1ELAA

Analogous inhibitors of elastase do not always bind analogously
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
240
structure length
240
Chain Sequence
b'VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ELASTASE
publication title Analogous inhibitors of elastase do not always bind analogously.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Hydrolase/hydrolase inhibitor
total genus 62
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1993-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1elaA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1elaA01
1GJ8B 3RXKA 2WYGA 1G30B 2VNTA 3BTQE 1QJ6B 2BTCE 3ZVGA 2WUCA 1O2UA 2PFEA 3ESTA 1JWTA 1GBDA 1Q31A 3OY6U 1H9HE 1O3PB 2R0KA 2Y80A 3ZZAA 5L30H 2OBOA 2ZCLP 4NIVA 1CE5A 1F0UA 2XBWA 1G3BA 1MTNB 6LPRA 4ZHAA 1LHDH 2QF0A 4X2VA 3QTVH 1TBQH 1DSUA 1C2JA 1SOTA 1A2CH 2BY8X 3PM3A 3RP2A 1AE8H 4QT8C 3ZVDA 1RIWB 5A8ZA 1DXWA 1VITH 2OXSA 3RXHA 4JK6A 4U32A 1MKXH 2XXLA 5EW1H 4K8BA 2GMTB 4Y76A 3RLYH 3U69H 3D23A 2PTNA 2P3TB 1BOQA 2FI5E 3TGJE 1OP0A 1SSXA 5ETXA 1EAWA 5EPNA 1PPHE 1TPSA 3OTJE 1NFYA 1OWJA 2C8ZB 2PTCE 1T8MA 1NRNH 1SQOA 2JETB 1CHOG 4XFQA 1F5KU 2ZGXH 4DVAU 2CHAC 5E0JA 3TJOA 1GI9B 1ZGIA 2FOGA 3S9AA 1CT2E 2D1JA 5TCCA 1GMHF 4U30A 2XCFA 4YZUA 1A61H 5IDKA 1Q3XA 2NU1E 4JZIA 2J4IA 1IQIA 3SU5A 5K0HA 4H4FA 3BG4C 4RKJB 2Z94A 5C20A 1FUJA 1V2KT 3LIWA 1O32A 1O2RA 3CP7A 5DJ7A 5DKMA 1EP5A 4FUEA 1K22H 2ZFQH 3ZVBA 1O2VA 4WH6A 3ZVFA 3PB1E 3A7VA 3QX5H 4TY7A 3SBKA 3Q77A 1O37A 1EZSC 1ELDE 1SGDE 2ZA5A 1W0YH 3V3MA 5C1XA 4GAWA 1FY5A 3LGIA 4OS2A 4DIIH 2PW8H 1C2FA 4KKDA 5I46H 1CVWH 3RXBA 4TY6A 1MMJN 1LHCH 2PR3A 1SLXB 3QUMP 1W3CA 1ETSH 1HGTH 1BTWA 1XXDA 2TGAA 4AB8A 3BIVH 2BLVA 2ZIQH 1P05A 2WV4A 2H9TH 1Y3XA 1H9IE 2W26A 2XBVA 3OSYA 5GCHF 1J15A 3QGJA 1ZMNA 1O3EA 1PQ8A 5F6MA 1BBRE 1C1WH 4ABEA 3AVZA 2WINI 3VPKA 3M5OA 2G4TA 2Q6DA 1O3AA 4IBLH 3Q3KA 3ELAH 4IC5A 1HYLA 2A5AA 2ZQ2A 1GCTC 2F9NA 4AFSA 3S7HB 4D76A 4TWYA 5E0GA 4A7IB 2ZU1A 1P04A 1MTNC 3UOPA 1TNGA 4Y0YE 3U1IB 2ZCKP 2FESH 4WMFA 3L33A 1AVGH 4WVPE 1P2JA 1GDUA 2OC0A 1TMUH 4A92A 3VXEH 2G00A 1PPZA 2SGDE 2SGQE 3BN9A 4TYDA 4K69A 3G01A 5F8TA 2GMTC 2ZECA 1C1RA 3PMBB 2ZDLA 1QA0A 3M3SA 1YF4A 2FDAA 1L0ZA 1UCYE 1C2LA 2J92A 1G37A 4WMEA 2GCHF 4I31A 2JETC 1W7XH 1LHEH 3UR9A 2G4UA 1TRYA 2A2XH 2UUKB 3H5CB 4JZFH 1C5TA 2Z9GA 2ZGJA 2JH0D 4X1PU 3SUFA 4ASHA 1TNLA 3E90B 1P2KA 4M7GA 2Y7XA 1ESBA 3SU2A 3DHKH 2A7JA 1W14U 1BBRH 1RTKA 2ZF0H 2ZFFH 4UONA 2A5KA 4YOIA 1SGCA 1IHSH 1OP2A 1CQQA 1OPHB 2F9PA 3BG8A 3UNQA 5DO4H 1DDJA 4D7FA 1CBWC 3TH2H 2CF9H 1DPOA 2FOAA 1ELVA 1NFXA 1JIRA 4FUCA 3VB3A 2ANKH 1LHFH 4IGDA 6CHAB 4CR5A 5BRRE 2ZPRA 1P8VC 1F92A 4NFFA 2FTLE 2ODQA 2UWOA 2FOEA 5A09A 3LJOA 2VH0A 3S9CA 1Z6EA 3BEUA 2FOFA 1SL3A 1ZPBA 1C2GA 1FY4A 3VB4A 1RGQA 4OS5A 4CRFA 4LXBH 1ANDA 1TWXB 4O3TA 1P2MA 2F83A 2AEIH 4AZ2B 4B76A 2AYWA 3FVFB 2W5EA 1MKWH 3T25A 4B2AA 4FXGH 4O97A 5EODA 2HPQH 2OC7A 2WUBA 4JZ1A 1YCPH 4BAHB 1EKBB 3LPRA 4DY7B 5JPMH 1PQ7A 1HCGA 4WWYA 2P93A 2BXUH 2UWPA 3A83A 2SGAA 5GWZA 4XBDA 1HDTH 1DWBH 3E3TA 2FMJA 2P3UB 1O2HA 3LU9B 4NSVA 5E2PA 1OOKB 1JBUH 4IN1A 1F7ZA 1HPGA 4K5ZA 4B1TA 1SGPE 3NWUA 3UQOA 2GT7A 1Z71A 3M5LA 3QWCH 2ZDVH 1O5FH 2ZGBH 1YYY1 3E1XB 1C5MD 3FP7E 1ORFA 3R3GB 1DLEA 4A1VA 4AG2A 1QQ4A 3B23B 3A7TA 1UJ1A 1S6FA 1EX3A 1V2UT 1S82A 3S0NA 2PKSB 2B8OH 2O8MA 1AY6H 3UNSA 5GIBA 3IITA 4AFUA 4UFDH 4CRAA 2H6MA 3GCNA 1SLWB 1O5DH 2I6SA 5E8EH 1O2XA 1FV9A 3ATWA 1NY22 4Y11E 1CA0B 2OP9A 2YOLA 2KAIA 4OS7A 5EGMA 1Z1JA 1Z8JB 4PROA 3O8DA 1O2ZA 3SNAA 5FPSA 1RD3B 4HZHA 4ZKSU 1GBAA 3QTOH 1QBNA 4MNWA 1ELGA 1TIOA 4X0WU 2FS8A 3A8CA 1MU8B 2FLRH 1HB0B 2Z3EA 4BNRA 3A87A 3BTME 1O5AB 3AW1A 1O31A 1TAWA 2ZCHP 3A85A 3H7TA 2VIQA 1N1LA 2GGVB 3SU4A 3ZZCA 5T6FA 2O8TA 4Y7AA 8KME2 2BLOA 3BTDE 1MQ5A 2FP7B 2QIQA 1GHBG 2EA3A 3JZ2B 2BDBA 1K2I1 4E7NA 2OQ5A 4ZKNU 3GCOA 1RTFB 2ODPA 5JYIA 1DOJA 2LNCA 3FFGA 4ZHMU 1OS8A 3P8FA 3AW0A 1NTPA 1PQ5A 4X8TH 1E38B 3BTEE 1EPTB 1IQLA 2QGRA 8ESTE 1H8DH 2ZHDA 3R0FA 4IC6A 5FBEA 1GMCF 4ABJA 1GJAB 5JBBS 1P06A 1VCWA 1DE7H 2AGIX 1F5LA 2YNAA 2BDYA 9LPRA 1IQKA 4I8KA 3IWMA 1WQVH 2BD8A 1FQ3A 1QL8A 1XUKA 3GICB 1AQ7A 3SORA 5JBCS 4CBOA 1O3FA 1TLDA 3B9FH 2SFAA 2F9BH 4Q7XA 2V35A 1ETTH 3ODDA 3ZZ8A 2FOBA 4ESTE 2Y81A 2G51A 1RXPA 2A1DB 4INLA 2PV9B 3RMMH 1C5QA 1QGFA 2CGAA 2ZGHA 1SBWA 4J1YA 3ZVAA 2FI4E 1HAXB 2EI8A 4DG4A 4ABHA 1IQNA 3VEQB 4FVBA 1WV7H 4THNH 1GGDB 1INCA 4GSOA 4BOHA 4INHA 3RXGA 2PKSC 1XVOA 3QZRA 1W11U 1LO6A 3KCGH 2BQWB 5C3NA 1D3QB 2A32A 1MZAA 3MU5A 2Y5HA 2C8YB 1FMGA 1EASA 3QN7A 3MH7A 1GBBA 2ZU2A 2LPRA 4MNXA 1CA0C 2PUQH 4BAQB 5JB9S 4IN2A 2IJOB 3ZZ5A 7GCHG 4DGJA 3F9HA 3KHVA 1BCUH 1HAZB 3OU0A 3PMAB 1O34A 1GBKA 4HI3A 1L4ZA 3UOUA 1G32B 5HM2A 1O3HA 1IQMA 1OYTH 4K60A 5FCKA 1O2YA 1VITG 3MFJA 3SNBA 1UVTH 4NCYA 3RDZA 2VIPA 3TJUA 4FU7A 1QCPA 1C1VH 2D8WA 2PSXA 1CGIE 4ABBA 3MHWU 1NU7B 1C1PA 1Z8RA 3A80A 1AU8A 1B7XB 6ESTA 5J4SA 1C1MA 3A7ZA 1DXPA 2AERH 1GJ9B 1GBLA 2CMYA 1UHBB 1NS3A 3KQCA 1JIMA 2ZU5A 4JK5A 2WYJA 1EOLA 2ALVA 1AUTC 1DITH 1ZHPA 1EAIA 3Q3XA 2QV1A 1OKXA 1OXGA 2HRVA 4NA9H 4X6PA 1EPTC 1ZSLA 2DUCA 1P01A 4AGKA 1A0JA 2AFQB 1S5SA 1BT7A 3D49H 3A8AA 1HBTH 1Q2WA 4X6OA 2FYQA 2BHGA 2XRCA 3MI4A 2VGCB 3U98H 3P8GA 2A4OA 5FAHA 1ABJH 1TX7A 1U6QA 1XM1A 2ZTYA 2ZO3H 3NXPA 3M5NA 2BD7A 1FI8A 2P8OB 1TOMH 1ZHRA 3QGNB 1G2LA 1YPEH 1ZGVA 4GHQA 1AO5A 1EATA 1TRNA 5IYTA 2HNTE 2NU0E 4YM9A 1KXDA 3UTUH 3T29A 2H5DA 1ARCA 1NT1A 3BEFB 1HAIH 3T28A 1ACBE 3RLWH 3NCLA 2JH6D 4MLFB 3SQHE 1AE5A 4K3JA 1O2WA 2AIPA 3A86A 2GP9B 5ESTE 2F3CE 1ZZZA 3GCTF 1GGDC 4GUXA 1TNHA 1XXFA 5EQRA 1BTXA 1LVYA 1O2MA 1ZJKA 3SV7A 5FCRA 3LJJA 2H5CA 2Z9IA 3E0NB 1GHBF 1GI3A 3VXFH 2FOMB 1VZQH 1C4U2 2QXGA 4NG9H 1NFWA 1O3KA 4FUJA 2OC1A 1AWHB 8LPRA 2BXTH 3EDXB 1EJMA 1WYKA 3O8RA 2H9HA 1PJPA 1BMAA 1V2OT 5F03A 5FBIA 1TBZH 1AFQC 3ODFA 2FI3E 3M5MA 2D26C 4JYVH 4X8UH 4LOYH 1QB9A 1GI4A 1PQAA 1N6YA 1B0FA 2PKAA 2BVXH 4ABFA 5DP7A 1THRH 5K7RA 2UUFB 2ZDNA 5FHTA 4Q7YA 1GJ6A 1TB6H 2R3YA 1F2SE 3GY3A 3TH3H 1L1NA 1QL9A 1RTLA 4GPGA 1XKAC 5JBTA 2B0FA 2ZEBA 2EI6A 1P2IA 2Z6BD 5HGGA 5A2MH 2K1QA 3T5FH 1LQEA 2CN0H 2OLGA 2VIVA 5DP5A 1DX5M 3LGWA 1L1JA 1NZQH 3LGVA 2ZP0H 2OQUA 5F8ZA 1RRKA 4YESB 4D9RA 2AMDA 2VGCC 4DJZB 4A5TS 4D9QA 5E0HA 1A4WH 3V13A 1GBMA 4F49A 3K9XB 2P8OC 4X2WA 1P0SH 2IOTA 1LVOA 1SOZA 3NPSA 2VIWA 4KTSA 1BJUA 1HJAB 3SZNA 7GCHF 1UHBA 1BTZA 4ISNA 2J2UA 1FNIA 3UWJH 1A3EH 1LTOA 8GCHF 1GG6C 1T8NA 3AASA 2NU3E 1UTMA 4JYUH 3PLPA 1FDPA 5LPEA 3U9AH 2STBE 5DP8A 1VITF 1GDQA 2ILNA 4K8YA 1GCDA 3TLOA 2ASUB 3U8RH 4INKA 1V2WT 4B74A 5A8XA 1BRBE 1J8AA 2ZG0H 1DWEH 1Z6JH 1O3LA 1O38A 2BZAA 3RXCA 1PPCE 1IOEA 1C4V2 1C5RA 4A6LA 3W94A 3M3TA 4Y71A 2PWXA 3H7OA 4BXWA 1QRWA 3QLPH 1K1LA 1ZMLA 4X2XA 3SJKA 4AGJA 2VVVA 1P2QA 3P92A 2J95A 4UE7H 3SJIA 1BTYA 2GKVE 1PPBH 1C5WB 4FUDA 1Y5AT 4ZROA 4YOJA 2Y5FA 2QA9E 1CO7E 2HOBA 5CHAB 1TA2A 1JMOH 3CS7A 3RM0H 1BMLA 1Z1IA 1UVOA 2VB0A 1ELBA 1S81A 1P10A 3MO6A 3A7YA 1MBMA 5AF9H 3KL6A 1SPJA 1TPPA 4IMZA 4HTCH 1ZSKA 5HXFA 4AYYB 1ESTA 3SUEA 3UR6A 1C5YB 3ZYEA 3SV8A 3BTTE 1GI0A 4WJG2 1SGQE 1G3EA 2Z7FE 3M37A 1GBIA 1GPZA 1OWHA 1LVMA 1NESE 1CT4E 3E91A 1SFQB 1C5ZB 1YC0A 2Y82A 1FAKH 2BY6X 3BTKE 1RIWC 5GJ4B 4X6MA 2A2QH 4ZH8A 1CGJE 4RSPA 2FOHA 2KAIB 1QBVH 1T8OA 4KTUA 2NU2E 2RA3A 2XNIA 2ZC9H 2J9NA 2A31A 1ANCA 2FX6A 7ESTE 5DP4A 1GI1A 2IPHA 3SUGA 2V3OH 1AGJA 4CREA 5C1YA 3HKIB 2FZZA 1SGFG 1O2TA 4JZEH 4X8VH 3SJOA 1O5EH 1SGTA 4UD9H 1HJAC 1XMNB 1A46H 1W2KH 1OWDA 2PLXA 1K1NA 1SQTA 3RXUA 3MNCA 1YKTA 3SW2B 3RC5A 1W10U 1JXPA 2FM2A 4NWKA 4TPYA 4B2CA 3BSQA 3DFLA 3ATKA 4HGCA 4A1TA 1BRCE 3TPIZ 1SVPA 5L6NH 1QFKH 4ABDA 3RC4A 1DLKB 2D2DA 2ODYB 1AKSB 4ISHH 5AVDA 2ANYA 1K1OA 4OS4A 2HGTH 3EA9A 4CBNA 5L2YH 2ZI2H 5CE1A 1UTQA 1MUEB 3GDVA 3M7QA 1SHYA 1HNEE 4J2YB 3KIDU 3C27B 2FPZA 1NFUA 2ZHQH 3RXOA 3F68H 2GV7A 1GHYH 5C2ZA 1MTSA 4I8HA 5DK1A 1BJVA 2ZGCA 1D6RA 1O2SA 1MD7A 4YLQH 6GCHG 2BY9X 4AX9H 1UCYH 3Q00A 5CHAC 3A7WA 3ZZ9A 2GD4B 5FX6A 1GL0E 2H1UA 1LHGH 2HLCA 3STJA 4R0IA 2RA0A 4BTIB 1HAPH 1QRXA 3WY8A 4IMQA 3SV2H 1CHOF 3MOCA 1ZPCA 1NRSH 4I8LA 3BTHE 1AVXA 2Q6GA 1ELCA 4GLYA 3PTBA 5TCAA 1SGNE 2ZDMA 5B6OA 4B75A 1NC6A 1UK3A 2TGPZ 1TRMA 2O8LA 1LMWB 1TGTA 2QC2A 1NM6A 2TIOA 4Y7BA 5T6DA 1EP6A 2I6QA 3F9EA 1HAVB 4LZ1H 1QB6A 2F9OA 3MNSA 3P6ZB 1KXEA 2ANWA 4NGAH 1MU6B 2CJIA 4DW2U 5HM9A 1MKWK 3ENSB 3TJNA 3M35A 4FUHA 3PMHB 1GHXH 1O39A 1S0QA 2Y7ZA 1UTPA 2XWBI 4ISIH 3LT3A 3MWIU 1IQJA 4Q7ZA 1K1IA 1QNJA 3A8DA 4U01A 4BXSA 3GY8A 1SLUB 2BLWA 1E36B 1H4WA 2SGEE 2QXJA 5J4QA 5H4IB 2FYRA 3TVJB 1THPB 1YPHC 1MCVA 1O5GH 1GI6A 1A1RA 1KLIH 2PGQB 2ZNKH 3TNSA 4BAOB 2WPJS 1YCPM 4X6NA 3QK1A 1QL7A 1KSNA 2VINA 1H1BA 7LPRA 2ULLA 2SGPE 2ZKSA 4Y8XA 3E0PB 2GDDA 2ZWLH 3F9GA 3HKJB 1TA6A 1NU9A 1EB2A 3LH1A 5C5OA 3M36A 1ID5H 6CHAC 5JDUB 3EA8A 2BY5X 1NO9H 3I77A 4D7GA 2WV5A 2BD9A 2QXIA 1TPOA 2XYAA 3A88A 1FY1A 3AAVA 4GVUA 4BAKB 2QAAA 4E7RG 4ISLA 1A5IA 3C1KA 2F91A 1GBFA 1IAUA 3KGPA 4O3UA 1HAOH 3RUOA 3SGQE 3LKWA 1L4DA 4Q80A 5A0AE 5FX5A 1MAXA 1A7SA 3OX7U 4CRBA 1GJBB 1WTGH 1AKSA 1O2IA 3MU4A 3HATH 1YPJH 1O3DA 3TGKE 1DWCH 1TMTH 1KTTB 2CXVA 1O3MA 3HPTB 3SU3A 1V2VT 5FPTA 3PROA 7KMEH 4YO9A 4D8NA 1MTUA 3QDZB 3TK5A 1UK2A 2VVCA 3MH5A 1SFIA 2VWOA 3I29A 2BQ6B 1BMMH 3ATIA 1IQEA 2VWMA 3ZZ4A 3MO3A 1C1OA 3M7TA 3RXFA 4JYTA 4MPUA 1YM0A 2XCNA 1EZXC 3KQBA 4U2WA 3VGCB 4CR9A 4X1RU 2A5IA 3RC6A 1EAUA 4XBBA 2Z3CA 1OX1A 1SC8U 1K28D 3SU0A 1P3CA 3CENA 1DICA 1P02A 2AMQA 1D6WA 3A89A 2ZPQA 2SNVA 3A7XA 1C5LH 3PLBA 3SNCA 2BX3A 3UNRA 1GHWH 1E0FD 1DY8A 1NN6A 2PSYA 2BDIA 2ZPSA 3HGPA 1NRQH 1F5RA 2VIOA 3RXQA 2PKAB 3PLKA 4CH8B 3TGIE 1O3JA 6GCHF 1GVZA 1EOJA 1HAVA 1J9CH 4X8SH 3A81A 1S85A 4FUFA 4BTTB 1FJSA 2QF3A 2QXHA 1C2DA 1O2LA 3Q3YA 1F0RA 3PWBA 2BMGB 2BDGA 1GJ7B 1EZQA 5JBAS 1GI7B 3HK3B 1ELAA 1V2TT 2W3KA 1BQYA 1SGRE 1A5GH 3SHCH 1A0LA 4FUIA 3I78A 2R0LA 2G5NA 1C5NH 1KLTA 1ZTLA 3SU6A 4X1QU 1AZ8A 1KDQB 2YNBA 3GOVB 1QJ1B 1NPMA 2J94A 1ZMJA 1ZJDA 4YLUA 2F9UA 5EW2H 4I8GA 1YPHE 1BTHH 2CV3A 4MPVA 4Y79A 3M61U 5ESBA 1C5SA 1DANH 4XOJA 3RXEA 1O2QA 2AMPA 9ESTA 1K1PA 1O36A 1TALA 4UFGH 3K2UA 2J34A 3UPEA 1XUFA 2BOHB 3RXSA 3P17H 5GDSH 1SLVB 1AUJA 1UVSH 4MG3A 1T4VH 3RU4E 2GZ8A 4ZHLU 1P09A 4JMYA 3S9BA 3ATMA 1O33A 3DUXH 1LPKB 1O3GA 4B73A 1HAGE 3E16B 1OSSA 5L2ZH 1DS2E 4MTBA 2GX4A 1VGCB 1ZSJA 3TJVA 2ZDKA 2CF8H 1MH0A 4H42U 1C2MA 2EI7A 4O9VA 4NFEA 1H9LB 2QYIA 5LH8A 1V2RT 3L3TA 2B7DH 4MQAA 5GCHG 2RG3A 2P3FH 5T3HA 1WTHD 1EXFA 2R2MB 3LH3A 3GY4A 2BDAA 3TH4H 3KF2A 1SGIB 4B2BA 1UVPA 2WPKS 3U8OH 2CHAB 2F9VA 1TE0A 2AH4X 1FAXA 5EQQA 5ABWA 1E34B 1P3EA 3TNTA 1QHRB 1TX6A 1HFDA 3BTGE 5CMXH 4UFFH 3PTNA 2OINA 3BF6H 4A1XA 4Y8YA 4BAMB 4JCNA 1UTJA 5LPFA 3BG4B 3S69A 3DA9B 1OP8A 1CA8B 2OUAA 1E37B 4X1SU 1DVAH 1CHGA 2ZFSA 2DE8A 4CHAB 3GDSA 1N8OB 1AD8H 4Q2KA 5EOKA 3BIUH 3S7KB 1O30A 3A8BA 1A5HA 1GI2A 3LONA 2GCHG 2IN2A 1C1TA 3UY9A 2A7HA 1VCPA 4FUGA 3GYLB 3F6UH 2A0QB 3EAJA 4FVDA 1DFPA 2ZHWH 1KXAA 4NIYA 1FLEE 1V2LT 2GDEH 4I32A 4SGAE 1C4Y2 1O3BA 1S6HA 5PTPA 1ELEE 1GBTA 1KXBA 1TGSZ 2ZFRH 3N7OA 1W0ZU 3KQDA 3P95A 1E35B 3SI3H 3MH6A 1ZRBA 1CU1A 2FS9A 2EC9H 2HVXA 3KEEA 4ZKRU 1PPEE 1ELTA 2Q1JA 3SOSA 1HXEH 3LGUA 1J14A 4TWWA 4WF8A 4XBCA 5GPIB 3ZZDA 5EQSA 3TK6A 2M5TA 1GCTB 3EE0B 2HWLB 2ZDAH 1Y5UT 2GZ9A 4NIXA 1T7CA 3ZV9A 2HNTF 1KDQA 1NRRH 4H6SB 1LVBA 1QBOA 2O9QA 1WAYB 5EXLA 3LGYA 1YBWA 4IW4E 1P57B 4MDSA 1VGCC 1HRTH 3RXRA 1DY9A 1ARBA 3FP8E 3FZZA 4H6TA 3OY5U 1P12E 2HPPH 1PYTC 3K65B 1ZLRA 2Z9KA 2J38A 1GWAA 1O0DH 2OTVA 2AGEX 4BANB 1GBJA 4DT7B 1MKXK 1EAXA 1ANBA 1LKBA 1DUAA 4R8TB 5C1UA 1CSOE 1TGBA 4WMDA 4Y0ZE 4CH2B 1ETRH 1KTSB 1BITA 3ATLA 2W3IA 1BB0B 2FXRA 4AOQA 2XC0A 2BM2A 1YGCH 3BTFE 4ZXXH 3KN2A 2ZZUH 1SHHB 5A0CA 3UIRA 4E05H 3VFEA 1AZZA 2TGTA 3TK9A 3URDA 1DSTA 3ZVCA 3SNDA 4I8JA 1FXYA 1YLDA 2B5TB 3KNXA 1JOUB 1JRSA 4UFEH 2GTBA 2V6NA 1SB1H 3BV9B 5DP6A 1UTNA 1O2KA 1ABIH 1CBWB 1TPAE 2C8WB 4CHAC 1N8OC 1QIXB 1TNJA 1J17T 4MVNA 1PPFE 1C1UH 1ZOMA 3UQVA 3A82A 2VIDA 2ZFPH 1GMDG 1EQ9A 4IS5A 3MMGA 4ISOA 1AB9B 1TFXA 1EB1H 3U1JB 4NA8A 3ZZ7A 2BLQA 3D62A 4NA7A 1Z8GA 1D4PB 4LK4A 1BRAA 3EQ0H 5DP9A 3P8NA 3EA7A 1D9IA 2JKHA 2PUXB 1FY3A 1BIOA 1GVKB 2BVRH 1QR3E 1TGCA 1T31A 3SN8A 1D3PB 1GJDB 1GJ5H 2FTMA 2BVSH 1LKAA 4YTAA 3RMNH 1DM4B 1O3CA 2OBQA 3P8OA 1L1GA 2FEQH 1QA7A 1GI8B 1UTKA 5FPYA 1DWDH 2UUJB 5C67A 3SI4H 3SGAE 3ZZ3A 1OWIA 1SGFA 2VWNA 4GCHG 1LPGB 1GHAG 1AFEH 1O5BB 1F0SA 3IG6B 1WCZA 1HV7A 3O8BA 1PFXC 1AIXH 1J16A 2BDHA 2XW9A 5JB8S 3FAOA 3T62A 1TNKA 4NZQA 1XVMA 3RU4D 3RXIA 1LQDB 1WU1A 5TJXA 3GY6A 4ABGA 3BEIB 5I25A 3ZYDA 1GMCG 1K9OE 1Y8TA 3GDUA 4Z6AH 1HAHH 4BTUB 4UDWH 1HJ8A 2TPIZ 2Y5GA 4DIHH 5HMAA 3SUDA 2VJ1A 3RXLA 2BD5A 2ZTZA 3EGKH 1DT2A 4VGCB 1O3NA 3RXVA 4DCDA 2BY7X 1FONA 3STIA 2A4RA 2EEKA 2A4GA 4DURA 3PWCA 1ZR0A 4GHTA 1AHTH 2ZHFH 3MU0A 3HGNA 5GXPA 1YPLH 4KTCA 5FXLA 1QURH 4MNYA 1LDTT 1HIAB 5C5NA 3ZZ6A 1XUJA 1QY6A 4AFZA 3DFJA 1C5PA 4AG1A 1IQFA 2XWAA 1QQUA 1BBRK 4MPXA 1ZTJA 3F1SB 1X7AC 3GY2A 1BHXF 1TMBH 3U8TH 1Y5BT 4AORA 3ZV8A 1FPHH 1BDAA 1BTUA 2H9EH 1P2NA 1A3BH 2QN5T 1MBQA 1ANEA 1FN8A 2BZ6H 1AWFH 1FPCH 1RJXB 1P9SA 1QJ7B 3CS0A 4Z0KA 1G9IE 1WOFA 1C2HA 1C5XB 1ZTKA 1K21H 3NZIA 1HLTH 5SGAE 2ZTXA 1AB9C 4Y8ZA 2G8TA 2FLBH 2HALA 1KY9A 5EU8A 3MYWA 3MNBA 3GISB 4K1EA 3TIUA 1W12U 1GJ4H 1NROH 4KELA 1N6XA 2BD4A 1W7GH 3E8LA 1GVLA 1C2EA 1IQHA 4NWLA 4O03A 1O3OA 1UO6A 2RDLA 1UCYK 1SI5H 2STAE 3MU8A 1QB1A 3ZVEA 1HAYB 2W7UA 1IHTH 1NRPH 3K6ZA 1FN6A 1BZXE 1KXFA 1P03A 3LOXA 3PYHA 3VB5A 4ZXYH 1YPKH 2QY0B 3FANA 1T8LA 1GBEA 1S0RA 1GHZA 2NWNA 1UTOA 1GJCB 3LC3A 2TBSA 5DP3A 2ZHEH 1UTLM 1V6DA 1YCPK 1AN1E 3V12A 3T27A 2GVFA 2G81E 4OGYA 3RMLH 1HXFH 2BD2A 1UMAH 1VJ9U 1TABE 1HJ9A 4FU8A 3RM2H 3RXPA 1V2ST 5EG4A 3SHAH 3QZQA 2G5VA 1XUHA 4Y10E 3RXDA 3SGBE 5AHGH 3O8CA 1TQ0B 4X2YA 3GY5A 2GCTB 5G4BA 2OC8A 5DG6A 1Y3UA 1GMDF 1O5CB 2WPLS 1MQ6A 2TRMA 2AGGX 4VGCC 1MD8A 3T2NA 5T6GA 1AVWA 3SNEA 3BTWE 3RMOH 1SR5C 2Q6FA 2BOKA 3A84A 2C90B 1WUNH 1C9PA 1D3DB 4OS1A 2FO9A 4NSYA 2TGDA 1OWEA 3TITA 2AIQA 4ABAA 5DPAA 2WPHS 1W8BH 4YOGA 2ZU4A 1ZPZA 1C5VA 3PMJA 1JRTA 1G2MA 4YT7H 1G3DA 4AB9A 1C1SA 5BPEA 1Y3WA 3Q76A 4FUBA 2VVUA 4LZ4B 1VJAU 1CGHA 5AFYH 2P94A 2P59A 1VR1H 1TQ7B 2Y6TA 4B71A 1SGEE 1BMNH 2H2ZA 3GCTG 3PV4A 2UUYA 3L6PA 1FZZA 1QRZA 2R3UA 3GY7A 4GCHF 4ZAEA 3EYDA 1GHAF 2SGFE 1CT0E 2XBXA 4DOQA 2Z9LA 2DE9A 1T32A 3UWIA 1O35A 1ZRKA 2C3SA 3VB6A 2VU8E 1G36A 1TOCB 1P2OA 3RXTA 4JZDH 3PO1B 5DGJA 1S83A 3JZ1B 1O3IA 1HIAA 1GDNA 2B9LA 1HUTH 2HNTC 4HFPB 4WXIA 5A0BA 1QTFA 3GCHB 2A45B 1TX8A 1BUIA 2NU4E 3ZZBA 1F0TA 5EPYA 1TNIA 3NK8A 3E6PH 4K1SA 2UWLA 4Y6DA 3V7TA 3SJ9A 3NUMA 1O2JA 1YLCA 1WSSH 1MZDA 3W95A 1O2OA 4OGXA 3TU7H 2P16A 1L2EA 3RU4T 5A8YA 2G55A 3MU1A 2BQ7B 2Z3DA 4XDEA 2AS9A 2GT8A 2WPIS 4TPIZ 1BA8B 1V2NT 4XE4A 2XC5A 1PPGE 1C2IA 2C93B 1P9UA 1YP9A 2VWLA 2G52A 2PHBA 4KGAA 1KXCA 1SG8B 1GL1A 1LCYA 1T4UH 1V2MT 5AFZH 1Z8IB 3D65E 2XC4A 2GCTC 1UK4A 4K2YA 2ESTE 1TONA 2XBYA 1LPZB 2RCEA 3RXMA 1BHXB 1ESAA 3NKKA 1XUGA 1MTVA 1C1QA 4K1TA 3MH4A 3V0XA 1GI5A 3MTYA 1V2PT 1O2PA 4XSKU 4RN6A 4ABIA 4ZKOU 3RXAA 1KLJH 3LGTA 8GCHG 2JH5D 3SO3A 3ITIA 1GMHG 3QO6A 2THFB 5EXMA 4ZUHA 1ZYOA 1KIGH 4MNVA 2ZFTA 1C9TA 1BTPA 3MO9A 1W13U 4MPWA 1GHVH 2ANMH 1V2JT 2PGBB 1AFQB 5LGOA 1OWKA 2BYAX 4X1NU 1O2NA 2V3HH 3UUZA 1C5UA 4YT6H 2GV6A 2WPMS 3KQEA 3HK6B 3VB7A 1PYTD 2ZQ1A 1MCTA 1A0HB 1AMHA 3LC5A 2ZU3A 1ZHMA 3PO1C 3K6YA 1G3CA 3RXJA 1Z7KA 1Y3YA 2FOCA 1V2QT 1MAYA 2Z9JA 1YPGH 1XUIA 1SGYE 1FIWA 1GBHA 1EZUC 1MTWA 2OD3B 4NZLA 3GCHC 3B8JA 4I33A 1H8IH 5HYOA 1KYNA 2FX4A 2BD3A 3M3VA 4NIWA 1TBRH 1EJNA 3VGCC 3GYMA 2P95A 2OCVB 3SU1A 4SGBE 1RS0A 2ALPA 3FZDA 1IQGA 3OYPA 3DT0H 3T26A 1XX9A 3M7UA 3SJ8A 1WQSA 4F4OC 4OS6A 1SQAA 1Y3VA 2FWWA 2VH6A 3SV9A 1M9UA 2FIRH 2GZ7A 3P70B 4WH8A 3UREA 4WY3A 1OYQA 2C4FH 1K1JA 2XTTB 2R2WU 1GG6B 3SQEE 3AAUA 4AYVB 1RFNA 4CRDA 1EPTA 2QCYA 1VCQA 1YPMH 1ELFA 3DD2H 1O2GH 1K1MA 1EJAA 4FU9A 5EXNA 2R9PA 1D3TB 1THSH 1Y59T 2W7SA 2BB4A 4I7YH 4AN7A 1UVUH 4RKOB 4WXVA 1XKBC 2SNWA 4AFQA 3MNXA 1AI8H 4CRGA 2A7CA 1DUEA 3FP6E 2C8XB 1EUFA 4UEHH 5F8XA 1C5OH 1TGNA 1FIZA 3F9FA 2BDCA 1BRUP 5E2OA 1GBCA 1C1NA 1TYNA 1V3XA 1FY8E 2V0BA 2O8WA 2BX4A 2O8UA 1P11E 1S84A 1B5GH 4CRCA 4E06H 1C2KA 2A4QA 4ZMAH 5LPRA 3LDXH 3UFAA 1WBGB 1SMFE 3URCA 1B0EA 4KP0A 3SV6A 2FODA
chains in the Genus database with same CATH superfamily
1GJ8B 3RXKA 2WYGA 1G30B 2VNTA 3BTQE 1QJ6B 2BTCE 3ZVGA 2WUCA 1O2UA 2PFEA 3ESTA 1JWTA 1GBDA 1Q31A 3OY6U 1H9HE 1O3PB 2R0KA 2Y80A 3ZZAA 5L30H 2OBOA 2ZCLP 4NIVA 1CE5A 1F0UA 2XBWA 1G3BA 1MTNB 6LPRA 4ZHAA 1LHDH 2QF0A 4X2VA 3QTVH 1TBQH 1DSUA 1C2JA 1SOTA 1A2CH 2BY8X 3PM3A 3RP2A 1AE8H 4QT8C 3ZVDA 1RIWB 5A8ZA 1DXWA 1VITH 2OXSA 3RXHA 4JK6A 4U32A 1MKXH 2XXLA 5EW1H 4K8BA 2GMTB 4Y76A 3RLYH 3U69H 3D23A 1MABB 2PTNA 2P3TB 1BOQA 2FI5E 3TGJE 1OP0A 1SSXA 5ETXA 1EAWA 5EPNA 1PPHE 1TPSA 3OTJE 1NFYA 1OWJA 2C8ZB 2PTCE 1T8MA 1NRNH 1SQOA 2JETB 1CHOG 4XFQA 1F5KU 2ZGXH 4DVAU 2CHAC 5E0JA 3TJOA 1GI9B 1ZGIA 2FOGA 3S9AA 1CT2E 2AHME 2D1JA 5TCCA 4P02A 1GMHF 4U30A 2XCFA 4YZUA 1A61H 5IDKA 1Q3XA 2NU1E 4JZIA 2J4IA 1IQIA 3SU5A 5K0HA 4H4FA 3BG4C 4RKJB 2Z94A 5C20A 3SZEA 2WHXA 2PP6A 1FUJA 3MQKC 1V2KT 3LIWA 1O32A 1O2RA 3CP7A 5DJ7A 5DKMA 1EP5A 2WV9A 4FUEA 1K22H 2ZFQH 3ZVBA 1O2VA 4WH6A 3ZVFA 3PB1E 3A7VA 3QX5H 4TY7A 3SBKA 3Q77A 1O37A 1EZSC 1ELDE 1SGDE 2ZA5A 1W0YH 3V3MA 5C1XA 4GAWA 1FY5A 3LGIA 3ZIAD 4OS2A 4DIIH 2PW8H 1C2FA 4KKDA 5I46H 1CVWH 3RXBA 4TY6A 1MMJN 1LHCH 2PR3A 1SLXB 3QUMP 1W3CA 1ETSH 1HGTH 1BTWA 1XXDA 2TGAA 4AB8A 3BIVH 2BLVA 2ZIQH 1P05A 2XNDD 2WV4A 2H9TH 1Y3XA 2YMSB 1H9IE 1UW7A 2IJD1 2W26A 2XBVA 3OSYA 5GCHF 1J15A 3QGJA 1ZMNA 1O3EA 1PQ8A 5F6MA 1BBRE 1C1WH 4ABEA 3F0OA 3AVZA 2WINI 3VPKA 3M5OA 2G4TA 2Q6DA 3H09A 1O3AA 4IBLH 3Q3KA 3ELAH 4IC5A 1HYLA 2A5AA 2ZQ2A 1GCTC 2F9NA 4AFSA 3S7HB 4D76A 4TWYA 5E0GA 4A7IB 2ZU1A 1P04A 1MTNC 3UOPA 1TNGA 3NRLA 4Y0YE 3U1IB 2ZCKP 2FESH 4WMFA 3L33A 1AVGH 4WVPE 1P2JA 1GDUA 2OC0A 3OEED 1TMUH 4A92A 3VXEH 2G00A 1PPZA 2SGDE 2SGQE 3BN9A 4TYDA 4K69A 3G01A 5F8TA 2GMTC 2ZECA 1C1RA 3PMBB 2ZDLA 1QA0A 3M3SA 1YF4A 2FDAA 1L0ZA 1UCYE 1C2LA 5HIYA 2J92A 1G37A 4WMEA 2GCHF 4I31A 2JETC 1W7XH 1LHEH 3UR9A 2G4UA 1TRYA 2A2XH 2UUKB 3H5CB 4JZFH 1C5TA 2Z9GA 2ZGJA 2JH0D 4X1PU 3SUFA 4ASHA 1TNLA 3E90B 1P2KA 4M7GA 2Y7XA 1ESBA 3SU2A 3DHKH 2A7JA 1W14U 1BBRH 1RTKA 2ZF0H 2ZFFH 4UONA 2A5KA 4YOIA 1SGCA 1IHSH 1OP2A 1CQQA 1OPHB 2F9PA 3BG8A 3UNQA 4I86A 5DO4H 1DDJA 4D7FA 1CBWC 3TH2H 2CF9H 1DPOA 2FOAA 1ELVA 5EIYA 1NFXA 1JIRA 4FUCA 3VB3A 2ANKH 1LHFH 4IGDA 6CHAB 2V3MA 3PRBA 4CR5A 5BRRE 2ZPRA 1P8VC 1F92A 4NFFA 2FTLE 2ODQA 2UWOA 2FOEA 5A09A 3LJOA 2VH0A 3S9CA 1Z6EA 3BEUA 2FOFA 4YXWD 1SL3A 1ZPBA 2YMSC 1C2GA 1FY4A 3VB4A 1RGQA 4OS5A 4CRFA 4LXBH 1ANDA 1TWXB 4O3TA 1P2MA 4XRNA 2F83A 2AEIH 4AZ2B 4B76A 2AYWA 3FVFB 2W5EA 1MKWH 4ASUD 3T25A 4B2AA 4FXGH 4O97A 5EODA 2HPQH 2OC7A 2WUBA 4JZ1A 1YCPH 4BAHB 1EKBB 3LPRA 4DY7B 5JPMH 1PQ7A 1HCGA 4WWYA 2P93A 2BXUH 2UWPA 3A83A 2SGAA 5GWZA 4XBDA 2W6ID 1HDTH 1DWBH 3E3TA 2FMJA 2P3UB 1O2HA 3LU9B 4NSVA 5E2PA 1OOKB 1JBUH 4IN1A 3EE7A 1F7ZA 1HPGA 4K5ZA 4B1TA 1SGPE 3NWUA 3UQOA 2GT7A 1Z71A 3M5LA 3QWCH 2ZDVH 1O5FH 2ZGBH 1YYY1 3E1XB 1C5MD 3FP7E 4F48B 1ORFA 3R3GB 1DLEA 4A1VA 4AG2A 1QQ4A 3B23B 3A7TA 1UJ1A 1S6FA 1EX3A 1V2UT 1S82A 3S0NA 2PKSB 2B8OH 2O8MA 1AY6H 3UNSA 5GIBA 3IITA 4AFUA 2EQNA 4UFDH 4CRAA 4Z1MD 2H6MA 3GCNA 1SLWB 1O5DH 2I6SA 5E8EH 1O2XA 1FV9A 3ATWA 1NY22 4Y11E 1CA0B 2OP9A 2YOLA 2KAIA 4OS7A 5EGMA 1Z1JA 1Z8JB 4PROA 3O8DA 1O2ZA 3SNAA 5FPSA 1RD3B 4HZHA 4ZKSU 1GBAA 3QTOH 1QBNA 4MNWA 1ELGA 1TIOA 1OHHD 4RT0A 4X0WU 2FS8A 3A8CA 1MU8B 1YY3A 2FLRH 5IK2D 1HB0B 2Z3EA 4BNRA 3A87A 2KX4A 3BTME 1O5AB 3AW1A 1O31A 1TAWA 2ZCHP 3A85A 3H7TA 2VIQA 1N1LA 2GGVB 3SU4A 3ZZCA 5T6FA 2O8TA 4Y7AA 8KME2 2BLOA 3BTDE 1MQ5A 2FP7B 2QIQA 1GHBG 2EA3A 3JZ2B 2BDBA 2JJ2D 1K2I1 4E7NA 2OQ5A 4ZKNU 3GCOA 1RTFB 2ODPA 5JYIA 1DOJA 2LNCA 3FFGA 4ZHMU 1OS8A 3P8FA 3AW0A 1NTPA 1PQ5A 4X8TH 1E38B 3BTEE 1EPTB 1IQLA 2QGRA 8ESTE 1H8DH 2ZHDA 3R0FA 4IC6A 5FBEA 1GMCF 4ABJA 1GJAB 5JBBS 1P06A 1VCWA 1DE7H 2AGIX 1F5LA 2YNAA 2BDYA 9LPRA 1IQKA 1E1QD 4I8KA 3IWMA 1WQVH 2BD8A 1FQ3A 1QL8A 1XUKA 3GICB 1AQ7A 3SORA 5JBCS 4CBOA 1O3FA 1TLDA 3B9FH 2SFAA 2F9BH 4Q7XA 2V35A 1ETTH 3ODDA 3UB0A 3ZZ8A 2FOBA 4ESTE 3F3BA 2Y81A 2G51A 2GJGA 1RXPA 2A1DB 3U28C 4INLA 1W0JD 2PV9B 3RMMH 1C5QA 1QGFA 2CGAA 2F4LA 2ZGHA 1SBWA 4J1YA 3ZVAA 2FI4E 1HAXB 3PV5A 2EI8A 3UAIC 4DG4A 4ABHA 1IQNA 3VEQB 4FVBA 1WV7H 4THNH 1GGDB 1INCA 4GSOA 4BOHA 4INHA 3RXGA 2PKSC 1XVOA 4AC9A 3QZRA 1W11U 1LO6A 3KCGH 2BQWB 5C3NA 1D3QB 2A32A 1MZAA 3MU5A 2Y5HA 3KQ5A 2C8YB 1FMGA 1EASA 3QN7A 3MH7A 1GBBA 2ZU2A 2LPRA 4MNXA 1CA0C 2PUQH 1NBME 4BAQB 5JB9S 4IN2A 4ZCNA 2IJOB 3ZZ5A 7GCHG 4DGJA 3F9HA 3KHVA 1BCUH 1HAZB 3OU0A 3PMAB 1O34A 1GBKA 4HI3A 1L4ZA 3UOUA 2M2AA 1G32B 5HM2A 1O3HA 1IQMA 1OYTH 4K60A 5FCKA 1O2YA 1VITG 3MFJA 3SNBA 1UVTH 4NCYA 3RDZA 2KCOA 2VIPA 3TJUA 2CK3D 4FU7A 1QCPA 1C1VH 2D8WA 2PSXA 1CGIE 4ABBA 3MHWU 1NU7B 1C1PA 1Z8RA 3A80A 1AU8A 1B7XB 6ESTA 3DSPA 5J4SA 1C1MA 3A7ZA 1DXPA 2AERH 1GJ9B 1GBLA 2CMYA 1UHBB 1NS3A 3KQCA 1JIMA 2ZU5A 4JK5A 2WYJA 1EOLA 2ALVA 1AUTC 1DITH 1ZHPA 1EAIA 3Q3XA 2QV1A 1OKXA 1OXGA 2HRVA 4NA9H 4X6PA 1EPTC 1ZSLA 2DUCA 1P01A 4AGKA 1A0JA 2AFQB 1S5SA 1BT7A 3D49H 3A8AA 1HBTH 1Q2WA 4X6OA 2FYQA 2BHGA 2XRCA 3MI4A 2VGCB 3U98H 3P8GA 2A4OA 5FAHA 1ABJH 1TX7A 1U6QA 1XM1A 2ZTYA 5EJZA 2ZO3H 3NXPA 3M5NA 2BD7A 1FI8A 2P8OB 1TOMH 1ZHRA 3QGNB 1G2LA 1YPEH 1ZGVA 4GHQA 1AO5A 1EATA 1TRNA 5IYTA 2HNTE 2NU0E 4YM9A 1KXDA 3UTUH 3T29A 2H5DA 1ARCA 1NT1A 3BEFB 1HAIH 3T28A 1ACBE 3RLWH 3NCLA 2JH6D 4MLFB 3SQHE 1AE5A 4K3JA 1O2WA 2AIPA 3A86A 2GP9B 5ESTE 2F3CE 1ZZZA 3GCTF 1GGDC 4GUXA 1TNHA 1XXFA 5EQRA 1BTXA 1LVYA 1O2MA 1ZJKA 3SV7A 5FCRA 3LJJA 2H5CA 2Z9IA 3E0NB 1GHBF 1GI3A 3VXFH 2FOMB 1VZQH 1C4U2 2QXGA 4NG9H 1NFWA 1O3KA 4FUJA 2OC1A 1AWHB 1W0KD 8LPRA 2BXTH 3EDXB 2K8IA 1EJMA 1WYKA 3O8RA 2H9HA 1PJPA 1BMAA 1V2OT 5F03A 5FBIA 1TBZH 1AFQC 3ODFA 2FI3E 3M5MA 2D26C 4JYVH 4X8UH 4LOYH 1QB9A 1GI4A 1PQAA 1N6YA 1B0FA 2PKAA 2BVXH 4ABFA 5DP7A 1THRH 5K7RA 2UUFB 2ZDNA 5FHTA 1SQRA 4Q7YA 1GJ6A 1TB6H 2R3YA 1F2SE 3GY3A 3TH3H 1L1NA 1QL9A 1RTLA 4GPGA 1XKAC 5JBTA 2B0FA 2ZEBA 2EI6A 1P2IA 2Z6BD 5HGGA 5A2MH 2K1QA 3T5FH 1LQEA 2CN0H 2OLGA 2VIVA 5DP5A 1DX5M 3LGWA 1L1JA 1NZQH 3LGVA 2ZP0H 2OQUA 3OAAD 5F8ZA 1RRKA 2KCYA 4YESB 2AMDA 2VGCC 4D9RA 4DJZB 4A5TS 4D9QA 5E0HA 1A4WH 3V13A 1GBMA 4F49A 3F2HA 1SKYE 3K9XB 2P8OC 4X2WA 1P0SH 2IOTA 1LVOA 1SOZA 3NPSA 2VIWA 4KTSA 1BJUA 1HJAB 3SZNA 7GCHF 1UHBA 1BTZA 4ISNA 2J2UA 1FNIA 3FKSD 3UWJH 1A3EH 1LTOA 8GCHF 1GG6C 1T8NA 3AASA 2NU3E 1UTMA 4JYUH 3PLPA 1FDPA 5LPEA 3U9AH 2STBE 5DP8A 1VITF 1GDQA 2ILNA 4K8YA 1GCDA 3TLOA 2ASUB 3U8RH 4INKA 1V2WT 4B74A 5A8XA 5DN6D 1BRBE 1J8AA 2ZG0H 1DWEH 1Z6JH 1O3LA 1O38A 2BZAA 3RXCA 1PPCE 1IOEA 1C4V2 1C5RA 4A6LA 3W94A 3M3TA 4Y71A 2PWXA 2WZQA 3H7OA 4BXWA 1QRWA 3QLPH 1K1LA 1ZMLA 4X2XA 3SJKA 4AGJA 2VVVA 1P2QA 3P92A 3OTPA 2J95A 4UE7H 3SJIA 1BTYA 2GKVE 1PPBH 1C5WB 4FUDA 1Y5AT 4ZROA 4YOJA 2Y5FA 2QA9E 1CO7E 2HOBA 5CHAB 1TA2A 1JMOH 3CS7A 3RM0H 1BMLA 1Z1IA 1UVOA 2VB0A 2J5UA 1ELBA 1S81A 1P10A 3MO6A 3A7YA 1MBMA 5AF9H 3KL6A 1SPJA 1TPPA 2WSSD 4FETA 4IMZA 1NBMD 1ZSKA 4HTCH 5HXFA 1EFRD 4AYYB 4RI0A 1ESTA 3SUEA 3UR6A 1C5YB 3ZYEA 3SV8A 3BTTE 1GI0A 4WJG2 1SGQE 1G3EA 2Z7FE 3M37A 1GBIA 1GPZA 1OWHA 1LVMA 1NESE 1CT4E 3E91A 1SFQB 1C5ZB 1YC0A 2Y82A 1FAKH 2BY6X 3BTKE 5KGOA 1WDIA 1RIWC 3F2FA 4X6MA 2A2QH 3GS9A 5GJ4B 1CGJE 4ZH8A 4RSPA 4FOUC 2FOHA 2KAIB 1QBVH 1T8OA 4KTUA 2NU2E 2RA3A 2XNIA 2ZC9H 3F0PA 2J9NA 2A31A 1ANCA 2FX6A 7ESTE 5DP4A 1GI1A 2IPHA 3SUGA 2V3OH 1AGJA 4CREA 5C1YA 3HKIB 2FZZA 1SGFG 1O2TA 4JZEH 4X8VH 3SJOA 1O5EH 1SGTA 4UD9H 1HJAC 1XMNB 1A46H 5GNDA 1H8HD 1W2KH 1OWDA 2PLXA 1K1NA 1SQTA 3RXUA 3MNCA 2K0QA 1YKTA 3SW2B 3RC5A 1W10U 1JXPA 2FM2A 4NWKA 4TPYA 4B2CA 3BSQA 3DFLA 3ATKA 4HGCA 4A1TA 1BRCE 3TPIZ 1SVPA 5L6NH 1QFKH 4ABDA 3RC4A 1DLKB 2D2DA 2ODYB 1AKSB 4ISHH 5AVDA 3KYFA 2ANYA 1K1OA 4OS4A 2HGTH 3EA9A 4CBNA 5L2YH 2ZI2H 5CE1A 1UTQA 1MUEB 3GDVA 3M7QA 1SHYA 1HNEE 4J2YB 5CDFE 3KIDU 3C27B 2FPZA 1NFUA 2ZHQH 3RXOA 3F68H 2GV7A 1GHYH 5C2ZA 1MTSA 2WPDD 4I8HA 5DK1A 1BJVA 2ZGCA 1D6RA 4TT3D 1O2SA 1MD7A 4YLQH 6GCHG 2BY9X 4AX9H 1UCYH 1COWD 3Q00A 5CHAC 3A7WA 3ZZ9A 2GD4B 5FX6A 1GL0E 4P00A 2H1UA 1LHGH 2HLCA 3STJA 4R0IA 2RA0A 4BTIB 1HAPH 1QRXA 3WY8A 4IMQA 3SV2H 4DT4A 1CHOF 3MOCA 1ZPCA 1NRSH 2KZ4A 4I8LA 3BTHE 1AVXA 2Q6GA 1ELCA 4GLYA 3PTBA 5TCAA 1SGNE 2ZDMA 1QZ8A 5B6OA 4B75A 1NC6A 1UK3A 2TGPZ 1TRMA 2O8LA 1LMWB 1TGTA 2QC2A 1NM6A 2TIOA 4Y7BA 5T6DA 1EP6A 2I6QA 3F9EA 1HAVB 3FN8A 4LZ1H 1QB6A 2F9OA 3MNSA 3P6ZB 1KXEA 2ANWA 4NGAH 1MU6B 2CJIA 4DW2U 5HM9A 1MKWK 3ENSB 3TJNA 3M35A 4FUHA 3PMHB 1GHXH 1O39A 1S0QA 2Y7ZA 1UTPA 1KMHB 2XWBI 4ISIH 3LT3A 3MWIU 1IQJA 4Q7ZA 1K1IA 1QNJA 3A8DA 4U01A 4BXSA 3GY8A 1SLUB 2BLWA 1E36B 1H4WA 2SGEE 2QXJA 5J4QA 5H4IB 2FYRA 2KFWA 3TVJB 1THPB 1YPHC 1MCVA 1O5GH 5C17A 1GI6A 1A1RA 1KLIH 2PGQB 2ZNKH 3TNSA 4BAOB 2LP6A 2WPJS 1YCPM 4X6NA 3QK1A 1QL7A 1KSNA 2VINA 3DSGA 1H1BA 7LPRA 2ULLA 2RDEA 2SGPE 2ZKSA 4Y8XA 3E0PB 2GDDA 2ZWLH 3F9GA 3HKJB 1TA6A 1NU9A 1EB2A 3LH1A 5C5OA 3M36A 1ID5H 6CHAC 5JDUB 3EA8A 2BY5X 1NO9H 3I77A 4D7GA 2WV5A 2BD9A 2QXIA 1TPOA 2XYAA 3A88A 1FY1A 3AAVA 4GVUA 4BAKB 2QAAA 4E7RG 4ISLA 1A5IA 3C1KA 2F91A 1GBFA 1IAUA 3KGPA 4O3UA 1HAOH 3RUOA 2QF5A 3SGQE 3LKWA 1L4DA 1YLNA 4Q80A 5A0AE 2JDID 5FX5A 1MAXA 1A7SA 3OX7U 4CRBA 1GJBB 1WTGH 1AKSA 1O2IA 3MU4A 3HATH 1YPJH 1O3DA 3TGKE 1DWCH 1TMTH 1KTTB 2CXVA 1O3MA 3HPTB 3SU3A 1V2VT 5FPTA 3PROA 7KMEH 4YO9A 4D8NA 1MTUA 3QDZB 3TK5A 1UK2A 2VVCA 5EJ1A 3MH5A 1SFIA 2VWOA 3I29A 2BQ6B 1BMMH 3ATIA 1IQEA 2VWMA 3ZZ4A 3MO3A 1C1OA 3M7TA 3RXFA 2J98A 4JYTA 4MPUA 1YM0A 2JIZD 2XCNA 1EZXC 3KQBA 4U2WA 3VGCB 4CR9A 4X1RU 2A5IA 3RC6A 1EAUA 4XBBA 2Z3CA 1OX1A 1SC8U 1K28D 3SU0A 1P3CA 3CENA 1DICA 1P02A 5DSFA 3SYJA 2AMQA 1D6WA 3A89A 2ZPQA 2SNVA 3A7XA 1C5LH 3PLBA 3SNCA 2BX3A 3UNRA 1GHWH 1E0FD 1DY8A 1NN6A 2PSYA 2BDIA 2ZPSA 3HGPA 1NRQH 1F5RA 2VIOA 3RXQA 3FOAA 2PKAB 3PLKA 4M9FA 4CH8B 3TGIE 1O3JA 6GCHF 1GVZA 1EOJA 1HAVA 1J9CH 4X8SH 3A81A 1S85A 4FUFA 4BTTB 1FJSA 2QF3A 2QXHA 1C2DA 1O2LA 3Q3YA 1F0RA 3PWBA 2BMGB 3PRDA 1H8ED 2BDGA 1GJ7B 1EZQA 5JBAS 1GI7B 3HK3B 1ELAA 1V2TT 2W3KA 1BQYA 1SGRE 1A5GH 3SHCH 1A0LA 4FUIA 3I78A 2R0LA 2G5NA 1C5NH 1KLTA 1ZTLA 5C94A 3SU6A 4X1QU 1AZ8A 1KDQB 2YNBA 3GOVB 1QJ1B 1NPMA 2J94A 1ZMJA 1ZJDA 4YLUA 2F9UA 5EW2H 4I8GA 1YPHE 1BTHH 2CV3A 4OM9A 4MPVA 4Y79A 3M61U 5ESBA 1C5SA 1DANH 2KR7A 4XOJA 2KCAA 3RXEA 1O2QA 2AMPA 9ESTA 1K1PA 1O36A 1TALA 4UFGH 3K2UA 2J34A 3UPEA 1XUFA 2BOHB 3RXSA 3P17H 5GDSH 1SLVB 1AUJA 1UVSH 2KM0A 4MG3A 1T4VH 3RU4E 2GZ8A 4ZHLU 1P09A 4JMYA 3S9BA 3ATMA 1O33A 3DUXH 1LPKB 2F43B 1O3GA 4B73A 1HAGE 3E16B 1OSSA 5L2ZH 1DS2E 4MTBA 2GX4A 1VGCB 1ZSJA 3TJVA 2ZDKA 2CF8H 1MH0A 4H42U 1C2MA 2EI7A 5F53A 2V7QD 4O9VA 4NFEA 1H9LB 2QYIA 5LH8A 1V2RT 3L3TA 2B7DH 4MQAA 5GCHG 2RG3A 2P3FH 5T3HA 1WTHD 1EXFA 2R2MB 3LH3A 3GY4A 2BDAA 3TH4H 3KF2A 1SGIB 4B2BA 1UVPA 2WPKS 3U8OH 2CHAB 2F9VA 1TE0A 2AH4X 1FAXA 5EQQA 5ABWA 3WW7A 1E34B 1P3EA 3TNTA 1QHRB 1TX6A 1HFDA 3BTGE 5CMXH 4UFFH 3PTNA 2OINA 3BF6H 4A1XA 4Y8YA 4BAMB 4JCNA 1UTJA 5LPFA 2OK5A 3BG4B 3S69A 3DA9B 1OP8A 1S6LA 1CA8B 2OUAA 1E37B 4X1SU 1DVAH 1CHGA 2ZFSA 2DE8A 4CHAB 3GDSA 1N8OB 1AD8H 4Q2KA 5EOKA 3BIUH 3S7KB 1O30A 3A8BA 1A5HA 1GI2A 3LONA 2GCHG 2IN2A 1C1TA 3UY9A 2A7HA 1VCPA 4FUGA 3GYLB 3F6UH 2A0QB 3EAJA 4FVDA 1DFPA 2ZHWH 1KXAA 4NIYA 1FLEE 1V2LT 2GDEH 4I32A 4SGAE 1C4Y2 1O3BA 1S6HA 5PTPA 1ELEE 1GBTA 4ACAA 1E79D 1KXBA 1TGSZ 2ZFRH 3N7OA 1W0ZU 3KQDA 3P95A 1E35B 3SI3H 3MH6A 1ZRBA 1CU1A 2FS9A 2EC9H 2HVXA 3KEEA 4ZKRU 1PPEE 1ELTA 2Q1JA 3SOSA 1HXEH 5KECA 3LGUA 1J14A 4TWWA 4WF8A 4XBCA 5GPIB 3ZZDA 5EQSA 3TK6A 2M5TA 1GCTB 3EE0B 2HWLB 2ZDAH 1Y5UT 2GZ9A 4NIXA 1T7CA 3ZV9A 2HNTF 1KDQA 1NRRH 4H6SB 1LVBA 1QBOA 2O9QA 1WAYB 5EXLA 5B6LA 3LGYA 1YBWA 4IW4E 1P57B 4MDSA 1VGCC 1HRTH 3RXRA 1DY9A 1ARBA 3FP8E 3FZZA 4H6TA 3OY5U 1P12E 2L6OA 2HPPH 1PYTC 3K65B 1ZLRA 2Z9KA 2J38A 1GWAA 1O0DH 2OTVA 2AGEX 4BANB 1GBJA 4DT7B 1MKXK 1EAXA 1ANBA 1LKBA 2IPQX 1DUAA 4R8TB 5C1UA 1CSOE 1TGBA 4WMDA 4Y0ZE 4CH2B 1ETRH 1KTSB 1BITA 3ATLA 2W3IA 1BB0B 2FXRA 4AOQA 2YMSD 2XC0A 2BM2A 4F55A 1YGCH 3BTFE 4ZXXH 3KN2A 2ZZUH 1SHHB 5A0CA 3UIRA 4E05H 3VFEA 1AZZA 2TGTA 3TK9A 3URDA 1DSTA 3ZVCA 3SNDA 4I8JA 1FXYA 1YLDA 2B5TB 3KNXA 2QE7D 1JOUB 1JRSA 4UFEH 2GTBA 2V6NA 3DCLA 1SB1H 3BV9B 5DP6A 1UTNA 1O2KA 4ACBA 1ABIH 1CBWB 1TPAE 2C8WB 5HIZA 4CHAC 1N8OC 1QIXB 1TNJA 1J17T 4MVNA 1PPFE 1C1UH 1ZOMA 3KYGA 3UQVA 3A82A 2VIDA 2L74A 2ZFPH 1GMDG 5FL7D 1EQ9A 4IS5A 3MMGA 4ISOA 1AB9B 1TFXA 1EB1H 3U1JB 4NA8A 3ZZ7A 3F2GA 2BLQA 3D62A 4NA7A 1Z8GA 1D4PB 4LK4A 1BRAA 3EQ0H 5DP9A 3P8NA 3EA7A 1D9IA 2JKHA 2PUXB 1FY3A 1BIOA 1GVKB 5C0TA 2BVRH 1QR3E 1TGCA 1T31A 3SN8A 1D3PB 1GJDB 1GJ5H 2FTMA 2BVSH 1LKAA 4YTAA 3RMNH 1DM4B 1O3CA 2OBQA 3P8OA 1L1GA 2FEQH 1QA7A 1GI8B 1UTKA 5C0UA 5FPYA 1DWDH 2UUJB 5C67A 3SI4H 3SGAE 3ZZ3A 1OWIA 1SGFA 2VWNA 4GCHG 1LPGB 1GHAG 1AFEH 1O5BB 1F0SA 3IG6B 1WCZA 1HV7A 3O8BA 4B6EA 2RFKC 1PFXC 1AIXH 1J16A 4Q4LA 2BDHA 2XW9A 2KCPA 5JB8S 3FAOA 3N99A 3T62A 1TNKA 4NZQA 1XVMA 3RU4D 3RXIA 1LQDB 1WU1A 5TJXA 3GY6A 4ABGA 3BEIB 5I25A 3ZYDA 1GMCG 1K9OE 1Y8TA 3GDUA 4Z6AH 1HAHH 4BTUB 4UDWH 1HJ8A 3VG8A 2TPIZ 2Y5GA 4DIHH 5HMAA 3SUDA 2VJ1A 3RXLA 2BD5A 2ZTZA 3EGKH 1DT2A 4VGCB 1O3NA 3RXVA 5HKKD 4DCDA 2BY7X 1FONA 3STIA 2A4RA 2EEKA 2A4GA 4DURA 3PWCA 3WWBA 1ZR0A 4GHTA 1AHTH 2ZHFH 3MU0A 4RT1A 3HGNA 3N7DA 5GXPA 1YPLH 4KTCA 5FXLA 1QURH 1FX0B 4MNYA 1LDTT 1HIAB 5C5NA 3ZZ6A 1XUJA 1QY6A 4AFZA 3DFJA 1C5PA 4AG1A 1IQFA 5CHBA 2XWAA 1QQUA 1BBRK 4MPXA 1ZTJA 5KEDA 3F1SB 1X7AC 3GY2A 1BHXF 1TMBH 3U8TH 1Y5BT 4AORA 3ZV8A 1FPHH 1BDAA 1BTUA 2H9EH 2J98B 1P2NA 1A3BH 2QN5T 1MBQA 1ANEA 1FN8A 2BZ6H 1AWFH 1FPCH 1RJXB 1P9SA 3N7EA 1QJ7B 3CS0A 4Z0KA 1G9IE 1WOFA 1C2HA 1C5XB 1ZTKA 1K21H 3NZIA 1HLTH 5SGAE 2ZTXA 1AB9C 4Y8ZA 2G8TA 2FLBH 2HALA 1KY9A 5EU8A 3MYWA 3MNBA 3GISB 2HVYB 4K1EA 3TIUA 1W12U 1GJ4H 1NROH 4KELA 1N6XA 2BD4A 1W7GH 3E8LA 1GVLA 1C2EA 1IQHA 4NWLA 4O03A 1O3OA 1UO6A 2RDLA 1UCYK 1SI5H 1WXRA 2STAE 3MU8A 1QB1A 3ZVEA 1HAYB 2W7UA 1IHTH 1NRPH 3K6ZA 1FN6A 1BZXE 1KXFA 1P03A 3LOXA 3PYHA 3VB5A 4ZXYH 1YPKH 2QY0B 3FANA 1T8LA 1GBEA 1S0RA 1GHZA 2NWNA 1UTOA 1GJCB 3LC3A 2TBSA 5DP3A 2ZHEH 1UTLM 1V6DA 1YCPK 1AN1E 3V12A 3T27A 2GVFA 3W1EA 2G81E 4OGYA 3RMLH 1HXFH 2BD2A 1UMAH 1VJ9U 1TABE 1HJ9A 4FU8A 3RM2H 3RXPA 1V2ST 5EG4A 3SHAH 4B6FA 3QZQA 2G5VA 1XUHA 4Y10E 3RXDA 3SGBE 5AHGH 3O8CA 1TQ0B 4X2YA 3GY5A 2GCTB 5G4BA 2OC8A 5DG6A 1Y3UA 1GMDF 1O5CB 2WPLS 1MQ6A 2TRMA 2AGGX 4VGCC 1MD8A 3T2NA 5T6GA 1AVWA 3SNEA 3BTWE 3RMOH 1SR5C 1BMFD 2Q6FA 2BOKA 3A84A 2C90B 1WUNH 1C9PA 1D3DB 4OS1A 2FO9A 4NSYA 2TGDA 1OWEA 3TITA 3CNRA 2AIQA 4ABAA 5DPAA 1E1RD 1W8BH 2LELA 2WPHS 4YOGA 2ZU4A 1ZPZA 1C5VA 3PMJA 1JRTA 1G2MA 4YT7H 1G3DA 4AB9A 1C1SA 5BPEA 1Y3WA 3Q76A 4FUBA 2VVUA 2EY4C 4LZ4B 1VJAU 1CGHA 5AFYH 2P94A 2P59A 1VR1H 1TQ7B 2Y6TA 4B71A 1SGEE 1BMNH 2H2ZA 2XOKD 3GCTG 3PV4A 2UUYA 3AK5A 3L6PA 1K0HA 1FZZA 1QRZA 2R3UA 3GY7A 4GCHF 4ZAEA 3EYDA 1GHAF 2SGFE 1CT0E 2XBXA 4DOQA 2Z9LA 3FO8D 2DE9A 1T32A 3UWIA 1O35A 1ZRKA 2C3SA 3VB6A 2VU8E 1G36A 1TOCB 1P2OA 3RXTA 4JZDH 3PO1B 5DGJA 1S83A 3JZ1B 1O3IA 1HIAA 1GDNA 2B9LA 1HUTH 2HNTC 4HFPB 4WXIA 5A0BA 1QTFA 3GCHB 2A45B 1TX8A 1BUIA 2NU4E 3ZZBA 1F0TA 5EPYA 1TNIA 3NK8A 3E6PH 4K1SA 2UWLA 4Y6DA 3V7TA 3SJ9A 3NUMA 1O2JA 4HG6A 1YLCA 1WSSH 1MZDA 1VKYA 3W95A 1O2OA 4OGXA 3TU7H 2P16A 2HLDD 1L2EA 3RU4T 5A8YA 2G55A 3MU1A 2BQ7B 2Z3DA 3DSOA 4XDEA 2AS9A 2GT8A 2WPIS 4TPIZ 1BA8B 1V2NT 4XE4A 2XC5A 3OE7D 1PPGE 1C2IA 2W6JD 2C93B 1P9UA 1YP9A 2VWLA 2G52A 2VBCA 2PHBA 4KGAA 1KXCA 1SG8B 1GL1A 1LCYA 1T4UH 1V2MT 5AFZH 1Z8IB 3D65E 2XC4A 2GCTC 1UK4A 4K2YA 2ESTE 1TONA 2XBYA 1LPZB 2RCEA 3RXMA 1BHXB 1ESAA 3NKKA 1XUGA 1MTVA 1C1QA 4K1TA 3MH4A 3V0XA 1GI5A 3MTYA 1V2PT 1O2PA 4XSKU 4RN6A 4ABIA 4ZKOU 3RXAA 1KLJH 3LGTA 8GCHG 2JH5D 3SO3A 3ITIA 1GMHG 3QO6A 2THFB 5EXMA 4ZUHA 1ZYOA 1KIGH 4MNVA 2ZFTA 1C9TA 1BTPA 3MO9A 1W13U 4MPWA 1GHVH 2ANMH 1V2JT 2PGBB 1AFQB 5LGOA 1OWKA 3WWFA 2BYAX 4X1NU 4XD7D 1O2NA 2V3HH 3OEHD 1C5UA 3UUZA 4YT6H 2GV6A 2WPMS 3KQEA 3HK6B 3VB7A 1PYTD 2ZQ1A 1MCTA 1A0HB 1AMHA 3LC5A 2ZU3A 1ZHMA 3PO1C 3K6YA 1G3CA 3RXJA 1Z7KA 1Y3YA 2FOCA 1V2QT 1MAYA 2Z9JA 1YPGH 1XUIA 1SGYE 1FIWA 1GBHA 1EZUC 1MTWA 2OD3B 4NZLA 3GCHC 3B8JA 4I33A 1H8IH 5HYOA 1KYNA 2FX4A 2BD3A 3M3VA 4NIWA 1TBRH 1EJNA 3VGCC 3GYMA 2P95A 2OCVB 3SU1A 4SGBE 1RS0A 4Q63A 2ALPA 3FZDA 5EJLA 1IQGA 3OYPA 3DT0H 3T26A 1XX9A 3M7UA 3SJ8A 4TSFD 1WQSA 4F4OC 4OS6A 1SQAA 1Y3VA 2FWWA 2VH6A 3SV9A 1M9UA 2FIRH 2GZ7A 3P70B 4WH8A 3UREA 4WY3A 1OYQA 2C4FH 1K1JA 2XTTB 2J97A 2R2WU 1GG6B 3SQEE 3AAUA 4AYVB 1RFNA 4CRDA 1EPTA 2QCYA 1VCQA 1YPMH 1ELFA 3DD2H 1O2GH 1K1MA 1EJAA 4FU9A 5EXNA 2R9PA 1D3TB 1THSH 1Y59T 2QF4A 5T1VA 2BB4A 2W7SA 4I7YH 4AN7A 1UVUH 4RKOB 4WXVA 1XKBC 2SNWA 4AFQA 3MNXA 1AI8H 4CRGA 2A7CA 1DUEA 3FP6E 2C8XB 1EUFA 2JJ1D 4UEHH 5F8XA 1C5OH 1TGNA 1FIZA 3F9FA 2BDCA 1BRUP 5E2OA 1GBCA 1C1NA 1TYNA 1V3XA 1FY8E 2V0BA 2O8WA 2BX4A 3OFND 3PV2A 2O8UA 1P11E 1S84A 1B5GH 4CRCA 4E06H 1C2KA 2A4QA 4ZMAH 5LPRA 3LDXH 3UFAA 1WBGB 1YWUA 1SMFE 3URCA 1B0EA 4KP0A 3SV6A 2FODA
chains in the Genus database with same CATH topology
1GJ8B 3RXKA 2WYGA 1G30B 2VNTA 3BTQE 1QJ6B 2BTCE 3ZVGA 2WUCA 1O2UA 2PFEA 3ESTA 1JWTA 1GBDA 1Q31A 3OY6U 1H9HE 1O3PB 2R0KA 2Y80A 3ZZAA 5L30H 2OBOA 2ZCLP 4NIVA 1CE5A 1F0UA 2XBWA 1G3BA 1MTNB 6LPRA 4ZHAA 1LHDH 2QF0A 4X2VA 3QTVH 1TBQH 1DSUA 1C2JA 1SOTA 1A2CH 2BY8X 3PM3A 3RP2A 1AE8H 4QT8C 3ZVDA 1RIWB 5A8ZA 1DXWA 1VITH 2OXSA 3RXHA 4JK6A 4U32A 1MKXH 2XXLA 5EW1H 4K8BA 2GMTB 4Y76A 3RLYH 3U69H 3D23A 2PTNA 2P3TB 1BOQA 2FI5E 3TGJE 1OP0A 1SSXA 5ETXA 1EAWA 5EPNA 1PPHE 1TPSA 3OTJE 1NFYA 1OWJA 2C8ZB 2PTCE 1T8MA 1NRNH 1SQOA 2JETB 1CHOG 4XFQA 1F5KU 2ZGXH 4DVAU 2CHAC 5E0JA 3TJOA 1GI9B 1ZGIA 2FOGA 3S9AA 1CT2E 2D1JA 5TCCA 1GMHF 4U30A 2XCFA 4YZUA 1A61H 5IDKA 1Q3XA 2NU1E 4JZIA 2J4IA 1IQIA 3SU5A 5K0HA 4H4FA 3BG4C 4RKJB 2Z94A 5C20A 1FUJA 1V2KT 3LIWA 1O32A 1O2RA 3CP7A 5DJ7A 5DKMA 1EP5A 4FUEA 1K22H 2ZFQH 3ZVBA 1O2VA 4WH6A 3ZVFA 3PB1E 3A7VA 3QX5H 4TY7A 3SBKA 3Q77A 1O37A 1EZSC 1ELDE 1SGDE 2ZA5A 1W0YH 3V3MA 5C1XA 4GAWA 1FY5A 3LGIA 4OS2A 4DIIH 2PW8H 1C2FA 4KKDA 5I46H 1CVWH 3RXBA 4TY6A 1MMJN 1LHCH 2PR3A 1SLXB 3QUMP 1W3CA 1ETSH 1HGTH 1BTWA 1XXDA 2TGAA 4AB8A 3BIVH 2BLVA 2ZIQH 1P05A 2WV4A 2H9TH 1Y3XA 1H9IE 2W26A 2XBVA 3OSYA 5GCHF 1J15A 3QGJA 1ZMNA 1O3EA 1PQ8A 5F6MA 1BBRE 1C1WH 4ABEA 3AVZA 2WINI 3VPKA 3M5OA 2G4TA 2Q6DA 1O3AA 4IBLH 3Q3KA 3ELAH 4IC5A 1HYLA 2A5AA 2ZQ2A 1GCTC 2F9NA 4AFSA 3S7HB 4D76A 4TWYA 5E0GA 4A7IB 2ZU1A 1P04A 1MTNC 3UOPA 1TNGA 4Y0YE 3U1IB 2ZCKP 2FESH 4WMFA 3L33A 1AVGH 4WVPE 1P2JA 1GDUA 2OC0A 1TMUH 4A92A 3VXEH 2G00A 1PPZA 2SGDE 2SGQE 3BN9A 4TYDA 4K69A 3G01A 5F8TA 2GMTC 2ZECA 1C1RA 3PMBB 2ZDLA 1QA0A 3M3SA 1YF4A 2FDAA 1L0ZA 1UCYE 1C2LA 2J92A 1G37A 4WMEA 2GCHF 4I31A 2JETC 1W7XH 1LHEH 3UR9A 2G4UA 1TRYA 2A2XH 2UUKB 3H5CB 4JZFH 1C5TA 2Z9GA 2ZGJA 2JH0D 4X1PU 3SUFA 4ASHA 1TNLA 3E90B 1P2KA 4M7GA 2Y7XA 1ESBA 3SU2A 3DHKH 2A7JA 1W14U 1BBRH 1RTKA 2ZF0H 2ZFFH 4UONA 2A5KA 4YOIA 1SGCA 1IHSH 1OP2A 1CQQA 1OPHB 2F9PA 3BG8A 3UNQA 5DO4H 1DDJA 4D7FA 1CBWC 3TH2H 2CF9H 1DPOA 2FOAA 1ELVA 1NFXA 1JIRA 4FUCA 3VB3A 2ANKH 1LHFH 4IGDA 6CHAB 4CR5A 5BRRE 2ZPRA 1P8VC 1F92A 4NFFA 2FTLE 2ODQA 2UWOA 2FOEA 5A09A 3LJOA 2VH0A 3S9CA 1Z6EA 3BEUA 2FOFA 1SL3A 1ZPBA 1C2GA 1FY4A 3VB4A 1RGQA 4OS5A 4CRFA 4LXBH 1ANDA 1TWXB 4O3TA 1P2MA 2F83A 2AEIH 4AZ2B 4B76A 2AYWA 3FVFB 2W5EA 1MKWH 3T25A 4B2AA 4FXGH 4O97A 5EODA 2HPQH 2OC7A 2WUBA 4JZ1A 1YCPH 4BAHB 1EKBB 3LPRA 4DY7B 5JPMH 1PQ7A 1HCGA 4WWYA 2P93A 2BXUH 2UWPA 3A83A 2SGAA 5GWZA 4XBDA 1HDTH 1DWBH 3E3TA 2FMJA 2P3UB 1O2HA 3LU9B 4NSVA 5E2PA 1OOKB 1JBUH 4IN1A 1F7ZA 1HPGA 4K5ZA 4B1TA 1SGPE 3NWUA 3UQOA 2GT7A 1Z71A 3M5LA 3QWCH 2ZDVH 1O5FH 2ZGBH 1YYY1 3E1XB 1C5MD 3FP7E 1ORFA 3R3GB 1DLEA 4A1VA 4AG2A 1QQ4A 3B23B 3A7TA 1UJ1A 1S6FA 1EX3A 1V2UT 1S82A 3S0NA 2PKSB 2B8OH 2O8MA 1AY6H 3UNSA 5GIBA 3IITA 4AFUA 4UFDH 4CRAA 2H6MA 3GCNA 1SLWB 1O5DH 2I6SA 5E8EH 1O2XA 1FV9A 3ATWA 1NY22 4Y11E 1CA0B 2OP9A 2YOLA 2KAIA 4OS7A 5EGMA 1Z1JA 1Z8JB 4PROA 3O8DA 1O2ZA 3SNAA 5FPSA 1RD3B 4HZHA 4ZKSU 1GBAA 3QTOH 1QBNA 4MNWA 1ELGA 1TIOA 4X0WU 2FS8A 3A8CA 1MU8B 2FLRH 1HB0B 2Z3EA 4BNRA 3A87A 3BTME 1O5AB 3AW1A 1O31A 1TAWA 2ZCHP 3A85A 3H7TA 2VIQA 1N1LA 2GGVB 3SU4A 3ZZCA 5T6FA 2O8TA 4Y7AA 8KME2 2BLOA 3BTDE 1MQ5A 2FP7B 2QIQA 1GHBG 2EA3A 3JZ2B 2BDBA 1K2I1 4E7NA 2OQ5A 4ZKNU 3GCOA 1RTFB 2ODPA 5JYIA 1DOJA 2LNCA 3FFGA 4ZHMU 1OS8A 3P8FA 3AW0A 1NTPA 1PQ5A 4X8TH 1E38B 3BTEE 1EPTB 1IQLA 2QGRA 8ESTE 1H8DH 2ZHDA 3R0FA 4IC6A 5FBEA 1GMCF 4ABJA 1GJAB 5JBBS 1P06A 1VCWA 1DE7H 2AGIX 1F5LA 2YNAA 2BDYA 9LPRA 1IQKA 4I8KA 3IWMA 1WQVH 2BD8A 1FQ3A 1QL8A 1XUKA 3GICB 1AQ7A 3SORA 5JBCS 4CBOA 1O3FA 1TLDA 3B9FH 2SFAA 2F9BH 4Q7XA 2V35A 1ETTH 3ODDA 3ZZ8A 2FOBA 4ESTE 2Y81A 2G51A 1RXPA 2A1DB 4INLA 2PV9B 3RMMH 1C5QA 1QGFA 2CGAA 2ZGHA 1SBWA 4J1YA 3ZVAA 2FI4E 1HAXB 2EI8A 4DG4A 4ABHA 1IQNA 3VEQB 4FVBA 1WV7H 4THNH 1GGDB 1INCA 4GSOA 4BOHA 4INHA 3RXGA 2PKSC 1XVOA 3QZRA 1W11U 1LO6A 3KCGH 2BQWB 5C3NA 1D3QB 2A32A 1MZAA 3MU5A 2Y5HA 2C8YB 1FMGA 1EASA 3QN7A 3MH7A 1GBBA 2ZU2A 2LPRA 4MNXA 1CA0C 2PUQH 4BAQB 5JB9S 4IN2A 2IJOB 3ZZ5A 7GCHG 4DGJA 3F9HA 3KHVA 1BCUH 1HAZB 3OU0A 3PMAB 1O34A 1GBKA 4HI3A 1L4ZA 3UOUA 1G32B 5HM2A 1O3HA 1IQMA 1OYTH 4K60A 5FCKA 1O2YA 1VITG 3MFJA 3SNBA 1UVTH 4NCYA 3RDZA 2VIPA 3TJUA 4FU7A 1QCPA 1C1VH 2D8WA 2PSXA 1CGIE 4ABBA 3MHWU 1NU7B 1C1PA 1Z8RA 3A80A 1AU8A 1B7XB 6ESTA 5J4SA 1C1MA 3A7ZA 1DXPA 2AERH 1GJ9B 1GBLA 2CMYA 1UHBB 1NS3A 3KQCA 1JIMA 2ZU5A 4JK5A 2WYJA 1EOLA 2ALVA 1AUTC 1DITH 1ZHPA 1EAIA 3Q3XA 2QV1A 1OKXA 1OXGA 2HRVA 4NA9H 4X6PA 1EPTC 1ZSLA 2DUCA 1P01A 4AGKA 1A0JA 2AFQB 1S5SA 1BT7A 3D49H 3A8AA 1HBTH 1Q2WA 4X6OA 2FYQA 2BHGA 2XRCA 3MI4A 2VGCB 3U98H 3P8GA 2A4OA 5FAHA 1ABJH 1TX7A 1U6QA 1XM1A 2ZTYA 2ZO3H 3NXPA 3M5NA 2BD7A 1FI8A 2P8OB 1TOMH 1ZHRA 3QGNB 1G2LA 1YPEH 1ZGVA 4GHQA 1AO5A 1EATA 1TRNA 5IYTA 2HNTE 2NU0E 4YM9A 1KXDA 3UTUH 3T29A 2H5DA 1ARCA 1NT1A 3BEFB 1HAIH 3T28A 1ACBE 3RLWH 3NCLA 2JH6D 4MLFB 3SQHE 1AE5A 4K3JA 1O2WA 2AIPA 3A86A 2GP9B 5ESTE 2F3CE 1ZZZA 3GCTF 1GGDC 4GUXA 1TNHA 1XXFA 5EQRA 1BTXA 1LVYA 1O2MA 1ZJKA 3SV7A 5FCRA 3LJJA 2H5CA 2Z9IA 3E0NB 1GHBF 1GI3A 3VXFH 2FOMB 1VZQH 1C4U2 2QXGA 4NG9H 1NFWA 1O3KA 4FUJA 2OC1A 1AWHB 8LPRA 2BXTH 3EDXB 1EJMA 1WYKA 3O8RA 2H9HA 1PJPA 1BMAA 1V2OT 5F03A 5FBIA 1TBZH 1AFQC 3ODFA 2FI3E 3M5MA 2D26C 4JYVH 4X8UH 4LOYH 1QB9A 1GI4A 1PQAA 1N6YA 1B0FA 2PKAA 2BVXH 4ABFA 5DP7A 1THRH 5K7RA 2UUFB 2ZDNA 5FHTA 4Q7YA 1GJ6A 1TB6H 2R3YA 1F2SE 3GY3A 3TH3H 1L1NA 1QL9A 1RTLA 4GPGA 1XKAC 5JBTA 2B0FA 2ZEBA 2EI6A 1P2IA 2Z6BD 5HGGA 5A2MH 2K1QA 3T5FH 1LQEA 2CN0H 2OLGA 2VIVA 5DP5A 1DX5M 3LGWA 1L1JA 1NZQH 3LGVA 2ZP0H 2OQUA 5F8ZA 1RRKA 4YESB 4D9RA 2AMDA 2VGCC 4DJZB 4A5TS 4D9QA 5E0HA 1A4WH 3V13A 1GBMA 4F49A 3K9XB 2P8OC 4X2WA 1P0SH 2IOTA 1LVOA 1SOZA 3NPSA 2VIWA 4KTSA 1BJUA 1HJAB 3SZNA 7GCHF 1UHBA 1BTZA 4ISNA 2J2UA 1FNIA 3UWJH 1A3EH 1LTOA 8GCHF 1GG6C 1T8NA 3AASA 2NU3E 1UTMA 4JYUH 3PLPA 1FDPA 5LPEA 3U9AH 2STBE 5DP8A 1VITF 1GDQA 2ILNA 4K8YA 1GCDA 3TLOA 2ASUB 3U8RH 4INKA 1V2WT 4B74A 5A8XA 1BRBE 1J8AA 2ZG0H 1DWEH 1Z6JH 1O3LA 1O38A 2BZAA 3RXCA 1PPCE 1IOEA 1C4V2 1C5RA 4A6LA 3W94A 3M3TA 4Y71A 2PWXA 3H7OA 4BXWA 1QRWA 3QLPH 1K1LA 1ZMLA 4X2XA 3SJKA 4AGJA 2VVVA 1P2QA 3P92A 2J95A 4UE7H 3SJIA 1BTYA 2GKVE 1PPBH 1C5WB 4FUDA 1Y5AT 4ZROA 4YOJA 2Y5FA 2QA9E 1CO7E 2HOBA 5CHAB 1TA2A 1JMOH 3CS7A 3RM0H 1BMLA 1Z1IA 1UVOA 2VB0A 1ELBA 1S81A 1P10A 3MO6A 3A7YA 1MBMA 5AF9H 3KL6A 1SPJA 1TPPA 4IMZA 4HTCH 1ZSKA 5HXFA 4AYYB 1ESTA 3SUEA 3UR6A 1C5YB 3ZYEA 3SV8A 3BTTE 1GI0A 4WJG2 1SGQE 1G3EA 2Z7FE 3M37A 1GBIA 1GPZA 1OWHA 1LVMA 1NESE 1CT4E 3E91A 1SFQB 1C5ZB 1YC0A 2Y82A 1FAKH 2BY6X 3BTKE 1RIWC 5GJ4B 4X6MA 2A2QH 4ZH8A 1CGJE 4RSPA 2FOHA 2KAIB 1QBVH 1T8OA 4KTUA 2NU2E 2RA3A 2XNIA 2ZC9H 2J9NA 2A31A 1ANCA 2FX6A 7ESTE 5DP4A 1GI1A 2IPHA 3SUGA 2V3OH 1AGJA 4CREA 5C1YA 3HKIB 2FZZA 1SGFG 1O2TA 4JZEH 4X8VH 3SJOA 1O5EH 1SGTA 4UD9H 1HJAC 1XMNB 1A46H 1W2KH 1OWDA 2PLXA 1K1NA 1SQTA 3RXUA 3MNCA 1YKTA 3SW2B 3RC5A 1W10U 1JXPA 2FM2A 4NWKA 4TPYA 4B2CA 3BSQA 3DFLA 3ATKA 4HGCA 4A1TA 1BRCE 3TPIZ 1SVPA 5L6NH 1QFKH 4ABDA 3RC4A 1DLKB 2D2DA 2ODYB 1AKSB 4ISHH 5AVDA 2ANYA 1K1OA 4OS4A 2HGTH 3EA9A 4CBNA 5L2YH 2ZI2H 5CE1A 1UTQA 1MUEB 3GDVA 3M7QA 1SHYA 1HNEE 4J2YB 3KIDU 3C27B 2FPZA 1NFUA 2ZHQH 3RXOA 3F68H 2GV7A 1GHYH 5C2ZA 1MTSA 4I8HA 5DK1A 1BJVA 2ZGCA 1D6RA 1O2SA 1MD7A 4YLQH 6GCHG 2BY9X 4AX9H 1UCYH 3Q00A 5CHAC 3A7WA 3ZZ9A 2GD4B 5FX6A 1GL0E 2H1UA 1LHGH 2HLCA 3STJA 4R0IA 2RA0A 4BTIB 1HAPH 1QRXA 3WY8A 4IMQA 3SV2H 1CHOF 3MOCA 1ZPCA 1NRSH 4I8LA 3BTHE 1AVXA 2Q6GA 1ELCA 4GLYA 3PTBA 5TCAA 1SGNE 2ZDMA 5B6OA 4B75A 1NC6A 1UK3A 2TGPZ 1TRMA 2O8LA 1LMWB 1TGTA 2QC2A 1NM6A 2TIOA 4Y7BA 5T6DA 1EP6A 2I6QA 3F9EA 1HAVB 4LZ1H 1QB6A 2F9OA 3MNSA 3P6ZB 1KXEA 2ANWA 4NGAH 1MU6B 2CJIA 4DW2U 5HM9A 1MKWK 3ENSB 3TJNA 3M35A 4FUHA 3PMHB 1GHXH 1O39A 1S0QA 2Y7ZA 1UTPA 2XWBI 4ISIH 3LT3A 3MWIU 1IQJA 4Q7ZA 1K1IA 1QNJA 3A8DA 4U01A 4BXSA 3GY8A 1SLUB 2BLWA 1E36B 1H4WA 2SGEE 2QXJA 5J4QA 5H4IB 2FYRA 3TVJB 1THPB 1YPHC 1MCVA 1O5GH 1GI6A 1A1RA 1KLIH 2PGQB 2ZNK