1ELAA

Analogous inhibitors of elastase do not always bind analogously
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analogous inhibitors of elastase do not always bind analogously.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords ELASTASE
total genus 62
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1993-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1elaA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1elaA01
3EGKH 1GVLA 3RXVA 5L2ZH 1S84A 3GDUA 3KGPA 1H9HE 4X6MA 4B2BA 1QRZA 1E37B 1J14A 1JIMA 3SORA 1XKBC 1P04A 2FOHA 4UE7H 1D3TB 1LHFH 1J16A 1O2SA 4B75A 7GCHF 2C3SA 1GBEA 2ZFRH 5T3HA 3A7VA 2PFEA 3A7WA 2FODA 5FBEA 2FI4E 4DOQA 1FI8A 2BY6X 1GWAA 3PMBB 3Q3YA 2BDYA 4THNH 1TX7A 2H5DA 2FOBA 3GCHC 1GHAF 2VIVA 2H9EH 2G00A 3FP8E 3E1XB 4NA8A 2FXRA 3E6PH 3SV8A 4K2YA 2HVXA 1INCA 3UTUH 1C9TA 1GBLA 1ELBA 1PFXC 3W94A 1EQ9A 5EODA 1V2RT 1RTLA 3BTHE 1ETRH 1BMNH 4A92A 1P03A 1A5HA 1C9PA 2CXVA 4XFQA 4CRGA 3BTQE 1T4VH 3ODDA 4UFFH 3FANA 1YM0A 2P16A 1SOZA 5JBBS 1ZPCA 1GL0E 2GZ9A 4MG3A 3LGVA 3E16B 3PYHA 2VIWA 3PO1B 3FP6E 5JB8S 1HIAB 2C8ZB 2TRMA 1SG8B 1UO6A 5FPTA 1C5XB 1O2VA 4BANB 1SLWB 1H8DH 1F0UA 3PM3A 4NWKA 4D9QA 1SFIA 1NROH 4RKOB 3UR6A 2F3CE 1IHSH 3RXGA 4UFEH 3RUOA 1TFXA 5A8XA 3JZ1B 1SPJA 2OINA 1HAHH 3UOPA 1AB9B 1GBFA 3SNCA 5F6MA 4AOQA 3VB3A 4DIHH 2BXUH 5EG4A 1P3EA 1RJXB 5HM2A 2ZIQH 1J15A 1YC0A 4MLFB 4AGKA 1CBWC 1O3CA 1EZSC 1QL7A 4X1SU 2ZDVH 3IWMA 1CHOF 3SI4H 3MH6A 1KDQA 3A85A 1O3FA 1QTFA 2QIQA 5BRRE 1FPHH 2YNAA 4WVPE 3M5NA 1NFXA 3RLWH 1D3DB 4Y8YA 1HIAA 1F2SE 2ZQ1A 1G2LA 3GCTF 2OTVA 4NG9H 4WH6A 1ZZZA 2QF3A 4RKJB 3PV4A 1TB6H 5DG6A 1C1RA 4ISIH 3R3GB 1EZXC 1TBZH 3S9AA 1AY6H 1PJPA 1KY9A 3ZVFA 2FS9A 1O2PA 1DSTA 5F8TA 1Y3VA 2BVSH 1PPGE 4LZ1H 1VR1H 7LPRA 3ELAH 2PKSB 2Y5FA 3TH3H 1BBRH 1TNJA 2WUBA 2YNBA 1OWDA 3TU7H 2WUCA 3V7TA 1UCYE 3BIUH 1EXFA 3RXPA 1TPSA 1A46H 3E3TA 2A5KA 1YPGH 3KQDA 3HK6B 1GJ9B 1QL8A 2AIQA 4YESB 5K7RA 5FCKA 1O5CB 3M3VA 4MPXA 1GHWH 4WH8A 1SQAA 4MNWA 1T7CA 1PYTD 3RXTA 1C5LH 1FONA 3WY8A 4X8TH 1ESAA 1PPCE 1QQUA 5JBCS 2FI3E 1OWHA 1QR3E 1ZTKA 4ZKRU 1TQ0B 2TBSA 1MD7A 3SI3H 1TNLA 1M9UA 3E8LA 1NU7B 9ESTA 4VGCC 1EPTB 2G51A 1O2KA 5JBTA 1V2MT 1QGFA 4AZ2B 1QHRB 2Z7FE 1GHBG 1XUGA 2GMTB 4HTCH 1C5OH 1ZMLA 1DANH 1GI6A 1P3CA 3BTGE 1GVKB 1ZHPA 4A1XA 4FUIA 4INKA 1WQSA 1DOJA 1A3EH 3EYDA 3S9BA 1GMDF 3C1KA 2HALA 2RG3A 3TIUA 3OYPA 5FX5A 1T4UH 2ZU5A 1AQ7A 2QA9E 4LXBH 1BTPA 1KDQB 3SJ8A 1UK2A 5ABWA 1H8IH 1C2JA 3GY3A 4X2YA 1ANDA 5LPEA 3ENSB 1T31A 2ZFPH 1O31A 5GXPA 4Y71A 4U01A 1ZGVA 3A7XA 4CRDA 2GP9B 1NRPH 1MAYA 1MZDA 1XUKA 4IS5A 2OC7A 3SU1A 1BRBE 2ZDLA 2ZG0H 1AMHA 1OPHB 1C5UA 1TRYA 5JB9S 1G2MA 3TH4H 2D8WA 4JYVH 2A31A 1SB1H 4X1RU 5AFZH 3RXAA 1N6YA 3MMGA 4CHAC 2OBOA 1DY9A 4F4OC 5TCAA 1NZQH 1DFPA 1MTSA 1WU1A 4AFUA 4MPUA 4OS4A 4IC5A 1AWFH 1GJBB 3KIDU 3UIRA 1CA8B 1MZAA 1EX3A 6CHAB 1ACBE 4WMEA 2G4TA 1K2I1 1D9IA 4BAQB 1KIGH 2C8XB 5FHTA 1VITH 4BTUB 3O8BA 2A2QH 2P59A 1W0ZU 1SGFA 2ZHEH 2F9NA 1Y5BT 2WYGA 4TPYA 2UWOA 2WINI 2XCFA 3JZ2B 1ANBA 1MTWA 1LHEH 2LPRA 5T6DA 1DXWA 4X8SH 1K21H 1GMDG 1Z8JB 3A88A 1VCQA 5DP8A 1K1LA 1BITA 4GUXA 1H4WA 2XYAA 3MU8A 5F8XA 4ZAEA 1A7SA 2PKSC 2J9NA 5AHGH 1A5GH 2ZP0H 1Z6EA 2ZI2H 2HNTC 2XBYA 1UTMA 2Y82A 2VH6A 3F9GA 2AYWA 3U1IB 2OQUA 2O8UA 1QNJA 2OC8A 4GHTA 1QA7A 3SUEA 6GCHG 2QAAA 3GCHB 2Z3DA 4DURA 2CN0H 1OP2A 2VH0A 1TA6A 3RXIA 2H9TH 3GY2A 3T27A 2EI8A 3ZZ8A 1FQ3A 1ZSJA 1AN1E 3FAOA 4ZMAH 1L1GA 4YM9A 3U1JB 1O39A 2UUYA 3QTVH 1GGDC 4GSOA 4XBDA 3SV9A 4MNVA 4IN1A 2PHBA 2SGPE 4IN2A 1OYQA 2GZ8A 4WMDA 1GBDA 2IPHA 1C5TA 1XM1A 4GPGA 1RIWB 4XBCA 3M5OA 3GY7A 2ZWLH 3QZRA 5EXLA 7GCHG 1AI8H 3HK3B 3F9FA 2ZHFH 3S7HB 1S85A 3N7OA 2W3IA 1IQEA 1Z8GA 3LIWA 4X2WA 3ZZ3A 1HJ8A 1S82A 1C1TA 5LPFA 3SU0A 3QK1A 1UTPA 1YBWA 4MQAA 4RSPA 3LGIA 2QXIA 3A7ZA 2R2MB 1HJAB 3L6PA 1MKXH 1LVOA 1P8VC 1QB9A 4BAHB 3D62A 4X2VA 1ZGIA 1TPPA 1ELDE 4B2AA 1G37A 3LH3A 1MTNC 3QWCH 3BTKE 3CENA 1QB6A 3KL6A 4MPVA 1ZRKA 3M61U 2BZ6H 4Q80A 1PPBH 1EZUC 2WV4A 4MTBA 5EW1H 2A4QA 1V2KT 2PSXA 3LC5A 4JZIA 2VJ1A 1NTPA 2BD7A 3TK9A 2BYAX 4Q2KA 1LVMA 3ZVCA 4X8UH 2VWOA 2ZGHA 4UEHH 3UOUA 2FYQA 2ZU3A 4XOJA 4D7FA 2AH4X 1AU8A 1HV7A 1F5RA 1SGQE 3GY8A 3F6UH 1PYTC 5EW2H 1G3EA 1SR5C 4I8HA 1AIXH 3IG6B 1HAGE 1F7ZA 1FN8A 1G9IE 4NIXA 2BQWB 2FTMA 5A2MH 3KHVA 2WPKS 1YPLH 5IYTA 1DUEA 1P9UA 3S9CA 2Z94A 2EA3A 1LDTT 1Y3WA 3QUMP 5LPRA 3PMHB 1BHXF 1O2YA 5FBIA 3A8CA 1BTZA 2CF8H 4PROA 2J38A 1LCYA 4UDWH 3RXCA 1PQ7A 2VIPA 3H7TA 3PMJA 3Q3KA 1GI7B 5DKMA 5ESTE 4CRAA 1HRTH 5GWZA 1FY5A 4YT6H 1FNIA 3FZDA 4K1SA 4WMFA 2XXLA 1NO9H 2QXHA 3RXDA 1G3CA 5E8EH 2ZGXH 1ESBA 2VIQA 2ODQA 3TVJB 1Y5AT 2VNTA 1BOQA 2ZA5A 1DT2A 1CBWB 2AGEX 3A8AA 2FOCA 3S0NA 3PO1C 4Z0KA 3KNXA 3PWCA 1C1VH 1AFQB 2KAIA 5EQQA 8KME2 2PSYA 1ZTJA 5GPIB 2ZPQA 4U30A 2THFB 1JIRA 4D9RA 1ELEE 1LMWB 1C1OA 1ZRBA 1GHBF 2FOMB 4X6PA 2BZAA 1SVPA 1P05A 2FESH 1NRNH 1HBTH 5GDSH 2Z9LA 4FUGA 4BTIB 3ZZ5A 3M37A 1ZJDA 2ZZUH 2O8TA 2AMQA 1AFEH 3A89A 1SGYE 1HJAC 1WOFA 1RXPA 1WBGB 3V12A 3STJA 1P06A 3A87A 1VITG 2AGGX 4CREA 3Q00A 4ZKNU 2Q6FA 8GCHG 3TNSA 3ZZ6A 4AN7A 1TMUH 3B9FH 4XSKU 1GL1A 2GDDA 4DVAU 2F9VA 4ZXYH 1CGJE 1AZ8A 3P70B 3F9EA 3PLBA 2QGRA 1K28D 4I8KA 3VXFH 3LKWA 3ITIA 1QJ7B 2ANKH 2XWBI 4Y7BA 4ABGA 1HFDA 1GJ8B 3RXMA 1C5MD 3HKIB 4GCHF 2A7CA 2ALPA 3QGNB 4Y8ZA 2ZCHP 1IQMA 3UWJH 4FUCA 1EUFA 1ABJH 2G5NA 2ZFQH 3FP7E 1YPJH 3A81A 1K1NA 1ARBA 4KGAA 1ZOMA 3SNAA 5GJ4B 1N8OC 5DJ7A 1TBRH 1V6DA 2A5AA 1LTOA 2A7JA 4ZHAA 2EC9H 2VWNA 1BTWA 1CT2E 2STAE 3LH1A 2XC5A 1C1NA 3MWIU 1TWXB 2BDGA 4NWLA 1FY3A 5DP7A 1C2MA 1ORFA 1O2WA 1F5KU 3DT0H 1ABIH 1DWCH 1EAXA 2CHAC 1HCGA 2Q1JA 5C1XA 2OCVB 3E0NB 1G30B 1Z1IA 1DS2E 1GVZA 3SJIA 5GCHF 1EP6A 2BQ6B 4MNYA 1S0QA 2ZQ2A 1VGCB 3MTYA 5DP9A 1FMGA 4KTUA 1B0EA 2BLVA 4NA9H 3FZZA 2NWNA 1TPAE 3PWBA 3AW1A 4CBOA 4AG2A 1ZPZA 2V35A 1C5RA 2XNIA 4DGJA 1GBMA 1KXBA 2ZC9H 1TE0A 1C1SA 3LOXA 2NU4E 1SGTA 3UWIA 4I8LA 1C2HA 1QJ6B 2ZDKA 3MYWA 3SUFA 2FLRH 1UHBB 3V3MA 5A8YA 1SHYA 1KXCA 1UVOA 2VIDA 2NU3E 1A5IA 3SHCH 2A1DB 2XTTB 3SU3A 1QQ4A 7ESTE 1L1NA 4U2WA 1V2ST 1W14U 2ZHWH 4NFEA 3LU9B 7KMEH 1QB1A 2O8MA 1IQNA 1EJNA 4AFQA 2V0BA 1O3AA 1QRWA 3RXUA 3ATMA 1WQVH 1GCTC 1YKTA 4YT7H 4IW4E 2BD9A 4CH2B 1KXDA 3GICB 2HNTF 4BAMB 4AYYB 1HPGA 1C5NH 1GHXH 3SN8A 1SL3A 2WPJS 1HAVA 2ZU4A 5I46H 4CR5A 3RC4A 4B71A 1ZYOA 4CH8B 1ZJKA 2ODPA 3QX5H 3ZVAA 1MBQA 1P10A 5AVDA 4OGYA 1OOKB 4ABJA 1JWTA 1UTOA 3U8TH 2GKVE 2Y6TA 4IBLH 2W7SA 4H4FA 3ZYEA 4FXGH 3PTNA 1IQJA 3HKJB 4J2YB 2A0QB 1K9OE 2P3UB 1UTKA 1GBCA 1C2DA 2ZCLP 3GY6A 1SOTA 2ZGBH 5A0AE 1DPOA 2ZU1A 2C93B 2BDAA 1CGIE 3FFGA 3LDXH 3SOSA 3TJUA 1DLKB 1BDAA 2ZHQH 1BTYA 1B0FA 4JK6A 4Y76A 3BTEE 1BB0B 1UK3A 1WYKA 1NRSH 2GX4A 3GCTG 2VVUA 1EASA 1W7GH 2J94A 1IQLA 2QC2A 2ZTZA 1AVWA 2QXJA 1DDJA 1Z6JH 3NK8A 1Z7KA 2WYJA 3ZV9A 1XMNB 4H6TA 3TITA 4DW2U 3SGAE 1H9IE 3TH2H 1O2TA 1SGNE 3VB6A 1O3EA 1QRXA 4ABBA 1GDUA 2ZDNA 3RDZA 2TGTA 2A45B 1OWIA 3P8NA 3LPRA 3KCGH 1P2JA 1NS3A 3A8BA 1Y3XA 1AD8H 1XUJA 2FOEA 2GV7A 1AZZA 1IQHA 1MCVA 3ODFA 4KELA 1NN6A 2UUKB 3ATIA 2C90B 4GCHG 1W7XH 1SFQB 1FY8E 2Z9JA 2SNVA 3VGCB 4ABDA 2FPZA 1LQDB 5CMXH 4Q7ZA 4Q7YA 3KQCA 1D3QB 4KTCA 5B6OA 4QT8C 4HFPB 1G36A 4DCDA 4ISHH 2J2UA 3EA9A 3TGJE 3FVFB 2BD4A 3TK6A 4K60A 4HGCA 5EXMA 4Y6DA 2HLCA 3RXOA 4X6OA 3E0PB 3DHKH 2TGDA 4MNXA 3LC3A 3NZIA 1SLVB 1S83A 1T8OA 1A61H 1EATA 2I6SA 1OX1A 1EAUA 1O3IA 5JDUB 1GPZA 8LPRA 5L2YH 1C5VA 1UK4A 1GI1A 4NIWA 5EU8A 1MKWH 1P09A 2QCYA 5EQRA 1O5AB 3RXHA 4O3UA 3MU5A 2H2ZA 2FDAA 2SFAA 1LKBA 2A5IA 1BBRK 1O5DH 1TALA 4NA7A 5E2OA 4OS6A 1AVXA 2AMDA 1GDNA 4NGAH 3UFAA 1YCPK 2VWLA 1UCYH 4Y10E 3SQEE 5A8ZA 1DVAH 1YPHE 1OYTH 3VB4A 3AVZA 6ESTA 4ABEA 1FY1A 4WWYA 5E2PA 2UWPA 1EPTA 1S81A 2R0LA 1O2NA 3I29A 1FY4A 5F8ZA 2OQ5A 1A1RA 2ZPRA 1N6XA 3LJJA 1L0ZA 1L4ZA 2QV1A 1O3JA 4K8BA 1HAPH 2BOKA 1RRKA 1EB2A 1SGPE 1YF4A 3EQ0H 3U98H 1P2IA 1DXPA 3GDVA 1AO5A 2BMGB 1GI4A 2FIRH 2J92A 1SC8U 3UR9A 1J17T 3PMAB 3TLOA 1BIOA 1KYNA 1ELVA 2PTCE 4K69A 4ZHLU 3GY4A 4XE4A 4FUEA 3BTDE 2B9LA 2A32A 2ANWA 2BD2A 2O8LA 2XC4A 3RMOH 3TPIZ 1ZMJA 3UNRA 4F49A 1J9CH 2ANMH 2CV3A 3EE0B 3V13A 1CHOG 4ISNA 2OC0A 5CE1A 1O3GA 4BXWA 1O34A 2ANYA 2UWLA 4E06H 2CMYA 3MH4A 1QFKH 3RLYH 2BLOA 4YOGA 2C8YB 3EA7A 4FU8A 3SZNA 1GJ7B 1TOMH 3RXRA 5FXLA 1G3BA 1QURH 2GMTC 2B8OH 4NZQA 1C5WB 1DITH 2AMPA 3SJOA 2Y7ZA 3TNTA 1N1LA 4SGBE 4YO9A 5EGMA 4VGCB 2BLQA 4NSYA 5DP3A 3M3TA 2JH5D 2BX4A 2GCTB 2VGCB 2VB0A 2SGFE 1MBMA 1HYLA 1D6WA 1ZHRA 3Q77A 2G81E 1GGDB 3ZYDA 5AFYH 4FUHA 3ZVEA 1DICA 2QXGA 1MQ6A 2XRCA 1B5GH 2AERH 3BN9A 1TMBH 1GMHG 1L1JA 3BSQA 2BDCA 1ELTA 1UTQA 1V2QT 1G3DA 3BV9B 5J4QA 4MDSA 1P2QA 2BVXH 1TQ7B 4ASHA 2PV9B 1SBWA 3HATH 3OSYA 4GLYA 5C5OA 2UUJB 1BUIA 1OWEA 1CU1A 3MNCA 1O35A 8ESTE 1NRQH 2HNTE 3K2UA 1IHTH 1YP9A 2ZGJA 4O3TA 3AASA 4JCNA 4ZHMU 1HAZB 4FUJA 5TJXA 3U8OH 4NZLA 1CA0C 4FVDA 2BM2A 1RTKA 2CGAA 2R3UA 4K8YA 3UPEA 5HM9A 1E36B 1Z8IB 1TNIA 4GAWA 1HDTH 3DFLA 2YOLA 3CS0A 1YPEH 1MD8A 2Y5GA 1CQQA 4I31A 4H6SB 1SGIB 2ESTE 2FP7B 4JZDH 1UJ1A 3KQEA 3SNEA 4NIYA 1O3LA 2WPMS 1YGCH 2STBE 2ZDAH 1KSNA 5E0HA 4M7GA 3Q3XA 3O8DA 4DIIH 4AG1A 5CHAB 2NU1E 1KXFA 3SNBA 1A0LA 1Z1JA 1QCPA 4TWWA 1XXDA 5DGJA 2Z9IA 1NFUA 5FPYA 1GJ5H 3I78A 3BEUA 2HRVA 2DUCA 2AFQB 4NCYA 1TBQH 5HYOA 1MU6B 4Y11E 3M7QA 1ANEA 2GGVB 4UONA 1A0JA 4YOIA 4CRFA 1CT4E 2VWMA 5LH8A 5PTPA 3T26A 4B1TA 3OTJE 4X1QU 1S6FA 1GI8B 1D6RA 4ESTE 4ISLA 2Y5HA 2ZFFH 5C67A 2XWAA 4ISOA 2KAIB 5BPEA 1C2LA 4YTAA 1NESE 4K5ZA 5F03A 1BJUA 2ZEBA 1QA0A 2PKAB 3SNDA 3SU2A 3O8RA 1IQGA 1YCPM 1VGCC 1BMAA 4MPWA 5JBAS 1TMTH 1MTNB 2Z9KA 1FXYA 2R0KA 2ALVA 4RN6A 3SHAH 3SV2H 1DWBH 1GJDB 4NSVA 1O36A 4TWYA 1P2NA 1IQKA 3BTTE 3RM2H 2W7UA 1A0HB 2ZO3H 2IJOB 1O5GH 1KTTB 1MKWK 1GJAB 3LGTA 1BMMH 4ZXXH 1V2VT 4DJZB 2OXSA 2P8OB 1GJ4H 1V2NT 1ELAA 1XUHA 5ESBA 1S0RA 2FX4A 1NY22 4XBBA 4I8GA 3NKKA 3GCOA 2F9BH 4IGDA 4WJG2 1HGTH 1GBHA 1V2PT 1BQYA 3VB5A 5JYIA 1PPHE 3BF6H 3A80A 3RXLA 1FIZA 2OD3B 2Z3CA 1F0RA 3GOVB 1TIOA 4YOJA 2FZZA 2TPIZ 2ZU2A 3S7KB 3T29A 4AYVB 2C8WB 1C5PA 2ZKSA 3UQVA 2ZFTA 1S5SA 2ZDMA 2A4OA 2OP9A 3M36A 4XDEA 1DLEA 1YLCA 2WV5A 1OP0A 5CHAC 1OWJA 1EZQA 1C2FA 1O5BB 1K1IA 2TGPZ 1B7XB 3P6ZB 2GV6A 1ETTH 1C1QA 2F83A 1L4DA 3TK5A 5T6GA 1UHBA 1LO6A 1ZHMA 3BG4B 2PR3A 1KTSB 2J4IA 2BD3A 1K1MA 3SU5A 2QYIA 3SBKA 4HZHA 2PGQB 2FMJA 3MNSA 3SU4A 2AGIX 4CRCA 4OS1A 3T5FH 1GJCB 1GBTA 1O3MA 5FCRA 4Z6AH 1VITF 1PPEE 1TGCA 3B8JA 1SGCA 2H6MA 3RMMH 3BG4C 1YPHC 1TA2A 4E7RG 1YYY1 1S6HA 3DA9B 1Q31A 2SNWA 4OS2A 2ZTXA 1O2RA 1H1BA 3ZZ7A 2PKAA 2G55A 3BIVH 2XBVA 2FX6A 5H4IB 4UD9H 3MO6A 2NU2E 1BRAA 1TX6A 4O97A 1O3BA 1O2OA 1SHHB 2EI7A 2H1UA 2P94A 1QY6A 2QN5T 3SV7A 1FAKH 1GHVH 1FLEE 2O8WA 5C1YA 4JYUH 5EQSA 2BVRH 5AF9H 1O3PB 1C2EA 3G01A 4I8JA 3P8OA 1DUAA 3VFEA 2BY8X 2PUQH 1VCPA 5FX6A 4CHAB 5HXFA 1V2WT 2PW8H 4E7NA 2JH0D 1AB9C 4I32A 3UQOA 4LZ4B 2RCEA 4JZ1A 4Q7XA 4X1NU 2ZF0H 1E34B 2VGCC 2GCTC 1FIWA 1TGSZ 2FWWA 1O2XA 3UREA 3GYMA 4TY7A 1WTHD 3S69A 4A6LA 1CE5A 1AE8H 3RMNH 1OP8A 2A4GA 3MNBA 3NXPA 1GI9B 2ZCKP 1O2UA 1QBNA 1LPGB 1YPMH 3NUMA 2QY0B 3RMLH 1EP5A 1FUJA 3U9AH 1EOLA 1YPKH 4Y7AA 3PLKA 3SV6A 1W0YH 1EB1H 1TGBA 1TRMA 1O2LA 1UTJA 1RS0A 1UMAH 1BMLA 3P17H 1P2MA 2ILNA 3D23A 1XXFA 3LGYA 1WV7H 1DX5M 2VVVA 3PB1E 1BCUH 4WY3A 1ZMNA 3A83A 1CGHA 3GISB 1C5QA 3HGNA 2Z9GA 3T62A 1AWHB 3QN7A 3RXBA 4UFDH 1ZLRA 9LPRA 4DY7B 1HAOH 1LHDH 1HXFH 1Q3XA 1RD3B 1AUTC 3PTBA 1EPTC 1T32A 1GCTB 2Q6GA 2K1QA 4TY6A 1UVSH 1NU9A 3MH5A 1NRRH 1PQAA 2W5EA 2BD8A 1Y5UT 3P92A 2GCHF 4D7GA 4LK4A 4BNRA 1CA0B 1C1WH 2P8OC 3BG8A 4B74A 4JZFH 1MAXA 1NFWA 2M5TA 3RP2A 1C2KA 1GHZA 3BTWE 1F92A 1TX8A 5K0HA 4FUFA 4U32A 5A09A 1MTVA 1O37A 4AFZA 1OS8A 5E0GA 2W3KA 4Y79A 2B7DH 2BDIA 1SSXA 2I6QA 2ULLA 1GMHF 2GTBA 5J4SA 1BA8B 4ZH8A 2ZGCA 2BDHA 3DD2H 1ZR0A 2R9PA 2SGAA 4OGXA 3SW2B 3ZZAA 1KLIH 2GVFA 1FV9A 3ZZDA 1THSH 3MNXA 1NFYA 5C2ZA 3M5MA 4D8NA 1CVWH 3D65E 4K3JA 1VCWA 4DT7B 4SGAE 1OWKA 5C3NA 3R0FA 1DE7H 3MU1A 1GMCG 1GHAG 1EAWA 3M7UA 3PROA 1XUIA 1YLDA 2A7HA 2ZFSA 3TGKE 5EPNA 1ZSKA 1VZQH 1A3BH 1ZPBA 3AAVA 3ATLA 3OY6U 1HNEE 1SQOA 4FU7A 1SGDE 4H42U 1O3NA 3HGPA 3M3SA 4INLA 1U6QA 2JKHA 3BEFB 4ZKOU 1SLXB 1BT7A 1PPFE 1CHGA 2OUAA 1FZZA 2J34A 2FS8A 2GZ7A 1CO7E 1C1UH 1O3KA 2SGQE 1GDQA 1GHYH 3ZV8A 3QTOH 3RXEA 2LNCA 1C2GA 3OY5U 3RXJA 3TJVA 3SJ9A 2EEKA 2BX3A 2XC0A 3UNQA 5C5NA 1ZSLA 5DO4H 1P12E 3CS7A 3P95A 4A1VA 3A7TA 1HUTH 3HPTB 2XBXA 2RDLA 5DP6A 1T8MA 4AB9A 2EI6A 3RU4E 1AGJA 2GCHG 2H5CA 3E90B 3MHWU 1GG6B 1WTGH 1DWDH 1HJ9A 3C27B 3K6YA 1BRUP 1ARCA 2AS9A 1MCTA 1Z8RA 3QGJA 5DK1A 5L6NH 4TPIZ 4YZUA 4IMQA 4YLUA 1XVMA 2IN2A 2VU8E 4FU9A 3EDXB 1C5YB 3ZZCA 1IQIA 1J8AA 3OU0A 1O2ZA 1BRCE 1O38A 1LVBA 2R2WU 1WAYB 4ABAA 2ZPSA 1VJ9U 1OSSA 1QIXB 2AEIH 3K65B 1AKSB 2GT8A 1D4PB 1F0TA 1UVPA 3V0XA 1OKXA 4R8TB 5A0CA 1Z71A 2BY5X 4ZUHA 3T2NA 2DE8A 4X0WU 3ESTA 3TJNA 2JETC 1UVUH 3RC5A 2Q6DA 3SUDA 5HGGA 1AHTH 3VEQB 4IC6A 3GDSA 2G5VA 4BXSA 4B2CA 2G4UA 1Y3UA 3T25A 3MO9A 1EJMA 1KXAA 2BD5A 1W12U 4MVNA 1HAIH 5DP5A 1DY8A 1AFQC 3UNSA 1W11U 1BHXB 3NCLA 4Y8XA 1CSOE 1T8LA 2QF0A 3GY5A 2PTNA 4K1EA 1P9SA 1AUJA 4D76A 2D1JA 1SQTA 2BDBA 5ETXA 4AORA 1A4WH 1O2IA 5FAHA 3TGIE 1H9LB 1DM4B 2WPIS 2FOGA 2XCNA 1NM6A 4NFFA 2FOFA 3RC6A 1FN6A 2Y81A 3MH7A 1Q2WA 3W95A 3SJKA 4CR9A 4NIVA 1TABE 2VIOA 2B0FA 1KLTA 1SI5H 1TOCB 1HAYB 1KXEA 4O03A 2WPLS 2O9QA 1MUEB 1C1PA 1XVOA 1THRH 3QLPH 1UCYK 1W8BH 2FM2A 3EA8A 2ASUB 4DG4A 4KKDA 1TNGA 3RXSA 1BZXE 4INHA 1TGNA 1VJAU 2BB4A 3L3TA 5FPSA 3KF2A 3A86A 5JPMH 4B73A 1QL9A 1ID5H 1GI0A 1TPOA 2OLGA 1JOUB 3UUZA 1C2IA 4CRBA 1TNHA 3SU6A 2PLXA 3U8RH 4FVBA 1O2QA 1FDPA 3URDA 1SGFG 1MTUA 2RA3A 3ZZBA 1E0FD 1JRSA 2CHAB 2V3HH 4ZROA 1P01A 3QZQA 1DWEH 2B5TB 2FO9A 2VVCA 1NT1A 2V3OH 3M7TA 2Z3EA 2ZNKH 2FYRA 1UTNA 2P3TB 5DPAA 3KEEA 3LT3A 1Y3YA 2VINA 1W13U 1F0SA 4WXIA 2Y80A 4KTSA 1LPZB 4LOYH 2BY9X 6GCHF 4B76A 1K1OA 1N8OB 2D2DA 4A1TA 5GIBA 3F68H 2HPQH 2PUXB 1SLUB 1HAVB 1GBIA 1W10U 1LVYA 3DUXH 4JZEH 1PPZA 1MQ5A 2WPHS 1P11E 1O3OA 1SGRE 4X8VH 8GCHF 2R3YA 4JMYA 3F9HA 4ABIA 3ATWA 3VB7A 1JXPA 1V2OT 1P2KA 1C4V2 1C5ZB 1TYNA 1DSUA 1KLJH 3M35A 1MKXK 1X7AC 5I25A 1OXGA 1C4Y2 2D26C 4A7IB 1MU8B 3P8FA 5LGOA 1GCDA 3UY9A 1TGTA 1SGEE 1TRNA 1V3XA 5T6FA 1V2TT 2F91A 1O32A 1V2LT 3EAJA 2F9OA 2JETB 2CF9H 4BTTB 3ZVDA 6LPRA 1YCPH 2BOHB 1C5SA 2DE9A 2Y7XA 2BHGA 4ZKSU 5C20A 4I7YH 1GI2A 1P2OA 5EPYA 1LHGH 1P0SH 3RXQA 1NC6A 1PQ8A 1O2MA 2FEQH 1RGQA 4HI3A 4GHQA 4UFGH 3VGCC 4BAOB 2PGBB 1MMJN 2BLWA 2P3FH 2GD4B 3MOCA 5DP4A 2G52A 5HMAA 3LJOA 2FLBH 2HOBA 1O2GH 4TYDA 3B23B 1NPMA 2P93A 2TGAA 2SGEE 3ZVGA 1JMOH 3MI4A 4JK5A 1FPCH 5IDKA 5SGAE 2RA0A 4YLQH 2HGTH 1GMCF 4OS5A 1O2JA 3CP7A 3I77A 3T28A 4BOHA 1QBVH 1EJAA 3H7OA 1TONA 1V2JT 2FTLE 1ELFA 4BAKB 2W26A 1ELCA 1W2KH 1THPB 1BBRE 1MH0A 2XBWA 1BTXA 3RXFA 1GBAA 4O9VA 2BTCE 5EXNA 1TNKA 1RFNA 3IITA 3RU4T 1QJ1B 3VXEH 1O2HA 4X6NA 3BEIB 1F5LA 3GCNA 3A84A 1TAWA 1WUNH 3SQHE 1K1JA 1RTFB 1D3PB 1AE5A 1K1PA 2V6NA 2GDEH 3BTFE 4AB8A 1O30A 2H9HA 2ZECA 1K22H 1IOEA 4R0IA 2OBQA 1O5EH 2A4RA 1O0DH 1LQEA 1ZTLA 2ZTYA 1BJVA 1JBUH 1PQ5A 1E35B 2BY7X 3RXKA 3LONA 1IAUA 3QDZB 1ETSH 1GBKA 3URCA 2HPPH 1HLTH 1HB0B 4KP0A 1W3CA 3RU4D 1WSSH 5E0JA 1ESTA 4AGJA 4JYTA 2C4FH 3LGUA 3BTME 2FOAA 1E38B 3L33A 4E05H 1P02A 2FI5E 1XUFA 1JRTA 1O3HA 3E91A 5G4BA 3MO3A 2HWLB 1GG6C 2G8TA 2UUFB 4CBNA 4Y0ZE 6CHAC 3H5CB 3M5LA 3STIA 4A5TS 1GI5A 3F1SB 3TJOA 1AKSA 4AX9H 4OS7A 4WF8A 1WCZA 1P57B 2P95A 3K6ZA 3O8CA 4ABHA 1LHCH 2SGDE 3NPSA 1GBJA 1XKAC 3NWUA 1HAXB 2BQ7B 1A2CH 2F9PA 3QO6A 4X2XA 2CJIA 2ODYB 3D49H 2Z6BD 5EOKA 3AAUA 1UVTH 1GBBA 4K1TA 4Y0YE 3ZZ9A 1GI3A 4X1PU 1RIWC 2ZHDA 2OC1A 3A7YA 3U69H 4AFSA 3LGWA 2J95A 3A8DA 3GYLB 1AVGH 1G32B 1C4U2 3SGBE 1LKAA 3ATKA 4FUBA 2TIOA 3VPKA 1EOJA 1EKBB 1FAXA 2A2XH 4ABFA 1O3DA 5C1UA 3Q76A 1CT0E 1BTHH 1L2EA 4WXVA 1V2UT 3MFJA 1UTLM 1IQFA 1HXEH 4IMZA 5TCCA 1QBOA 3ZVBA 3AW0A 2GT7A 2JH6D 1LPKB 1Y59T 3DFJA 3KQBA 2PWXA 2NU0E 3MU0A 2IOTA 1C1MA 3A82A 1EAIA 1ELGA 1FJSA 1TLDA 3MU4A 3OX7U 1T8NA 1GJ6A 3ZZ4A 5L30H 2XW9A 3RM0H 4FUDA 3PLPA 4GVUA 3P8GA 3SGQE 1O33A 1O5FH 3KN2A 2AIPA 1XX9A 1Y8TA 3SO3A 2F9UA 4I33A 1BTUA 4J1YA 5A0BA 3SUGA 5GCHG 2BXTH 3K9XB 1SMFE 1ANCA
chains in the Genus database with same CATH superfamily
3EGKH 1GVLA 3RXVA 5L2ZH 3PRDA 1S84A 3GDUA 3KGPA 1H9HE 4X6MA 4B2BA 1QRZA 1E37B 1J14A 1JIMA 3DSPA 3SORA 1XKBC 1P04A 2FOHA 4UE7H 1D3TB 1LHFH 1J16A 4ASUD 1O2SA 4B75A 7GCHF 2C3SA 1GBEA 2ZFRH 5T3HA 3A7VA 2PFEA 3A7WA 2FODA 5FBEA 2FI4E 4DOQA 1FI8A 2BY6X 1GWAA 3PMBB 3Q3YA 2BDYA 4THNH 1TX7A 2XNDD 2H5DA 2FOBA 3GCHC 1GHAF 2VIVA 2H9EH 2G00A 3FP8E 3E1XB 4NA8A 2FXRA 3E6PH 3SV8A 4K2YA 2HVXA 1INCA 3UTUH 1C9TA 2EQNA 1GBLA 1ELBA 1PFXC 3W94A 1EQ9A 5EODA 1V2RT 1RTLA 3BTHE 1ETRH 1BMNH 4A92A 1P03A 1A5HA 1C9PA 2CXVA 4XFQA 4CRGA 3BTQE 1T4VH 3ODDA 4UFFH 3FANA 1YM0A 2P16A 1SOZA 5JBBS 1ZPCA 1GL0E 2GZ9A 4MG3A 3LGVA 3E16B 3PYHA 2VIWA 3PO1B 3FP6E 5JB8S 1HIAB 2C8ZB 2TRMA 1SG8B 1UO6A 5FPTA 1C5XB 1O2VA 4BANB 1SLWB 1H8DH 1F0UA 3PM3A 4NWKA 4D9QA 1SFIA 1NROH 4RKOB 3UR6A 2F3CE 1IHSH 3RXGA 4UFEH 3RUOA 1TFXA 5A8XA 3JZ1B 1SPJA 2OINA 1HAHH 3UOPA 1AB9B 1GBFA 2IPQX 3SNCA 5C0UA 5F6MA 4AOQA 3VB3A 4DIHH 2BXUH 5EG4A 1P3EA 1RJXB 5HM2A 2ZIQH 1J15A 1YC0A 4MLFB 4AGKA 1CBWC 1O3CA 1EZSC 1QL7A 4X1SU 2ZDVH 3IWMA 1CHOF 3SI4H 3MH6A 1KDQA 3A85A 1O3FA 1QTFA 2QIQA 5BRRE 1FPHH 2YNAA 4WVPE 3M5NA 1NFXA 4RI0A 3RLWH 1D3DB 4Y8YA 1HIAA 5T1VA 1F2SE 2ZQ1A 1G2LA 3N7DA 3GCTF 2OTVA 4NG9H 1W0KD 4WH6A 1ZZZA 2QF3A 4RKJB 3PV4A 1TB6H 5DG6A 1C1RA 4ISIH 3R3GB 1EZXC 1TBZH 3S9AA 1AY6H 1PJPA 1KY9A 3ZVFA 2FS9A 1O2PA 1DSTA 5F8TA 1Y3VA 2BVSH 1PPGE 4LZ1H 1VR1H 7LPRA 3ELAH 2AHME 2PKSB 2Y5FA 3TH3H 1BBRH 1TNJA 2WUBA 2YNBA 1OWDA 3TU7H 1E79D 2WUCA 3V7TA 1UCYE 3BIUH 1EXFA 3RXPA 1TPSA 1A46H 3E3TA 2A5KA 1YPGH 3KQDA 3HK6B 2J98A 1GJ9B 1QL8A 2AIQA 4YESB 3OEHD 5K7RA 5FCKA 1O5CB 3M3VA 4MPXA 1GHWH 4WH8A 1SQAA 4MNWA 1T7CA 1PYTD 3RXTA 1C5LH 1FONA 3WY8A 4X8TH 1ESAA 1PPCE 1QQUA 5JBCS 2FI3E 1OWHA 1QR3E 1ZTKA 4ZKRU 2L74A 1TQ0B 2TBSA 1MD7A 3SI3H 1TNLA 1M9UA 3E8LA 1NU7B 9ESTA 4VGCC 1EPTB 2G51A 1O2KA 5JBTA 1V2MT 1QGFA 4AZ2B 1QHRB 2Z7FE 1GHBG 1XUGA 2J97A 2GMTB 2KM0A 3U28C 3UB0A 4HTCH 1C5OH 1ZMLA 1DANH 1GI6A 1P3CA 3BTGE 1GVKB 1ZHPA 4A1XA 4FUIA 4INKA 1WQSA 1DOJA 1A3EH 3EYDA 3S9BA 1GMDF 3N7EA 3C1KA 2HALA 2RG3A 3TIUA 3OYPA 5FX5A 1T4UH 2ZU5A 1AQ7A 2QA9E 4LXBH 1BTPA 1KDQB 3SJ8A 1UK2A 5ABWA 1H8IH 1C2JA 3GY3A 4X2YA 1ANDA 5LPEA 3ENSB 1T31A 2ZFPH 1O31A 5GXPA 4Y71A 4U01A 1ZGVA 3A7XA 4CRDA 2GP9B 1NRPH 1MAYA 1MZDA 1XUKA 4IS5A 2WHXA 2OC7A 3SU1A 1BRBE 2ZDLA 2ZG0H 1AMHA 1OPHB 1C5UA 4B6EA 1TRYA 5JB9S 1G2MA 3TH4H 2D8WA 4JYVH 2A31A 1SB1H 4X1RU 5AFZH 3RXAA 1N6YA 3MMGA 4CHAC 2OBOA 1DY9A 4F4OC 5TCAA 1NZQH 1DFPA 1MTSA 1WU1A 4AFUA 4MPUA 4OS4A 4IC5A 1AWFH 1GJBB 3KIDU 3UIRA 1CA8B 1MZAA 1EX3A 6CHAB 1ACBE 4WMEA 2G4TA 1K2I1 1D9IA 4BAQB 1KIGH 2C8XB 5FHTA 1VITH 4BTUB 3O8BA 2A2QH 2P59A 1W0ZU 1SGFA 2ZHEH 1NBMD 2F9NA 1Y5BT 2WYGA 4TPYA 2UWOA 2WINI 2XCFA 5F53A 3JZ2B 1ANBA 2KX4A 1MTWA 1LHEH 2LPRA 5T6DA 1DXWA 4X8SH 1K21H 1GMDG 1Z8JB 3A88A 4F55A 1VCQA 2KR7A 5DP8A 1K1LA 4TT3D 1BITA 4GUXA 1H4WA 2XYAA 3MU8A 5F8XA 4ZAEA 1A7SA 2PKSC 2J9NA 5AHGH 1A5GH 2ZP0H 1Z6EA 2ZI2H 3OTPA 2HNTC 2XBYA 1UTMA 2Y82A 2VH6A 3F9GA 2AYWA 5C0TA 3U1IB 2OQUA 2O8UA 1QNJA 2OC8A 4GHTA 1QA7A 2KCOA 3SUEA 2QAAA 3GCHB 2Z3DA 4DURA 6GCHG 2CN0H 1OP2A 2JJ2D 2VH0A 1TA6A 3RXIA 2H9TH 3GY2A 3T27A 2EI8A 3ZZ8A 1FQ3A 1ZSJA 1AN1E 3FAOA 4ZMAH 1L1GA 2WV9A 4YM9A 3U1JB 1O39A 2UUYA 3QTVH 1GGDC 4GSOA 4XBDA 3SV9A 4MNVA 3KQ5A 4IN1A 2PHBA 2SGPE 4IN2A 1OYQA 2GZ8A 4WMDA 1GBDA 2IPHA 1C5TA 1XM1A 4GPGA 1RIWB 4XBCA 3M5OA 3GY7A 2ZWLH 3QZRA 5EXLA 7GCHG 1AI8H 3HK3B 2YMSC 3F9FA 2ZHFH 3S7HB 1S85A 3N7OA 2W3IA 5C94A 1IQEA 1Z8GA 3LIWA 4X2WA 3ZZ3A 1HJ8A 1S82A 1E1QD 1C1TA 5LPFA 3SU0A 3QK1A 3VG8A 1UTPA 1YBWA 4MQAA 4RSPA 3LGIA 2QXIA 3A7ZA 2R2MB 1HJAB 3L6PA 1MKXH 1LVOA 1P8VC 1QB9A 4BAHB 5KECA 3D62A 4X2VA 2LELA 1ZGIA 1TPPA 1ELDE 4B2AA 1G37A 3LH3A 1MTNC 3QWCH 3BTKE 3CENA 1QB6A 3KL6A 4MPVA 1ZRKA 3M61U 2BZ6H 4Q80A 2RFKC 1PPBH 1EZUC 2WV4A 4MTBA 5EW1H 2A4QA 3WW7A 1V2KT 2PSXA 3LC5A 4JZIA 2BD7A 1NTPA 2VJ1A 3TK9A 2BYAX 4Q2KA 1LVMA 3ZVCA 4X8UH 2VWOA 2ZGHA 4UEHH 3UOUA 2FYQA 2ZU3A 4XOJA 4D7FA 2AH4X 1AU8A 1HV7A 1F5RA 1SGQE 3GY8A 3F6UH 1PYTC 5EW2H 1G3EA 1SR5C 4I8HA 1AIXH 3IG6B 1HAGE 1F7ZA 1FN8A 1G9IE 2VBCA 4NIXA 2BQWB 2FTMA 3KYGA 3KHVA 5A2MH 2WPKS 1YPLH 5IYTA 1DUEA 2J98B 1P9UA 3S9CA 2Z94A 2EA3A 1LDTT 1Y3WA 3QUMP 5LPRA 3PMHB 1BHXF 1O2YA 3F2GA 5FBIA 3A8CA 1BTZA 2CF8H 4PROA 2J38A 1LCYA 4UDWH 3RXCA 1PQ7A 2VIPA 5GNDA 3H7TA 3PMJA 3Q3KA 1GI7B 5DKMA 5ESTE 4CRAA 1HRTH 5GWZA 1FY5A 1SKYE 4YT6H 1FNIA 3FZDA 4K1SA 4WMFA 2XXLA 1NO9H 2QXHA 3RXDA 1G3CA 5E8EH 2ZGXH 1ESBA 2VIQA 2ODQA 3TVJB 1Y5AT 2VNTA 1BOQA 2ZA5A 1DT2A 1CBWB 5EJLA 2AGEX 3A8AA 3F2HA 2FOCA 3S0NA 3PO1C 4Z0KA 3KNXA 3PWCA 1C1VH 1AFQB 2KAIA 5EQQA 8KME2 2PSYA 1ZTJA 5GPIB 2ZPQA 4U30A 1UW7A 2THFB 1JIRA 4D9RA 1ELEE 1LMWB 1C1OA 1ZRBA 3PV5A 1GHBF 2FOMB 4X6PA 2BZAA 1SVPA 1P05A 2FESH 1NRNH 1HBTH 5GDSH 2Z9LA 4FUGA 4BTIB 3ZZ5A 3M37A 1ZJDA 1YLNA 2ZZUH 2O8TA 2AMQA 1AFEH 3A89A 1SGYE 1HJAC 1WOFA 1RXPA 1WBGB 3V12A 3STJA 1P06A 3A87A 1VITG 2AGGX 4CREA 3Q00A 4ZKNU 2Q6FA 4YXWD 8GCHG 3TNSA 3ZZ6A 4AN7A 1TMUH 3B9FH 3F3BA 4XSKU 1GL1A 2GDDA 4DVAU 2F9VA 4ZXYH 1CGJE 1AZ8A 3P70B 3F9EA 3PLBA 2QGRA 1K28D 2CK3D 4I8KA 3VXFH 3LKWA 3ITIA 1QJ7B 2ANKH 2XWBI 4Y7BA 4ABGA 1HFDA 1GJ8B 3RXMA 1C5MD 3HKIB 4GCHF 2A7CA 2ALPA 3QGNB 4Y8ZA 2ZCHP 1IQMA 3UWJH 4FUCA 1EUFA 1ABJH 2G5NA 2ZFQH 3FP7E 1YPJH 3A81A 1K1NA 1ARBA 4KGAA 1ZOMA 3SNAA 5GJ4B 1N8OC 5DJ7A 1TBRH 1V6DA 2A5AA 1LTOA 2A7JA 4ZHAA 2EC9H 2VWNA 1BTWA 1CT2E 2STAE 3LH1A 2F4LA 2XC5A 1C1NA 3MWIU 1TWXB 2BDGA 4NWLA 1FY3A 5DP7A 1C2MA 1ORFA 1O2WA 1F5KU 3DT0H 1ABIH 1DWCH 1EAXA 2CHAC 1HCGA 2Q1JA 5C1XA 1E1RD 2OCVB 3E0NB 1G30B 1Z1IA 1DS2E 1GVZA 4Q63A 3SJIA 5GCHF 1EP6A 2BQ6B 4MNYA 1S0QA 2ZQ2A 1VGCB 3MTYA 5DP9A 1FMGA 4KTUA 1MABB 1B0EA 2BLVA 4NA9H 3FZZA 2NWNA 1TPAE 3PWBA 3AW1A 4CBOA 4AG2A 1ZPZA 2V35A 1C5RA 2XNIA 1W0JD 4DGJA 1GBMA 1KXBA 2ZC9H 1TE0A 1C1SA 3LOXA 2NU4E 1SGTA 3UWIA 4I8LA 1C2HA 1QJ6B 2ZDKA 3MYWA 3SUFA 2FLRH 1UHBB 3V3MA 5A8YA 1SHYA 1KXCA 1UVOA 2VIDA 2NU3E 1A5IA 3SHCH 2A1DB 2XTTB 3SU3A 1QQ4A 7ESTE 1YWUA 1L1NA 4U2WA 1V2ST 1W14U 2ZHWH 4NFEA 3LU9B 7KMEH 1QB1A 2O8MA 1IQNA 1EJNA 4AFQA 2V0BA 4XRNA 1O3AA 1QRWA 3RXUA 3ATMA 5EIYA 1WQVH 1GCTC 1YKTA 4YT7H 4IW4E 2BD9A 4CH2B 1KXDA 3GICB 2HNTF 4BAMB 4AYYB 1HPGA 1GHXH 1C5NH 3SN8A 1SL3A 2WPJS 1HAVA 2ZU4A 5I46H 4CR5A 3RC4A 4B71A 1ZYOA 4CH8B 1ZJKA 2ODPA 3QX5H 3ZVAA 1MBQA 1P10A 5AVDA 4OGYA 1OOKB 4ABJA 1JWTA 1UTOA 3U8TH 2GKVE 2Y6TA 4IBLH 2QF5A 2W7SA 4H4FA 3ZYEA 4FXGH 3PTNA 1IQJA 1YY3A 3HKJB 4J2YB 2A0QB 1K9OE 2P3UB 1UTKA 1GBCA 1C2DA 2ZCLP 3GY6A 1SOTA 2ZGBH 5A0AE 1DPOA 2ZU1A 2C93B 2BDAA 1CGIE 3FFGA 3LDXH 3SOSA 3TJUA 1DLKB 1BDAA 2ZHQH 1BTYA 1B0FA 4JK6A 4Y76A 3BTEE 1BB0B 1UK3A 1WYKA 1NRSH 2GX4A 3GCTG 2VVUA 1EASA 1W7GH 2J94A 1IQLA 2QC2A 2ZTZA 1AVWA 2QXJA 1DDJA 1Z6JH 3NK8A 1Z7KA 2WYJA 5CHBA 3ZV9A 1XMNB 4H6TA 3TITA 4DW2U 3SGAE 1H9IE 3TH2H 3FO8D 1O2TA 1SGNE 3VB6A 1O3EA 1QRXA 4ABBA 1GDUA 2ZDNA 3RDZA 2TGTA 2A45B 1OWIA 3P8NA 3LPRA 3KCGH 1P2JA 1NS3A 3A8BA 1Y3XA 1AD8H 1XUJA 5HKKD 2KCAA 2FOEA 2GV7A 1AZZA 1IQHA 1MCVA 3ODFA 4KELA 1NN6A 2UUKB 3ATIA 2C90B 4GCHG 1W7XH 1SFQB 1FY8E 2Z9JA 3PV2A 2SNVA 3VGCB 4ABDA 2FPZA 1LQDB 5CMXH 4Q7ZA 4Q7YA 3KQCA 1D3QB 4KTCA 5B6OA 4QT8C 4HFPB 1G36A 4DCDA 2KZ4A 4ISHH 2J2UA 3EA9A 3TGJE 3FVFB 2BD4A 3TK6A 4K60A 4HGCA 5EXMA 4Y6DA 2HLCA 3RXOA 4X6OA 3E0PB 3DHKH 2TGDA 4MNXA 3LC3A 3NZIA 1SLVB 1S83A 1T8OA 1A61H 1EATA 2I6SA 4B6FA 1OX1A 1EAUA 1O3IA 1OHHD 5JDUB 1GPZA 8LPRA 5L2YH 1C5VA 1UK4A 1GI1A 4NIWA 5EU8A 1MKWH 1P09A 2QCYA 5EQRA 1O5AB 2WSSD 3RXHA 4O3UA 3MU5A 2H2ZA 2FDAA 2SFAA 3PRBA 1LKBA 2A5IA 1BBRK 1O5DH 1TALA 4NA7A 5E2OA 4OS6A 1AVXA 3ZIAD 2AMDA 1GDNA 4NGAH 3UFAA 1YCPK 2VWLA 1UCYH 4Y10E 3SQEE 5A8ZA 3WWFA 3EE7A 1DVAH 1YPHE 1OYTH 3VB4A 3AVZA 6ESTA 4ABEA 1FY1A 4WWYA 5E2PA 3OAAD 2UWPA 1EPTA 1S81A 2R0LA 1O2NA 3I29A 1FY4A 5F8ZA 2OQ5A 1A1RA 2ZPRA 1N6XA 3LJJA 1L0ZA 1L4ZA 2QV1A 1O3JA 4K8BA 1HAPH 2BOKA 1RRKA 1EB2A 1SGPE 1YF4A 3EQ0H 3U98H 1P2IA 1DXPA 3GDVA 1AO5A 1K0HA 2BMGB 1GI4A 2FIRH 2J92A 1SC8U 3UR9A 1J17T 3PMAB 2RDEA 1BIOA 1KYNA 3TLOA 1ELVA 2PTCE 4K69A 4HG6A 4ZHLU 3GY4A 4XE4A 4M9FA 4FUEA 3BTDE 2B9LA 2A32A 2ANWA 2BD2A 2O8LA 2XC4A 3RMOH 3TPIZ 1ZMJA 3UNRA 4F49A 1J9CH 2ANMH 2CV3A 3EE0B 3V13A 1CHOG 4ISNA 2OC0A 5CE1A 1O3GA 4BXWA 1O34A 2ANYA 2UWLA 4P02A 4E06H 2CMYA 3MH4A 1QFKH 3RLYH 2BLOA 4YOGA 2C8YB 3EA7A 3UAIC 4FU8A 3SZNA 1GJ7B 2F43B 1TOMH 3RXRA 5FXLA 1G3BA 1QURH 2GMTC 2B8OH 4NZQA 1C5WB 1DITH 2AMPA 3SJOA 2Y7ZA 3TNTA 1N1LA 4SGBE 4YO9A 5EGMA 4VGCB 2BLQA 4NSYA 5DP3A 3M3TA 2JH5D 2BX4A 2GCTB 2VGCB 2VB0A 2SGFE 1MBMA 1HYLA 1D6WA 1ZHRA 2M2AA 3Q77A 2G81E 1WDIA 1GGDB 3ZYDA 5AFYH 4FUHA 3ZVEA 5KEDA 1DICA 2QXGA 1MQ6A 2XRCA 1B5GH 2AERH 3BN9A 2HVYB 1TMBH 1GMHG 1L1JA 3BSQA 2BDCA 1ELTA 1UTQA 1V2QT 1G3DA 1QZ8A 3BV9B 5J4QA 4MDSA 1P2QA 2BVXH 1TQ7B 4ASHA 2PV9B 1SBWA 3HATH 3OSYA 4GLYA 5C5OA 2UUJB 1BUIA 4RT0A 1OWEA 1CU1A 3MNCA 1O35A 8ESTE 1NRQH 2HNTE 3K2UA 1IHTH 1YP9A 2ZGJA 4O3TA 3AASA 4JCNA 4ZHMU 1HAZB 4FUJA 2LP6A 5TJXA 3U8OH 1EFRD 2K0QA 4NZLA 1CA0C 4FVDA 2BM2A 1RTKA 2CGAA 2R3UA 4K8YA 3UPEA 5HM9A 1E36B 3MQKC 1Z8IB 1TNIA 4GAWA 1HDTH 3DFLA 2YOLA 3CS0A 1YPEH 1MD8A 2QE7D 1CQQA 2Y5GA 4I31A 4H6SB 1SGIB 2ESTE 2FP7B 4JZDH 1UJ1A 3KQEA 3SNEA 4NIYA 1O3LA 2WPMS 1YGCH 2STBE 2ZDAH 1KSNA 5E0HA 4M7GA 5HIZA 3Q3XA 3O8DA 4DIIH 4AG1A 5CHAB 2NU1E 1KXFA 3SNBA 1A0LA 1Z1JA 1QCPA 4TWWA 1XXDA 5DGJA 2Z9IA 1NFUA 1VKYA 5FPYA 1GJ5H 3I78A 3BEUA 2HRVA 2DUCA 2AFQB 4NCYA 1TBQH 5HYOA 1MU6B 4Y11E 3M7QA 1ANEA 3OE7D 2GGVB 4UONA 1A0JA 4YOIA 4CRFA 1CT4E 2VWMA 2KCYA 5LH8A 1WXRA 5PTPA 3T26A 4B1TA 2V7QD 3OTJE 4X1QU 3W1EA 1S6FA 1GI8B 1D6RA 4ESTE 4ISLA 2Y5HA 2ZFFH 4F48B 5C67A 2XWAA 4ISOA 2KAIB 5BPEA 1C2LA 4YTAA 1NESE 4K5ZA 5F03A 1BJUA 2ZEBA 1QA0A 2PKAB 3SNDA 3SU2A 3O8RA 1IQGA 1YCPM 1VGCC 1BMAA 4MPWA 5JBAS 1TMTH 1MTNB 2Z9KA 1FXYA 2R0KA 2ALVA 4RN6A 3SHAH 3SV2H 1DWBH 1GJDB 4NSVA 1COWD 1O36A 4TWYA 1P2NA 1IQKA 3BTTE 3H09A 3RM2H 4ACAA 2W7UA 1A0HB 2ZO3H 2IJOB 1O5GH 1KTTB 1MKWK 1GJAB 3LGTA 1BMMH 4ZXXH 1V2VT 4DJZB 2OXSA 2QF4A 2GJGA 2P8OB 1GJ4H 1V2NT 2YMSB 4Z1MD 1ELAA 1XUHA 5ESBA 1S0RA 2FX4A 1NY22 4XBBA 4I8GA 3NKKA 3GCOA 2F9BH 4IGDA 4WJG2 1HGTH 1GBHA 1V2PT 1BQYA 3VB5A 5JYIA 1PPHE 3BF6H 3A80A 3RXLA 1FIZA 2OD3B 2Z3CA 1F0RA 3GOVB 1TIOA 4YOJA 2FZZA 2TPIZ 2ZU2A 3S7KB 3T29A 4AYVB 2C8WB 1C5PA 2ZKSA 3UQVA 2ZFTA 1S5SA 2ZDMA 2A4OA 2EY4C 2OP9A 3M36A 4XDEA 1DLEA 1YLCA 2WV5A 1OP0A 5CHAC 1OWJA 1EZQA 1C2FA 1O5BB 1K1IA 2TGPZ 1B7XB 3P6ZB 2GV6A 1ETTH 1C1QA 2F83A 1L4DA 3TK5A 5T6GA 1UHBA 1LO6A 1ZHMA 3BG4B 2PR3A 1KTSB 2J4IA 2BD3A 1K1MA 3SU5A 2QYIA 3SBKA 4HZHA 2PGQB 2FMJA 3MNSA 3SU4A 2AGIX 4CRCA 4OS1A 3DCLA 3T5FH 1GJCB 1GBTA 1O3MA 5FCRA 4Z6AH 1VITF 1PPEE 1TGCA 3B8JA 1SGCA 2H6MA 3RMMH 3BG4C 1YPHC 1TA2A 4E7RG 1YYY1 1S6HA 3DA9B 1Q31A 2SNWA 4OS2A 2ZTXA 1O2RA 1H1BA 3ZZ7A 2PKAA 2G55A 3BIVH 2XBVA 5FL7D 2FX6A 5H4IB 4UD9H 3MO6A 2NU2E 3FOAA 1BRAA 1TX6A 4O97A 1O3BA 5EJZA 1O2OA 1SHHB 2EI7A 2H1UA 2P94A 1QY6A 2QN5T 3SV7A 1FAKH 1GHVH 1FLEE 2O8WA 5C1YA 4JYUH 5EQSA 5DSFA 2BVRH 2JDID 5AF9H 1O3PB 2W6ID 1C2EA 3G01A 4I8JA 3P8OA 1DUAA 3VFEA 2BY8X 2PUQH 1VCPA 5FX6A 4CHAB 5HXFA 1V2WT 2IJD1 2PW8H 4E7NA 2JH0D 1AB9C 4I32A 3UQOA 4LZ4B 2RCEA 4JZ1A 4Q7XA 4X1NU 4P00A 2ZF0H 1E34B 2GCTC 1FIWA 1TGSZ 2FWWA 2VGCC 4XD7D 1O2XA 3UREA 3GYMA 4TY7A 1WTHD 3S69A 4A6LA 1CE5A 1AE8H 3KYFA 3RMNH 1OP8A 2A4GA 3MNBA 3NXPA 1GI9B 2ZCKP 1O2UA 1QBNA 1LPGB 1YPMH 3NUMA 2QY0B 3RMLH 1EP5A 1FUJA 3U9AH 1EOLA 1YPKH 4Y7AA 3PLKA 3SV6A 1W0YH 1EB1H 1TGBA 1TRMA 1O2LA 1UTJA 1RS0A 1UMAH 1BMLA 3P17H 1P2MA 2ILNA 3D23A 1XXFA 3LGYA 1WV7H 1BMFD 1DX5M 2VVVA 3PB1E 1BCUH 4WY3A 1ZMNA 3A83A 1CGHA 3GISB 1C5QA 3HGNA 2Z9GA 3T62A 1AWHB 3QN7A 3RXBA 4UFDH 1ZLRA 9LPRA 4DY7B 1HAOH 1LHDH 1HXFH 1Q3XA 1RD3B 1AUTC 3PTBA 1EPTC 1T32A 1GCTB 2Q6GA 2K1QA 4TY6A 1UVSH 5HIYA 1NU9A 3MH5A 1NRRH 1PQAA 2W5EA 2BD8A 4I86A 1Y5UT 3P92A 2GCHF 4D7GA 5EJ1A 4LK4A 4BNRA 1CA0B 1C1WH 2P8OC 3BG8A 4B74A 4JZFH 1MAXA 1NFWA 2M5TA 3RP2A 1C2KA 1GHZA 3BTWE 1F92A 1TX8A 5K0HA 4FUFA 4U32A 5A09A 1MTVA 1O37A 4AFZA 3OFND 1OS8A 5E0GA 2W3KA 4Y79A 2B7DH 2BDIA 1SSXA 2I6QA 2ULLA 1GMHF 2GTBA 5J4SA 1BA8B 4ZH8A 2ZGCA 2BDHA 3DD2H 1ZR0A 2R9PA 2SGAA 4OGXA 3SW2B 3ZZAA 1KLIH 2GVFA 1FV9A 3ZZDA 1THSH 3MNXA 1NFYA 5C2ZA 3M5MA 4D8NA 3SZEA 1CVWH 4TSFD 3D65E 2WZQA 4K3JA 1VCWA 4DT7B 4SGAE 1OWKA 2L6OA 5C3NA 3R0FA 1DE7H 3MU1A 1GMCG 1GHAG 1EAWA 3M7UA 3PROA 1XUIA 1YLDA 2A7HA 2ZFSA 3TGKE 5EPNA 1ZSKA 1VZQH 1A3BH 1ZPBA 3AAVA 3ATLA 3OY6U 1HNEE 1SQOA 4FU7A 1KMHB 1SGDE 4H42U 1O3NA 3HGPA 3M3SA 4INLA 5B6LA 1U6QA 4AC9A 2JKHA 3BEFB 4ZKOU 1SLXB 1BT7A 1PPFE 1CHGA 2OUAA 1FZZA 2J34A 2FS8A 2GZ7A 1CO7E 1C1UH 1O3KA 2SGQE 1GDQA 1GHYH 3ZV8A 4ZCNA 3QTOH 3RXEA 2LNCA 1C2GA 3OY5U 3RXJA 3TJVA 4ACBA 3SJ9A 2EEKA 2BX3A 2XC0A 3UNQA 5C5NA 1ZSLA 5DO4H 1P12E 3CS7A 3P95A 4A1VA 3A7TA 1HUTH 3HPTB 2XBXA 2RDLA 5DP6A 1T8MA 4AB9A 2EI6A 3RU4E 1AGJA 2GCHG 2H5CA 3E90B 3MHWU 1GG6B 1WTGH 1DWDH 1HJ9A 3C27B 3K6YA 1BRUP 1ARCA 2AS9A 1MCTA 1Z8RA 3QGJA 5DK1A 5L6NH 4TPIZ 3FKSD 4YZUA 4IMQA 4YLUA 1XVMA 2IN2A 2VU8E 4FU9A 3EDXB 1C5YB 3ZZCA 1IQIA 1J8AA 3OU0A 1O2ZA 1BRCE 1O38A 1LVBA 2R2WU 1WAYB 4ABAA 2ZPSA 1VJ9U 1OSSA 1QIXB 2AEIH 3K65B 1AKSB 2GT8A 1D4PB 1F0TA 1H8HD 1UVPA 3V0XA 1OKXA 4R8TB 5A0CA 1Z71A 2BY5X 4ZUHA 3T2NA 2DE8A 4X0WU 3ESTA 3TJNA 2JETC 5IK2D 1UVUH 3RC5A 2Q6DA 3SUDA 5HGGA 1AHTH 3VEQB 4IC6A 3GDSA 2G5VA 4BXSA 4B2CA 2G4UA 1Y3UA 3T25A 3MO9A 1EJMA 1KXAA 2BD5A 1W12U 4MVNA 1HAIH 5DP5A 1DY8A 1AFQC 3UNSA 1W11U 1BHXB 3NCLA 4Y8XA 1CSOE 1SQRA 1T8LA 2QF0A 3GY5A 2PTNA 4K1EA 1P9SA 1AUJA 4D76A 2D1JA 1SQTA 4FOUC 3WWBA 2BDBA 2JIZD 5ETXA 1A4WH 4AORA 1O2IA 5FAHA 3TGIE 1H9LB 1DM4B 2WPIS 2FOGA 2XCNA 1NM6A 4NFFA 2FOFA 3RC6A 1FN6A 2Y81A 3MH7A 1Q2WA 3W95A 3SJKA 4CR9A 4NIVA 1TABE 2VIOA 2B0FA 1KLTA 1SI5H 1TOCB 1HAYB 2HLDD 1KXEA 4O03A 2WPLS 2O9QA 1MUEB 1FX0B 1C1PA 1XVOA 1THRH 3QLPH 1UCYK 1W8BH 2FM2A 3EA8A 2ASUB 4DG4A 4KKDA 1TNGA 3RXSA 1BZXE 4INHA 1TGNA 1VJAU 2BB4A 3L3TA 4Q4LA 5FPSA 3KF2A 3A86A 5JPMH 4B73A 1QL9A 1ID5H 1GI0A 1TPOA 2OLGA 1JOUB 2W6JD 3UUZA 1C2IA 3CNRA 1TNHA 3SU6A 4CRBA 2PLXA 3U8RH 4FVBA 1O2QA 1FDPA 3URDA 1SGFG 1MTUA 2RA3A 3ZZBA 1E0FD 1JRSA 2CHAB 2V3HH 4ZROA 1P01A 3QZQA 1DWEH 2B5TB 3OEED 2FO9A 2VVCA 1NT1A 2V3OH 3M7TA 2Z3EA 2ZNKH 1NBME 2FYRA 1UTNA 2P3TB 5DPAA 2KFWA 3KEEA 3LT3A 1Y3YA 2VINA 1W13U 1F0SA 4WXIA 2Y80A 4KTSA 1LPZB 4LOYH 2BY9X 6GCHF 4B76A 1K1OA 1N8OB 2D2DA 4A1TA 5GIBA 3F68H 2HPQH 2PUXB 1SLUB 1HAVB 1GBIA 1W10U 1LVYA 3DUXH 4JZEH 1PPZA 2WPDD 1MQ5A 2WPHS 1P11E 1O3OA 1SGRE 4X8VH 8GCHF 2R3YA 4JMYA 3F9HA 4ABIA 3ATWA 3VB7A 1JXPA 1V2OT 1P2KA 1C4V2 1C5ZB 1TYNA 1DSUA 1KLJH 3M35A 4OM9A 1MKXK 1X7AC 5I25A 1OXGA 2KCPA 1C4Y2 2D26C 4A7IB 1MU8B 3P8FA 5LGOA 1GCDA 3UY9A 1TGTA 1SGEE 1TRNA 1V3XA 5T6FA 1V2TT 5DN6D 5CDFE 2F91A 1O32A 1V2LT 3EAJA 2F9OA 2JETB 2CF9H 4BTTB 3ZVDA 3F0PA 6LPRA 1YCPH 2BOHB 3SYJA 1C5SA 2DE9A 2Y7XA 2BHGA 4ZKSU 5C20A 4I7YH 1GI2A 1P2OA 5EPYA 1LHGH 1P0SH 3RXQA 1NC6A 1PQ8A 1O2MA 2FEQH 1RGQA 4HI3A 4GHQA 4UFGH 2PP6A 3VGCC 4BAOB 2V3MA 2PGBB 1MMJN 2BLWA 2K8IA 2P3FH 2GD4B 3MOCA 5DP4A 2G52A 5HMAA 3LJOA 2FLBH 2HOBA 5C17A 1O2GH 4TYDA 3B23B 1NPMA 2P93A 2TGAA 2SGEE 3ZVGA 1JMOH 3MI4A 4JK5A 1FPCH 5IDKA 5SGAE 2RA0A 4YLQH 2HGTH 1GMCF 4OS5A 1O2JA 3CP7A 3I77A 3T28A 4BOHA 1QBVH 1EJAA 3H7OA 1TONA 1V2JT 2FTLE 1ELFA 4BAKB 2W26A 1ELCA 1W2KH 1THPB 2YMSD 1BBRE 1MH0A 2XBWA 1BTXA 3RXFA 1GBAA 4O9VA 2BTCE 5EXNA 1TNKA 3AK5A 1RFNA 3IITA 3RU4T 1QJ1B 3VXEH 1O2HA 4X6NA 3BEIB 1F5LA 3GCNA 3A84A 1TAWA 1WUNH 3SQHE 1K1JA 1H8ED 1RTFB 1D3PB 1AE5A 1K1PA 2V6NA 3DSGA 2GDEH 3NRLA 3BTFE 4AB8A 1O30A 2H9HA 2ZECA 1K22H 1IOEA 4R0IA 2OBQA 1O5EH 2A4RA 1O0DH 1LQEA 1ZTLA 2ZTYA 4FETA 1BJVA 1JBUH 2XOKD 1S6LA 1PQ5A 1E35B 2BY7X 3RXKA 3LONA 1IAUA 3QDZB 1ETSH 1GBKA 3URCA 2HPPH 1HLTH 1HB0B 4KP0A 1W3CA 3RU4D 1WSSH 5E0JA 1ESTA 2OK5A 4AGJA 4JYTA 2C4FH 3LGUA 3BTME 2FOAA 1E38B 3L33A 4E05H 1P02A 2FI5E 1XUFA 1JRTA 1O3HA 3E91A 5G4BA 3MO3A 2HWLB 1GG6C 3F0OA 2G8TA 2UUFB 3N99A 4CBNA 4Y0ZE 4RT1A 6CHAC 3H5CB 3M5LA 3STIA 4A5TS 1GI5A 3F1SB 3TJOA 1AKSA 4AX9H 4OS7A 4WF8A 1WCZA 1P57B 2P95A 3K6ZA 3FN8A 4ABHA 3O8CA 1LHCH 2SGDE 3NPSA 1GBJA 1XKAC 3NWUA 1HAXB 2BQ7B 1A2CH 2F9PA 3QO6A 4X2XA 2CJIA 2ODYB 3D49H 2Z6BD 5EOKA 3AAUA 1UVTH 1GBBA 4K1TA 4Y0YE 3ZZ9A 1GI3A 4X1PU 1RIWC 2ZHDA 2OC1A 3A7YA 3U69H 4AFSA 3LGWA 2J95A 3A8DA 2J5UA 3GYLB 1AVGH 1G32B 1C4U2 3SGBE 1LKAA 3ATKA 4FUBA 2TIOA 3VPKA 1EOJA 1EKBB 1FAXA 2A2XH 4ABFA 1O3DA 5C1UA 3Q76A 1CT0E 1BTHH 1L2EA 4WXVA 2JJ1D 1V2UT 3MFJA 1UTLM 1IQFA 1HXEH 4IMZA 5KGOA 1QBOA 5TCCA 3ZVBA 3AW0A 2GT7A 2JH6D 1LPKB 1Y59T 3DFJA 3KQBA 2PWXA 2NU0E 3MU0A 2IOTA 1C1MA 3A82A 1EAIA 1ELGA 1FJSA 1TLDA 3MU4A 4DT4A 3OX7U 1T8NA 1GJ6A 3ZZ4A 5L30H 2XW9A 3RM0H 4FUDA 3PLPA 4GVUA 3F2FA 3P8GA 3GS9A 3SGQE 1O33A 1O5FH 3KN2A 2AIPA 1XX9A 1Y8TA 3SO3A 2F9UA 3DSOA 4I33A 1BTUA 4J1YA 5A0BA 3SUGA 5GCHG 2BXTH 3K9XB 1SMFE 1ANCA
chains in the Genus database with same CATH topology
3EGKH 1GVLA 3RXVA 5L2ZH 1S84A 3GDUA 3KGPA 1H9HE 4X6MA 4B2BA 1QRZA 1E37B 1J14A 1JIMA 3SORA 1XKBC 1P04A 2FOHA 4UE7H 1D3TB 1LHFH 1J16A 1O2SA 4B75A 7GCHF 2C3SA 1GBEA 2ZFRH 5T3HA 3A7VA 2PFEA 3A7WA 2FODA 5FBEA 2FI4E 4DOQA 1FI8A 2BY6X 1GWAA 3PMBB 3Q3YA 2BDYA 4THNH 1TX7A 2H5DA 2FOBA 3GCHC 1GHAF 2VIVA 2H9EH 2G00A 3FP8E 3E1XB 4NA8A 2FXRA 3E6PH 3SV8A 4K2YA 2HVXA 1INCA 3UTUH 1C9TA 1GBLA 1ELBA 1PFXC 3W94A 1EQ9A 5EODA 1V2RT 1RTLA 3BTHE 1ETRH 1BMNH 4A92A 1P03A 1A5HA 1C9PA 2CXVA 4XFQA 4CRGA 3BTQE 1T4VH 3ODDA 4UFFH 3FANA 1YM0A 2P16A 1SOZA 5JBBS 1ZPCA 1GL0E 2GZ9A 4MG3A 3LGVA 3E16B 3PYHA 2VIWA 3PO1B 3FP6E 5JB8S 1HIAB 2C8ZB 2TRMA 1SG8B 1UO6A 5FPTA 1C5XB 1O2VA 4BANB 1SLWB 1H8DH 1F0UA 3PM3A 4NWKA 4D9QA 1SFIA 1NROH 4RKOB 3UR6A 2F3CE 1IHSH 3RXGA 4UFEH 3RUOA 1TFXA 5A8XA 3JZ1B 1SPJA 2OINA 1HAHH 3UOPA 1AB9B 1GBFA 3SNCA 5F6MA 4AOQA 3VB3A 4DIHH 2BXUH 5EG4A 1P3EA 1RJXB 5HM2A 2ZIQH 1J15A 1YC0A 4MLFB 4AGKA 1CBWC 1O3CA 1EZSC 1QL7A 4X1SU 2ZDVH 3IWMA 1CHOF 3SI4H 3MH6A 1KDQA 3A85A 1O3FA 1QTFA 2QIQA 5BRRE 1FPHH 2YNAA 4WVPE 3M5NA 1NFXA 3RLWH 1D3DB 4Y8YA 1HIAA 1F2SE 2ZQ1A 1G2LA 3GCTF 2OTVA 4NG9H 4WH6A 1ZZZA 2QF3A 4RKJB 3PV4A 1TB6H 5DG6A 1C1RA 4ISIH 3R3GB 1EZXC 1TBZH 3S9AA 1AY6H 1PJPA 1KY9A 3ZVFA 2FS9A 1O2PA 1DSTA 5F8TA 1Y3VA 2BVSH 1PPGE 4LZ1H 1VR1H 7LPRA 3ELAH 2PKSB 2Y5FA 3TH3H 1BBRH 1TNJA 2WUBA 2YNBA 1OWDA 3TU7H 2WUCA 3V7TA 1UCYE 3BIUH 1EXFA 3RXPA 1TPSA 1A46H 3E3TA 2A5KA 1YPGH 3KQDA 3HK6B 1GJ9B 1QL8A 2AIQA 4YESB 5K7RA 5FCKA 1O5CB 3M3VA 4MPXA 1GHWH 4WH8A 1SQAA 4MNWA 1T7CA 1PYTD 3RXTA 1C5LH 1FONA 3WY8A 4X8TH 1ESAA 1PPCE 1QQUA 5JBCS 2FI3E 1OWHA 1QR3E 1ZTKA 4ZKRU 1TQ0B 2TBSA 1MD7A 3SI3H 1TNLA 1M9UA 3E8LA 1NU7B 9ESTA 4VGCC 1EPTB 2G51A 1O2KA 5JBTA 1V2MT 1QGFA 4AZ2B 1QHRB 2Z7FE 1GHBG 1XUGA 2GMTB 4HTCH 1C5OH 1ZMLA 1DANH 1GI6A 1P3CA 3BTGE 1GVKB 1ZHPA 4A1XA 4FUIA 4INKA 1WQSA 1DOJA 1A3EH 3EYDA 3S9BA 1GMDF 3C1KA 2HALA 2RG3A 3TIUA 3OYPA 5FX5A 1T4UH 2ZU5A 1AQ7A 2QA9E 4LXBH 1BTPA 1KDQB 3SJ8A 1UK2A 5ABWA 1H8IH 1C2JA 3GY3A 4X2YA 1ANDA 5LPEA 3ENSB 1T31A 2ZFPH 1O31A 5GXPA 4Y71A 4U01A 1ZGVA 3A7XA 4CRDA 2GP9B 1NRPH 1MAYA 1MZDA 1XUKA 4IS5A 2OC7A 3SU1A 1BRBE 2ZDLA 2ZG0H 1AMHA 1OPHB 1C5UA 1TRYA 5JB9S 1G2MA 3TH4H 2D8WA 4JYVH 2A31A 1SB1H 4X1RU 5AFZH 3RXAA 1N6YA 3MMGA 4CHAC 2OBOA 1DY9A 4F4OC 5TCAA 1NZQH 1DFPA 1MTSA 1WU1A 4AFUA 4MPUA 4OS4A 4IC5A 1AWFH 1GJBB 3KIDU 3UIRA 1CA8B 1MZAA 1EX3A 6CHAB 1ACBE 4WMEA 2G4TA 1K2I1 1D9IA 4BAQB 1KIGH 2C8XB 5FHTA 1VITH 4BTUB 3O8BA 2A2QH 2P59A 1W0ZU 1SGFA 2ZHEH 2F9NA 1Y5BT 2WYGA 4TPYA 2UWOA 2WINI 2XCFA 3JZ2B 1ANBA 1MTWA 1LHEH 2LPRA 5T6DA 1DXWA 4X8SH 1K21H 1GMDG 1Z8JB 3A88A 1VCQA 5DP8A 1K1LA 1BITA 4GUXA 1H4WA 2XYAA 3MU8A 5F8XA 4ZAEA 1A7SA 2PKSC 2J9NA 5AHGH 1A5GH 2ZP0H 1Z6EA 2ZI2H 2HNTC 2XBYA 1UTMA 2Y82A 2VH6A 3F9GA 2AYWA 3U1IB 2OQUA 2O8UA 1QNJA 2OC8A 4GHTA 1QA7A 3SUEA 6GCHG 2QAAA 3GCHB 2Z3DA 4DURA 2CN0H 1OP2A 2VH0A 1TA6A 3RXIA 2H9TH 3GY2A 3T27A 2EI8A 3ZZ8A 1FQ3A 1ZSJA 1AN1E 3FAOA 4ZMAH 1L1GA 4YM9A 3U1JB 1O39A 2UUYA 3QTVH 1GGDC 4GSOA 4XBDA 3SV9A 4MNVA 4IN1A 2PHBA 2SGPE 4IN2A 1OYQA 2GZ8A 4WMDA 1GBDA 2IPHA 1C5TA 1XM1A 4GPGA 1RIWB 4XBCA 3M5OA 3GY7A 2ZWLH 3QZRA 5EXLA 7GCHG 1AI8H 3HK3B 3F9FA 2ZHFH 3S7HB 1S85A 3N7OA 2W3IA 1IQEA 1Z8GA 3LIWA 4X2WA 3ZZ3A 1HJ8A 1S82A 1C1TA 5LPFA 3SU0A 3QK1A 1UTPA 1YBWA 4MQAA 4RSPA 3LGIA 2QXIA 3A7ZA 2R2MB 1HJAB 3L6PA 1MKXH 1LVOA 1P8VC 1QB9A 4BAHB 3D62A 4X2VA 1ZGIA 1TPPA 1ELDE 4B2AA 1G37A 3LH3A 1MTNC 3QWCH 3BTKE 3CENA 1QB6A 3KL6A 4MPVA 1ZRKA 3M61U 2BZ6H 4Q80A 1PPBH 1EZUC 2WV4A 4MTBA 5EW1H 2A4QA 1V2KT 2PSXA 3LC5A 4JZIA 2VJ1A 1NTPA 2BD7A 3TK9A 2BYAX 4Q2KA 1LVMA 3ZVCA 4X8UH 2VWOA 2ZGHA 4UEHH 3UOUA 2FYQA 2ZU3A 4XOJA 4D7FA 2AH4X 1AU8A 1HV7A 1F5RA 1SGQE 3GY8A 3F6UH 1PYTC 5EW2H 1G3EA 1SR5C 4I8HA 1AIXH 3IG6B 1HAGE 1F7ZA 1FN8A 1G9IE 4NIXA 2BQWB 2FTMA 5A2MH 3KHVA 2WPKS 1YPLH 5IYTA 1DUEA 1P9UA 3S9CA 2Z94A 2EA3A 1LDTT 1Y3WA 3QUMP 5LPRA 3PMHB 1BHXF 1O2YA 5FBIA 3A8CA 1BTZA 2CF8H 4PROA 2J38A 1LCYA 4UDWH 3RXCA 1PQ7A 2VIPA 3H7TA 3PMJA 3Q3KA 1GI7B 5DKMA 5ESTE 4CRAA 1HRTH 5GWZA 1FY5A 4YT6H 1FNIA 3FZDA 4K1SA 4WMFA 2XXLA 1NO9H 2QXHA 3RXDA 1G3CA 5E8EH 2ZGXH 1ESBA 2VIQA 2ODQA 3TVJB 1Y5AT 2VNTA 1BOQA 2ZA5A 1DT2A 1CBWB 2AGEX 3A8AA 2FOCA 3S0NA 3PO1C 4Z0KA 3KNXA 3PWCA 1C1VH 1AFQB 2KAIA 5EQQA 8KME2 2PSYA 1ZTJA 5GPIB 2ZPQA 4U30A 2THFB 1JIRA 4D9RA 1ELEE 1LMWB 1C1OA 1ZRBA 1GHBF 2FOMB 4X6PA 2BZAA 1SVPA 1P05A 2FESH 1NRNH 1HBTH 5GDSH 2Z9LA 4FUGA 4BTIB 3ZZ5A 3M37A 1ZJDA 2ZZUH 2O8TA 2AMQA 1AFEH 3A89A 1SGYE 1HJAC 1WOFA 1RXPA 1WBGB 3V12A 3STJA 1P06A 3A87A 1VITG 2AGGX 4CREA 3Q00A 4ZKNU 2Q6FA 8GCHG 3TNSA 3ZZ6A 4AN7A 1TMUH 3B9FH 4XSKU 1GL1A 2GDDA 4DVAU 2F9VA 4ZXYH 1CGJE 1AZ8A 3P70B 3F9EA 3PLBA 2QGRA 1K28D 4I8KA 3VXFH 3LKWA 3ITIA 1QJ7B 2ANKH 2XWBI 4Y7BA 4ABGA 1HFDA 1GJ8B 3RXMA 1C5MD 3HKIB 4GCHF 2A7CA 2ALPA 3QGNB 4Y8ZA 2ZCHP 1IQMA 3UWJH 4FUCA 1EUFA 1ABJH 2G5NA 2ZFQH 3FP7E 1YPJH 3A81A 1K1NA 1ARBA 4KGAA 1ZOMA 3SNAA 5GJ4B 1N8OC 5DJ7A 1TBRH 1V6DA 2A5AA 1LTOA 2A7JA 4ZHAA 2EC9H 2VWNA 1BTWA 1CT2E 2STAE 3LH1A 2XC5A 1C1NA 3MWIU 1TWXB 2BDGA 4NWLA 1FY3A 5DP7A 1C2MA 1ORFA 1O2WA 1F5KU 3DT0H 1ABIH 1DWCH 1EAXA 2CHAC 1HCGA 2Q1JA 5C1XA 2OCVB 3E0NB 1G30B 1Z1IA 1DS2E 1GVZA 3SJIA 5GCHF 1EP6A 2BQ6B 4MNYA 1S0QA 2ZQ2A 1VGCB 3MTYA 5DP9A 1FMGA 4KTUA 1B0EA 2BLVA 4NA9H 3FZZA 2NWNA 1TPAE 3PWBA 3AW1A 4CBOA 4AG2A 1ZPZA 2V35A 1C5RA 2XNIA 4DGJA 1GBMA 1KXBA 2ZC9H 1TE0A 1C1SA 3LOXA 2NU4E 1SGTA 3UWIA 4I8LA 1C2HA 1QJ6B 2ZDKA 3MYWA 3SUFA 2FLRH 1UHBB 3V3MA 5A8YA 1SHYA 1KXCA 1UVOA 2VIDA 2NU3E 1A5IA 3SHCH 2A1DB 2XTTB 3SU3A 1QQ4A 7ESTE 1L1NA 4U2WA 1V2ST 1W14U 2ZHWH 4NFEA 3LU9B 7KMEH 1QB1A 2O8MA 1IQNA 1EJNA 4AFQA 2V0BA 1O3AA 1QRWA 3RXUA 3ATMA 1WQVH 1GCTC 1YKTA 4YT7H 4IW4E 2BD9A 4CH2B 1KXDA 3GICB 2HNTF 4BAMB 4AYYB 1HPGA 1C5NH 1GHXH 3SN8A 1SL3A 2WPJS 1HAVA 2ZU4A 5I46H 4CR5A 3RC4A 4B71A 1ZYOA 4CH8B 1ZJKA 2ODPA 3QX5H 3ZVAA 1MBQA 1P10A 5AVDA 4OGYA 1OOKB 4ABJA 1JWTA 1UTOA 3U8TH 2GKVE 2Y6TA 4IBLH 2W7SA 4H4FA 3ZYEA 4FXGH 3PTNA 1IQJA 3HKJB 4J2YB 2A0QB 1K9OE 2P3UB 1UTKA 1GBCA 1C2DA 2ZCLP 3GY6A 1SOTA 2ZGBH 5A0AE 1DPOA 2ZU1A 2C93B 2BDAA 1CGIE 3FFGA 3LDXH 3SOSA 3TJUA 1DLKB 1BDAA 2ZHQH 1BTYA 1B0FA 4JK6A 4Y76A 3BTEE 1BB0B 1UK3A 1WYKA 1NRSH 2GX4A 3GCTG 2VVUA 1EASA 1W7GH 2J94A 1IQLA 2QC2A 2ZTZA 1AVWA 2QXJA 1DDJA 1Z6JH 3NK8A 1Z7KA 2WYJA 3ZV9A 1XMNB 4H6TA 3TITA 4DW2U 3SGAE 1H9IE 3TH2H 1O2TA 1SGNE 3VB6A 1O3EA 1QRXA 4ABBA 1GDUA 2ZDNA 3RDZA 2TGTA 2A45B 1OWIA 3P8NA 3LPRA 3KCGH 1P2JA 1NS3A 3A8BA 1Y3XA 1AD8H 1XUJA 2FOEA 2GV7A 1AZZA 1IQHA 1MCVA 3ODFA 4KELA 1NN6A 2UUKB 3ATIA 2C90B 4GCHG 1W7XH 1SFQB 1FY8E 2Z9JA 2SNVA 3VGCB 4ABDA 2FPZA 1LQDB 5CMXH 4Q7ZA 4Q7YA 3KQCA 1D3QB 4KTCA 5B6OA 4QT8C 4HFPB 1G36A 4DCDA 4ISHH 2J2UA 3EA9A 3TGJE 3FVFB 2BD4A 3TK6A 4K60A 4HGCA 5EXMA 4Y6DA 2HLCA 3RXOA 4X6OA 3E0PB 3DHKH 2TGDA 4MNXA 3LC3A 3NZIA 1SLVB 1S83A 1T8OA 1A61H 1EATA 2I6SA 1OX1A 1EAUA 1O3IA 5JDUB 1GPZA 8LPRA 5L2YH 1C5VA 1UK4A 1GI1A 4NIWA 5EU8A 1MKWH 1P09A 2QCYA 5EQRA 1O5AB 3RXHA 4O3UA 3MU5A 2H2ZA 2FDAA 2SFAA 1LKBA 2A5IA 1BBRK 1O5DH 1TALA 4NA7A 5E2OA 4OS6A 1AVXA 2AMDA 1GDNA 4NGAH 3UFAA 1YCPK 2VWLA 1UCYH 4Y10E 3SQEE 5A8ZA 1DVAH 1YPHE 1OYTH 3VB4A 3AVZA 6ESTA 4ABEA 1FY1A 4WWYA 5E2PA 2UWPA 1EPTA 1S81A 2R0LA 1O2NA 3I29A 1FY4A 5F8ZA 2OQ5A 1A1RA 2ZPRA 1N6XA 3LJJA 1L0ZA 1L4ZA 2QV1A 1O3JA 4K8BA 1HAPH 2BOKA 1RRKA 1EB2A 1SGPE 1YF4A 3EQ0H 3U98H 1P2IA 1DXPA 3GDVA 1AO5A 2BMGB 1GI4A 2FIRH 2J92A 1SC8U 3UR9A 1J17T 3PMAB 3TLOA 1BIOA 1KYNA 1ELVA 2PTCE 4K69A 4ZHLU 3GY4A 4XE4A 4FUEA 3BTDE 2B9LA 2A32A 2ANWA 2BD2A 2O8LA 2XC4A 3RMOH 3TPIZ 1ZMJA 3UNRA 4F49A 1J9CH 2ANMH 2CV3A 3EE0B 3V13A 1CHOG 4ISNA 2OC0A 5CE1A 1O3GA 4BXWA 1O34A 2ANYA 2UWLA 4E06H 2CMYA 3MH4A 1QFKH 3RLYH 2BLOA 4YOGA 2C8YB 3EA7A 4FU8A 3SZNA 1GJ7B 1TOMH 3RXRA 5FXLA 1G3BA 1QURH 2GMTC 2B8OH 4NZQA 1C5WB 1DITH 2AMPA 3SJOA 2Y7ZA 3TNTA 1N1LA 4SGBE 4YO9A 5EGMA 4VGCB 2BLQA 4NSYA 5DP3A 3M3TA 2JH5D 2BX4A 2GCTB 2VGCB 2VB0A 2SGFE 1MBMA 1HYLA 1D6WA 1ZHRA 3Q77A 2G81E