA 2TGAA 1C5ZB 2XBWA 2GJGA 4LZ1H 3L6PA 2BXTH 4WXVA 5JB9S 2BYAX 4DIHH 3EE0B 5TJXA 3RXUA 3FKSD 4A6LA 1C1PA 3D49H 4ZUHA 1LKBA 2YMSD 3V3MA 5LGOA 3RMOH 4CRAA 4I8HA 1VITG 2FOEA 3TITA 4CRGA 2BD7A 3BF6H 1H1BA 1MABB 1MAXA 4WMDA 2PTNA 4FU7A 1EJMA 1CT0E 2KX4A 4K1EA 1WTGH 1LHFH 2OBOA 1TX7A 3MFJA 2PR3A 1W13U 1SG8B 3HKIB 4FUGA 1EAWA 4FUHA 4LOYH 5EU8A 2QXGA 5DP6A 4XRNA 1P8VC 2W3KA 1CT2E 2O9QA 1KXEA 1FY5A 3S69A 3SNDA 2Q6FA 1AZ8A 1WDIA 4DGJA 4Y7BA 2ANKH 3QLPH 1NO9H 4YZUA 1GCTB 3SGQE 2ZFQH 1MH0A 5EJLA 2WINI 1UJ1A 1SQAA 4U2WA 1EPTA 1C1OA 2PSXA 2VGCC 5GCHG 4RT0A 1C5VA 1NZQH 2QV1A 2ZI2H 3FANA 3ITIA 4Y0ZE 4X1PU 1GJBB 1NRQH 1T32A 2FS9A 2FX6A 3UUZA 4ZAEA 2J98B 2GD4B 2BHGA 5GWZA 1SBWA 1JIMA 5DP4A 1ELEE 3RXEA 2KR7A 2F9BH 5FX6A 2EA3A 4Y79A 1UK4A 1T8MA 4B6FA 3S0NA 1W14U 1TPPA 4XBCA 3P8FA 2ZA5A 2R3UA 2SGFE 2VH6A 1GG6B 4FVDA 1P05A 7LPRA 4NGAH 3GY6A 1UTLM 4WWYA 3RU4T 1S85A 3DSPA 3RXGA 4WF8A 1UTJA 4MLFB 1TWXB 2FTMA 2JETB 2A5IA 1AFEH 2CXVA 3KQEA 4CR5A 3MO6A 1O2GH 1P57B 5E0GA 3SGBE 2WYJA 1O5FH 2KCYA 1TPSA 3SU2A 3M7UA 3MH4A 3ATMA 3BIUH 1S81A 2J5UA 1ELVA 1ZSKA 4D7GA 1BB0B 1BMAA 2FLBH 4ZKSU 2IPHA 3VPKA 2GX4A 1SSXA 3TJUA 3RXPA 2H1UA 3NUMA 1C5SA 1P0SH 5CE1A 3LJOA 2DUCA 2QC2A 4I31A 3HATH 4K2YA 1BCUH 1O5DH 2GMTB 4AGKA 4UD9H 4RKOB 4A1TA 1DWBH 3GICB 2BX3A 2EI6A 5DP3A 6CHAC 4FU9A 1G2LA 1BJUA 5FPYA 3MHWU 1H4WA 1O34A 2AMQA 3TLOA 3P8OA 1DSTA 1SGFG 1ZZZA 2QXIA 1Y3WA 2ZFSA 1OWDA 1AMHA 3I29A 4BTTB 4Y10E 1LKAA 2QYIA 1GBJA 1GI5A 4AORA 1P10A 1C1NA 2O8WA 3ZV9A 3TNSA 5EJZA 1TRYA 2ZNKH 1NRNH 1VITH 3M5LA 2SGQE 1W7GH 3FOAA 4ZHMU 1E37B 1ZTLA 2G5VA 2R2MB 1IQFA 1D9IA 4FOUC 3SN8A 3LIWA 3UWIA 1WQSA 1S0QA 2Z3DA 1QCPA 1ZSLA 5K7RA 1QB1A 4MDSA 4U01A 2SGEE 2KM0A 2STBE 4Y11E 1AY6H 2ZEBA 2CMYA 1O2LA 3RXCA 1C5MD 1GHVH 2XTTB 1UTKA 2FODA 2FESH 2XC4A 5T6DA 4BTIB 3MH7A 1WUNH 3KF2A 1GCDA 3PWBA 4ZHLU 3K9XB 1DLKB 1F5RA 3T29A 2JJ2D 3TK9A 1PQ7A 1SGDE 1TYNA 1QBNA 4Q4LA 1OYTH 1Y5BT 1N1LA 4D7FA 5C5NA 1Z6JH 1KXBA 2ZZUH 2OC7A 3LC5A 4AOQA 3P92A 2BD4A 4MQAA 1QQ4A 2ZU5A 3DCLA 1CE5A 2AGEX 2A7JA 3A7TA 3MU1A 5TCCA 4ZKRU 2FI3E 4UFGH 2VB0A 4IBLH 3GCHB 2EI8A 1B0FA 2ZHQH 3RUOA 5KGOA 5IYTA 1ID5H 3F9FA 1LPGB 1OHHD 3BTDE 3MNSA 4TWYA 1GHXH 1W12U 1MZAA 3HK6B 1NFUA 4R0IA 4MPUA 5FAHA 1GVKB 2BDIA 1PYTC 2ZDVH 1S83A 2C90B 1ZHRA 1NU9A 4NZLA 3UNQA 2Z9JA 1CVWH 2G55A 5EJ1A 1BMMH 5BPEA 2RG3A 1TBRH 1ELFA 1XKBC 4Z6AH 2PP6A 4JYTA 2A45B 1SLWB 1O2QA 5HIZA 2P3FH 4FUBA 3LGVA 3SUDA 4DVAU 2FX4A 1J14A 3VB4A 2BLWA 2Z94A 4CH8B 5EG4A 3AK5A 1MD7A 1V2QT 3OFND 3E1XB 3F2FA 1ESAA 2A5AA 2CHAB 2LP6A 3TH4H 3LJJA 2OLGA 3M36A 4B75A 2VBCA 1MTNC 1EJAA 2PTCE 2NWNA 4XSKU 1VGCC 2Z9GA 4E06H 5L6NH 2W26A 1MU6B 1KYNA 1YPHE 2D8WA 2FOBA 7ESTE 5EQQA 1K2I1 3OY5U 2ODYB 1GI6A 2FZZA 2H5DA 2YNBA 4X8UH 3F0OA 1QY6A 1A1RA 1GGDB 4BANB 3RXJA 2XXLA 1Y8TA 2FOFA 4OS5A 5F8TA 1MKXK 2FPZA 4K5ZA 3VFEA 2BD3A 1OX1A 1E36B 4J2YB 3VXEH 1A3EH 5JB8S 2NU0E 3U8OH 1HAGE 3GDSA 1TLDA 3S9BA 4A1VA 1QL8A 1K1LA 3N7DA 2OP9A 1LVYA 1FV9A 1RXPA 1SKYE 4D9QA 1BMLA 1QQUA 3OTJE 4TY6A 1EPTB 2RA3A 2ZGHA 4HG6A 4XOJA 1ZPZA 1CHGA 5AFZH 1UTMA 3O8DA 1ZMJA 1C9PA 1BTHH 1ELDE 1G3BA 1QJ7B 3ZVAA 2GVFA 4J1YA 3AAUA 1SB1H 2BDGA 3SU6A 1TE0A 1AE8H 1DWCH 2C8YB 1TONA 4MPVA 4IS5A 5C5OA 3ZZ5A 2FOCA 2P93A 1GI1A 3Q00A 1EFRD 2IJOB 1ZTKA 2F3CE 1FUJA 2BTCE 2UWPA 1CBWC 2WUBA 1AVXA 1TGTA 3FZDA 4B2BA 1GMCF 2A7HA 2B7DH 3VB3A 2VVVA 1DICA 2OQ5A 3S7HB 3OSYA 3VGCB 2Y5HA 2FYQA 1RTKA 2PWXA 1AN1E 4FU8A 3A88A 3MI4A 4B73A 3E0PB 3PTBA 1EP6A 1RRKA 2BZ6H 3C1KA 1SFQB 4B76A 4TPYA 2QGRA 4KTUA 2F91A 5E8EH 4JCNA 2Z9LA 2IJD1 3O8RA 1UMAH 1FY1A 1L1NA 1BTYA 1DWDH 2C3SA 2TGDA 1H8DH 3BEUA 4ZROA 1XUFA 1UO6A 1KXFA 4Q80A 1GJDB 2VWNA 2CV3A 2H9EH 4BOHA 2AFQB 5IDKA 4ISLA 2CGAA 2B9LA 1K0HA 1P2OA 1P9SA 1L1JA 5A8XA 3ZZBA 3SU1A 1UCYH 2EC9H 2Y6TA 1O3MA 1PPEE 2JKHA 4R8TB 1GJCB 1YPMH 1Z7KA 5ESBA 4FUIA 3VEQB 3OAAD 2BD2A 3ATKA 1FPHH 1IOEA 3FZZA 2P3UB 1TALA 4A92A 1BTPA 3OYPA 1AKSB 5EGMA 3TGIE 1XX9A 6LPRA 1FNIA 1SC8U 1GCTC 1V2PT 1QRZA 2AERH 3E6PH 3A81A 1RTLA 1T8LA 4OGXA 2QCYA 3UB0A 1MU8B 1N8OB 1KXDA 1THSH 1JBUH 3M5NA 2QXJA 1FXYA 1OPHB 4X6PA 1UTPA 1O3PB 2ZHDA 1BMFD 3TIUA 4YT7H 5DP7A 4DY7B 4IN2A 2UUKB 3A82A 1PJPA 1MQ6A 2ZTXA 4OS4A 1YCPH 3TGKE 3U8RH 3F9HA 1XKAC 2AGGX 3U9AH 1GBTA 1OWHA 1Z8IB 3M35A 3SOSA 2ZGJA 1NRPH 2FLRH 8ESTE 5A2MH 1BMNH 1MCVA 4FUJA 1BBRK 1W8BH 1FZZA 5F03A 1BTXA 4GLYA 5TCAA 2GCTB 4CHAB 2XC5A 3NRLA 2WPJS 3D65E 5F53A 2G51A 3PMHB 1GG6C 2B0FA 2ZFTA 1Z1IA 2ZHEH 5DGJA 2P16A 2M2AA 1W7XH 2XNDD 1TNKA 3F9EA 3CS0A 3P17H 2JDID 3SORA 5PTPA 1FIZA 1GMDG 3BTTE 3PMAB 1KTTB 1O3BA 4ISIH 2V3OH 1TRNA 1UTQA 3URCA 2GTBA 4B74A 1A0HB 3L3TA 2ANWA 3RM2H 2PGBB 4HZHA 3T27A 2A5KA 1ZMNA 3TJNA 1O3FA 1VR1H 3DA9B 5JPMH 1S5SA 3RXLA 3GDUA 3T28A 4GPGA 4KGAA 1E35B 4IC5A 4JZFH 3SV7A 1DE7H 1V2KT 2ODPA 1Y3VA 3ATIA 4GUXA 4WVPE 9LPRA 2HNTE 2GMTC 3ATWA 1H8ED 1SGTA 2BDHA 1HV7A 2NU1E 2ZFFH 5GJ4B 3FP6E 2W3IA 5FCKA 3EGKH 3GY3A 1CHOG 1WXRA 1Y5AT 1ARCA 2Z9KA 3LGUA 1EATA 1INCA 1EOJA 1AQ7A 4DJZB 3U8TH 1E0FD 5F8ZA 2F9OA 3P95A 1GI8B 2KAIB 4A1XA 1AHTH 4TYDA 1CA8B 4AN7A 4BXWA 2ZU4A 1HAPH 2BY8X 2XYAA 3QK1A 4TT3D 1D6WA 5A0AE 2WYGA 5FHTA 4MNVA 4YTAA 1JOUB 3DD2H 2HOBA 1KLIH 1V2WT 1HIAA 1KMHB 2ZGBH 3SBKA 3SJIA 1F5LA 4WH8A 1XUKA 4DG4A 3ZVCA 2R9PA 1F92A 1C4U2 5E0HA 2SFAA 2ZWLH 1Y3YA 1O32A 3HGPA 1T7CA 3S9CA 2BVXH 5CHAB 2IPQX 3P8GA 1IHSH 1O39A 1PPCE 4NIVA 1B5GH 1GBFA 1HRTH 2RCEA 4ZXYH 3K6ZA 4JZ1A 1K28D 3OY6U 1WYKA 3ZZ9A 1TOCB 2PHBA 1EZQA 1MMJN 2ZIQH 3IWMA 4KP0A 2AH4X 3RXBA 1WOFA 3UQOA 3HKJB 4I86A 2VIOA 3SYJA 5I25A 1GBIA 4MPWA 1NY22 3ATLA 1GDQA 3PV5A 4Y8YA 1NS3A 4I8LA 2BQWB 3BTGE 2XBVA 3QN7A 3KHVA 5DPAA 3ZVGA 1XUGA 2ILNA 3EQ0H 2ZPSA 5EODA 3TU7H 2QAAA 3HPTB 1YPGH 2F43B 3MU4A 2HLDD 1GVZA 3A89A 3T26A 1MTWA 5DP9A 5F6MA 1O0DH 1ELGA 1TNHA 3LH3A 1O2VA 2J95A 3KYFA 3GS9A 1AIXH 4Q7ZA 1UW7A 2QF0A 1GJ5H 4ZKOU 1HFDA 2QN5T 1K21H 4NA9H 3ZIAD 3UR6A 2BX4A 1QBOA 2CK3D 2R0KA 3TVJB 3T5FH 4YXWD 3AVZA 1MKWH 2WZQA 4Y0YE 1C1QA 1G2MA 1IQMA 1THRH 1VJAU 2GCHF 4FUEA 4Q2KA 2VVUA 2PLXA 3NWUA 1IQNA 1ELTA 3H7TA 3SZNA 1SOZA 1TOMH 2ZTYA 3FN8A 2G00A 1A7SA 5HMAA 2C8XB 1VCPA 2OC8A 1O2IA 2L74A 1TQ0B 1KLJH 1O3CA 1V2TT 2W7UA 3CS7A 5HKKD 5FBIA 1LHCH 3F68H 4NA7A 1KDQA 1C4Y2 5DKMA 1DVAH 1HAVA 2NU3E 3RXHA 5E0JA 1P03A 1RS0A 1OOKB 2ZU3A 2P94A 1YLDA 4ASHA 1GVLA 5E2OA 1NPMA 3SO3A 1GGDC 2ZCKP 1GI2A 1LTOA 3BTKE 1E1QD 1TNIA 3LPRA 5JYIA 4F48B 3Q76A 3N7EA 1O2TA 1Z6EA 2RDEA 2PW8H 4NWLA 1XUHA 3VXFH 4AFSA 1O2YA 3ZYDA 4YOIA 1C2LA 1A5GH 4ISNA 1K1OA 2VIQA 4K3JA 1D3TB 2VH0A 3RXFA 1D3DB 4X0WU 2UUJB 2VWOA 1NROH 3EA8A 5DP8A 3MNBA 2Z3CA 1EPTC 1IQKA 1KSNA 1TPAE 1ZSJA 4HFPB 4INHA 5T6FA 3A87A 1EZSC 1V2JT 1ZGIA 5ETXA 4CRDA 1J17T 1RTFB 1DY8A 1BZXE 1MD8A 2Y5FA 2HNTF 3BV9B 2QXHA 1TABE 1ELAA 1QURH 2BVSH 2RFKC 2H9TH 2YMSB 4JK5A 2W5EA 4X8VH 4CRBA 2Z9IA 2AEIH 3O8BA 1O37A 2ZF0H 5L2YH 4D8NA 1V2VT 3NK8A 1AVGH 3HGNA 2GDDA 3MH6A 1O2SA 1O2UA 2J38A 3MO9A 3QWCH 4JZIA 3VGCC 2GZ8A 1QTFA 5GPIB 5L30H 1HJ9A 1YPJH 1O2OA 3BTHE 1L1GA 1HLTH 2D1JA 3TGJE 4B6EA 1HBTH 1ZPBA 3RDZA 1H9LB 5EXMA 2OC0A 1SGIB 3QGNB 3ZYEA 3RXKA 3V7TA 1TQ7B 2I6QA 2BM2A 5DP5A 2TPIZ 1ANDA 2H6MA 4NCYA 1BTZA 3T62A 1GJ4H 3UY9A 3K65B 2KZ4A 4OS6A 1GI7B 1BOQA 2PFEA 2V35A 1FONA 2F9VA 3C27B 1QA7A 1GHAF 1TGNA 3MO3A 2ZTZA 1N6YA 2GT7A 1FPCH 1JWTA 2FEQH 4AFUA 3SNCA 4HTCH 2BY9X 4FETA 1SMFE 5FXLA 4ABIA 3H5CB 2OCVB 2HVYB 1DXWA 8LPRA 1GI4A 2BVRH 4JZEH 5C20A 1PQAA 1C5NH 1F7ZA 3QTVH 3M61U 4WJG2 2TGPZ 1F0RA 1E79D 3KQBA 2A4GA 1AUTC 3RC5A 3V12A 2P3TB 1DT2A 4TPIZ 1C2MA 2ZCHP 2UUYA 1QNJA 2ZFPH 1V2OT 4AB8A 4Y8ZA 3SZEA 2L6OA 1YYY1 2KCPA 1HIAB 1MBQA 5A8ZA 3LH1A 5SGAE 1SI5H 1GJAB 1ZJKA 1C5UA 2EI7A 3WWFA 3M5OA 1EOLA 5C2ZA 2ZHFH 3RC6A 1PPHE 1SFIA 1AFQB 1HYLA 3PB1E 5AF9H 3BIVH 2AIQA 1A3BH 1S6FA 1AO5A 1L0ZA 3A83A 4BXSA 1TMTH 3FVFB 1QFKH 4DCDA 3WW7A 1IQLA 1TIOA 3BTME 3KIDU 3OU0A 3RC4A 2GCTC 4CHAC 1O3DA 4KTCA 5C17A 1T31A 2Z7FE 1GJ6A 2WUCA 1DXPA 3R0FA 1AUJA 1WU1A 4MVNA 1T4UH 3UQVA 1BQYA 5AVDA 3W1EA 1ACBE 1ZHPA 3PWCA 3DFLA 1J9CH 1GDNA 1TBQH 4GAWA 3T2NA 1E38B 2BZAA 4CR9A 4X2YA 2ZDAH 3GY7A 1O2PA 2V7QD 2ANMH 1MQ5A 4UE7H 2CF8H 1YY3A 2F83A 2ZDLA 4X6MA 2LPRA 2G4TA 1ETRH 1K1JA 1RJXB 3U69H 4I8JA 3PRDA 3RMNH 1V2UT 1DFPA 2FOHA 1M9UA 1SLUB 3RMMH 3CNRA 1LQEA 2GZ7A 4I32A 5K0HA 3GY8A 3SV9A 2LELA 4E05H 3MH5A 4FUDA 5KEDA 1FQ3A 4JZDH 1C5XB 2FP7B 1XXDA 4UFDH 1DITH 1F0UA 2CJIA 2HRVA 3PROA 1YM0A 1ANEA 1AZZA 1PPGE 1P3CA 3SQHE 1YC0A 3Q77A 2AMPA 1WV7H 5CHBA 1EXFA 1OP2A 2ZPQA 5B6LA 1HUTH 1GHWH 3SI4H 6GCHF 5C1UA 1O3LA 4X8SH 4ESTE 3ZVDA 1TPOA 5GDSH 1LHDH 1T8NA 1YPKH 1O33A 1MUEB 5JDUB 2H5CA 3BG4B 1P2NA 3Q3YA 2W7SA 3AW0A 1K1NA 4YLUA 1D4PB 1XVOA 4UDWH 4PROA 1DANH 1UVTH 3PMJA 5DK1A 3RXTA 1KDQB 5JBAS 1P2KA 2OK5A 4O3UA 4YLQH 1CGHA 5FL7D 1S0RA 5DG6A 1P09A 1FY4A 3SHCH 1PYTD 1FI8A 2PKSB 1YBWA 1UCYK 2K1QA 2ZDKA 4P02A 4RI0A 1HDTH 3BTEE 5CHAC 2BQ7B 1OYQA 3EE7A 3UTUH 1C2HA 3UNRA 3UOUA 2VIDA 4HI3A 4D76A 4F4OC 1GBEA 2OC1A 1Y3XA 2TRMA 1O3JA 1ZJDA 3PTNA 5ESTE 5L2ZH 2H9HA 1ETTH 5EPYA 4ASUD 1O2NA 1YPLH 1AWHB 2ZHWH 2G5NA 3BEFB 1HJAB 5GNDA 1ORFA 2M5TA 3F9GA 4UFFH 1COWD 2FOGA 1XXFA 2JH0D 4GCHF 4B71A 4JYUH 2ZGCA 4Y6DA 4ABAA 1SQTA 5HM9A 1KXAA 1O31A 2W6ID 2Z3EA 3UREA 1OP0A 1OWKA 3A8AA 1VCWA 1YCPK 1PFXC 4OS1A 3U28C 1GHBF 4RSPA 1SLVB 2H2ZA 2P59A 4RN6A 3LONA 5A8YA 3MOCA 3KGPA 1AU8A 1GMHF 1JXPA 4RT1A 1EQ9A 1C4V2 5C0TA 1F5KU 1C5WB 1DX5M 1FN6A 1TGBA 3DSGA 1ANBA 4INLA 1MZDA 3MTYA 3SNAA 2SGDE 2WV9A 1KY9A 2BY7X 5EXNA 2P8OB 2VIVA 1QA0A 3K2UA 4IMZA 3ZZ7A 1BT7A 2FDAA 1O2XA 3E91A 1SR5C 3ZVEA 4BTUB 1W11U 3RXDA 1P01A 4ABFA 3SUEA 5C1YA 2BLQA 5EW1H 3UR9A 7KMEH 5GIBA 2Q6DA 1XMNB 3DHKH 5LPEA 4Q7YA 3SU0A 2XBXA 3V0XA 4X2XA 4NIWA 1YWUA 1LCYA 1C1MA 1C2GA 2QF3A 3RM0H 1O5AB 2D2DA 1EKBB 1YPEH 2SNWA 1QBVH 1S6LA 7GCHF 3ESTA 1C1VH 4NSVA 2NU4E 3A85A 1O3NA 2BB4A 2BY5X 4X6OA 1G32B 1CQQA 2AIPA 3SGAE 2VVCA 1TB6H 3PLPA 1IQIA 1HB0B 4ABDA 5A09A 2VIWA 1AWFH 2PKAA 1Q31A 1SHHB 2AS9A 3D62A 2HPQH 2K0QA 4CH2B 2GDEH 2KCOA 4XD7D 1O35A 3A86A 1EAIA 1ZR0A 4H6TA 1TX6A 4BAQB 2HLCA 1VITF 1AVWA 4B1TA 3RLWH 4O3TA 1V2ST 3P8NA 1P9UA 3SUGA 1OWJA 2JETC 3E16B 1IQHA 1GJ9B 3SV6A 1JRTA 8GCHF 4ZKNU 2GV6A 1SGCA 4H4FA 3UWJH 1J15A 4ZXXH 1ELBA 2G4UA 3GY4A 1FJSA 3UNSA 3QTOH 2XWAA 1C2FA 2JH6D 3LU9B 3VB6A 3F6UH 1HCGA 1UCYE 3GDVA 1JRSA 1NTPA 1HXEH 1NRRH 1GMCG 5GXPA 2I6SA 1IQJA 3LDXH 2Y5GA 2SGAA 1ZOMA 2YMSC 2ASUB 4MG3A 2HVXA 3WWBA 3EYDA 1LO6A 1QB6A 3OEED 1O3KA 1LHGH 2A7CA 3FO8D 4FUCA 4WMFA 5GCHF 1UVOA 3RMLH 4O97A 2ESTE 3NCLA 4AYVB 4X1RU 1UHBA 3H09A 1ARBA 1PPZA 5J4SA 4E7RG 1B7XB 1LDTT 1LMWB 4CRCA 2RA0A 2ZKSA 1DSUA 1L4DA 2AYWA 1F2SE 1LQDB 2ZQ1A 1F0TA 1D3PB 1DLEA 3KNXA 3W95A 3OX7U 1W0JD 3RU4E 5CMXH 1QZ8A 3KQDA 1BRBE 4AX9H 5AHGH 2VNTA 3M3VA 1TRMA 3GCTF 2VU8E 2ZECA 3TH2H 4IN1A 5A0CA 1FDPA 2XCNA 1SL3A 1O2MA 2C93B 3F0PA 5FCRA 1W0KD 1O30A 1QB9A 2A31A 1DS2E 2J92A 2SNVA 2Y81A 4GHQA 1EJNA 1EUFA 3E3TA 3LKWA 1ABIH 2GZ9A 1X7AC 4INKA 3PMBB 3A8BA 4QT8C 4NIYA 4F49A 5E2PA 1MKWK 3LT3A 1V2NT 4ZMAH 2YNAA 1CBWB 3UIRA 3ODDA 4BAKB 2VJ1A 4ABJA 2DE9A 3MQKC 1ZGVA 2XNIA 1HNEE 3MU8A 4Y8XA 4YM9A 2ZFRH 5F8XA 4OS2A 3GCHC 1WBGB 2AGIX 1BTUA 3F2GA 2Y80A 4X2VA 1KIGH 1RGQA 4B2CA 2QF5A 2XWBI 1C1UH 1D6RA 2V6NA 1BBRE 1EASA 1ZLRA 3TH3H 1HGTH 4IW4E 4NIXA 1AFQC 1HPGA 1W10U 4ACBA 3ODFA 3H7OA 1QJ1B 3B8JA 3M37A 2F4LA 4RKJB 2JJ1D 3SUFA 4U30A 1C1WH 5HGGA 5EIYA 3A7YA 1L2EA 1QIXB 3HK3B 3RXOA 3NKKA 3KEEA 1BRUP 4UEHH 2GT8A 3F2HA 1GDUA 1QRXA 8GCHG 1O5GH 4AGJA 3PM3A 4F55A 4UFEH 2ULLA 5FPTA 1A0JA 2A4QA 2FI5E 1FY3A 5EXLA 3GY5A 4OS7A 2SGPE 1C5LH 1H8HD 1HJ8A 5EQSA 1HAZB 1K1PA 2FIRH 3NPSA 1A46H 4NSYA 2F9PA 1TFXA 2ZPRA 3AW1A 3SNEA 2FMJA 2QF4A 1GI9B 3FAOA 1IQGA 3BTWE 2BOKA 1UVUH 5DO4H 4AFQA 2QIQA 2CHAC 4XDEA 3RU4D 2QA9E 4AZ2B 1W3CA 2J34A 4K1TA 1GBAA 2D26C 3M3TA 1PQ8A 1DUAA 3G01A 1H9IE 4NZQA 1ABJH 1CGJE 2Q6GA 1ZPCA 2VIPA 3SV8A 2C8WB 3KQCA 3PYHA 2Y7XA 4AG2A 3QX5H 1NFYA 1NESE 1P12E 1NBME 1T8OA 2BD5A 2ODQA 3ZZ3A 1E34B 1EB1H 1RD3B 5H4IB 3D23A 3BTFE 1QHRB 2G81E 1AI8H 2PUXB 1DM4B 1Z8JB 1EZXC 2GV7A 1GI3A 3RXAA 4ABHA 3QO6A 1AB9B 2Y7ZA 5BRRE 1OXGA 1C1RA 1NU7B 2IN2A 1EAUA 3STJA 1ZTJA 3A80A 4K69A 4IGDA 3MYWA 3BG4C 3OEHD 1O3GA 4I8GA 3TNTA 3GCTG 3LGYA 4WMEA 1CA0B 2BD8A 5AFYH 3U1IB 1C5OH 2K8IA 2OINA 3A84A 3SV2H 3KQ5A 3RXRA 1MCTA 1TX8A 3GISB 5FX5A 4WY3A 2PKSC 1CU1A 2ALVA 2OBQA 3IITA 1PPFE 2V0BA 2PKAB 1FAXA 1GHZA 1G3EA 3R3GB 1BUIA 1BA8B 1TNJA 1UK3A 3M3SA 1C2JA 3EDXB 1Z71A 1UTNA 3ZZ8A 3TJOA 1NRSH 1WCZA 2XRCA 1DWEH 4TWWA 1HAXB 2CN0H 1AGJA 3B9FH 2BLVA 1HJAC 1FY8E 1QL9A 3KYGA 1GBMA 1AE5A 2A2QH 1LPKB 2W6JD 3K6YA 4Q7XA 1GWAA 1QL7A 1UVSH 1KXCA 2VWLA 3ZZ4A 4YESB 1DUEA 1AKSA 2JIZD 2LNCA 1MBMA 2R0LA 1EAXA 2WPIS 4CREA 2TBSA 2R3YA 2WV5A 1DOJA 2WSSD 4HGCA 3SJOA 3A7ZA 1S84A 3EA7A 3BTQE 3MU5A 5LH8A 2O8UA 1ELCA 1XUIA 1O3AA 4X8TH 3PLBA 3A8DA 1Y59T 1BRAA 1O3OA 4X1NU 1WQVH 4GHTA 1MTSA 9ESTA 4NFFA 1A4WH 1J16A 3N99A 4H42U 3KL6A 3Q3KA 1HAOH 4JMYA 4LZ4B 3SU4A 2J97A 3GYLB 1NBMD 3PO1B 2OD3B 1KTSB
chains in the Genus database with same CATH topology
2GCHG 2PGQB 1RIWB 3AAVA 3LGIA 4Y7AA 1IHTH 2ZG0H 3M7QA 3SQEE 1GBCA 1K9OE 1W0YH 2A0QB 3BG8A 2P8OC 2THFB 2FOMB 4VGCB 3SJ9A 6ESTA 3MMGA 2AMDA 1UHBB 1TA2A 2J2UA 1YF4A 1G37A 1GPZA 1N8OC 2BLOA 3ZVFA 1SLXB 1A0LA 3GY2A 4A7IB 1ZMLA 1FIWA 3GYMA 5LPRA 1BTWA 1SGNE 1O38A 4JYVH 1DPOA 2J9NA 2O8TA 2ZQ2A 1H9HE 2XC0A 1FLEE 1ZRKA 1QR3E 1TMUH 2ZCLP 2Q1JA 4SGBE 2VWMA 2HALA 3IG6B 3UOPA 1O2ZA 3NXPA 3DUXH 1V6DA 2ZDMA 2ZGXH 3RP2A 3TJVA 4IMQA 2C8ZB 5G4BA 3GOVB 1C5RA 2OTVA 3STIA 1F0SA 3ZZAA 3SU3A 2ZDNA 1OP8A 1N6XA 1UK2A 4WH6A 1C2KA 1LPZB 1SQOA 4BAHB 4CBOA 1MTUA 1TA6A 2FXRA 1ANCA 2BD9A 1G30B 1FN8A 1S6HA 3MNXA 1OSSA 1O5BB 4THNH 4K60A 1DDJA 1Z1JA 1G9IE 3S9AA 1A5HA 1P2MA 2BDCA 4NFEA 1A5IA 3URDA 1O2WA 4X2WA 1BIOA 2ZO3H 1Y3UA 2BY6X 4A5TS 1BJVA 4BNRA 1TNGA 1JIRA 1W0ZU 4MNYA 2KAIA 1AD8H 5ABWA 2VGCB 1CGIE 5HXFA 1V2RT 5J4QA 3W94A 1UVPA 1K1MA 3L33A 1FAKH 4ISOA 5I46H 3FP7E 1XVMA 1GL1A 1A2CH 1IQEA 4DOQA 4UONA 2TIOA 2BQ6B 1RFNA 4DURA 4DIIH 3JZ2B 5JBBS 4WXIA 3A8CA 1YPHC 3RXIA 1TGSZ 3DFJA 1SGRE 2P95A 5EPNA 3ELAH 1SVPA 4Y71A 1H8IH 1ESTA 1LHEH 1YCPM 1YP9A 4JK6A 2NU2E 1D3QB 3SJKA 1CO7E 3I78A 1O5CB 2BMGB 3SW2B 1B0EA 1VZQH 2B8OH 4NWKA 1ESBA 1XUJA 4LK4A 2OXSA 1LVBA 4KKDA 1GHYH 4GVUA 4KTSA 3MU0A 1QRWA 1GHAG 1V2LT 1NM6A 1OWIA 2QY0B 1C5TA 4DT7B 3QUMP 3LGTA 4ABGA 1HAVB 1C1TA 1SGYE 2GGVB 2A1DB 4CBNA 3DT0H 3JZ1B 3QDZB 5HYOA 1KLTA 1C2IA 1OS8A 3ENSB 1GMDF 4O03A 1O2KA 3ZZCA 5EW2H 2PUQH 1NFXA 1O3IA 1OKXA 4XE4A 1C2DA 4O9VA 1C1SA 1BRCE 1VCQA 1TMBH 1SGQE 3EAJA 3UPEA 6CHAB 1ZHMA 1SGFA 4BAOB 1MKXH 2ALPA 1P02A 2DE8A 2FTLE 3P6ZB 1EZUC 1VJ9U 4M7GA 1O3HA 3TK6A 1NT1A 2Y82A 3LOXA 5T3HA 3ZZDA 4AB9A 2BOHB 3SU5A 3MNCA 4Z0KA 3V13A 4YT6H 1UTOA 4K8BA 3I77A 1U6QA 2HGTH 1CHOF 5EOKA 1MAYA 1IAUA 3PV4A 3SHAH 1FMGA 3QZRA 3SNBA 1C5QA 4YOGA 1Y5UT 1O5EH 2F9NA 3BEIB 4MTBA 2FWWA 1QGFA 4ZH8A 4I33A 3RXQA 1P11E 3NZIA 4X1SU 1MTVA 5JBTA 5B6OA 1GBHA 1C5PA 2FM2A 2WPMS 1DY9A 1C9TA 1WSSH 2FI4E 2WPLS 4I7YH 1Q3XA 5LPFA 3RXMA 4AFZA 1P04A 2FOAA 2XCFA 4ABBA 4MNXA 3EA9A 2ZU2A 2WV4A 3A7VA 3LGWA 4TY7A 4AG1A 2UWOA 1CT4E 5EQRA 1TNLA 2FS8A 2RDLA 1L4ZA 1C5YB 3CENA 3TK5A 1P06A 1TAWA 5HM2A 2JH5D 4MPXA 2UUFB 1S82A 2G52A 2A32A 4XBBA 3KCGH 4ZHAA 1SOTA 2PV9B 3B23B 1ZRBA 2BDYA 2GP9B 4MNWA 4ABEA 1LVMA 4AYYB 1THPB 2YOLA 3E90B 3E0NB 3KN2A 1PQ5A 1Q2WA 2VINA 1GBDA 4YO9A 4GSOA 3A7XA 3M7TA 2J4IA 2CF9H 2WPKS 6GCHG 2V3HH 2J94A 1GJ8B 2HPPH 5FPSA 3Q3XA 5C67A 4XFQA 2A2XH 2BXUH 2XBYA 4SGAE 4K8YA 4BAMB 3WY8A 1SPJA 2EEKA 1EB2A 1AB9C 3O8CA 3VB7A 8KME2 1V2MT 2Z6BD 2O8LA 3FP8E 1NN6A 3ZZ6A 4OGYA 1A61H 1O2RA 5FBEA 1GBBA 3QZQA 3T25A 1SGEE 1GJ7B 1O2JA 1HAIH 1CA0C 3BN9A 1CSOE 1V3XA 1BITA 4DW2U 2F9UA 3F1SB 1SGPE 1PPBH 1EX3A 4D9RA 2HWLB 2ANYA 4I8KA 1G3DA 3ZV8A 1T4VH 1YKTA 1Z8RA 1EP5A 1ETSH 1NFWA 1MTNB 1VGCB 2O8MA 4Y76A 1XM1A 1BDAA 5C1XA 1O36A 3CP7A 2STAE 3MWIU 4CRFA 5T6GA 1BBRH 4GCHG 2TGTA 1TBZH 2HNTC 4X1QU 3P70B 3GCNA 2G8TA 1NC6A 3N7OA 2B5TB 1YLCA 1Z8GA 4LXBH 5JBCS 3ZVBA 2C4FH 4FXGH 1GHBG 1O3EA 2FYRA 5DJ7A 4XBDA 3LC3A 4NG9H 5A0BA 1P2IA 1BHXF 3S7KB 1GMHG 1W2KH 1SHYA 3E8LA 3PLKA 1HAHH 1G36A 4ISHH 1P3EA 4KELA 1YGCH 4NA8A 1C2EA 1JMOH 1QJ6B 1K1IA 3A7WA 4IC6A 3TPIZ 3UFAA 1O2HA 4YOJA 4FVBA 3SJ8A 4E7NA 2WPHS 3VB5A 3AASA 3SI3H 1WTHD 4X6NA 2BDAA 3PO1C 3GCOA 2R2WU 4B2AA 3U98H 1WAYB 1HXFH 4H6SB 5C3NA 2XW9A 2ZU1A 3U1JB 1RIWC 3QGJA 3RXVA 2A4RA 1J8AA 1GI0A 2OQUA 1OWEA 4VGCC 2ZC9H 4FUFA 1BHXB 1G3CA 1P2QA 2A4OA 2FO9A 1GL0E 1ZYOA 3M5MA 1GBKA 2IOTA 1K22H 2UWLA 2ZP0H 4K1SA 1LVOA 3BSQA 3FFGA 3RXSA 2BDBA 7GCHG 1HAYB 2GKVE 1P2JA 3RLYH 1GBLA 1TGCA 2PSYA 4U32A 2OUAA 2TGAA 1C5ZB 2XBWA 4LZ1H 3L6PA 2BXTH 4WXVA 5JB9S 2BYAX 4DIHH 3EE0B 5TJXA 3RXUA 4A6LA 1C1PA 3D49H 4ZUHA 1LKBA 3V3MA 5LGOA 3RMOH 4CRAA 4I8HA 1VITG 2FOEA 3TITA 4CRGA 2BD7A 3BF6H 1H1BA 1MAXA 4WMDA 2PTNA 4FU7A 1EJMA 1CT0E 4K1EA 1WTGH 1LHFH 2OBOA 1TX7A 3MFJA 2PR3A 1W13U 1SG8B 3HKIB 4FUGA 1EAWA 4FUHA 4LOYH 5EU8A 2QXGA 5DP6A 1P8VC 2W3KA 1CT2E 2O9QA 1KXEA 1FY5A 3S69A 3SNDA 2Q6FA 1AZ8A 4DGJA 4Y7BA 2ANKH 3QLPH 1NO9H 4YZUA 1GCTB 3SGQE 2ZFQH 1MH0A 2WINI 1UJ1A 1SQAA 4U2WA 1EPTA 1C1OA 2PSXA 2VGCC 5GCHG 1C5VA 1NZQH 2QV1A 2ZI2H 3FANA 3ITIA 4Y0ZE 4X1PU 1GJBB 1NRQH 1T32A 2FS9A 2FX6A 3UUZA 4ZAEA 2GD4B 2BHGA 5GWZA 1SBWA 1JIMA 5DP4A 1ELEE 3RXEA 2F9BH 5FX6A 2EA3A 4Y79A 1UK4A 1T8MA 3S0NA 1W14U 1TPPA 4XBCA 3P8FA 2ZA5A 2R3UA 2SGFE 2VH6A 1GG6B 4FVDA 1P05A 7LPRA 4NGAH 3GY6A 1UTLM 4WWYA 3RU4T 1S85A 3RXGA 4WF8A 1UTJA 4MLFB 1TWXB 2FTMA 2JETB 2A5IA 1AFEH 2CXVA 3KQEA 4CR5A 3MO6A 1O2GH 1P57B 5E0GA 3SGBE 2WYJA 1O5FH 3SU2A 1TPSA 3M7UA 3MH4A 3ATMA 3BIUH 1S81A 1ELVA 1ZSKA 4D7GA 1BB0B 1BMAA 2FLBH 4ZKSU 2IPHA 3VPKA 2GX4A 1SSXA 3TJUA 3RXPA 2H1UA 3NUMA 1C5SA 1P0SH 5CE1A 3LJOA 2DUCA 2QC2A 4I31A 3HATH 4K2YA 1BCUH 1O5DH 2GMTB 4AGKA 4UD9H 4RKOB 4A1TA 1DWBH 3GICB 2BX3A 2EI6A 5DP3A 6CHAC 4FU9A 1G2LA 1BJUA 5FPYA 3MHWU 1H4WA 1O34A 2AMQA 3TLOA 3P8OA 1DSTA 1SGFG 1ZZZA 2QXIA 1Y3WA 2ZFSA 1OWDA 1AMHA 3I29A 4BTTB 4Y10E 1LKAA 2QYIA 1GBJA 1GI5A 4AORA 1P10A 1C1NA 2O8WA 3ZV9A 3TNSA 1TRYA 2ZNKH 1NRNH 1VITH 3M5LA 2SGQE 1W7GH 4ZHMU 1E37B 1ZTLA 2G5VA 2R2MB 1IQFA 1D9IA 3SN8A 3LIWA 3UWIA 1WQSA 1S0QA 2Z3DA 1QCPA 1ZSLA 5K7RA 1QB1A 4MDSA 4U01A 2SGEE 2STBE 4Y11E 1AY6H 2ZEBA 2CMYA 1O2LA 3RXCA 1C5MD 1GHVH 2XTTB 1UTKA 2FODA 2FESH 2XC4A 5T6DA 4BTIB 3MH7A 1WUNH 3KF2A 1GCDA 3PWBA 4ZHLU 3K9XB 1DLKB 1F5RA 3T29A 3TK9A 1PQ7A 1SGDE 1TYNA 1QBNA 1OYTH 1Y5BT 1N1LA 4D7FA 5C5NA 1Z6JH 1KXBA 2ZZUH 2OC7A 3LC5A 4AOQA 3P92A 2BD4A 4MQAA 1QQ4A 2ZU5A 1CE5A 2AGEX 2A7JA 3A7TA 3MU1A 5TCCA 4ZKRU 2FI3E 4UFGH 2VB0A 4IBLH 3GCHB 2EI8A 1B0FA 2ZHQH 3RUOA 5IYTA 1ID5H 3F9FA 1LPGB 3BTDE 3MNSA 4TWYA 1GHXH 1W12U 1MZAA 3HK6B 1NFUA 4R0IA 4MPUA 5FAHA 1GVKB 2BDIA 1PYTC 2ZDVH 1S83A 2C90B 1ZHRA 1NU9A 4NZLA 3UNQA 2Z9JA 1CVWH 2G55A 1BMMH 5BPEA 2RG3A 1TBRH 1ELFA 1XKBC 4Z6AH 4JYTA 2A45B 1SLWB 1O2QA 2P3FH 4FUBA 3LGVA 3SUDA 4DVAU 2FX4A 1J14A 3VB4A 2BLWA 2Z94A 4CH8B 5EG4A 1MD7A 1V2QT 3E1XB 1ESAA 2A5AA 2CHAB 3TH4H 3LJJA 2OLGA 3M36A 4B75A 1MTNC 1EJAA 2PTCE 2NWNA 4XSKU 1VGCC 2Z9GA 4E06H 5L6NH 2W26A 1MU6B 1KYNA 1YPHE 2D8WA 2FOBA 7ESTE 5EQQA 1K2I1 3OY5U 2ODYB 1GI6A 2FZZA 2H5DA 2YNBA 4X8UH 1QY6A 1A1RA 1GGDB 4BANB 3RXJA 2XXLA 1Y8TA 2FOFA 4OS5A 5F8TA 1MKXK 2FPZA 4K5ZA 3VFEA 2BD3A 1OX1A 1E36B 4J2YB 3VXEH 1A3EH 5JB8S 2NU0E 3U8OH 1HAGE 3GDSA 1TLDA 3S9BA 4A1VA 1QL8A 1K1LA 2OP9A 1LVYA 1FV9A 1RXPA 4D9QA 1BMLA 1QQUA 3OTJE 4TY6A 1EPTB 2RA3A 2ZGHA 4XOJA 1ZPZA 1CHGA 5AFZH 1UTMA 3O8DA 1ZMJA 1C9PA 1BTHH 1ELDE 1G3BA 1QJ7B 3ZVAA 2GVFA 4J1YA 3AAUA 1SB1H 2BDGA 3SU6A 1TE0A 1AE8H 1DWCH 2C8YB 1TONA 4MPVA 4IS5A 5C5OA 3ZZ5A 2FOCA 2P93A 1GI1A 3Q00A 2IJOB 1ZTKA 2F3CE 1FUJA 2BTCE 2UWPA 1CBWC 2WUBA 1AVXA 1TGTA 3FZDA 4B2BA 1GMCF 2A7HA 2B7DH 3VB3A 2VVVA 1DICA 2OQ5A 3S7HB 3OSYA 3VGCB 2Y5HA 2FYQA 1RTKA 2PWXA 1AN1E 4FU8A 3A88A 3MI4A 4B73A 3E0PB 3PTBA 1EP6A 1RRKA 2BZ6H 3C1KA 1SFQB 4B76A 4TPYA 2QGRA 4KTUA 2F91A 5E8EH 4JCNA 2Z9LA 3O8RA 1UMAH 1FY1A 1L1NA 1BTYA 1DWDH 2C3SA 2TGDA 1H8DH 3BEUA 4ZROA 1XUFA 1UO6A 1KXFA 4Q80A 1GJDB 2VWNA 2CV3A 2H9EH 4BOHA 2AFQB 5IDKA 4ISLA 2CGAA 2B9LA 1P2OA 1P9SA 1L1JA 5A8XA 3ZZBA 3SU1A 1UCYH 2EC9H 2Y6TA 1O3MA 1PPEE 2JKHA 4R8TB 1GJCB 1YPMH 1Z7KA 5ESBA 4FUIA 3VEQB 2BD2A 3ATKA 1FPHH 1IOEA 3FZZA 2P3UB 1TALA 4A92A 1BTPA 3OYPA 1AKSB 5EGMA 3TGIE 1XX9A 6LPRA 1FNIA 1SC8U 1GCTC 1V2PT 1QRZA 2AERH 3E6PH 3A81A 1RTLA 1T8LA 4OGXA 2QCYA 1MU8B 1N8OB 1KXDA 1THSH 1JBUH 3M5NA 2QXJA 1FXYA 1OPHB 4X6PA 1UTPA 1O3PB 2ZHDA 3TIUA 4YT7H 5DP7A 4DY7B 4IN2A 2UUKB 3A82A 1PJPA 1MQ6A 2ZTXA 4OS4A 1YCPH 3TGKE 3U8RH 3F9HA 1XKAC 2AGGX 3U9AH 1GBTA 1OWHA 1Z8IB 3M35A 3SOSA 2ZGJA 1NRPH 2FLRH 8ESTE 5A2MH 1BMNH 1MCVA 4FUJA 1BBRK 1W8BH 1FZZA 5F03A 1BTXA 4GLYA 5TCAA 2GCTB 4CHAB 2XC5A 2WPJS 3D65E 2G51A 3PMHB 1GG6C 2B0FA 2ZFTA 1Z1IA 2ZHEH 5DGJA 2P16A 1W7XH 1TNKA 3F9EA 3CS0A 3P17H 3SORA 5PTPA 1FIZA 1GMDG 3BTTE 3PMAB 1KTTB 1O3BA 4ISIH 2V3OH 1TRNA 1UTQA 3URCA 2GTBA 4B74A 1A0HB 3L3TA 2ANWA 3RM2H 2PGBB 4HZHA 3T27A 2A5KA 1ZMNA 3TJNA 1O3FA 1VR1H 3DA9B