1PJPA

The 2.2 a crystal structure of human chymase in complex with succinyl-ala-ala-pro-phe-chloromethylketone
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
226
structure length
226
Chain Sequence
IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQKNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGAAQGIVSYGRSDAKPPAVFTRISHYQPWINQILQAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords CHYMASE
publication title The 2.2 A crystal structure of human chymase in complex with succinyl-Ala-Ala-Pro-Phe-chloromethylketone: structural explanation for its dipeptidyl carboxypeptidase specificity.
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 226
sequence length 226
ec nomenclature ec 3.4.21.39: Chymase.
pdb deposition date 1998-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1pjpA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1pjpA02
2XBWA 2F9UA 3GICB 4DJZB 3PB1E 1UTQA 1T32A 1ZHRA 1JBUH 1C4Y2 2JH5D 1VGCC 4Y7AA 1DT2A 4JZFH 8GCHF 3URDA 4OGXA 4BAHB 2OC0A 3L3TA 4MDSA 5JBCS 1XXDA 4SGAE 6LPRA 1GG6B 2UWLA 1O5BB 3TITA 3A8CA 1O2HA 3CENA 5A0BA 3RXPA 3V7TA 2UWOA 1VZQH 1D6RA 1F0UA 1LO6A 3BTHE 3NPSA 1C9TA 1FQ3A 1GCDA 3PYHA 1P3CA 1QL9A 1GJ7B 1O31A 3SJ9A 2P3FH 1YLCA 1ANCA 2WV5A 3LC3A 4DY7B 1QTFA 1IQJA 1UHBB 2AMDA 1GWAA 3KHVA 1SC8U 2RA0A 3NCLA 1H8IH 3PLBA 1C1SA 2OINA 1KYNA 1KDQA 5HXFA 2BVSH 1YPHE 4ISIH 2FTMA 1S82A 2BDBA 3MNBA 1MKWH 1Z71A 3SUEA 4XBBA 2ZCHP 4JZDH 1C2GA 1L2EA 4YM9A 1P2JA 2Q6DA 2QV1A 1C5NH 1FJSA 1QFKH 2BLWA 3LGVA 4ZKRU 1JOUB 4ZXXH 1ZGVA 3T2NA 3BEFB 5DG6A 1WAYB 1CGHA 1SR5C 2GMTB 4WWYA 3SJOA 4THNH 1C5UA 4MVNA 1H9LB 1P3EA 1AVGH 1K1JA 2ILNA 3RXBA 4B1TA 2ZHDA 2RCEA 1HDTH 5JYIA 4MNWA 3M3VA 2WPLS 1TAWA 1ZRBA 2J92A 2SGEE 1AN1E 3TK9A 1MU6B 3GOVB 1BT7A 3SNBA 1FLEE 1KXCA 1G9IE 6ESTA 1O3NA 2AIPA 1E35B 2WYJA 1ZRKA 5T6GA 4K2YA 5DKMA 3LGTA 1EJMA 2GX4A 4CBOA 1BMMH 4BOHA 5EQQA 2QCYA 2VINA 4FUDA 1SGYE 1S83A 3E16B 2ZTXA 3BF6H 5HGGA 1TFXA 2J9NA 2H9EH 1GHAG 1MZAA 3R3GB 2IN2A 2BD9A 1UTLM 1ESBA 3AAUA 1YCPH 4HFPB 1O37A 3H7OA 3B23B 2BVRH 4U2WA 5AFYH 2FOGA 1HAZB 1NRPH 1C1VH 4O3UA 4I8HA 1TPAE 3SU2A 1QY6A 1HJ8A 2A4OA 1K1IA 1GJ6A 2SGQE 2FLBH 2PKAB 2BDCA 4Y8YA 2FPZA 1AO5A 1BHXB 3GDSA 2QGRA 1YKTA 2BB4A 1MKXH 2IOTA 1MQ5A 3F9FA 3PROA 2XC5A 4WMFA 1RS0A 1JXPA 3MYWA 3SU5A 3MTYA 2BD5A 1XUKA 3V3MA 3SUGA 2VIPA 2ZECA 1NT1A 3BTDE 3FP7E 1BMAA 5EW1H 4BXSA 2CF8H 3QGNB 1PQ7A 3ZVDA 1EX3A 1M9UA 3SNDA 4K8BA 1A0LA 1S6HA 2QYIA 2NU0E 1XUIA 3PMHB 1CBWB 1O2MA 2BDGA 3PWCA 4Y71A 3S9CA 1ZTJA 3QO6A 2XC0A 1QGFA 2HRVA 1EAIA 1GHWH 1GJ8B 2BY6X 3ZVFA 3SBKA 2QC2A 2Z9JA 1A5GH 1O35A 1DPOA 3GDVA 1EJAA 4Y0YE 3ZVBA 4ISOA 2ZU3A 2QY0B 1SFIA 2ZFTA 1CT0E 2ZHEH 2ODYB 1N6XA 2F9BH 1V2RT 2J38A 1P2NA 1TNJA 2IPHA 1IHTH 5K0HA 1AVXA 1DY9A 1GBDA 1GVKB 5GCHF 2R0LA 4FUBA 1KDQB 1MTWA 1V2LT 3GCHC 1CHOF 3A87A 3ZZBA 1NTPA 2J95A 1GMDF 4NFEA 4NFFA 3DUXH 2G52A 1WTHD 2BD8A 5FCKA 1DUAA 2RDLA 1PQ8A 2VWMA 1O2RA 2ZU5A 1GHBF 3LH3A 4DIHH 4CR9A 3M7TA 1UTNA 2ZDKA 3NKKA 4JZ1A 3KEEA 3RXVA 3LDXH 3VB4A 3HPTB 1HIAA 3NWUA 3UWIA 2B5TB 4CHAC 4VGCB 2Y6TA 5G4BA 1A2CH 2TGTA 5DP5A 3MU5A 1AE8H 1YPKH 1UK4A 1YBWA 4B74A 1BTUA 2FS9A 1NU7B 1RRKA 4JMYA 3SZNA 1HXEH 4GAWA 2UUYA 3MU8A 2QIQA 2SFAA 3RMLH 1DM4B 1N8OB 2A4QA 2BDIA 4ZKNU 2ZFPH 1GJAB 1O5EH 1OWHA 1NS3A 4B75A 4H6SB 2HPQH 2BY9X 2ZNKH 1C2LA 2BD2A 2ZDLA 4INKA 1AD8H 1TABE 2PR3A 1UCYE 1ELFA 1BMLA 2HNTF 2VH6A 2G5VA 3BIUH 1DUEA 1ELGA 2QN5T 1C5OH 1MUEB 1O30A 1QRZA 1PPCE 5FAHA 1P9UA 1ARBA 2EI8A 1A1RA 1EZQA 3A89A 2G00A 1ZMNA 3QZQA 4MNXA 1FDPA 2GGVB 1GJ5H 1KLJH 3A80A 1HB0B 5F6MA 1SLWB 4WXIA 1B5GH 1S5SA 1ELTA 2W5EA 2OC8A 2BZAA 3MH6A 2G81E 1GI5A 1ABJH 3A86A 2O8TA 2BMGB 3OU0A 4FVDA 4E7NA 5JDUB 1LQDB 4RKOB 4JK6A 1C5MD 2P3TB 1Z1IA 1XMNB 4J1YA 2OLGA 3RXDA 2F9OA 3NZIA 1BUIA 1OP0A 1XM1A 1DLEA 4IC5A 3VXFH 3ZZ3A 3A85A 2GCHG 4DGJA 2Z9IA 1P11E 4YOIA 1MH0A 2IJOB 2VVUA 2FI3E 3K9XB 5EOKA 2A7HA 1FAXA 1MD7A 1F92A 1CE5A 4H4FA 1GBJA 2R3YA 3TH4H 1MZDA 2KAIA 1DX5M 1OYQA 3BEIB 3U8TH 1LVMA 3PMJA 2TBSA 1P10A 3OTJE 2ALVA 1DVAH 4KGAA 1PYTD 4D76A 1D3DB 5FCRA 2ZDNA 1C5SA 1BBRH 4ISHH 3ZZ9A 3E0PB 3MOCA 1NN6A 1AMHA 2ODQA 1C5LH 2ZDMA 4Q7YA 3RXKA 1S0QA 2V0BA 3MNCA 3W94A 1TGBA 2G5NA 1UTPA 3VB7A 4MG3A 1VCPA 2ZU4A 1O3PB 3RMOH 1Y3UA 4DIIH 3QZRA 1IQIA 3RXCA 3ELAH 2YNBA 2VIQA 3UUZA 3V13A 3Q3XA 2ULLA 3TNSA 1KIGH 1L4ZA 4GLYA 1FAKH 1J16A 1CHGA 1G30B 4NWLA 3ATIA 1QIXB 1GI7B 1TBRH 3LJOA 1PQ5A 1NFUA 1SVPA 4TWWA 2ZCKP 3VPKA 2PKSC 1LDTT 4YT6H 1XVOA 5HM9A 1KXDA 1UK2A 3PO1C 5JBTA 1O3EA 2D1JA 3VEQB 3DFLA 1O3AA 1IAUA 1QRXA 4TY7A 2C8WB 2VNTA 2DE9A 2WPIS 1LCYA 2YNAA 2O9QA 4FUIA 4X1SU 1AI8H 1O5GH 3EA7A 2FI4E 1O2OA 2Z94A 1WV7H 5DPAA 1GMCG 3VB6A 3QLPH 1MQ6A 4NA7A 4YESB 3DD2H 4M7GA 3FP6E 1O32A 1UCYK 1HIAB 4ZAEA 3H7TA 1QB6A 1HJAC 3BTFE 4B76A 1BTWA 3UREA 2OBOA 1TWXB 1GBMA 3KGPA 1SGEE 2ANMH 4Z6AH 1SPJA 3SJ8A 3LIWA 7KMEH 3SQHE 1JRSA 3VGCB 4FU7A 1GCTC 3T29A 2W7UA 3PMBB 4YT7H 5EW2H 1HUTH 3BV9B 2BYAX 4FUGA 1C2EA 1TGCA 3SGQE 3ZVEA 1IQNA 1UTJA 4NG9H 1Z8JB 3EAJA 1C5XB 1GHAF 5HYOA 1GMHG 1OKXA 3LU9B 1YF4A 4AFSA 3E90B 2FDAA 3DFJA 4UONA 4CR5A 3TGKE 1ZSKA 3NXPA 1B0EA 2AH4X 1MAXA 1O38A 4YZUA 3ATWA 1MAYA 2B0FA 3RXQA 5GXPA 4Y79A 1K28D 2FESH 4A7IB 5AFZH 2Q6FA 3S7KB 2Q6GA 2RG3A 4H42U 2A7JA 2PV9B 2V35A 1QJ7B 1C1TA 2AIQA 2GKVE 1GJDB 1P2MA 5DP4A 1HPGA 5FBEA 1CT2E 3N7OA 2QXIA 2AERH 4Q7ZA 1AQ7A 4Q7XA 1H9HE 1SGFG 4ABEA 3LC5A 3KN2A 2O8WA 1PPBH 3CS7A 3A83A 4IN2A 4WH8A 4O9VA 1V2QT 2BVXH 3SW2B 3OSYA 5CHAC 3O8BA 1WBGB 3EA9A 4AFZA 1HXFH 3KL6A 1THRH 3RXRA 1OOKB 1WOFA 1JRTA 4GPGA 1TA6A 4KTCA 3MU4A 3GY3A 1AIXH 3A82A 4I8JA 5E2OA 5AVDA 5FX5A 3SJIA 2KAIB 1F0TA 2HLCA 1W0ZU 3SGBE 1XVMA 1GDNA 2C90B 4X6PA 1VJAU 4R8TB 2R2MB 5EXNA 3ZVGA 3UR9A 1PQAA 2OC1A 3RXMA 1V2PT 1ANBA 2GT8A 1UCYH 1ZOMA 1Y5UT 2XBYA 1PPEE 4AYVB 3RUOA 3M35A 4TY6A 1DICA 3TIUA 5EODA 1A0JA 3LKWA 2M5TA 3HKJB 1P8VC 3V0XA 3ATLA 1O2XA 5EPNA 3U8OH 1FIWA 1F5LA 4JZIA 3AW1A 1FV9A 1EB1H 1TQ0B 2OQ5A 1HAVA 3RLYH 9ESTA 1MBQA 1O2YA 4NA8A 5K7RA 4ABGA 2XC4A 1LVYA 3RU4T 5C5OA 1FY4A 1P57B 2HPPH 2ZQ2A 2GCTB 1GJCB 3FAOA 4NSVA 1GI6A 1IHSH 4WJG2 1GI1A 1ELBA 1Z8GA 1HAXB 1ETSH 2XW9A 3MH5A 2P59A 5C67A 3O8DA 3F1SB 2QXHA 3ZYEA 1O3GA 1SHYA 3P8GA 3ZV9A 1GBCA 3GY8A 2CHAC 4FUJA 1OWEA 3OY5U 3IG6B 1NC6A 5FPYA 1O2IA 2B9LA 2Z9GA 3MO6A 1TGTA 4B2BA 1VITH 2ZWLH 3OY6U 1TQ7B 3UY9A 1JIMA 4ZXYH 2GTBA 3SORA 5DP9A 4BTIB 1UO6A 1FMGA 1ZSLA 3M3TA 2Y82A 1CU1A 3RMMH 4D7GA 1VCQA 1FI8A 3Q76A 3T25A 1C9PA 4GHTA 2ZGBH 3CP7A 2BXTH 1W7XH 1O0DH 3FVFB 2ZIQH 2ZGHA 4CRAA 1LKAA 1P0SH 5ESBA 3ATKA 2HNTE 1F5RA 1SQAA 4JCNA 4ABBA 1XKBC 5I46H 4ISLA 1NO9H 1AHTH 1C2DA 1YP9A 2BTCE 1WYKA 2VWLA 2WINI 1O2GH 3SNAA 1LQEA 4K60A 1XX9A 3PLKA 4WVPE 1DSTA 1NESE 8KME2 1C5QA 1GGDC 1PPHE 1V6DA 2SNVA 4XSKU 3MO3A 3U1JB 1EPTA 4Z0KA 2ZI2H 3TH2H 2JETB 3ZZCA 1SQTA 4YTAA 1LVBA 1BRBE 1B7XB 1TA2A 1O2TA 1FN6A 1QR3E 2Y5HA 2P94A 3BEUA 5FX6A 1T4UH 1BIOA 2VGCC 1PJPA 2QA9E 1O3DA 2O8MA 3F9HA 4WF8A 3BN9A 1YM0A 1QHRB 1L4DA 1TPPA 2GCHF 1BRAA 3RXSA 4ASHA 2PSXA 2PHBA 1W12U 5LPFA 1SGPE 2FTLE 1O2JA 5B6OA 2BQ7B 2P8OB 5JB9S 2XYAA 3MNSA 1ZMJA 1ANDA 1GBIA 3RXTA 2CN0H 2PGQB 1MTSA 2ZC9H 3SJKA 1ZSJA 5DJ7A 2HWLB 1A0HB 1O3LA 1KLIH 2ZFSA 1RIWB 1AFEH 4KKDA 1TNHA 1ID5H 2XWBI 2VIVA 1PPZA 4HI3A 3MU0A 4MQAA 4K3JA 2VIWA 4KP0A 3DHKH 1G2LA 4UD9H 1ZPCA 3ODFA 3QUMP 4UFDH 2ZU1A 5E2PA 1O5DH 7GCHG 5L30H 5ESTE 3T28A 1IQKA 1C2KA 5JBAS 1C5RA 2RA3A 3ENSB 3ODDA 1WSSH 4KTSA 4WMDA 3TGJE 2D2DA 1AB9B 1UVUH 1T8OA 3SI4H 2OC7A 1GI2A 4NCYA 5E0GA 1L1GA 2YOLA 4I8LA 4X8VH 1HCGA 1ZJDA 4JK5A 1WU1A 1FN8A 1T8LA 3ZZAA 5E0JA 1HAVB 1K1MA 2FO9A 1BQYA 3FP8E 2XBVA 3SU0A 4IMQA 4TPYA 1QJ1B 3MH7A 1C1QA 1DLKB 1K22H 2ZZUH 5LPEA 4HTCH 5FPSA 1O2VA 4XBCA 4UE7H 5EXMA 1OSSA 4TPIZ 3JZ1B 1MBMA 2CMYA 3GY4A 2BOHB 2F83A 3Q77A 1ZJKA 1MTNB 4OS2A 1DWEH 4BTUB 4BNRA 3R0FA 4CREA 1GMCF 2LPRA 1BTZA 1D6WA 3MNXA 2C93B 1HAYB 1GBEA 1GBTA 1CA0B 1NRRH 4K69A 1AFQB 1DWBH 2A1DB 3RXOA 1QRWA 4AFQA 2ANKH 2FOCA 5FXLA 4WY3A 1YLDA 1C4V2 4YLQH 1O2QA 1TIOA 1C2HA 3HK6B 2BY5X 3BG4C 5L2ZH 1ZMLA 3A7VA 3ZZ4A 1D3TB 2G8TA 2ZTYA 3AW0A 3P95A 2OTVA 3SHAH 1C2MA 1S6FA 2XXLA 1GPZA 2BY7X 2VJ1A 4INLA 5HMAA 4Y6DA 1TNGA 2CXVA 3QN7A 6GCHG 1ZLRA 2VWOA 4IGDA 4X6OA 1GMHF 3A8AA 4KELA 1NFXA 1O36A 1N1LA 2ZGCA 1O2NA 2XWAA 2ZPRA 5L2YH 3QDZB 3BTGE 3FFGA 2BDHA 4K8YA 1NRSH 4IBLH 1SHHB 4I7YH 3S0NA 1C5VA 5EU8A 1AKSA 1THSH 4NA9H 4RN6A 4X8SH 5LPRA 1NZQH 6CHAC 1D3QB 4B71A 1AZZA 3FZDA 3IWMA 4X2WA 1BA8B 2JH6D 4FUFA 5TCAA 2BLOA 1EPTB 1TPSA 3VB3A 1PFXC 1C1OA 1E34B 1LPZB 3NUMA 4IMZA 1LHGH 1IQLA 4X0WU 4A5TS 3B9FH 3RXUA 5SGAE 2QXGA 2FYQA 4AORA 3G01A 1DWDH 4I8GA 1VGCB 4GCHF 3KF2A 1G36A 2HVXA 1J8AA 1K21H 2WUCA 1SLVB 2PLXA 1BZXE 1QB9A 3TPIZ 4BTTB 1JWTA 2JKHA 2EA3A 1RFNA 1KTTB 2H2ZA 1DFPA 2TPIZ 1UVPA 4R0IA 1OWDA 1ELEE 4FVBA 1FY1A 2ZDVH 4JYTA 1GHZA 1TBQH 2R0KA 1G2MA 4MLFB 3SU6A 1Y3YA 3A7XA 3S9BA 1FY3A 3Q3YA 1QL8A 3ZZ8A 1V2MT 3D49H 3M61U 2J94A 2BLVA 1FPCH 1AVWA 3TJVA 2J34A 2D8WA 4CRCA 2BDYA 1V2JT 1A46H 4BAMB 2BXUH 1DWCH 5EG4A 1O5FH 1VITG 1BRUP 2HALA 1P9SA 4O03A 1SGNE 4F49A 1G32B 1ETTH 1KXFA 4Y76A 1LHDH 2THFB 2I6QA 1DS2E 1GI0A 1ZGIA 9LPRA 3MU1A 2TGDA 4I32A 2ZG0H 2WPHS 3LGWA 2F9VA 4ZMAH 1ZHPA 3U98H 1TPOA 1PPFE 2ZA5A 2DUCA 1BDAA 1EXFA 4MNVA 4YOGA 5EGMA 3BSQA 1FXYA 2PWXA 4Q2KA 1MCTA 3UOPA 4HZHA 3UNQA 4TWYA 4XDEA 1TNKA 1OWIA 1XUFA 2PUQH 2ASUB 2AGGX 1AGJA 2W3IA 1K1NA 2BM2A 1WCZA 1P12E 1C2FA 3GY2A 1IQFA 4U30A 5T6FA 1SFQB 2QF0A 1Q3XA 4OS1A 1C5PA 4OGYA 1GG6C 3MFJA 3ESTA 4X2XA 2ZU2A 2FEQH 3ZVAA 1K2I1 1GHYH 2AGEX 4U32A 3K65B 3WY8A 3RXIA 1AZ8A 4OS6A 3GISB 2ZGXH 3GYLB 1UVSH 1V2KT 1GHXH 4A92A 1DXPA 2ZHFH 4UDWH 5DP3A 4UEHH 2A5IA 1FPHH 1MU8B 8ESTE 5GPIB 1IQGA 1E38B 1V2TT 3P70B 1PPGE 1H8DH 3RP2A 2UUFB 1C2JA 1BMNH 3UPEA 1NRQH 2O8LA 4B2CA 2R9PA 1O3MA 1JIRA 2FODA 3LT3A 2A2XH 4OS7A 3GY5A 2GZ9A 1G3DA 3SUDA 4YOJA 2PUXB 1O2LA 1TX6A 2Z6BD 5A8XA 2F9NA 3KQDA 1AKSB 1GJ9B 2A4RA 1C5TA 3LONA 3D23A 1C5YB 5ETXA 1HRTH 5DO4H 1Y5AT 2ANWA 2VIOA 3M3SA 4DOQA 3A8DA 1NY22 3T62A 2GMTC 3I29A 3M5LA 1Z8RA 2ZFRH 1C1PA 2NU1E 1THPB 1WQVH 2J2UA 4ABJA 2UUKB 1T31A 4Y0ZE 2EEKA 1YPEH 1XUHA 4X8UH 1Y5BT 1S81A 3LGUA 2G51A 1K9OE 4AB9A 4DVAU 2ZF0H 3TH3H 4AG1A 2Z3EA 4SGBE 5A2MH 3SU4A 1CT4E 1HYLA 1H9IE 1A3BH 2TRMA 1CGIE 1KLTA 2QF3A 1KSNA 1P09A 2B8OH 4E7RG 1SOZA 1C5ZB 4I33A 3IITA 2ZKSA 3RXGA 1EAXA 4D9RA 4NGAH 7GCHF 1Y3XA 1B0FA 4JZEH 4AB8A 3MI4A 2BY8X 2HGTH 3L6PA 3URCA 1RXPA 4X1PU 4CH8B 1GHVH 2FS8A 1UTKA 2OCVB 1TNIA 2W26A 1EOLA 3P92A 2Z9KA 4DT7B 4LZ4B 4WMEA 3HKIB 2G4TA 2ZEBA 2CF9H 1GVZA 2FIRH 1C1NA 3GCHB 3K6ZA 5GCHG 4A6LA 1WUNH 3RC6A 2GV6A 1YCPM 3GY6A 5IDKA 1G37A 4NZLA 1NFWA 4D7FA 1VR1H 1RTKA 2FOMB 2LNCA 1FY5A 3RXHA 2Y5GA 1FZZA 1N6YA 5L6NH 1J15A 3GDUA 1GI4A 2FWWA 2FLRH 1JMOH 1C5WB 1QURH 2PW8H 1S0RA 5A0CA 1S84A 2H5CA 2WUBA 1IQMA 3A7ZA 5HM2A 1AU8A 3QK1A 3P6ZB 1OWKA 4CHAB 4K5ZA 1C2IA 2ZHWH 3QTOH 4FXGH 4YLUA 3BTKE 1O3OA 3LPRA 1OPHB 4A1XA 2OXSA 2AYWA 1F0SA 1TMBH 3SN8A 3S69A 2ZDAH 1D9IA 1CBWC 3GY7A 3EYDA 2SGAA 1Q31A 1TGNA 1BHXF 3UQVA 1W7GH 4ZKSU 5H4IB 3SNCA 1Q2WA 1MTUA 3U9AH 2P93A 2Z7FE 2I6SA 3EDXB 3SV7A 1O2WA 1O3HA 3ITIA 1OP2A 5C20A 2FYRA 1MKWK 3M7UA 4QT8C 1F0RA 1O3CA 1KXAA 1OWJA 6GCHF 1GDQA 1RTFB 2FI5E 4DCDA 5A8YA 1EAWA 1TX8A 4AX9H 3SUFA 1J17T 3C27B 4NIVA 4X1NU 3V12A 1WQSA 5DGJA 1FUJA 1GI9B 2XCFA 5T6DA 3RU4D 1GI3A 3RM2H 5GWZA 1A7SA 2ZHQH 1K1OA 1QB1A 2G55A 3TJUA 5EPYA 1O3FA 1YYY1 7ESTE 4ABDA 1O39A 3DT0H 4X1RU 1MMJN 3PM3A 4WH6A 1E37B 2PGBB 2ZCLP 2VH0A 2NU4E 1TYNA 2W7SA 1YPJH 2XCNA 4LK4A 1Z6EA 1BRCE 3H5CB 1TOMH 1NU9A 2FOFA 2STAE 3PLPA 1SBWA 1T8MA 1SSXA 1YC0A 1YPGH 3MMGA 4FUCA 2BHGA 1C1RA 4VGCC 5E8EH 3SGAE 1RTLA 2BQWB 1GBHA 1UTMA 1A4WH 1EZSC 4GUXA 3UFAA 4AZ2B 1NPMA 1O3JA 1UJ1A 3SV8A 4OS4A 1EZXC 1WTGH 3B8JA 5C1UA 1K1PA 2ODPA 5F03A 1HAGE 3ZV8A 1TBZH 1YCPK 1XKAC 2BDAA 1N8OC 1QNJA 1ZR0A 4NZQA 2C8YB 2PFEA 1O3BA 2C8XB 2A5AA 1W8BH 1FY8E 3M5OA 3A88A 4ZHAA 3SV2H 1VITF 1FNIA 2VWNA 3UQOA 3KQBA 5FBIA 1TNLA 1RGQA 5TCCA 4CRDA 1H4WA 3KCGH 4U01A 3QTVH 1O2KA 2D26C 1TGSZ 1DANH 1GDUA 4E06H 2ZQ1A 1ANEA 2TIOA 4I8KA 1MKXK 3GCNA 5A8ZA 3E6PH 1CA8B 4D9QA 4ZUHA 2XTTB 2PKSB 1TLDA 2HOBA 3VFEA 3PO1B 3GCTG 1DDJA 2F9PA 4JYUH 1G3CA 3F68H 1BB0B 1LPGB 4Y8XA 2F3CE 2C8ZB 4KTUA 1QL7A 2OUAA 4FU8A 2Y80A 3BTWE 4NWKA 1IOEA 2Q1JA 1H1BA 3E1XB 1UVOA 2Z3DA 3E91A 5AF9H 3PTNA 1AWFH 2H9HA 3M7QA 3MWIU 2A0QB 1Y59T 4AOQA 1W11U 3K2UA 1SI5H 1HJAB 4ISNA 2P95A 2QAAA 3HK3B 1MCVA 4TYDA 1EOJA 3CS0A 5EQRA 2GDEH 7LPRA 2FX6A 2WYGA 1O2ZA 1J14A 3E3TA 5EXLA 3DA9B 1L1NA 1HV7A 1D3PB 1GBKA 3D65E 2BLQA 5C1YA 5LH8A 8LPRA 1GCTB 2P16A 1DE7H 2FMJA 4J2YB 1ABIH 3RXAA 1GL0E 1UVTH 4K1SA 1F5KU 4AYYB 3E0NB 4NIWA 4ABHA 2A31A 1BTXA 1C4U2 2BZ6H 4NSYA 1BBRE 3FANA 4DURA 3FZZA 4ZHLU 3BTQE 3RXEA 5CMXH 1DSUA 2A7CA 2AS9A 1A5HA 1QJ6B 3AVZA 1GBAA 2STBE 3VB5A 2NU2E 1D4PB 1SLUB 2VIDA 4AGJA 3F9GA 4ABAA 4I31A 2ZFFH 3A7WA 3UWJH 3M5NA 1K1LA 1O2UA 1V2WT 1X7AC 2P3UB 2Z9LA 2ZO3H 2PSYA 1ACBE 1P06A 3C1KA 3P8NA 1SGRE 1HAHH 2BX4A 1HLTH 1ARCA 4Y7BA 1O2SA 3OYPA 3SV6A 4Q80A 1SL3A 2CJIA 3O8RA 1CVWH 4MPUA 1QBVH 3UR6A 1L1JA 5CHAB 1Z8IB 4RSPA 1TOCB 4X6NA 1HNEE 1ELVA 5JBBS 2BOKA 1ZPZA 1SGTA 1QQ4A 4XFQA 4Y10E 3ATMA 2FM2A 2VVCA 4AGKA 1LHCH 2V3OH 1OXGA 3P8FA 3VGCC 2A2QH 3I77A 2AFQB 2UUJB 1ELAA 4O97A 1ZHMA 3BTTE 4ZHMU 4BANB 5C1XA 2AMQA 4CRBA 3BIVH 3LJJA 1BJVA 1G3EA 1Y3WA 1OX1A 1EUFA 2NWNA 2A32A 1SOTA 5BPEA 1O5AB 1SG8B 3SO3A 4GHQA 1XUGA 4JYVH 1ESAA 2JH0D 1LHEH 5EQSA 3ZZ5A 1SGQE 3A84A 1ZYOA 5J4SA 1DY8A 1UK3A 2UWPA 2XBXA 4YO9A 1BJUA 2H5DA 1AWHB 1IQHA 1VJ9U 1LKBA 1HAOH 5J4QA 4E05H 1UMAH 2FX4A 2WV4A 1C1UH 1TB6H 1BITA 4X1QU 3RU4E 5GDSH 1C1MA 3EE0B 2FOAA 4GVUA 1ZTLA 2FOHA 4CRGA 2QXJA 5PTPA 1SB1H 1W2KH 4XE4A 4XBDA 3SV9A 1OYTH 3A7YA 3RLWH 1SMFE 4B2AA 8GCHG 4ESTE 1TRYA 1QA0A 1O34A 2C4FH 4CH2B 2CHAB 4NIXA 1Z1JA 1EASA 3TLOA 4ZROA 2GT7A 1XXFA 2TGPZ 3EA8A 2H1UA 1A5IA 5DP8A 2Y5FA 1BBRK 2OP9A 3KNXA 3VXEH 5ABWA 3SU3A 1P2KA 1TE0A 2V6NA 1J9CH 3M5MA 1ZZZA 1ELDE 4PROA 2HNTC 5LGOA 1YPLH 1TALA 1PYTC 1NROH 5IYTA 3TU7H 2CV3A 1YPHC 1NRNH 5E0HA 3AASA 1AY6H 3LOXA 4AN7A 4CBNA 1GL1A 2ZGJA 4LOYH 3OX7U 3ZZ7A 4A1TA 1T8NA 1AUJA 1SGFA 2CGAA 3RXLA 3UNRA 1ELCA 1ZPBA 2ALPA 5FHTA 4BAOB 2BD7A 1DXWA 1EB2A 1V2NT 1GVLA 1P2IA 1BTYA 4DW2U 4FUEA 3TVJB 3RC4A 1HBTH 2VB0A 2R3UA 1QBNA 1GGDB 1HFDA 3PV4A 1P2OA 4UFFH 4IW4E 1TONA 3QX5H 1EP5A 3TJOA 1F7ZA 1EQ9A 2GP9B 4WXVA 2BQ6B 1V2ST 2GCTC 4A1VA 1HJ9A 1KY9A 3JZ2B 1QBOA 4AG2A 1OP8A 1EAUA 4H6TA 2FOBA 3EQ0H 1Y3VA 1T7CA 3BG8A 2EI7A 4INHA 2GV7A 2VGCB 1NFYA 1KTSB 2AGIX 2BD3A 2OBQA 1MTVA 1W10U 2H9TH 1KXEA 5GJ4B 5TJXA 2Z3CA 1GJBB 2GZ7A 1W3CA 1ORFA 1DOJA 4Y8ZA 3HGPA 4IC6A 2AEIH 1T4VH 5C5NA 4MPVA 2PTNA 1BCUH 1LMWB 5C2ZA 3O8CA 1EP6A 2GD4B 4LZ1H 3ZVCA 3A7TA 4UFGH 1EATA 5FPTA 3Q00A 2BD4A 1LVOA 1BTHH 2SNWA 1V3XA 2A45B 2OD3B 3U8RH 2C3SA 3STJA 1P03A 2SGFE 2V3HH 1GBLA 3PTBA 1QA7A 1GBBA 3U69H 3MHWU 2R2WU 1ETRH 2Y81A 3S7HB 4HGCA 4FUHA 5AHGH 1V2UT 2ZTZA 2ANYA 1FONA 2W3KA 4IS5A 4BAQB 4B73A 3STIA 1VCWA 4D8NA 2BX3A 1EJNA 1MD8A 2O8UA 1A3EH 1P01A 2FP7B 1W13U 3S9AA 1YGCH 4BAKB 2JETC 3RMNH 4CRFA 4RKJB 4F4OC 1V2VT 3AAVA 4X8TH 1QQUA 1ESTA 3GCTF 4MPXA 3BTEE 4FU9A 1HAPH 4LXBH 1CO7E 3A8BA 4BXWA 1A61H 3UTUH 2G4UA 3SQEE 2AMPA 4IN1A 3A81A 1TRNA 1TMTH 5JPMH 2FZZA 2TGAA 2VU8E 1NM6A 5DK1A 2DE8A 1P04A 3P8OA 3ZZ6A 1EZUC 5A0AE 1Z7KA 1SLXB 3F9EA 2VVVA 2P8OC 1RJXB 5CE1A 1LTOA 3SNEA 3RXFA 5I25A 5A09A 5DP7A 3EGKH 4X2YA 4O3TA 5T3HA 3RC5A 2SGDE 1DITH 1GI8B 2PTCE 1RIWC 3SU1A 3HATH 2WPMS 2GVFA 1W0YH 2FOEA 2H6MA 3BG4B 1UHBA 2WPJS 3QGJA 2A4GA 1YPMH 3BTME 4X6MA 3GYMA 1GJ4H 1SGDE 3LGIA 1TX7A 2F91A 3TJNA 3K6YA 1AUTC 1P02A 3RM0H 2GZ8A 1HAIH 3SOSA 2GDDA 1AB9C 1F2SE 1SGCA 2ESTE 1OS8A 4X2VA 4DG4A 4MTBA 4GSOA 4ZH8A 1O3IA 1GBFA 1P2QA 4UFEH 3TGIE 3ZZDA 3RXJA 3TK5A 1CHOG 1UTOA 1L0ZA 1GMDG 2A5KA 1HGTH 3U1IB 6CHAB 3L33A 1Y8TA 4K1TA 2ZPQA 3ZYDA 3KIDU 1LPKB 2Y7ZA 1GHBG 1O3KA 2EC9H 2XNIA 3LH1A 2FXRA 3PMAB 5DP6A 3SHCH 1IQEA 1CGJE 3LGYA 1MTNC 3HGNA 3RDZA 3TK6A 3PWBA 1TMUH 5C3NA 1O33A 1U6QA 1C1WH 4GCHG 4XOJA 1ZTKA 1CA0C 2ZFQH 4K1EA 1AFQC 1EKBB 3QWCH 5F8ZA 4ZKOU 1Z6JH 2OQUA 4NIYA 1LHFH 2J4IA 3T27A 4OS5A 3M37A 3I78A 2ZPSA 2Y7XA 1O5CB 3M36A 1G3BA 2B7DH 4Y11E 3W95A 1INCA 1SQOA 3GCOA 5F8XA 1E36B 1P05A 3TNTA 2WPKS 2ZP0H 1S85A 2K1QA 5F8TA 1W14U 2XRCA 2SGPE 4MPWA 3UIRA 4ABFA 1E0FD 3UOUA 1TRMA 3D62A 3Q3KA 3E8LA 2NU3E 5GIBA 1AE5A 3T5FH 3P17H 1QCPA 3KQCA 1BTPA 1O2PA 4ABIA 2EI6A 3UNSA 1KXBA 1BOQA 1V2OT 5JB8S 2PKAA 3SI3H 4AFUA 1CSOE 1SGIB 1FIZA 3T26A 3KQEA 4MNYA 3NK8A 1EPTC 1XUJA 1CQQA 1RD3B 3MH4A 3F6UH 3MO9A 5BRRE
chains in the Genus database with same CATH superfamily
2XBWA 3KYGA 2F9UA 3GICB 4DJZB 3PB1E 1UTQA 1T32A 1ZHRA 1JBUH 1C4Y2 2JH5D 1VGCC 4Y7AA 1DT2A 4JZFH 2KCOA 8GCHF 3URDA 2KFWA 4OGXA 4TSFD 4BAHB 2OC0A 3L3TA 3UAIC 4MDSA 5JBCS 1XXDA 4SGAE 6LPRA 2F4LA 1GG6B 2UWLA 1O5BB 3TITA 3A8CA 1O2HA 3CENA 5A0BA 3RXPA 3V7TA 2UWOA 1VZQH 1D6RA 1F0UA 1LO6A 3BTHE 3NPSA 1C9TA 1FQ3A 3OFND 1GCDA 4RI0A 3PYHA 1P3CA 1QL9A 1GJ7B 1O31A 3SJ9A 2P3FH 1YLCA 1ANCA 2WV5A 3LC3A 4DY7B 1QTFA 1IQJA 1UHBB 2AMDA 1GWAA 3KHVA 1SC8U 2RA0A 3NCLA 1H8IH 3N7DA 3PLBA 1C1SA 2OINA 1KYNA 1KDQA 5HXFA 2BVSH 1YPHE 4ISIH 2FTMA 1S82A 2BDBA 3MNBA 1MKWH 1Z71A 3SUEA 4XBBA 2ZCHP 4JZDH 1C2GA 1L2EA 4YM9A 1P2JA 2Q6DA 2QV1A 1C5NH 1FJSA 1QFKH 2BLWA 3LGVA 4ZKRU 1JOUB 4ZXXH 1ZGVA 3T2NA 3BEFB 5DG6A 1WAYB 1CGHA 1SR5C 2GMTB 4WWYA 3SJOA 4THNH 1C5UA 4MVNA 1H9LB 1P3EA 1AVGH 1K1JA 2ILNA 3RXBA 1KMHB 4B1TA 2ZHDA 2RCEA 1HDTH 4ACAA 5JYIA 4MNWA 3M3VA 2WPLS 1TAWA 1ZRBA 2J92A 2SGEE 1AN1E 3TK9A 1MU6B 3GOVB 1BT7A 3SNBA 1FLEE 1KXCA 4HG6A 1G9IE 6ESTA 1O3NA 2AIPA 1E35B 2WYJA 1ZRKA 5T6GA 4K2YA 5DKMA 2KX4A 3LGTA 1EJMA 2GX4A 4CBOA 1BMMH 4BOHA 5EQQA 2QCYA 2VINA 4FUDA 3ZIAD 1SGYE 1S83A 3E16B 2ZTXA 3BF6H 5HGGA 1TFXA 2J9NA 2H9EH 1GHAG 1MZAA 3R3GB 2IN2A 2BD9A 1UTLM 1ESBA 3AAUA 1YCPH 4HFPB 1O37A 3H7OA 3B23B 2BVRH 2HLDD 4U2WA 5AFYH 2FOGA 1HAZB 1NRPH 1C1VH 4O3UA 4I8HA 1TPAE 3SU2A 1QY6A 5EIYA 1HJ8A 2A4OA 1K1IA 1GJ6A 2SGQE 2FLBH 2PKAB 2BDCA 4Y8YA 2FPZA 1AO5A 1BHXB 3GDSA 2QGRA 1YKTA 2BB4A 1MKXH 2IOTA 1MQ5A 3F9FA 3PROA 3OEED 2XC5A 4WMFA 1RS0A 1JXPA 3MYWA 3SU5A 2KZ4A 3MTYA 2BD5A 1XUKA 3V3MA 3SUGA 2VIPA 2ZECA 1NT1A 3BTDE 3FP7E 1BMAA 5EW1H 4BXSA 2CF8H 3QGNB 1PQ7A 3ZVDA 1EX3A 1M9UA 3SNDA 4K8BA 1A0LA 1S6HA 2QYIA 5FL7D 2NU0E 1XUIA 3PMHB 1CBWB 1O2MA 2BDGA 3PWCA 4Y71A 3S9CA 1ZTJA 3QO6A 2XC0A 1QGFA 2HRVA 1EAIA 1GHWH 1WDIA 1GJ8B 2BY6X 3ZVFA 3SBKA 2QC2A 2Z9JA 1A5GH 1O35A 1DPOA 3GDVA 1EJAA 4Y0YE 3ZVBA 4ISOA 2J98A 2ZU3A 2QY0B 1SFIA 4F48B 2ZFTA 1CT0E 2ZHEH 4TT3D 2ODYB 1N6XA 2F9BH 1V2RT 2J38A 1P2NA 1TNJA 2IPHA 1IHTH 5K0HA 3DSOA 1AVXA 1DY9A 1GBDA 1GVKB 5GCHF 2R0LA 4FUBA 1KDQB 1MTWA 1V2LT 3GCHC 1CHOF 3A87A 3ZZBA 2K8IA 1NTPA 2J95A 1GMDF 4NFEA 4NFFA 3DUXH 2G52A 1WTHD 2BD8A 5FCKA 1DUAA 2RDLA 1PQ8A 2VWMA 1O2RA 2EQNA 2ZU5A 1GHBF 3LH3A 4DIHH 4CR9A 3M7TA 1UTNA 2ZDKA 3NKKA 4JZ1A 3KEEA 3RXVA 3LDXH 3VB4A 3HPTB 1HIAA 3NWUA 3UWIA 2B5TB 4CHAC 2RFKC 4VGCB 2Y6TA 5G4BA 1A2CH 2TGTA 5DP5A 3MU5A 1AE8H 1YPKH 1UK4A 1YBWA 4B74A 1BTUA 2FS9A 1NU7B 4I86A 1NBMD 1RRKA 4JMYA 3SZNA 1HXEH 4GAWA 2UUYA 3MU8A 2QIQA 2SFAA 3RMLH 1DM4B 1N8OB 2A4QA 2YMSC 2BDIA 4ZKNU 2ZFPH 1GJAB 1O5EH 1OWHA 1NS3A 4B75A 4H6SB 2HPQH 2BY9X 2ZNKH 1C2LA 1S6LA 2BD2A 2ZDLA 4INKA 1AD8H 1TABE 2PR3A 1UCYE 1ELFA 1BMLA 2HNTF 2VH6A 2G5VA 3BIUH 1DUEA 1ELGA 2QN5T 1C5OH 1MUEB 1O30A 1QRZA 1PPCE 5FAHA 1P9UA 1ARBA 2EI8A 1A1RA 1EZQA 3A89A 2G00A 1ZMNA 3QZQA 2PP6A 4MNXA 1FDPA 2GGVB 1GJ5H 1KLJH 3A80A 1HB0B 5F6MA 1SLWB 4WXIA 1B5GH 1S5SA 1ELTA 2W5EA 2OC8A 2BZAA 3MH6A 2G81E 1GI5A 1ABJH 3A86A 2O8TA 2BMGB 3OU0A 4FVDA 4E7NA 5JDUB 1LQDB 4RKOB 4JK6A 1C5MD 2P3TB 3NRLA 1Z1IA 1XMNB 4J1YA 2V3MA 2OLGA 4Q4LA 3RXDA 2F9OA 3NZIA 1BUIA 1OP0A 1XM1A 1DLEA 3WW7A 4IC5A 3VXFH 3ZZ3A 3A85A 2GCHG 4DGJA 2Z9IA 1P11E 4YOIA 1MH0A 2IJOB 2VVUA 2FI3E 3K9XB 5EOKA 2A7HA 1FAXA 1MD7A 1F92A 1CE5A 4H4FA 1GBJA 2R3YA 3TH4H 1MZDA 2KAIA 1DX5M 1OYQA 3BEIB 3U8TH 3U28C 1LVMA 3PMJA 2TBSA 1P10A 3OTJE 2ALVA 1DVAH 4KGAA 1PYTD 4D76A 1D3DB 5FCRA 2ZDNA 1C5SA 3OEHD 1BBRH 4ISHH 3ZZ9A 3E0PB 3MOCA 1NN6A 1AMHA 2ODQA 1C5LH 2ZDMA 4Q7YA 3RXKA 1S0QA 2V0BA 3MNCA 3W94A 3F0PA 1TGBA 2G5NA 1UTPA 3VB7A 2J98B 4MG3A 1VCPA 2ZU4A 1O3PB 3RMOH 1Y3UA 4DIIH 3QZRA 1IQIA 3RXCA 3ELAH 2YNBA 2VIQA 3UUZA 3V13A 3Q3XA 2ULLA 3TNSA 1KIGH 1L4ZA 4GLYA 3F0OA 1FAKH 1J16A 1CHGA 1G30B 4NWLA 3DSPA 3ATIA 1QIXB 1GI7B 1TBRH 3LJOA 1PQ5A 1NFUA 1SVPA 4TWWA 2ZCKP 3VPKA 2PKSC 1LDTT 4YT6H 1XVOA 5HM9A 1KXDA 1UK2A 3PO1C 5JBTA 1O3EA 2D1JA 5CDFE 3VEQB 3DFLA 1O3AA 1IAUA 1QRXA 4TY7A 2C8WB 3DCLA 2VNTA 2DE9A 2WPIS 1LCYA 2YNAA 2O9QA 4FUIA 4X1SU 1AI8H 1O5GH 4XRNA 3EA7A 2FI4E 1O2OA 2Z94A 1WV7H 5DPAA 1GMCG 3VB6A 3QLPH 1MQ6A 4NA7A 4YESB 3DD2H 4M7GA 3FP6E 1O32A 1UCYK 1HIAB 4ZAEA 3H7TA 1QB6A 1HJAC 3BTFE 4B76A 1BTWA 3UREA 2OBOA 1TWXB 3KQ5A 1GBMA 3KGPA 1SGEE 2ANMH 4Z6AH 1SPJA 3SJ8A 3LIWA 7KMEH 3SQHE 1JRSA 3VGCB 4FU7A 1GCTC 3T29A 2W7UA 3PMBB 4YT7H 5EW2H 1HUTH 3BV9B 2BYAX 4FUGA 1C2EA 1TGCA 3SGQE 3ZVEA 1IQNA 1UTJA 4NG9H 1Z8JB 3EAJA 1C5XB 1GHAF 5HYOA 1GMHG 1BMFD 1OKXA 3LU9B 1YF4A 2CK3D 4AFSA 3E90B 2FDAA 3DFJA 4UONA 4CR5A 3TGKE 1ZSKA 3NXPA 1B0EA 2AH4X 1MAXA 1O38A 4YZUA 3ATWA 4DT4A 1MAYA 2B0FA 3RXQA 5GXPA 4Y79A 1K28D 2FESH 4A7IB 5AFZH 2Q6FA 3S7KB 2Q6GA 2RG3A 4H42U 2A7JA 2PV9B 2V35A 1QJ7B 1C1TA 2AIQA 2GKVE 5C0UA 1GJDB 1P2MA 5DP4A 1HPGA 1SKYE 5FBEA 1CT2E 3N7OA 2QXIA 2AERH 4Q7ZA 1QZ8A 1AQ7A 4Q7XA 1H9HE 1SGFG 4ABEA 3LC5A 3KN2A 2O8WA 1PPBH 3CS7A 3A83A 4IN2A 4WH8A 4O9VA 1V2QT 2BVXH 3SW2B 3OSYA 5CHAC 3O8BA 1WBGB 3EA9A 4AFZA 1HXFH 3KL6A 1THRH 3RXRA 1OOKB 1WOFA 1JRTA 4GPGA 1TA6A 4KTCA 3MU4A 1W0JD 3GY3A 1AIXH 3A82A 4I8JA 5E2OA 5AVDA 5FX5A 3SJIA 2KAIB 1F0TA 5DN6D 2HLCA 1W0ZU 3SGBE 1XVMA 1GDNA 2C90B 4X6PA 1VJAU 1EFRD 4R8TB 4XD7D 2R2MB 5EXNA 3ZVGA 3UR9A 1PQAA 2OC1A 4OM9A 3RXMA 1V2PT 1ANBA 2GT8A 1UCYH 1ZOMA 1Y5UT 2XBYA 1PPEE 4AYVB 3PV2A 3M35A 4TY6A 1DICA 3RUOA 5EODA 3TIUA 3VG8A 1NBME 1A0JA 3LKWA 2M5TA 3HKJB 2HVYB 1P8VC 3V0XA 2F43B 1O2XA 3ATLA 5EPNA 3U8OH 1FIWA 1F5LA 4JZIA 3AW1A 1FV9A 1EB1H 1TQ0B 2OQ5A 1HAVA 3RLYH 9ESTA 1MBQA 1O2YA 4NA8A 5K7RA 4ABGA 4B6EA 2XC4A 1LVYA 3RU4T 5C5OA 1FY4A 3F2HA 1P57B 2HPPH 2ZQ2A 2GCTB 1GJCB 3FAOA 4NSVA 5DSFA 1GI6A 1IHSH 4WJG2 1GI1A 1ELBA 1Z8GA 1HAXB 1ETSH 2XW9A 3MH5A 2P59A 5C67A 3O8DA 3F1SB 2QXHA 3ZYEA 1O3GA 1SHYA 3P8GA 3ZV9A 1GBCA 3GY8A 2CHAC 4FUJA 1OWEA 3OY5U 3IG6B 1NC6A 5FPYA 1O2IA 2B9LA 2Z9GA 3MO6A 1TGTA 4B2BA 1VITH 2ZWLH 3OY6U 1TQ7B 3H09A 3UY9A 1JIMA 4ZXYH 2GTBA 3SORA 5DP9A 4BTIB 1UO6A 1FMGA 1ZSLA 3M3TA 2Y82A 1CU1A 1W0KD 3RMMH 4D7GA 1VCQA 1FI8A 3Q76A 3T25A 1C9PA 4GHTA 3OAAD 2ZGBH 3CP7A 2BXTH 1W7XH 1O0DH 3FVFB 2ZIQH 2ZGHA 4CRAA 1LKAA 1P0SH 2J97A 5ESBA 3ATKA 2HNTE 1F5RA 1SQAA 4JCNA 4ABBA 1XKBC 5I46H 4ISLA 1NO9H 1AHTH 1C2DA 1YP9A 2BTCE 1WYKA 2VWLA 2WINI 1O2GH 3SNAA 1LQEA 4K60A 1XX9A 3PLKA 4WVPE 1DSTA 1NESE 8KME2 1C5QA 1GGDC 1PPHE 1V6DA 2SNVA 4XSKU 3MO3A 3U1JB 1EPTA 4Z0KA 2ZI2H 3TH2H 3F3BA 2JETB 3ZZCA 1SQTA 4YTAA 1LVBA 1BRBE 1B7XB 1TA2A 1O2TA 1FN6A 1QR3E 2Y5HA 2P94A 2AHME 3BEUA 5FX6A 1T4UH 1BIOA 2VGCC 1PJPA 2QA9E 1O3DA 2O8MA 4Q63A 3F9HA 4WF8A 3BN9A 1YM0A 1QHRB 1L4DA 1TPPA 2GCHF 1BRAA 3RXSA 4ASHA 2PSXA 2XOKD 2PHBA 1W12U 5LPFA 1SGPE 2FTLE 1O2JA 5B6OA 2BQ7B 2P8OB 5JB9S 2XYAA 3MNSA 1ZMJA 1ANDA 1GBIA 3RXTA 3SZEA 2CN0H 2PGQB 1MTSA 2ZC9H 3SJKA 1ZSJA 5DJ7A 2HWLB 1A0HB 1O3LA 1KLIH 2L6OA 2ZFSA 1RIWB 1AFEH 4KKDA 1TNHA 1ID5H 2XWBI 2VIVA 1PPZA 4HI3A 3MU0A 4MQAA 2WV9A 2VIWA 4K3JA 3DHKH 1G2LA 4KP0A 1ZPCA 3ODFA 4UD9H 3QUMP 4UFDH 2ZU1A 4P02A 1O5DH 5E2PA 7GCHG 5L30H 5ESTE 3T28A 1IQKA 1C2KA 5JBAS 1C5RA 2RA3A 3ENSB 3ODDA 1WSSH 4KTSA 4WMDA 3TGJE 2D2DA 1AB9B 1UVUH 1T8OA 3SI4H 2OC7A 1GI2A 4NCYA 5E0GA 1L1GA 2YOLA 4I8LA 4X8VH 1HCGA 1ZJDA 4JK5A 1WU1A 1FN8A 1T8LA 3ZZAA 5E0JA 1HAVB 1K1MA 2FO9A 1BQYA 3FP8E 2XBVA 3SU0A 4IMQA 4TPYA 1QJ1B 3MH7A 1C1QA 1DLKB 1K22H 2ZZUH 5LPEA 4HTCH 4M9FA 5FPSA 1O2VA 4XBCA 3FO8D 4UE7H 5EXMA 1OSSA 4TPIZ 3JZ1B 1MBMA 2CMYA 3GY4A 2BOHB 2F83A 3Q77A 1ZJKA 1MTNB 4OS2A 1DWEH 2J5UA 4BTUB 4BNRA 3R0FA 4CREA 1GMCF 2LPRA 1BTZA 1D6WA 3MNXA 2C93B 1HAYB 1GBEA 3F2FA 2JIZD 1GBTA 1CA0B 1NRRH 4K69A 1AFQB 1DWBH 2A1DB 3RXOA 1QRWA 4AFQA 2ANKH 2FOCA 5FXLA 4WY3A 1YLDA 1C4V2 4YLQH 1WXRA 1O2QA 1TIOA 1C2HA 3AK5A 5EJLA 3HK6B 2BY5X 3BG4C 5L2ZH 1ZMLA 3A7VA 3ZZ4A 1D3TB 2G8TA 2ZTYA 3AW0A 3P95A 2OTVA 3SHAH 1C2MA 1S6FA 2XXLA 1GPZA 2BY7X 2VJ1A 4INLA 5HMAA 5C94A 4Y6DA 1TNGA 2CXVA 3QN7A 6GCHG 1ZLRA 2VWOA 4IGDA 4X6OA 1GMHF 3A8AA 4KELA 1NFXA 1UW7A 1O36A 1N1LA 2ZGCA 1O2NA 2XWAA 2ZPRA 5L2YH 3QDZB 3BTGE 3FFGA 2BDHA 4K8YA 1NRSH 4IBLH 1SHHB 4I7YH 3S0NA 1C5VA 5EU8A 1AKSA 1THSH 4NA9H 4RN6A 3FN8A 4X8SH 1NZQH 6CHAC 5LPRA 1D3QB 4B71A 1AZZA 3FZDA 3IWMA 4X2WA 2JDID 1BA8B 2JH6D 4FUFA 5TCAA 2BLOA 1EPTB 1TPSA 3VB3A 1PFXC 1C1OA 1E34B 1LPZB 3NUMA 4IMZA 1LHGH 1IQLA 4X0WU 4A5TS 3B9FH 3RXUA 5T1VA 5SGAE 2QXGA 2FYQA 4AORA 3G01A 1DWDH 4I8GA 1VGCB 4GCHF 2L74A 1G36A 3KF2A 2HVXA 1J8AA 1K21H 2WUCA 1SLVB 2PLXA 1BZXE 1QB9A 3TPIZ 4BTTB 1JWTA 5EJ1A 2JKHA 2EA3A 1RFNA 1KTTB 2H2ZA 1DFPA 2TPIZ 1UVPA 4R0IA 1OWDA 1ELEE 4FVBA 1FY1A 2ZDVH 4JYTA 1GHZA 1TBQH 2R0KA 1G2MA 4MLFB 3SU6A 1Y3YA 3A7XA 3S9BA 1FY3A 3Q3YA 1QL8A 3ZZ8A 1V2MT 3D49H 3M61U 2J94A 2BLVA 1FPCH 1AVWA 3TJVA 2J34A 2D8WA 4ACBA 2BDYA 4CRCA 1V2JT 1A46H 4BAMB 2BXUH 1DWCH 5EG4A 5GNDA 1O5FH 1VITG 1BRUP 2HALA 1P9SA 4O03A 1SGNE 4F49A 1G32B 1ETTH 3SYJA 1KXFA 4Y76A 1LHDH 2THFB 2I6QA 1DS2E 1GI0A 1ZGIA 9LPRA 3MU1A 2TGDA 4I32A 2ZG0H 2WPHS 1COWD 3FOAA 3LGWA 2F9VA 4ZMAH 1ZHPA 3U98H 1TPOA 4AC9A 1PPFE 1E1RD 2ZA5A 2DUCA 1BDAA 1EXFA 4MNVA 4YOGA 5EGMA 3BSQA 1FXYA 2PWXA 3MQKC 4Q2KA 1MCTA 3UOPA 4HZHA 3UNQA 4TWYA 1SQRA 3EE7A 4XDEA 5EJZA 1TNKA 1OWIA 1XUFA 2PUQH 2ASUB 2AGGX 1AGJA 2W3IA 1K1NA 2BM2A 1WCZA 1P12E 1C2FA 3GY2A 1IQFA 4U30A 5T6FA 2KCYA 1SFQB 2QF0A 1Q3XA 2QF4A 4OS1A 1C5PA 4OGYA 1GG6C 3MFJA 3ESTA 4X2XA 2ZU2A 2FEQH 3ZVAA 1K2I1 1GHYH 2AGEX 4U32A 3K65B 3WY8A 3RXIA 1AZ8A 2YMSD 4OS6A 4RT0A 3GISB 2ZGXH 3GYLB 1UVSH 1V2KT 1GHXH 4A92A 2JJ2D 1DXPA 5KECA 4RT1A 2ZHFH 4UDWH 5DP3A 4UEHH 2A5IA 1FPHH 1MU8B 8ESTE 5GPIB 1IQGA 1E38B 1V2TT 3P70B 1PPGE 1H8DH 3RP2A 2UUFB 1C2JA 1BMNH 3UPEA 1NRQH 2O8LA 4B2CA 5CHBA 2R9PA 1O3MA 1JIRA 2FODA 3LT3A 2A2XH 4OS7A 3GY5A 2GZ9A 1G3DA 3SUDA 4YOJA 2PUXB 1O2LA 1TX6A 2WZQA 2Z6BD 5A8XA 2F9NA 3KQDA 1AKSB 1GJ9B 2A4RA 1C5TA 3LONA 3D23A 1C5YB 5ETXA 1HRTH 5DO4H 1Y5AT 2ANWA 2VIOA 3M3SA 4DOQA 3A8DA 1NY22 3T62A 2GMTC 3I29A 3M5LA 1Z8RA 2ZFRH 1C1PA 2NU1E 1THPB 5IK2D 1WQVH 2J2UA 4ABJA 2UUKB 1T31A 4Y0ZE 2WHXA 2EEKA 1YPEH 1XUHA 4X8UH 1Y5BT 1S81A 3LGUA 5HIZA 2G51A 1K9OE 4AB9A 2V7QD 4DVAU 2ZF0H 3TH3H 5HIYA 4AG1A 1K0HA 5B6LA 2Z3EA 4SGBE 5A2MH 2OK5A 3SU4A 1CT4E 1HYLA 1H9IE 5C0TA 1A3BH 2TRMA 1CGIE 1KLTA 2QF3A 1KSNA 1P09A 2B8OH 4E7RG 1SOZA 1C5ZB 4I33A 3IITA 2ZKSA 3RXGA 1EAXA 4D9RA 4NGAH 7GCHF 1Y3XA 1B0FA 4JZEH 4AB8A 3MI4A 2BY8X 2HGTH 3L6PA 3URCA 1RXPA 4X1PU 4CH8B 2RDEA 1GHVH 2FS8A 1UTKA 2OCVB 1TNIA 2W26A 1EOLA 3P92A 2Z9KA 4DT7B 4LZ4B 4WMEA 3HKIB 2G4TA 2QE7D 2ZEBA 2CF9H 1GVZA 2FIRH 1C1NA 3GCHB 3K6ZA 5GCHG 4A6LA 1WUNH 3RC6A 2GV6A 1YCPM 3GY6A 5IDKA 1G37A 4NZLA 1NFWA 3W1EA 4D7FA 1VR1H 1RTKA 5HKKD 3F2GA 2FOMB 2LNCA 1FY5A 3RXHA 2Y5GA 1FZZA 1N6YA 5L6NH 1J15A 3GDUA 1GI4A 2FWWA 2FLRH 1JMOH 1C5WB 1QURH 2PW8H 1S0RA 5A0CA 1S84A 2H5CA 2WUBA 1IQMA 3A7ZA 5HM2A 1AU8A 3QK1A 2KR7A 3P6ZB 1OWKA 3KYFA 4CHAB 4K5ZA 1C2IA 2ZHWH 3QTOH 4FXGH 4YLUA 3BTKE 1O3OA 3LPRA 1OPHB 4A1XA 2OXSA 2AYWA 1F0SA 1TMBH 3SN8A 3S69A 2ZDAH 1D9IA 1CBWC 3GY7A 3EYDA 2SGAA 1Q31A 1TGNA 1BHXF 3UQVA 1W7GH 4ZKSU 5H4IB 3SNCA 4ZCNA 1Q2WA 1MTUA 3U9AH 2P93A 2YMSB 2Z7FE 2I6SA 3EDXB 5F53A 1O2WA 1O3HA 3ITIA 3SV7A 1OP2A 5C20A 2FYRA 1MKWK 3M7UA 4QT8C 1F0RA 1O3CA 1KXAA 1OWJA 3OTPA 6GCHF 1GDQA 1RTFB 2FI5E 4DCDA 5A8YA 1EAWA 1TX8A 4AX9H 3SUFA 1J17T 3C27B 4NIVA 4X1NU 3V12A 1WQSA 5DGJA 1FUJA 1GI9B 2XCFA 5T6DA 3RU4D 1GI3A 3CNRA 3RM2H 5GWZA 1A7SA 2ZHQH 1K1OA 1QB1A 2G55A 3TJUA 5EPYA 1O3FA 1YYY1 7ESTE 4ABDA 1O39A 2GJGA 3DT0H 3N7EA 3OE7D 4X1RU 1MMJN 3PM3A 4WH6A 1E37B 2PGBB 2ZCLP 2VH0A 2NU4E 1TYNA 2W7SA 1YPJH 2XCNA 1H8HD 4LK4A 1Z6EA 1BRCE 3H5CB 1TOMH 1NU9A 2FOFA 2STAE 3PLPA 1SBWA 1T8MA 1SSXA 1YC0A 1YPGH 3MMGA 4FUCA 2BHGA 1C1RA 4VGCC 5E8EH 3SGAE 3PV5A 1RTLA 2BQWB 1GBHA 1UTMA 1A4WH 1EZSC 4GUXA 3PRBA 3UFAA 4AZ2B 1NPMA 1O3JA 1UJ1A 3SV8A 4OS4A 1EZXC 1WTGH 3B8JA 4FOUC 4YXWD 5C1UA 1K1PA 2ODPA 5F03A 3UB0A 1HAGE 2VBCA 3ZV8A 1TBZH 1YCPK 1XKAC 2BDAA 1N8OC 1QNJA 1ZR0A 4NZQA 2C8YB 2PFEA 1O3BA 2C8XB 2A5AA 1W8BH 1FY8E 3M5OA 3A88A 4ZHAA 3SV2H 1VITF 1FNIA 2VWNA 3UQOA 3KQBA 5FBIA 5C17A 1TNLA 1RGQA 5TCCA 4CRDA 3PRDA 1H4WA 3KCGH 4U01A 3QTVH 1O2KA 4B6FA 2D26C 1TGSZ 1DANH 1GDUA 4E06H 2ZQ1A 1ANEA 2TIOA 4I8KA 1MKXK 3GCNA 5A8ZA 3E6PH 1CA8B 4D9QA 4ZUHA 2XTTB 2PKSB 1TLDA 2HOBA 3VFEA 3PO1B 3GCTG 1DDJA 2F9PA 4JYUH 1G3CA 3F68H 1BB0B 1LPGB 4Y8XA 2F3CE 2C8ZB 4KTUA 1QL7A 2OUAA 4FU8A 2Y80A 3BTWE 4NWKA 1IOEA 2Q1JA 1H1BA 3E1XB 1UVOA 2Z3DA 3E91A 5AF9H 3PTNA 3WWFA 1AWFH 2H9HA 3M7QA 3MWIU 2A0QB 1Y59T 4AOQA 1W11U 3K2UA 1SI5H 1HJAB 4ISNA 2P95A 2QAAA 3HK3B 1MCVA 4TYDA 2WPDD 1EOJA 3CS0A 5EQRA 2GDEH 7LPRA 2FX6A 2WYGA 2IJD1 1O2ZA 1J14A 3E3TA 5EXLA 3DA9B 2KCAA 1L1NA 1HV7A 1D3PB 1GBKA 3D65E 2BLQA 5C1YA 5LH8A 1YLNA 8LPRA 1GCTB 2P16A 1DE7H 2FMJA 4J2YB 1ABIH 3RXAA 1GL0E 1UVTH 4K1SA 1F5KU 4AYYB 3E0NB 4NIWA 4ABHA 2A31A 2JJ1D 1BTXA 2W6ID 1C4U2 2BZ6H 4NSYA 1BBRE 3FANA 4DURA 3FZZA 4ZHLU 3BTQE 3RXEA 5CMXH 1DSUA 2A7CA 2AS9A 2QF5A 1A5HA 1QJ6B 3GS9A 3AVZA 1GBAA 2STBE 2IPQX 3VB5A 2NU2E 1D4PB 1SLUB 2VIDA 4AGJA 3F9GA 4ABAA 4I31A 2ZFFH 3A7WA 3UWJH 3M5NA 1K1LA 1O2UA 1V2WT 1X7AC 2P3UB 2Z9LA 2ZO3H 2PSYA 1ACBE 1P06A 3C1KA 3P8NA 1SGRE 1HAHH 2BX4A 1HLTH 1ARCA 4Y7BA 1O2SA 3OYPA 1E79D 3SV6A 4Q80A 1SL3A 2CJIA 3O8RA 1CVWH 4MPUA 1QBVH 3UR6A 1L1JA 5CHAB 1Z8IB 4RSPA 1TOCB 4X6NA 1HNEE 1ELVA 2KCPA 5JBBS 2BOKA 1ZPZA 1SGTA 1QQ4A 4XFQA 4Y10E 3ATMA 2M2AA 2FM2A 2VVCA 4AGKA 1LHCH 2V3OH 1OXGA 3P8FA 5KGOA 3VGCC 2A2QH 3I77A 2AFQB 2UUJB 1ELAA 4O97A 1ZHMA 3BTTE 4ZHMU 4BANB 5C1XA 2AMQA 4CRBA 3BIVH 3LJJA 1BJVA 1G3EA 1Y3WA 1OX1A 1EUFA 2NWNA 2A32A 1SOTA 2WSSD 5BPEA 1O5AB 1SG8B 3SO3A 4GHQA 1XUGA 4JYVH 2K0QA 1ESAA 2JH0D 1LHEH 5EQSA 3ZZ5A 1SGQE 3A84A 1ZYOA 2KM0A 5J4SA 1DY8A 1UK3A 2UWPA 2XBXA 4YO9A 1BJUA 2H5DA 1AWHB 1IQHA 1VJ9U 1LKBA 1HAOH 5J4QA 4E05H 1UMAH 2FX4A 2WV4A 1C1UH 1TB6H 1BITA 4X1QU 3RU4E 5GDSH 1C1MA 3EE0B 2FOAA 4GVUA 1ZTLA 2FOHA 4CRGA 2QXJA 5PTPA 1SB1H 1W2KH 4XE4A 4XBDA 3SV9A 1OYTH 3A7YA 3RLWH 1SMFE 4B2AA 8GCHG 4ESTE 1TRYA 1QA0A 1O34A 2C4FH 4CH2B 2CHAB 4NIXA 1Z1JA 1EASA 3TLOA 4ZROA 2GT7A 1XXFA 2TGPZ 3EA8A 2H1UA 1A5IA 5DP8A 2Y5FA 1BBRK 2OP9A 3KNXA 3VXEH 5ABWA 2EY4C 3SU3A 1P2KA 1TE0A 2V6NA 1E1QD 1J9CH 3M5MA 1ZZZA 1ELDE 4PROA 2HNTC 5LGOA 1YPLH 1TALA 1PYTC 4Z1MD 1NROH 5IYTA 3TU7H 2CV3A 1YPHC 1NRNH 5E0HA 3AASA 1AY6H 3LOXA 4AN7A 4CBNA 1GL1A 2ZGJA 4LOYH 3OX7U 3ZZ7A 4A1TA 1T8NA 1AUJA 1SGFA 2CGAA 3RXLA 3UNRA 1ELCA 1ZPBA 2ALPA 5FHTA 4BAOB 2BD7A 1DXWA 1EB2A 1V2NT 1GVLA 1P2IA 1BTYA 4DW2U 4FUEA 3TVJB 3RC4A 1HBTH 2VB0A 2R3UA 1QBNA 1GGDB 1HFDA 3PV4A 1P2OA 1YY3A 4UFFH 4IW4E 1TONA 3QX5H 1EP5A 3TJOA 1F7ZA 2LP6A 1EQ9A 2GP9B 4WXVA 2BQ6B 1V2ST 2GCTC 4A1VA 1HJ9A 1KY9A 3JZ2B 1QBOA 4AG2A 1OP8A 1EAUA 4H6TA 2FOBA 3EQ0H 1Y3VA 1T7CA 3BG8A 2EI7A 4INHA 2GV7A 2VGCB 1NFYA 1KTSB 2AGIX 2BD3A 2OBQA 1MTVA 1W10U 2H9TH 1KXEA 1YWUA 4ASUD 5GJ4B 5TJXA 2Z3CA 1GJBB 2GZ7A 1W3CA 1ORFA 1DOJA 4Y8ZA 3HGPA 4IC6A 2AEIH 3FKSD 1T4VH 5C5NA 4MPVA 2PTNA 1BCUH 1LMWB 5C2ZA 3O8CA 1EP6A 2GD4B 4LZ1H 3ZVCA 3A7TA 4UFGH 1EATA 5FPTA 3Q00A 2BD4A 1LVOA 1BTHH 2SNWA 1V3XA 2A45B 2OD3B 3U8RH 2C3SA 3STJA 1P03A 2SGFE 2V3HH 1GBLA 3PTBA 1QA7A 1GBBA 3U69H 3MHWU 2R2WU 1ETRH 2Y81A 3S7HB 4HGCA 4FUHA 5AHGH 1V2UT 2ZTZA 2ANYA 1FONA 2W3KA 4IS5A 4BAQB 4B73A 3STIA 1VCWA 4D8NA 2BX3A 1EJNA 1MD8A 2O8UA 1A3EH 1P01A 2FP7B 1W13U 3S9AA 1YGCH 4BAKB 2JETC 3RMNH 4CRFA 4RKJB 4F4OC 1V2VT 3AAVA 4X8TH 1QQUA 1ESTA 3GCTF 4MPXA 3BTEE 4FU9A 1HAPH 4LXBH 1CO7E 3A8BA 4BXWA 1A61H 3UTUH 2G4UA 3SQEE 2AMPA 4IN1A 3A81A 1TRNA 1TMTH 5JPMH 2FZZA 2TGAA 2VU8E 1NM6A 5DK1A 2DE8A 1P04A 3P8OA 3ZZ6A 1EZUC 5A0AE 1Z7KA 1SLXB 3F9EA 1VKYA 2VVVA 2P8OC 1RJXB 5CE1A 1LTOA 3SNEA 3RXFA 2W6JD 5I25A 3WWBA 5A09A 5DP7A 3EGKH 4X2YA 4O3TA 5T3HA 3RC5A 2SGDE 4F55A 3N99A 1DITH 1GI8B 2PTCE 1RIWC 3SU1A 2LELA 3HATH 2WPMS 2GVFA 1W0YH 2FOEA 2H6MA 3BG4B 1UHBA 2WPJS 3QGJA 2A4GA 1YPMH 3BTME 4X6MA 3GYMA 1GJ4H 1SGDE 1MABB 3LGIA 1TX7A 2F91A 3TJNA 3K6YA 1AUTC 1P02A 3RM0H 2GZ8A 1HAIH 3SOSA 2GDDA 1AB9C 1F2SE 1SGCA 2ESTE 1OS8A 4X2VA 4DG4A 4MTBA 4GSOA 4ZH8A 1O3IA 1GBFA 1P2QA 4UFEH 3TGIE 3ZZDA 3RXJA 3TK5A 1CHOG 1UTOA 1L0ZA 1GMDG 2A5KA 1HGTH 3U1IB 6CHAB 3L33A 1Y8TA 3DSGA 4K1TA 2XNDD 2ZPQA 3ZYDA 3KIDU 1LPKB 2Y7ZA 1GHBG 1O3KA 2EC9H 2XNIA 3LH1A 2FXRA 3PMAB 5DP6A 4FETA 3SHCH 1IQEA 1CGJE 3LGYA 1MTNC 3HGNA 3RDZA 3TK6A 3PWBA 1TMUH 5C3NA 1O33A 1U6QA 1C1WH 4GCHG 4XOJA 1ZTKA 1CA0C 2ZFQH 4K1EA 1AFQC 1EKBB 3QWCH 5F8ZA 4ZKOU 1Z6JH 2OQUA 4NIYA 5KEDA 1LHFH 2J4IA 3T27A 4OS5A 3M37A 3I78A 2ZPSA 2Y7XA 1O5CB 3M36A 1G3BA 2B7DH 4Y11E 3W95A 1INCA 1SQOA 3GCOA 5F8XA 1E36B 1P05A 3TNTA 1OHHD 1H8ED 2WPKS 2ZP0H 1S85A 2K1QA 5F8TA 1W14U 2XRCA 2SGPE 4MPWA 3UIRA 4ABFA 1E0FD 3UOUA 1TRMA 3D62A 3Q3KA 1FX0B 3E8LA 2NU3E 4P00A 5GIBA 1AE5A 3T5FH 3P17H 1QCPA 3KQCA 1BTPA 1O2PA 4ABIA 2EI6A 3UNSA 1KXBA 1BOQA 1V2OT 5JB8S 2PKAA 3SI3H 4AFUA 1CSOE 1SGIB 1FIZA 3T26A 3KQEA 4MNYA 3NK8A 1EPTC 1XUJA 1CQQA 1RD3B 3MH4A 3F6UH 3MO9A 5BRRE
chains in the Genus database with same CATH topology
2XBWA 2F9UA 3GICB 4DJZB 3PB1E 1UTQA 1T32A 1ZHRA 1JBUH 1C4Y2 2JH5D 1VGCC 4Y7AA 1DT2A 4JZFH 8GCHF 3URDA 4OGXA 4BAHB 2OC0A 3L3TA 4MDSA 5JBCS 1XXDA 4SGAE 6LPRA 1GG6B 2UWLA 1O5BB 3TITA 3A8CA 1O2HA 3CENA 5A0BA 3RXPA 3V7TA 2UWOA 1VZQH 1D6RA 1F0UA 1LO6A 3BTHE 3NPSA 1C9TA 1FQ3A 1GCDA 3PYHA 1P3CA 1QL9A 1GJ7B 1O31A 3SJ9A 2P3FH 1YLCA 1ANCA 2WV5A 3LC3A 4DY7B 1QTFA 1IQJA 1UHBB 2AMDA 1GWAA 3KHVA 1SC8U 2RA0A 3NCLA 1H8IH 3PLBA 1C1SA 2OINA 1KYNA 1KDQA 5HXFA 2BVSH 1YPHE 4ISIH 2FTMA 1S82A 2BDBA 3MNBA 1MKWH 1Z71A 3SUEA 4XBBA 2ZCHP 4JZDH 1C2GA 1L2EA 4YM9A 1P2JA 2Q6DA 2QV1A 1C5NH 1FJSA 1QFKH 2BLWA 3LGVA 4ZKRU 1JOUB 4ZXXH 1ZGVA 3T2NA 3BEFB 5DG6A 1WAYB 1CGHA 1SR5C 2GMTB 4WWYA 3SJOA 4THNH 1C5UA 4MVNA 1H9LB 1P3EA 1AVGH 1K1JA 2ILNA 3RXBA 4B1TA 2ZHDA 2RCEA 1HDTH 5JYIA 4MNWA 3M3VA 2WPLS 1TAWA 1ZRBA 2J92A 2SGEE 1AN1E 3TK9A 1MU6B 3GOVB 1BT7A 3SNBA 1FLEE 1KXCA 1G9IE 6ESTA 1O3NA 2AIPA 1E35B 2WYJA 1ZRKA 5T6GA 4K2YA 5DKMA 3LGTA 1EJMA 2GX4A 4CBOA 1BMMH 4BOHA 5EQQA 2QCYA 2VINA 4FUDA 1SGYE 1S83A 3E16B 2ZTXA 3BF6H 5HGGA 1TFXA 2J9NA 2H9EH 1GHAG 1MZAA 3R3GB 2IN2A 2BD9A 1UTLM 1ESBA 3AAUA 1YCPH 4HFPB 1O37A 3H7OA 3B23B 2BVRH 4U2WA 5AFYH 2FOGA 1HAZB 1NRPH 1C1VH 4O3UA 4I8HA 1TPAE 3SU2A 1QY6A 1HJ8A 2A4OA 1K1IA 1GJ6A 2SGQE 2FLBH 2PKAB 2BDCA 4Y8YA 2FPZA 1AO5A 1BHXB 3GDSA 2QGRA 1YKTA 2BB4A 1MKXH 2IOTA 1MQ5A 3F9FA 3PROA 2XC5A 4WMFA 1RS0A 1JXPA 3MYWA 3SU5A 3MTYA 2BD5A 1XUKA 3V3MA 3SUGA 2VIPA 2ZECA 1NT1A 3BTDE 3FP7E 1BMAA 5EW1H 4BXSA 2CF8H 3QGNB 1PQ7A 3ZVDA 1EX3A 1M9UA 3SNDA 4K8BA 1A0LA 1S6HA 2QYIA 2NU0E 1XUIA 3PMHB 1CBWB 1O2MA 2BDGA 3PWCA 4Y71A 3S9CA 1ZTJA 3QO6A 2XC0A 1QGFA 2HRVA 1EAIA 1GHWH 1GJ8B 2BY6X 3ZVFA 3SBKA 2QC2A 2Z9JA 1A5GH 1O35A 1DPOA 3GDVA 1EJAA 4Y0YE 3ZVBA 4ISOA 2ZU3A 2QY0B 1SFIA 2ZFTA 1CT0E 2ZHEH 2ODYB 1N6XA 2F9BH 1V2RT 2J38A 1P2NA 1TNJA 2IPHA 1IHTH 5K0HA 1AVXA 1DY9A 1GBDA 1GVKB 5GCHF 2R0LA 4FUBA 1KDQB 1MTWA 1V2LT 3GCHC 1CHOF 3A87A 3ZZBA 1NTPA 2J95A 1GMDF 4NFEA 4NFFA 3DUXH 2G52A 1WTHD 2BD8A 5FCKA 1DUAA 2RDLA 1PQ8A 2VWMA 1O2RA 2ZU5A 1GHBF 3LH3A 4DIHH 4CR9A 3M7TA 1UTNA 2ZDKA 3NKKA 4JZ1A 3KEEA 3RXVA 3LDXH 3VB4A 3HPTB 1HIAA 3NWUA 3UWIA 2B5TB 4CHAC 4VGCB 2Y6TA 5G4BA 1A2CH 2TGTA 5DP5A 3MU5A 1AE8H 1YPKH 1UK4A 1YBWA 4B74A 1BTUA 2FS9A 1NU7B 1RRKA 4JMYA 3SZNA 1HXEH 4GAWA 2UUYA 3MU8A 2QIQA 2SFAA 3RMLH 1DM4B 1N8OB 2A4QA 2BDIA 4ZKNU 2ZFPH 1GJAB 1O5EH 1OWHA 1NS3A 4B75A 4H6SB 2HPQH 2BY9X 2ZNKH 1C2LA 2BD2A 2ZDLA 4INKA 1AD8H 1TABE 2PR3A 1UCYE 1ELFA 1BMLA 2HNTF 2VH6A 2G5VA 3BIUH 1DUEA 1ELGA 2QN5T 1C5OH 1MUEB 1O30A 1QRZA 1PPCE 5FAHA 1P9UA 1ARBA 2EI8A 1A1RA 1EZQA 3A89A 2G00A 1ZMNA 3QZQA 4MNXA 1FDPA 2GGVB 1GJ5H 1KLJH 3A80A 1HB0B 5F6MA 1SLWB 4WXIA 1B5GH 1S5SA 1ELTA 2W5EA 2OC8A 2BZAA 3MH6A 2G81E 1GI5A 1ABJH 3A86A 2O8TA 2BMGB 3OU0A 4FVDA 4E7NA 5JDUB 1LQDB 4RKOB 4JK6A 1C5MD 2P3TB 1Z1IA 1XMNB 4J1YA 2OLGA 3RXDA 2F9OA 3NZIA 1BUIA 1OP0A 1XM1A 1DLEA 4IC5A 3VXFH 3ZZ3A 3A85A 2GCHG 4DGJA 2Z9IA 1P11E 4YOIA 1MH0A 2IJOB 2VVUA 2FI3E 3K9XB 5EOKA 2A7HA 1FAXA 1MD7A 1F92A 1CE5A 4H4FA 1GBJA 2R3YA 3TH4H 1MZDA 2KAIA 1DX5M 1OYQA 3BEIB 3U8TH 1LVMA 3PMJA 2TBSA 1P10A 3OTJE 2ALVA 1DVAH 4KGAA 1PYTD 4D76A 1D3DB 5FCRA 2ZDNA 1C5SA 1BBRH 4ISHH 3ZZ9A 3E0PB 3MOCA 1NN6A 1AMHA 2ODQA 1C5LH 2ZDMA 4Q7YA 3RXKA 1S0QA 2V0BA 3MNCA 3W94A 1TGBA 2G5NA 1UTPA 3VB7A 4MG3A 1VCPA 2ZU4A 1O3PB 3RMOH 1Y3UA 4DIIH 3QZRA 1IQIA 3RXCA 3ELAH 2YNBA 2VIQA 3UUZA 3V13A 3Q3XA 2ULLA 3TNSA 1KIGH 1L4ZA 4GLYA 1FAKH 1J16A 1CHGA 1G30B 4NWLA 3ATIA 1QIXB 1GI7B 1TBRH 3LJOA 1PQ5A 1NFUA 1SVPA 4TWWA 2ZCKP 3VPKA 2PKSC 1LDTT 4YT6H 1XVOA 5HM9A 1KXDA 1UK2A 3PO1C 5JBTA 1O3EA 2D1JA 3VEQB 3DFLA 1O3AA 1IAUA 1QRXA 4TY7A 2C8WB 2VNTA 2DE9A 2WPIS 1LCYA 2YNAA 2O9QA 4FUIA 4X1SU 1AI8H 1O5GH 3EA7A 2FI4E 1O2OA 2Z94A 1WV7H 5DPAA 1GMCG 3VB6A 3QLPH 1MQ6A 4NA7A 4YESB 3DD2H 4M7GA 3FP6E 1O32A 1UCYK 1HIAB 4ZAEA 3H7TA 1QB6A 1HJAC 3BTFE 4B76A 1BTWA 3UREA 2OBOA 1TWXB 1GBMA 3KGPA 1SGEE 2ANMH 4Z6AH 1SPJA 3SJ8A 3LIWA 7KMEH 3SQHE 1JRSA 3VGCB 4FU7A 1GCTC 3T29A 2W7UA 3PMBB 4YT7H 5EW2H 1HUTH 3BV9B 2BYAX 4FUGA 1C2EA 1TGCA 3SGQE 3ZVEA 1IQNA 1UTJA 4NG9H 1Z8JB 3EAJA 1C5XB 1GHAF 5HYOA 1GMHG 1OKXA 3LU9B 1YF4A 4AFSA 3E90B 2FDAA 3DFJA 4UONA 4CR5A 3TGKE 1ZSKA 3NXPA 1B0EA 2AH4X 1MAXA 1O38A 4YZUA 3ATWA 1MAYA 2B0FA 3RXQA 5GXPA 4Y79A 1K28D 2FESH 4A7IB 5AFZH 2Q6FA 3S7KB 2Q6GA 2RG3A 4H42U 2A7JA 2PV9B 2V35A 1QJ7B 1C1TA 2AIQA 2GKVE 1GJDB 1P2MA 5DP4A 1HPGA 5FBEA 1CT2E 3N7OA 2QXIA 2AERH 4Q7ZA 1AQ7A 4Q7XA 1H9HE 1SGFG 4ABEA 3LC5A 3KN2A 2O8WA 1PPBH 3CS7A 3A83A 4IN2A 4WH8A 4O9VA 1V2QT 2BVXH 3SW2B 3OSYA 5CHAC 3O8BA 1WBGB 3EA9A 4AFZA 1HXFH 3KL6A 1THRH 3RXRA 1OOKB 1WOFA 1JRTA 4GPGA 1TA6A 4KTCA 3MU4A 3GY3A 1AIXH 3A82A 4I8JA 5E2OA 5AVDA 5FX5A 3SJIA 2KAIB 1F0TA 2HLCA 1W0ZU 3SGBE 1XVMA 1GDNA 2C90B 4X6PA 1VJAU 4R8TB 2R2MB 5EXNA 3ZVGA 3UR9A 1PQAA 2OC1A 3RXMA 1V2PT 1ANBA 2GT8A 1UCYH 1ZOMA 1Y5UT 2XBYA 1PPEE 4AYVB 3RUOA 3M35A 4TY6A 1DICA 3TIUA 5EODA 1A0JA 3LKWA 2M5TA 3HKJB 1P8VC 3V0XA 3ATLA 1O2XA 5EPNA 3U8OH 1FIWA 1F5LA 4JZIA 3AW1A 1FV9A 1EB1H 1TQ0B 2OQ5A 1HAVA 3RLYH 9ESTA 1MBQA 1O2YA 4NA8A 5K7RA 4ABGA 2XC4A 1LVYA 3RU4T 5C5OA 1FY4A 1P57B 2HPPH 2ZQ2A 2GCTB 1GJCB 3FAOA 4NSVA 1GI6A 1IHSH 4WJG2 1GI1A 1ELBA 1Z8GA 1HAXB 1ETSH 2XW9A 3MH5A 2P59A 5C67A 3O8DA 3F1SB 2QXHA 3ZYEA 1O3GA 1SHYA 3P8GA 3ZV9A 1GBCA 3GY8A 2CHAC 4FUJA 1OWEA 3OY5U 3IG6B 1NC6A 5FPYA 1O2IA 2B9LA 2Z9GA 3MO6A 1TGTA 4B2BA 1VITH 2ZWLH 3OY6U 1TQ7B 3UY9A 1JIMA 4ZXYH 2GTBA 3SORA 5DP9A 4BTIB 1UO6A 1FMGA 1ZSLA 3M3TA 2Y82A 1CU1A 3RMMH 4D7GA 1VCQA 1FI8A 3Q76A 3T25A 1C9PA 4GHTA 2ZGBH 3CP7A 2BXTH 1W7XH 1O0DH 3FVFB 2ZIQH 2ZGHA 4CRAA 1LKAA 1P0SH 5ESBA 3ATKA 2HNTE 1F5RA 1SQAA 4JCNA 4ABBA 1XKBC 5I46H 4ISLA 1NO9H 1AHTH 1C2DA 1YP9A 2BTCE 1WYKA 2VWLA 2WINI 1O2GH 3SNAA 1LQEA 4K60A 1XX9A 3PLKA 4WVPE 1DSTA 1NESE 8KME2 1C5QA 1GGDC 1PPHE 1V6DA 2SNVA 4XSKU 3MO3A 3U1JB 1EPTA 4Z0KA 2ZI2H 3TH2H 2JETB 3ZZCA 1SQTA 4YTAA 1LVBA 1BRBE 1B7XB 1TA2A 1O2TA 1FN6A 1QR3E 2Y5HA 2P94A 3BEUA 5FX6A 1T4UH 1BIOA 2VGCC 1PJPA 2QA9E 1O3DA 2O8MA 3F9HA 4WF8A 3BN9A 1YM0A 1QHRB 1L4DA 1TPPA 2GCHF 1BRAA 3RXSA 4ASHA 2PSXA 2PHBA 1W12U 5LPFA 1SGPE 2FTLE 1O2JA 5B6OA 2BQ7B 2P8OB 5JB9S 2XYAA 3MNSA 1ZMJA 1ANDA 1GBIA 3RXTA 2CN0H 2PGQB 1MTSA 2ZC9H 3SJKA 1ZSJA 5DJ7A 2HWLB 1A0HB 1O3LA 1KLIH 2ZFSA 1RIWB 1AFEH 4KKDA 1TNHA 1ID5H 2XWBI 2VIVA 1PPZA 4HI3A 3MU0A 4MQAA 4K3JA 2VIWA 4KP0A 3DHKH 1G2LA 4UD9H 1ZPCA 3ODFA 3QUMP 4UFDH 2ZU1A 5E2PA 1O5DH 7GCHG 5L30H 5ESTE 3T28A 1IQKA 1C2KA 5JBAS 1C5RA 2RA3A 3ENSB 3ODDA 1WSSH 4KTSA 4WMDA 3TGJE 2D2DA 1AB9B 1UVUH 1T8OA 3SI4H 2OC7A 1GI2A 4NCYA 5E0GA 1L1GA 2YOLA 4I8LA 4X8VH 1HCGA 1ZJDA 4JK5A 1WU1A 1FN8A 1T8LA 3ZZAA 5E0JA 1HAVB 1K1MA 2FO9A 1BQYA 3FP8E 2XBVA 3SU0A 4IMQA 4TPYA 1QJ1B 3MH7A 1C1QA 1DLKB 1K22H 2ZZUH 5LPEA 4HTCH 5FPSA 1O2VA 4XBCA 4UE7H 5EXMA 1OSSA 4TPIZ 3JZ1B 1MBMA 2CMYA 3GY4A 2BOHB 2F83A 3Q77A 1ZJKA 1MTNB 4OS2A 1DWEH 4BTUB 4BNRA 3R0FA 4CREA 1GMCF 2LPRA 1BTZA 1D6WA 3MNXA 2C93B 1HAYB 1GBEA 1GBTA 1CA0B 1NRRH 4K69A 1AFQB 1DWBH 2A1DB 3RXOA 1QRWA 4AFQA 2ANKH 2FOCA 5FXLA 4WY3A 1YLDA 1C4V2 4YLQH 1O2QA 1TIOA 1C2HA 3HK6B 2BY5X 3BG4C 5L2ZH 1ZMLA 3A7VA 3ZZ4A 1D3TB 2G8TA 2ZTYA 3AW0A 3P95A 2OTVA 3SHAH 1C2MA 1S6FA 2XXLA 1GPZA 2BY7X 2VJ1A 4INLA 5HMAA 4Y6DA 1TNGA 2CXVA 3QN7A 6GCHG 1ZLRA 2VWOA 4IGDA 4X6OA 1GMHF 3A8AA 4KELA 1NFXA 1O36A 1N1LA 2ZGCA 1O2NA 2XWAA 2ZPRA 5L2YH 3QDZB 3BTGE 3FFGA 2BDHA 4K8YA 1NRSH 4IBLH 1SHHB 4I7YH 3S0NA 1C5VA 5EU8A 1AKSA 1THSH 4NA9H 4RN6A 4X8SH 5LPRA 1NZQH 6CHAC 1D3QB 4B71A 1AZZA 3FZDA 3IWMA 4X2WA 1BA8B 2JH6D 4FUFA 5TCAA 2BLOA 1EPTB 1TPSA 3VB3A 1PFXC 1C1OA 1E34B 1LPZB 3NUMA 4IMZA 1LHGH 1IQLA 4X0WU 4A5TS 3B9FH 3RXUA 5SGAE 2QXGA 2FYQA 4AORA 3G01A 1DWDH 4I8GA 1VGCB 4GCHF 3KF2A 1G36A 2HVXA 1J8AA 1K21H 2WUCA 1SLVB 2PLXA 1BZXE 1QB9A 3TPIZ 4BTTB 1JWTA 2JKHA 2EA3A 1RFNA 1KTTB 2H2ZA 1DFPA 2TPIZ 1UVPA 4R0IA 1OWDA 1ELEE 4FVBA 1FY1A 2ZDVH 4JYTA 1GHZA 1TBQH 2R0KA 1G2MA 4MLFB 3SU6A 1Y3YA 3A7XA 3S9BA 1FY3A 3Q3YA 1QL8A 3ZZ8A