2OC0A

Structure of ns3 complexed with a ketoamide inhibitor sch491762
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
181
structure length
181
Chain Sequence
APITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVAKAVDFIPVENLETTMRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hepatitis C Virus
publication title Discovery of the HCV NS3/4A protease inhibitor (1R,5S)-N-[3-amino-1-(cyclobutylmethyl)-2,3-dioxopropyl]-3- [2(S)-[[[(1,1-dimethylethyl)amino]carbonyl]amino]-3,3-dimethyl-1-oxobutyl]- 6,6-dimethyl-3-azabicyclo[3.1.0]hexan-2(S)-carboxamide (Sch 503034) II. Key steps in structure-based optimization.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Viral protein
total genus 40
structure length 181
sequence length 181
chains with identical sequence C
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2oc0A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2oc0A01
4JYUH 1DWDH 4TWWA 1HIAB 1DXPA 1O3CA 2XC4A 1SLWB 1OYQA 2XBXA 1TNGA 1UTKA 1ZOMA 2P95A 3M5LA 3TJOA 1P10A 1AIXH 1DWBH 1GI8B 4MQAA 3VGCB 3A7ZA 1Q31A 1P01A 1HAZB 2SFAA 4B76A 4ABEA 1YKTA 4A1VA 3RMLH 1AO5A 3SQHE 5L30H 1SGFG 4MPVA 3RC5A 3ZZDA 1AKSB 4Y10E 3ZVBA 2ANYA 2EI8A 1K1NA 1LVYA 5A2MH 1SGRE 2ZU2A 3RXVA 1TWXB 1BOQA 4YLUA 1C1RA 1HFDA 2G5NA 3RXOA 1BHXB 4BXSA 3GCHC 3ZZCA 2B9LA 1GG6B 4KTSA 5AVDA 3RXIA 1UHBA 1O3OA 2QN5T 5DP7A 4K1EA 3ZZ6A 5LPEA 1KTTB 1O2YA 1GHBG 1LHDH 2C8ZB 1S83A 3SV6A 2GCTB 2BD3A 3M36A 1ZLRA 4GHTA 1EXFA 3O8RA 1HAIH 1H9IE 2BVRH 5EW2H 5C1XA 3QX5H 3E1XB 1LVOA 1SL3A 4CBOA 1LKBA 1O3IA 2CN0H 4E06H 3BG4B 1SR5C 5FHTA 3MNXA 3ZYDA 3FANA 1ELTA 1NESE 1WSSH 1EAUA 2O9QA 3HPTB 1NPMA 4Y76A 1MBMA 4E05H 6ESTA 1PQ7A 2RG3A 1NN6A 3E8LA 3MU1A 1V2OT 1OP2A 3LKWA 5LGOA 1O35A 1C1UH 1S6HA 2ZPSA 2VIQA 2GV7A 3UNQA 1GWAA 1C5TA 4CRAA 3GCTF 2BQ7B 3GISB 4YOGA 2BX3A 3VEQB 2EI7A 1NS3A 3LC5A 1FV9A 2KAIB 2FOCA 1PPZA 4UD9H 1BITA 4OS2A 1UVTH 1V2UT 1RGQA 1TNJA 3RU4T 2FYQA 1WU1A 1BMNH 1OP8A 1O3BA 1T7CA 4TPYA 1O3LA 2ILNA 1B7XB 2H9TH 1FZZA 1TMUH 1CGJE 2BY7X 1GMDF 2V35A 1HPGA 1D9IA 1HLTH 1Q2WA 1E35B 1VCPA 1HAPH 1F0UA 1ELVA 3M35A 1GJAB 2GVFA 2WYJA 3Q77A 3TGIE 5C1UA 3SGBE 1QIXB 4B71A 1YYY1 1CHOG 4LZ1H 2HRVA 2IOTA 4NG9H 3OY5U 1SGYE 4A7IB 5PTPA 2C4FH 3NKKA 1P02A 2A4OA 2XWAA 5LPFA 1BRCE 2G4TA 2VWLA 4K8BA 1Z8IB 1TAWA 4ZKRU 3RXPA 3ZVFA 1PJPA 1GHAG 3JZ2B 5C1YA 4TWYA 2ZTXA 3LGYA 4KELA 4KKDA 1K21H 1BIOA 1CSOE 2VH0A 1AD8H 3LGTA 1GJCB 1SGPE 1SPJA 3P8OA 1ZMNA 1V2PT 3BTQE 4O3UA 4HFPB 4X8TH 1ZRKA 2BDCA 1MH0A 2BX4A 3SV7A 2VWNA 1UCYH 1MTVA 4JMYA 4X1QU 4E7NA 3WY8A 1Z6JH 2F4LA 2ZGXH 2FS8A 5GNDA 3TLOA 1SGQE 1KSNA 2NU0E 2NU2E 1SLVB 1QL8A 2A2XH 2PR3A 3T26A 4GLYA 3EA9A 3BEUA 1UTOA 3H7TA 1CGIE 2EEKA 4UFEH 2QAAA 3RU4D 1O2SA 3QUMP 1O2NA 1C5OH 1BQYA 1Y8TA 2Q6GA 1IQNA 1NZQH 2VVVA 3HATH 4YESB 1NFXA 2SGPE 3TJUA 1XKAC 2FESH 4B74A 3PV5A 4JK6A 1JRTA 3QZRA 4UEHH 3LU9B 4OS6A 1GMHG 2XCNA 4CH2B 3MU8A 5GCHG 2ZDAH 5DGJA 2ZFFH 3GCHB 4ZROA 1P2OA 1L1GA 3BIUH 2PKAB 4Q7YA 1F7ZA 3SNDA 1C1TA 1G30B 2Y82A 2BLQA 3ZZ4A 3KQCA 1LPZB 4DG4A 3LPRA 2QXJA 2GX4A 1ANCA 1K22H 1O3NA 1O3JA 1GDNA 2ZG0H 4WH6A 4ZAEA 3IWMA 4MDSA 3ATIA 3S9CA 1QB1A 2FZZA 1KLTA 1TBRH 1C5XB 5TCCA 1ELAA 4R8TB 5AFYH 2OC7A 2QXHA 3T29A 2CXVA 1XUGA 4MPWA 3SU4A 4B2AA 4NFEA 2BDGA 4NA9H 3T25A 1THSH 3KN2A 1UVSH 2HGTH 1SSXA 3NPSA 1T8NA 2XCFA 1LHCH 2Z6BD 4K1TA 2A5AA 5JB9S 2GMTC 1V2MT 3MHWU 1KY9A 2ANKH 2OLGA 2WYGA 2ZHFH 4Q7XA 4ISHH 4U30A 3O8BA 4I32A 1C1SA 1KXEA 2PGQB 2GZ9A 2FOBA 1UCYK 1PYTC 2WPMS 1O2XA 3NZIA 2ASUB 2ZWLH 2HALA 1F0TA 2ULLA 1ELDE 1BMMH 1DVAH 1S81A 3TNSA 1GI9B 3KIDU 1GBDA 4DOQA 1F5LA 2ZHEH 3PV2A 4BTUB 1SGDE 3TH2H 5FAHA 1O2HA 1NRSH 3I77A 1S0QA 1C5QA 1VCWA 2BY6X 1NC6A 1P06A 2UUYA 1D3PB 5EXMA 2D8WA 1HRTH 1C2FA 3PO1C 5LPRA 1NU7B 3NUMA 2H9EH 2QCYA 1O5DH 1GCTC 3UREA 4DJZB 3M7QA 4AB9A 3GY5A 1MAXA 3SGAE 2BB4A 4AFZA 1SVPA 1KYNA 3LH1A 5CHAC 4H4FA 1JMOH 2ZU5A 1O2QA 3A8CA 4TPIZ 5FBIA 1O2TA 1ZR0A 1JBUH 4GVUA 1ZHRA 1ANDA 1UVPA 8ESTE 5IDKA 2BY9X 2ZNKH 1W14U 4FVDA 1J16A 2TBSA 2RCEA 2OBOA 3A81A 1ZSKA 2QYIA 1TB6H 1AWFH 1P03A 3SV2H 3E0PB 2H5DA 3I29A 1P05A 3RXQA 1O3EA 2XNIA 1NO9H 1A5HA 4BAHB 2H1UA 1OS8A 1BMAA 3A7WA 4DGJA 2BXTH 1O3MA 2H6MA 1KXDA 3SJKA 1QR3E 2XBYA 2J2UA 1TIOA 2Z3CA 2JETC 1GMDG 3U1JB 3U1IB 2HNTF 2R3YA 1V2ST 1GMCF 1ELGA 1C5ZB 3A8BA 1L2EA 1JWTA 1ZYOA 1CE5A 2Z3EA 5HYOA 1OWIA 1O0DH 2Z9JA 2OTVA 1O2LA 2OC8A 2BTCE 2TGDA 3O8CA 1BT7A 1W2KH 2J92A 3S7HB 4K69A 1UTJA 3PTBA 2P16A 1TPOA 3E6PH 2A5KA 1WYKA 4NIXA 4ABDA 3DFLA 4LZ4B 3RXTA 1KTSB 1B5GH 1BTHH 2FX4A 3OSYA 1E37B 1GG6C 2FDAA 2FI5E 2W7SA 4WVPE 4ZKNU 1YPJH 1IQKA 2D26C 3D49H 3S9BA 3SN8A 2BDBA 1C2HA 2BVSH 3BG8A 1YCPH 1TOMH 1GBHA 1TA6A 4O3TA 1IAUA 6LPRA 5GPIB 1GBKA 5ESBA 5C5NA 3SOSA 1C2EA 1EPTC 2A5IA 2FI4E 4XSKU 4ISIH 4DIIH 1Y3WA 1LQEA 2JH5D 3MOCA 6CHAC 5HM9A 1L1JA 4XOJA 3U9AH 1Q3XA 1SQAA 5FPYA 2VNTA 2ZDKA 1GBCA 2GDDA 4AGJA 3BSQA 1MZDA 1FMGA 1O38A 4X2YA 1FIWA 1YPEH 2BQWB 2BXUH 2TRMA 4ZH8A 1DICA 3QTOH 1GJ9B 3A7VA 5JBAS 1TX7A 4X8SH 1LHEH 3QDZB 3V0XA 2ZKSA 4DW2U 2FTMA 1ZTKA 2Z9KA 5GIBA 4AZ2B 2GMTB 2PGBB 2FOEA 3HKIB 2JH6D 4WMFA 5A8XA 2ANWA 3SNEA 5C2ZA 2D2DA 1P0SH 2PKSC 1O2WA 4WMEA 2BDIA 4F49A 4HZHA 1RIWB 2ALVA 1RFNA 3M3VA 3FP7E 1NFUA 2FMJA 5JBTA 2PUQH 3IG6B 1AFQC 2BD9A 2HWLB 3S9AA 2BD2A 1HAVB 4NZLA 1PPCE 2OQUA 2BM2A 3MO3A 1C1VH 1TRNA 1T4UH 2HOBA 1O3HA 3DA9B 1NT1A 4NSYA 2EI6A 1NRQH 2J4IA 3ZVCA 2BOKA 1CU1A 1CBWC 2XBWA 2ZFSA 3SV9A 2QC2A 3W94A 3TGKE 3ZZBA 1TPSA 1FY4A 1FNIA 5FX5A 1GHYH 1NRNH 3PO1B 1HV7A 3LJJA 5F03A 4WF8A 4ABFA 1SB1H 5T6GA 2ZFTA 1GCTB 4K3JA 3QN7A 2P3TB 2CMYA 3TH4H 2ESTE 3L6PA 3GDSA 4GCHF 1ACBE 1SGNE 1V2NT 4J2YB 1SFIA 1QJ7B 5CHAB 1YBWA 1DSTA 1OKXA 2RA0A 1O2ZA 4BTIB 2XC0A 2H9HA 1XM1A 3SHCH 3ZVDA 4WXIA 1EAIA 4NZQA 1SHHB 3AVZA 3MI4A 1J8AA 1SGEE 3VXFH 1D4PB 5B6LA 4OS7A 2CF8H 2QY0B 3PTNA 2VVCA 1QRZA 2SGAA 2FXRA 4WMDA 4FUDA 4AG1A 5JBCS 1HYLA 4ISLA 1Y3YA 1AGJA 2ZDVH 1LVBA 1LHFH 2F9BH 3VXEH 4AN7A 2ZFQH 3MWIU 4GAWA 1W0YH 2TIOA 3F9FA 1IQHA 1B0EA 1K1LA 1YPHE 3RXLA 5DO4H 2ODQA 1DE7H 1QRXA 3F68H 1W0ZU 3BV9B 2W26A 1P2IA 1GDUA 1J15A 2BD5A 1G37A 4XBCA 4FUHA 2JETB 1HAHH 1QRWA 2NWNA 3ZZ7A 3L3TA 2AH4X 1BTUA 3UPEA 2ZGCA 4XE4A 2ZCKP 3RC4A 2OP9A 3ZV8A 1QBOA 5T6DA 3I78A 3SI3H 3ZZ8A 3SNCA 1JOUB 2C8WB 1CT0E 1Z8GA 3TJNA 1NROH 2TGAA 4X6MA 1GI2A 1MKXH 2XRCA 1P3CA 5JBBS 2ZZUH 4O97A 5DG6A 1O36A 2ZGHA 3ZVEA 3LGVA 4X8VH 4CRBA 1EOLA 8GCHG 2G5VA 2FEQH 1BB0B 1DS2E 4XFQA 2Q6DA 3M3TA 1NTPA 3B8JA 3KHVA 2ZDMA 1GI7B 1EQ9A 1FPHH 1MBQA 2BDYA 3RXHA 1GPZA 3PWCA 2Y7XA 1HCGA 1NFWA 1V2VT 1V3XA 4A5TS 3STJA 3ATWA 1EPTB 1ZHMA 3BTWE 1P9SA 1GJ5H 1QHRB 2GGVB 2SNVA 3QO6A 3UFAA 2BVXH 3NK8A 4D76A 3SU1A 6CHAB 2Y80A 4UE7H 1GHXH 5JYIA 1C5WB 2A4QA 4AFSA 5FXLA 2VIWA 1VITH 3RLWH 2FOMB 1PYTD 3UOUA 1Z71A 1IQGA 2P94A 3V3MA 4HGCA 3P8GA 1C1QA 3CENA 1BRAA 1PFXC 3NXPA 1LQDB 3A89A 5FPSA 1DFPA 1QCPA 1LKAA 1QBNA 2OBQA 1TLDA 1A4WH 1IHTH 3L33A 5DJ7A 4A92A 2FOHA 1PPHE 1UHBB 2TPIZ 1VCQA 1HNEE 1YPLH 1LPGB 3CS7A 2PKSB 2PV9B 4YZUA 1F2SE 1GMCG 1Z8RA 1TE0A 4BAKB 4YT6H 1MQ5A 1D3TB 1V2WT 4OM9A 1IQMA 1AWHB 1UK4A 1GGDC 1DY9A 1T4VH 2F9OA 2OXSA 1EZSC 1ZGVA 4BTTB 3PLKA 1QQ4A 1AFQB 1XXDA 5EOKA 4CHAC 1XX9A 1FY1A 3PV4A 1Z7KA 2G00A 1MQ6A 3P8FA 1WTHD 2AIPA 1UTMA 1BDAA 4E7RG 2ZHDA 2NU4E 5CE1A 1EB2A 1GJDB 3UTUH 2O8WA 1C4U2 2SGEE 2O8UA 1C5RA 3A8AA 3VFEA 1RD3B 3VB7A 1CBWB 5K0HA 1WAYB 1LVMA 4OS5A 3V13A 4HI3A 3Q00A 3S0NA 1MZAA 4B1TA 1ZPBA 2C90B 1SOTA 2GP9B 2WUCA 5EPNA 3TNTA 1T8LA 3DHKH 1C2GA 1MD7A 2UUKB 1P2MA 1MKXK 2GCHG 3K2UA 3RXRA 1TA2A 2GT7A 3VB6A 1E38B 3EDXB 4X2XA 3GY8A 3DFJA 2BD8A 1G2LA 4VGCC 2J38A 3M3SA 1IQEA 2AFQB 1JRSA 3A85A 4XDEA 1VITG 3D23A 3BTEE 5C20A 5EQQA 1H1BA 3P95A 4FVBA 4Y7BA 3TGJE 2ZU3A 2W5EA 3ITIA 4LK4A 4JZ1A 2A7JA 1Y5UT 1TPAE 2ZECA 3KGPA 3GCOA 1TPPA 4MNYA 1HAXB 1GBMA 3MO6A 4INHA 1YF4A 4X6PA 1SOZA 5EPYA 2HNTE 2XW9A 2G51A 3C27B 1HJ8A 1L4ZA 1WTGH 1Y3VA 4FUCA 1G32B 1HB0B 4UDWH 5EXNA 1ANBA 1C5NH 1H9HE 2B7DH 2G81E 4CRCA 4CRFA 1O3GA 1FY5A 4NWLA 4IN2A 1ETTH 1TBZH 4X1NU 1VJAU 5ETXA 1A5IA 1YPHC 1V2JT 1BZXE 3OTJE 4B2CA 4NIYA 1TGTA 3UUZA 1DANH 2A2QH 4DURA 1WQVH 2ZO3H 3U8RH 4OS4A 2J9NA 3O8DA 3Q76A 1AU8A 3GY7A 1C4Y2 4I8LA 3RDZA 4D7GA 3VPKA 3MU0A 2UWPA 3F9GA 1H4WA 1TNKA 1AI8H 4GCHG 4ZXXH 2P8OC 3P92A 1GJ7B 1BA8B 2QGRA 2QA9E 1FPCH 2C8YB 1QNJA 2ZTZA 2VIOA 2ZPRA 5IYTA 1U6QA 4I8GA 1WQSA 2AGEX 2R2WU 1AMHA 2GZ8A 3QGNB 4Y0YE 2CHAC 2BZ6H 1E34B 1T31A 4YO9A 4INLA 1ELBA 2ZCHP 3LJOA 4BNRA 3A82A 1MU6B 2FOAA 4JZEH 1YP9A 1OXGA 1DM4B 1YLDA 2C93B 4U32A 2PHBA 2I6QA 2WPKS 1ESTA 2PW8H 7GCHF 3RXMA 1C5VA 4YM9A 3M61U 1KDQA 1ZZZA 3OYPA 7KMEH 4IGDA 1TRMA 4IMQA 1XUFA 2FOFA 1GBJA 4PROA 3TK9A 3E0NB 1C1MA 3ZYEA 4I33A 1GI4A 3BIVH 2B0FA 1RIWC 3MNCA 1EATA 1C1WH 1ZPZA 2VU8E 1WCZA 1DWEH 1HDTH 1O3AA 1FJSA 3SJIA 5FPTA 4X6OA 1GGDB 5TJXA 4UFGH 1OWKA 1MCVA 1P3EA 3F9HA 1BRUP 1W13U 4CHAB 4ISNA 4A1XA 5K7RA 1GHWH 2ZC9H 2XTTB 1QTFA 3GICB 1A0HB 4BAQB 1C2KA 2QXIA 1QJ1B 1A3BH 2QF0A 3SU3A 3BTDE 2IN2A 3M5MA 1V2LT 4X0WU 2A32A 2VWMA 1HJ9A 1G3BA 9LPRA 1BBRE 4I8JA 3FFGA 1P2NA 2ZHWH 4NFFA 3FVFB 3HGPA 4FU9A 5EW1H 1HJAC 4ZXYH 2R9PA 5FCRA 4WXVA 3SNAA 1O2VA 1S85A 2XC5A 1YM0A 1O2JA 5J4QA 5A0BA 1HAGE 1ZMLA 2SGDE 3UIRA 2J34A 4VGCB 4D8NA 2WV9A 3ZV9A 2YNAA 4F4OC 1VGCC 1ZSLA 2BQ6B 1ZSJA 1PPEE 1RTLA 2QXGA 4ZKSU 1IOEA 1KLJH 4D7FA 1IHSH 1O2KA 1P12E 1AB9C 3PM3A 1EJAA 1PPBH 1O5AB 1V2TT 3VB5A 1FLEE 2PWXA 1LPKB 2M5TA 3MNBA 1QA7A 2ANMH 3FAOA 1A46H 3GCTG 1B0FA 4FXGH 1MTSA 3UWIA 1H8IH 2AEIH 1GHBF 2FO9A 3PWBA 1UVUH 4ZKOU 1YPMH 2WV5A 1O37A 4HTCH 1THPB 1TX6A 3RXCA 1FY8E 1GVLA 1TMBH 1TMTH 3SU2A 3P8NA 1EJNA 1ZHPA 1E0FD 3KCGH 1J17T 1CVWH 3S69A 2BLWA 5E0HA 5C5OA 2HNTC 1C5MD 4JK5A 7ESTE 1TALA 3LC3A 5DP9A 3JZ1B 1O5CB 2BMGB 3UQVA 1O3KA 3QK1A 1A0LA 2ALPA 1IQFA 2SNWA 2R2MB 2H5CA 4Q7ZA 4Y79A 3SW2B 1DSUA 1UTPA 4D9RA 1LTOA 9ESTA 4H42U 1TYNA 1OYTH 2Z94A 1WUNH 1TNLA 2DUCA 3RM0H 4AFUA 1KXBA 4JZDH 1W11U 3BTHE 4I8KA 1CT2E 3RUOA 4INKA 2RA3A 1K1JA 3MNSA 3M37A 1C5YB 1HXFH 2A7HA 3F6UH 1ESAA 2EA3A 1Z6EA 1GDQA 1AVXA 1GJBB 3MH7A 4IMZA 4Q2KA 2ZF0H 5EODA 3QLPH 2AMDA 4JZFH 2FM2A 2P8OB 1SC8U 1FAXA 3GCNA 4ZUHA 1EZXC 2BD4A 3TK6A 3BTME 3QWCH 4ISOA 3RP2A 2BY8X 1O3PB 2WPJS 5E0JA 1GHZA 1JIRA 2V6NA 1C2LA 1TGNA 1AQ7A 1WBGB 2CHAB 1O5BB 1AUJA 1XUJA 2OC1A 3NWUA 6GCHF 5EG4A 5DP3A 1GI0A 1BHXF 5F6MA 2UWLA 2ZDNA 1CA8B 1QA0A 1BTXA 1CHOF 1GBLA 5F8TA 1LMWB 1TQ7B 1CA0B 5EQRA 1AVWA 2OD3B 1T8OA 4FUFA 3MO9A 3GY4A 5FBEA 1C2DA 2SGQE 4AOQA 3R0FA 1GJ6A 2ZDLA 3ZZ9A 1ZTJA 3UY9A 3V7TA 1GBBA 2THFB 3FZZA 1V6DA 3FZDA 5DPAA 3ZVAA 3A87A 1SHYA 1SGFA 1GHAF 1VR1H 2G8TA 1MKWH 1G3EA 1O5EH 3T2NA 3NCLA 1GI5A 3RXFA 1G2MA 3MTYA 5GJ4B 2AMQA 1EZQA 1BJVA 3W95A 1MTNC 3TPIZ 1GL1A 2Z7FE 1AUTC 3RXDA 2B8OH 4AX9H 2Z9IA 2GD4B 1S6FA 2JKHA 2XWBI 3T27A 1O5FH 1Z1IA 4KP0A 3RXAA 2PLXA 3TU7H 1HAOH 2Y7ZA 2Y5FA 3BN9A 2JH0D 2A45B 1AY6H 4JCNA 1ELCA 1ELEE 4RKJB 3LONA 3RMOH 3RXSA 3IITA 4X1PU 1ID5H 1N6YA 3EQ0H 1HJAB 3A7YA 5AHGH 2AIQA 3M7TA 1W3CA 2V0BA 1DXWA 3TK5A 4Z6AH 3B9FH 2C3SA 3MFJA 3KQEA 4JYVH 2VH6A 2BD7A 2GKVE 4YTAA 1VGCB 2QF3A 3E3TA 1D3DB 1O33A 4DVAU 4BOHA 1PQAA 1YCPK 3P70B 5L6NH 4K8YA 1AB9B 1W12U 4FUIA 1HIAA 3F1SB 5GCHF 1F5RA 3BTGE 1F5KU 3RC6A 3A86A 2FWWA 7LPRA 3LIWA 4ABHA 2F91A 4WJG2 3A7XA 4U01A 2ZQ1A 4MPXA 2I6SA 5DK1A 3ENSB 2BZAA 1GBFA 1AKSA 1LCYA 2ZCLP 1HUTH 2Z3DA 4NA7A 3A88A 4R0IA 4I31A 1TNIA 2G4UA 4X8UH 4I7YH 1AN1E 1GBEA 3EA7A 1KLIH 3N7OA 2V3OH 4QT8C 3RM2H 4TYDA 4CRGA 2WHXA 4GSOA 1C9PA 2XYAA 1AVGH 3KEEA 3UNSA 1RXPA 1BRBE 1MKWK 1GJ8B 2Z9LA 4MTBA 2GT8A 5B6OA 5E2PA 1EAXA 4AORA 1ZPCA 1A5GH 1K9OE 4CR5A 1OP0A 3LDXH 1FN6A 5I46H 1FI8A 3K6YA 2ZPQA 2FP7B 5TCAA 3MU4A 1EPTA 4J1YA 1UTLM 3SJ8A 3A80A 3SJOA 4ABBA 1F0RA 4CR9A 5C67A 2HLCA 2ZA5A 1QBVH 3AW1A 2FIRH 1EKBB 3F9EA 2G55A 2STBE 3U69H 1OOKB 4AYYB 2TGTA 4NIWA 2FYRA 1O2IA 2FPZA 1C1PA 1OWDA 4RI0A 2WPLS 5LH8A 4SGAE 1OWHA 1RTFB 1YLCA 4SGBE 3MMGA 1NY22 1ANEA 3C1KA 3Q3KA 3SU0A 1BMLA 3OY6U 2ZQ2A 1Y5BT 3A8DA 2KAIA 1DLKB 1EZUC 1KXFA 3OTPA 2TGPZ 3LOXA 3Q3YA 1JXPA 4FU7A 1XUIA 2AS9A 2BLVA 1TABE 1DT2A 1F0SA 2PTNA 4I8HA 3PMBB 1GI1A 1FXYA 1SQTA 2OQ5A 3AASA 3EYDA 1C5PA 1PPFE 3DUXH 4ABAA 1Y5AT 1NRPH 2ZU1A 1QGFA 3MH5A 2VJ1A 2WV4A 1DUAA 1TRYA 2J95A 1KIGH 1L1NA 2FTLE 3BTTE 3FP6E 4YOIA 5F8ZA 2FODA 3E90B 4TY6A 3UWJH 3SHAH 3SJ9A 3M5NA 2A31A 5DP8A 1WXRA 2GDEH 2BLOA 1N1LA 2A1DB 1MTNB 3AK5A 1DLEA 1K1IA 1UK2A 4LOYH 1O31A 1RJXB 2ZGJA 3TJVA 5T3HA 1J9CH 5ESTE 1EP6A 3PLPA 2J94A 3PB1E 1A3EH 2O8LA 2ZFPH 3EA8A 3GY2A 3SZNA 1H8DH 3M7UA 1C2IA 5SGAE 3GYLB 1TGCA 3P6ZB 1K1OA 4ZHLU 5ABWA 1SLUB 3TITA 1BCUH 3PYHA 3QZQA 4ABJA 4LXBH 1TGBA 1FDPA 1ZTLA 4Y8YA 1CT4E 3R3GB 2A0QB 1SG8B 3DT0H 2R0LA 1XVMA 2HPPH 2W3IA 4X1RU 1C5LH 2VVUA 1SI5H 6GCHG 2Y6TA 4GUXA 2PSXA 1GBTA 1GVZA 4Y8ZA 1UTQA 3RXEA 2FOGA 3SNBA 3CS0A 1P04A 1A61H 1TBQH 3T28A 3D62A 1DITH 1SGTA 4YOJA 1BBRH 4CRDA 2ZP0H 1HXEH 1MAYA 3GY3A 1AZ8A 1VJ9U 4IC6A 1WOFA 2Y5HA 1K1MA 5HXFA 1DDJA 1PQ8A 2W3KA 1OSSA 1SMFE 4FU8A 5JB8S 1SGCA 1EJMA 1P09A 3AW0A 3FP8E 1ESBA 1S84A 1TQ0B 1QL7A 2Y81A 2ODYB 1O3DA 5J4SA 3ZZAA 4ASHA 4M9FA 4H6SB 1QB6A 3M5OA 3LH3A 3S7KB 2K1QA 1FQ3A 3D65E 1AZZA 1ORFA 2AERH 3VB3A 3RXKA 2BOHB 5A8YA 2F9VA 2VINA 2WINI 5A8ZA 1P11E 5FCKA 1QFKH 4UONA 5EXLA 5JPMH 3G01A 1IQIA 1MUEB 1BUIA 1MU8B 1MMJN 3KF2A 4GHQA 3ZZ5A 1GL0E 1GBAA 1ZMJA 1W8BH 2PKAA 1XKBC 3QTVH 2H2ZA 1Y3UA 3MH4A 4Y71A 1GJ4H 3BEFB 1YGCH 2BYAX 2P59A 4JZIA 4IBLH 5FX6A 4OGXA 1H9LB 1THRH 4ABGA 3Q3XA 8LPRA 5GDSH 1PQ5A 1G3CA 1TNHA 3SZEA 3SGQE 5GWZA 1SQOA 2G52A 3KNXA 4ABIA 1T32A 4WY3A 5DKMA 2EC9H 1G9IE 2P93A 3B23B 3BTKE 2P3FH 1FONA 3AAUA 3T5FH 4AYVB 1FAKH 1EOJA 1S82A 1S0RA 3RU4E 1AE5A 1D6WA 1A0JA 3MH6A 4WH8A 1YPKH 3PMJA 4KGAA 2F83A 1O3FA 1HAYB 2AGIX 4MNWA 2C8XB 4UFDH 4IW4E 4TY7A 2AGGX 2RDLA 2UWOA 1X7AC 4BAOB 1XVOA 1AFEH 1K1PA 3RMNH 5E8EH 1C2MA 4Q80A 1J14A 2QV1A 1P8VC 1CA0C 2FS9A 1L4DA 4MVNA 4UFFH 4XBDA 1BBRK 1RTKA 4RSPA 2OK5A 2CV3A 3LT3A 5GXPA 2OUAA 4MNXA 5A0CA 2D1JA 1ZGIA 1C1OA 2F9UA 3HGNA 1F92A 4JYTA 1SGIB 2PUXB 1ZJKA 2ZGBH 1GBIA 2XBVA 3A7TA 2VIPA 2ZIQH 2BHGA 2VGCC 3CP7A 1FN8A 3GDUA 3HKJB 1HBTH 4CREA 4NCYA 1CHGA 3TVJB 3PMAB 1O2UA 4IC5A 4IN1A 1Y59T 4MNVA 4ZMAH 2ZEBA 1O34A 1YCPM 2Z9GA 3LGWA 2AMPA 1SLXB 1XUKA 2NU3E 1O2OA 3DD2H 4MG3A 1V2KT 3V12A 4AG2A 1MD8A 1BTPA 1OWEA 2CJIA 4RN6A 5JDUB 1MTWA 1A7SA 1VZQH 3ZZ3A 1G36A 1BTYA 4AFQA 5AF9H 4DT7B 2PFEA 3RXUA 1GI6A 4BANB 1YPGH 4KTUA 1EUFA 1KDQB 3PLBA 4B6EA 2FLRH 2A7CA 5I25A 1ZRBA 1O2RA 1C2JA 1Z1JA 1W7GH 8KME2 1ABJH 3SI4H 3E16B 3P17H 4Y7AA 3T62A 1L0ZA 1W10U 2Q1JA 3STIA 1TOCB 2HPQH 2LNCA 3SUDA 4FUJA 3KQDA 3LGIA 4WWYA 1GCDA 3AAVA 4MPUA 1ETSH 4RKOB 2IJOB 1P57B 3HK3B 1BTZA 1PPGE 1QB9A 2QIQA 3ESTA 3RXJA 1C1NA 2O8TA 1EAWA 4M7GA 3TIUA 1DUEA 1UTNA 1O30A 5HGGA 8GCHF 3OU0A 4ZHAA 2Y5GA 2VIDA 1TX8A 5BRRE 1M9UA 3H7OA 4X2WA 1UCYE 1XUHA 2ZTYA 1ARCA 2FI3E 1BTWA 1AE8H 4A6LA 2UUJB 2CF9H 5EU8A 1ETRH 2F9NA 3U98H 3SQEE 2AYWA 4ZHMU 3SO3A 2A4GA 3SU6A 2UUFB 2VIVA 1Y3XA 3E91A 1N8OC 3ODFA 2F3CE 2STAE 1NFYA 5L2YH 5A09A 3URCA 3A84A 2R3UA 2BDAA 1Z8JB 1RS0A 4BXWA 4O9VA 1DOJA 1CQQA 5AFZH 2VWOA 3EAJA 1GVKB 3RXBA 1D6RA 2V3HH 2OC0A 1QL9A 2SGFE 4NSVA 2Q6FA 1NU9A 4AGKA 1UVOA 5H4IB 1O2MA 2DE9A 4X2VA 4NGAH 1SBWA 4BAMB 1T8MA 5G4BA 4OS1A 3VGCC 3URDA 4X6NA 3SV8A 1YC0A 2OINA 1UO6A 3ATMA 3H09A 4K60A 2FX6A 5DP5A 3LGUA 4Y8XA 1ABIH 1DY8A 4B75A 3MU5A 5F8XA 2WPHS 1UJ1A 1NRRH 1E36B 3KL6A 4NWKA 2CGAA 1P2JA 2BY5X 4A1TA 4B6FA 3H5CB 1P2KA 1TFXA 3SORA 1G3DA 3SBKA 1A1RA 1O2GH 3BEIB 4CH8B 4IS5A 4THNH 2GCTC 1AHTH 2YOLA 1DPOA 2GCHF 1CGHA 5T1VA 2PSYA 3K6ZA 4FUEA 2ZU4A 1KXCA 1S5SA 1ELFA 1W7XH 3RLYH 4H6TA 4DCDA 5HMAA 1HAVA 3SU5A 3BG4C 4XBBA 4MLFB 1OX1A 1D3QB 1EP5A 3EE0B 1FIZA 1VITF 2P3UB 2NU1E 2VGCB 3SUGA 1O2PA 1P9UA 4KTCA 3U8TH 3ATKA 1ARBA 1QURH 4YLQH 1IQLA 1V2RT 3SYJA 2FLBH 3SUFA 1N6XA 1C5UA 3UR9A 1MTUA 1UMAH 4K5ZA 3PROA 1SFQB 3UR6A 2XXLA 2O8MA 1GI3A 3GDVA 1P2QA 2GZ7A 2LPRA 1JIMA 4DIHH 3SUEA 2YNBA 3RXGA 1XMNB 4FUGA 1K28D 4AB8A 1O32A 3K65B 1C5SA 1UK3A 3GYMA 3ELAH 1WV7H 3U8OH 3ATLA 4D9QA 3QGJA 5A0AE 2DE8A 3BF6H 1BJUA 4NIVA 2IPHA 1NM6A 1A2CH 4U2WA 2ZFRH 5DP4A 3KQBA 2WPIS 2F9PA 3A83A 5E2OA 1FY3A 5C3NA 1INCA 4ESTE 1IQJA 2OCVB 2PTCE 3K9XB 3ZVGA 3UOPA 1EX3A 1O39A 1C9TA 4K2YA 4O03A 5EGMA 1O5GH 2WUBA 4DY7B 2GTBA 3UQOA 4GPGA 1GMHF 1TONA 1LDTT 1XXFA 3TH3H 4Y0ZE 1QQUA 1GHVH 1LO6A 3PMHB 7GCHG 1HGTH 4Y11E 2VBCA 2B5TB 2ZI2H 1DX5M 5L2ZH 2A4RA 3RMMH 1LHGH 4CBNA 5E0GA 4Z0KA 1CO7E 2HVXA 4FUBA 1QY6A 2R0KA 5EQSA 1MCTA 1KXAA 2GV6A 1K2I1 4X1SU 4Y6DA 5HM2A 5T6FA 5CMXH 1QJ6B 3UNRA 2WZQA 4YT7H 3VB4A 3EGKH 1FUJA 1OPHB 1V2QT 1ZJDA 2ZHQH 5DP6A 4OGYA 1N8OB 1DWCH 3GY6A 2ODPA 3OX7U 4B73A 1RRKA 1TGSZ 1EB1H 3GOVB 1OWJA 1C4V2 1EASA 3BTFE 5BPEA 2W7UA 3ODDA 3MYWA 2IJD1 3HK6B 4B2BA 2VB0A 4K1SA 4NA8A 2BDHA
chains in the Genus database with same CATH superfamily
4JYUH 1DWDH 4TWWA 1HIAB 1DXPA 1O3CA 2XC4A 1SLWB 1OYQA 2XBXA 1TNGA 1UTKA 5DSFA 1ZOMA 2P95A 3M5LA 3TJOA 1P10A 1AIXH 1DWBH 1GI8B 4MQAA 3VGCB 3A7ZA 1Q31A 1P01A 1HAZB 2SFAA 4B76A 3OFND 4ABEA 1YKTA 4A1VA 3RMLH 1AO5A 3SQHE 5L30H 4Q63A 1SGFG 4MPVA 3RC5A 3ZZDA 1AKSB 4Y10E 3ZVBA 2ANYA 2EI8A 1K1NA 1LVYA 5A2MH 1SGRE 2ZU2A 3RXVA 1TWXB 1BOQA 4YLUA 1C1RA 1HFDA 2G5NA 3RXOA 1BHXB 4BXSA 3GCHC 3ZZCA 2V3MA 2B9LA 1GG6B 4KTSA 5AVDA 3RXIA 1UHBA 1O3OA 2QN5T 5DP7A 4K1EA 3ZZ6A 5LPEA 1KTTB 1O2YA 1GHBG 1LHDH 2C8ZB 1S83A 1QZ8A 3SV6A 2GCTB 2BD3A 3M36A 1ZLRA 4GHTA 1EXFA 3PRDA 3O8RA 1HAIH 1H9IE 2BVRH 5EW2H 5C1XA 3QX5H 3E1XB 1LVOA 1SL3A 4CBOA 1LKBA 1O3IA 2CN0H 4E06H 3BG4B 1SR5C 5FHTA 3MNXA 3ZYDA 3FANA 1ELTA 1NESE 2KCAA 1WSSH 1EAUA 2O9QA 3HPTB 1NPMA 4Y76A 1MBMA 4E05H 3F3BA 1PQ7A 2RG3A 1NN6A 6ESTA 3E8LA 3MU1A 1V2OT 1OP2A 3LKWA 5LGOA 1O35A 1C1UH 1S6HA 2ZPSA 2VIQA 2GV7A 3F0PA 3UNQA 1GWAA 1C5TA 4CRAA 3GCTF 2BQ7B 3GISB 4YOGA 2BX3A 3VEQB 2EI7A 1NS3A 3LC5A 1FV9A 2KAIB 2FOCA 1PPZA 4UD9H 1BITA 4OS2A 1UVTH 1V2UT 1RGQA 1TNJA 3RU4T 2FYQA 1WU1A 1BMNH 1OP8A 1O3BA 1T7CA 4TPYA 1O3LA 2ILNA 1B7XB 2H9TH 1FZZA 1TMUH 1CGJE 2BY7X 1GMDF 2V35A 1HPGA 1D9IA 1HLTH 1Q2WA 2RDEA 1E35B 1VCPA 1HAPH 1F0UA 1ELVA 3M35A 1GJAB 2GVFA 2WYJA 3Q77A 3TGIE 5C1UA 3SGBE 1QIXB 4B71A 1YYY1 1CHOG 4LZ1H 2HRVA 2IOTA 4NG9H 3OY5U 1SGYE 4A7IB 5PTPA 2C4FH 3NKKA 1P02A 2A4OA 2XWAA 5LPFA 1BRCE 2G4TA 2VWLA 4K8BA 1Z8IB 1TAWA 4ZKRU 3RXPA 3ZVFA 1PJPA 1GHAG 3JZ2B 5C1YA 4TWYA 2ZTXA 3LGYA 4KELA 4KKDA 1K21H 1BIOA 1CSOE 1W0KD 2VH0A 1AD8H 3LGTA 1GJCB 1SGPE 1SPJA 3P8OA 1ZMNA 1V2PT 3BTQE 4O3UA 4HFPB 4X8TH 1ZRKA 2BDCA 1MH0A 2BX4A 3SV7A 2VWNA 1UCYH 1MTVA 3KQ5A 4JMYA 4X1QU 4E7NA 3WY8A 1Z6JH 2F4LA 2ZGXH 2FS8A 2HVYB 5GNDA 2AHME 3TLOA 1SGQE 1KSNA 2NU0E 2NU2E 1SLVB 1QL8A 2A2XH 2PR3A 3T26A 4GLYA 3EA9A 3BEUA 1UTOA 3H7TA 1CGIE 2EEKA 4UFEH 2QAAA 3RU4D 1O2SA 3QUMP 1O2NA 1C5OH 1BQYA 3PRBA 1Y8TA 2Q6GA 1IQNA 1NZQH 2VVVA 3HATH 4YESB 1NFXA 2SGPE 3TJUA 1XKAC 2FESH 3PV5A 2KX4A 4B74A 4JK6A 1JRTA 3QZRA 4UEHH 3LU9B 4OS6A 1GMHG 2XCNA 4CH2B 3MU8A 4YXWD 5GCHG 2ZDAH 5DGJA 2ZFFH 3GCHB 4ZROA 1P2OA 1L1GA 3BIUH 2PKAB 4Q7YA 1F7ZA 3SNDA 1C1TA 1G30B 2Y82A 2BLQA 3ZZ4A 3KQCA 1LPZB 4DG4A 3LPRA 2QXJA 2GX4A 1ANCA 1K22H 1O3NA 1O3JA 1GDNA 2ZG0H 4WH6A 4ZAEA 3IWMA 4MDSA 3ATIA 3S9CA 1QB1A 2FZZA 1KLTA 1TBRH 1C5XB 5TCCA 1ELAA 4R8TB 5AFYH 2OC7A 2QXHA 3T29A 2CXVA 1XUGA 4MPWA 3SU4A 4B2AA 4NFEA 2BDGA 4NA9H 3T25A 1THSH 3KN2A 1UVSH 2HGTH 1SSXA 3KYGA 3NPSA 1T8NA 2XCFA 1LHCH 2Z6BD 4K1TA 2A5AA 5JB9S 2GMTC 1V2MT 3MHWU 1KY9A 2ANKH 2OLGA 2WYGA 2ZHFH 4Q7XA 4ISHH 4U30A 3O8BA 4I32A 1C1SA 1KXEA 2PGQB 2GZ9A 2FOBA 5EJ1A 1UCYK 1PYTC 2WPMS 1O2XA 3NZIA 2ASUB 2ZWLH 2HALA 3FOAA 1F0TA 2ULLA 1ELDE 1BMMH 1DVAH 3F2GA 1S81A 3TNSA 1GI9B 3KIDU 1GBDA 2IPQX 4DOQA 1F5LA 2WSSD 2ZHEH 3PV2A 1EFRD 4BTUB 1SGDE 3TH2H 5FAHA 1O2HA 1NRSH 3I77A 1S0QA 1C5QA 1VCWA 2BY6X 1NC6A 1P06A 2UUYA 1D3PB 5EXMA 4DT4A 2D8WA 1HRTH 1C2FA 3PO1C 5LPRA 1NU7B 3NUMA 4P02A 2H9EH 2QCYA 1O5DH 1GCTC 3UREA 4DJZB 2KCOA 2XOKD 2KCPA 3KYFA 3M7QA 4AB9A 3GY5A 1MAXA 3SGAE 2BB4A 4AFZA 1SVPA 1KYNA 3LH1A 5CHAC 4H4FA 1JMOH 2ZU5A 1O2QA 3A8CA 4TPIZ 5FBIA 1O2TA 1ZR0A 1JBUH 4GVUA 1ZHRA 1ANDA 1H8ED 1UVPA 8ESTE 5IDKA 2BY9X 2ZNKH 1W14U 4FVDA 1J16A 2TBSA 2RCEA 2OBOA 3A81A 1ZSKA 2QYIA 1TB6H 1AWFH 1P03A 3SV2H 3E0PB 2H5DA 3I29A 1P05A 3RXQA 1O3EA 2XNIA 1NO9H 1A5HA 4BAHB 2H1UA 1OS8A 1BMAA 3A7WA 4DGJA 2BXTH 1O3MA 2H6MA 1UW7A 1KXDA 3SJKA 1QR3E 2XBYA 2J2UA 1TIOA 2Z3CA 2JETC 1GMDG 3U1JB 3U1IB 2HNTF 2R3YA 1V2ST 1GMCF 1ELGA 1C5ZB 3A8BA 1L2EA 1JWTA 1ZYOA 1CE5A 2Z3EA 5HYOA 1OWIA 1S6LA 1O0DH 2Z9JA 2OTVA 1O2LA 2OC8A 2BTCE 2TGDA 3CNRA 3O8CA 1BT7A 4Q4LA 1W2KH 2J92A 4XD7D 3S7HB 4K69A 1MABB 1UTJA 3PTBA 2P16A 1TPOA 3E6PH 2A5KA 1WYKA 3OAAD 4NIXA 4ABDA 3DFLA 4LZ4B 3RXTA 1KTSB 1B5GH 1BTHH 2FX4A 3OSYA 1E37B 1GG6C 2FDAA 2FI5E 2W7SA 4WVPE 4ZKNU 1YPJH 1IQKA 2D26C 3D49H 3S9BA 1SKYE 3SN8A 2BDBA 1C2HA 2BVSH 3BG8A 1YCPH 1TOMH 1GBHA 1TA6A 4O3TA 1IAUA 6LPRA 5GPIB 1GBKA 5ESBA 5C5NA 3SOSA 1C2EA 1EPTC 2A5IA 2FI4E 3F0OA 4ISIH 4XSKU 4DIIH 1Y3WA 1LQEA 2JH5D 3MOCA 6CHAC 5HM9A 1L1JA 4XOJA 3U9AH 1Q3XA 1SQAA 3DCLA 5FPYA 5C0UA 2VNTA 2ZDKA 1GBCA 2GDDA 4AGJA 3BSQA 1MZDA 1FMGA 1O38A 4X2YA 1FIWA 1YPEH 2BQWB 2BXUH 4I86A 2TRMA 4ZH8A 1DICA 3QTOH 1GJ9B 3A7VA 5JBAS 1TX7A 4X8SH 1LHEH 3QDZB 3V0XA 2ZKSA 4DW2U 2FTMA 1ZTKA 2Z9KA 5GIBA 4AZ2B 2GMTB 2PGBB 2FOEA 3HKIB 2JH6D 4WMFA 5A8XA 2ANWA 3SNEA 5C2ZA 2D2DA 1P0SH 1SQRA 1O2WA 2PKSC 4WMEA 2BDIA 4F49A 4HZHA 1RIWB 2ALVA 1RFNA 3M3VA 3FP7E 1NFUA 2FMJA 5JBTA 2PUQH 3IG6B 1AFQC 2BD9A 2HWLB 3S9AA 2BD2A 1HAVB 4NZLA 1PPCE 2OQUA 2BM2A 3MO3A 1C1VH 1TRNA 1T4UH 2HOBA 1O3HA 3DA9B 1NT1A 4NSYA 2EQNA 2EI6A 1NRQH 2J4IA 3ZVCA 2BOKA 1CU1A 1CBWC 2XBWA 2ZFSA 2EY4C 3SV9A 2QC2A 3W94A 3TGKE 3ZZBA 1TPSA 1FY4A 1FNIA 5FX5A 1GHYH 1NRNH 3PO1B 1HV7A 3LJJA 5F03A 4WF8A 4ABFA 1SB1H 5T6GA 2ZFTA 1GCTB 4K3JA 3QN7A 1NBMD 2P3TB 2CMYA 3TH4H 2ESTE 3L6PA 3GDSA 4GCHF 1ACBE 1E1QD 1SGNE 1V2NT 4J2YB 1SFIA 1QJ7B 1NBME 1YBWA 1DSTA 5CHAB 1OKXA 2RA0A 1O2ZA 4BTIB 2XC0A 2H9HA 1XM1A 3SHCH 3DSPA 3ZVDA 4WXIA 1EAIA 4NZQA 1SHHB 3AVZA 3MI4A 1J8AA 1SGEE 3VXFH 1D4PB 5B6LA 4OS7A 2CF8H 2QY0B 3PTNA 2VVCA 1QRZA 2SGAA 2FXRA 4WMDA 4FUDA 4AG1A 5JBCS 1HYLA 4ISLA 1Y3YA 1AGJA 2ZDVH 1LVBA 1LHFH 2F9BH 3VXEH 4AN7A 3ZIAD 2ZFQH 3MWIU 4GAWA 2CK3D 1W0YH 2TIOA 3F9FA 1IQHA 1B0EA 1K1LA 1YPHE 3RXLA 5DO4H 2ODQA 1DE7H 1QRXA 3F68H 1W0ZU 3BV9B 2W26A 1P2IA 1GDUA 1J15A 2BD5A 1G37A 4XBCA 4FUHA 2JETB 1HAHH 1QRWA 2KZ4A 2NWNA 3ZZ7A 3L3TA 2AH4X 1BTUA 3UPEA 2ZGCA 4XE4A 2ZCKP 3RC4A 2OP9A 3ZV8A 1QBOA 5T6DA 3I78A 3SI3H 3ZZ8A 3SNCA 1JOUB 2C8WB 1CT0E 1Z8GA 3TJNA 1NROH 2TGAA 4X6MA 1GI2A 1MKXH 2XRCA 1P3CA 5JBBS 2ZZUH 4O97A 5DG6A 1O36A 2ZGHA 3ZVEA 3LGVA 4X8VH 4CRBA 1EOLA 3OEHD 8GCHG 2F43B 2G5VA 2FEQH 1BB0B 1DS2E 4XFQA 2Q6DA 3M3TA 1NTPA 3B8JA 3KHVA 2ZDMA 1GI7B 1EQ9A 1FPHH 1MBQA 2BDYA 3RXHA 1GPZA 3PWCA 2Y7XA 1HCGA 1NFWA 1V2VT 1V3XA 5CHBA 4A5TS 3STJA 3ATWA 1EPTB 1ZHMA 3BTWE 4TSFD 1P9SA 1GJ5H 1QHRB 2GGVB 2SNVA 3QO6A 3UFAA 2BVXH 3NK8A 4D76A 3SU1A 6CHAB 2Y80A 4UE7H 1GHXH 4F55A 5JYIA 1C5WB 2A4QA 4AFSA 5FXLA 2VIWA 1VITH 3RLWH 2FOMB 1PYTD 3UOUA 1Z71A 1IQGA 2P94A 3V3MA 4HGCA 3P8GA 1C1QA 3CENA 1BRAA 1PFXC 3NXPA 1LQDB 3A89A 5FPSA 1DFPA 1QCPA 4ACBA 1LKAA 1QBNA 2OBQA 2YMSD 1TLDA 1YLNA 1A4WH 1IHTH 3L33A 5DJ7A 4A92A 2FOHA 1PPHE 1UHBB 2TPIZ 1VCQA 1HNEE 1YPLH 3N99A 1LPGB 3CS7A 2PKSB 2PV9B 4YZUA 1F2SE 1GMCG 1Z8RA 1TE0A 1OHHD 4BAKB 4YT6H 1MQ5A 1D3TB 1V2WT 4OM9A 1IQMA 1WDIA 1AWHB 1UK4A 1GGDC 1DY9A 1T4VH 2F9OA 2OXSA 1EZSC 1ZGVA 4BTTB 3PLKA 1QQ4A 1AFQB 1XXDA 5EOKA 4CHAC 1XX9A 1FY1A 3PV4A 1Z7KA 2G00A 1MQ6A 3P8FA 1WTHD 2AIPA 1UTMA 1BDAA 4E7RG 2ZHDA 2J5UA 2NU4E 5CE1A 1EB2A 1GJDB 3UTUH 5KECA 2O8WA 1C4U2 2SGEE 4HG6A 2O8UA 2L74A 1C5RA 3A8AA 3VFEA 1RD3B 3VB7A 1CBWB 5K0HA 1WAYB 1LVMA 4OS5A 3V13A 4HI3A 3Q00A 3S0NA 1MZAA 4B1TA 1ZPBA 2C90B 1SOTA 2GP9B 2WUCA 5EPNA 3TNTA 1T8LA 3DHKH 1C2GA 1MD7A 2UUKB 1P2MA 1MKXK 2GCHG 3K2UA 3RXRA 1TA2A 2GT7A 3UB0A 3VB6A 1E38B 3EDXB 4X2XA 4FETA 3GY8A 3DFJA 2QE7D 2BD8A 1G2LA 2V7QD 4VGCC 2J38A 3M3SA 1IQEA 2AFQB 1JRSA 3A85A 4XDEA 1VITG 3D23A 3BTEE 5C20A 5EQQA 1H1BA 3P95A 4FVBA 4Y7BA 2J97A 3WWFA 3TGJE 2ZU3A 2W5EA 3ITIA 4LK4A 4JZ1A 2A7JA 5KGOA 1Y5UT 1TPAE 2ZECA 3KGPA 3GCOA 1TPPA 4MNYA 1HAXB 1GBMA 3NRLA 3MO6A 4INHA 4P00A 1YF4A 4X6PA 1SOZA 5EPYA 2HNTE 2XW9A 2GJGA 2G51A 3C27B 1HJ8A 1L4ZA 2L6OA 1WTGH 1Y3VA 4FUCA 1G32B 1HB0B 4UDWH 5EXNA 1ANBA 1C5NH 1H9HE 2B7DH 2G81E 4CRCA 4CRFA 1O3GA 1FY5A 4NWLA 4IN2A 1ETTH 1TBZH 3UAIC 4X1NU 1VJAU 5ETXA 1A5IA 1YPHC 2JJ1D 3WWBA 3FN8A 1V2JT 1BZXE 3OTJE 4B2CA 4NIYA 1TGTA 3UUZA 1DANH 2A2QH 4DURA 1WQVH 2ZO3H 3U8RH 4OS4A 2J9NA 3O8DA 3Q76A 1AU8A 3GY7A 1C4Y2 4I8LA 3RDZA 4D7GA 3VPKA 3MU0A 2UWPA 3F9GA 1H4WA 1TNKA 1AI8H 4GCHG 4ZXXH 2P8OC 3P92A 2RFKC 1GJ7B 1BA8B 2QGRA 2QA9E 1FPCH 2C8YB 1QNJA 3MQKC 2ZTZA 2VIOA 2ZPRA 5IYTA 3VG8A 1U6QA 4I8GA 1WQSA 4AC9A 2AGEX 4F48B 2R2WU 1AMHA 2GZ8A 3QGNB 4Y0YE 2CHAC 2BZ6H 1E34B 1T31A 4YO9A 4INLA 1ELBA 2ZCHP 3LJOA 4BNRA 3A82A 1MU6B 2FOAA 4JZEH 1YP9A 1OXGA 5EJZA 1DM4B 1YLDA 2C93B 4U32A 2PHBA 2I6QA 2WPKS 1ESTA 2PW8H 7GCHF 3RXMA 1C5VA 4YM9A 3M61U 1KDQA 1ZZZA 2QF5A 3OYPA 3DSOA 7KMEH 4IGDA 1TRMA 4IMQA 1XUFA 2FOFA 1GBJA 4PROA 3TK9A 3E0NB 1C1MA 3ZYEA 4I33A 1GI4A 3BIVH 2B0FA 1RIWC 3MNCA 1EATA 1C1WH 1ZPZA 2VU8E 1WCZA 1DWEH 1HDTH 1O3AA 1FJSA 3SJIA 5FPTA 4X6OA 1GGDB 5TJXA 4UFGH 2KR7A 1OWKA 1MCVA 2YMSC 1P3EA 3F9HA 1BRUP 1W13U 4CHAB 4ISNA 4A1XA 5K7RA 1GHWH 2ZC9H 2XTTB 1QTFA 3GICB 1A0HB 4BAQB 1C2KA 2QXIA 1QJ1B 1A3BH 2QF0A 3SU3A 3BTDE 2IN2A 3M5MA 1V2LT 4X0WU 2A32A 2VWMA 1HJ9A 1G3BA 9LPRA 1BBRE 4I8JA 3FFGA 1P2NA 2ZHWH 4NFFA 3FVFB 3HGPA 4FU9A 5EW1H 1HJAC 4ZXYH 2R9PA 2W6ID 5FCRA 4WXVA 3SNAA 1O2VA 1S85A 2XC5A 1YM0A 1O2JA 5J4QA 5A0BA 1HAGE 1ZMLA 2SGDE 3UIRA 2J34A 4VGCB 4D8NA 2WV9A 3ZV9A 2YNAA 4F4OC 1VGCC 1ZSLA 2BQ6B 1YY3A 1ZSJA 1PPEE 1RTLA 2QXGA 4ZKSU 1IOEA 1VKYA 1KLJH 4D7FA 1IHSH 1O2KA 1P12E 1AB9C 3PM3A 1EJAA 1PPBH 1O5AB 1V2TT 3VB5A 1FLEE 2PWXA 1LPKB 2J98A 2M5TA 3MNBA 1QA7A 2ANMH 3FAOA 1A46H 3GCTG 1B0FA 4FXGH 1MTSA 3UWIA 1H8IH 2AEIH 1GHBF 2FO9A 3PWBA 1UVUH 4ZKOU 1YPMH 1H8HD 2WV5A 5KEDA 1O37A 4HTCH 1THPB 1TX6A 3RXCA 1FY8E 1GVLA 1TMBH 1TMTH 3SU2A 3P8NA 1EJNA 1ZHPA 1E0FD 3KCGH 1J17T 1CVWH 3S69A 2BLWA 5E0HA 5C5OA 2HNTC 1C5MD 4JK5A 7ESTE 1TALA 3LC3A 5DP9A 3JZ1B 1O5CB 2BMGB 3UQVA 1O3KA 3QK1A 1A0LA 2ALPA 1IQFA 2SNWA 2R2MB 2H5CA 4Q7ZA 4Y79A 3SW2B 1DSUA 2QF4A 1UTPA 4D9RA 1LTOA 9ESTA 4H42U 1TYNA 3N7EA 1OYTH 2Z94A 1WUNH 1TNLA 2DUCA 3RM0H 4AFUA 1KXBA 4JZDH 1W11U 3BTHE 4I8KA 1CT2E 3RUOA 4INKA 2RA3A 1K1JA 3MNSA 3M37A 1C5YB 1HXFH 2A7HA 3F6UH 1ESAA 2EA3A 1Z6EA 1GDQA 1AVXA 1GJBB 3MH7A 4IMZA 4Q2KA 2ZF0H 5EODA 3QLPH 2AMDA 4JZFH 3OE7D 2FM2A 2P8OB 1SC8U 1FAXA 3GCNA 4ZUHA 1EZXC 2BD4A 3TK6A 3BTME 5FL7D 3QWCH 4ISOA 3RP2A 2BY8X 1O3PB 2WPJS 5E0JA 1GHZA 1JIRA 2V6NA 1C2LA 1TGNA 1AQ7A 1WBGB 2CHAB 1O5BB 1AUJA 1XUJA 2OC1A 3NWUA 6GCHF 5EG4A 5DP3A 1GI0A 1BHXF 5F6MA 2UWLA 2ZDNA 1CA8B 3FKSD 1QA0A 1BTXA 1CHOF 1GBLA 5F8TA 1LMWB 1TQ7B 1CA0B 5EQRA 1AVWA 2OD3B 1T8OA 4FUFA 3MO9A 3GY4A 5FBEA 1C2DA 2SGQE 4AOQA 3R0FA 1GJ6A 2ZDLA 3ZZ9A 1ZTJA 3UY9A 3V7TA 1GBBA 2THFB 3FZZA 1V6DA 3FZDA 5DPAA 3ZVAA 3A87A 1SHYA 5EJLA 1SGFA 1GHAF 1VR1H 2G8TA 1MKWH 1G3EA 1O5EH 3T2NA 3NCLA 1GI5A 3RXFA 1G2MA 3MTYA 5GJ4B 2AMQA 1EZQA 5EIYA 1BJVA 2YMSB 3W95A 1MTNC 2M2AA 3TPIZ 1GL1A 2Z7FE 1AUTC 3RXDA 2B8OH 4AX9H 2Z9IA 2GD4B 1S6FA 2JKHA 2XWBI 3T27A 1O5FH 1Z1IA 4KP0A 3RXAA 2PLXA 3TU7H 1HAOH 2Y7ZA 2Y5FA 3BN9A 2JH0D 2A45B 1AY6H 4JCNA 1ELCA 1ELEE 4RKJB 3LONA 3RMOH 3RXSA 3IITA 4X1PU 1ID5H 1N6YA 3EQ0H 4Z1MD 1HJAB 2K0QA 2PP6A 3A7YA 5AHGH 2AIQA 3M7TA 1W3CA 2V0BA 1DXWA 3TK5A 4Z6AH 3B9FH 2C3SA 3MFJA 3KQEA 4JYVH 2VH6A 2BD7A 2GKVE 4YTAA 1VGCB 2QF3A 1FX0B 3E3TA 4XRNA 3WW7A 1D3DB 1O33A 1YWUA 4DVAU 4FOUC 4BOHA 1PQAA 1YCPK 3P70B 5L6NH 4K8YA 1AB9B 1W12U 4FUIA 1HIAA 3F1SB 5GCHF 1F5RA 3BTGE 1F5KU 3RC6A 3A86A 2FWWA 7LPRA 3LIWA 4ABHA 2F91A 4WJG2 3A7XA 4U01A 2ZQ1A 4MPXA 2I6SA 1COWD 5DK1A 3ENSB 2BZAA 1GBFA 1AKSA 1LCYA 2ZCLP 1HUTH 2Z3DA 4NA7A 3A88A 4R0IA 4I31A 1TNIA 2G4UA 4X8UH 4I7YH 1AN1E 1GBEA 3EA7A 1KLIH 3N7OA 2V3OH 4QT8C 3RM2H 4TYDA 4CRGA 2WHXA 4GSOA 1C9PA 2XYAA 1AVGH 3KEEA 3UNSA 1RXPA 1BRBE 1MKWK 1GJ8B 2Z9LA 4MTBA 2GT8A 5B6OA 5E2PA 1EAXA 4AORA 1ZPCA 1A5GH 1K9OE 4CR5A 1OP0A 3LDXH 1FN6A 5I46H 1BMFD 1FI8A 2XNDD 3K6YA 2ZPQA 2FP7B 5TCAA 3MU4A 1EPTA 4J1YA 1UTLM 3SJ8A 3A80A 3SJOA 4ABBA 1F0RA 4CR9A 5C67A 5F53A 2HLCA 2ZA5A 1QBVH 3AW1A 2FIRH 1EKBB 3F9EA 2G55A 2STBE 3U69H 1OOKB 4AYYB 2TGTA 4NIWA 2FYRA 1O2IA 2FPZA 1C1PA 1OWDA 4RI0A 2WPLS 5LH8A 4SGAE 1OWHA 1RTFB 1YLCA 4SGBE 3MMGA 1NY22 1ANEA 3C1KA 3Q3KA 3SU0A 1BMLA 3OY6U 2ZQ2A 1Y5BT 3A8DA 2KAIA 1DLKB 1EZUC 1KXFA 3OTPA 2TGPZ 3LOXA 3Q3YA 1JXPA 4FU7A 1XUIA 2AS9A 2BLVA 1TABE 1DT2A 2KCYA 1F0SA 2PTNA 4I8HA 3PMBB 1GI1A 1FXYA 1SQTA 2OQ5A 3AASA 3EYDA 1C5PA 1PPFE 3DUXH 4ABAA 1Y5AT 1NRPH 2ZU1A 1QGFA 3MH5A 2VJ1A 2KFWA 2WV4A 1DUAA 1TRYA 2J95A 1KIGH 1L1NA 2FTLE 3BTTE 3FP6E 4YOIA 5F8ZA 2FODA 3E90B 4TY6A 3UWJH 3SHAH 3SJ9A 3M5NA 2A31A 5DP8A 1WXRA 2GDEH 2BLOA 1N1LA 2A1DB 1MTNB 3AK5A 1DLEA 1K1IA 1UK2A 4LOYH 1O31A 5CDFE 1RJXB 2ZGJA 3TJVA 5T3HA 1J9CH 5ESTE 1EP6A 3PLPA 2J94A 3PB1E 1A3EH 2O8LA 2ZFPH 3EA8A 3GY2A 3SZNA 1H8DH 3M7UA 1C2IA 5SGAE 3GYLB 1TGCA 3P6ZB 1K1OA 4ZHLU 5ABWA 1SLUB 3TITA 1BCUH 3PYHA 3QZQA 4ABJA 4LXBH 1TGBA 1FDPA 1ZTLA 2JDID 4Y8YA 1CT4E 3R3GB 2A0QB 1SG8B 1E79D 3DT0H 2R0LA 1XVMA 2HPPH 2W3IA 4X1RU 1C5LH 2VVUA 1SI5H 6GCHG 2Y6TA 4GUXA 2PSXA 1GBTA 1GVZA 4Y8ZA 1UTQA 3RXEA 2FOGA 3SNBA 3CS0A 1P04A 1A61H 1TBQH 3T28A 3D62A 1DITH 1SGTA 4YOJA 1BBRH 4CRDA 2ZP0H 1HXEH 1MAYA 3GY3A 1AZ8A 1VJ9U 4IC6A 1WOFA 2Y5HA 1K1MA 5HXFA 1DDJA 1PQ8A 2W3KA 1OSSA 1SMFE 4FU8A 5JB8S 1SGCA 1EJMA 1P09A 3AW0A 3FP8E 1ESBA 1S84A 1TQ0B 2JJ2D 3OEED 1QL7A 3F2HA 2Y81A 2ODYB 1O3DA 5J4SA 3ZZAA 4ASHA 4M9FA 4H6SB 1QB6A 3M5OA 3LH3A 3S7KB 2K1QA 1FQ3A 3D65E 1AZZA 1ORFA 2AERH 3VB3A 3RXKA 2BOHB 5A8YA 2F9VA 2VINA 2WINI 5A8ZA 1P11E 5FCKA 1QFKH 4UONA 5EXLA 5JPMH 3G01A 1IQIA 1MUEB 1BUIA 1MU8B 1MMJN 3KF2A 4GHQA 3ZZ5A 1GL0E 1GBAA 1ZMJA 1W8BH 2PKAA 1XKBC 3QTVH 5HKKD 2H2ZA 1Y3UA 3MH4A 4Y71A 1GJ4H 3BEFB 1YGCH 2BYAX 2P59A 2LELA 4JZIA 4IBLH 5FX6A 4OGXA 1H9LB 1THRH 4ABGA 3Q3XA 8LPRA 5GDSH 1PQ5A 1G3CA 1TNHA 3SZEA 3SGQE 5GWZA 1SQOA 2G52A 3KNXA 4ABIA 1T32A 4WY3A 3EE7A 5DKMA 2EC9H 1G9IE 2P93A 3B23B 3BTKE 2P3FH 1FONA 3AAUA 4ACAA 3T5FH 4AYVB 1FAKH 1EOJA 1S82A 1S0RA 3RU4E 1AE5A 1D6WA 1A0JA 3FO8D 3MH6A 4WH8A 1YPKH 3PMJA 4KGAA 2F83A 1O3FA 5C17A 1HAYB 2AGIX 4MNWA 2C8XB 4UFDH 2KM0A 4IW4E 4TY7A 2AGGX 4RT0A 2RDLA 2UWOA 1X7AC 4BAOB 1XVOA 1AFEH 1K1PA 3RMNH 5E8EH 1C2MA 4Q80A 1J14A 2QV1A 1P8VC 1CA0C 2FS9A 1L4DA 4MVNA 4UFFH 4XBDA 5C0TA 1BBRK 1RTKA 4RSPA 2OK5A 2CV3A 3LT3A 5GXPA 2OUAA 4MNXA 5A0CA 2D1JA 1ZGIA 1C1OA 1E1RD 2F9UA 3HGNA 1F92A 4JYTA 1SGIB 2PUXB 1ZJKA 2ZGBH 1GBIA 2XBVA 3A7TA 2VIPA 2ZIQH 2BHGA 2VGCC 3CP7A 1FN8A 3GDUA 3HKJB 1HBTH 4CREA 4NCYA 1CHGA 3TVJB 3PMAB 1O2UA 4IC5A 4IN1A 1Y59T 4MNVA 4ZMAH 2ZEBA 1O34A 1YCPM 2Z9GA 3LGWA 2AMPA 1SLXB 1XUKA 2NU3E 1O2OA 3DD2H 4MG3A 1V2KT 2WPDD 3V12A 4AG2A 1MD8A 3GS9A 5HIZA 1BTPA 1OWEA 2CJIA 4RN6A 5JDUB 1MTWA 1A7SA 1VZQH 3ZZ3A 1G36A 1BTYA 4AFQA 5AF9H 4DT7B 2PFEA 3RXUA 1GI6A 4BANB 1YPGH 4KTUA 1EUFA 1KDQB 2K8IA 3PLBA 4B6EA 2FLRH 2A7CA 5I25A 1ZRBA 1O2RA 1C2JA 1Z1JA 1W7GH 8KME2 1ABJH 3SI4H 3E16B 3P17H 4Y7AA 3T62A 1L0ZA 1W10U 2Q1JA 3STIA 1TOCB 2HPQH 2LNCA 3DSGA 3SUDA 4FUJA 3KQDA 3LGIA 4WWYA 1GCDA 3AAVA 4MPUA 1ETSH 4RKOB 2IJOB 4ASUD 1P57B 3HK3B 1BTZA 1PPGE 1QB9A 2QIQA 3ESTA 3RXJA 1C1NA 3W1EA 2O8TA 1EAWA 4M7GA 3TIUA 1DUEA 1UTNA 1O30A 5HGGA 8GCHF 3OU0A 4ZHAA 2Y5GA 2VIDA 1TX8A 5BRRE 1M9UA 3H7OA 4X2WA 1UCYE 4ZCNA 1XUHA 2ZTYA 2W6JD 1ARCA 2FI3E 1BTWA 1AE8H 4A6LA 2UUJB 2CF9H 5EU8A 1ETRH 2F9NA 3U98H 3SQEE 2AYWA 2HLDD 4ZHMU 3SO3A 2A4GA 3SU6A 2UUFB 2VIVA 1Y3XA 3E91A 1N8OC 3ODFA 2F3CE 2STAE 1NFYA 5L2YH 5A09A 3URCA 3A84A 2R3UA 2BDAA 2LP6A 1Z8JB 1RS0A 4BXWA 4O9VA 1DOJA 1CQQA 5AFZH 2VWOA 3EAJA 1GVKB 3RXBA 1D6RA 2V3HH 2OC0A 1QL9A 2SGFE 4NSVA 2Q6FA 1NU9A 4AGKA 2J98B 1UVOA 5H4IB 1O2MA 2DE9A 4X2VA 4NGAH 1SBWA 4BAMB 1T8MA 5G4BA 4OS1A 3VGCC 1K0HA 3URDA 4X6NA 3SV8A 1YC0A 2OINA 1UO6A 3ATMA 3H09A 4K60A 2FX6A 5DP5A 3LGUA 4Y8XA 1ABIH 1DY8A 4B75A 3MU5A 1KMHB 5F8XA 2WPHS 1UJ1A 1NRRH 1E36B 3KL6A 4NWKA 2CGAA 1P2JA 2BY5X 4A1TA 4B6FA 3H5CB 1P2KA 1TFXA 2JIZD 3SORA 1G3DA 3SBKA 1A1RA 1O2GH 3BEIB 4CH8B 4IS5A 4THNH 2GCTC 1AHTH 5HIYA 2YOLA 1DPOA 5C94A 2GCHF 1CGHA 5T1VA 2PSYA 3K6ZA 4FUEA 2ZU4A 1KXCA 1S5SA 1ELFA 4TT3D 1W7XH 3RLYH 4H6TA 4DCDA 5HMAA 1HAVA 3SU5A 3BG4C 4XBBA 4MLFB 1OX1A 1D3QB 1EP5A 3EE0B 1FIZA 1VITF 2P3UB 2NU1E 2VGCB 3SUGA 1O2PA 1P9UA 4KTCA 3U8TH 3U28C 3ATKA 1ARBA 5IK2D 1QURH 4YLQH 1IQLA 1V2RT 3SYJA 2FLBH 3SUFA 1N6XA 1C5UA 3UR9A 1MTUA 1UMAH 4K5ZA 3PROA 1SFQB 3UR6A 2XXLA 2O8MA 1GI3A 3GDVA 1P2QA 2GZ7A 2LPRA 1JIMA 4DIHH 3SUEA 2YNBA 3RXGA 1XMNB 4FUGA 1K28D 4AB8A 1O32A 3K65B 1C5SA 5DN6D 1UK3A 3GYMA 3ELAH 1WV7H 3U8OH 3ATLA 4D9QA 3QGJA 5A0AE 2DE8A 3BF6H 1BJUA 4NIVA 2IPHA 1NM6A 1A2CH 4U2WA 2ZFRH 5DP4A 3KQBA 2WPIS 2F9PA 3A83A 5E2OA 1FY3A 5C3NA 1INCA 4ESTE 1IQJA 2OCVB 2PTCE 3K9XB 3ZVGA 3UOPA 4RT1A 1EX3A 1O39A 1C9TA 4K2YA 4O03A 5EGMA 1O5GH 2WUBA 4DY7B 2GTBA 3UQOA 4GPGA 1GMHF 1TONA 1LDTT 1XXFA 3TH3H 4Y0ZE 1QQUA 1GHVH 1LO6A 3PMHB 7GCHG 1HGTH 4Y11E 2VBCA 2B5TB 2ZI2H 1DX5M 5L2ZH 2A4RA 3RMMH 1LHGH 4CBNA 5E0GA 3F2FA 4Z0KA 1CO7E 2HVXA 4FUBA 1QY6A 2R0KA 5EQSA 1MCTA 1KXAA 3N7DA 2GV6A 1K2I1 4X1SU 4Y6DA 5HM2A 5T6FA 5CMXH 1QJ6B 2WZQA 3UNRA 4YT7H 3VB4A 3EGKH 1FUJA 1OPHB 1V2QT 1ZJDA 1W0JD 2ZHQH 5DP6A 4OGYA 1N8OB 1DWCH 3GY6A 2ODPA 3OX7U 4B73A 1RRKA 1TGSZ 1EB1H 3GOVB 1OWJA 1C4V2 1EASA 3BTFE 5BPEA 2W7UA 3ODDA 3MYWA 2IJD1 3HK6B 4B2BA 2VB0A 4K1SA 4NA8A 2BDHA
chains in the Genus database with same CATH topology
4JYUH 1DWDH 4TWWA 1HIAB 1DXPA 1O3CA 2XC4A 1SLWB 1OYQA 2XBXA 1TNGA 1UTKA 5DSFA 1ZOMA 2P95A 3M5LA 3TJOA 1P10A 1AIXH 1DWBH 1GI8B 4MQAA 3VGCB 3A7ZA 1Q31A 1P01A 1HAZB 2SFAA 4B76A 3OFND 4ABEA 1YKTA 4A1VA 3RMLH 1AO5A 3SQHE 5L30H 4Q63A 1SGFG 4MPVA 3RC5A 3ZZDA 1AKSB 4Y10E 3ZVBA 2ANYA 2EI8A 1K1NA 1LVYA 5A2MH 1SGRE 2ZU2A 3RXVA 1TWXB 1BOQA 4YLUA 1C1RA 1HFDA 2G5NA 3RXOA 1BHXB 4BXSA 3GCHC 3ZZCA 2B9LA 1GG6B 4KTSA 5AVDA 3RXIA 1UHBA 1O3OA 2QN5T 5DP7A 4K1EA 3ZZ6A 5LPEA 1KTTB 1O2YA 1GHBG 1LHDH 2C8ZB 1S83A 3SV6A 2GCTB 2BD3A 3M36A 1ZLRA 4GHTA 1EXFA 3PRDA 3O8RA 1HAIH 1H9IE 2BVRH 5EW2H 5C1XA 3QX5H 3E1XB 1LVOA 1SL3A 4CBOA 1LKBA 1O3IA 2CN0H 4E06H 3BG4B 1SR5C 5FHTA 3MNXA 3ZYDA 3FANA 1ELTA 1NESE 2KCAA 1WSSH 1EAUA 2O9QA 3HPTB 1NPMA 4Y76A 1MBMA 4E05H 6ESTA 1PQ7A 2RG3A 1NN6A 3F3BA 3E8LA 3MU1A 1V2OT 1OP2A 3LKWA 5LGOA 1O35A 1C1UH 1S6HA 2ZPSA 2VIQA 2GV7A 3UNQA 3F0PA 1GWAA 1C5TA 4CRAA 3GCTF 2BQ7B 3GISB 4YOGA 2BX3A 3VEQB 2EI7A 1NS3A 3LC5A 1FV9A 2KAIB 2FOCA 1PPZA 4UD9H 1BITA 4OS2A 1UVTH 1V2UT 1RGQA 1TNJA 3RU4T 2FYQA 1WU1A 1BMNH 1OP8A 1O3BA 1T7CA 4TPYA 1O3LA 2ILNA 1B7XB 2H9TH 1FZZA 1TMUH 1CGJE 2BY7X 1GMDF 2V35A 1HPGA 1D9IA 1HLTH 1Q2WA 1E35B 1VCPA 1HAPH 1F0UA 1ELVA 3M35A 1GJAB 2GVFA 2WYJA 3Q77A 3TGIE 5C1UA 3SGBE 1QIXB 4B71A 1YYY1 1CHOG 4LZ1H 2HRVA 2IOTA 4NG9H 3OY5U 1SGYE 4A7IB 5PTPA 2C4FH 3NKKA 1P02A 2A4OA 2XWAA 5LPFA 1BRCE 2G4TA 2VWLA 4K8BA 1Z8IB 1TAWA 4ZKRU 3RXPA 3ZVFA 1PJPA 1GHAG 3JZ2B 5C1YA 4TWYA 2ZTXA 3LGYA 4KELA 4KKDA 1K21H 1BIOA 1CSOE 1W0KD 2VH0A 1AD8H 3LGTA 1GJCB 1SGPE 1SPJA 3P8OA 1ZMNA 1V2PT 3BTQE 4O3UA 4HFPB 4X8TH 1ZRKA 2BDCA 1MH0A 2BX4A 3SV7A 2VWNA 1UCYH 1MTVA 4JMYA 4X1QU 4E7NA 3WY8A 1Z6JH 2F4LA 2ZGXH 2FS8A 5GNDA 2AHME 3TLOA 1SGQE 1KSNA 2NU0E 2NU2E 1SLVB 1QL8A 2A2XH 2PR3A 3T26A 4GLYA 3EA9A 3BEUA 1UTOA 3H7TA 1CGIE 2EEKA 4UFEH 2QAAA 3RU4D 1O2SA 3QUMP 1O2NA 1C5OH 1BQYA 3PRBA 1Y8TA 2Q6GA 1IQNA 1NZQH 2VVVA 3HATH 4YESB 1NFXA 2SGPE 3TJUA 1XKAC 2FESH 4B74A 3PV5A 4JK6A 1JRTA 3QZRA 4UEHH 3LU9B 4OS6A 1GMHG 2XCNA 4CH2B 3MU8A 4YXWD 5GCHG 2ZDAH 5DGJA 2ZFFH 3GCHB 4ZROA 1P2OA 1L1GA 3BIUH 2PKAB 4Q7YA 1F7ZA 3SNDA 1C1TA 1G30B 2Y82A 2BLQA 3ZZ4A 3KQCA 1LPZB 4DG4A 3LPRA 2QXJA 2GX4A 1ANCA 1K22H 1O3NA 1O3JA 1GDNA 2ZG0H 4WH6A 4ZAEA 3IWMA 4MDSA 3ATIA 3S9CA 1QB1A 2FZZA 1KLTA 1TBRH 1C5XB 5TCCA 1ELAA 4R8TB 5AFYH 2OC7A 2QXHA 3T29A 2CXVA 1XUGA 4MPWA 3SU4A 4B2AA 4NFEA 2BDGA 4NA9H 3T25A 1THSH 3KN2A 1UVSH 2HGTH 1SSXA 3NPSA 1T8NA 2XCFA 1LHCH 2Z6BD 4K1TA 2A5AA 5JB9S 2GMTC 1V2MT 3MHWU 1KY9A 2ANKH 2OLGA 2WYGA 2ZHFH 4Q7XA 4ISHH 4U30A 3O8BA 4I32A 1C1SA 1KXEA 2PGQB 2GZ9A 2FOBA 1UCYK 1PYTC 2WPMS 1O2XA 3NZIA 2ASUB 2ZWLH 2HALA 3FOAA 1F0TA 2ULLA 1ELDE 1BMMH 1DVAH 3F2GA 1S81A 3TNSA 1GI9B 3KIDU 1GBDA 4DOQA 1F5LA 2ZHEH 2WSSD 3PV2A 1EFRD 4BTUB 1SGDE 3TH2H 5FAHA 1O2HA 1NRSH 3I77A 1S0QA 1C5QA 1VCWA 2BY6X 1NC6A 1P06A 2UUYA 1D3PB 5EXMA 4DT4A 2D8WA 1HRTH 1C2FA 3PO1C 5LPRA 1NU7B 3NUMA 2H9EH 2QCYA 1O5DH 1GCTC 3UREA 4DJZB 2KCOA 2XOKD 3M7QA 2KCPA 4AB9A 3GY5A 1MAXA 3SGAE 2BB4A 4AFZA 1SVPA 1KYNA 3LH1A 5CHAC 4H4FA 1JMOH 2ZU5A 1O2QA 3A8CA 4TPIZ 5FBIA 1O2TA 1ZR0A 1JBUH 4GVUA 1ZHRA 1ANDA 1H8ED 1UVPA 8ESTE 5IDKA 2BY9X 2ZNKH 1W14U 4FVDA 1J16A 2TBSA 2RCEA 2OBOA 3A81A 1ZSKA 2QYIA 1TB6H 1AWFH 1P03A 3SV2H 3E0PB 2H5DA 3I29A 1P05A 3RXQA 1O3EA 2XNIA 1NO9H 1A5HA 4BAHB 2H1UA 1OS8A 1BMAA 3A7WA 4DGJA 2BXTH 1O3MA 2H6MA 1KXDA 3SJKA 1QR3E 2XBYA 2J2UA 1TIOA 2Z3CA 2JETC 1GMDG 3U1JB 3U1IB 2HNTF 2R3YA 1V2ST 1GMCF 1ELGA 1C5ZB 3A8BA 1L2EA 1JWTA 1ZYOA 1CE5A 2Z3EA 5HYOA 1OWIA 1S6LA 1O0DH 2Z9JA 2OTVA 1O2LA 2OC8A 2BTCE 2TGDA 3O8CA 1BT7A 4Q4LA 1W2KH 2J92A 4XD7D 3S7HB 4K69A 1MABB 1UTJA 3PTBA 2P16A 1TPOA 3E6PH 2A5KA 1WYKA 3OAAD 4NIXA 4ABDA 3DFLA 4LZ4B 3RXTA 1KTSB 1B5GH 1BTHH 2FX4A 3OSYA 1E37B 1GG6C 2FDAA 2FI5E 2W7SA 4WVPE 4ZKNU 1YPJH 1IQKA 2D26C 3D49H 3S9BA 1SKYE 3SN8A 2BDBA 1C2HA 2BVSH 3BG8A 1YCPH 1TOMH 1GBHA 1TA6A 4O3TA 1IAUA 6LPRA 5GPIB 1GBKA 5ESBA 5C5NA 3SOSA 1C2EA 1EPTC 2A5IA 2FI4E 4XSKU 4ISIH 3F0OA 4DIIH 1Y3WA 1LQEA 2JH5D 3MOCA 6CHAC 5HM9A 1L1JA 4XOJA 3U9AH 1Q3XA 1SQAA 5FPYA 3DCLA 5C0UA 2VNTA 2ZDKA 1GBCA 2GDDA 4AGJA 3BSQA 1MZDA 1FMGA 1O38A 4X2YA 1FIWA 1YPEH 2BQWB 2BXUH 2TRMA 4ZH8A 1DICA 3QTOH 1GJ9B 3A7VA 5JBAS 1TX7A 4X8SH 1LHEH 3QDZB 3V0XA 2ZKSA 4DW2U 2FTMA 1ZTKA 2Z9KA 5GIBA 4AZ2B 2GMTB 2PGBB 2FOEA 3HKIB 2JH6D 4WMFA 5A8XA 2ANWA 3SNEA 5C2ZA 2D2DA 1P0SH 2PKSC 1O2WA 4WMEA 2BDIA 4F49A 4HZHA 1RIWB 2ALVA 1RFNA 3M3VA 3FP7E 1NFUA 2FMJA 5JBTA 2PUQH 3IG6B 1AFQC 2BD9A 2HWLB 3S9AA 2BD2A 1HAVB 4NZLA 1PPCE 2OQUA 2BM2A 3MO3A 1C1VH 1TRNA 1T4UH 2HOBA 1O3HA 3DA9B 1NT1A 4NSYA 2EI6A 1NRQH 2J4IA 3ZVCA 2BOKA 1CU1A 1CBWC 2XBWA 2ZFSA 3SV9A 2QC2A 3W94A 3TGKE 3ZZBA 1TPSA 1FY4A 1FNIA 5FX5A 1GHYH 1NRNH 3PO1B 1HV7A 3LJJA 5F03A 4WF8A 4ABFA 1SB1H 5T6GA 2ZFTA 1GCTB 4K3JA 3QN7A 1NBMD 2P3TB 2CMYA 3TH4H 2ESTE 3L6PA 3GDSA 4GCHF 1ACBE 1SGNE 1E1QD 1V2NT 4J2YB 1SFIA 1QJ7B 5CHAB 1YBWA 1DSTA 1NBME 1OKXA 2RA0A 1O2ZA 4BTIB 2XC0A 2H9HA 1XM1A 3SHCH 3ZVDA 3DSPA 4WXIA 1EAIA 4NZQA 1SHHB 3AVZA 3MI4A 1J8AA 1SGEE 3VXFH 1D4PB 5B6LA 4OS7A 2CF8H 2QY0B 3PTNA 2VVCA 1QRZA 2SGAA 2FXRA 4WMDA 4FUDA 4AG1A 5JBCS 1HYLA 4ISLA 1Y3YA 1AGJA 2ZDVH 1LVBA 1LHFH 2F9BH 3VXEH 4AN7A 3ZIAD 2ZFQH 3MWIU 4GAWA 2CK3D 1W0YH 2TIOA 3F9FA 1IQHA 1B0EA 1K1LA 1YPHE 3RXLA 5DO4H 2ODQA 1DE7H 1QRXA 3F68H 1W0ZU 3BV9B 2W26A 1P2IA 1GDUA 1J15A 2BD5A 1G37A 4XBCA 4FUHA 2JETB 1HAHH 1QRWA 2KZ4A 2NWNA 3ZZ7A 3L3TA 2AH4X 1BTUA 3UPEA 2ZGCA 4XE4A 2ZCKP 3RC4A 2OP9A 3ZV8A 1QBOA 5T6DA 3I78A 3SI3H 3ZZ8A 3SNCA 1JOUB 2C8WB 1CT0E 1Z8GA 3TJNA 1NROH 2TGAA 4X6MA 1GI2A 1MKXH 2XRCA 1P3CA 5JBBS 2ZZUH 4O97A 5DG6A 1O36A 2ZGHA 3ZVEA 3LGVA 4X8VH 4CRBA 1EOLA 8GCHG 3OEHD 2F43B 2G5VA 2FEQH 1BB0B 1DS2E 4XFQA 2Q6DA 3M3TA 1NTPA 3B8JA 3KHVA 2ZDMA 1GI7B 1EQ9A 1FPHH 1MBQA 2BDYA 3RXHA 1GPZA 3PWCA 2Y7XA 1HCGA 1NFWA 1V2VT 1V3XA 5CHBA 4A5TS 3STJA 3ATWA 1EPTB 1ZHMA 3BTWE 4TSFD 1P9SA 1GJ5H 1QHRB 2GGVB 2SNVA 3QO6A 3UFAA 2BVXH 3NK8A 4D76A 3SU1A 6CHAB 2Y80A 4UE7H 1GHXH 4F55A 5JYIA 1C5WB 2A4QA 4AFSA 5FXLA 2VIWA 1VITH 3RLWH 2FOMB 1PYTD 3UOUA 1Z71A 1IQGA 2P94A 3V3MA 4HGCA 3P8GA 1C1QA 3CENA 1BRAA 1PFXC 3NXPA 1LQDB 3A89A 5FPSA 1DFPA 1QCPA 1LKAA 1QBNA 2OBQA 2YMSD 1TLDA 1A4WH 1IHTH 3L33A 5DJ7A 4A92A 2FOHA 1PPHE 1UHBB 2TPIZ 1VCQA 1HNEE 1YPLH 3N99A 1LPGB 3CS7A 2PKSB 2PV9B 4YZUA 1F2SE 1GMCG 1Z8RA 1TE0A 4BAKB 1OHHD 4YT6H 1MQ5A 1D3TB 1V2WT 4OM9A 1IQMA 1AWHB 1UK4A 1GGDC 1DY9A 1T4VH 2F9OA 2OXSA 1EZSC 1ZGVA 4BTTB 3PLKA 1QQ4A 1AFQB 1XXDA 5EOKA 4CHAC 1XX9A 1FY1A 3PV4A 1Z7KA 2G00A 1MQ6A 3P8FA 1WTHD 2AIPA 1UTMA 1BDAA 4E7RG 2ZHDA 2J5UA 2NU4E 5CE1A 1EB2A 1GJDB 3UTUH 2O8WA 1C4U2 2SGEE 2O8UA 1C5RA 3A8AA 3VFEA 1RD3B 3VB7A 1CBWB 5K0HA 1WAYB 1LVMA 4OS5A 3V13A 4HI3A 3Q00A 3S0NA 1MZAA 4B1TA 1ZPBA 2C90B 1SOTA 2GP9B 2WUCA 5EPNA 3TNTA 1T8LA 3DHKH 1C2GA 1MD7A 2UUKB 1P2MA 1MKXK 2GCHG 3K2UA 3RXRA 1TA2A 2GT7A 3UB0A 3VB6A 1E38B 3EDXB 4X2XA 4FETA 3GY8A 3DFJA 2QE7D 2BD8A 1G2LA 2V7QD 4VGCC 2J38A 3M3SA 1IQEA 2AFQB 1JRSA 3A85A 4XDEA 1VITG 3D23A 3BTEE 5C20A 5EQQA 1H1BA 3P95A 4FVBA 4Y7BA 3TGJE 3WWFA 2ZU3A 2W5EA 3ITIA 4LK4A 4JZ1A 2A7JA 1Y5UT 1TPAE 2ZECA 3KGPA 3GCOA 1TPPA 4MNYA 1HAXB 1GBMA 3NRLA 3MO6A 4INHA 1YF4A 4X6PA 1SOZA 5EPYA 2HNTE 2XW9A 2G51A 3C27B 1HJ8A 1L4ZA 2L6OA 1WTGH 1Y3VA 4FUCA 1G32B 1HB0B 4UDWH 5EXNA 1ANBA 1C5NH 1H9HE 2B7DH 2G81E 4CRCA 4CRFA 1O3GA 1FY5A 4NWLA 4IN2A 1ETTH 1TBZH 4X1NU 1VJAU 5ETXA 1A5IA 1YPHC 2JJ1D 3WWBA 3FN8A 1V2JT 1BZXE 3OTJE 4B2CA 4NIYA 1TGTA 3UUZA 1DANH 2A2QH 4DURA 1WQVH 2ZO3H 3U8RH 4OS4A 2J9NA 3O8DA 3Q76A 1AU8A 3GY7A 1C4Y2 4I8LA 3RDZA 4D7GA 3VPKA 3MU0A 2UWPA 3F9GA 1H4WA 1TNKA 1AI8H 4GCHG 4ZXXH 2P8OC 3P92A 1GJ7B 1BA8B 2QGRA 2QA9E 1FPCH 2C8YB 1QNJA 2ZTZA 2VIOA 2ZPRA 5IYTA 3VG8A 1U6QA 4I8GA 1WQSA 2AGEX 2R2WU 1AMHA 2GZ8A 3QGNB 4Y0YE 2CHAC 2BZ6H 1E34B <