2BDBA

Porcine pancreatic elastase complexed with asn-pro-ile and ala-ala at ph 5.0
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Elastase-1
publication title Structural analyses on intermediates in serine protease catalysis
pubmed doi rcsb
molecule tags Hydrolase
total genus 61
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2005-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bdbA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bdbA01
1MKWH 3BTQE 2GP9B 2XCNA 3L6PA 2AYWA 1HAHH 4YT6H 2V6NA 4DIHH 2IPHA 3IWMA 1O5AB 1ANEA 2A4RA 1OP8A 1IAUA 5F03A 5FPTA 1O2MA 1WYKA 4AG1A 1VR1H 1QA0A 1EZQA 4DGJA 1CGJE 4FU7A 1NROH 3TPIZ 1EAXA 3F9FA 3A83A 3NK8A 3P6ZB 3RC6A 1PPHE 4ABDA 2O8TA 2ZWLH 2G8TA 3SO3A 3GCTF 1MU6B 1TNLA 3GDSA 4GPGA 2BD5A 3KQCA 3LGIA 3KQBA 3URCA 3RLYH 3M36A 2GCHF 5E0HA 1YF4A 1O2UA 5DP3A 5E2OA 5EW1H 3VEQB 1BIOA 2BDGA 3QUMP 1XUGA 4O3UA 3UIRA 1O2VA 7LPRA 1GCDA 3A85A 1MTNC 2WPLS 3BTGE 2OC0A 2ZU3A 1P10A 2TGPZ 5K7RA 1TPAE 2TGTA 2VINA 4MPUA 3U8RH 4IMQA 2GVFA 1O38A 3EA7A 2OQ5A 1DXWA 1QBNA 3TGJE 1GHWH 4F4OC 3TJVA 1RIWB 1P2IA 3CP7A 1NU9A 3PMJA 2BDBA 1HAPH 1AY6H 1RTFB 4FUGA 3SW2B 1AMHA 4NGAH 1UVTH 4UDWH 2BY7X 4H42U 2RCEA 1TALA 4ABBA 1AE8H 2BY6X 4YT7H 1SBWA 1SGCA 1BOQA 1QA7A 1V2MT 3U98H 5HGGA 3SORA 1RRKA 1GBDA 1T8NA 2WV4A 3ATKA 4ZKNU 1ZZZA 4DVAU 1TGTA 3TVJB 1THSH 5I46H 1V3XA 1BTZA 1O5FH 2ODPA 5L6NH 2A4OA 1E37B 4I8KA 1PQ5A 4B2CA 2ZU2A 4ZROA 3RXGA 3FFGA 5L2ZH 1O2GH 1O2WA 2ZU1A 1G37A 3ZZ5A 2FOHA 1CU1A 4X1QU 1CE5A 3A7XA 1TIOA 2A0QB 8ESTE 8LPRA 5F8TA 1L1GA 1HAOH 1QRWA 1DM4B 1EZSC 4THNH 1QJ1B 4X1RU 4OGYA 1BZXE 1P01A 5JYIA 4FUBA 1OWEA 1A0JA 1GBBA 1GMCG 2JETB 4NZLA 4B2BA 1TPPA 1P3CA 2J94A 3RXJA 4WMDA 1S6HA 1FY1A 2NU3E 2VB0A 3RMMH 3W95A 3TJNA 2FI4E 1O3GA 1XM1A 1XMNB 4MPWA 3UNRA 7ESTE 4Y0ZE 3T28A 1UK4A 1YM0A 4CRBA 1Y5BT 3LKWA 1K1JA 8GCHG 2ZFSA 4E05H 1ZRBA 2J9NA 3T2NA 1FAKH 1MBMA 2BB4A 2SFAA 2VIDA 3NUMA 1NRRH 3S9BA 2FOFA 2A5IA 4HI3A 3MWIU 3RXKA 4X1SU 1E36B 3U1JB 1EOLA 3QX5H 1P57B 1V2ST 4BOHA 1ZSLA 2BY9X 4BAHB 2H1UA 1FLEE 4OS1A 1K1NA 2CF8H 1J9CH 1GL1A 2A31A 1T31A 3BEIB 1G2LA 4MNXA 1HJ9A 2Y81A 1YBWA 5A0BA 1KXCA 2ODQA 4KGAA 1EOJA 1LPZB 1RJXB 1TMUH 3I78A 1BBRH 1V2TT 2ZFQH 1EJAA 2GV7A 3JZ2B 1P05A 8KME2 1J17T 4Y0YE 4AGJA 5AF9H 2BVXH 1YPGH 1XUKA 1SOZA 1HV7A 2ZFRH 4MG3A 3K9XB 1ANCA 4RN6A 4B1TA 5BPEA 2PLXA 1ELTA 5L2YH 5JBAS 2ZGCA 1FN6A 5T6GA 2V35A 3P8OA 2QYIA 1L4ZA 1OWHA 2BLQA 1NRNH 1GI6A 2C90B 1T8LA 1YP9A 1HYLA 3RUOA 4YLQH 4OGXA 1BHXB 1ZRKA 1NC6A 2BD4A 4NZQA 5K0HA 1AO5A 2XRCA 4TPIZ 1TX6A 1L2EA 1D6WA 4GAWA 1QFKH 4UEHH 1YC0A 1QRXA 5ESBA 2ZP0H 4JYUH 1BTUA 1OOKB 1X7AC 2BM2A 2VWNA 1SGFG 3MI4A 1ETRH 1QIXB 2SGEE 1VITG 5I25A 2VH0A 3GDVA 5FX6A 1ABIH 1HAVB 4BAMB 1C2JA 2WPMS 1CA0C 1W12U 1HGTH 1FUJA 2QXGA 4ABFA 1SR5C 4MNWA 1TOMH 4YOIA 4D76A 3ATIA 4VGCB 4X2VA 1A3EH 1PPEE 3PWBA 1O2HA 1RD3B 1GG6B 2BVRH 1DSUA 2BMGB 2B0FA 3LGTA 4FVBA 1HRTH 3PWCA 1AGJA 3H5CB 2BLWA 2ZHEH 3BTHE 4U01A 2AIPA 2BLVA 5IYTA 1PYTC 4YM9A 3SJKA 2P95A 2J34A 3ZZ6A 1C2HA 1Y5UT 1CHGA 3S7HB 3BTFE 5A2MH 2SGAA 3GCHB 2O9QA 2SGPE 2JH6D 1DY9A 1GI2A 1O3AA 2P3TB 4UFGH 1D4PB 2ZDNA 4INLA 3SU4A 1QR3E 5ETXA 1WCZA 2WV5A 3P8NA 3SI3H 5FAHA 1HBTH 3BTWE 1Z1IA 2C3SA 1C5VA 2FM2A 3SV2H 5A0CA 5TCAA 1EQ9A 1TWXB 1VCQA 2VWLA 4ZUHA 1CGHA 2C8XB 4X2YA 3DT0H 4OS6A 1V2NT 3U9AH 1DICA 1Z71A 2WPJS 1QBVH 2ZPQA 3BG4C 4IBLH 1MKXK 1BTWA 3B23B 3ODDA 1FY5A 5ABWA 3PTNA 1OYQA 2P16A 1P11E 3F1SB 4MPVA 4JZIA 4ZKSU 3SGBE 1Z7KA 3SU6A 1L1JA 3ZVBA 1GWAA 1YLDA 3WY8A 1G3EA 1QB1A 3QLPH 4Q7XA 1RXPA 1O3BA 3SI4H 2QA9E 3H7TA 4XOJA 2TIOA 1EATA 2SGFE 1T8MA 1BJUA 1CT2E 1MU8B 1K28D 2A2QH 2H2ZA 1WBGB 4ABEA 4SGAE 1UK2A 4NA8A 4CRCA 1XKBC 3EE0B 1GHYH 4X8SH 1AKSA 4JZ1A 1NN6A 1O35A 1YCPH 2RDLA 1V2JT 2EI8A 1EP5A 3VB7A 1XKAC 1GHAG 1AQ7A 3ITIA 1H4WA 1O2YA 2R2MB 3DFJA 4TPYA 4IN1A 2Z6BD 5CHAB 2GKVE 4ABGA 2UUJB 2VVUA 3GCOA 4ZKOU 1QB6A 3B8JA 2UWPA 1VGCB 3M5OA 2JKHA 5FCKA 3M61U 1EAUA 2ZDMA 3E6PH 2SNVA 5C1XA 2BX3A 3PB1E 1GI8B 1S82A 2OC7A 2AH4X 3MU5A 1O36A 3TGIE 3NPSA 2HNTC 1ORFA 1ZOMA 4Q7ZA 1IQLA 3GY2A 1U6QA 2FOBA 4CHAB 2VWMA 1NFUA 1TPSA 3M7QA 1EX3A 4RKOB 4FUJA 1F7ZA 2OINA 1OWJA 3RLWH 3L3TA 1TNHA 1AVWA 3PLBA 3I29A 3MH5A 1L1NA 2GZ7A 3GYMA 1AWHB 1BUIA 1GJ4H 3LJJA 1LHEH 1RGQA 1GI3A 1W7XH 3TIUA 3H7OA 1QRZA 4E7NA 3BEUA 3E3TA 3SV6A 3MO9A 3LDXH 1YPHE 1MTWA 1BRUP 4X8VH 3PMAB 1HIAA 4FU8A 1OWKA 2YOLA 1W0ZU 3F9HA 1GJ5H 2Z9IA 1EASA 1UTKA 3MU1A 1MAYA 3HATH 4X1PU 4B76A 1C9PA 4IS5A 4A7IB 3S0NA 3A82A 1K22H 2V3OH 1G3BA 2CXVA 4WY3A 3A86A 1SOTA 1JIMA 3TH3H 5A8XA 2R3UA 2GX4A 2FYRA 3RM2H 1GMDG 1QURH 1INCA 1ELCA 4GSOA 3KL6A 3D23A 4WH6A 2P93A 4K1SA 2JH0D 1AIXH 4AX9H 3KEEA 4XBDA 1NFWA 4NSVA 2FOAA 4Y71A 4I31A 1LDTT 2ANKH 1ID5H 1SC8U 3GY6A 3UOUA 3G01A 3JZ1B 3QTVH 1THPB 1DWBH 4E06H 4TYDA 3ENSB 4YOGA 2GMTC 1GVZA 3TK5A 2XC4A 3ZVGA 1P2KA 2FOMB 2ALVA 1GBTA 2ZTZA 2V0BA 3O8DA 1Y3VA 5FXLA 2ESTE 3SQHE 4I33A 2J95A 2C8WB 1GGDC 1Z8IB 1ELBA 4K5ZA 1Y3UA 4IN2A 1KLIH 2HVXA 4K1TA 1HXFH 1XXDA 1FPCH 4WJG2 1SGYE 3MOCA 2NU2E 1O2KA 5GXPA 3F68H 1A7SA 1YLCA 2BQWB 1O0DH 3MH4A 5A09A 2ZQ1A 3UY9A 1DWCH 1O3DA 1CQQA 2VJ1A 1W11U 1C2FA 2STAE 3GDUA 4FUFA 1P04A 2DUCA 3RXPA 1O2OA 1GBLA 1WQVH 1NTPA 1C5NH 1MTVA 2D8WA 1SGRE 2Z3EA 1K2I1 2Z9GA 1P3EA 1EP6A 1ELGA 3PMBB 3M7TA 1GI5A 1DXPA 3LU9B 3RDZA 4X1NU 2CHAB 1C2LA 1D6RA 1DWEH 2OC1A 1ARCA 1BTYA 1AWFH 3TNSA 1NM6A 2STBE 4DG4A 1IQEA 1ZYOA 2OC8A 2AEIH 4ZHLU 4AG2A 4JK5A 3RXSA 2BXTH 2VU8E 1TA2A 2TRMA 2Z9LA 1WTGH 1HUTH 3MTYA 1HJAB 2P8OB 3RU4T 3U1IB 4ZKRU 1GHBG 2ANMH 4XBCA 4Q2KA 5HXFA 4AFZA 1N6YA 4WXIA 1O3MA 1C1SA 3DD2H 3VGCC 1UHBB 3BTEE 2ZGHA 4B2AA 1CHOF 2BDYA 1YGCH 3NXPA 4ASHA 4DIIH 1DWDH 2BY8X 1ACBE 3GOVB 2FPZA 5DGJA 1XUIA 3QWCH 3SNCA 1CO7E 1LVBA 1B0EA 2Z9JA 1HAVA 1IHSH 2FX4A 2IN2A 2BTCE 1F0UA 1QQ4A 3ZVDA 1S0QA 1C5TA 2PKSB 4KTSA 1BRBE 2K1QA 2WPHS 5HM2A 1MD8A 3NCLA 7KMEH 3AASA 4DOQA 2Y5HA 2WPKS 1NT1A 4FUHA 1VZQH 1FPHH 5PTPA 1TFXA 2GT8A 1D3TB 1GDUA 4Y7AA 4TWYA 1UTJA 1UCYH 2A1DB 2CN0H 3A88A 1GVLA 2ALPA 1UTQA 3VB4A 5EPNA 1O3CA 2F9VA 3QGJA 3HKIB 1FIWA 1ZJDA 2R2WU 4INHA 1AKSB 4WMEA 5DG6A 2FS9A 1HAIH 1ARBA 5JB8S 1OYTH 2GCHG 2LNCA 1P2MA 3ESTA 3ZVCA 4MTBA 4GVUA 4YESB 3FAOA 2C8YB 2ZFTA 2G81E 4GUXA 3T62A 1C1WH 1C1TA 1V2LT 4WH8A 4E7RG 6GCHG 1RIWC 2A2XH 4H4FA 2Y7XA 1O2RA 2NU4E 4O9VA 3LGVA 3A81A 1FXYA 1B7XB 2BZ6H 1CGIE 3R3GB 4ABHA 3TJOA 4O97A 1TABE 1Z8RA 1P12E 1FNIA 3KN2A 2BQ7B 1HAYB 1F5RA 1IQNA 1SGNE 1GMHG 3DFLA 2ZU4A 4UE7H 2H9EH 1KDQB 4DY7B 1ABJH 1MTSA 3VB6A 4O03A 2ILNA 1HIAB 3SNAA 2UWOA 4R0IA 5E0GA 3MMGA 5J4QA 3LJOA 2PKAA 1DANH 2A5AA 2WINI 1BT7A 1ESTA 1ZTLA 2FX6A 2NWNA 4ZHMU 3UTUH 3RC4A 1LQDB 1N1LA 6CHAB 3QN7A 1P9UA 2BZAA 4LK4A 1O3JA 2ZIQH 1AB9B 1IQHA 4NIXA 2ZO3H 2Y6TA 1O33A 2JETC 1O2IA 4ISOA 1NESE 1DSTA 4A6LA 2XXLA 2PUXB 5EGMA 4YO9A 7GCHF 1GMCF 1DS2E 5TJXA 1FDPA 1JOUB 1MMJN 1QB9A 1O32A 4ABAA 1C1UH 1P0SH 1C1MA 3A7WA 2QAAA 5GIBA 1O5CB 3A7YA 3MYWA 4BTUB 2AIQA 3P17H 1QJ7B 3D62A 2TGAA 1S84A 3SV9A 1C5UA 4ZXYH 8GCHF 1GPZA 4K8BA 3LC5A 3LIWA 3SNEA 1HCGA 2ZNKH 3OSYA 3VPKA 4BTTB 1GJCB 3DA9B 3C27B 1GL0E 1C2GA 2TPIZ 3SUGA 1W0YH 2Y5GA 3Q3KA 1G3DA 3PV4A 3AW1A 1P8VC 4D9RA 1TBRH 1MKWK 5FPYA 1GJ8B 1Q3XA 2SGQE 1P9SA 1Y5AT 4A1TA 2IOTA 4M7GA 3SJ9A 4XSKU 3ZZ9A 2PSYA 1BMAA 3S9CA 3Q3YA 1D9IA 3BG8A 3BIVH 1NZQH 1O3FA 2OXSA 5CMXH 1KXBA 2BXUH 1EB1H 4NCYA 2GZ9A 4UFEH 2J92A 1PQ8A 2VIPA 1OP0A 2ZPSA 2AGGX 2ULLA 3LONA 4OS4A 1TNIA 1PQ7A 1O31A 3UPEA 4BXWA 1N6XA 1MUEB 3PYHA 1ZPCA 1XUFA 1Y3YA 5GCHG 5DP8A 1PFXC 2UUKB 3OY6U 4OS5A 1BTHH 3E0NB 3F6UH 2ZGBH 2A45B 3LGYA 3MH7A 5FHTA 2OLGA 1EJMA 1PYTD 3T5FH 2J2UA 1SQOA 5HM9A 4ZMAH 2XWBI 1T4VH 3RM0H 3ZVEA 3E8LA 1V2UT 4I8LA 1Q2WA 1XUJA 1ZHMA 1V2QT 2W5EA 1ANDA 1UJ1A 1YCPM 2BD8A 3N7OA 1GJDB 2G4TA 1F0RA 4LZ4B 1KXFA 1GCTB 2XBVA 1K21H 4NA7A 5EW2H 5DP9A 2QCYA 3L33A 3CS7A 3RXMA 3SV7A 1CT4E 5DPAA 2UWLA 2XNIA 2CGAA 1NS3A 2SNWA 1YPEH 1UTMA 1TNGA 4U2WA 1VITF 3A84A 1IOEA 5AFZH 3TLOA 5EXLA 2Y82A 1VJ9U 1OXGA 4QT8C 1ANBA 3UQVA 1V2WT 3RXRA 1DLKB 4VGCC 4KP0A 3DUXH 2PV9B 1GHXH 1GG6C 2D2DA 1MZAA 1ZGVA 2F9NA 1THRH 4NFEA 1IHTH 1SGTA 1HAXB 1C1OA 1SVPA 5H4IB 2A32A 2C4FH 4GHQA 5JBBS 3Q77A 2HRVA 4HGCA 1AUTC 1TOCB 2G5VA 1V2PT 1W2KH 1TBZH 1UVOA 1S81A 1ZR0A 2FI5E 2BQ6B 2UUFB 2Q1JA 3GCHC 5LPEA 2AFQB 4X2XA 1C4V2 3NKKA 3SV8A 4AFQA 2F9PA 2V3HH 1SPJA 4OS7A 1LHCH 2BDCA 1C1NA 2Y7ZA 1CBWB 4GCHG 2OD3B 3Q00A 2EI6A 2RG3A 3FZDA 1ZSKA 1PQAA 2ZC9H 2WUCA 1F5LA 4Y6DA 4K69A 4I8JA 2TBSA 4CRFA 3KQDA 1AZZA 1HDTH 1UHBA 1OP2A 4ZAEA 2BYAX 3VXEH 1O3LA 4GLYA 1N8OB 1SQAA 3U8TH 4K2YA 3EA9A 3CS0A 3TU7H 3O8CA 5E2PA 4BAOB 3V3MA 3TJUA 1EPTB 2XC5A 1QGFA 3MNBA 5HMAA 5SGAE 2FO9A 2PTNA 5GDSH 4YOJA 1Z6EA 1P06A 2CJIA 3M3VA 3TH2H 3E1XB 1GHZA 1O5DH 2GTBA 2PKAB 2FLRH 1J14A 2OBOA 2ZCKP 5GPIB 1OWIA 3TNTA 2P94A 3K6YA 1G9IE 9ESTA 1GBKA 1KXEA 4B74A 4HTCH 2HALA 4ZXXH 2QIQA 5C67A 3RXIA 3UUZA 1F0SA 5E8EH 1DY8A 5C1YA 1BBRK 5G4BA 2ZQ2A 4WF8A 2BVSH 1H1BA 2BD3A 1GHAF 4Y8YA 2F9OA 5CHAC 1SB1H 2VIOA 3K65B 1CA8B 3RP2A 1AUJA 1VGCC 1KTSB 1ESAA 1YPJH 1IQJA 4H6SB 4ISNA 3RXEA 1ELVA 2Q6DA 4Y8ZA 2GV6A 1A5IA 3MH6A 3PLKA 3KGPA 2HNTF 1C4Y2 4AOQA 4CHAC 4K3JA 4CH8B 2VGCB 3BEFB 4WXVA 5GWZA 1W8BH 5E0JA 4AYYB 1GJAB 5A0AE 5T3HA 5JBCS 2H5CA 1O30A 2FZZA 4MNYA 1L0ZA 2W3IA 1MBQA 2Z3DA 4KKDA 3EDXB 1YKTA 1H8IH 3LOXA 3TITA 1KDQA 4K8YA 1DLEA 2PHBA 1P09A 3HKJB 5DKMA 1ZPBA 5LGOA 3ZVFA 2BOKA 3QGNB 4U30A 3LH1A 4O3TA 2FI3E 2ZHWH 5EG4A 2O8UA 3TK6A 1BTXA 4IC5A 2YNAA 3SGAE 1ZJKA 4NSYA 2FTMA 3P92A 2BD9A 3ZZBA 2AS9A 1T32A 1NO9H 1MZDA 3M35A 1LHFH 2FDAA 2O8LA 3UFAA 4XDEA 3ZZDA 4R8TB 2W3KA 1C1PA 2P3UB 1TPOA 4NIWA 1BITA 2AGIX 2GD4B 1DX5M 6LPRA 1Q31A 3SNBA 2PUQH 1DUAA 2BDAA 4X6MA 2DE9A 2O8MA 2QN5T 3RXTA 1NPMA 3PROA 3M3SA 1C5PA 1GBFA 1GMDF 3FVFB 2UUYA 4X8UH 4Y10E 4FU9A 1B5GH 3NZIA 1LVMA 2ZGJA 3ODFA 1F0TA 4A1XA 1CT0E 5JB9S 3O8RA 1TGSZ 1GDNA 4KTCA 1TRYA 1K9OE 1J16A 2H5DA 1GBCA 2ZFPH 1WOFA 1C2EA 1O2XA 2OBQA 1SG8B 2OQUA 1O5GH 1DPOA 2O8WA 1SLUB 2ANWA 1ZHPA 1SGDE 1XUHA 3S7KB 1AVXA 1NRQH 5C1UA 5F8ZA 3PO1B 2ZI2H 1UTPA 4MQAA 1SL3A 1C5SA 2BX4A 5C2ZA 1FJSA 4KELA 3E90B 3UOPA 1O2PA 5EQRA 3A8AA 3UNQA 2PFEA 4ABJA 3E16B 1LCYA 1GVKB 3D49H 3BIUH 2ZDLA 2ZDVH 1LQEA 1SQTA 1ETTH 2H9HA 2BDHA 2BHGA 4FUEA 3UR6A 1P2NA 2F83A 4BXSA 4Q80A 5LPFA 4RSPA 3T27A 2LPRA 5DJ7A 1O34A 1WSSH 4ZH8A 3ZVAA 2QY0B 1S6FA 3RU4D 2CHAC 3V12A 4Y79A 3MO3A 2XCFA 4AGKA 1E0FD 2GCTB 3FP6E 1M9UA 1W3CA 1AFQC 2VIQA 1TRMA 1BMNH 1ELAA 1W7GH 2AMPA 4RKJB 1C2KA 3ZV8A 1A5GH 3I77A 3RXFA 3B9FH 1WAYB 3K6ZA 1C1RA 1AN1E 1KYNA 1NFXA 2W7UA 1BDAA 1A46H 1HJAC 2P8OC 4D8NA 1H9HE 2ODYB 2THFB 3LPRA 3QZQA 1UTNA 1RS0A 1S85A 2R9PA 1SFQB 2F91A 3BTKE 4Y7BA 4BANB 1C5LH 1JMOH 3SUEA 1SLVB 5EPYA 3A89A 3T26A 5IDKA 1EZXC 1YCPK 2M5TA 5DK1A 4FUCA 2FESH 2FOGA 1PPCE 1JXPA 1ZPZA 1ELDE 3ATWA 1WUNH 2VVCA 5F6MA 2ZPRA 2ZCLP 4CRGA 1VCPA 1IQMA 1RTLA 2PKSC 2ZCHP 4XBBA 3KCGH 4I32A 2GT7A 1TMTH 3URDA 5FBEA 1KXDA 1HAZB 2PGQB 4X2WA 2EC9H 4HZHA 1WU1A 1SGPE 2XTTB 4UD9H 5EQQA 5EQSA 5GJ4B 1P02A 1FIZA 3SHAH 3RMNH 4K1EA 1K1LA 1LKBA 1SGFA 1A5HA 3GISB 1ZMNA 3SN8A 2PR3A 5AFYH 2ZHQH 2PSXA 3OTJE 4U32A 1IQIA 1GBHA 4FXGH 1TMBH 3BTDE 2EI7A 3EYDA 3GCTG 1C5QA 1E38B 2H6MA 3GY5A 1SSXA 2Z94A 2B7DH 3GY4A 1C1QA 3T29A 3GY7A 1O2SA 1TA6A 2PWXA 3MU4A 2YNBA 2QXJA 1SMFE 2HNTE 3TK9A 5EOKA 2HLCA 4FUIA 3KHVA 1C1VH 1MD7A 3S69A 3Q76A 2XW9A 3ZZ7A 4Z6AH 2FODA 1UMAH 1G2MA 1VCWA 1C5YB 1OSSA 2W26A 4AFUA 3CENA 3RXCA 4NWKA 3IITA 4CRAA 1G30B 1GBIA 1ZTJA 3VFEA 1ZMLA 1EB2A 1MTNB 3FP7E 1O3PB 6GCHF 3LT3A 2TGDA 5B6OA 1O5BB 2B9LA 1GBMA 2BOHB 3RXUA 1LO6A 5C3NA 2ZHFH 1JRTA 2A5KA 1UCYE 3AAUA 2ZDKA 1C5OH 2Z7FE 1XX9A 2GGVB 2ZZUH 3EQ0H 3HK3B 4AORA 1Z8GA 1OPHB 3BN9A 2VVVA 2ZG0H 1GHVH 5BRRE 3F9GA 3P70B 3P95A 1EPTA 3UQOA 1C5MD 2AMQA 2EEKA 1GMHF 1C2MA 1GJBB 3BV9B 3M37A 3RXLA 3A8BA 1JBUH 2A4QA 4AFSA 5JBTA 2GDEH 4CREA 1ZTKA 1NFYA 2CF9H 1JWTA 1OKXA 4UFFH 1WTHD 3M3TA 1GBAA 1MH0A 2HGTH 5HYOA 1JRSA 1OWDA 2G5NA 3GICB 1TNJA 2FYQA 2ZECA 4TY6A 6CHAC 3MNXA 1J8AA 1O5EH 4TWWA 4DT7B 1AB9C 1GBJA 3SU0A 2BY5X 2QC2A 4X8TH 4JMYA 3OU0A 4UFDH 2RA3A 1O3EA 5EODA 1JIRA 5FBIA 1IQKA 1C4U2 1UVPA 3TH4H 4WMFA 3FP8E 2QV1A 1TNKA 2QF3A 1TBQH 1V2OT 4B71A 1TQ0B 3KNXA 1V6DA 4FVDA 4BAQB 1IQGA 5LH8A 2Y80A 1YPKH 7GCHG 3SU2A 4LXBH 3M5LA 1YPMH 1F92A 2KAIB 1ESBA 4CR9A 1NRPH 4X6OA 3E0PB 4WWYA 1BJVA 3V13A 1H8DH 1OS8A 1MKXH 2H9TH 3GY8A 1BA8B 1KTTB 4H6TA 1O2QA 1TB6H 1AZ8A 1C5WB 4IMZA 2BD2A 1Y59T 1LHGH 1QTFA 4YLUA 4MPXA 2OUAA 1DT2A 4MLFB 3LGUA 2Q6FA 2FEQH 4Z0KA 4UONA 2I6SA 1Y8TA 1OX1A 1IQFA 1MCVA 1UK3A 2ZF0H 3GY3A 1HFDA 3KF2A 1TRNA 4ISLA 1PPFE 1GJ7B 1C9TA 3TGKE 3UREA 3BSQA 1H9IE 3SU1A 3SU3A 3RMLH 1QY6A 1SI5H 5C5OA 1FAXA 2XBXA 2Z3CA 5AHGH 2FLBH 2C8ZB 2VIWA 4B73A 2FOEA 1FZZA 1AVGH 1GDQA 3RXAA 1FMGA 3A8CA 1ELEE 2ZTXA 3DHKH 2BLOA 3VB5A 3PTBA 3SOSA 5A8YA 5L30H 1GBEA 1SLWB 3VXFH 1SHHB 3HGNA 1TX7A 2I6QA 4D7GA 3W94A 5CE1A 1HB0B 5DP4A 5EU8A 1S5SA 5GCHF 5DP5A 1Z8JB 2QXIA 3BF6H 4CBNA 2IJOB 1O2ZA 1QL8A 4I8HA 4KTUA 1O3KA 2FWWA 4ZHAA 1DE7H 1YPHC 1UCYK 4B75A 5FX5A 1MCTA 1MQ5A 1TGCA 1BHXF 3LH3A 4DURA 3MU0A 3RU4E 2R0KA 3V7TA 1FI8A 4JYTA 1GCTC 5DO4H 2FP7B 2Z9KA 1QCPA 1O2LA 2ZHDA 5LPRA 1BBRE 1BRCE 4FUDA 1EAIA 1D3DB 1AFEH 5EXMA 4JZFH 1C5RA 3M7UA 1EJNA 1CSOE 1BQYA 1GI4A 3AVZA 3VB3A 4DW2U 2P3FH 2AERH 2A7CA 5J4SA 1TYNA 1DVAH 3SNDA 4A92A 2JH5D 1G36A 1XVOA 2ZU5A 1HNEE 1LMWB 2FXRA 2XBYA 3F9EA 1AE5A 1A3BH 1A1RA 2HWLB 3SHCH 1CA0B 1EKBB 4AZ2B 4IGDA 3S9AA 1K1OA 3ZYEA 3U8OH 1UTOA 1V2VT 1GI7B 2FTLE 3RXBA 1P2JA 3STJA 1Z1JA 3KIDU 1Z6JH 3ZYDA 1DFPA 2ZTYA 2Y5FA 4K60A 2QF0A 4Q7YA 5FCRA 4ISIH 1CBWC 1FONA 4MNVA 1O3OA 3ATLA 3ZZ8A 1A0HB 3MFJA 4DJZB 1BMMH 3ZZCA 3EAJA 1NY22 1SGEE 4GCHF 4ESTE 1C5ZB 3SQEE 3PLPA 1GJ6A 3M5MA 1E34B 1GI9B 2NU1E 3HGPA 1O3HA 4OS2A 1PJPA 3ZZ3A 1W13U 1SHYA 3QZRA 4NIVA 3SU5A 1H9LB 1N8OC 1SGIB 1QQUA 4JZDH 3BTTE 3O8BA 3AW0A 3PMHB 4Y11E 1T4UH 2A7JA 1A0LA 3ATMA 2AMDA 4NIYA 1A2CH 4X6NA 2W7SA 1O39A 2FMJA 1EPTC 1NRSH 4YTAA 3A7TA 1BTPA 4GHTA 4MVNA 1V2RT 2PTCE 3SUDA 5C20A 2XWAA 1BMLA 1E35B 2VIVA 1HLTH 5TCCA 3BG4B 4CRDA 1P2OA 1YYY1 2ZA5A 4J1YA 1MTUA 3T25A 2VWOA 2G52A 3U69H 5C5NA 2J4IA 2ZFFH 2WUBA 1LPKB 3SZNA 3AAVA 3ZZ4A 4LOYH 1ZHRA 6ESTA 1S83A 3A8DA 3QK1A 1KXAA 1A61H 2ASUB 2FS8A 3RXHA 2B8OH 3LC3A 3A87A 2DE8A 2FOCA 5AVDA 2OTVA 1EUFA 3E91A 4JCNA 4LZ1H 1Y3XA 1DDJA 1FY4A 2XC0A 4ABIA 1XVMA 1YPLH 1KLTA 4CR5A 3UNSA 5T6FA 3OYPA 3R0FA 2A7HA 2RA0A 2WPIS 1VJAU 1PPBH 2ZKSA 4DCDA 1TE0A 4AYVB 1UVSH 1A4WH 4JK6A 3SJ8A 4D7FA 1TGNA 1GJ9B 1SGQE 5DP7A 5DP6A 2HOBA 1P03A 3HK6B 1MQ6A 2VGCC 2G51A 1LKAA 4Y76A 1BCUH 2EA3A 3P8GA 1C2DA 2CV3A 3SUFA 1KLJH 1TLDA 4NFFA 1C2IA 4AN7A 1TGBA 3GYLB 1XXFA 3RXQA 4NWLA 1HJ8A 1K1MA 1HPGA 1ZMJA 2G4UA 1QBOA 4PROA 3UR9A 1GI1A 1SLXB 4MDSA 1LTOA 2R0LA 3MO6A 1WV7H 4JYVH 4SGBE 2PGBB 5JPMH 1DITH 3EGKH 3MHWU 1VITH 1AD8H 1K1IA 1EZUC 5F8XA 3A7ZA 1EAWA 2F3CE 2ZGXH 5ESTE 1FN8A 2ANYA 3OX7U 1LHDH 1UVUH 3MNCA 4WVPE 2R3YA 3FANA 5EXNA 1O37A 1KY9A 1DOJA 1HAGE 1PPZA 4INKA 3OY5U 2BDIA 2VNTA 4BAKB 1RFNA 4NA9H 5FPSA 3SGQE 1S0RA 1T7CA 1TONA 1W14U 2D26C 3ZZAA 3STIA 1FQ3A 1ZGIA 5JDUB 2ZDAH 2KAIA 3LGWA 1HXEH 4HFPB 2B5TB 4YZUA 2GZ8A 3PO1C 3A80A 1LVOA 1T8OA 2A4GA 1C5XB 2OP9A 2ZEBA 1W10U 3MU8A 1P2QA 4Y8XA 1FY8E 1Y3WA 4A1VA 1K1PA 3RXDA 1O3NA 1QJ6B 3SBKA 2AGEX 4NG9H 3RXOA 3M5NA 1WQSA 1KSNA 2G00A 1B0FA 1MAXA 3QTOH 3KQEA 3C1KA 2GMTB 3RC5A 3UWIA 4BTIB 2BD7A 1DUEA 5A8ZA 1AHTH 1ELFA 1V2KT 3ZV9A 1FY3A 4AB9A 3V0XA 1GGDB 1QL7A 2F9UA 1LPGB 1D3QB 1TX8A 4XFQA 1D3PB 1J15A 4J2YB 4CBOA 2FIRH 3MNSA 3SJIA 1NU7B 3K2UA 1L4DA 1AU8A 2GCTC 1FV9A 1KIGH 1ZLRA 1O3IA 1O2NA 3BTME 2QGRA 1QNJA 9LPRA 1ETSH 1AI8H 3Q3XA 1F5KU 3ELAH 3EA8A 4I7YH 1TAWA 2XBWA 1GI0A 4X0WU 1BRAA 2Q6GA 4BNRA 2J38A 5T6DA 2HPQH 2WYJA 3FZZA 1O2TA 3UWJH 4A5TS 2NU0E 4F49A 1F2SE 2P59A 1AFQB 4JZEH 1UTLM 1SFIA 1GHBF 2C93B 2G55A 3IG6B 3QDZB 1G3CA 1QL9A 1QHRB 4ISHH 1BB0B 1G32B 2WYGA 3NWUA 3P8FA 1PPGE 4XE4A 3QO6A 1EXFA 3GCNA 4X6PA 1O2JA 2HPPH 2OCVB 1TQ7B 4TY7A 3SJOA 1ZSJA 2SGDE 2PW8H 3PM3A 1RTKA 3RMOH 4I8GA 4AB8A 4D9QA 1CVWH 2GDDA 3RXVA 3HPTB 3A7VA 1UO6A 4IW4E 2XYAA 2QXHA 2VH6A 4CH2B 1LVYA 1CHOG 3VGCB 2CMYA 3D65E 2D1JA 4IC6A 2F9BH
chains in the Genus database with same CATH superfamily
1MKWH 3BTQE 2GP9B 2XCNA 3L6PA 2AYWA 1HAHH 4YT6H 2V6NA 4DIHH 2IPHA 3IWMA 1O5AB 1ANEA 2A4RA 1OP8A 1IAUA 5F03A 5FPTA 1O2MA 1WYKA 4AG1A 1VR1H 1QA0A 1EZQA 4DGJA 1CGJE 3OAAD 4FU7A 1NROH 5DSFA 3TPIZ 1YY3A 1EAXA 3F9FA 3A83A 3DSOA 3NK8A 3P6ZB 2WSSD 3RC6A 1PPHE 4ABDA 2O8TA 2ZWLH 2G8TA 3SO3A 5KGOA 3GCTF 2PP6A 1MU6B 1TNLA 3GDSA 4GPGA 2BD5A 3KQCA 3LGIA 3KQBA 3URCA 3RLYH 3M36A 2GCHF 5E0HA 1YF4A 1O2UA 5DP3A 4Q63A 5E2OA 3N7EA 5EW1H 3VEQB 1BIOA 2BDGA 3QUMP 1XUGA 4O3UA 3UIRA 1O2VA 4RT0A 7LPRA 1GCDA 3A85A 1MTNC 2WPLS 3BTGE 2OC0A 2ZU3A 1P10A 2TGPZ 5K7RA 1TPAE 2TGTA 2VINA 4MPUA 3U8RH 4IMQA 2GVFA 1O38A 3EA7A 2OQ5A 1DXWA 1QBNA 3TGJE 1GHWH 4F4OC 3TJVA 1RIWB 1P2IA 3CP7A 1NU9A 3PMJA 2BDBA 1HAPH 1AY6H 1RTFB 4FUGA 3SW2B 1AMHA 4NGAH 1UVTH 4UDWH 2BY7X 4H42U 2RCEA 3OTPA 1TALA 4ABBA 1AE8H 2BY6X 4YT7H 1SBWA 1SGCA 1BOQA 1QA7A 1V2MT 3U98H 5HGGA 3SORA 1RRKA 1GBDA 1T8NA 2WV4A 3ATKA 4ZKNU 1ZZZA 4DVAU 1TGTA 3TVJB 1THSH 5I46H 1V3XA 1BTZA 1O5FH 2ODPA 5L6NH 2A4OA 1E37B 4I8KA 1PQ5A 4B2CA 2ZU2A 4ZROA 3RXGA 3FFGA 5L2ZH 1O2GH 1O2WA 2ZU1A 1G37A 3ZZ5A 2FOHA 1CU1A 4X1QU 1CE5A 1OHHD 3A7XA 1TIOA 2A0QB 8ESTE 8LPRA 5F8TA 1L1GA 1HAOH 1QRWA 1DM4B 1EZSC 1EFRD 4THNH 1QJ1B 4X1RU 4OGYA 1BZXE 1P01A 3U28C 5JYIA 4FUBA 1OWEA 1A0JA 5CDFE 1GBBA 1GMCG 2JETB 4NZLA 4B2BA 1TPPA 1P3CA 2J94A 3RXJA 4WMDA 1S6HA 1FY1A 2NU3E 2VB0A 3RMMH 3W95A 3TJNA 2FI4E 1O3GA 1XM1A 1XMNB 4MPWA 3UNRA 7ESTE 4Y0ZE 3T28A 1UK4A 1YM0A 4CRBA 1Y5BT 3LKWA 1K1JA 8GCHG 3F3BA 2ZFSA 4E05H 1ZRBA 2J9NA 3T2NA 1FAKH 1MBMA 2BB4A 2SFAA 2CK3D 2VIDA 3NUMA 1NRRH 5C0UA 3S9BA 2FOFA 4I86A 2A5IA 4HI3A 3MWIU 3RXKA 4X1SU 1E36B 3U1JB 1EOLA 3QX5H 1P57B 1V2ST 3VG8A 4BOHA 1ZSLA 2BY9X 4BAHB 2H1UA 1FLEE 4OS1A 1K1NA 2CF8H 1J9CH 1GL1A 2A31A 1T31A 3BEIB 1G2LA 4MNXA 1HJ9A 2Y81A 3OEHD 1YBWA 2WZQA 5A0BA 1KXCA 2ODQA 4KGAA 1EOJA 1LPZB 1RJXB 1TMUH 3I78A 1BBRH 1V2TT 2ZFQH 1EJAA 2GV7A 3JZ2B 1P05A 8KME2 1J17T 4Y0YE 4AGJA 5AF9H 2BVXH 1YPGH 1XUKA 1SOZA 1HV7A 2ZFRH 4MG3A 3K9XB 1ANCA 4RN6A 4B1TA 5BPEA 2PLXA 1ELTA 5L2YH 5JBAS 2ZGCA 1FN6A 5T6GA 2V35A 3P8OA 2QYIA 2L6OA 1L4ZA 1OWHA 2BLQA 1NRNH 1GI6A 2C90B 1T8LA 1YP9A 2YMSB 1HYLA 3RUOA 4YLQH 4OGXA 1BHXB 1ZRKA 3AK5A 1NC6A 2BD4A 4NZQA 5K0HA 1AO5A 2XRCA 4TPIZ 1TX6A 1L2EA 1D6WA 4GAWA 1QFKH 4UEHH 1YC0A 1QRXA 5ESBA 2ZP0H 4JYUH 1BTUA 1OOKB 1X7AC 2BM2A 2VWNA 1SGFG 3MI4A 1ETRH 1QIXB 2SGEE 1VITG 5I25A 2VH0A 3GDVA 5FX6A 1ABIH 1HAVB 4BAMB 1C2JA 2WPMS 1CA0C 1W12U 1HGTH 1FUJA 2QXGA 2KM0A 4ABFA 3WWFA 1SR5C 4MNWA 1TOMH 4YOIA 4D76A 3ATIA 4VGCB 4X2VA 1A3EH 1PPEE 3PWBA 1O2HA 1RD3B 1GG6B 2KCAA 2BVRH 1DSUA 2BMGB 2B0FA 3LGTA 4FVBA 1HRTH 3PWCA 1AGJA 1H8HD 2GJGA 3H5CB 2BLWA 2ZHEH 3BTHE 2RDEA 2AIPA 4U01A 2BLVA 2WV9A 1PYTC 5IYTA 3SJKA 2P95A 4YM9A 2J34A 3ZZ6A 1C2HA 1Y5UT 1CHGA 3S7HB 3BTFE 5A2MH 2SGAA 3GCHB 2O9QA 2SGPE 2JH6D 1DY9A 1GI2A 1O3AA 2IPQX 2P3TB 1D4PB 4UFGH 2ZDNA 4INLA 3SU4A 1QR3E 3MQKC 5ETXA 1WCZA 2WV5A 3P8NA 3SI3H 5FAHA 1HBTH 2HVYB 3BTWE 1Z1IA 2C3SA 1C5VA 2FM2A 3SV2H 5A0CA 5TCAA 1EQ9A 1TWXB 1VCQA 2VWLA 4ZUHA 1CGHA 2C8XB 4X2YA 3DT0H 4OS6A 1V2NT 3U9AH 1DICA 1SKYE 1Z71A 2WPJS 1QBVH 2ZPQA 3BG4C 4IBLH 3CNRA 1MKXK 1BTWA 3B23B 3ODDA 2IJD1 1FY5A 5ABWA 3PTNA 1OYQA 3F2FA 2P16A 1P11E 3N99A 3F1SB 4MPVA 4JZIA 4ZKSU 3SGBE 1Z7KA 3SU6A 1L1JA 3ZVBA 1GWAA 1YLDA 3WY8A 1G3EA 1QB1A 3QLPH 4Q7XA 1RXPA 1O3BA 3SI4H 2QA9E 3H7TA 4XOJA 2TIOA 1EATA 2SGFE 1T8MA 1BJUA 1CT2E 1MU8B 3DSGA 4RI0A 1K28D 2A2QH 2H2ZA 1WBGB 4ABEA 4SGAE 1UK2A 4NA8A 4CRCA 3F2GA 1XKBC 3EE0B 1GHYH 4X8SH 1AKSA 4JZ1A 1NN6A 1O35A 1YCPH 2RDLA 1V2JT 2EI8A 1EP5A 3VB7A 1XKAC 1GHAG 1AQ7A 3ITIA 1H4WA 1O2YA 2R2MB 5GNDA 3DFJA 4TPYA 4IN1A 2Z6BD 5CHAB 2GKVE 4ABGA 2UUJB 2VVUA 3GCOA 4ZKOU 1QB6A 3B8JA 2UWPA 1VGCB 3M5OA 2JKHA 5FCKA 3M61U 1EAUA 2ZDMA 3E6PH 2SNVA 5C1XA 2BX3A 3PB1E 1GI8B 1S82A 2OC7A 2AH4X 3MU5A 1O36A 3TGIE 3NPSA 2HNTC 1ORFA 1ZOMA 4Q7ZA 1IQLA 3GY2A 4Q4LA 1U6QA 2FOBA 4CHAB 2VWMA 1NFUA 1TPSA 3M7QA 1EX3A 4RKOB 4FUJA 1F7ZA 2OINA 1NBMD 1OWJA 3RLWH 3L3TA 1TNHA 1AVWA 3PLBA 3I29A 1K0HA 3MH5A 1L1NA 2GZ7A 3GYMA 1AWHB 1BUIA 1GJ4H 3LJJA 1LHEH 1RGQA 1GI3A 1W7XH 3TIUA 3H7OA 1QRZA 4E7NA 3BEUA 3E3TA 3SV6A 2XNDD 3MO9A 3LDXH 1YPHE 1MTWA 1BRUP 3UAIC 4X8VH 3PMAB 1HIAA 4FU8A 1OWKA 2YOLA 5EJZA 1W0ZU 3F9HA 1GJ5H 3PV5A 2Z9IA 1EASA 1UTKA 3MU1A 1MAYA 3HATH 4X1PU 4B76A 1C9PA 4IS5A 4A7IB 3S0NA 4P02A 3A82A 1K22H 2V3OH 1G3BA 2CXVA 4WY3A 3A86A 1SOTA 1JIMA 3TH3H 5A8XA 2R3UA 2GX4A 2FYRA 3RM2H 1GMDG 1QURH 1INCA 1ELCA 4GSOA 3KL6A 3D23A 4WH6A 2P93A 4K1SA 2JH0D 1AIXH 4AX9H 3KEEA 4XBDA 1NFWA 4NSVA 4ACAA 2FOAA 4Y71A 4I31A 2K8IA 1LDTT 5C17A 2ANKH 1ID5H 1SC8U 3GY6A 3UOUA 3G01A 3JZ1B 3QTVH 1THPB 1DWBH 4E06H 4M9FA 4TYDA 3ENSB 4YOGA 2GMTC 1BMFD 1GVZA 3TK5A 2XC4A 3ZVGA 1P2KA 2FOMB 2ALVA 1GBTA 2ZTZA 2V0BA 3O8DA 1Y3VA 5FXLA 2ESTE 3SQHE 4I33A 2J95A 2C8WB 1GGDC 1Z8IB 1ELBA 4K5ZA 1Y3UA 1KMHB 4IN2A 1KLIH 2HVXA 4K1TA 1HXFH 1XXDA 1FPCH 2JIZD 4WJG2 1SGYE 3MOCA 2NU2E 1O2KA 5GXPA 3F68H 1A7SA 1YLCA 2BQWB 1O0DH 3MH4A 5HKKD 5A09A 2ZQ1A 3UY9A 1DWCH 1O3DA 1CQQA 2VJ1A 1W11U 1C2FA 2STAE 3GDUA 4FUFA 1P04A 2DUCA 3RXPA 1O2OA 1GBLA 1WQVH 1NTPA 1C5NH 1MTVA 2D8WA 1SGRE 2Z3EA 1K2I1 2Z9GA 1P3EA 1EP6A 1ELGA 2KZ4A 3PMBB 3M7TA 1GI5A 1DXPA 3LU9B 3RDZA 4X1NU 2CHAB 1C2LA 1D6RA 1DWEH 2OC1A 1ARCA 1BTYA 1AWFH 3TNSA 1NM6A 2STBE 4DG4A 1IQEA 1ZYOA 2OC8A 2AEIH 4ZHLU 4AG2A 4JK5A 3RXSA 2BXTH 3PV2A 2KFWA 2VU8E 1TA2A 2TRMA 2Z9LA 1WTGH 1HUTH 3MTYA 1HJAB 2P8OB 3RU4T 3U1IB 4ZKRU 1GHBG 3F0PA 2ANMH 4XBCA 4Q2KA 5HXFA 4AFZA 1N6YA 4WXIA 1O3MA 1C1SA 3DD2H 3VGCC 1YWUA 1UHBB 3BTEE 2ZGHA 4B2AA 1CHOF 2BDYA 1YGCH 3NXPA 4ASHA 4DIIH 1DWDH 2BY8X 1ACBE 3GOVB 2FPZA 5DGJA 1XUIA 3QWCH 3SNCA 1CO7E 1LVBA 1B0EA 2Z9JA 1HAVA 1IHSH 2FX4A 2IN2A 2BTCE 4XD7D 1F0UA 1QQ4A 3ZVDA 1S0QA 1C5TA 2PKSB 4KTSA 1BRBE 2K1QA 2WPHS 5HM2A 1MD8A 3NCLA 1W0KD 7KMEH 3AASA 2K0QA 4DOQA 2Y5HA 2WPKS 1NT1A 4FUHA 1VZQH 1FPHH 5PTPA 1W0JD 1TFXA 5KEDA 2GT8A 1D3TB 1GDUA 4Y7AA 4TWYA 1UTJA 1UCYH 2A1DB 2CN0H 3A88A 1GVLA 2ALPA 1UTQA 3VB4A 5EPNA 1O3CA 2F9VA 3QGJA 2KR7A 3HKIB 1FIWA 1ZJDA 2R2WU 4INHA 1AKSB 4WMEA 5DG6A 2FS9A 1HAIH 1ARBA 5JB8S 1OYTH 2GCHG 2LNCA 1P2MA 3ESTA 2KX4A 3ZVCA 4MTBA 4GVUA 4YESB 3FAOA 2C8YB 2ZFTA 2G81E 4GUXA 3T62A 1C1WH 1C1TA 1V2LT 2F4LA 4WH8A 4E7RG 6GCHG 1RIWC 2A2XH 4H4FA 2Y7XA 1O2RA 2NU4E 4O9VA 2EQNA 3LGVA 3A81A 1FXYA 1B7XB 2BZ6H 4ZCNA 1CGIE 3R3GB 4ABHA 3TJOA 4O97A 1TABE 1Z8RA 1P12E 4AC9A 1FNIA 3KN2A 2BQ7B 1HAYB 1F5RA 1IQNA 1SGNE 1GMHG 3DFLA 2ZU4A 4UE7H 2H9EH 1KDQB 4DY7B 1ABJH 1MTSA 3VB6A 4O03A 2ILNA 2LP6A 1HIAB 3SNAA 2UWOA 4R0IA 5E0GA 3MMGA 5J4QA 3LJOA 2PKAA 1DANH 2A5AA 2WINI 1BT7A 1ESTA 1ZTLA 2FX6A 2NWNA 4ZHMU 3UTUH 3RC4A 1LQDB 1N1LA 6CHAB 3QN7A 1P9UA 2BZAA 4LK4A 1O3JA 2ZIQH 1AB9B 4P00A 1IQHA 4NIXA 2ZO3H 2Y6TA 1O33A 2JETC 1O2IA 4ISOA 1NESE 1DSTA 4A6LA 2XXLA 2PUXB 5EGMA 2L74A 4YO9A 7GCHF 1GMCF 1DS2E 5TJXA 1FDPA 1JOUB 1MMJN 1QB9A 1O32A 4ABAA 1C1UH 1P0SH 1C1MA 3A7WA 2QAAA 5GIBA 1O5CB 3A7YA 3MYWA 4BTUB 2AIQA 3P17H 4B6FA 1QJ7B 3D62A 2TGAA 1S84A 3SV9A 1C5UA 4ZXYH 8GCHF 1GPZA 3DSPA 4K8BA 3LC5A 3LIWA 3SNEA 1HCGA 2ZNKH 3OSYA 3VPKA 4BTTB 1GJCB 3DA9B 3C27B 1GL0E 1C2GA 2TPIZ 3SUGA 1W0YH 2Y5GA 3Q3KA 1G3DA 3PV4A 1H8ED 3AW1A 1P8VC 4D9RA 1TBRH 3SYJA 1MKWK 5FPYA 1GJ8B 1Q3XA 2SGQE 1P9SA 2QE7D 3GS9A 1Y5AT 4A1TA 2IOTA 4M7GA 3SJ9A 4XSKU 3ZZ9A 2PSYA 1BMAA 3S9CA 3Q3YA 1D9IA 3BG8A 3BIVH 1NZQH 1O3FA 2OXSA 5CMXH 1KXBA 2BXUH 1EB1H 4NCYA 2GZ9A 4UFEH 2J92A 1PQ8A 2VIPA 1OP0A 2ZPSA 2AGGX 2ULLA 3KYFA 3LONA 2RFKC 4OS4A 1TNIA 1PQ7A 1O31A 3UPEA 4BXWA 1N6XA 1MUEB 3PYHA 1ZPCA 1S6LA 1XUFA 1Y3YA 5GCHG 5DP8A 1PFXC 2UUKB 3OY6U 4OS5A 1BTHH 3E0NB 3F6UH 2ZGBH 2A45B 3LGYA 3MH7A 5FHTA 2OLGA 1EJMA 1PYTD 3T5FH 2J2UA 1SQOA 2YMSC 5HM9A 4ZMAH 2XWBI 1T4VH 3RM0H 3ZVEA 3E8LA 1V2UT 4I8LA 1Q2WA 1XUJA 1ZHMA 1V2QT 2W5EA 1ANDA 2OK5A 1UJ1A 1YCPM 2BD8A 3N7OA 1GJDB 2G4TA 1F0RA 4LZ4B 1KXFA 1GCTB 2XBVA 1K21H 4NA7A 5EW2H 5DP9A 2QCYA 3L33A 3CS7A 3RXMA 3SV7A 1CT4E 4TT3D 5DPAA 2UWLA 2XNIA 2CGAA 1NS3A 2SNWA 1YPEH 3WWBA 1UTMA 1TNGA 4U2WA 1VITF 3A84A 1IOEA 5AFZH 3TLOA 5EXLA 2Y82A 1VJ9U 1OXGA 4QT8C 1ANBA 3UQVA 1V2WT 3RXRA 1DLKB 4VGCC 4KP0A 3DUXH 2PV9B 1GHXH 1GG6C 2D2DA 1MZAA 1ZGVA 2F9NA 1THRH 4NFEA 1IHTH 1SGTA 1HAXB 1C1OA 1SVPA 2QF4A 5H4IB 2A32A 2C4FH 4GHQA 5JBBS 5HIZA 3Q77A 2HRVA 4HGCA 1AUTC 1TOCB 2G5VA 1V2PT 1W2KH 1TBZH 1UVOA 1S81A 1ZR0A 2FI5E 2BQ6B 2UUFB 2Q1JA 3GCHC 3F2HA 5LPEA 2AFQB 4X2XA 1C4V2 3NKKA 3SV8A 4AFQA 2F9PA 2V3HH 1SPJA 4OS7A 1LHCH 2BDCA 1C1NA 2Y7ZA 1CBWB 2KCPA 4GCHG 2OD3B 3Q00A 2EI6A 2RG3A 3WW7A 3FZDA 1ZSKA 1PQAA 2ZC9H 2WUCA 1F5LA 4Y6DA 5F53A 4K69A 4I8JA 5KECA 2TBSA 4CRFA 3KQDA 1AZZA 1HDTH 1UHBA 1OP2A 4ZAEA 2BYAX 3VXEH 4ACBA 1O3LA 4GLYA 1N8OB 1SQAA 3U8TH 4K2YA 3EA9A 3CS0A 3TU7H 3O8CA 5E2PA 4BAOB 4XRNA 3V3MA 3TJUA 1EPTB 2XC5A 1QGFA 3MNBA 5HMAA 5SGAE 2FO9A 2PTNA 5GDSH 4YOJA 1Z6EA 1P06A 2CJIA 3M3VA 3TH2H 3E1XB 1GHZA 1O5DH 2GTBA 2PKAB 2FLRH 1J14A 2OBOA 2ZCKP 5GPIB 1OWIA 3TNTA 2P94A 3K6YA 1G9IE 9ESTA 1GBKA 2J97A 1KXEA 4B74A 4HTCH 2HALA 2J98B 4ZXXH 2QIQA 5C67A 3RXIA 3UUZA 1F0SA 5E8EH 1DY8A 5C1YA 1BBRK 5G4BA 2ZQ2A 4WF8A 2BVSH 1H1BA 2BD3A 1GHAF 4Y8YA 2F9OA 5CHAC 1SB1H 3FKSD 2V3MA 2VIOA 3K65B 1CA8B 3RP2A 1AUJA 1VGCC 1KTSB 1ESAA 1YPJH 1IQJA 4H6SB 2LELA 4ISNA 3RXEA 1ELVA 2Q6DA 4Y8ZA 2GV6A 1A5IA 3MH6A 3PLKA 2JJ2D 3KGPA 2HNTF 1C4Y2 4AOQA 4CHAC 4K3JA 2W6ID 4CH8B 2VGCB 3BEFB 4WXVA 5GWZA 1W8BH 5E0JA 4AYYB 1GJAB 5CHBA 5A0AE 5T3HA 5JBCS 2H5CA 1O30A 2FZZA 4MNYA 1L0ZA 2W3IA 1MBQA 2F43B 2Z3DA 3EDXB 4KKDA 1YKTA 4B6EA 1H8IH 3LOXA 3TITA 1KDQA 4K8YA 1DLEA 2PHBA 1P09A 3HKJB 5DKMA 1ZPBA 5LGOA 3ZVFA 2BOKA 1FX0B 3QGNB 4U30A 3LH1A 4O3TA 2FI3E 2ZHWH 5EG4A 2O8UA 3TK6A 1BTXA 4IC5A 2YNAA 4FOUC 3SGAE 1ZJKA 4NSYA 2FTMA 3P92A 2BD9A 3ZZBA 2AS9A 1T32A 1NO9H 1MZDA 3M35A 1LHFH 2FDAA 2O8LA 3UFAA 4XDEA 3ZZDA 4R8TB 3UB0A 2W3KA 1C1PA 2P3UB 1TPOA 4NIWA 1BITA 2AGIX 2GD4B 1DX5M 6LPRA 1Q31A 3SNBA 2PUQH 1DUAA 2BDAA 4X6MA 2DE9A 2O8MA 2QN5T 3RXTA 1NPMA 3PROA 3EE7A 3M3SA 1C5PA 1GBFA 1GMDF 3FVFB 2UUYA 4X8UH 4Y10E 4FU9A 3KQ5A 1B5GH 3NZIA 3F0OA 1LVMA 2ZGJA 3ODFA 1F0TA 4A1XA 1CT0E 5JB9S 3O8RA 1TGSZ 1GDNA 4KTCA 1TRYA 1K9OE 1J16A 2H5DA 1GBCA 2ZFPH 1WOFA 1C2EA 1O2XA 2OBQA 1SG8B 2OQUA 1O5GH 1COWD 1DPOA 2O8WA 1SLUB 2ANWA 1ZHPA 1SGDE 1XUHA 3S7KB 1AVXA 1NRQH 5C1UA 5F8ZA 3PO1B 2ZI2H 1UTPA 4MQAA 1SL3A 1C5SA 2BX4A 5C2ZA 1FJSA 4KELA 3E90B 3UOPA 1O2PA 5EQRA 3A8AA 3UNQA 2PFEA 1E79D 2AHME 4ABJA 3E16B 1LCYA 1GVKB 3D49H 3BIUH 2ZDLA 2ZDVH 1LQEA 1SQTA 1ETTH 2H9HA 2BDHA 2BHGA 4FUEA 3UR6A 1P2NA 2F83A 4BXSA 4Q80A 5LPFA 4RSPA 3T27A 2LPRA 5DJ7A 1O34A 1WSSH 4ZH8A 3ZVAA 2QY0B 5DN6D 1S6FA 3RU4D 2CHAC 3V12A 4Y79A 3DCLA 3MO3A 2XCFA 4AGKA 1E0FD 2GCTB 3FP6E 1M9UA 1W3CA 1AFQC 2VIQA 1TRMA 1BMNH 1ELAA 1W7GH 2AMPA 4RKJB 1C2KA 3ZV8A 1A5GH 3I77A 3RXFA 3B9FH 1WAYB 3K6ZA 1C1RA 1AN1E 1KYNA 1NFXA 2W7UA 1BDAA 1A46H 1HJAC 2P8OC 4D8NA 1H9HE 2ODYB 2THFB 3LPRA 3W1EA 3QZQA 1UTNA 1RS0A 1S85A 2R9PA 1SFQB 2F91A 3BTKE 4Y7BA 4BANB 1C5LH 1JMOH 3SUEA 2KCYA 1SLVB 5EPYA 1YLNA 3A89A 3T26A 5IDKA 1EZXC 2XOKD 1YCPK 2M5TA 5DK1A 2JDID 4FUCA 3N7DA 2FESH 2FOGA 1PPCE 1JXPA 1ZPZA 1ELDE 3ATWA 1WUNH 2VVCA 5F6MA 2ZPRA 2ZCLP 4CRGA 1VCPA 1IQMA 1RTLA 2PKSC 2ZCHP 4XBBA 3KCGH 4I32A 2GT7A 1TMTH 3URDA 5FBEA 1KXDA 1HAZB 2PGQB 4X2WA 2EC9H 4HZHA 1WU1A 1SGPE 2XTTB 4UD9H 5EQQA 5EQSA 5GJ4B 1P02A 4F55A 1FIZA 3SHAH 3RMNH 4K1EA 1K1LA 1LKBA 1SGFA 1A5HA 3GISB 1ZMNA 3SN8A 2PR3A 5AFYH 2ZHQH 2PSXA 3OTJE 4U32A 1IQIA 1GBHA 4FXGH 1TMBH 3BTDE 2EI7A 3EYDA 3GCTG 1C5QA 1WXRA 1E38B 2H6MA 3GY5A 1SSXA 2Z94A 2B7DH 3GY4A 1C1QA 3T29A 3GY7A 1O2SA 1TA6A 2PWXA 3MU4A 2YNBA 2QXJA 1SMFE 2HNTE 2W6JD 3TK9A 5EOKA 2HLCA 4FUIA 3KHVA 1C1VH 1MD7A 3S69A 3Q76A 2XW9A 4RT1A 3ZZ7A 2FODA 4Z6AH 1UMAH 1G2MA 1VCWA 1C5YB 1WDIA 1OSSA 2W26A 1MABB 4AFUA 3CENA 3RXCA 4NWKA 3IITA 4CRAA 1G30B 1GBIA 1ZTJA 3VFEA 1ZMLA 1EB2A 1SQRA 1MTNB 3FP7E 1O3PB 6GCHF 3LT3A 2TGDA 5B6OA 1O5BB 2JJ1D 2B9LA 1GBMA 2BOHB 3RXUA 1LO6A 5C3NA 2ZHFH 1JRTA 2A5KA 1UCYE 3AAUA 2ZDKA 1C5OH 2Z7FE 1XX9A 2GGVB 2ZZUH 3EQ0H 3HK3B 4AORA 1Z8GA 1OPHB 3BN9A 2WPDD 2VVVA 2ZG0H 1GHVH 5BRRE 3F9GA 3P70B 3P95A 1EPTA 3UQOA 1C5MD 2HLDD 2AMQA 2EEKA 1GMHF 1C2MA 1GJBB 3BV9B 3M37A 3RXLA 3A8BA 1JBUH 2A4QA 4AFSA 5JBTA 2GDEH 4CREA 1ZTKA 1NFYA 2CF9H 1JWTA 1OKXA 4UFFH 1WTHD 3M3TA 1GBAA 1MH0A 2HGTH 5HYOA 1JRSA 1OWDA 2G5NA 3GICB 1TNJA 2FYQA 2ZECA 1NBME 4TY6A 6CHAC 3MNXA 1J8AA 1O5EH 4TWWA 4DT7B 1AB9C 1GBJA 3SU0A 2J98A 2BY5X 2QC2A 4X8TH 4JMYA 3OU0A 4UFDH 2RA3A 1O3EA 5EODA 1JIRA 5FBIA 1IQKA 1C4U2 1UVPA 3TH4H 4WMFA 3FP8E 2QV1A 1TNKA 2QF3A 1TBQH 1V2OT 4B71A 1TQ0B 3KNXA 1V6DA 4FVDA 4BAQB 1IQGA 5LH8A 2Y80A 1YPKH 7GCHG 3SU2A 4LXBH 3M5LA 1YPMH 1F92A 2KAIB 1ESBA 4CR9A 1NRPH 4X6OA 3E0PB 5EJLA 4WWYA 1BJVA 3V13A 1H8DH 1OS8A 1MKXH 1VKYA 2H9TH 3GY8A 1BA8B 1KTTB 4H6TA 1O2QA 1TB6H 2YMSD 1AZ8A 1C5WB 4IMZA 2BD2A 1Y59T 1LHGH 1QTFA 3KYGA 3PRBA 4YLUA 4MPXA 2OUAA 3OE7D 1DT2A 4MLFB 3LGUA 2Q6FA 2FEQH 4Z0KA 4UONA 2I6SA 1Y8TA 1OX1A 1IQFA 1MCVA 1UK3A 2ZF0H 3GY3A 1HFDA 3KF2A 1TRNA 4ISLA 1PPFE 1QZ8A 1GJ7B 1C9TA 3TGKE 3UREA 3BSQA 1H9IE 3SU1A 3SU3A 3RMLH 1QY6A 1SI5H 5C5OA 1FAXA 2XBXA 2Z3CA 5AHGH 2FLBH 2C8ZB 2VIWA 4B73A 2FOEA 1FZZA 1AVGH 1GDQA 3RXAA 1FMGA 3A8CA 5C94A 1ELEE 2ZTXA 3DHKH 2BLOA 3VB5A 3PTBA 3SOSA 5A8YA 5L30H 1GBEA 1SLWB 3VXFH 1SHHB 3HGNA 1TX7A 2I6QA 4D7GA 3W94A 5CE1A 1HB0B 5EIYA 5DP4A 5EU8A 1S5SA 5GCHF 5DP5A 1Z8JB 2QXIA 3BF6H 4CBNA 2IJOB 1O2ZA 1QL8A 4I8HA 4KTUA 1O3KA 2FWWA 4ZHAA 1DE7H 1YPHC 1UCYK 4B75A 5FX5A 1MCTA 1MQ5A 1TGCA 1BHXF 2WHXA 3LH3A 4DURA 3MU0A 3RU4E 2R0KA 3V7TA 1FI8A 4JYTA 1GCTC 5DO4H 2FP7B 2Z9KA 1QCPA 1O2LA 2ZHDA 5LPRA 1BBRE 1BRCE 4FUDA 1EAIA 1D3DB 1AFEH 5EXMA 4JZFH 1C5RA 3M7UA 1EJNA 1CSOE 1BQYA 1GI4A 2M2AA 5B6LA 3AVZA 3VB3A 4DW2U 2P3FH 2AERH 2A7CA 5J4SA 1TYNA 1DVAH 3SNDA 4A92A 2JH5D 1G36A 1XVOA 2ZU5A 1HNEE 1LMWB 2FXRA 2XBYA 3F9EA 1AE5A 1A3BH 1A1RA 2HWLB 3SHCH 1CA0B 1EKBB 4AZ2B 4IGDA 3S9AA 1K1OA 3ZYEA 3U8OH 1UTOA 1V2VT 1GI7B 2FTLE 3RXBA 1P2JA 3STJA 1Z1JA 3KIDU 1Z6JH 1UW7A 3ZYDA 5EJ1A 1DFPA 5HIYA 2ZTYA 2Y5FA 4K60A 2QF0A 2QF5A 4Q7YA 5FCRA 4ISIH 2VBCA 1CBWC 1FONA 4MNVA 1O3OA 3ATLA 3ZZ8A 1A0HB 3MFJA 4DJZB 1BMMH 3ZZCA 3EAJA 1NY22 1SGEE 4GCHF 4ESTE 1C5ZB 3SQEE 3PLPA 1GJ6A 3M5MA 1E34B 1GI9B 2NU1E 3HGPA 1O3HA 4OS2A 1PJPA 3ZZ3A 1W13U 1SHYA 3QZRA 3FOAA 4NIVA 3SU5A 1H9LB 1N8OC 1SGIB 1QQUA 4JZDH 3BTTE 3O8BA 3AW0A 3PMHB 4Y11E 1T4UH 2A7JA 1A0LA 3ATMA 2AMDA 4ASUD 4NIYA 1A2CH 4X6NA 2W7SA 1O39A 2FMJA 1EPTC 1NRSH 4YTAA 3A7TA 1BTPA 4GHTA 4MVNA 1V2RT 2PTCE 3SUDA 5C20A 1E1RD 2XWAA 1BMLA 1E35B 2VIVA 1HLTH 5TCCA 3BG4B 4CRDA 1P2OA 1YYY1 2ZA5A 4J1YA 1MTUA 3T25A 2VWOA 2G52A 3U69H 5C5NA 2J4IA 2ZFFH 2WUBA 1LPKB 3SZNA 3AAVA 3ZZ4A 4LOYH 1ZHRA 6ESTA 1S83A 3A8DA 3QK1A 1KXAA 1A61H 2ASUB 2FS8A 3RXHA 3ZIAD 2B8OH 3LC3A 3A87A 2DE8A 2FOCA 5AVDA 2OTVA 1EUFA 3E91A 4JCNA 4LZ1H 1Y3XA 5FL7D 1DDJA 2V7QD 1FY4A 2XC0A 4ABIA 2J5UA 1XVMA 1YPLH 1KLTA 4CR5A 3UNSA 5T6FA 3OYPA 3R0FA 2A7HA 2RA0A 2WPIS 1VJAU 1PPBH 2ZKSA 4DCDA 1TE0A 2EY4C 4AYVB 1UVSH 1A4WH 4JK6A 3SJ8A 4D7FA 1TGNA 3OFND 1GJ9B 1SGQE 5DP7A 5DP6A 2HOBA 1P03A 3HK6B 1MQ6A 2VGCC 2G51A 1LKAA 4Y76A 1BCUH 2EA3A 3P8GA 1C2DA 2CV3A 3SUFA 1KLJH 1TLDA 4NFFA 1C2IA 4AN7A 1TGBA 3GYLB 4DT4A 1XXFA 3RXQA 4NWLA 1HJ8A 1K1MA 1HPGA 1ZMJA 2G4UA 1QBOA 4PROA 3UR9A 1GI1A 1SLXB 4MDSA 1LTOA 2R0LA 3FO8D 3MO6A 1WV7H 4JYVH 4SGBE 2PGBB 5JPMH 4YXWD 1DITH 3EGKH 3MHWU 1VITH 1AD8H 1K1IA 1EZUC 5F8XA 3A7ZA 1EAWA 2F3CE 2ZGXH 5ESTE 1FN8A 2ANYA 3OX7U 1LHDH 1UVUH 3H09A 2KCOA 3MNCA 4WVPE 2R3YA 3FANA 5EXNA 1O37A 1KY9A 1DOJA 1HAGE 1PPZA 4INKA 3OY5U 2BDIA 3FN8A 2VNTA 4BAKB 1RFNA 4NA9H 5FPSA 4OM9A 3SGQE 5T1VA 1S0RA 1T7CA 1TONA 1W14U 2D26C 3ZZAA 3STIA 3SZEA 1FQ3A 1ZGIA 5JDUB 2ZDAH 3PRDA 2KAIA 3LGWA 4F48B 1HXEH 4HFPB 4Z1MD 2B5TB 4YZUA 2GZ8A 3PO1C 3A80A 1LVOA 1T8OA 2A4GA 1C5XB 2OP9A 2ZEBA 1W10U 5C0TA 3MU8A 1P2QA 4Y8XA 1FY8E 1Y3WA 4A1VA 1K1PA 3RXDA 1O3NA 1QJ6B 3SBKA 2AGEX 4NG9H 3RXOA 3M5NA 1WQSA 1KSNA 2G00A 1B0FA 1MAXA 3QTOH 3KQEA 3C1KA 2GMTB 3RC5A 3UWIA 4BTIB 2BD7A 1DUEA 5A8ZA 1AHTH 1ELFA 4TSFD 1V2KT 3ZV9A 1FY3A 4AB9A 3V0XA 1GGDB 1QL7A 2F9UA 1LPGB 1D3QB 1TX8A 3OEED 4XFQA 1D3PB 1E1QD 1J15A 4J2YB 4CBOA 5IK2D 2FIRH 3MNSA 3SJIA 1NU7B 3K2UA 1L4DA 1AU8A 2GCTC 1FV9A 1KIGH 1ZLRA 1O3IA 1O2NA 3BTME 2QGRA 1QNJA 9LPRA 1ETSH 1AI8H 3Q3XA 1F5KU 3ELAH 3EA8A 4I7YH 1TAWA 2XBWA 1GI0A 4X0WU 1BRAA 2Q6GA 4BNRA 2J38A 5T6DA 2HPQH 2WYJA 3FZZA 1O2TA 3UWJH 4A5TS 2NU0E 3NRLA 4F49A 1F2SE 2P59A 1AFQB 4JZEH 1UTLM 1SFIA 1GHBF 2C93B 2G55A 3IG6B 3QDZB 1G3CA 1QL9A 1QHRB 4ISHH 1BB0B 1G32B 2WYGA 3NWUA 3P8FA 1PPGE 4XE4A 3QO6A 1EXFA 3GCNA 4X6PA 1O2JA 2HPPH 2OCVB 1TQ7B 4FETA 4TY7A 3SJOA 1ZSJA 2SGDE 2PW8H 3PM3A 1RTKA 3RMOH 4I8GA 4AB8A 4D9QA 4HG6A 1CVWH 2GDDA 3RXVA 3HPTB 3A7VA 1UO6A 4IW4E 2XYAA 2QXHA 2VH6A 4CH2B 1LVYA 1CHOG 3VGCB 2CMYA 3D65E 2D1JA 4IC6A 2F9BH
chains in the Genus database with same CATH topology
1MKWH 3BTQE 2GP9B 2XCNA 3L6PA 2AYWA 1HAHH 4YT6H 2V6NA 4DIHH 2IPHA 3IWMA 1O5AB 1ANEA 2A4RA 1OP8A 1IAUA 5F03A 5FPTA 1O2MA 1WYKA 4AG1A 1VR1H 1QA0A 1EZQA 4DGJA 1CGJE 4FU7A 1NROH 3TPIZ 1EAXA 3F9FA 3A83A 3NK8A 3P6ZB 3RC6A 1PPHE 4ABDA 2O8TA 2ZWLH 2G8TA 3SO3A 3GCTF 1MU6B 1TNLA 3GDSA 4GPGA 2BD5A 3KQCA 3LGIA 3KQBA 3URCA 3RLYH 3M36A 2GCHF 5E0HA 1YF4A 1O2UA 5DP3A 5E2OA 5EW1H 3VEQB 1BIOA 2BDGA 3QUMP 1XUGA 4O3UA 3UIRA 1O2VA 7LPRA 1GCDA 3A85A 1MTNC 2WPLS 3BTGE 2OC0A 2ZU3A 1P10A 2TGPZ 5K7RA 1TPAE 2TGTA 2VINA 4MPUA 3U8RH 4IMQA 2GVFA 1O38A 3EA7A 2OQ5A 1DXWA 1QBNA 3TGJE 1GHWH 4F4OC 3TJVA 1RIWB 1P2IA 3CP7A 1NU9A 3PMJA 2BDBA 1HAPH 1AY6H 1RTFB 4FUGA 3SW2B 1AMHA 4NGAH 1UVTH 4UDWH 2BY7X 4H42U 2RCEA 1TALA 4ABBA 1AE8H 2BY6X 4YT7H 1SBWA 1SGCA 1BOQA 1QA7A 1V2MT 3U98H 5HGGA 3SORA 1RRKA 1GBDA 1T8NA 2WV4A 3ATKA 4ZKNU 1ZZZA 4DVAU 1TGTA 3TVJB 1THSH 5I46H 1V3XA 1BTZA 1O5FH 2ODPA 5L6NH 2A4OA 1E37B 4I8KA 1PQ5A 4B2CA 2ZU2A 4ZROA 3RXGA 3FFGA 5L2ZH 1O2GH 1O2WA 2ZU1A 1G37A 3ZZ5A 2FOHA 1CU1A 4X1QU 1CE5A 3A7XA 1TIOA 2A0QB 8ESTE 8LPRA 5F8TA 1L1GA 1HAOH 1QRWA 1DM4B 1EZSC 4THNH 1QJ1B 4X1RU 4OGYA 1BZXE 1P01A 5JYIA 4FUBA 1OWEA 1A0JA 1GBBA 1GMCG 2JETB 4NZLA 4B2BA 1TPPA 1P3CA 2J94A 3RXJA 4WMDA 1S6HA 1FY1A 2NU3E 2VB0A 3RMMH 3W95A 3TJNA 2FI4E 1O3GA 1XM1A 1XMNB 4MPWA 3UNRA 7ESTE 4Y0ZE 3T28A 1UK4A 1YM0A 4CRBA 1Y5BT 3LKWA 1K1JA 8GCHG 2ZFSA 4E05H 1ZRBA 2J9NA 3T2NA 1FAKH 1MBMA 2BB4A 2SFAA 2VIDA 3NUMA 1NRRH 3S9BA 2FOFA 2A5IA 4HI3A 3MWIU 3RXKA 4X1SU 1E36B 3U1JB 1EOLA 3QX5H 1P57B 1V2ST 4BOHA 1ZSLA 2BY9X 4BAHB 2H1UA 1FLEE 4OS1A 1K1NA 2CF8H 1J9CH 1GL1A 2A31A 1T31A 3BEIB 1G2LA 4MNXA 1HJ9A 2Y81A 1YBWA 5A0BA 1KXCA 2ODQA 4KGAA 1EOJA 1LPZB 1RJXB 1TMUH 3I78A 1BBRH 1V2TT 2ZFQH 1EJAA 2GV7A 3JZ2B 1P05A 8KME2 1J17T 4Y0YE 4AGJA 5AF9H 2BVXH 1YPGH 1XUKA 1SOZA 1HV7A 2ZFRH 4MG3A 3K9XB 1ANCA 4RN6A 4B1TA 5BPEA 2PLXA 1ELTA 5L2YH 5JBAS 2ZGCA 1FN6A 5T6GA 2V35A 3P8OA 2QYIA 1L4ZA 1OWHA 2BLQA 1NRNH 1GI6A 2C90B 1T8LA 1YP9A 1HYLA 3RUOA 4YLQH 4OGXA 1BHXB 1ZRKA 1NC6A 2BD4A 4NZQA 5K0HA 1AO5A 2XRCA 4TPIZ 1TX6A 1L2EA 1D6WA 4GAWA 1QFKH 4UEHH 1YC0A 1QRXA 5ESBA 2ZP0H 4JYUH 1BTUA 1OOKB 1X7AC 2BM2A 2VWNA 1SGFG 3MI4A 1ETRH 1QIXB 2SGEE 1VITG 5I25A 2VH0A 3GDVA 5FX6A 1ABIH 1HAVB 4BAMB 1C2JA 2WPMS 1CA0C 1W12U 1HGTH 1FUJA 2QXGA 4ABFA 1SR5C 4MNWA 1TOMH 4YOIA 4D76A 3ATIA 4VGCB 4X2VA 1A3EH 1PPEE 3PWBA 1O2HA 1RD3B 1GG6B 2BVRH 1DSUA 2BMGB 2B0FA 3LGTA 4FVBA 1HRTH 3PWCA 1AGJA 3H5CB 2BLWA 2ZHEH 3BTHE 4U01A 2AIPA 2BLVA 5IYTA 1PYTC 4YM9A 3SJKA 2P95A 2J34A 3ZZ6A 1C2HA 1Y5UT 1CHGA 3S7HB 3BTFE 5A2MH 2SGAA 3GCHB 2O9QA 2SGPE 2JH6D 1DY9A 1GI2A 1O3AA 2P3TB 4UFGH 1D4PB 2ZDNA 4INLA 3SU4A 1QR3E 5ETXA 1WCZA 2WV5A 3P8NA 3SI3H 5FAHA 1HBTH 3BTWE 1Z1IA 2C3SA 1C5VA 2FM2A 3SV2H 5A0CA 5TCAA 1EQ9A 1TWXB 1VCQA 2VWLA 4ZUHA 1CGHA 2C8XB 4X2YA 3DT0H 4OS6A 1V2NT 3U9AH 1DICA 1Z71A 2WPJS 1QBVH 2ZPQA 3BG4C 4IBLH 1MKXK 1BTWA 3B23B 3ODDA 1FY5A 5ABWA 3PTNA 1OYQA 2P16A 1P11E 3F1SB 4MPVA 4JZIA 4ZKSU 3SGBE 1Z7KA 3SU6A 1L1JA 3ZVBA 1GWAA 1YLDA 3WY8A 1G3EA 1QB1A 3QLPH 4Q7XA 1RXPA 1O3BA 3SI4H 2QA9E 3H7TA 4XOJA 2TIOA 1EATA 2SGFE 1T8MA 1BJUA 1CT2E 1MU8B 1K28D 2A2QH 2H2ZA 1WBGB 4ABEA 4SGAE 1UK2A 4NA8A 4CRCA 1XKBC 3EE0B 1GHYH 4X8SH 1AKSA 4JZ1A 1NN6A 1O35A 1YCPH 2RDLA 1V2JT 2EI8A 1EP5A 3VB7A 1XKAC 1GHAG 1AQ7A 3ITIA 1H4WA 1O2YA 2R2MB 3DFJA 4TPYA 4IN1A 2Z6BD 5CHAB 2GKVE 4ABGA 2UUJB 2VVUA 3GCOA 4ZKOU 1QB6A 3B8JA 2UWPA 1VGCB 3M5OA 2JKHA 5FCKA 3M61U 1EAUA 2ZDMA 3E6PH 2SNVA 5C1XA 2BX3A 3PB1E 1GI8B 1S82A 2OC7A 2AH4X 3MU5A 1O36A 3TGIE 3NPSA 2HNTC 1ORFA 1ZOMA 4Q7ZA 1IQLA 3GY2A 1U6QA 2FOBA 4CHAB 2VWMA 1NFUA 1TPSA 3M7QA 1EX3A 4RKOB 4FUJA 1F7ZA 2OINA 1OWJA 3RLWH 3L3TA 1TNHA 1AVWA 3PLBA 3I29A 3MH5A 1L1NA 2GZ7A 3GYMA 1AWHB 1BUIA 1GJ4H 3LJJA 1LHEH 1RGQA 1GI3A 1W7XH 3TIUA 3H7OA 1QRZA 4E7NA 3BEUA 3E3TA 3SV6A 3MO9A 3LDXH 1YPHE 1MTWA 1BRUP 4X8VH 3PMAB 1HIAA 4FU8A 1OWKA 2YOLA 1W0ZU 3F9HA 1GJ5H 2Z9IA 1EASA 1UTKA 3MU1A 1MAYA 3HATH 4X1PU 4B76A 1C9PA 4IS5A 4A7IB 3S0NA 3A82A 1K22H 2V3OH 1G3BA 2CXVA 4WY3A 3A86A 1SOTA 1JIMA 3TH3H 5A8XA 2R3UA 2GX4A 2FYRA 3RM2H 1GMDG 1QURH 1INCA 1ELCA 4GSOA 3KL6A 3D23A 4WH6A 2P93A 4K1SA 2JH0D 1AIXH 4AX9H 3KEEA 4XBDA 1NFWA 4NSVA 2FOAA 4Y71A 4I31A 1LDTT 2ANKH 1ID5H 1SC8U 3GY6A 3UOUA 3G01A 3JZ1B 3QTVH 1THPB 1DWBH 4E06H 4TYDA 3ENSB 4YOGA 2GMTC 1GVZA 3TK5A 2XC4A 3ZVGA 1P2KA 2FOMB 2ALVA 1GBTA 2ZTZA 2V0BA 3O8DA 1Y3VA 5FXLA 2ESTE 3SQHE 4I33A 2J95A 2C8WB 1GGDC 1Z8IB 1ELBA 4K5ZA 1Y3UA 4IN2A 1KLIH 2HVXA 4K1TA 1HXFH 1XXDA 1FPCH 4WJG2 1SGYE 3MOCA 2NU2E 1O2KA 5GXPA 3F68H 1A7SA 1YLCA 2BQWB 1O0DH 3MH4A 5A09A 2ZQ1A 3UY9A 1DWCH 1O3DA 1CQQA 2VJ1A 1W11U 1C2FA 2STAE 3GDUA 4FUFA 1P04A 2DUCA 3RXPA 1O2OA 1GBLA 1WQVH 1NTPA 1C5NH 1MTVA 2D8WA 1SGRE 2Z3EA 1K2I1 2Z9GA 1P3EA 1EP6A 1ELGA 3PMBB 3M7TA 1GI5A 1DXPA 3LU9B 3RDZA 4X1NU 2CHAB 1C2LA 1D6RA 1DWEH 2OC1A 1ARCA 1BTYA 1AWFH 3TNSA 1NM6A 2STBE 4DG4A 1IQEA 1ZYOA 2OC8A 2AEIH 4ZHLU 4AG2A 4JK5A 3RXSA 2BXTH 2VU8E 1TA2A 2TRMA 2Z9LA 1WTGH 1HUTH 3MTYA 1HJAB 2P8OB 3RU4T 3U1IB 4ZKRU 1GHBG 2ANMH 4XBCA 4Q2KA 5HXFA 4AFZA 1N6YA 4WXIA 1O3MA 1C1SA 3DD2H 3VGCC 1UHBB 3BTEE 2ZGHA 4B2AA 1CHOF 2BDYA 1YGCH 3NXPA 4ASHA 4DIIH 1DWDH 2BY8X 1ACBE 3GOVB 2FPZA 5DGJA 1XUIA 3QWCH 3SNCA 1CO7E 1LVBA 1B0EA 2Z9JA 1HAVA 1IHSH 2FX4A 2IN2A 2BTCE 1F0UA 1QQ4A 3ZVDA 1S0QA 1C5TA 2PKSB 4KTSA 1BRBE 2K1QA 2WPHS 5HM2A 1MD8A 3NCLA 7KMEH 3AASA 4DOQA 2Y5HA 2WPKS 1NT1A 4FUHA 1VZQH 1FPHH 5PTPA 1TFXA 2GT8A 1D3TB 1GDUA 4Y7AA 4TWYA 1UTJA 1UCYH 2A1DB 2CN0H 3A88A 1GVLA 2ALPA 1UTQA 3VB4A 5EPNA 1O3CA 2F9VA 3QGJA 3HKIB 1FIWA 1ZJDA 2R2WU 4INHA 1AKSB 4WMEA 5DG6A 2FS9A 1HAIH 1ARBA 5JB8S 1OYTH 2GCHG 2LNCA 1P2MA 3ESTA 3ZVCA 4MTBA 4GVUA 4YESB 3FAOA 2C8YB 2ZFTA 2G81E 4GUXA 3T62A 1C1WH 1C1TA 1V2LT 4WH8A 4E7RG 6GCHG 1RIWC 2A2XH 4H4FA 2Y7XA 1O2RA 2NU4E 4O9VA 3LGVA 3A81A 1FXYA 1B7XB 2BZ6H 1CGIE 3R3GB 4ABHA 3TJOA 4O97A 1TABE 1Z8RA 1P12E 1FNIA 3KN2A 2BQ7B 1HAYB 1F5RA 1IQNA 1SGNE 1GMHG 3DFLA 2ZU4A 4UE7H 2H9EH 1KDQB 4DY7B 1ABJH 1MTSA 3VB6A 4O03A 2ILNA 1HIAB 3SNAA 2UWOA 4R0IA 5E0GA 3MMGA 5J4QA 3LJOA 2PKAA 1DANH 2A5AA 2WINI 1BT7A 1ESTA 1ZTLA 2FX6A 2NWNA 4ZHMU 3UTUH 3RC4A 1LQDB 1N1LA 6CHAB 3QN7A 1P9UA 2BZAA 4LK4A 1O3JA 2ZIQH 1AB9B 1IQHA 4NIXA 2ZO3H 2Y6TA 1O33A 2JETC 1O2IA 4ISOA 1NESE 1DSTA 4A6LA 2XXLA 2PUXB 5EGMA 4YO9A 7GCHF 1GMCF 1DS2E 5TJXA 1FDPA 1JOUB 1MMJN 1QB9A 1O32A 4ABAA 1C1UH 1P0SH 1C1MA 3A7WA 2QAAA 5GIBA 1O5CB 3A7YA 3MYWA 4BTUB 2AIQA 3P17H 1QJ7B 3D62A 2TGAA 1S84A 3SV9A 1C5UA 4ZXYH 8GCHF 1GPZA 4K8BA 3LC5A 3LIWA 3SNEA 1HCGA 2ZNKH 3OSYA 3VPKA 4BTTB 1GJCB 3DA9B 3C27B 1GL0E 1C2GA 2TPIZ 3SUGA 1W0YH 2Y5GA 3Q3KA 1G3DA 3PV4A 3AW1A 1P8VC 4D9RA 1TBRH 1MKWK 5FPYA 1GJ8B 1Q3XA 2SGQE 1P9SA 1Y5AT 4A1TA 2IOTA 4M7GA 3SJ9A 4XSKU 3ZZ9A 2PSYA 1BMAA 3S9CA 3Q3YA 1D9IA 3BG8A 3BIVH 1NZQH 1O3FA 2OXSA 5CMXH 1KXBA 2BXUH 1EB1H 4NCYA 2GZ9A 4UFEH 2J92A 1PQ8A 2VIPA 1OP0A 2ZPSA 2AGGX 2ULLA 3LONA 4OS4A 1TNIA 1PQ7A 1O31A 3UPEA 4BXWA 1N6XA 1MUEB 3PYHA 1ZPCA 1XUFA 1Y3YA 5GCHG 5DP8A 1PFXC 2UUKB 3OY6U 4OS5A 1BTHH 3E0NB 3F6UH 2ZGBH 2A45B 3LGYA 3MH7A 5FHTA 2OLGA 1EJMA 1PYTD 3T5FH 2J2UA 1SQOA 5HM9A 4ZMAH 2XWBI 1T4VH 3RM0H 3ZVEA 3E8LA 1V2UT 4I8LA 1Q2WA 1XUJA 1ZHMA 1V2QT 2W5EA 1ANDA 1UJ1A 1YCPM 2BD8A 3N7OA 1GJDB 2G4TA 1F0RA 4LZ4B 1KXFA 1GCTB 2XBVA 1K21H 4NA7A 5EW2H 5DP9A 2QCYA 3L33A 3CS7A 3RXMA 3SV7A 1CT4E 5DPAA 2UWLA 2XNIA 2CGAA 1NS3A 2SNWA 1YPEH 1UTMA 1TNGA 4U2WA 1VITF 3A84A 1IOEA 5AFZH 3TLOA 5EXLA 2Y82A 1VJ9U 1OXGA 4QT8C 1ANBA 3UQVA 1V2WT 3RXRA 1DLKB 4VGCC 4KP0A 3DUXH 2PV9B 1GHXH 1GG6C 2D2DA 1MZAA 1ZGVA 2F9NA 1THRH 4NFEA 1IHTH 1SGTA 1HAXB 1C1OA 1SVPA 5H4IB 2A32A 2C4FH 4GHQA 5JBBS 3Q77A 2HRVA 4HGCA 1AUTC 1TOCB 2G5VA 1V2PT 1W2KH 1TBZH 1UVOA 1S81A 1ZR0A 2FI5E 2BQ6B 2UUFB 2Q1JA 3GCHC 5LPEA 2AFQB 4X2XA 1C4V2 3NKKA 3SV8A 4AFQA 2F9PA 2V3HH 1SPJA 4OS7A 1LHCH 2BDCA 1C1NA 2Y7ZA 1CBWB 4GCHG 2OD3B 3Q00A 2EI6A 2RG3A 3FZDA 1ZSKA 1PQAA 2ZC9H 2WUCA 1F5LA 4Y6DA 4K69A 4I8JA 2TBSA 4CRFA 3KQDA 1AZZA 1HDTH 1UHBA 1OP2A