1PJPA

The 2.2 a crystal structure of human chymase in complex with succinyl-ala-ala-pro-phe-chloromethylketone
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
226
structure length
226
Chain Sequence
IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQKNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGAAQGIVSYGRSDAKPPAVFTRISHYQPWINQILQAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 2.2 A crystal structure of human chymase in complex with succinyl-Ala-Ala-Pro-Phe-chloromethylketone: structural explanation for its dipeptidyl carboxypeptidase specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords CHYMASE
total genus 46
structure length 226
sequence length 226
ec nomenclature ec 3.4.21.39: Chymase.
pdb deposition date 1998-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1pjpA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1pjpA02
1ZTKA 1DWCH 1ELDE 1FMGA 1AIXH 1TNGA 1OP8A 2P8OB 1F7ZA 1W7GH 1SB1H 1MD7A 2FDAA 3ZV9A 4GLYA 2R2MB 1UTNA 3NWUA 1AFEH 2WPJS 1CU1A 5I46H 3UOUA 1BMLA 3M3VA 1GJ7B 3QDZB 4ABGA 2AMPA 1BUIA 3PYHA 3RXGA 4I8GA 1VCQA 4NWKA 1DUEA 1EUFA 3D23A 1AO5A 1GDNA 3CS7A 4YOJA 3UUZA 3F68H 3S7HB 1SGQE 2ZU1A 4CHAC 1J8AA 2D1JA 2ZDAH 4FXGH 3QGJA 2ODYB 3FZZA 2Z7FE 1VITH 1O3BA 3A83A 4DCDA 1NZQH 1E35B 1CGHA 1QRXA 3A7WA 4UDWH 3O8BA 4I32A 4IN2A 1C1PA 5DP8A 4WMEA 2SNVA 1IQFA 2ZFRH 3A7XA 1NFYA 2ALPA 2RG3A 3BSQA 3FVFB 1O36A 2OUAA 2ZU4A 1PPHE 3EA7A 1S0RA 4TYDA 1CA8B 3SV2H 1A5HA 1C5NH 5FPTA 1KIGH 1TWXB 1ZSLA 2EI7A 3EQ0H 1AFQB 1O5BB 2CV3A 2VU8E 4R8TB 2ZO3H 4B76A 4E7RG 2OD3B 1ZSKA 1F0UA 3EGKH 4NA7A 4NCYA 3URDA 2H5DA 1A4WH 3K9XB 1O2KA 4YLQH 1RIWC 1ELAA 1E0FD 5A0CA 3GYLB 4GAWA 2AH4X 4TY7A 2UWPA 5PTPA 3T26A 3GCTG 1DITH 1ELBA 1H9HE 1CQQA 4WF8A 1G2LA 4ABBA 1FUJA 2Y7XA 2SGEE 1YBWA 2G4UA 3CS0A 3D65E 4JZFH 3V13A 1TOCB 2OC7A 4WMFA 2ZTZA 4K2YA 1THSH 5HM9A 3OTJE 1GBFA 2R2WU 3E0NB 4KGAA 1IQHA 1LTOA 2C8ZB 1O2SA 1SMFE 1LHEH 4DIHH 3M5NA 4BXWA 1GCDA 4X1QU 1DFPA 1IHSH 4NIYA 5I25A 3GDVA 2TGDA 1C4Y2 1O2QA 3C27B 1TNIA 2FIRH 1W0YH 3VXEH 3IG6B 2M5TA 1JRTA 1QR3E 2BOHB 1O5DH 1GJ6A 1P2IA 2SNWA 2V3HH 3MH5A 5EODA 3BG8A 3SJOA 4KTSA 4JYTA 1FN8A 3QTVH 1LCYA 1EB1H 3RXAA 1BTZA 1HIAA 1HV7A 3VGCB 4A1TA 3EE0B 3KQDA 4DY7B 2OCVB 2PUXB 1EAUA 2OBQA 5FBEA 5A2MH 4LZ1H 1GWAA 1LDTT 1Y3XA 1ZGIA 3KIDU 4TWYA 1GMDF 1AWHB 3GCHB 1BOQA 2XWAA 1EJAA 1SLVB 1SSXA 3QWCH 1WSSH 1QQ4A 2Y6TA 2FS8A 2P3FH 5C67A 1G30B 3MFJA 4X8SH 1HJAB 4X6OA 3BG4B 4X0WU 2HNTC 1F0RA 1O34A 2BXUH 1V3XA 3RXOA 2I6SA 2J94A 3A7YA 1KTTB 3ZZBA 1NU7B 3M3SA 3MMGA 4Q7ZA 3G01A 3MU1A 1DDJA 3TGJE 1BTWA 3OU0A 2IPHA 1C2EA 3MYWA 2ZGXH 1C5RA 1TFXA 3VB4A 2CXVA 5E0JA 4DURA 3E3TA 1A61H 1MD8A 1NESE 1WV7H 5JBAS 3UTUH 4ASHA 2R3YA 2WPKS 3TLOA 1W12U 2BB4A 4IS5A 4FUGA 4TY6A 1UTMA 1ANDA 3QZQA 4TWWA 3B8JA 5GCHG 1F92A 3PMBB 4DT7B 1KXAA 1HIAB 1NTPA 2XCFA 1S85A 1QJ1B 5EGMA 2QIQA 5FHTA 1GBMA 1CT4E 4YLUA 4IMQA 3KF2A 1UVTH 4WMDA 4Y71A 1YPKH 2FI4E 4CHAB 3BEFB 4B71A 4D7GA 1U6QA 1O38A 1TMUH 1KSNA 2ZHQH 4K1SA 2ZZUH 3LGWA 1O2IA 1O2UA 3HPTB 1GI5A 4MTBA 2FZZA 1LHDH 4CH2B 1D3PB 2AIPA 4FUCA 1DWBH 3SUDA 3UREA 3PO1C 3M5OA 3R0FA 2BX4A 1DY8A 3RXVA 4B73A 1QL7A 4NA9H 3S0NA 3ITIA 1AN1E 3ZZDA 2AERH 2AGIX 4ABDA 3W95A 8LPRA 5EQQA 5BRRE 4UD9H 2BD7A 3F9FA 3KCGH 3LPRA 4X8VH 1AZZA 1AFQC 3GISB 4NFEA 1T31A 1FIWA 1KTSB 1XMNB 3M35A 2BQ6B 1O30A 2OBOA 1QA7A 1WCZA 3F9EA 1TB6H 1GBJA 3PM3A 1L1JA 1HAYB 1RTFB 3RXRA 2ESTE 3MU4A 1SGDE 2OC8A 1SR5C 1C2IA 4GPGA 1YP9A 2FOEA 2YNAA 1SI5H 1VGCB 3HGNA 1GJ4H 1J17T 1DVAH 1THPB 3ZYEA 2IOTA 2WYJA 1P03A 4OS5A 3UWJH 3DHKH 2RA0A 3U1IB 3Q3XA 1L1NA 1W14U 1N6YA 4GHQA 4YOIA 1YYY1 4J1YA 1SGFA 4INKA 1M9UA 4UE7H 3BTKE 3ATMA 4UFGH 1O3FA 3SU6A 1GI8B 1BHXB 1QGFA 1GHZA 1OWEA 1MTUA 1ZZZA 1XX9A 2WUCA 3HK3B 3LONA 4UFFH 1OOKB 3PTNA 1P9UA 2JKHA 3BTHE 2BYAX 3S9AA 1LO6A 2BD2A 4AFSA 1SGPE 4O03A 3KGPA 5C3NA 1UCYE 3QN7A 2K1QA 1TNLA 3SU4A 1PPCE 1GMCG 1TRMA 2FESH 3KL6A 3FFGA 1B7XB 1AD8H 1OKXA 1FPCH 2WINI 1GJ5H 1O2GH 1D3DB 2C4FH 1FY8E 1JOUB 1V2WT 5CMXH 1BT7A 1Z8RA 1OX1A 1AHTH 3FAOA 1SFIA 5LPFA 1Z6JH 1HAXB 1N8OB 2GD4B 1BQYA 1FY4A 3E90B 4CH8B 4ISHH 1A0HB 2BD4A 2Z9IA 1QL8A 1OYQA 2UUKB 3MI4A 1ESTA 1F5RA 5EOKA 3GCTF 1VJAU 1HJAC 1UVSH 1PQAA 2O9QA 2HOBA 3A8AA 3S9BA 1TBZH 3Q77A 1NS3A 3GCOA 3EYDA 4F49A 1AQ7A 1GCTB 1LPGB 1YPEH 1O39A 2XYAA 1Y3UA 3OY5U 5T6FA 2FO9A 2NU0E 1A2CH 1ARCA 2XWBI 1WAYB 3VEQB 2JETC 3OY6U 4XDEA 5DKMA 5DP3A 4FUBA 4MLFB 3LGYA 4FUDA 3TH4H 3TK9A 4CRFA 2ILNA 5LGOA 1O2XA 5DK1A 1E36B 1Y8TA 3I78A 2HWLB 3SJ8A 2QXGA 1O3PB 2B8OH 4INHA 1WTHD 2HALA 3VB7A 1BMAA 1EP6A 2A5KA 2A4GA 3RXBA 4Y0YE 5AF9H 3QLPH 4GUXA 3F6UH 3SI4H 4ZMAH 1UJ1A 3B9FH 2OC1A 1NM6A 1D9IA 1TGSZ 2AGEX 2ANYA 4IW4E 1F5LA 1KLJH 1YPHC 3W94A 2W5EA 4JZDH 1QCPA 4U30A 3GY8A 1W2KH 5DP6A 1MKXK 2ZDNA 1RGQA 3E16B 1GPZA 3A89A 4ZUHA 1X7AC 1PPEE 1MMJN 2YNBA 4X8TH 3SQHE 2UUFB 5EW2H 3BG4C 3HATH 4ABHA 1LMWB 5AHGH 2F91A 2PV9B 1ANBA 4FUHA 4X6MA 1O3NA 1ZPCA 4GCHG 1HLTH 1AE8H 3QK1A 1XUFA 3BEUA 2GCTC 3OYPA 1TMTH 1ZJDA 1P06A 1XVMA 1VITG 4Q7YA 1KXEA 5LH8A 3KN2A 3VB3A 1A5IA 1V2JT 1V6DA 3BF6H 1RJXB 1YCPM 3RMOH 1GI7B 3EA8A 4I8LA 1HXEH 2ZA5A 3A8CA 2Y80A 2SGFE 2ALVA 1EKBB 2QXIA 1AGJA 4K1TA 1P2MA 2GDEH 2GX4A 1VGCC 2FLBH 1F0TA 1XKBC 3V7TA 3NXPA 2R0LA 2GMTB 2BQWB 1XUKA 3SNCA 1FONA 1MQ6A 1UTKA 2VB0A 2PTNA 2AMDA 1XUGA 1QJ6B 2P3TB 2FEQH 1O3AA 2VVVA 4JK5A 1WUNH 3ODDA 5DP5A 1O5FH 4Y76A 2FS9A 4GVUA 1GI1A 2P94A 3A84A 1A7SA 2IJOB 2VVUA 4D8NA 2G51A 3B23B 3GY2A 4YESB 2V3OH 4NA8A 1P01A 4NZLA 1EPTB 1UK2A 5T6DA 2WPMS 3GDSA 1Y59T 3A86A 4FU7A 1EP5A 1XM1A 3SHCH 2F83A 3H5CB 1CGJE 1G3DA 2H2ZA 6CHAB 2G5VA 3TJVA 3P17H 1A1RA 1N8OC 2ZGHA 5JB8S 1FI8A 4MPWA 1IOEA 1AMHA 1WOFA 1TE0A 2QXJA 4O9VA 5T3HA 4AGKA 3QZRA 1K2I1 1PQ5A 2BVRH 3MO9A 4X8UH 3LDXH 2BVSH 4WH6A 1SLUB 4UFEH 1UVPA 2EA3A 2HRVA 3M7QA 1ZSJA 2VVCA 1Z1JA 2Z9KA 2TIOA 1EASA 5LPEA 2H1UA 2OINA 2CHAB 3NCLA 5EU8A 1PQ8A 1AVXA 1ELVA 4FUIA 3S7KB 1G37A 1PPGE 2ANMH 3L3TA 2UUJB 3A88A 3JZ1B 1C5TA 1SQTA 4MQAA 3ZZ5A 5A8YA 1GI3A 1TPSA 2FYRA 1OXGA 2ZPSA 2BD8A 1JIMA 2P3UB 1GBBA 1C1UH 3VB6A 4O97A 1G32B 5C1XA 2SGQE 1JIRA 1GGDB 2AYWA 5DPAA 1AUTC 2QGRA 4IN1A 2ZPQA 3DD2H 2J38A 2STBE 4H4FA 1CBWB 1MAXA 1TRYA 2ZHDA 2Z94A 4NSVA 3NPSA 1YPHE 1IQGA 2H9TH 3LT3A 1NFWA 2V35A 1K9OE 1DX5M 1HJ9A 5E0GA 1ANEA 1G9IE 2GZ8A 2TGPZ 1C5XB 2ZP0H 3LU9B 1PYTD 1S83A 1ZHRA 4HGCA 1H1BA 4LZ4B 2H5CA 2WV4A 3M61U 3VFEA 4OGYA 1O2RA 2HPPH 1GJ8B 1V2MT 3P70B 1JWTA 1W13U 4RSPA 2XW9A 1GDUA 4WXVA 1LKBA 1VCWA 2QF3A 1G36A 1MAYA 2WPLS 1GHAF 2GCHF 2CN0H 2QCYA 3MU8A 1WQVH 2H9EH 1PYTC 1C1RA 3A8BA 3D49H 4XE4A 2Q1JA 2OQ5A 1BDAA 5ESTE 4JZIA 1P3CA 4AGJA 2EI6A 4ZHLU 4ZKSU 1C1QA 2GP9B 1DT2A 2ZU5A 1NRNH 5EXLA 2H9HA 2ZHFH 1WQSA 1GBDA 2BDCA 5DGJA 3SUFA 1P8VC 2H6MA 1SQAA 1ORFA 2FWWA 1ZGVA 1BMMH 3SUEA 3QUMP 5ESBA 1A46H 4BTTB 3GCHC 4AORA 3ZZ8A 1RD3B 4XBCA 4XFQA 1SG8B 4BAOB 1C5UA 1TX7A 5L6NH 1ELFA 3STJA 3QX5H 1ZLRA 2Y5HA 3SGAE 1TX8A 2ZHEH 1ELGA 5F8XA 2TPIZ 3VXFH 2ANKH 5B6OA 1C5SA 1JBUH 3PLBA 3EA9A 2DE9A 1P9SA 2NU2E 4LK4A 3RXJA 2LNCA 3RMLH 1ZHPA 4RKJB 4DVAU 3BTEE 3BIUH 1FQ3A 1J9CH 3RU4T 5HXFA 3UFAA 1O2OA 3MHWU 3UNRA 4FU9A 2ZFQH 2XNIA 2PKSC 2SGDE 1K1MA 1HNEE 1L4DA 4MNVA 2A7CA 2O8MA 1A3EH 1Y5UT 3K2UA 4MPVA 1YC0A 1SVPA 4ISLA 1HJ8A 1CGIE 1P0SH 4JYUH 1SOTA 3RLWH 2NU4E 1SC8U 1ZPZA 1A0JA 3U8TH 2A2QH 4Q2KA 1D3QB 3LC3A 3Q00A 1GI4A 3SO3A 4Y79A 4TPIZ 5ETXA 1ZMLA 1P04A 3HGPA 2J2UA 1GHBG 4X1NU 5T6GA 2GT7A 2CHAC 1QQUA 1XUJA 2ZDKA 1DUAA 4B1TA 1UTLM 4WH8A 4ZHMU 3ZZ4A 3RU4D 4MNYA 1GG6B 2OC0A 2TBSA 1O33A 1LQEA 1TBQH 1TOMH 1O2NA 2ODQA 4Y7AA 3ZZ6A 1ZMNA 4A7IB 1GGDC 1EPTC 1QBOA 2ZCKP 1K1LA 3PWBA 1CO7E 1INCA 3BTGE 3GDUA 3P8GA 1LKAA 1VZQH 2ZGCA 9LPRA 1MTSA 3A7TA 3E91A 1G3BA 1OWDA 4CRCA 3TJUA 5IYTA 2ZG0H 2VIWA 5C5OA 2BLQA 1GBHA 1FV9A 1GBCA 1OS8A 1GBKA 1KLIH 5C2ZA 2VWNA 4BTIB 2HGTH 2BD5A 1ELEE 1O0DH 1T8LA 5JBCS 3CP7A 1AVGH 1C5PA 1KXFA 4JZEH 3ZVAA 2A1DB 1EOLA 4DW2U 4CBOA 1KXDA 3UR9A 4ZKNU 1AUJA 1MCTA 1ID5H 1TNJA 2C8XB 1GMHG 3A80A 5LPRA 2PUQH 2Y82A 4KELA 1T8NA 3MH6A 1Q2WA 1KXCA 2A31A 3KQEA 1NROH 2NWNA 4MNXA 3SJIA 1K1OA 2STAE 1O2TA 1OWKA 4ZH8A 2BTCE 4BTUB 1BZXE 1MTWA 3K65B 3U1JB 2BDBA 1SLXB 1F5KU 1H9LB 2ZECA 2ZFTA 4I8JA 1AKSB 4E7NA 3TK6A 1ZRKA 4GHTA 3AW0A 1O2MA 5FX6A 3RXPA 1SGCA 3IWMA 1CT0E 3RMNH 1TLDA 4U32A 1B0FA 3LC5A 1DXPA 2XBYA 2FPZA 1P05A 1T4UH 3MO6A 3MNCA 4E06H 4YM9A 3BTWE 1ABJH 1YPLH 1GMDG 1LPKB 2VINA 3SU3A 3A7ZA 1UHBB 3MNXA 2P16A 4I8HA 3DT0H 5CHAB 2CGAA 2ZDVH 5BPEA 1OSSA 2GZ9A 1TA2A 1NN6A 3ZZ9A 3A7VA 1C9PA 1TGTA 1HGTH 4AFUA 1KXBA 4U2WA 3ZVFA 2XCNA 1YCPK 2A7JA 2TRMA 1T8OA 2D26C 1IQLA 1Z8IB 2W3KA 3M37A 3BN9A 2FI3E 1EAIA 5E8EH 3TNTA 1MTVA 1LVBA 4ZKRU 1QJ7B 4B2BA 1W8BH 5E2OA 3AAVA 4FVBA 1CT2E 3AASA 1XXDA 1TONA 2FTLE 1GVZA 3HKIB 3SU2A 4SGAE 1VITF 1SHYA 4BAKB 3MNBA 3PB1E 2QYIA 4JCNA 1V2LT 1ESAA 4NZQA 1XVOA 3RC6A 1YF4A 3RXMA 1N1LA 4BAQB 3LJJA 4D9QA 1J16A 3H7TA 4JZ1A 3T28A 3R3GB 2W7SA 1TGNA 1HCGA 1TQ7B 2XC0A 4RN6A 1YLCA 1V2RT 4BNRA 2KAIA 1LHGH 5HGGA 1IAUA 1MBQA 4ZAEA 2F3CE 3KHVA 1MTNC 1MZDA 5E2PA 3SJ9A 2O8UA 4DOQA 1DPOA 1S81A 1T8MA 3SW2B 2GCTB 2A0QB 1LVMA 3LOXA 4DJZB 6GCHF 7LPRA 1AKSA 4CRAA 2FP7B 2XXLA 2XC5A 3UOPA 3BIVH 4VGCB 1ZJKA 1FY5A 1CE5A 3M7UA 3P6ZB 3SNDA 2Z9LA 4FUFA 1P02A 3GY7A 2YOLA 2FXRA 1QB9A 4K60A 3RM0H 4ZXYH 2OTVA 1GHVH 3SUGA 2F9PA 4A92A 1FJSA 3I77A 4Y6DA 4Z0KA 1ELTA 2RDLA 4MVNA 1GBEA 7GCHF 1SHHB 2CF8H 3U9AH 4BOHA 1O5EH 3GY4A 1TPOA 3TIUA 4CR5A 1ZTLA 1MU8B 1B5GH 5DG6A 4WXIA 1P3EA 2RCEA 1P11E 3D62A 8ESTE 3T25A 3FZDA 3VGCC 2PGQB 4XOJA 1FY1A 1C1SA 3RC4A 1TAWA 1HXFH 2GKVE 3KQBA 1IQKA 3K6ZA 4CRBA 1ZR0A 1GJ9B 2ANWA 3ZZ7A 1NU9A 1GVLA 3TU7H 2XRCA 5F8ZA 4HZHA 2BZAA 1LVOA 5L30H 1S6HA 1TMBH 1F2SE 4BXSA 2HLCA 2BOKA 3AVZA 1BHXF 1QBNA 1MKXH 4K69A 1GJCB 4ABJA 2ZTYA 5C20A 4DG4A 3ZYDA 3RXSA 1GJBB 1P2NA 1TPPA 1HAZB 4MG3A 1MU6B 1CHGA 4BAMB 3BTME 2VWOA 4NWLA 3EAJA 1V2UT 2XBXA 1Y5AT 1O31A 3MOCA 3TVJB 1SGYE 1TBRH 2XBWA 3SHAH 1OYTH 1GHYH 4GSOA 1LHFH 5JBTA 4U01A 1LQDB 1C1VH 2QN5T 3GCNA 4NSYA 5EQRA 5GDSH 1VJ9U 5CHAC 4X2YA 5HM2A 3O8CA 1O2WA 3P8FA 1C2DA 2G81E 2ZFSA 3RXIA 2PFEA 5EPYA 1QA0A 3LGVA 3RXCA 4CRDA 1RS0A 3ZV8A 3SV9A 1P2KA 2ZU2A 3TH2H 5IDKA 1K1JA 3PROA 3RUOA 2WYGA 1DY9A 1GBAA 3UNQA 4XSKU 2BDYA 4HI3A 3A8DA 1AVWA 4SGBE 1BRBE 3U69H 2Z3DA 1V2OT 5C1YA 4ABAA 3E6PH 1PFXC 3E8LA 1P2OA 4AB8A 4AYYB 2PW8H 4A1XA 2R9PA 4H6TA 1HAIH 1GI9B 3MH7A 1HAOH 1H9IE 4XBBA 3ATWA 4ABIA 4Y8XA 2ZGBH 1Q3XA 4WVPE 5TJXA 1V2TT 3SZNA 4B2CA 1NFUA 1O3KA 5F8TA 1YLDA 2FOHA 3TGIE 1HRTH 1UMAH 4AG1A 1SQOA 4FU8A 1TRNA 4ZKOU 1UVOA 2KAIB 4JK6A 1DWDH 8KME2 3SNAA 1SLWB 1O3OA 2FX4A 1O3HA 3T29A 2CMYA 1XKAC 2PLXA 2QXHA 3UY9A 1BRCE 3SNEA 1BIOA 2G00A 3L6PA 4OS1A 5GCHF 1UCYK 1O3GA 1AZ8A 1TQ0B 1UHBA 1Z71A 2BLVA 5A0BA 2OLGA 4NG9H 2ZHWH 1V2QT 1O35A 2QA9E 1NRRH 4I7YH 4NFFA 3L33A 3U98H 1GMHF 4D76A 1AWFH 2NU3E 2WPHS 4OS7A 5A8ZA 1O2LA 2OQUA 2ZKSA 1TALA 3F9HA 3LGTA 1W3CA 6LPRA 2FOGA 3F9GA 1C5QA 1HAPH 4D9RA 1BMNH 5GIBA 1GBTA 1BRUP 3E1XB 4O3UA 2G55A 1RRKA 2VNTA 2A5IA 3BV9B 3UQVA 2TGTA 2ZCLP 3LGIA 5J4QA 3LJOA 1PJPA 2Z9JA 1OP2A 3UPEA 4Y7BA 3SORA 2ASUB 3FP8E 3JZ2B 3I29A 3ZVGA 1V2PT 1MQ5A 4K3JA 2SGAA 1Y5BT 1YPMH 3MTYA 4B2AA 5EW1H 1WYKA 2I6QA 5J4SA 3HKJB 3KNXA 3QGNB 3M36A 1C2MA 3SOSA 5JB9S 1BITA 1CHOF 3UIRA 4UEHH 2D2DA 3SGQE 4X1SU 2FI5E 3S9CA 2BQ7B 1ZYOA 4Y8ZA 1O3IA 3SI3H 1Y3VA 1D6WA 1S84A 1UTQA 4X2XA 1B0EA 1QB1A 4I8KA 4Y8YA 1DLKB 1TA6A 2FLRH 2FYQA 5FAHA 1LPZB 4AB9A 1HFDA 1UTJA 3PWCA 5C1UA 4IC6A 2VH0A 1GHWH 2ZIQH 1C5OH 2UWLA 4YTAA 3RXQA 3P92A 3ATIA 1N6XA 1C2KA 1EOJA 4AN7A 1MUEB 2ULLA 3LH3A 1DWEH 3KQCA 4H42U 4OS6A 2B9LA 1K1IA 1GJAB 1GI6A 1XUHA 1EQ9A 4AYVB 5K0HA 1DICA 4IC5A 1KDQA 3UWIA 1C1NA 1Z7KA 2Q6GA 1EX3A 2AGGX 1QB6A 1MZAA 2A5AA 1BTPA 4FUEA 2R0KA 9ESTA 8GCHF 3N7OA 1O3EA 2C3SA 1A0LA 4QT8C 3ZVDA 1SGNE 1WU1A 2GT8A 1V2NT 1ZMJA 1AE5A 1RTKA 3A81A 2BDGA 4FVDA 1EXFA 2RA3A 2GV6A 4X2VA 2PWXA 1ACBE 3T62A 2VIDA 2VIPA 3PTBA 1OP0A 4OGXA 5H4IB 1W0ZU 3SBKA 1PPFE 3SJKA 1IQJA 2WPIS 2FOAA 5F03A 4ABFA 2C93B 2BHGA 2F9OA 2O8LA 4Z6AH 1FLEE 4ISIH 1FAKH 1SGTA 4KTCA 5C5NA 3MH4A 3ATLA 3VPKA 3SU1A 3TH3H 2OP9A 3UNSA 2PSXA 2CF9H 2FX6A 2SFAA 1C1WH 1MKWH 2VGCC 1O32A 4YT6H 4NIVA 1E34B 3A85A 1BBRK 1GCTC 1ZRBA 2FMJA 2ZQ1A 2ZGJA 3C1KA 1YPJH 2PSYA 2QY0B 4I33A 2BY5X 2JETB 2TGAA 3K6YA 3UR6A 4JMYA 1UTPA 1UO6A 1XUIA 2XTTB 1O3MA 2NU1E 1XXFA 1NO9H 2J9NA 2A7HA 5CE1A 1ETSH 1JXPA 3MNSA 5EXNA 1QBVH 3GYMA 1HUTH 4B74A 2C8WB 2AEIH 1F0SA 3SV8A 2PR3A 1NRPH 4YZUA 1TNKA 1ETRH 3P8NA 2GVFA 2G8TA 1K28D 1HDTH 1L2EA 4MPUA 3RM2H 4K1EA 1GI2A 1MBMA 1K1PA 1EATA 1C4V2 2P93A 2W26A 4UONA 5GXPA 3GY5A 1SGRE 6CHAC 3UQOA 1C2FA 4A6LA 1QL9A 3LIWA 5JBBS 5EXMA 2IN2A 5ABWA 1UVUH 1O2HA 1NRQH 3QTOH 1C2JA 1MH0A 1ABIH 3RXKA 1ANCA 1W10U 1DLEA 1UTOA 2XBVA 2BDIA 4LOYH 1OWIA 4ZXXH 3O8RA 2WUBA 4JYVH 3T27A 2FOFA 2J34A 5JDUB 1FXYA 2F9UA 3RMMH 4A5TS 2J92A 4B75A 2GDDA 2C90B 4H6SB 4BAHB 3TITA 1QHRB 4INLA 4HFPB 4E05H 5DP7A 3GY6A 5E0HA 3SQEE 4BANB 1ZHMA 3V0XA 1Q31A 2JH0D 1K22H 1EJNA 4M7GA 1G3CA 2Y81A 7KMEH 1BCUH 3MO3A 3RP2A 2F9VA 1IHTH 2ZFPH 2BDHA 2GMTC 1KLTA 1O2ZA 2O8WA 5EPNA 1FY3A 1DSTA 1DM4B 2B0FA 2BD9A 5FXLA 3SU0A 2AIQA 1CA0B 3PMAB 4ZROA 4DIIH 3H7OA 3U8OH 3SN8A 1SGIB 1O3LA 2BY7X 3NKKA 2ZC9H 4AFQA 1BB0B 2ZU3A 1ZOMA 4K8YA 4X6NA 3RXHA 4K5ZA 3KEEA 1MTNB 2HVXA 1C5VA 2BXTH 1EZUC 3ELAH 1OWHA 2ZWLH 3SNBA 1T32A 5TCAA 3T5FH 1KY9A 1FPHH 1EB2A 3GICB 2A4RA 3DFLA 3DA9B 1CVWH 3P95A 4VGCC 3FP6E 2PGBB 5FCKA 1Y3YA 2UUYA 2W7UA 3RU4E 2QV1A 2BMGB 1NRSH 1C5YB 1K1NA 2FOMB 3DFJA 1D6RA 2BY6X 1YPGH 3DUXH 1FNIA 1UK4A 4GCHF 1Z6EA 1V2ST 1BA8B 2EI8A 5HMAA 2ZQ2A 1BTXA 1RFNA 2HNTF 1QNJA 3TPIZ 5G4BA 3ZZCA 4IGDA 5JYIA 1YM0A 3WY8A 3NUMA 1SOZA 5GWZA 1P10A 4YO9A 3PMHB 1W11U 4KKDA 4WWYA 1YGCH 4F4OC 1GJDB 1O2PA 2ZCHP 3BTFE 1BJVA 2FM2A 3TK5A 1Z1IA 1BTYA 3BTTE 1NPMA 4UFDH 3ZZAA 1D4PB 4YOGA 1GDQA 1AB9B 2GV7A 3E0PB 1OPHB 5GPIB 5A09A 2ZDLA 5GJ4B 5A8XA 4CBNA 1RXPA 4WY3A 4Y0ZE 1IQNA 1QRZA 1GL0E 3RXFA 2VIVA 1L4ZA 1PPBH 4J2YB 1IQMA 7ESTE 1P09A 4WJG2 2PTCE 1TABE 1PQ7A 1P57B 3BTDE 5DO4H 1HYLA 1ELCA 1JRSA 3PV4A 2ZF0H 1O2YA 2SGPE 4ISOA 4IBLH 2FTMA 2A45B 1O5CB 4ZHAA 1Z8GA 4O3TA 1DXWA 1P12E 3O8DA 2DE8A 3PO1B 3RC5A 4AG2A 1ESBA 1C9TA 4ISNA 4YT7H 4LXBH 4HTCH 1CBWC 3T2NA 2QC2A 1C4U2 1O3DA 5FCRA 1KYNA 5HYOA 7GCHG 2Z9GA 2HPQH 1ZPBA 2VJ1A 3GOVB 3MU5A 1YCPH 3BEIB 1D3TB 1IQEA 1W7XH 4MNWA 2BLOA 3NK8A 1L1GA 4XBDA 5L2YH 4FUJA 1A5GH 4Y11E 3HK6B 1C2GA 2JH6D 1TGCA 2G5NA 1BBRH 5AFYH 3Q3KA 2VGCB 4CREA 3STIA 4X1PU 4A1VA 3ZVCA 3TGKE 1C5ZB 1UCYH 1HBTH 2P59A 2GGVB 1H8DH 1HPGA 1YKTA 3TJNA 1S5SA 1GHXH 3RDZA 2GZ7A 1GBLA 1PPZA 1GMCF 1LHCH 1H4WA 1EZXC 3ESTA 3M5MA 4MPXA 2FOCA 3SGBE 8GCHG 1QTFA 1LVYA 3LH1A 1CHOG 1VCPA 2VWMA 3A82A 5DP9A 2P8OC 2O8TA 2CJIA 2Z6BD 3MWIU 4X2WA 3ODFA 2WV5A 2EEKA 3Q3YA 1P2JA 5JPMH 1DOJA 2VH6A 1GG6C 5FBIA 2HNTE 2G4TA 2A4QA 5FX5A 2UWOA 4IMZA 1ZTJA 2GCHG 2PHBA 2THFB 3RXEA 1J14A 3URCA 2B7DH 1EZQA 1AY6H 2VIOA 3MU0A 1JMOH 1SBWA 3M3TA 2ZEBA 3AAUA 2V6NA 2D8WA 1H8IH 2R3UA 2Z3EA 3S69A 4NIWA 1FIZA 1DANH 1QY6A 3ZZ3A 2Q6DA 1EAXA 2EC9H 4AX9H 5SGAE 1BTUA 1G3EA 3NZIA 1BTHH 5TCCA 1FDPA 2AFQB 2BD3A 1EPTA 4Q80A 1HAHH 1EZSC 1EAWA 1V2KT 1L0ZA 1C1TA 3M7TA 1SGEE 5A0AE 1ARBA 5EQSA 3ZVBA 2FOBA 1C1OA 2ZPRA 2FODA 1KDQB 2Y7ZA 3ATKA 3Q76A 4KTUA 1GBIA 2AMQA 4NIXA 1C5LH 2JH5D 2J4IA 3QO6A 1IQIA 3OSYA 3CENA 2GTBA 1C2LA 1NT1A 1O3JA 2VWLA 2PKSB 1HAVB 1HB0B 1E38B 1VR1H 4Y10E 5EG4A 1CSOE 1GHBF 3PLKA 6ESTA 1QIXB 2PKAA 2ZDMA 2G52A 1P2QA 3AW1A 2Y5FA 3RXLA 1TX6A 3A87A 2W3IA 1HAVA 5K7RA 1DE7H 1A3BH 4RKOB 2ODPA 2Y5GA 4D7FA 2BY9X 1QURH 3ZVEA 1BJUA 1TNHA 1ETTH 3PLPA 5DP4A 1FN6A 2F9NA 1CA0C 1C5MD 2ZNKH 2ZI2H 2Z3CA 4PROA 5FPYA 1RIWB 2PKAB 2A4OA 3BTQE 3IITA 1WBGB 3GY3A 1AB9C 1C1MA 4R0IA 3TNSA 3LGUA 5F6MA 1O37A 4KP0A 3VB5A 5DJ7A 2DUCA 1C2HA 1O5GH 3U8RH 1QRWA 1S82A 1THRH 4AOQA 1NFXA 3F1SB 1WTGH 2QF0A 1OWJA 1J15A 3SU5A 5AFZH 1BBRE 1K21H 2C8YB 1EJMA 4OS2A 3SV6A 1S0QA 1TIOA 4OS4A 3V12A 2XC4A 3RXUA 1DSUA 2LPRA 2A32A 3TJOA 1GI0A 1RTLA 4THNH 3RXDA 1T7CA 4X1RU 2B5TB 1DS2E 4I31A 3RLYH 1GHAG 2VIQA 3FP7E 1NC6A 4ABEA 1HAGE 2BX3A 2Q6FA 1SFQB 3M5LA 1V2VT 4ESTE 1SGFG 1TYNA 1AU8A 5FPSA 4TPYA 4CR9A 1AI8H 3RXTA 6GCHG 2QAAA 1C5WB 1S6FA 3SV7A 4AZ2B 2BY8X 3EDXB 1MKWK 1G2MA 2BDAA 1O2VA 1O3CA 4X6PA 1GL1A 2OXSA 3ENSB 2BM2A 2A2XH 2J95A 1O5AB 3PMJA 1Z8JB 2ZTXA 5AVDA 1FAXA 2P95A 2ZFFH 5L2ZH 4CRGA 3LKWA 2F9BH 1BRAA 1GVKB 2BLWA 4DGJA 1SPJA 1E37B 3V3MA 1NY22 1T4VH 4Q7XA 1QFKH 1UK3A 3OX7U 1TPAE 1Y3WA 4NGAH 3P8OA 4MDSA 1TGBA 4K8BA 2V0BA 1SL3A 3FANA 2AS9A 1O2JA 4AFZA 1FZZA 2BZ6H 1MCVA 2BVXH
chains in the Genus database with same CATH superfamily
1ZTKA 1DWCH 1ELDE 1FMGA 1AIXH 1TNGA 1OP8A 2P8OB 1F7ZA 1W7GH 1SB1H 1MD7A 2FDAA 3ZV9A 4GLYA 2R2MB 1UTNA 3NWUA 1AFEH 2WPJS 1CU1A 5I46H 3UOUA 1BMLA 3M3VA 1GJ7B 3QDZB 4ABGA 2F43B 2AMPA 1BUIA 5HIYA 3PYHA 3RXGA 4I8GA 1VCQA 4NWKA 1DUEA 3FN8A 1EUFA 3D23A 1AO5A 1GDNA 3CS7A 4YOJA 3UUZA 3F68H 3S7HB 1SGQE 2ZU1A 4CHAC 1J8AA 2D1JA 2ZDAH 4FXGH 3QGJA 2ODYB 3FZZA 2Z7FE 1VITH 1O3BA 3A83A 4DCDA 1NZQH 1E35B 1CGHA 4F48B 2KFWA 1QRXA 3A7WA 1SQRA 4UDWH 3O8BA 4I32A 4IN2A 3F2HA 1C1PA 5DP8A 4WMEA 2SNVA 1IQFA 2ZFRH 3A7XA 1NFYA 2ALPA 2RG3A 3BSQA 3FVFB 1O36A 2OUAA 2ZU4A 1PPHE 3EA7A 1S0RA 4TYDA 1CA8B 3SV2H 1A5HA 1C5NH 5FPTA 1KIGH 1TWXB 2QE7D 1ZSLA 2EI7A 3EQ0H 1AFQB 1O5BB 2CV3A 2VU8E 4R8TB 2ZO3H 5HKKD 4B76A 4E7RG 2OD3B 1ZSKA 1F0UA 3EGKH 4NA7A 4NCYA 3URDA 2H5DA 1A4WH 3K9XB 1O2KA 4YLQH 1RIWC 1ELAA 1E0FD 5A0CA 3GYLB 4GAWA 2AH4X 4TY7A 2UWPA 5PTPA 3T26A 3GCTG 1DITH 1ELBA 1H9HE 2LELA 1CQQA 4WF8A 1G2LA 4ABBA 1FUJA 2Y7XA 2SGEE 1YBWA 2G4UA 3CS0A 3D65E 4JZFH 3V13A 1TOCB 2OC7A 4WMFA 2ZTZA 4K2YA 1THSH 5HM9A 3OTJE 1GBFA 2R2WU 3E0NB 4KGAA 1IQHA 1LTOA 2C8ZB 1O2SA 1SMFE 1LHEH 4DIHH 3M5NA 4OM9A 1GCDA 4X1QU 4BXWA 1DFPA 1IHSH 4NIYA 5I25A 3WWBA 3GDVA 2TGDA 1C4Y2 1O2QA 3C27B 1TNIA 2FIRH 2QF4A 1W0YH 4HG6A 3VXEH 3IG6B 2M5TA 1JRTA 1QR3E 2BOHB 1O5DH 1GJ6A 1P2IA 2SNWA 2V3HH 3MH5A 5EODA 3BG8A 3SJOA 4KTSA 4JYTA 1FN8A 3QTVH 3KYFA 1LCYA 1EB1H 3RXAA 1BTZA 1HIAA 1HV7A 2VBCA 3VGCB 3EE0B 4A1TA 3KQDA 2J98B 3SZEA 4DY7B 2OCVB 2PUXB 1EAUA 2OBQA 5FBEA 5A2MH 4LZ1H 1GWAA 1LDTT 2J98A 1Y3XA 1ZGIA 3KIDU 4TWYA 1GMDF 1AWHB 3GCHB 1BOQA 2XWAA 1EJAA 1SLVB 1SSXA 3QWCH 1WSSH 1QQ4A 2Y6TA 2FS8A 2P3FH 5C67A 1G30B 3MFJA 4X8SH 1HJAB 4X6OA 3BG4B 4X0WU 2HNTC 1F0RA 1O34A 2BXUH 1V3XA 3RXOA 2I6SA 2J94A 3A7YA 1KTTB 3DSGA 3ZZBA 1NU7B 2EQNA 3M3SA 3MMGA 4Q7ZA 3G01A 3MU1A 1DDJA 3TGJE 1BTWA 3OU0A 2IPHA 1C2EA 3MYWA 2ZGXH 1C5RA 1TFXA 3VB4A 2CXVA 5E0JA 4DURA 3E3TA 1A61H 1MD8A 1NESE 1WV7H 5JBAS 3UTUH 4ASHA 2R3YA 2WPKS 3TLOA 1W12U 2BB4A 4IS5A 4FUGA 4TY6A 1UTMA 4P00A 1ANDA 3QZQA 4TWWA 3B8JA 5GCHG 1F92A 3PMBB 4TT3D 4DT7B 1KXAA 1HIAB 1NTPA 1S85A 2XCFA 1QJ1B 5EGMA 2QIQA 5FHTA 1GBMA 1CT4E 4YLUA 4IMQA 3KF2A 1UVTH 4WMDA 4Y71A 1YPKH 2FI4E 4CHAB 3BEFB 4B71A 4D7GA 1U6QA 1O38A 1TMUH 1KSNA 2ZHQH 4K1SA 2ZZUH 4P02A 3LGWA 1O2IA 4M9FA 1O2UA 3HPTB 1GI5A 3F3BA 1COWD 4MTBA 2FZZA 1LHDH 4CH2B 1D3PB 2AIPA 4FUCA 1DWBH 3SUDA 3UREA 1KMHB 3M5OA 3PO1C 2XOKD 3R0FA 2BX4A 1DY8A 3RXVA 4B73A 1QL7A 4NA9H 3S0NA 3ITIA 1AN1E 3ZZDA 2AERH 2AGIX 4ABDA 3W95A 8LPRA 5EQQA 5BRRE 4UD9H 2BD7A 3F9FA 3KCGH 3LPRA 4X8VH 1AZZA 1AFQC 3GISB 4NFEA 1T31A 1FIWA 1KTSB 1XMNB 3M35A 2BQ6B 1O30A 2OBOA 1QA7A 1WCZA 3F9EA 1TB6H 1GBJA 3PM3A 1L1JA 1HAYB 1RTFB 3RXRA 3FKSD 2ESTE 3MU4A 1SGDE 2OC8A 1SR5C 1C2IA 4GPGA 1YP9A 2FOEA 2YNAA 1SI5H 1VGCB 2KCOA 1GJ4H 3HGNA 1MABB 1J17T 1DVAH 1THPB 3ZYEA 2IOTA 2WYJA 1P03A 2YMSD 4OS5A 3UWJH 3DHKH 2RA0A 3U1IB 3Q3XA 1L1NA 1W14U 1N6YA 4GHQA 4YOIA 1YYY1 4J1YA 1SGFA 4INKA 1M9UA 4UE7H 2OK5A 3BTKE 3ATMA 4UFGH 1O3FA 3SU6A 1GI8B 1BHXB 4RT1A 1QGFA 1GHZA 1OWEA 1MTUA 1ZZZA 5CDFE 1XX9A 2WUCA 3HK3B 3LONA 4UFFH 1OOKB 3PTNA 1P9UA 2JKHA 3U28C 3BTHE 2BYAX 3S9AA 1LO6A 2BD2A 4AFSA 1SGPE 4O03A 3KGPA 5C3NA 1UCYE 3QN7A 2K1QA 1TNLA 3SU4A 1PPCE 1GMCG 1TRMA 2FESH 3KL6A 3FFGA 1B7XB 1AD8H 1OKXA 1FPCH 2WINI 1GJ5H 1O2GH 1D3DB 2C4FH 1FY8E 1JOUB 1V2WT 5CMXH 1BT7A 3VG8A 1Z8RA 1OX1A 1AHTH 3FAOA 1SFIA 5LPFA 1Z6JH 1HAXB 1N8OB 2GD4B 1BQYA 1FY4A 3E90B 4CH8B 5B6LA 4ISHH 1A0HB 2BD4A 2Z9IA 1QL8A 1OYQA 2UUKB 3MI4A 1ESTA 1F5RA 5EOKA 3GCTF 1VJAU 1HJAC 1UVSH 1PQAA 2O9QA 2HOBA 4ACBA 2L74A 2KM0A 3A8AA 3S9BA 1TBZH 3Q77A 1NS3A 3GCOA 3EYDA 4F49A 1AQ7A 1GCTB 1LPGB 1YPEH 1O39A 2XYAA 1Y3UA 3OY5U 4F55A 5T6FA 2FO9A 2NU0E 1A2CH 1ARCA 2XWBI 1WAYB 3VEQB 2JETC 3OY6U 4XDEA 5DKMA 5DP3A 4B6FA 4FUBA 4MLFB 3LGYA 4FUDA 3TH4H 3TK9A 4CRFA 2ILNA 5LGOA 1O2XA 5DK1A 1E36B 1Y8TA 2IPQX 3I78A 2HWLB 3SJ8A 2QXGA 1O3PB 2B8OH 4INHA 1WTHD 2HALA 3VB7A 1BMAA 1EP6A 2A5KA 2A4GA 3RXBA 4Y0YE 5AF9H 3QLPH 4GUXA 3F6UH 3SI4H 4ZMAH 1UJ1A 3B9FH 2OC1A 3W1EA 1NM6A 1D9IA 1TGSZ 2AGEX 2ANYA 4IW4E 1F5LA 1KLJH 1YPHC 3W94A 2W5EA 2JIZD 4JZDH 1QCPA 4U30A 3GY8A 5KEDA 1W2KH 5DP6A 5CHBA 1MKXK 2ZDNA 1RGQA 3E16B 2HLDD 1GPZA 3A89A 4ZUHA 1X7AC 4RI0A 1PPEE 1MMJN 2YNBA 4X8TH 3SQHE 2UUFB 5EW2H 3BG4C 3HATH 4ABHA 1LMWB 5AHGH 2F91A 2PV9B 1ANBA 4FUHA 4X6MA 1O3NA 1ZPCA 4GCHG 5EJLA 1HLTH 1AE8H 3QK1A 1XUFA 3BEUA 2GCTC 3OYPA 2WPDD 1TMTH 1ZJDA 1P06A 1XVMA 1VITG 4Q7YA 1KXEA 5LH8A 3KN2A 5DN6D 3VB3A 1A5IA 1V2JT 1V6DA 3BF6H 1RJXB 1YCPM 3CNRA 3RMOH 1GI7B 3EA8A 4I8LA 1HXEH 2ZA5A 5C94A 3A8CA 2Y80A 2SGFE 1YWUA 2ALVA 1EKBB 2QXIA 1AGJA 4K1TA 1P2MA 2GDEH 2GX4A 1VGCC 2FLBH 1F0TA 1XKBC 3V7TA 3NXPA 2R0LA 2GMTB 2BQWB 1XUKA 3SNCA 1FONA 1MQ6A 1UTKA 2VB0A 2PTNA 2YMSB 2AMDA 1XUGA 1QJ6B 2P3TB 2FEQH 1O3AA 2VVVA 4JK5A 5F53A 1WUNH 3ODDA 5DP5A 1O5FH 4Y76A 2FS9A 4GVUA 1GI1A 2P94A 3A84A 2HVYB 1A7SA 2IJOB 2VVUA 3PRDA 2G51A 4D8NA 3B23B 3GY2A 4YESB 2V3OH 4NA8A 1P01A 4NZLA 1EPTB 1UK2A 5T6DA 2WPMS 3GDSA 1Y59T 3A86A 4FU7A 1EP5A 1XM1A 2JJ2D 3SHCH 2F83A 3H5CB 1CGJE 1G3DA 2H2ZA 6CHAB 2J5UA 2G5VA 3TJVA 3P17H 1A1RA 1N8OC 2ZGHA 5JB8S 1FI8A 4MPWA 1IOEA 1AMHA 1WOFA 1TE0A 2QXJA 2JDID 3N99A 4O9VA 5T3HA 4AGKA 3QZRA 1K2I1 1PQ5A 2BVRH 3MO9A 4X8UH 3LDXH 2BVSH 4WH6A 1SLUB 4UFEH 1UVPA 2EA3A 2HRVA 3M7QA 1ZSJA 2V3MA 2VVCA 1Z1JA 2Z9KA 2TIOA 1EASA 5LPEA 2H1UA 2OINA 2CHAB 3NCLA 5EU8A 1PQ8A 1AVXA 1ELVA 4FUIA 3S7KB 1G37A 1PPGE 2ANMH 3L3TA 2UUJB 3A88A 3JZ1B 1C5TA 1SQTA 4MQAA 3ZZ5A 5A8YA 1GI3A 1TPSA 2FYRA 1OXGA 3ZIAD 2ZPSA 2BD8A 1JIMA 2P3UB 1GBBA 1C1UH 3VB6A 4O97A 2WZQA 1G32B 5C1XA 2SGQE 3WWFA 4FOUC 1JIRA 1GGDB 2AYWA 5DPAA 1AUTC 2QGRA 2KR7A 4IN1A 2ZPQA 3DD2H 2J38A 2STBE 4H4FA 1CBWB 1MAXA 1TRYA 2ZHDA 2Z94A 4NSVA 3NPSA 1YPHE 1IQGA 2H9TH 3LT3A 1NFWA 2V35A 1K9OE 1DX5M 1HJ9A 5E0GA 1ANEA 1G9IE 2GZ8A 2TGPZ 1C5XB 2ZP0H 3LU9B 1PYTD 1S83A 1ZHRA 3F0PA 4HGCA 1H1BA 4LZ4B 2H5CA 2WV4A 3M61U 3VFEA 4OGYA 1O2RA 2HPPH 1GJ8B 1V2MT 3P70B 1JWTA 1W13U 4RSPA 2XW9A 1GDUA 4WXVA 1LKBA 1VCWA 2QF3A 1G36A 1MAYA 2WPLS 1GHAF 2GCHF 2CN0H 2QCYA 3MU8A 1WQVH 2H9EH 1PYTC 1C1RA 3A8BA 3D49H 4XE4A 2Q1JA 2OQ5A 1BDAA 5ESTE 4JZIA 1P3CA 4AGJA 2EI6A 4ZHLU 4ZKSU 1C1QA 2GP9B 1DT2A 2ZU5A 1NRNH 5EXLA 2H9HA 2ZHFH 1WQSA 1GBDA 2BDCA 5DGJA 3SUFA 1P8VC 2H6MA 1SQAA 1ORFA 2FWWA 1ZGVA 1BMMH 3SUEA 3QUMP 3KYGA 5ESBA 1A46H 4BTTB 3GCHC 4AORA 3ZZ8A 1RD3B 4XBCA 4XFQA 1SG8B 4BAOB 1C5UA 1TX7A 5L6NH 5EJ1A 1ELFA 3STJA 3QX5H 1ZLRA 2Y5HA 3SGAE 1TX8A 2ZHEH 1ELGA 1VKYA 2TPIZ 5F8XA 3VXFH 2ANKH 5B6OA 1C5SA 1JBUH 3PLBA 3EA9A 1SKYE 2DE9A 1P9SA 2NU2E 4LK4A 3RXJA 2LNCA 3RMLH 1ZHPA 4RKJB 3H09A 4DVAU 3BTEE 3BIUH 1FQ3A 1J9CH 3RU4T 5HXFA 3UFAA 1O2OA 3MHWU 3UNRA 4FU9A 2ZFQH 2XNIA 2PKSC 2SGDE 1K1MA 1HNEE 3OFND 1L4DA 4MNVA 2A7CA 2O8MA 1A3EH 1Y5UT 3K2UA 4MPVA 1YC0A 1SVPA 4ISLA 1HJ8A 1CGIE 1P0SH 4JYUH 1SOTA 3RLWH 2NU4E 2IJD1 1SC8U 1ZPZA 1A0JA 3U8TH 5GNDA 2CK3D 2A2QH 4Q2KA 1D3QB 3LC3A 3Q00A 1GI4A 3SO3A 4Y79A 4TPIZ 5ETXA 1ZMLA 1P04A 3HGPA 2J2UA 1GHBG 4X1NU 5T6GA 2GT7A 2CHAC 1QQUA 1XUJA 2ZDKA 1DUAA 4B1TA 1UTLM 4WH8A 4ZHMU 3ZZ4A 3RU4D 4MNYA 1GG6B 2OC0A 2TBSA 1O33A 1LQEA 1TBQH 1TOMH 1O2NA 2ODQA 4Y7AA 2AHME 1E1RD 3ZZ6A 1ZMNA 1QZ8A 4A7IB 1GGDC 1EPTC 1QBOA 2ZCKP 1K1LA 3PWBA 1CO7E 1INCA 3BTGE 3GDUA 3P8GA 1LKAA 1VZQH 2ZGCA 9LPRA 1MTSA 3A7TA 3E91A 1G3BA 1OWDA 3F2FA 4CRCA 3TJUA 5IYTA 5C0UA 2ZG0H 2VIWA 5C5OA 2BLQA 1GBHA 1OHHD 1FV9A 1GBCA 1OS8A 1GBKA 1KLIH 5C2ZA 2VWNA 4BTIB 2HGTH 2BD5A 1ELEE 1O0DH 1T8LA 5JBCS 3CP7A 1AVGH 1C5PA 1KXFA 4JZEH 3ZVAA 2A1DB 1EOLA 4DW2U 4CBOA 1KXDA 3UR9A 4ZKNU 1AUJA 3OTPA 1MCTA 1ID5H 4DT4A 1TNJA 2C8XB 1GMHG 3A80A 5LPRA 2PUQH 2Y82A 4KELA 1T8NA 3MH6A 2K8IA 1Q2WA 1KXCA 2A31A 3KQEA 1NROH 2NWNA 4MNXA 3SJIA 2RFKC 1K1OA 2STAE 1O2TA 1OWKA 4ZH8A 2BTCE 4BTUB 1BZXE 1MTWA 3K65B 2GJGA 2J97A 3U1JB 2BDBA 1SLXB 1F5KU 1H9LB 1H8ED 2ZECA 2ZFTA 1AKSB 4I8JA 4E7NA 3TK6A 1ZRKA 4GHTA 3AW0A 1O2MA 5FX6A 3RXPA 1SGCA 3IWMA 1CT0E 3RMNH 1TLDA 4U32A 1B0FA 3LC5A 1DXPA 2XBYA 2FPZA 1P05A 1T4UH 3MO6A 3MNCA 4E06H 4XD7D 4YM9A 3BTWE 1ABJH 1YPLH 1GMDG 1LPKB 2VINA 3SU3A 3A7ZA 4RT0A 1UHBB 3MNXA 2P16A 4I8HA 3DT0H 5CHAB 2CGAA 2ZDVH 5BPEA 1OSSA 2GZ9A 1TA2A 1NN6A 3ZZ9A 3A7VA 1C9PA 1TGTA 1HGTH 4AFUA 1KXBA 4U2WA 3ZVFA 1YCPK 2XCNA 2A7JA 2TRMA 1T8OA 2D26C 1IQLA 1Z8IB 2W3KA 3M37A 3BN9A 2FI3E 1EAIA 5E8EH 3TNTA 4ZCNA 1MTVA 1LVBA 4ZKRU 1QJ7B 4B2BA 1W8BH 5E2OA 3AAVA 4FVBA 1CT2E 3AASA 1XXDA 1TONA 2FTLE 1GVZA 3HKIB 3SU2A 4SGAE 1VITF 1SHYA 4BAKB 3MNBA 3PB1E 2QYIA 4JCNA 1V2LT 1ESAA 4NZQA 3OEHD 1XVOA 3RC6A 1YF4A 3RXMA 3GS9A 1N1LA 4BAQB 3LJJA 4D9QA 1J16A 3H7TA 4JZ1A 2KCAA 3T28A 3R3GB 2W7SA 1TGNA 1S6LA 1HCGA 1TQ7B 2XC0A 4RN6A 5EJZA 1YLCA 1V2RT 4BNRA 2KAIA 1LHGH 5HGGA 1IAUA 1MBQA 4ZAEA 2F3CE 3KHVA 1MTNC 1MZDA 5E2PA 3SJ9A 2O8UA 4DOQA 1DPOA 1S81A 1T8MA 3SW2B 2GCTB 2A0QB 1LVMA 3LOXA 4DJZB 6GCHF 7LPRA 1AKSA 4CRAA 2FP7B 2XXLA 2XC5A 3UOPA 3BIVH 4VGCB 1ZJKA 1FY5A 1CE5A 3M7UA 3P6ZB 3SNDA 2Z9LA 4FUFA 1P02A 3GY7A 2YOLA 2FXRA 1QB9A 4K60A 3RM0H 4ZXYH 2OTVA 1GHVH 3SUGA 2F9PA 4A92A 1FJSA 3I77A 4Y6DA 4Z0KA 1ELTA 2RDLA 4MVNA 1GBEA 7GCHF 1SHHB 2CF8H 3U9AH 4BOHA 1O5EH 3GY4A 3FOAA 1TPOA 3TIUA 4CR5A 1ZTLA 1MU8B 1B5GH 5DG6A 2KCYA 4WXIA 1P3EA 3DCLA 2RCEA 1P11E 3D62A 8ESTE 3T25A 3FZDA 3VGCC 2PGQB 3SYJA 4XOJA 1FY1A 2RDEA 1C1SA 3RC4A 1TAWA 1HXFH 2GKVE 3KQBA 1NBME 1IQKA 3K6ZA 4CRBA 1ZR0A 1GJ9B 2ANWA 3ZZ7A 1NU9A 1GVLA 3TU7H 2XRCA 5T1VA 5F8ZA 4HZHA 2BZAA 4TSFD 1LVOA 5L30H 1S6HA 1TMBH 1F2SE 4BXSA 2HLCA 2BOKA 3AVZA 1BHXF 1QBNA 1MKXH 4K69A 1GJCB 4ABJA 2ZTYA 5C20A 4DG4A 4Q4LA 3ZYDA 3RXSA 1GJBB 1P2NA 1TPPA 1HAZB 4MG3A 1MU6B 1CHGA 4BAMB 3BTME 2VWOA 4NWLA 3EAJA 1V2UT 2XBXA 1Y5AT 1O31A 3MOCA 3TVJB 1SGYE 1TBRH 2XBWA 2V7QD 3SHAH 1OYTH 1GHYH 4GSOA 1LHFH 5JBTA 4U01A 1LQDB 1C1VH 2QN5T 3GCNA 4NSYA 5EQRA 5GDSH 1VJ9U 5CHAC 3OAAD 4X2YA 5HM2A 3O8CA 1O2WA 3P8FA 1C2DA 2G81E 2ZFSA 3RXIA 2PFEA 5EPYA 1QA0A 3LGVA 3RXCA 4CRDA 1RS0A 3ZV8A 3SV9A 1P2KA 2ZU2A 3TH2H 5IDKA 1K1JA 3PROA 3RUOA 2WYGA 1DY9A 1GBAA 3UNQA 4XSKU 2BDYA 4HI3A 3A8DA 1AVWA 4SGBE 1BRBE 3U69H 2Z3DA 1V2OT 1WDIA 2F4LA 5C1YA 4ABAA 3E6PH 1PFXC 3E8LA 4AC9A 1P2OA 4AB8A 4AYYB 2PW8H 4A1XA 2R9PA 3N7DA 4H6TA 1HAIH 1GI9B 4ASUD 3OEED 3F0OA 3MH7A 1HAOH 1H9IE 4XBBA 3ATWA 4ABIA 4Y8XA 2ZGBH 1Q3XA 4WVPE 5TJXA 4Q63A 1V2TT 3SZNA 4B2CA 1NFUA 1O3KA 5F8TA 1YLDA 2FOHA 3TGIE 1HRTH 1UMAH 4AG1A 1SQOA 4FU8A 1TRNA 4ZKOU 1UVOA 2KAIB 4JK6A 2QF5A 1DWDH 8KME2 3SNAA 1SLWB 1O3OA 2WSSD 2FX4A 1O3HA 3T29A 2CMYA 1XKAC 2PLXA 2QXHA 3UY9A 2KX4A 5C17A 1BRCE 3SNEA 1BIOA 2EY4C 2G00A 3L6PA 4OS1A 5GCHF 1UCYK 1O3GA 1AZ8A 1TQ0B 1UHBA 1Z71A 2BLVA 5A0BA 2OLGA 4NG9H 2ZHWH 1V2QT 1O35A 2QA9E 1NRRH 4I7YH 4NFFA 3L33A 3U98H 1GMHF 4D76A 1AWFH 2NU3E 2WPHS 4OS7A 5A8ZA 1O2LA 2OQUA 2ZKSA 1TALA 3F9HA 3LGTA 1W3CA 6LPRA 2FOGA 3F9GA 1C5QA 1HAPH 4D9RA 1BMNH 5GIBA 1GBTA 1BRUP 3E1XB 4O3UA 2G55A 1RRKA 2VNTA 2A5IA 3BV9B 3UQVA 2TGTA 2ZCLP 3LGIA 5J4QA 3LJOA 1PJPA 2Z9JA 1OP2A 3UPEA 4Y7BA 3SORA 2ASUB 1YLNA 3FP8E 3JZ2B 3I29A 3ZVGA 1V2PT 1MQ5A 4K3JA 2SGAA 1Y5BT 1YPMH 3MTYA 4B2AA 5EW1H 1WYKA 2I6QA 3PV5A 5J4SA 3HKJB 3KNXA 3QGNB 3M36A 1C2MA 3PV2A 3SOSA 1BITA 5JB9S 1CHOF 3UIRA 4UEHH 2D2DA 3SGQE 4X1SU 2FI5E 1W0KD 3S9CA 1UW7A 2BQ7B 3PRBA 1ZYOA 4Y8ZA 3FO8D 1O3IA 3SI3H 1Y3VA 1D6WA 1S84A 1UTQA 4X2XA 1B0EA 1QB1A 4I8KA 4Y8YA 1DLKB 1TA6A 2FLRH 1NBMD 2FYQA 5FAHA 1LPZB 4AB9A 1HFDA 1UTJA 3PWCA 5C1UA 4IC6A 2VH0A 1GHWH 2ZIQH 1C5OH 2KZ4A 2UWLA 4YTAA 3RXQA 3P92A 3ATIA 1N6XA 1C2KA 1EOJA 4AN7A 1MUEB 2ULLA 3LH3A 4Z1MD 1DWEH 3KQCA 4H42U 4OS6A 3OE7D 2B9LA 1K1IA 1GJAB 1GI6A 1XUHA 1EQ9A 4AYVB 5K0HA 1DICA 4IC5A 1KDQA 3UWIA 1C1NA 1Z7KA 2Q6GA 1EX3A 2AGGX 1QB6A 1MZAA 2A5AA 1BTPA 4FUEA 2R0KA 9ESTA 8GCHF 3N7OA 1O3EA 2C3SA 1A0LA 4QT8C 3ZVDA 1SGNE 3F2GA 1WU1A 2GT8A 1V2NT 1ZMJA 1AE5A 1RTKA 2JJ1D 3A81A 2BDGA 4FVDA 1EXFA 2RA3A 2GV6A 4X2VA 2PWXA 1ACBE 3T62A 2VIDA 2VIPA 3PTBA 1OP0A 2WHXA 4OGXA 5H4IB 1W0ZU 3SBKA 1PPFE 3SJKA 1IQJA 2WPIS 2FOAA 5F03A 4ABFA 2C93B 2BHGA 2F9OA 2O8LA 4Z6AH 1FLEE 4ISIH 2M2AA 1FAKH 1SGTA 4KTCA 5C5NA 3MH4A 3ATLA 3VPKA 3SU1A 3TH3H 2OP9A 3UNSA 2PSXA 2CF9H 2FX6A 2SFAA 1C1WH 1MKWH 2VGCC 1O32A 4YT6H 4NIVA 1E34B 1BMFD 3A85A 1BBRK 1GCTC 1ZRBA 5KGOA 2FMJA 2ZQ1A 2ZGJA 3C1KA 2K0QA 1YPJH 2PSYA 2QY0B 4I33A 2BY5X 2JETB 2TGAA 3K6YA 3UR6A 4JMYA 2PP6A 1UTPA 1UO6A 1XUIA 2NU1E 1O3MA 2XTTB 1XXFA 1NO9H 2J9NA 2A7HA 5CE1A 1ETSH 1JXPA 3MNSA 5EXNA 1QBVH 3GYMA 1HUTH 4B74A 2C8WB 2AEIH 1F0SA 3SV8A 2PR3A 1NRPH 4YZUA 1TNKA 1ETRH 3P8NA 1H8HD 2GVFA 1EFRD 2G8TA 1K28D 1HDTH 1L2EA 4MPUA 3RM2H 4K1EA 1GI2A 1MBMA 1K1PA 1EATA 1C4V2 2P93A 2W26A 4UONA 5GXPA 3GY5A 1SGRE 6CHAC 3UQOA 1C2FA 3UB0A 4A6LA 1QL9A 1W0JD 3LIWA 5JBBS 5EXMA 5KECA 2IN2A 5ABWA 1UVUH 1O2HA 1NRQH 3QTOH 3AK5A 1C2JA 1MH0A 1ABIH 3RXKA 1ANCA 1W10U 1DLEA 1UTOA 2XBVA 2BDIA 4LOYH 1OWIA 4ZXXH 3O8RA 2WUBA 4FETA 1WXRA 4JYVH 3T27A 2FOFA 2J34A 4B6EA 5JDUB 1FXYA 1K0HA 2F9UA 3RMMH 4A5TS 2J92A 4B75A 2GDDA 2C90B 4H6SB 4BAHB 3TITA 1QHRB 2WV9A 4INLA 4HFPB 4E05H 5DP7A 3GY6A 5E0HA 3SQEE 4BANB 1ZHMA 3V0XA 1Q31A 2JH0D 1K22H 1EJNA 4M7GA 1G3CA 2Y81A 7KMEH 1BCUH 3MO3A 3RP2A 2F9VA 1IHTH 2ZFPH 2BDHA 2GMTC 1KLTA 1O2ZA 2O8WA 5EPNA 1FY3A 1DSTA 1DM4B 2B0FA 2BD9A 5FXLA 3SU0A 2AIQA 1CA0B 3PMAB 4ZROA 4DIIH 1FX0B 3H7OA 3U8OH 3SN8A 1SGIB 1O3LA 2BY7X 3NKKA 2ZC9H 4AFQA 1BB0B 2ZU3A 1ZOMA 4K8YA 4X6NA 3RXHA 4K5ZA 3KEEA 1MTNB 2HVXA 1C5VA 2BXTH 1EZUC 3ELAH 1OWHA 2ZWLH 3SNBA 1T32A 5TCAA 3T5FH 3DSPA 1KY9A 1FPHH 1EB2A 3GICB 2A4RA 3DFLA 3DA9B 1CVWH 3P95A 4VGCC 3FP6E 2PGBB 5FCKA 1Y3YA 2UUYA 2W7UA 3RU4E 2QV1A 2BMGB 1NRSH 1C5YB 1K1NA 2FOMB 3DFJA 1D6RA 2BY6X 1YPGH 3DUXH 1FNIA 1UK4A 4GCHF 1Z6EA 1V2ST 1BA8B 2EI8A 5HMAA 2ZQ2A 1BTXA 1RFNA 2HNTF 1QNJA 3TPIZ 5G4BA 3ZZCA 4IGDA 5IK2D 5JYIA 1YM0A 3WY8A 3NUMA 1SOZA 5GWZA 1P10A 4YO9A 3PMHB 1W11U 4KKDA 4WWYA 1YGCH 4F4OC 1GJDB 1O2PA 2ZCHP 3BTFE 1BJVA 2FM2A 3EE7A 3KQ5A 3TK5A 1Z1IA 1BTYA 3BTTE 1NPMA 3DSOA 4UFDH 3ZZAA 1D4PB 4YOGA 1GDQA 1AB9B 2GV7A 1E79D 3E0PB 1OPHB 5GPIB 5A09A 2ZDLA 5GJ4B 5A8XA 2W6JD 5HIZA 4CBNA 1RXPA 4WY3A 4Y0ZE 1IQNA 1QRZA 1GL0E 3RXFA 2VIVA 1L4ZA 1PPBH 4J2YB 1IQMA 7ESTE 1P09A 3UAIC 4WJG2 2PTCE 1TABE 1PQ7A 1P57B 3BTDE 5DO4H 1HYLA 1ELCA 1JRSA 3PV4A 2ZF0H 1O2YA 2SGPE 4ISOA 4IBLH 2FTMA 2A45B 1O5CB 4ZHAA 1Z8GA 4O3TA 1DXWA 1P12E 3O8DA 2DE8A 3PO1B 3RC5A 4AG2A 1ESBA 1C9TA 4ISNA 4YT7H 1E1QD 4LXBH 4HTCH 1CBWC 3T2NA 2QC2A 1C4U2 1O3DA 5FCRA 1KYNA 4YXWD 5HYOA 7GCHG 2Z9GA 2HPQH 4ACAA 1ZPBA 2VJ1A 3GOVB 3MU5A 1YCPH 3BEIB 1D3TB 1IQEA 1W7XH 4MNWA 2BLOA 3NK8A 1L1GA 4XBDA 5L2YH 4FUJA 1A5GH 4Y11E 2XNDD 3HK6B 1C2GA 2JH6D 1TGCA 2G5NA 1BBRH 5AFYH 3Q3KA 2VGCB 4CREA 3STIA 2W6ID 4X1PU 4A1VA 3ZVCA 3TGKE 1C5ZB 1UCYH 1HBTH 2P59A 2GGVB 1H8DH 1HPGA 1YKTA 3TJNA 1S5SA 1GHXH 3RDZA 2GZ7A 1GBLA 1PPZA 5C0TA 1GMCF 1LHCH 1H4WA 1EZXC 3ESTA 3M5MA 4MPXA 2FOCA 3SGBE 8GCHG 1QTFA 1LVYA 3LH1A 1CHOG 1VCPA 2VWMA 3A82A 5DP9A 2P8OC 2O8TA 2CJIA 2Z6BD 3MWIU 4X2WA 3ODFA 2WV5A 2EEKA 3Q3YA 1P2JA 5JPMH 1DOJA 2VH6A 1GG6C 5FBIA 2HNTE 2G4TA 2A4QA 5FX5A 2UWOA 4IMZA 1ZTJA 2GCHG 2PHBA 2THFB 3RXEA 1J14A 3URCA 2B7DH 1EZQA 1AY6H 2VIOA 3MU0A 1JMOH 1SBWA 3M3TA 2ZEBA 3AAUA 3MQKC 2V6NA 2D8WA 1H8IH 2R3UA 2Z3EA 3S69A 4NIWA 1FIZA 5EIYA 1DANH 1QY6A 3ZZ3A 2Q6DA 1EAXA 2EC9H 4AX9H 5SGAE 1BTUA 1G3EA 3NZIA 1BTHH 5TCCA 1FDPA 2AFQB 2BD3A 1EPTA 2LP6A 4Q80A 1HAHH 1EZSC 1EAWA 1V2KT 1L0ZA 1C1TA 3M7TA 1SGEE 5A0AE 1ARBA 5EQSA 3ZVBA 2FOBA 1C1OA 2ZPRA 2FODA 1KDQB 2Y7ZA 3ATKA 3Q76A 4KTUA 1GBIA 2AMQA 4NIXA 1C5LH 2JH5D 2J4IA 3QO6A 1IQIA 3OSYA 3CENA 2GTBA 1C2LA 1NT1A 1O3JA 5FL7D 2VWLA 4XRNA 2PKSB 1HAVB 1HB0B 1E38B 1VR1H 4Y10E 5EG4A 1CSOE 1GHBF 3PLKA 6ESTA 1QIXB 2PKAA 2ZDMA 2G52A 1P2QA 3AW1A 2Y5FA 3RXLA 1TX6A 3A87A 2W3IA 1HAVA 5K7RA 1DE7H 1A3BH 4RKOB 2ODPA 2Y5GA 4D7FA 2BY9X 1QURH 3ZVEA 1BJUA 1TNHA 1ETTH 3PLPA 5DP4A 1FN6A 2F9NA 1CA0C 1C5MD 2ZNKH 2ZI2H 3N7EA 2Z3CA 4PROA 5FPYA 1RIWB 2PKAB 2A4OA 3BTQE 3IITA 1WBGB 3GY3A 1AB9C 1C1MA 4R0IA 3NRLA 3TNSA 3LGUA 5F6MA 1O37A 4KP0A 3VB5A 5DJ7A 2DUCA 1C2HA 1O5GH 3U8RH 1QRWA 1S82A 1THRH 4AOQA 1NFXA 3F1SB 1WTGH 2QF0A 1OWJA 1J15A 3SU5A 5AFZH 1BBRE 1K21H 2C8YB 1EJMA 2KCPA 4OS2A 3SV6A 1S0QA 1TIOA 4OS4A 3V12A 2XC4A 3RXUA 1DSUA 2LPRA 2A32A 1YY3A 3TJOA 1GI0A 1RTLA 4THNH 3RXDA 1T7CA 4X1RU 2B5TB 1DS2E 4I31A 3RLYH 1GHAG 2VIQA 3FP7E 1NC6A 4ABEA 5DSFA 1HAGE 2BX3A 2Q6FA 1SFQB 4I86A 3M5LA 1V2VT 4ESTE 1SGFG 1TYNA 1AU8A 5FPSA 4TPYA 4CR9A 1AI8H 3RXTA 6GCHG 2QAAA 1C5WB 1S6FA 3SV7A 4AZ2B 2BY8X 3EDXB 1MKWK 1G2MA 2BDAA 1O2VA 1O3CA 4X6PA 1GL1A 2OXSA 3ENSB 2BM2A 2A2XH 2L6OA 2J95A 1O5AB 3PMJA 1Z8JB 3WW7A 2ZTXA 5AVDA 1FAXA 2P95A 2ZFFH 5L2ZH 4CRGA 3LKWA 2F9BH 1BRAA 1GVKB 2BLWA 4DGJA 1SPJA 1E37B 3V3MA 1NY22 1T4VH 4Q7XA 1QFKH 1UK3A 3OX7U 1TPAE 1Y3WA 2YMSC 3P8OA 4NGAH 4MDSA 1TGBA 4K8BA 2V0BA 1SL3A 3FANA 2AS9A 1O2JA 4AFZA 1FZZA 2BZ6H 1MCVA 2BVXH
chains in the Genus database with same CATH topology
1ZTKA 1DWCH 1ELDE 1FMGA 1AIXH 1TNGA 1OP8A 2P8OB 1F7ZA 1W7GH 1SB1H 1MD7A 2FDAA 3ZV9A 4GLYA 2R2MB 1UTNA 3NWUA 1AFEH 2WPJS 1CU1A 5I46H 3UOUA 1BMLA 3M3VA 1GJ7B 3QDZB 4ABGA 2AMPA 1BUIA 3PYHA 3RXGA 4I8GA 1VCQA 4NWKA 1DUEA 1EUFA 3D23A 1AO5A 1GDNA 3CS7A 4YOJA 3UUZA 3F68H 3S7HB 1SGQE 2ZU1A 4CHAC 1J8AA 2D1JA 2ZDAH 4FXGH 3QGJA 2ODYB 3FZZA 2Z7FE 1VITH 1O3BA 3A83A 4DCDA 1NZQH 1E35B 1CGHA 1QRXA 3A7WA 4UDWH 3O8BA 4I32A 4IN2A 1C1PA 5DP8A 4WMEA 2SNVA 1IQFA 2ZFRH 3A7XA 1NFYA 2ALPA 2RG3A 3BSQA 3FVFB 1O36A 2OUAA 2ZU4A 1PPHE 3EA7A 1S0RA 4TYDA 1CA8B 3SV2H 1A5HA 1C5NH 5FPTA 1KIGH 1TWXB 1ZSLA 2EI7A 3EQ0H 1AFQB 1O5BB 2CV3A 2VU8E 4R8TB 2ZO3H 4B76A 4E7RG 2OD3B 1ZSKA 1F0UA 3EGKH 4NA7A 4NCYA 3URDA 2H5DA 1A4WH 3K9XB 1O2KA 4YLQH 1RIWC 1ELAA 1E0FD 5A0CA 3GYLB 4GAWA 2AH4X 4TY7A 2UWPA 5PTPA 3T26A 3GCTG 1DITH 1ELBA 1H9HE 1CQQA 4WF8A 1G2LA 4ABBA 1FUJA 2Y7XA 2SGEE 1YBWA 2G4UA 3CS0A 3D65E 4JZFH 3V13A 1TOCB 2OC7A 4WMFA 2ZTZA 4K2YA 1THSH 5HM9A 3OTJE 1GBFA 2R2WU 3E0NB 4KGAA 1IQHA 1LTOA 2C8ZB 1O2SA 1SMFE 1LHEH 4DIHH 3M5NA 4BXWA 1GCDA 4X1QU 1DFPA 1IHSH 4NIYA 5I25A 3GDVA 2TGDA 1C4Y2 1O2QA 3C27B 1TNIA 2FIRH 1W0YH 3VXEH 3IG6B 2M5TA 1JRTA 1QR3E 2BOHB 1O5DH 1GJ6A 1P2IA 2SNWA 2V3HH 3MH5A 5EODA 3BG8A 3SJOA 4KTSA 4JYTA 1FN8A 3QTVH 1LCYA 1EB1H 3RXAA 1BTZA 1HIAA 1HV7A 3VGCB 4A1TA 3EE0B 3KQDA 4DY7B 2OCVB 2PUXB 1EAUA 2OBQA 5FBEA 5A2MH 4LZ1H 1GWAA 1LDTT 1Y3XA 1ZGIA 3KIDU 4TWYA 1GMDF 1AWHB 3GCHB 1BOQA 2XWAA 1EJAA 1SLVB 1SSXA 3QWCH 1WSSH 1QQ4A 2Y6TA 2FS8A 2P3FH 5C67A 1G30B 3MFJA 4X8SH 1HJAB 4X6OA 3BG4B 4X0WU 2HNTC 1F0RA 1O34A 2BXUH 1V3XA 3RXOA 2I6SA 2J94A 3A7YA 1KTTB 3ZZBA 1NU7B 3M3SA 3MMGA 4Q7ZA 3G01A 3MU1A 1DDJA 3TGJE 1BTWA 3OU0A 2IPHA 1C2EA 3MYWA 2ZGXH 1C5RA 1TFXA 3VB4A 2CXVA 5E0JA 4DURA 3E3TA 1A61H 1MD8A 1NESE 1WV7H 5JBAS 3UTUH 4ASHA 2R3YA 2WPKS 3TLOA 1W12U 2BB4A 4IS5A 4FUGA 4TY6A 1UTMA 1ANDA 3QZQA 4TWWA 3B8JA 5GCHG 1F92A 3PMBB 4DT7B 1KXAA 1HIAB 1NTPA 2XCFA 1S85A 1QJ1B 5EGMA 2QIQA 5FHTA 1GBMA 1CT4E 4YLUA 4IMQA 3KF2A 1UVTH 4WMDA 4Y71A 1YPKH 2FI4E 4CHAB 3BEFB 4B71A 4D7GA 1U6QA 1O38A 1TMUH 1KSNA 2ZHQH 4K1SA 2ZZUH 3LGWA 1O2IA 1O2UA 3HPTB 1GI5A 4MTBA 2FZZA 1LHDH 4CH2B 1D3PB 2AIPA 4FUCA 1DWBH 3SUDA 3UREA 3PO1C 3M5OA 3R0FA 2BX4A 1DY8A 3RXVA 4B73A 1QL7A 4NA9H 3S0NA 3ITIA 1AN1E 3ZZDA 2AERH 2AGIX 4ABDA 3W95A 8LPRA 5EQQA 5BRRE 4UD9H 2BD7A 3F9FA 3KCGH 3LPRA 4X8VH 1AZZA 1AFQC 3GISB 4NFEA 1T31A 1FIWA 1KTSB 1XMNB 3M35A 2BQ6B 1O30A 2OBOA 1QA7A 1WCZA 3F9EA 1TB6H 1GBJA 3PM3A 1L1JA 1HAYB 1RTFB 3RXRA 2ESTE 3MU4A 1SGDE 2OC8A 1SR5C 1C2IA 4GPGA 1YP9A 2FOEA 2YNAA 1SI5H 1VGCB 3HGNA 1GJ4H 1J17T 1DVAH 1THPB 3ZYEA 2IOTA 2WYJA 1P03A 4OS5A 3UWJH 3DHKH 2RA0A 3U1IB 3Q3XA 1L1NA 1W14U 1N6YA 4GHQA 4YOIA 1YYY1 4J1YA 1SGFA 4INKA 1M9UA 4UE7H 3BTKE 3ATMA 4UFGH 1O3FA 3SU6A 1GI8B 1BHXB 1QGFA 1GHZA 1OWEA 1MTUA 1ZZZA 1XX9A 2WUCA 3HK3B 3LONA 4UFFH 1OOKB 3PTNA 1P9UA 2JKHA 3BTHE 2BYAX 3S9AA 1LO6A 2BD2A 4AFSA 1SGPE 4O03A 3KGPA 5C3NA 1UCYE 3QN7A 2K1QA 1TNLA 3SU4A 1PPCE 1GMCG 1TRMA 2FESH 3KL6A 3FFGA 1B7XB 1AD8H 1OKXA 1FPCH 2WINI 1GJ5H 1O2GH 1D3DB 2C4FH 1FY8E 1JOUB 1V2WT 5CMXH 1BT7A 1Z8RA 1OX1A 1AHTH 3FAOA 1SFIA 5LPFA 1Z6JH 1HAXB 1N8OB 2GD4B 1BQYA 1FY4A 3E90B 4CH8B 4ISHH 1A0HB 2BD4A 2Z9IA 1QL8A 1OYQA 2UUKB 3MI4A 1ESTA 1F5RA 5EOKA 3GCTF 1VJAU 1HJAC 1UVSH 1PQAA 2O9QA 2HOBA 3A8AA 3S9BA 1TBZH 3Q77A 1NS3A 3GCOA 3EYDA 4F49A 1AQ7A 1GCTB 1LPGB 1YPEH 1O39A 2XYAA 1Y3UA 3OY5U 5T6FA 2FO9A 2NU0E 1A2CH 1ARCA 2XWBI 1WAYB 3VEQB 2JETC 3OY6U 4XDEA 5DKMA 5DP3A 4FUBA 4MLFB 3LGYA 4FUDA 3TH4H 3TK9A 4CRFA 2ILNA 5LGOA 1O2XA 5DK1A 1E36B 1Y8TA 3I78A 2HWLB 3SJ8A 2QXGA 1O3PB 2B8OH 4INHA 1WTHD 2HALA 3VB7A 1BMAA 1EP6A 2A5KA 2A4GA 3RXBA 4Y0YE 5AF9H 3QLPH 4GUXA 3F6UH 3SI4H 4ZMAH 1UJ1A 3B9FH 2OC1A 1NM6A 1D9IA 1TGSZ 2AGEX 2ANYA 4IW4E 1F5LA 1KLJH 1YPHC 3W94A 2W5EA 4JZDH 1QCPA 4U30A 3GY8A 1W2KH 5DP6A 1MKXK 2ZDNA 1RGQA 3E16B 1GPZA 3A89A 4ZUHA 1X7AC 1PPEE 1MMJN 2YNBA 4X8TH 3SQHE 2UUFB 5EW2H 3BG4C 3HATH 4ABHA 1LMWB 5AHGH 2F91A 2PV9B 1ANBA 4FUHA 4X6MA 1O3NA 1ZPCA 4GCHG 1HLTH 1AE8H 3QK1A 1XUFA 3BEUA 2GCTC 3OYPA 1TMTH 1ZJDA 1P06A 1XVMA 1VITG 4Q7YA 1KXEA 5LH8A 3KN2A 3VB3A 1A5IA 1V2JT 1V6DA 3BF6H 1RJXB 1YCPM 3RMOH 1GI7B 3EA8A 4I8LA 1HXEH 2ZA5A 3A8CA 2Y80A 2SGFE 2ALVA 1EKBB 2QXIA 1AGJA 4K1TA 1P2MA 2GDEH 2GX4A 1VGCC 2FLBH 1F0TA 1XKBC 3V7TA 3NXPA 2R0LA 2GMTB 2BQWB 1XUKA 3SNCA 1FONA 1MQ6A 1UTKA 2VB0A 2PTNA 2AMDA 1XUGA 1QJ6B 2P3TB 2FEQH 1O3AA 2VVVA 4JK5A 1WUNH 3ODDA 5DP5A 1O5FH 4Y76A 2FS9A 4GVUA 1GI1A 2P94A 3A84A 1A7SA 2IJOB 2VVUA 4D8NA 2G51A 3B23B 3GY2A 4YESB 2V3OH 4NA8A 1P01A 4NZLA 1EPTB 1UK2A 5T6DA 2WPMS 3GDSA 1Y59T 3A86A 4FU7A 1EP5A 1XM1A 3SHCH 2F83A 3H5CB 1CGJE 1G3DA 2H2ZA 6CHAB 2G5VA 3TJVA 3P17H 1A1RA 1N8OC 2ZGHA 5JB8S 1FI8A 4MPWA 1IOEA 1AMHA 1WOFA 1TE0A 2QXJA 4O9VA 5T3HA 4AGKA 3QZRA 1K2I1 1PQ5A 2BVRH 3MO9A 4X8UH 3LDXH 2BVSH 4WH6A 1SLUB 4UFEH 1UVPA 2EA3A 2HRVA 3M7QA 1ZSJA 2VVCA 1Z1JA 2Z9KA 2TIOA 1EASA 5LPEA 2H1UA 2OINA 2CHAB 3NCLA 5EU8A 1PQ8A 1AVXA 1ELVA 4FUIA 3S7KB 1G37A 1PPGE 2ANMH 3L3TA 2UUJB 3A88A 3JZ1B 1C5TA 1SQTA 4MQAA 3ZZ5A 5A8YA 1GI3A 1TPSA 2FYRA 1OXGA 2ZPSA 2BD8A 1JIMA 2P3UB 1GBBA 1C1UH 3VB6A 4O97A 1G32B 5C1XA 2SGQE 1JIRA 1GGDB 2AYWA 5DPAA 1AUTC 2QGRA 4IN1A 2ZPQA 3DD2H 2J38A 2STBE 4H4FA 1CBWB 1MAXA 1TRYA 2ZHDA 2Z94A 4NSVA 3NPSA 1YPHE 1IQGA 2H9TH 3LT3A 1NFWA 2V35A 1K9OE 1DX5M 1HJ9A 5E0GA 1ANEA 1G9IE 2GZ8A 2TGPZ 1C5XB 2ZP0H 3LU9B 1PYTD 1S83A 1ZHRA 4HGCA 1H1BA 4LZ4B 2H5CA 2WV4A 3M61U 3VFEA 4OGYA 1O2RA 2HPPH 1GJ8B 1V2MT 3P70B 1JWTA 1W13U 4RSPA 2XW9A 1GDUA 4WXVA 1LKBA 1VCWA 2QF3A 1G36A 1MAYA 2WPLS 1GHAF 2GCHF 2CN0H 2QCYA 3MU8A 1WQVH 2H9EH 1PYTC 1C1RA 3A8BA 3D49H 4XE4A 2Q1JA 2OQ5A 1BDAA 5ESTE 4JZIA 1P3CA 4AGJA 2EI6A 4ZHLU 4ZKSU 1C1QA 2GP9B 1DT2A 2ZU5A 1NRNH 5EXLA 2H9HA 2ZHFH 1WQSA 1GBDA 2BDCA 5DGJA 3SUFA 1P8VC 2H6MA 1SQAA 1ORFA 2FWWA 1ZGVA 1BMMH 3SUEA 3QUMP 5ESBA 1A46H 4BTTB 3GCHC 4AORA 3ZZ8A 1RD3B 4XBCA 4XFQA 1SG8B 4BAOB 1C5UA 1TX7A 5L6NH 1ELFA 3STJA 3QX5H 1ZLRA 2Y5HA 3SGAE 1TX8A 2ZHEH 1ELGA 5F8XA 2TPIZ 3VXFH 2ANKH 5B6OA 1C5SA 1JBUH 3PLBA 3EA9A 2DE9A 1P9SA 2NU2E 4LK4A 3RXJA 2LNCA 3RMLH 1ZHPA 4RKJB 4DVAU 3BTEE 3BIUH 1FQ3A 1J9CH 3RU4T 5HXFA 3UFAA 1O2OA 3MHWU 3UNRA 4FU9A 2ZFQH 2XNIA 2PKSC 2SGDE 1K1MA 1HNEE 1L4DA 4MNVA 2A7CA 2O8MA 1A3EH 1Y5UT 3K2UA 4MPVA 1YC0A 1SVPA 4ISLA 1HJ8A 1CGIE 1P0SH 4JYUH 1SOTA 3RLWH 2NU4E 1SC8U 1ZPZA 1A0JA 3U8TH 2A2QH 4Q2KA 1D3QB 3LC3A 3Q00A 1GI4A 3SO3A 4Y79A 4TPIZ 5ETXA 1ZMLA 1P04A 3HGPA 2J2UA 1GHBG 4X1NU 5T6GA 2GT7A 2CHAC 1QQUA 1XUJA 2ZDKA 1DUAA 4B1TA 1UTLM 4WH8A 4ZHMU 3ZZ4A 3RU4D 4MNYA 1GG6B 2OC0A 2TBSA 1O33A 1LQEA 1TBQH 1TOMH 1O2NA 2ODQA 4Y7AA 3ZZ6A 1ZMNA 4A7IB 1GGDC 1EPTC 1QBOA 2ZCKP 1K1LA 3PWBA 1CO7E 1INCA 3BTGE 3GDUA 3P8GA 1LKAA 1VZQH 2ZGCA 9LPRA 1MTSA 3A7TA 3E91A 1G3BA 1OWDA 4CRCA 3TJUA 5IYTA 2ZG0H 2VIWA 5C5OA 2BLQA 1GBHA 1FV9A 1GBCA 1OS8A 1GBKA 1KLIH 5C2ZA 2VWNA 4BTIB 2HGTH 2BD5A 1ELEE 1O0DH 1T8LA 5JBCS 3CP7A 1AVGH 1C5PA 1KXFA 4JZEH 3ZVAA 2A1DB 1EOLA 4DW2U 4CBOA 1KXDA 3UR9A 4ZKNU 1AUJA 1MCTA 1ID5H 1TNJA 2C8XB 1GMHG 3A80A 5LPRA 2PUQH 2Y82A 4KELA 1T8NA 3MH6A 1Q2WA 1KXCA 2A31A 3KQEA 1NROH 2NWNA 4MNXA 3SJIA 1K1OA 2STAE 1O2TA 1OWKA 4ZH8A 2BTCE 4BTUB 1BZXE 1MTWA 3K65B 3U1JB 2BDBA 1SLXB 1F5KU 1H9LB 2ZECA 2ZFTA 4I8JA 1AKSB 4E7NA 3TK6A 1ZRKA 4GHTA 3AW0A 1O2MA 5FX6A 3RXPA 1SGCA 3IWMA 1CT0E 3RMNH 1TLDA 4U32A 1B0FA 3LC5A 1DXPA 2XBYA 2FPZA 1P05A 1T4UH 3MO6A 3MNCA 4E06H 4YM9A 3BTWE 1ABJH 1YPLH 1GMDG 1LPKB 2VINA 3SU3A 3A7ZA 1UHBB 3MNXA 2P16A 4I8HA 3DT0H 5CHAB 2CGAA 2ZDVH 5BPEA 1OSSA 2GZ9A 1TA2A 1NN6A 3ZZ9A 3A7VA 1C9PA 1TGTA 1HGTH 4AFUA 1KXBA 4U2WA 3ZVFA 2XCNA 1YCPK 2A7JA 2TRMA 1T8OA 2D26C 1IQLA 1Z8IB 2W3KA 3M37A 3BN9A 2FI3E 1EAIA 5E8EH 3TNTA 1MTVA 1LVBA 4ZKRU 1QJ7B 4B2BA 1W8BH 5E2OA 3AAVA 4FVBA 1CT2E 3AASA 1XXDA 1TONA 2FTLE 1GVZA 3HKIB 3SU2A 4SGAE 1VITF 1SHYA 4BAKB 3MNBA 3PB1E 2QYIA 4JCNA 1V2LT 1ESAA 4NZQA 1XVOA 3RC6A 1YF4A 3RXMA 1N1LA 4BAQB 3LJJA 4D9QA 1J16A 3H7TA 4JZ1A