1PJPA

The 2.2 a crystal structure of human chymase in complex with succinyl-ala-ala-pro-phe-chloromethylketone
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
226
structure length
226
Chain Sequence
IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQKNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGAAQGIVSYGRSDAKPPAVFTRISHYQPWINQILQAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHYMASE
publication title The 2.2 A crystal structure of human chymase in complex with succinyl-Ala-Ala-Pro-Phe-chloromethylketone: structural explanation for its dipeptidyl carboxypeptidase specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 46
structure length 226
sequence length 226
ec nomenclature ec 3.4.21.39: Chymase.
pdb deposition date 1998-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1pjpA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1pjpA02
1C2LA 1LVOA 1OWEA 4F49A 2Z9KA 4MNXA 1UHBA 2GKVE 1GGDC 1MQ6A 1OPHB 4QT8C 1EASA 5EODA 1ANCA 2ULLA 1MKXK 4UFFH 2W5EA 2PKSC 1WYKA 2AGIX 2ZGHA 2BX3A 3RXEA 3SHAH 3T62A 2AFQB 4XFQA 1V2UT 4BTTB 4I8GA 1ZGVA 1QJ7B 1RGQA 4XE4A 5E2PA 1C2MA 2FOFA 1K21H 1PFXC 1QB6A 3RLYH 3BIVH 1A0HB 1IHSH 1HAPH 1TNJA 3O8CA 1EAWA 5HMAA 4ZHMU 1J8AA 1C2EA 1XKBC 1T7CA 4TY6A 4O03A 1XUIA 1QRZA 5JBCS 1A5GH 2EI7A 3T25A 3STJA 4OS2A 2QIQA 5LH8A 3A86A 1K22H 5DP7A 3FP7E 1A2CH 1ZMLA 4A6LA 4Y8XA 4X6OA 5F8TA 1F7ZA 2BDBA 1RIWB 1LCYA 3KHVA 1J15A 3TK9A 1FY1A 3PWBA 1CBWB 1SGIB 3LGWA 1PPFE 2RG3A 4HTCH 2QF3A 4UFGH 5JB8S 4ZH8A 3RXQA 1D3TB 3GCHC 2B7DH 1TQ0B 3QUMP 2OBOA 4BAHB 1QNJA 5C5OA 1RJXB 1SGDE 1P12E 2STAE 2ZWLH 1JIMA 3LONA 3ZVCA 1GMCF 3ZZBA 3A8AA 1PPEE 3PMAB 2BDAA 5DP9A 1NU9A 1DSTA 2BLWA 1DXPA 1GBMA 4BXWA 2RDLA 2LNCA 3MH5A 2XC5A 2RCEA 5I25A 3RXJA 3M5LA 2FP7B 5HM9A 1QGFA 5JB9S 2OTVA 1IQHA 1HAGE 2R3YA 1YPJH 4Q7XA 1WV7H 1G2LA 1CHOF 2G4UA 5HM2A 4JYTA 3CS7A 2BQ6B 5HYOA 1Y5BT 3QGJA 1FAXA 1A3BH 3ATMA 1TNLA 4X2YA 4YZUA 3TJVA 1ELDE 1FAKH 7GCHF 2ODPA 2ZU4A 1GJ8B 1W8BH 3ZZ5A 1INCA 4IMZA 1BTUA 1WTGH 1W7XH 3GCTF 4FVDA 4A1VA 1ZHPA 2ZFQH 1ABJH 1RTKA 3S69A 3ZZ3A 4FU8A 4YESB 1F0UA 1ZJDA 3RC4A 1O2QA 1WBGB 1TX8A 2XCNA 3I29A 4I8JA 4JYUH 3KIDU 3ENSB 1TA2A 4INHA 4B73A 4WJG2 1Z1IA 1GBTA 5LPRA 1EXFA 1HRTH 3EA8A 3MU1A 4I32A 1C2FA 1GDNA 1CHGA 5SGAE 4X2XA 3ATWA 4WF8A 4WMEA 4Y0YE 1FONA 3Q3KA 5GXPA 2XW9A 3TK6A 1DM4B 1GBFA 5DP3A 4YO9A 4CRGA 4AZ2B 4CBNA 4IGDA 3RC5A 3QTVH 4ABHA 4X2VA 1SOZA 3ESTA 1C1QA 3RXAA 1TE0A 1NU7B 2ZFFH 4NIVA 1W2KH 2BHGA 4FXGH 1ZRBA 3ELAH 3BG4B 3A7ZA 2WINI 4I31A 3FANA 4D9QA 3A81A 1WOFA 3P92A 1WTHD 3RC6A 1T4VH 1GG6C 1QJ6B 1HLTH 1ZMJA 1ZTJA 3A80A 3RXMA 3ZZCA 1GBEA 1SGFG 1GJCB 2P95A 1TWXB 3RMLH 3V3MA 5EGMA 1S0QA 1G3DA 1GMHG 3LIWA 1MKWK 2A31A 4D9RA 2ZDLA 3RXRA 1GI9B 1NTPA 1O2YA 4MNWA 4X6MA 1Q2WA 1MCVA 4D7FA 1Z71A 1BHXB 2GX4A 2XWAA 1O0DH 1GJBB 2SGAA 2ZEBA 3SNDA 4AYVB 5GDSH 4BAOB 3BTFE 1PYTC 1FJSA 3R3GB 3QGNB 3RXTA 2A4OA 5GCHG 1AWHB 2FXRA 4Y0ZE 4ABAA 3O8BA 2DUCA 8KME2 1NN6A 1UVOA 2BY6X 1EPTC 3VB5A 2TGTA 1UTJA 1H9IE 3EAJA 4NA8A 4BOHA 4A1TA 2GCTC 3C27B 3LGVA 2Z6BD 2YNBA 4B74A 4FU7A 1HXEH 1LHGH 1BJUA 3A8DA 1XKAC 1S6HA 1O3JA 2GZ8A 1HYLA 3F9GA 3EDXB 3DD2H 3FZZA 2P3UB 3OTJE 1O3OA 1TGNA 4FUDA 1HDTH 2F9UA 1THSH 4RN6A 3BV9B 1GI7B 1VJAU 1C5NH 2GV6A 4MPVA 1OWKA 1BTZA 1LVMA 4Y79A 2AIQA 2ZO3H 1Q31A 2VWOA 2CF8H 4K1SA 3SV7A 1G9IE 2VU8E 4HGCA 3TJNA 3TGJE 1C5XB 4MQAA 1A0JA 3KGPA 4MNVA 1GCTC 3SJKA 3UQVA 4OS1A 5TCAA 1KIGH 1TALA 3RXCA 3IG6B 3UOUA 3SW2B 3UOPA 2PUXB 1V2QT 3PYHA 5A09A 1V2LT 1NT1A 3BEFB 3MI4A 1G3CA 3SHCH 1FZZA 4WMFA 2O9QA 4TWYA 4BTIB 1ELGA 5L6NH 3MO6A 5LGOA 2ZDKA 1P05A 3W95A 3E1XB 1GJ9B 1BT7A 4AX9H 1GHAG 1OKXA 3VXFH 4INKA 4Y71A 2PW8H 1VJ9U 1FLEE 2QYIA 1HPGA 2BB4A 1LQEA 1MUEB 2ZHWH 1SGQE 3F68H 1O3EA 1G30B 2BXUH 2C8WB 2D8WA 1A5HA 2Z3DA 2A0QB 1MCTA 6CHAC 1TX7A 4ZMAH 1O2SA 1C2HA 1MTNC 1JBUH 3VFEA 4FUHA 3RXGA 5JPMH 5AFZH 1TNIA 3TJOA 1FY3A 1A4WH 4NSVA 1G2MA 2OQUA 5PTPA 3M7UA 4ABBA 2BVSH 3T28A 5K0HA 1IQKA 4CH2B 1SQAA 1C1VH 6GCHF 3LDXH 1HIAA 4D7GA 4DIIH 2F9NA 5F8XA 1GHYH 1DWEH 3E8LA 2TIOA 1VGCC 3Q3XA 1DS2E 4K5ZA 4AFQA 3F9FA 3SJ9A 2VIQA 3VGCC 1SVPA 2JH5D 4ZHLU 4ZXYH 2ANWA 1HAVB 2WPIS 2M5TA 2W3IA 4D8NA 1O3LA 1XUGA 1Z6EA 2Q1JA 1Z6JH 1O33A 1TBQH 3A89A 1MTWA 1NRSH 2ZHDA 1KXFA 3A7YA 3UIRA 3FP8E 5FCRA 2A4GA 1HAZB 4BXSA 2R2MB 1NY22 4KKDA 2W26A 2YNAA 1HAYB 3OY6U 3TIUA 1EQ9A 2ZCHP 4Q7YA 2TRMA 4Q80A 1C1NA 4ABIA 1BB0B 1SI5H 1YGCH 2GZ7A 1RXPA 1LTOA 3K65B 3D23A 2FX6A 2BLOA 1CT4E 3NPSA 1C5QA 5AF9H 3DFJA 4MPWA 3Q76A 4ISNA 3M37A 4JZIA 1CGIE 5TJXA 1P57B 1GVZA 3RMNH 1BTXA 4JZDH 1W0ZU 2PFEA 1VCWA 2P8OC 3TGKE 2UUFB 1UTQA 1JRTA 2OLGA 2VJ1A 4UDWH 1DOJA 1GI0A 3AAVA 1TOCB 2A1DB 2P3FH 1RTLA 1XUKA 1QJ1B 1B0FA 2FZZA 3F9HA 4R8TB 4TPYA 1QTFA 1J16A 1O2LA 5CHAB 1E38B 1LHDH 2ZDNA 2A2QH 1ETTH 1O30A 4XOJA 3V7TA 2GD4B 1O2GH 1FI8A 3QO6A 4YOJA 2CHAB 2O8UA 2FOCA 2XYAA 2ZP0H 3MNCA 1JMOH 1ID5H 2ZTZA 3A84A 1MKXH 2ZDAH 2VVUA 1HBTH 1YLDA 4DW2U 2QXGA 2BD7A 3UNRA 2B9LA 1AU8A 1KDQA 1L4DA 1MH0A 4YLQH 5EPYA 1O34A 1GI3A 4H6SB 1AVGH 3ITIA 2B0FA 3SNEA 2OC8A 2BM2A 2C90B 1O2IA 1C1OA 3BTWE 1FIWA 2OQ5A 5L2YH 5EW2H 1TNKA 1GJAB 3SUEA 3BTGE 2Y6TA 1GHVH 3Q77A 4NIXA 2ZPRA 1QURH 1SBWA 1DANH 1NO9H 1AKSA 1LHEH 1PQ5A 4WXIA 2VIPA 2VVCA 3NUMA 3SV9A 1SHYA 2F3CE 2XWBI 1SQOA 3GDUA 2SGPE 1ABIH 4ZROA 3SQHE 2ZPSA 1GHBG 1LKBA 3ODDA 1HV7A 2G55A 1SGFA 1DDJA 4PROA 4ZKRU 2ZTXA 2QXJA 3M5NA 1BBRE 1CVWH 1PPGE 2ZGCA 1QRWA 2ODQA 2GZ9A 4B1TA 1AB9C 1O5EH 1OOKB 1UTPA 4INLA 1O5FH 4JK6A 3A7XA 1ELAA 3PTNA 2ALPA 2W7UA 2QA9E 3QX5H 2QXIA 1ESBA 1O2HA 3GYLB 1YF4A 4YT6H 1YM0A 2FTMA 1IQGA 1O2NA 5FHTA 2ZECA 1AN1E 4TY7A 1CA0C 2ALVA 3W94A 4IMQA 3BEUA 1V2OT 4GVUA 2BD3A 1BJVA 3BTME 3D65E 7LPRA 2BXTH 1HJAB 2ZU3A 1OS8A 3K6YA 2PHBA 2ZCKP 1G36A 1YLCA 1DXWA 1ESAA 1J14A 2XBXA 1O39A 3ZZ6A 2PTCE 4MVNA 1O2XA 1CT0E 1XVMA 1NPMA 2ZU2A 3MO3A 3SGBE 1ZTLA 3DUXH 3SQEE 5FXLA 5G4BA 1ETSH 1EZXC 2A4RA 4NSYA 1FV9A 3H7OA 4M7GA 4X8VH 3T5FH 4AB9A 3HPTB 2BLVA 1CO7E 3FP6E 4WH6A 1C5UA 5EXMA 1K2I1 2PKSB 4YOIA 1P9UA 3M3VA 3SU4A 4J2YB 4GCHG 4NWKA 3K6ZA 3KNXA 3SGAE 3MNXA 4XSKU 3TLOA 2FI4E 5FPSA 3SV2H 1Z1JA 3SU6A 1O35A 1OSSA 2I6QA 3GY2A 4NA7A 3U1IB 3ZZ7A 3VPKA 1PJPA 2Y80A 2Q6FA 3RU4D 2PTNA 2P94A 2Z9LA 5LPEA 2UUKB 5IYTA 3SGQE 1GPZA 4OGXA 1C2JA 3SUDA 4FUCA 4YTAA 1TFXA 3H5CB 5FAHA 3SBKA 2PR3A 3F1SB 4K3JA 1FIZA 2GDDA 1SLVB 3I78A 2BY9X 1SOTA 1IQJA 2PUQH 1ORFA 3S9BA 2OC7A 1EKBB 2G00A 1TGTA 1MKWH 1BQYA 5E8EH 2H2ZA 3KL6A 4XBDA 3GY4A 3LPRA 1Y3VA 4IN1A 3GCHB 4JCNA 1H9LB 4CRBA 5FX5A 1OWIA 1BIOA 1LQDB 4ABGA 3P95A 2PV9B 3TNTA 1F92A 5EPNA 1HFDA 2XTTB 4D76A 1Z8JB 1QFKH 2BOKA 1O37A 4ABDA 7KMEH 2HOBA 5T6FA 1TGCA 1AUTC 2BYAX 2FIRH 3RMOH 1QQ4A 4DOQA 1J9CH 2ANYA 1RTFB 2TGPZ 1BCUH 1BHXF 1SFIA 1F2SE 4LK4A 3M5OA 4B2BA 3T29A 3NXPA 1OP0A 1EP6A 1TPPA 4ABJA 3OY5U 4DVAU 3ZV9A 4IS5A 5IDKA 3BN9A 1DVAH 2AIPA 1DWCH 1EAXA 1YP9A 3BF6H 1P8VC 2V3HH 1THPB 1V3XA 3GY6A 3MU0A 1O2VA 2YOLA 1H1BA 3TK5A 2AERH 3GDSA 4NGAH 1FY8E 2ZC9H 5AVDA 5ESBA 5EXNA 3UTUH 8GCHG 1O31A 3LC3A 3BTQE 1C5VA 4AFZA 5CMXH 1GI6A 4CRFA 1C1UH 1MZDA 1OWJA 2GMTC 3V13A 1TABE 1V2RT 1B0EA 3SNCA 1BOQA 2JKHA 3BTKE 3LU9B 5DKMA 1XUHA 3NZIA 1LO6A 3FAOA 5GPIB 3KQCA 4DT7B 5FPTA 8ESTE 1EX3A 2BY7X 1KTSB 1P3EA 4MPUA 2VGCB 4MG3A 4WH8A 3SNBA 2FOBA 4ZKNU 3BTEE 1OP8A 5I46H 3LOXA 3M61U 2OCVB 1IHTH 1S5SA 1SSXA 4K1TA 4U2WA 1O5BB 3EA9A 1O3CA 2A32A 1P04A 1GHWH 2Q6DA 1C1WH 4NG9H 3O8RA 2VVVA 5C1YA 4SGBE 1PPBH 4X6PA 1MTVA 1QY6A 1TNGA 3ZZ4A 5FBIA 3RLWH 1F0TA 2FMJA 3A7WA 4ZXXH 1YCPK 5A2MH 5A0BA 3SI3H 3KEEA 2WUBA 2OC0A 1C1MA 1U6QA 2BDIA 5DP5A 1QA7A 2OP9A 1C5MD 1ZR0A 3QDZB 1SC8U 3MU5A 1T8MA 2H6MA 4FUGA 1GJ5H 1NRPH 1N1LA 2C4FH 1NC6A 2GCHG 3SUGA 1EB1H 1PPHE 4WY3A 1ANBA 2J34A 5EXLA 3UNQA 3LGUA 1O5DH 2ZQ1A 5K7RA 4U01A 1ZJKA 2TBSA 4Y7AA 1HAIH 1PQAA 3H7TA 1L0ZA 1UCYH 2IJOB 1O3GA 1ZLRA 3AW0A 1ZMNA 4MTBA 1UO6A 5DK1A 1O3HA 1QBNA 1HAOH 2F9BH 4WMDA 1P03A 2RA3A 3E16B 2OXSA 4FU9A 4A5TS 1O3AA 3U98H 2FTLE 1C1RA 4U32A 1NRRH 1B7XB 3MH4A 1QL8A 1HB0B 1CQQA 1T31A 1FY4A 1EPTB 4JZFH 3GY8A 1N8OC 1DE7H 4I8LA 3PROA 5BPEA 3LGTA 3TITA 1C4U2 2IOTA 2C8ZB 1DFPA 1IQFA 2BD5A 4VGCC 2GT7A 2SGQE 1P0SH 2ZU5A 1TMTH 4OS4A 3B9FH 2FS9A 2F9OA 5C5NA 2BZ6H 4KTSA 1MBMA 1AQ7A 1YPEH 1DSUA 1V2PT 1DY8A 3T26A 3A8CA 4HZHA 4R0IA 4DG4A 2BDHA 3TNSA 1QA0A 1GBHA 2A2XH 2D26C 4CREA 5A8ZA 2D2DA 1AFEH 1EATA 5HXFA 1KLIH 3ZVAA 3SV8A 2UWPA 1Z8RA 4ISHH 2F91A 4IN2A 3PO1B 2FPZA 1HAHH 1P01A 3S0NA 1KXEA 1QB9A 1KXCA 4LZ1H 4AORA 1P2OA 1S83A 1HGTH 1JIRA 1DPOA 3S7KB 4DY7B 5DJ7A 2O8LA 1V2WT 2JETB 1TB6H 2D1JA 4LXBH 2WUCA 2JH0D 1WCZA 1RD3B 2H9HA 3QTOH 1FY5A 3EGKH 6LPRA 2FDAA 4KTCA 3ATIA 1BRUP 3EYDA 1QB1A 1Y3WA 1EZUC 1NM6A 4ISLA 3PTBA 3QK1A 4X6NA 4BAQB 3TU7H 1G32B 3GISB 4WWYA 3M7TA 3NKKA 5E0GA 1IQEA 1D3PB 1W7GH 2G81E 2QGRA 3ZYDA 2GDEH 1AVXA 1T8LA 2XBVA 1SR5C 1WQVH 1D3DB 1OWDA 2O8WA 1YPLH 5FX6A 1DUEA 4WVPE 3UR6A 5ESTE 1D4PB 4NZLA 4Y10E 1O5GH 2QC2A 1O2JA 2F9PA 2VIWA 3B23B 2H1UA 2ZHFH 3A82A 4MPXA 1MAXA 2AMDA 1DWDH 1FN8A 1LHCH 1C4Y2 1C2DA 2BQWB 4GHQA 1UMAH 4B2CA 1O3MA 4BANB 1MTNB 1GVKB 1MTUA 4UE7H 1GMDG 1ACBE 5LPFA 1K1LA 4IC6A 4X1SU 2PKAB 2XC4A 2UWOA 3M5MA 1D9IA 1VITG 4BNRA 4DCDA 2H5DA 1C5ZB 2FO9A 1UTOA 1A0LA 3EA7A 1QCPA 1G3EA 3RM2H 1C5SA 1V2MT 2XC0A 2ZFTA 1N6XA 1ANDA 2Z3CA 4NFEA 1TMBH 1C5PA 1GBJA 2O8MA 1BA8B 1BZXE 1VGCB 2F83A 1IQMA 3GDVA 1GMHF 3G01A 4O3TA 2FI5E 1P9SA 4CR5A 1BTPA 1AMHA 3KQBA 1VCQA 1FQ3A 4NFFA 3A7VA 1GDUA 4OS7A 1TGSZ 3LT3A 1QQUA 2ZDMA 2BD9A 1A5IA 1LMWB 1XUJA 1C2IA 1GWAA 1EJMA 2ANMH 2A7HA 3VB4A 3SU3A 2J92A 2QAAA 1HAVA 1A1RA 2ZPQA 4GSOA 1GBBA 3M7QA 2FOHA 2ZFPH 3URDA 2IN2A 2VWLA 5GCHF 3UFAA 2ZF0H 1DITH 3M35A 2PGQB 1P10A 1P11E 4UONA 1EB2A 4KGAA 2VINA 1C5WB 3KCGH 9LPRA 4AGKA 2SNWA 4GHTA 2ZA5A 3TH2H 2RA0A 1ELVA 4AB8A 2EEKA 3P8OA 3U8RH 2H5CA 2ESTE 4KTUA 1DICA 1F0RA 1GI8B 1NROH 2P8OB 2WV5A 1Z8GA 2V3OH 2Z9JA 1P2QA 3MH6A 4X1RU 6ESTA 2EI6A 2CV3A 3ZYEA 4X1PU 1D6WA 1O3NA 2NU0E 1O2ZA 4K8YA 1GVLA 4U30A 1LDTT 2H9EH 3M36A 2CMYA 5DG6A 3UREA 4XBCA 3RU4E 3ZZ8A 3TPIZ 3SJ8A 5F6MA 1EOJA 1H4WA 1TRYA 1O2MA 1MAYA 2B5TB 2BDGA 4CHAB 3P8GA 4MLFB 1XUFA 3K2UA 4F4OC 2SGEE 1OWHA 2FESH 4K1EA 3A85A 3DHKH 1XM1A 1GJ7B 1BDAA 1ELTA 1Y3UA 1Y3YA 2QXHA 1GMCG 3GY3A 3ZV8A 1AKSB 2ZTYA 2HRVA 4H4FA 2ZGXH 1KLJH 3HK3B 4I7YH 2V35A 1CSOE 1H8DH 2EA3A 3VEQB 2P16A 1ZHMA 5E0JA 5EG4A 2O8TA 1O2OA 2KAIB 1O2RA 1V2TT 2JH6D 2XBWA 3UY9A 3SV6A 8LPRA 3SU0A 3AVZA 5B6OA 1CHOG 3U9AH 1GHAF 3V0XA 1IOEA 1E0FD 1K1NA 1WSSH 3Q3YA 1ZPZA 1TQ7B 2G5NA 3MH7A 1AFQB 2Y7XA 1TONA 2R0KA 2FX4A 1X7AC 4FUBA 5JDUB 7GCHG 1NFYA 1BITA 1MD7A 3O8DA 1O5CB 1Q3XA 4ZUHA 4NIYA 3PLBA 3HK6B 1T4UH 3F9EA 2QY0B 3LKWA 2ZGBH 2HPPH 3GCTG 3LH3A 1KYNA 1CA8B 2VNTA 1O2UA 1THRH 1SLWB 4ABFA 1TPSA 1GHXH 1GI1A 3QN7A 1GHZA 1GDQA 1GL0E 2GT8A 4B71A 4WXVA 4NIWA 3LGIA 3QWCH 2GTBA 1O2TA 1OP2A 1L4ZA 1TBZH 2HVXA 2QCYA 1LVBA 5T6DA 1AGJA 2Z9GA 5A8YA 1PQ7A 1CGHA 1C4V2 5EQQA 1UHBB 4FUJA 2OINA 3NK8A 1C9TA 1TX6A 4K69A 3RU4T 4AOQA 1C5TA 1UK2A 1UVPA 2C8XB 4CR9A 4AG1A 3MU4A 1DY9A 1JXPA 1BMMH 2SNVA 1CA0B 1QHRB 1LKAA 2G4TA 2DE9A 1O3PB 1SFQB 2PLXA 1K9OE 4CRDA 1IQNA 3OU0A 1C2GA 2C3SA 1DLEA 1CT2E 3FZDA 1ELFA 2UUJB 1F5KU 1GGDB 1BBRK 2TPIZ 3UNSA 3SO3A 1ZOMA 2SFAA 3GCNA 3FFGA 1S82A 5F8ZA 1FNIA 1HJ9A 5JBAS 2THFB 1QIXB 3PLPA 2BVXH 3UR9A 1ZZZA 1O3IA 4B76A 1V2KT 1T32A 3MMGA 5C1XA 3L3TA 3MYWA 2SGDE 1O2KA 1OYQA 3E90B 4UD9H 3KQEA 1F5LA 1ELCA 1C9PA 4ESTE 2BVRH 2NU1E 5A8XA 1EZQA 4A1XA 4K8BA 1O5AB 4CRAA 5BRRE 1TLDA 2BDCA 3UWJH 2FOEA 3VB3A 1NESE 1RIWC 2B8OH 1VR1H 1SLXB 1CBWC 1HXFH 2P3TB 2A7CA 1DX5M 3UWIA 2BMGB 3P8FA 4IW4E 1YCPH 1YBWA 1S81A 1UTNA 4B75A 1P2KA 1P09A 3S9CA 1SLUB 1G3BA 2ZHEH 5FCKA 1QBVH 3ZVGA 2WPMS 4FUFA 3I77A 1NRQH 3JZ2B 3A7TA 2J4IA 2CJIA 2Y81A 4GLYA 4Y7BA 1P2JA 3RXUA 2FS8A 1VITH 3GICB 2BDYA 1K1IA 3BG8A 1ZHRA 1HUTH 1O3KA 2W7SA 3OYPA 4Y8YA 3HGPA 3T27A 1Y59T 4GAWA 2ILNA 2HNTF 2PWXA 3RXKA 2J94A 1TRMA 3SNAA 5H4IB 1ZSKA 2XXLA 4YLUA 4AFSA 2V6NA 2ZDVH 2OBQA 1TA6A 4FVBA 1Z8IB 3LGYA 4CRCA 4NA9H 1TGBA 1K1MA 5DP8A 2PSXA 3U69H 2OUAA 3PMBB 1GI4A 2ODYB 3AW1A 2AS9A 2NU4E 2AEIH 1CE5A 1ARCA 2FLRH 2J38A 1LPGB 1GHBF 5CE1A 4AG2A 1AD8H 3SU2A 1LVYA 2HGTH 1K1JA 3WY8A 1UTMA 3HGNA 1ZPBA 4XBBA 4DJZB 4HFPB 4UFEH 4CH8B 1XXFA 1TOMH 2A5IA 1AZ8A 2NU3E 1UTKA 3MOCA 3RMMH 1Y5AT 3EQ0H 2R0LA 2UWLA 4X1NU 1Y5UT 2BD2A 4BTUB 2AMPA 1T8OA 2J2UA 1LPKB 1CGJE 2GMTB 3LH1A 3ODFA 1AHTH 1SB1H 2Z94A 5FPYA 3RXHA 3UPEA 3R0FA 1UK4A 4AGJA 1MU8B 1K1OA 1WQSA 1C1TA 2VGCC 3MO9A 1C1SA 2AGEX 3MHWU 4X1QU 2WYJA 3SORA 5C2ZA 2CN0H 1MTSA 1K28D 4OS5A 3RXDA 5AHGH 2W3KA 3BG4C 3RUOA 3DT0H 4XDEA 1MU6B 2BD4A 3A87A 2ZHQH 4BAMB 4SGAE 1BUIA 1SGEE 6GCHG 1FUJA 1EOLA 3HKJB 2XCFA 2ZG0H 1NFXA 1OX1A 4Y76A 4UEHH 1GG6B 5GJ4B 3RXLA 3U8OH 1QRXA 4JMYA 1ZRKA 1E34B 3ZVDA 2ZCLP 1G37A 3PMHB 2WPKS 4TPIZ 1SMFE 4CBOA 1XX9A 4JZ1A 3MNBA 1HJ8A 1V6DA 4DIHH 2A5AA 1ZTKA 4ZHAA 3AAUA 4GCHF 3TH4H 2HNTC 3BTHE 2EC9H 1JRSA 1W3CA 1DUAA 3QZRA 5ABWA 1EP5A 4FUEA 2EI8A 3TVJB 1M9UA 1GL1A 1SGCA 3E91A 2Y82A 4RKOB 2FLBH 3ATKA 3ZVBA 3S9AA 1D6RA 2Z3EA 3VB6A 4OS6A 5GWZA 2OC1A 1UVUH 2ANKH 4JYVH 1O2PA 2VIOA 4THNH 1W14U 2Y5FA 3SN8A 1AO5A 4ISIH 2WPJS 3K9XB 1TAWA 1FPCH 1XMNB 2AYWA 1E37B 1HCGA 1V2NT 3T2NA 3PV4A 4Y8ZA 2A5KA 1EAUA 1GBKA 4ZKOU 2VWMA 1BTYA 5TCCA 1W13U 2ZQ2A 1V2ST 2A7JA 2AMQA 4H42U 4YOGA 4KP0A 2Z7FE 1C2KA 2A4QA 1YPGH 1SPJA 3OX7U 2GCTB 1P2NA 3LC5A 1NRNH 2PSYA 1WU1A 2XBYA 1IAUA 2BY5X 2DE8A 2VH0A 5F03A 1SHHB 2H9TH 1S85A 1N8OB 1BTWA 1OXGA 2P93A 3OSYA 3SUFA 2LPRA 4MDSA 4VGCB 2WPLS 1TMUH 1GBLA 3RXBA 1GBCA 1SGNE 1BTHH 4DURA 1JOUB 3NWUA 3L33A 4Q2KA 2Z9IA 3SZNA 4AN7A 5T3HA 1TBRH 5L30H 2F9VA 4NCYA 1DLKB 4Y11E 2ZFSA 1EPTA 3PO1C 3ZZDA 2VH6A 1Y3XA 5EW1H 4O97A 2SGFE 4X8SH 1GJ4H 1GCTB 1TPAE 2HNTE 2ZKSA 5AFYH 1V2VT 2JETC 1A61H 2GVFA 1KXDA 1UCYE 2J9NA 1ARBA 1VCPA 2BX4A 2ZFRH 3UQOA 1VZQH 4IC5A 4YT7H 5JYIA 1W10U 1V2JT 1GBDA 1YYY1 2WV4A 2AH4X 1YCPM 1UJ1A 2FYQA 4ZKSU 4O3UA 3RP2A 4B2AA 3P8NA 2HLCA 1B5GH 4X0WU 1A46H 1Y8TA 1ETRH 1KXAA 3HKIB 4BAKB 3KQDA 1FDPA 3S7HB 3Q00A 1GBAA 2OD3B 1ESTA 8GCHF 3BSQA 4DGJA 1QR3E 5A0AE 2GGVB 3E6PH 2ZI2H 1O3BA 2FOAA 1KXBA 1GBIA 1S0RA 3D49H 5DGJA 1SQTA 2G8TA 1XVOA 5DPAA 1HIAB 4Z6AH 1SGPE 1BRCE 2XNIA 2NWNA 1ZGIA 1L1GA 1TPOA 2I6SA 2A45B 3PB1E 6CHAB 4NWLA 1KSNA 1AUJA 3GYMA 5FBEA 2Y5HA 3E0NB 4I8HA 5C20A 4TWWA 3SU1A 1O2WA 1BRBE 1L2EA 4GUXA 4TYDA 3ZZAA 2FM2A 2WYGA 1O3DA 4YM9A 3QLPH 1EZSC 1KTTB 2J95A 5T6GA 1YPKH 1C5YB 1L1JA 1C5RA 1H9HE 3A8BA 1ELEE 4GPGA 3P70B 5J4QA 3KF2A 5DO4H 3DFLA 2CF9H 1S84A 1H8IH 1UCYK 3FVFB 2VIDA 3RDZA 2AGGX 1AZZA 1IQLA 1O38A 1WUNH 4E7NA 2BLQA 4OGYA 5EQSA 1TNHA 1FXYA 3AASA 4AFUA 2NU2E 1A7SA 2R3UA 1EAIA 2C8YB 2BOHB 5EOKA 3DA9B 1LPZB 1E36B 3VGCB 3MNSA 1EJNA 1QBOA 1SGYE 4KELA 1NFWA 4X8TH 3HATH 3RXIA 1OYTH 1QL9A 1AY6H 3LJJA 3BEIB 1E35B 2PKAA 3V12A 2FOGA 2GCHF 5J4SA 4HI3A 1QL7A 2BTCE 1MD8A 4UFDH 1EUFA 2ZNKH 2TGDA 5A0CA 2GP9B 2WPHS 3PMJA 1NFUA 4MNYA 2QV1A 1ZPCA 1P3CA 3B8JA 3P17H 1PQ8A 2QN5T 4RKJB 2QF0A 1S6FA 1C5OH 1AIXH 1GI2A 5C67A 1ZSJA 3LJOA 2CGAA 5DP4A 3MTYA 1PPCE 2ASUB 1GCDA 3BTDE 1P06A 1HNEE 1EJAA 1W11U 3KN2A 2Y7ZA 3SU5A 1UK3A 1SGTA 1FMGA 2GV7A 4K2YA 1YPHC 4E05H 1XXDA 2ZU1A 3E3TA 1P02A 4I8KA 1AE8H 1MMJN 4LOYH 1K1PA 1DT2A 3SI4H 1BRAA 3RXVA 3UUZA 5DP6A 1N6YA 5CHAC 2BD8A 3N7OA 1ANEA 1MQ5A 3MWIU 5EU8A 1F5RA 2Y5GA 3ZVFA 2FI3E 2STBE 1KDQB 2CHAC 4JZEH 1FPHH 2G52A 4X2WA 2BY8X 1Z7KA 1PPZA 2Q6GA 2TGAA 2FYRA 3GY7A 3RXPA 1AI8H 3CS0A 3JZ1B 1W0YH 3TH3H 4E06H 1BBRH 1KLTA 1SL3A 1L1NA 4CHAC 1C5LH 1MZAA 1P2IA 5JBBS 1F0SA 1O3FA 3D62A 3GY5A 1J17T 3F6UH 3U1JB 2BQ7B 1AVWA 3A88A 2FWWA 1PYTD 3STIA 1BMAA 2HWLB 3U8TH 4ASHA 4NZQA 1UTLM 1W12U 4AYYB 2R9PA 3SJOA 3C1KA 5ETXA 2C93B 4ZAEA 3RM0H 7ESTE 1SG8B 1NS3A 1O36A 1T8NA 3RXFA 3ZVEA 1ELBA 2ZIQH 4H6TA 3BTTE 1WAYB 1KY9A 2HALA 1IQIA 1CU1A 3SJIA 1RFNA 3EE0B 1TRNA 1GJDB 4FUIA 4RSPA 2PGBB 3CP7A 5JBTA 2P59A 3A83A 1YPHE 1BMLA 4I33A 3MFJA 5C3NA 1AFQC 4O9VA 4A92A 2VIVA 4K60A 5EQRA 3E0PB 2G5VA 2ZGJA 1UVTH 4Y6DA 3NCLA 2UUYA 1AWFH 1YPMH 2KAIA 1JWTA 1P2MA 2FODA 2HPQH 2FOMB 3ATLA 1SGRE 4ABEA 3BIUH 3PLKA 3M3TA 1DWBH 1BMNH 4ISOA 1AE5A 1ZYOA 3RXOA 1GMDF 3PWCA 2XRCA 1GJ6A 4J1YA 9ESTA 1AB9B 2CXVA 1VITF 1ZSLA 3L6PA 4E7RG 2G51A 2FEQH 4Z0KA 1LHFH 1MBQA 5E2OA 1NZQH 3M3SA 5GIBA 5HGGA 2V0BA 1TYNA 3GCOA 3MU8A 3IWMA 3ZZ9A 5E0HA 3CENA 4JK5A 4Q7ZA 1O32A 1HJAC 2BZAA 1C1PA 3GOVB 3P6ZB 1RRKA 2VB0A 2IPHA 3VXEH 1RS0A 3URCA 3QZQA 5C1UA 3TGIE 2VWNA 1D3QB 1HAXB 3RXSA 3TJUA 5L2ZH 1UVSH 1A3EH 1FN6A 3PM3A 3VB7A 4IBLH 2ZZUH 2K1QA 2R2WU 1YC0A 4A7IB 4LZ4B 3IITA 1TIOA 1GI5A 4X8UH 1YKTA 3SOSA
chains in the Genus database with same CATH superfamily
1C2LA 1LVOA 1OWEA 4F49A 2Z9KA 4MNXA 1UHBA 2GKVE 1GGDC 1MQ6A 1OPHB 2V3MA 4QT8C 1EASA 5EODA 2YMSC 1ANCA 2ULLA 1MKXK 4UFFH 2W5EA 2PKSC 1WYKA 2AGIX 2ZGHA 2BX3A 3RXEA 3SHAH 3T62A 2CK3D 2AFQB 4XFQA 1V2UT 4BTTB 4I8GA 1ZGVA 1QJ7B 1RGQA 4XE4A 5E2PA 1C2MA 2FOFA 1K21H 1PFXC 1QB6A 3RLYH 3BIVH 1A0HB 1IHSH 1HAPH 1TNJA 3O8CA 1EAWA 5HMAA 4ZHMU 1J8AA 1C2EA 1XKBC 1T7CA 4TY6A 4O03A 3PRDA 1XUIA 1QRZA 4B6FA 5JBCS 1A5GH 2EI7A 3T25A 3STJA 4OS2A 2QIQA 5LH8A 3A86A 1K22H 5DP7A 3FP7E 1A2CH 1ZMLA 3F2HA 4A6LA 4Y8XA 4X6OA 5F8TA 1F7ZA 2BDBA 1RIWB 1LCYA 3KHVA 1J15A 3TK9A 1FY1A 3PWBA 1CBWB 1SGIB 3LGWA 1PPFE 2RG3A 4HTCH 2QF3A 4UFGH 5JB8S 4ZH8A 4ASUD 3RXQA 1D3TB 3GCHC 2B7DH 1TQ0B 3QUMP 2OBOA 4BAHB 1QNJA 5C5OA 1RJXB 1SGDE 1P12E 2STAE 2ZWLH 1JIMA 3LONA 3ZVCA 1GMCF 3ZZBA 3A8AA 1PPEE 3PMAB 2PP6A 2BDAA 5DP9A 1NU9A 1DSTA 2BLWA 1DXPA 1GBMA 4BXWA 2RDLA 2LNCA 3MH5A 5B6LA 2XC5A 2RCEA 5I25A 3RXJA 3M5LA 2FP7B 5HM9A 1QGFA 5JB9S 2OTVA 1IQHA 1HAGE 2R3YA 1YPJH 4Q7XA 1WV7H 1G2LA 1CHOF 2G4UA 5HM2A 4JYTA 3CS7A 2BQ6B 5HYOA 1Y5BT 3QGJA 1FAXA 1A3BH 3ATMA 1TNLA 4X2YA 4YZUA 3TJVA 1ELDE 1FAKH 7GCHF 2ODPA 2ZU4A 1GJ8B 1W8BH 3ZZ5A 1INCA 4IMZA 1BTUA 1WTGH 1W7XH 3GCTF 4FVDA 4A1VA 1ZHPA 2ZFQH 1ABJH 1RTKA 3S69A 3ZZ3A 4FU8A 4YESB 1F0UA 1ZJDA 3RC4A 1O2QA 1WBGB 1TX8A 2XCNA 3I29A 4I8JA 4JYUH 3KIDU 3ENSB 3VG8A 1TA2A 4INHA 4B73A 4WJG2 1Z1IA 1GBTA 5LPRA 1EXFA 1HRTH 3EA8A 3MU1A 4I32A 1C2FA 2AHME 2JIZD 1GDNA 1CHGA 5SGAE 4X2XA 3ATWA 4WF8A 4WMEA 4Y0YE 1FONA 3Q3KA 5GXPA 2XW9A 3TK6A 1DM4B 1GBFA 5DP3A 4YO9A 4CRGA 4AZ2B 4CBNA 4IGDA 3RC5A 3QTVH 4ABHA 4X2VA 1SOZA 3ESTA 1C1QA 3RXAA 1TE0A 1NU7B 2ZFFH 4NIVA 1W2KH 2BHGA 4FXGH 1ZRBA 3ELAH 3BG4B 3A7ZA 2WINI 4I31A 3FANA 4D9QA 3A81A 1WOFA 3P92A 1WTHD 3RC6A 1T4VH 5EJ1A 1GG6C 1QJ6B 1HLTH 2WZQA 1ZMJA 1ZTJA 3A80A 3RXMA 3ZZCA 1GBEA 1SGFG 1GJCB 2P95A 1TWXB 3RMLH 3V3MA 5EGMA 1S0QA 1G3DA 1GMHG 3LIWA 1MKWK 4RT1A 2A31A 4D9RA 2ZDLA 3RXRA 1GI9B 1NTPA 1O2YA 4MNWA 4X6MA 1Q2WA 1MCVA 4D7FA 1Z71A 1BHXB 2GX4A 2XWAA 1O0DH 3PV2A 1GJBB 2SGAA 2ZEBA 3SNDA 4AYVB 2L6OA 3CNRA 5GDSH 4BAOB 3BTFE 1PYTC 1FJSA 3R3GB 3QGNB 3RXTA 2A4OA 5GCHG 1AWHB 2FXRA 4Y0ZE 4ABAA 3O8BA 2DUCA 8KME2 1NN6A 1K0HA 1UVOA 2BY6X 1EPTC 3VB5A 2TGTA 3OE7D 1UTJA 1H9IE 3EAJA 4NA8A 4BOHA 4A1TA 2GCTC 3C27B 3LGVA 2Z6BD 2YNBA 4B74A 4FU7A 1HXEH 1LHGH 1BJUA 3A8DA 1XKAC 1S6HA 1O3JA 3OEED 2GZ8A 1HYLA 3F9GA 3EDXB 3DD2H 3FZZA 2P3UB 3OTJE 1O3OA 1TGNA 4FUDA 1HDTH 2F9UA 1THSH 4RN6A 3BV9B 1GI7B 1VJAU 1C5NH 2GV6A 4MPVA 1OWKA 1BTZA 1LVMA 4Y79A 2AIQA 2ZO3H 2J97A 1Q31A 2VWOA 2CF8H 4K1SA 3SV7A 1G9IE 2VU8E 4HGCA 3TJNA 3TGJE 1C5XB 4MQAA 1A0JA 3KGPA 4MNVA 1GCTC 3SJKA 3UQVA 4OS1A 5TCAA 2KCYA 1KIGH 1TALA 3RXCA 3IG6B 3UOUA 3SW2B 3W1EA 3UOPA 2PUXB 1V2QT 3PYHA 5A09A 1V2LT 1NT1A 3BEFB 1VKYA 3MI4A 1E79D 1G3CA 3SHCH 1FZZA 4WMFA 2O9QA 4TWYA 4BTIB 1ELGA 5L6NH 3MO6A 5LGOA 2ZDKA 1P05A 3W95A 3E1XB 1GJ9B 1BT7A 4AX9H 1GHAG 1OKXA 3VXFH 4INKA 4Y71A 2PW8H 1VJ9U 1FLEE 2QYIA 1HPGA 2BB4A 1LQEA 1MUEB 2ZHWH 1SGQE 3F68H 1O3EA 1G30B 2BXUH 2C8WB 3SZEA 1YLNA 2D8WA 1A5HA 2Z3DA 2A0QB 1MCTA 6CHAC 1TX7A 4ZMAH 1O2SA 1C2HA 1MTNC 1JBUH 3VFEA 4FUHA 4P02A 3RXGA 5JPMH 5AFZH 1TNIA 3TJOA 1FY3A 1A4WH 4NSVA 1G2MA 5C94A 2OQUA 5PTPA 3M7UA 4ABBA 2BVSH 3T28A 5K0HA 1IQKA 4CH2B 1SQAA 1C1VH 6GCHF 2KZ4A 3LDXH 1HIAA 4D7GA 4DIIH 2F9NA 4XD7D 5F8XA 1GHYH 1DWEH 3E8LA 2TIOA 1VGCC 3Q3XA 1DS2E 4K5ZA 4AFQA 3F9FA 3SJ9A 2VIQA 3VGCC 1SVPA 2JH5D 4ZHLU 4ZXYH 2ANWA 1HAVB 2WPIS 2M5TA 2W3IA 4D8NA 1O3LA 1XUGA 1Z6EA 5C17A 2Q1JA 1Z6JH 1O33A 1TBQH 3A89A 2LELA 1MTWA 1NRSH 2ZHDA 1KXFA 3A7YA 3PRBA 3UIRA 3FP8E 5FCRA 2A4GA 1HAZB 4BXSA 2R2MB 1NY22 4KKDA 2W26A 2YNAA 3F2GA 1HAYB 3OY6U 3TIUA 1EQ9A 2ZCHP 4Q7YA 2TRMA 4Q80A 1C1NA 4ABIA 1BB0B 1SI5H 1YGCH 2GZ7A 1RXPA 1LTOA 1COWD 3K65B 3D23A 2FX6A 2BLOA 1CT4E 3NPSA 1C5QA 5AF9H 3DFJA 4MPWA 3Q76A 3DCLA 3M37A 4ISNA 4JZIA 1CGIE 5TJXA 4YXWD 1P57B 1GVZA 3RMNH 1BTXA 4JZDH 1W0ZU 2PFEA 1VCWA 2VBCA 2P8OC 3TGKE 2UUFB 1UTQA 1JRTA 3KQ5A 2OLGA 2VJ1A 4UDWH 1DOJA 1GI0A 3AAVA 1TOCB 2A1DB 2P3FH 1RTLA 1XUKA 1QJ1B 1B0FA 2FZZA 3F9HA 4R8TB 4TPYA 1QTFA 1BMFD 1J16A 1O2LA 5CHAB 1E38B 1LHDH 2ZDNA 2A2QH 1ETTH 1O30A 4XOJA 3V7TA 2GD4B 1O2GH 1FI8A 3QO6A 4YOJA 2CHAB 2O8UA 2FOCA 2XYAA 2ZP0H 3MNCA 1JMOH 1ID5H 2ZTZA 3A84A 1MKXH 2ZDAH 4TSFD 2VVUA 1HBTH 1YLDA 4DW2U 2QXGA 5T1VA 2BD7A 3UNRA 2B9LA 1AU8A 1KDQA 1L4DA 1MH0A 4YLQH 5CDFE 2GJGA 5EPYA 1O34A 1GI3A 4H6SB 1AVGH 3ITIA 2B0FA 3SNEA 3WWBA 2OC8A 2BM2A 2C90B 1O2IA 1C1OA 3BTWE 1FIWA 2OQ5A 5L2YH 5EW2H 1TNKA 5DSFA 1GJAB 3SUEA 3BTGE 2Y6TA 1GHVH 3Q77A 4NIXA 2ZPRA 1QURH 1SBWA 1DANH 1NO9H 1AKSA 1LHEH 1PQ5A 4WXIA 2VIPA 4RT0A 2VVCA 3NUMA 3SV9A 1SHYA 2F3CE 2XWBI 1SQOA 2JJ1D 3GDUA 2SGPE 1ABIH 4ZROA 3SQHE 1S6LA 2ZPSA 1GHBG 1LKBA 3ODDA 2QF4A 1HV7A 2G55A 1SGFA 1DDJA 4PROA 4ZKRU 2ZTXA 2QXJA 3M5NA 1BBRE 1CVWH 1PPGE 2ZGCA 1QRWA 2ODQA 2GZ9A 5HKKD 4B1TA 1SQRA 1AB9C 1O5EH 1OOKB 1UTPA 4INLA 1O5FH 4JK6A 3A7XA 1ELAA 3PTNA 2ALPA 2W7UA 2QA9E 3QX5H 2QXIA 1ESBA 1O2HA 3GYLB 1YF4A 4YT6H 1YM0A 2FTMA 1IQGA 1O2NA 2WV9A 5FHTA 2ZECA 1AN1E 4TY7A 1CA0C 2ALVA 2IJD1 3W94A 4IMQA 3BEUA 2KM0A 1V2OT 5KECA 4GVUA 2BD3A 1BJVA 3BTME 3D65E 7LPRA 2J98B 2BXTH 1HJAB 2ZU3A 1OS8A 3K6YA 2PHBA 2ZCKP 1G36A 1YLCA 1DXWA 2KX4A 1ESAA 1J14A 2XBXA 1O39A 3FKSD 3ZZ6A 2PTCE 3DSOA 4MVNA 1O2XA 1CT0E 1XVMA 1NPMA 2ZU2A 3MO3A 3SGBE 1ZTLA 1FX0B 3DUXH 3SQEE 5FXLA 5G4BA 3FO8D 1ETSH 1EZXC 2A4RA 4NSYA 1FV9A 3H7OA 4M7GA 4X8VH 3T5FH 4AB9A 3HPTB 2BLVA 1CO7E 3FP6E 4WH6A 1C5UA 5EXMA 1K2I1 2PKSB 4YOIA 1P9UA 3M3VA 3SU4A 4J2YB 4GCHG 4NWKA 3K6ZA 3KNXA 3SGAE 3MNXA 2KCAA 4XSKU 3TLOA 2FI4E 5FPSA 3SV2H 1Z1JA 3SU6A 1O35A 1OSSA 2I6QA 3GY2A 4NA7A 3U1IB 3ZZ7A 3VPKA 1PJPA 4B6EA 2Y80A 2Q6FA 3RU4D 2PTNA 2P94A 2Z9LA 5LPEA 2UUKB 4P00A 5IYTA 3SGQE 1GPZA 4OGXA 1C2JA 3SUDA 4FUCA 4YTAA 1TFXA 3H5CB 5FAHA 3SBKA 2PR3A 3F1SB 4K3JA 1FIZA 2GDDA 1SLVB 3I78A 2BY9X 1SOTA 1IQJA 2PUQH 1ORFA 3S9BA 2OC7A 4FOUC 1EKBB 2G00A 1TGTA 1MKWH 3PV5A 1BQYA 5E8EH 2H2ZA 3KL6A 4XBDA 3GY4A 3LPRA 1Y3VA 4IN1A 3GCHB 4JCNA 1H9LB 4CRBA 5FX5A 1OWIA 1BIOA 1LQDB 4ABGA 3P95A 2PV9B 3TNTA 1F92A 5EPNA 1HFDA 2XTTB 4D76A 1Z8JB 1QFKH 2BOKA 1O37A 4ABDA 7KMEH 2HOBA 5T6FA 1TGCA 1AUTC 2BYAX 2FIRH 3RMOH 1QQ4A 4DOQA 1J9CH 2ANYA 1RTFB 2RDEA 2TGPZ 1BCUH 1BHXF 1SFIA 5EIYA 1F2SE 4LK4A 3M5OA 4B2BA 3N7EA 3T29A 3NXPA 1OP0A 1EP6A 3OFND 1TPPA 4ABJA 3OY5U 4DVAU 3ZV9A 3DSGA 4IS5A 5IDKA 4HG6A 3BN9A 1DVAH 2AIPA 1DWCH 1EAXA 1YP9A 3BF6H 1P8VC 2V3HH 1THPB 1V3XA 3GY6A 3MU0A 1O2VA 2YOLA 1H1BA 3TK5A 2AERH 3GDSA 4NGAH 1FY8E 2ZC9H 5AVDA 5ESBA 4ZCNA 5EXNA 3UTUH 8GCHG 1O31A 2V7QD 3LC3A 3BTQE 1C5VA 4AFZA 5CMXH 1GI6A 4XRNA 4CRFA 1C1UH 1MZDA 1OWJA 2GMTC 3V13A 1TABE 1V2RT 1B0EA 3SNCA 1BOQA 2JKHA 3BTKE 3LU9B 5DKMA 1XUHA 3NZIA 1LO6A 3FAOA 5GPIB 3KQCA 4DT7B 5FPTA 8ESTE 1EX3A 2BY7X 1KTSB 1P3EA 4MPUA 2VGCB 4MG3A 4WH8A 3SNBA 3F2FA 2FOBA 4ZKNU 3BTEE 1OP8A 5I46H 1W0KD 3LOXA 3M61U 2OCVB 1IHTH 1S5SA 1SSXA 4K1TA 4U2WA 1O5BB 3EA9A 1O3CA 2A32A 1P04A 2EY4C 1GHWH 2Q6DA 1C1WH 4NG9H 3O8RA 2VVVA 5C1YA 3FOAA 1PPBH 4SGBE 4X6PA 1MTVA 1QY6A 1TNGA 3ZZ4A 5F53A 5FBIA 3RLWH 1F0TA 2FMJA 3A7WA 4ZXXH 1YCPK 5A2MH 5A0BA 3SI3H 3KEEA 2WUBA 2OC0A 2XNDD 1C1MA 3N7DA 1U6QA 2BDIA 5DP5A 1QA7A 2OP9A 1C5MD 1ZR0A 3QDZB 1SC8U 3MU5A 1T8MA 2H6MA 4FUGA 1GJ5H 1NRPH 1N1LA 2C4FH 1NC6A 2GCHG 3SUGA 1EB1H 1PPHE 3KYGA 1ANBA 2J34A 4WY3A 5EXLA 3UNQA 3LGUA 1O5DH 2ZQ1A 5K7RA 4U01A 1ZJKA 2TBSA 4Y7AA 1HAIH 1PQAA 3H7TA 1L0ZA 1UCYH 2IJOB 1O3GA 1ZLRA 3AW0A 1ZMNA 4MTBA 1UO6A 5DK1A 1O3HA 2EQNA 1QBNA 1HAOH 2F9BH 4WMDA 1P03A 2RA3A 3E16B 2OXSA 4FU9A 4A5TS 1O3AA 3U98H 2FTLE 1C1RA 2KCOA 4U32A 1NRRH 1B7XB 3MH4A 1QL8A 1HB0B 1CQQA 1T31A 1FY4A 1EPTB 4JZFH 3GY8A 1N8OC 1DE7H 4I8LA 3PROA 5BPEA 3LGTA 3TITA 1C4U2 2IOTA 2C8ZB 1DFPA 1IQFA 2BD5A 4VGCC 2GT7A 2SGQE 1P0SH 2ZU5A 1TMTH 4OS4A 3B9FH 2FS9A 2F9OA 5C5NA 2BZ6H 4KTSA 1MBMA 1AQ7A 1YPEH 1DSUA 1V2PT 1DY8A 3T26A 3A8CA 4HZHA 4R0IA 4DG4A 2BDHA 3TNSA 1QA0A 1GBHA 2A2XH 2D26C 4CREA 5A8ZA 2D2DA 1AFEH 1EATA 5HXFA 1KLIH 3ZVAA 3SV8A 2UWPA 1Z8RA 4ISHH 2F91A 4IN2A 3PO1B 2FPZA 1HAHH 1P01A 3S0NA 1KXEA 1E1RD 1KXCA 1QB9A 4LZ1H 4AORA 1P2OA 1S83A 2IPQX 2LP6A 1HGTH 1JIRA 1DPOA 3S7KB 4DY7B 5DJ7A 2O8LA 1V2WT 3F0PA 2JETB 1TB6H 2D1JA 2WPDD 4LXBH 2WUCA 2JH0D 1WCZA 1RD3B 2H9HA 3QTOH 1FY5A 3EGKH 6LPRA 2FDAA 4KTCA 3ATIA 1BRUP 3EYDA 1QB1A 1Y3WA 1EZUC 1NM6A 4ISLA 3PTBA 3QK1A 4X6NA 2F43B 4BAQB 3TU7H 1G32B 3GISB 4WWYA 3M7TA 3NKKA 5E0GA 1IQEA 1D3PB 1W7GH 2G81E 2QGRA 3ZYDA 2GDEH 1AVXA 1T8LA 2XBVA 1SR5C 1WQVH 1D3DB 1OWDA 2O8WA 1YPLH 1NBMD 5FX6A 1DUEA 4WVPE 3UR6A 5ESTE 1D4PB 4NZLA 4Y10E 1O5GH 2QC2A 1YY3A 1O2JA 2F9PA 3OAAD 2VIWA 3B23B 2H1UA 2ZHFH 3A82A 4MPXA 1MAXA 2AMDA 1DWDH 1FN8A 1LHCH 1C4Y2 1C2DA 2BQWB 4GHQA 1UMAH 4B2CA 1O3MA 4BANB 1MTNB 1GVKB 1MTUA 4UE7H 1GMDG 1ACBE 5LPFA 1K1LA 4IC6A 4X1SU 2PKAB 2XC4A 2K8IA 4AC9A 2UWOA 3M5MA 1D9IA 1VITG 5CHBA 4BNRA 4DCDA 2H5DA 1C5ZB 2FO9A 1UTOA 1A0LA 3EA7A 1QCPA 1G3EA 3RM2H 1C5SA 1V2MT 2XC0A 2ZFTA 1N6XA 1ANDA 2Z3CA 4NFEA 1TMBH 3SYJA 3AK5A 4Q4LA 1C5PA 1GBJA 4OM9A 2O8MA 1BA8B 1BZXE 1VGCB 2F83A 1IQMA 3GDVA 1GMHF 2L74A 3G01A 4O3TA 2FI5E 1P9SA 1SKYE 1BTPA 1AMHA 3KQBA 1VCQA 4CR5A 1FQ3A 4NFFA 3A7VA 1GDUA 4OS7A 1TGSZ 3LT3A 1QQUA 2ZDMA 2BD9A 1A5IA 1LMWB 4Z1MD 1XUJA 1C2IA 1GWAA 1EJMA 2ANMH 2A7HA 3VB4A 3SU3A 2J92A 2QAAA 1HAVA 1A1RA 2ZPQA 4GSOA 1GBBA 3H09A 3M7QA 2FOHA 2ZFPH 3URDA 2IN2A 2VWLA 5GCHF 3UFAA 2ZF0H 1DITH 3M35A 1WDIA 2PGQB 1P10A 1P11E 4UONA 1EB2A 4KGAA 2VINA 1C5WB 3KCGH 9LPRA 4AGKA 2SNWA 4GHTA 2ZA5A 3TH2H 2RA0A 1ELVA 4AB8A 2EEKA 3P8OA 3U8RH 2H5CA 2ESTE 4KTUA 1DICA 1F0RA 1GI8B 1NROH 2P8OB 2WV5A 1Z8GA 2V3OH 2Z9JA 1P2QA 3MH6A 4X1RU 6ESTA 2EI6A 2CV3A 3ZYEA 4X1PU 1D6WA 1O3NA 2NU0E 1O2ZA 4K8YA 1GVLA 4U30A 1LDTT 2H9EH 3M36A 2CMYA 5DG6A 3UREA 4XBCA 5HIZA 3RU4E 3ZZ8A 3TPIZ 3SJ8A 5F6MA 1EOJA 1H4WA 1TRYA 1O2MA 1MAYA 2B5TB 2BDGA 4CHAB 3P8GA 4MLFB 1XUFA 3K2UA 4F4OC 2SGEE 4I86A 5IK2D 1OWHA 2FESH 3MQKC 4K1EA 5KEDA 3A85A 3DHKH 1XM1A 1GJ7B 1BDAA 1ELTA 1Y3UA 3DSPA 1Y3YA 2QXHA 1GMCG 3GY3A 3ZV8A 1AKSB 2ZTYA 2HRVA 4H4FA 2ZGXH 4DT4A 1KLJH 2WSSD 3HK3B 4I7YH 2V35A 1CSOE 1H8DH 2EA3A 3FN8A 3VEQB 3GS9A 2P16A 1ZHMA 5E0JA 5EG4A 2O8TA 1O2OA 2KAIB 1O2RA 1V2TT 2JH6D 2XBWA 3UY9A 3SV6A 8LPRA 3SU0A 3AVZA 5B6OA 1CHOG 3U9AH 1GHAF 3V0XA 1IOEA 1E0FD 1K1NA 1WSSH 3Q3YA 1ZPZA 1TQ7B 2G5NA 3MH7A 1AFQB 2Y7XA 1TONA 2R0KA 2FX4A 1X7AC 4FUBA 5JDUB 7GCHG 1NFYA 1BITA 1MD7A 3O8DA 4F55A 1O5CB 1Q3XA 4ZUHA 4NIYA 3PLBA 3HK6B 1T4UH 3F9EA 2QY0B 3LKWA 2ZGBH 2HPPH 3GCTG 3LH3A 1KYNA 1CA8B 1H8HD 1O2UA 2VNTA 1THRH 1SLWB 4ABFA 1TPSA 1GHXH 1GI1A 3QN7A 1GHZA 1GDQA 1GL0E 2GT8A 4B71A 4WXVA 4NIWA 3UB0A 3LGIA 3QWCH 2GTBA 1O2TA 1OP2A 1L4ZA 1TBZH 2HVXA 2QCYA 1LVBA 5T6DA 1AGJA 2Z9GA 5A8YA 1PQ7A 1CGHA 1C4V2 5EQQA 1UHBB 4FUJA 2OINA 3NK8A 1C9TA 1TX6A 4K69A 3RU4T 4AOQA 1C5TA 1UK2A 1UVPA 2C8XB 4CR9A 4AG1A 2JJ2D 3MU4A 4RI0A 1DY9A 1JXPA 1BMMH 2SNVA 1CA0B 1QHRB 1LKAA 2G4TA 3U28C 3EE7A 2DE9A 2KR7A 1O3PB 1SFQB 2PLXA 1K9OE 4CRDA 1IQNA 3OU0A 1C2GA 2C3SA 4ACBA 1DLEA 1CT2E 3FZDA 1ELFA 2UUJB 1F5KU 1GGDB 1BBRK 2TPIZ 3UNSA 3SO3A 1ZOMA 2SFAA 2YMSB 3GCNA 3FFGA 1S82A 5F8ZA 1FNIA 4F48B 1HJ9A 5JBAS 2THFB 1QIXB 2WHXA 3PLPA 2J98A 2BVXH 3UR9A 5DN6D 1H8ED 1ZZZA 1O3IA 4B76A 1V2KT 1T32A 3MMGA 5C1XA 3L3TA 3MYWA 2W6JD 2SGDE 1O2KA 1OYQA 3E90B 4UD9H 3KQEA 1F5LA 1ELCA 1C9PA 4ESTE 2BVRH 2NU1E 5A8XA 1EZQA 4A1XA 4K8BA 1O5AB 4CRAA 5BRRE 1TLDA 2BDCA 3UWJH 2FOEA 2KFWA 3VB3A 1NESE 1RIWC 2B8OH 1VR1H 1SLXB 1CBWC 1HXFH 2P3TB 2A7CA 1DX5M 3UWIA 3WW7A 2BMGB 3P8FA 4IW4E 1YCPH 1YBWA 1S81A 1UTNA 4B75A 1P2KA 1P09A 3S9CA 1SLUB 1G3BA 1MABB 2ZHEH 5FCKA 1QBVH 3ZVGA 2WPMS 3OTPA 4FUFA 3I77A 1NRQH 3UAIC 3JZ2B 2OK5A 3A7TA 2J4IA 2CJIA 2Y81A 4GLYA 4Y7BA 1P2JA 3RXUA 2FS8A 1VITH 3F3BA 3GICB 2BDYA 1K1IA 3BG8A 1ZHRA 1HUTH 1O3KA 2W7SA 3OYPA 4Y8YA 3HGPA 3T27A 1Y59T 3KYFA 4GAWA 2ILNA 2HNTF 2PWXA 3RXKA 2J94A 1TRMA 3SNAA 5H4IB 1ZSKA 4TT3D 2XXLA 4YLUA 4AFSA 2V6NA 2QF5A 2OBQA 2ZDVH 1TA6A 4FVBA 1Z8IB 3LGYA 4CRCA 4NA9H 1TGBA 1K1MA 5DP8A 2PSXA 3U69H 2OUAA 3WWFA 3PMBB 1GI4A 2ODYB 2XOKD 3AW1A 2AS9A 1W0JD 2NU4E 2AEIH 1CE5A 1ARCA 2FLRH 2J38A 1LPGB 1GHBF 5CE1A 4AG2A 1AD8H 3SU2A 1LVYA 4ACAA 2HGTH 1K1JA 3WY8A 1UTMA 3HGNA 1ZPBA 4XBBA 4DJZB 4HFPB 4UFEH 4CH8B 1XXFA 1TOMH 2A5IA 1AZ8A 2NU3E 1UTKA 3MOCA 3RMMH 1Y5AT 3EQ0H 2R0LA 2UWLA 4X1NU 1Y5UT 2BD2A 4BTUB 2AMPA 1T8OA 2J2UA 5GNDA 1LPKB 1CGJE 2GMTB 3LH1A 3ODFA 1AHTH 1SB1H 2Z94A 5FPYA 3RXHA 3UPEA 3R0FA 1UK4A 1NBME 4AGJA 1MU8B 1K1OA 1WQSA 1C1TA 2VGCC 3MO9A 1C1SA 2AGEX 3MHWU 4X1QU 2WYJA 3SORA 5C2ZA 2CN0H 1MTSA 1K28D 4OS5A 3RXDA 5AHGH 2W3KA 3BG4C 3RUOA 3DT0H 4XDEA 1MU6B 1EFRD 2BD4A 3A87A 2ZHQH 4BAMB 4SGAE 1BUIA 1SGEE 6GCHG 1FUJA 1EOLA 3HKJB 2XCFA 2ZG0H 1NFXA 1OX1A 4Y76A 4UEHH 1GG6B 5GJ4B 5EJLA 3RXLA 2RFKC 3U8OH 1QRXA 4JMYA 1ZRKA 2W6ID 1E34B 2HLDD 3ZVDA 2ZCLP 1G37A 3PMHB 2WPKS 4TPIZ 1SMFE 4CBOA 1XX9A 4JZ1A 3MNBA 1HJ8A 1V6DA 4DIHH 2A5AA 1ZTKA 4ZHAA 3AAUA 4GCHF 3TH4H 2HNTC 3BTHE 3N99A 2EC9H 1JRSA 1W3CA 1DUAA 3QZRA 5ABWA 1EP5A 4FUEA 2EI8A 3TVJB 1M9UA 1GL1A 1SGCA 3E91A 2Y82A 5C0UA 4RKOB 2FLBH 3ATKA 3ZVBA 3S9AA 1D6RA 2Z3EA 3VB6A 4OS6A 5GWZA 2OC1A 1UVUH 2ANKH 4JYVH 1O2PA 2VIOA 4THNH 1W14U 2Y5FA 3SN8A 1AO5A 4ISIH 2WPJS 3K9XB 5C0TA 1TAWA 1FPCH 1XMNB 2AYWA 1E37B 1HCGA 5KGOA 1V2NT 3T2NA 3PV4A 4Y8ZA 2A5KA 1EAUA 1GBKA 4ZKOU 2VWMA 1BTYA 5TCCA 1W13U 2ZQ2A 1V2ST 2A7JA 2AMQA 4H42U 4YOGA 4KP0A 2Z7FE 1C2KA 2A4QA 1YPGH 1SPJA 3OX7U 2GCTB 1P2NA 3LC5A 1NRNH 2PSYA 1WU1A 2XBYA 1IAUA 2BY5X 2DE8A 2VH0A 5F03A 2YMSD 1SHHB 2H9TH 1S85A 1N8OB 1BTWA 1OXGA 2P93A 3OSYA 3SUFA 2LPRA 4MDSA 4VGCB 2WPLS 1TMUH 1GBLA 3RXBA 1GBCA 1SGNE 1BTHH 2JDID 4DURA 1JOUB 3NWUA 3L33A 4Q2KA 2Z9IA 3SZNA 4AN7A 5T3HA 1TBRH 5L30H 2F9VA 4NCYA 1DLKB 4Y11E 2ZFSA 1EPTA 3PO1C 3ZZDA 2VH6A 1Y3XA 5EW1H 3OEHD 4O97A 2SGFE 4X8SH 1GJ4H 1GCTB 1TPAE 2HNTE 2ZKSA 5AFYH 1V2VT 2JETC 1A61H 2GVFA 1KXDA 1UCYE 2J9NA 1ARBA 1VCPA 2BX4A 2ZFRH 3UQOA 1VZQH 4FETA 4IC5A 5HIYA 4YT7H 5JYIA 1W10U 1V2JT 1GBDA 1YYY1 2WV4A 2AH4X 1YCPM 1UJ1A 2FYQA 4ZKSU 4O3UA 3RP2A 4B2AA 3P8NA 2HLCA 1B5GH 4X0WU 1A46H 1Y8TA 1ETRH 1KXAA 3HKIB 4BAKB 3KQDA 1FDPA 3S7HB 3Q00A 1GBAA 2OD3B 1ESTA 8GCHF 3BSQA 4DGJA 1QR3E 5A0AE 2GGVB 2QE7D 3E6PH 2KCPA 2ZI2H 1O3BA 2FOAA 1KXBA 1GBIA 1S0RA 3D49H 5DGJA 1SQTA 2G8TA 1XVOA 5DPAA 1HIAB 4Z6AH 1SGPE 1BRCE 2XNIA 2NWNA 1ZGIA 1L1GA 1TPOA 2I6SA 2A45B 3PB1E 6CHAB 4NWLA 1KSNA 1AUJA 3GYMA 5FBEA 2Y5HA 3E0NB 4I8HA 5C20A 2HVYB 4TWWA 3SU1A 1O2WA 1BRBE 1L2EA 4GUXA 4TYDA 3ZZAA 2FM2A 2WYGA 1O3DA 4YM9A 3QLPH 1EZSC 1KTTB 2J95A 5T6GA 1YPKH 1C5YB 1L1JA 1C5RA 1H9HE 3A8BA 1ELEE 4GPGA 3P70B 5J4QA 3KF2A 5DO4H 3DFLA 2CF9H 1S84A 1H8IH 1UCYK 3FVFB 2VIDA 3RDZA 2AGGX 1AZZA 1IQLA 1O38A 1WUNH 4E7NA 2BLQA 4OGYA 5EQSA 1TNHA 1FXYA 3AASA 4AFUA 2NU2E 1A7SA 2R3UA 1EAIA 2C8YB 2BOHB 5EOKA 3DA9B 1LPZB 1E36B 3VGCB 3MNSA 1EJNA 1QBOA 1SGYE 4KELA 1NFWA 4X8TH 3HATH 3RXIA 1OYTH 2F4LA 1QL9A 1AY6H 3LJJA 3BEIB 1E35B 2PKAA 3V12A 2FOGA 2GCHF 5J4SA 4HI3A 1QL7A 2BTCE 1MD8A 4UFDH 1EUFA 2ZNKH 1OHHD 2TGDA 5A0CA 2GP9B 2WPHS 3PMJA 1NFUA 4MNYA 2QV1A 1ZPCA 1P3CA 1UW7A 3B8JA 3P17H 1PQ8A 2QN5T 4RKJB 2QF0A 1S6FA 1C5OH 1AIXH 1GI2A 5C67A 1ZSJA 3LJOA 2CGAA 5DP4A 3MTYA 1PPCE 2ASUB 1GCDA 3BTDE 1P06A 1HNEE 1EJAA 1W11U 2J5UA 3KN2A 2Y7ZA 3SU5A 1UK3A 1SGTA 1FMGA 2GV7A 4K2YA 1YPHC 4E05H 1XXDA 2ZU1A 3E3TA 1P02A 4I8KA 1AE8H 1MMJN 4LOYH 1K1PA 1DT2A 3SI4H 1BRAA 3RXVA 3UUZA 5DP6A 1N6YA 5CHAC 2BD8A 3N7OA 1ANEA 1MQ5A 3MWIU 5EU8A 1F5RA 2Y5GA 3ZVFA 2FI3E 2STBE 1KDQB 2CHAC 4JZEH 1FPHH 2G52A 4X2WA 2BY8X 1Z7KA 1PPZA 2Q6GA 2TGAA 1WXRA 2FYRA 3GY7A 3RXPA 1AI8H 3CS0A 3JZ1B 1W0YH 3TH3H 4E06H 1BBRH 1KLTA 1SL3A 1L1NA 4CHAC 1C5LH 1MZAA 1P2IA 5JBBS 1F0SA 1O3FA 3D62A 3GY5A 1J17T 3F6UH 3U1JB 2BQ7B 1AVWA 3A88A 2FWWA 1PYTD 3STIA 1BMAA 2HWLB 3U8TH 4ASHA 4NZQA 1QZ8A 1UTLM 1W12U 4AYYB 2R9PA 3SJOA 3C1KA 5ETXA 2C93B 4ZAEA 3RM0H 7ESTE 1SG8B 1NS3A 1O36A 1T8NA 3RXFA 3ZVEA 1ELBA 2ZIQH 4H6TA 3BTTE 1WAYB 1KY9A 2HALA 1IQIA 1CU1A 3SJIA 1RFNA 3EE0B 1TRNA 1GJDB 3NRLA 4FUIA 4RSPA 2PGBB 3CP7A 5JBTA 2P59A 3A83A 1YPHE 1BMLA 4I33A 3MFJA 5C3NA 1AFQC 4O9VA 4A92A 2VIVA 4M9FA 4K60A 5EQRA 3E0PB 2G5VA 2ZGJA 1UVTH 4Y6DA 3NCLA 2UUYA 1E1QD 1AWFH 1YPMH 2KAIA 1JWTA 1P2MA 2FODA 2HPQH 2FOMB 3ATLA 1SGRE 4ABEA 3BIUH 3PLKA 3M3TA 1DWBH 1BMNH 4Q63A 4ISOA 1AE5A 1ZYOA 2M2AA 3RXOA 1GMDF 3PWCA 2XRCA 1GJ6A 4J1YA 9ESTA 3F0OA 5FL7D 1AB9B 2CXVA 1VITF 1ZSLA 3L6PA 4E7RG 1YWUA 2G51A 2FEQH 4Z0KA 1LHFH 1MBQA 5E2OA 1NZQH 3M3SA 5GIBA 5HGGA 2V0BA 1TYNA 3GCOA 5EJZA 3ZIAD 3MU8A 1KMHB 3IWMA 3ZZ9A 5E0HA 3CENA 4JK5A 4Q7ZA 1O32A 1HJAC 2BZAA 1C1PA 3GOVB 3P6ZB 1RRKA 2VB0A 2IPHA 3VXEH 1RS0A 3URCA 3QZQA 5C1UA 3TGIE 2VWNA 1D3QB 1HAXB 2K0QA 3RXSA 3TJUA 1UVSH 5L2ZH 1A3EH 1FN6A 3PM3A 3VB7A 4IBLH 2ZZUH 2K1QA 2R2WU 1YC0A 4A7IB 4LZ4B 3IITA 1TIOA 1GI5A 4X8UH 1YKTA 3SOSA
chains in the Genus database with same CATH topology
1C2LA 1LVOA 1OWEA 4F49A 2Z9KA 4MNXA 1UHBA 2GKVE 1GGDC 1MQ6A 1OPHB 4QT8C 1EASA 5EODA 1ANCA 2ULLA 1MKXK 4UFFH 2W5EA 2PKSC 1WYKA 2AGIX 2ZGHA 2BX3A 3RXEA 3SHAH 3T62A 2AFQB 4XFQA 1V2UT 4BTTB 4I8GA 1ZGVA 1QJ7B 1RGQA 4XE4A 5E2PA 1C2MA 2FOFA 1K21H 1PFXC 1QB6A 3RLYH 3BIVH 1A0HB 1IHSH 1HAPH 1TNJA 3O8CA 1EAWA 5HMAA 4ZHMU 1J8AA 1C2EA 1XKBC 1T7CA 4TY6A 4O03A 1XUIA 1QRZA 5JBCS 1A5GH 2EI7A 3T25A 3STJA 4OS2A 2QIQA 5LH8A 3A86A 1K22H 5DP7A 3FP7E 1A2CH 1ZMLA 4A6LA 4Y8XA 4X6OA 5F8TA 1F7ZA 2BDBA 1RIWB 1LCYA 3KHVA 1J15A 3TK9A 1FY1A 3PWBA 1CBWB 1SGIB 3LGWA 1PPFE 2RG3A 4HTCH 2QF3A 4UFGH 5JB8S 4ZH8A 3RXQA 1D3TB 3GCHC 2B7DH 1TQ0B 3QUMP 2OBOA 4BAHB 1QNJA 5C5OA 1RJXB 1SGDE 1P12E 2STAE 2ZWLH 1JIMA 3LONA 3ZVCA 1GMCF 3ZZBA 3A8AA 1PPEE 3PMAB 2BDAA 5DP9A 1NU9A 1DSTA 2BLWA 1DXPA 1GBMA 4BXWA 2RDLA 2LNCA 3MH5A 2XC5A 2RCEA 5I25A 3RXJA 3M5LA 2FP7B 5HM9A 1QGFA 5JB9S 2OTVA 1IQHA 1HAGE 2R3YA 1YPJH 4Q7XA 1WV7H 1G2LA 1CHOF 2G4UA 5HM2A 4JYTA 3CS7A 2BQ6B 5HYOA 1Y5BT 3QGJA 1FAXA 1A3BH 3ATMA 1TNLA 4X2YA 4YZUA 3TJVA 1ELDE 1FAKH 7GCHF 2ODPA 2ZU4A 1GJ8B 1W8BH 3ZZ5A 1INCA 4IMZA 1BTUA 1WTGH 1W7XH 3GCTF 4FVDA 4A1VA 1ZHPA 2ZFQH 1ABJH 1RTKA 3S69A 3ZZ3A 4FU8A 4YESB 1F0UA 1ZJDA 3RC4A 1O2QA 1WBGB 1TX8A 2XCNA 3I29A 4I8JA 4JYUH 3KIDU 3ENSB 1TA2A 4INHA 4B73A 4WJG2 1Z1IA 1GBTA 5LPRA 1EXFA 1HRTH 3EA8A 3MU1A 4I32A 1C2FA 1GDNA 1CHGA 5SGAE 4X2XA 3ATWA 4WF8A 4WMEA 4Y0YE 1FONA 3Q3KA 5GXPA 2XW9A 3TK6A 1DM4B 1GBFA 5DP3A 4YO9A 4CRGA 4AZ2B 4CBNA 4IGDA 3RC5A 3QTVH 4ABHA 4X2VA 1SOZA 3ESTA 1C1QA 3RXAA 1TE0A 1NU7B 2ZFFH 4NIVA 1W2KH 2BHGA 4FXGH 1ZRBA 3ELAH 3BG4B 3A7ZA 2WINI 4I31A 3FANA 4D9QA 3A81A 1WOFA 3P92A 1WTHD 3RC6A 1T4VH 1GG6C 1QJ6B 1HLTH 1ZMJA 1ZTJA 3A80A 3RXMA 3ZZCA 1GBEA 1SGFG 1GJCB 2P95A 1TWXB 3RMLH 3V3MA 5EGMA 1S0QA 1G3DA 1GMHG 3LIWA 1MKWK 2A31A 4D9RA 2ZDLA 3RXRA 1GI9B 1NTPA 1O2YA 4MNWA 4X6MA 1Q2WA 1MCVA 4D7FA 1Z71A 1BHXB 2GX4A 2XWAA 1O0DH 1GJBB 2SGAA 2ZEBA 3SNDA 4AYVB 5GDSH 4BAOB 3BTFE 1PYTC 1FJSA 3R3GB 3QGNB 3RXTA 2A4OA 5GCHG 1AWHB 2FXRA 4Y0ZE 4ABAA 3O8BA 2DUCA 8KME2 1NN6A 1UVOA 2BY6X 1EPTC 3VB5A 2TGTA 1UTJA 1H9IE 3EAJA 4NA8A 4BOHA 4A1TA 2GCTC 3C27B 3LGVA 2Z6BD 2YNBA 4B74A 4FU7A 1HXEH 1LHGH 1BJUA 3A8DA 1XKAC 1S6HA 1O3JA 2GZ8A 1HYLA 3F9GA 3EDXB 3DD2H 3FZZA 2P3UB 3OTJE 1O3OA 1TGNA 4FUDA 1HDTH 2F9UA 1THSH 4RN6A 3BV9B 1GI7B 1VJAU 1C5NH 2GV6A 4MPVA 1OWKA 1BTZA 1LVMA 4Y79A 2AIQA 2ZO3H 1Q31A 2VWOA 2CF8H 4K1SA 3SV7A 1G9IE 2VU8E 4HGCA 3TJNA 3TGJE 1C5XB 4MQAA 1A0JA 3KGPA 4MNVA 1GCTC 3SJKA 3UQVA 4OS1A 5TCAA 1KIGH 1TALA 3RXCA 3IG6B 3UOUA 3SW2B 3UOPA 2PUXB 1V2QT 3PYHA 5A09A 1V2LT 1NT1A 3BEFB 3MI4A 1G3CA 3SHCH 1FZZA 4WMFA 2O9QA 4TWYA 4BTIB 1ELGA 5L6NH 3MO6A 5LGOA 2ZDKA 1P05A 3W95A 3E1XB 1GJ9B 1BT7A 4AX9H 1GHAG 1OKXA 3VXFH 4INKA 4Y71A 2PW8H 1VJ9U 1FLEE 2QYIA 1HPGA 2BB4A 1LQEA 1MUEB 2ZHWH 1SGQE 3F68H 1O3EA 1G30B 2BXUH 2C8WB 2D8WA 1A5HA 2Z3DA 2A0QB 1MCTA 6CHAC 1TX7A 4ZMAH 1O2SA 1C2HA 1MTNC 1JBUH 3VFEA 4FUHA 3RXGA 5JPMH 5AFZH 1TNIA 3TJOA 1FY3A 1A4WH 4NSVA 1G2MA 2OQUA 5PTPA 3M7UA 4ABBA 2BVSH 3T28A 5K0HA 1IQKA 4CH2B 1SQAA 1C1VH 6GCHF 3LDXH 1HIAA 4D7GA 4DIIH 2F9NA 5F8XA 1GHYH 1DWEH 3E8LA 2TIOA 1VGCC 3Q3XA 1DS2E 4K5ZA 4AFQA 3F9FA 3SJ9A 2VIQA 3VGCC 1SVPA 2JH5D 4ZHLU 4ZXYH 2ANWA 1HAVB 2WPIS 2M5TA 2W3IA 4D8NA 1O3LA 1XUGA 1Z6EA 2Q1JA 1Z6JH 1O33A 1TBQH 3A89A 1MTWA 1NRSH 2ZHDA 1KXFA 3A7YA 3UIRA 3FP8E 5FCRA 2A4GA 1HAZB 4BXSA 2R2MB 1NY22 4KKDA 2W26A 2YNAA 1HAYB 3OY6U 3TIUA 1EQ9A 2ZCHP 4Q7YA 2TRMA 4Q80A 1C1NA 4ABIA 1BB0B 1SI5H 1YGCH 2GZ7A 1RXPA 1LTOA 3K65B 3D23A 2FX6A 2BLOA 1CT4E 3NPSA 1C5QA 5AF9H 3DFJA 4MPWA 3Q76A 4ISNA 3M37A 4JZIA 1CGIE 5TJXA 1P57B 1GVZA 3RMNH 1BTXA 4JZDH 1W0ZU 2PFEA 1VCWA 2P8OC 3TGKE 2UUFB 1UTQA 1JRTA 2OLGA 2VJ1A 4UDWH 1DOJA 1GI0A 3AAVA 1TOCB 2A1DB 2P3FH 1RTLA 1XUKA 1QJ1B 1B0FA 2FZZA 3F9HA 4R8TB 4TPYA 1QTFA 1J16A 1O2LA 5CHAB 1E38B 1LHDH 2ZDNA 2A2QH 1ETTH 1O30A 4XOJA 3V7TA 2GD4B 1O2GH 1FI8A 3QO6A 4YOJA 2CHAB 2O8UA 2FOCA 2XYAA 2ZP0H 3MNCA 1JMOH 1ID5H 2ZTZA 3A84A 1MKXH 2ZDAH 2VVUA 1HBTH 1YLDA 4DW2U 2QXGA 2BD7A 3UNRA 2B9LA 1AU8A 1KDQA 1L4DA 1MH0A 4YLQH 5EPYA 1O34A 1GI3A 4H6SB 1AVGH 3ITIA 2B0FA 3SNEA 2OC8A 2BM2A 2C90B 1O2IA 1C1OA 3BTWE 1FIWA 2OQ5A 5L2YH 5EW2H 1TNKA 1GJAB 3SUEA 3BTGE 2Y6TA 1GHVH 3Q77A 4NIXA 2ZPRA 1QURH 1SBWA 1DANH 1NO9H 1AKSA 1LHEH 1PQ5A 4WXIA 2VIPA 2VVCA 3NUMA 3SV9A 1SHYA 2F3CE 2XWBI 1SQOA 3GDUA 2SGPE 1ABIH 4ZROA 3SQHE 2ZPSA 1GHBG 1LKBA 3ODDA 1HV7A 2G55A 1SGFA 1DDJA 4PROA 4ZKRU 2ZTXA 2QXJA 3M5NA 1BBRE 1CVWH 1PPGE 2ZGCA 1QRWA 2ODQA 2GZ9A 4B1TA 1AB9C 1O5EH 1OOKB 1UTPA 4INLA 1O5FH 4JK6A 3A7XA 1ELAA 3PTNA 2ALPA 2W7UA 2QA9E 3QX5H 2QXIA 1ESBA 1O2HA 3GYLB 1YF4A 4YT6H 1YM0A 2FTMA 1IQGA 1O2NA 5FHTA 2ZECA 1AN1E 4TY7A 1CA0C 2ALVA 3W94A 4IMQA 3BEUA 1V2OT 4GVUA 2BD3A 1BJVA 3BTME 3D65E 7LPRA 2BXTH 1HJAB 2ZU3A 1OS8A 3K6YA 2PHBA 2ZCKP 1G36A 1YLCA 1DXWA 1ESAA 1J14A 2XBXA 1O39A 3ZZ6A 2PTCE 4MVNA 1O2XA 1CT0E 1XVMA 1NPMA 2ZU2A 3MO3A 3SGBE 1ZTLA 3DUXH 3SQEE 5FXLA 5G4BA 1ETSH 1EZXC 2A4RA 4NSYA 1FV9A 3H7OA 4M7GA 4X8VH 3T5FH 4AB9A 3HPTB 2BLVA 1CO7E 3FP6E 4WH6A 1C5UA 5EXMA 1K2I1 2PKSB 4YOIA 1P9UA 3M3VA 3SU4A 4J2YB 4GCHG 4NWKA 3K6ZA 3KNXA 3SGAE 3MNXA 4XSKU 3TLOA 2FI4E 5FPSA 3SV2H 1Z1JA 3SU6A 1O35A 1OSSA 2I6QA 3GY2A 4NA7A 3U1IB 3ZZ7A 3VPKA 1PJPA 2Y80A 2Q6FA 3RU4D 2PTNA 2P94A 2Z9LA 5LPEA 2UUKB 5IYTA 3SGQE 1GPZA 4OGXA 1C2JA 3SUDA 4FUCA 4YTAA 1TFXA 3H5CB 5FAHA 3SBKA 2PR3A 3F1SB 4K3JA 1FIZA 2GDDA 1SLVB 3I78A 2BY9X 1SOTA 1IQJA 2PUQH 1ORFA 3S9BA 2OC7A 1EKBB 2G00A 1TGTA 1MKWH 1BQYA 5E8EH 2H2ZA 3KL6A 4XBDA 3GY4A 3LPRA 1Y3VA 4IN1A 3GCHB 4JCNA 1H9LB 4CRBA 5FX5A 1OWIA 1BIOA 1LQDB 4ABGA 3P95A 2PV9B 3TNTA 1F92A 5EPNA 1HFDA 2XTTB 4D76A 1Z8JB 1QFKH 2BOKA 1O37A 4ABDA 7KMEH 2HOBA 5T6FA 1TGCA 1AUTC 2BYAX 2FIRH 3RMOH 1QQ4A 4DOQA 1J9CH 2ANYA 1RTFB 2TGPZ 1BCUH 1BHXF 1SFIA 1F2SE 4LK4A 3M5OA 4B2BA 3T29A 3NXPA 1OP0A 1EP6A 1TPPA 4ABJA 3OY5U 4DVAU 3ZV9A 4IS5A 5IDKA 3BN9A 1DVAH 2AIPA 1DWCH 1EAXA 1YP9A 3BF6H 1P8VC 2V3HH 1THPB 1V3XA 3GY6A 3MU0A 1O2VA 2YOLA 1H1BA 3TK5A 2AERH 3GDSA 4NGAH 1FY8E 2ZC9H 5AVDA 5ESBA 5EXNA 3UTUH 8GCHG 1O31A 3LC3A 3BTQE 1C5VA 4AFZA 5CMXH 1GI6A 4CRFA 1C1UH 1MZDA 1OWJA 2GMTC 3V13A 1TABE 1V2RT 1B0EA 3SNCA 1BOQA 2JKHA 3BTKE 3LU9B 5DKMA 1XUHA 3NZIA 1LO6A 3FAOA 5GPIB 3KQCA 4DT7B 5FPTA 8ESTE 1EX3A 2BY7X 1KTSB 1P3EA 4MPUA 2VGCB 4MG3A 4WH8A 3SNBA 2FOBA 4ZKNU 3BTEE 1OP8A 5I46H 3LOXA 3M61U 2OCVB 1IHTH 1S5SA 1SSXA 4K1TA 4U2WA 1O5BB 3EA9A 1O3CA 2A32A 1P04A 1GHWH 2Q6DA 1C1WH 4NG9H 3O8RA 2VVVA 5C1YA 4SGBE 1PPBH 4X6PA 1MTVA 1QY6A 1TNGA 3ZZ4A 5FBIA 3RLWH 1F0TA 2FMJA 3A7WA 4ZXXH 1YCPK 5A2MH 5A0BA 3SI3H 3KEEA 2WUBA 2OC0A 1C1MA 1U6QA 2BDIA 5DP5A 1QA7A 2OP9A 1C5MD 1ZR0A 3QDZB 1SC8U 3MU5A 1T8MA 2H6MA 4FUGA 1GJ5H 1NRPH 1N1LA 2C4FH 1NC6A 2GCHG 3SUGA 1EB1H 1PPHE 4WY3A 1ANBA 2J34A 5EXLA 3UNQA 3LGUA 1O5DH 2ZQ1A 5K7RA 4U01A 1ZJKA 2TBSA 4Y7AA 1HAIH 1PQAA 3H7TA 1L0ZA 1UCYH 2IJOB 1O3GA 1ZLRA 3AW0A 1ZMNA 4MTBA 1UO6A 5DK1A 1O3HA 1QBNA 1HAOH 2F9BH 4WMDA 1P03A 2RA3A 3E16B 2OXSA 4FU9A 4A5TS 1O3AA 3U98H 2FTLE 1C1RA 4U32A 1NRRH 1B7XB 3MH4A 1QL8A 1HB0B 1CQQA 1T31A 1FY4A 1EPTB 4JZFH 3GY8A 1N8OC 1DE7H 4I8LA 3PROA 5BPEA 3LGTA 3TITA 1C4U2 2IOTA 2C8ZB 1DFPA 1IQFA 2BD5A 4VGCC 2GT7A 2SGQE 1P0SH 2ZU5A 1TMTH 4OS4A 3B9FH 2FS9A 2F9OA 5C5NA 2BZ6H 4KTSA 1MBMA 1AQ7A 1YPEH 1DSUA 1V2PT 1DY8A 3T26A 3A8CA 4HZHA 4R0IA 4DG4A 2BDHA 3TNSA 1QA0A 1GBHA 2A2XH 2D26C 4CREA 5A8ZA 2D2DA 1AFEH 1EATA 5HXFA 1KLIH 3ZVAA 3SV8A 2UWPA 1Z8RA 4ISHH 2F91A 4IN2A 3PO1B 2FPZA 1HAHH 1P01A 3S0NA 1KXEA 1QB9A 1KXCA 4LZ1H 4AORA 1P2OA 1S83A 1HGTH 1JIRA 1DPOA 3S7KB 4DY7B 5DJ7A 2O8LA 1V2WT 2JETB 1TB6H 2D1JA 4LXBH 2WUCA 2JH0D 1WCZA 1RD3B 2H9HA 3QTOH 1FY5A 3EGKH 6LPRA 2FDAA 4KTCA 3ATIA 1BRUP 3EYDA 1QB1A 1Y3WA 1EZUC 1NM6A 4ISLA 3PTBA 3QK1A 4X6NA 4BAQB 3TU7H 1G32B 3GISB 4WWYA 3M7TA 3NKKA 5E0GA 1IQEA 1D3PB 1W7GH 2G81E 2QGRA 3ZYDA 2GDEH 1AVXA 1T8LA 2XBVA 1SR5C 1WQVH 1D3DB 1OWDA 2O8WA 1YPLH 5FX6A 1DUEA 4WVPE 3UR6A 5ESTE 1D4PB 4NZLA