2OC0A

Structure of ns3 complexed with a ketoamide inhibitor sch491762
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
181
structure length
181
Chain Sequence
APITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVAKAVDFIPVENLETTMRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hepatitis C Virus
publication title Discovery of the HCV NS3/4A protease inhibitor (1R,5S)-N-[3-amino-1-(cyclobutylmethyl)-2,3-dioxopropyl]-3- [2(S)-[[[(1,1-dimethylethyl)amino]carbonyl]amino]-3,3-dimethyl-1-oxobutyl]- 6,6-dimethyl-3-azabicyclo[3.1.0]hexan-2(S)-carboxamide (Sch 503034) II. Key steps in structure-based optimization.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Viral protein
total genus 40
structure length 181
sequence length 181
chains with identical sequence C
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2oc0A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2oc0A01
1P9UA 4YOGA 8KME2 2W5EA 2GKVE 1VR1H 3BTFE 1ZPZA 4X0WU 3K6YA 3SJOA 5T1VA 1DICA 1TPOA 3MNCA 2A7JA 2ZPRA 2ZNKH 4ZROA 3ATWA 4FUCA 5FAHA 1C9TA 1GI0A 3SI4H 1DPOA 2ZFRH 2VBCA 1GHAG 1ELFA 2XTTB 5E2PA 2BD4A 1QBVH 1A4WH 2ZU4A 1SG8B 2BQ7B 1BTUA 2ZHWH 4U2WA 3EDXB 2WPHS 1UTJA 1UTQA 1UVOA 1PYTD 3UPEA 1DY8A 1F92A 2GX4A 2J94A 5F8XA 4AORA 5CHAB 1T4UH 4WMEA 3MWIU 1MU8B 1O2GH 1EJNA 1OKXA 1HAZB 5JB8S 1SGEE 4Z6AH 3GCHC 1PPGE 1P03A 5AFZH 1V2TT 2R0LA 1D9IA 1UTMA 1K28D 1MUEB 2XC5A 2HRVA 1GBMA 1J16A 3UOPA 2A7HA 1EPTA 3UY9A 3UNRA 2PKSB 4X6MA 1KDQA 4KKDA 3UR6A 4A6LA 2PW8H 2ZGXH 1BTPA 2XWBI 4ABHA 4PROA 1SQAA 1GJAB 2CN0H 4OS1A 2PTCE 3KF2A 2XC4A 1MKXK 4NGAH 2WHXA 4I31A 1SGFG 1C2JA 1GDQA 1MBMA 3LC5A 3ZZAA 4BNRA 1QA7A 3ZYEA 2AH4X 2R2MB 1EZUC 1QRXA 1S5SA 1GDNA 3LGYA 3KN2A 7GCHF 4IMQA 3FVFB 3LJOA 2ZECA 1W0YH 1K1JA 1KLIH 4X1NU 2BQ6B 4MVNA 2OC1A 1KYNA 1GBKA 1FIZA 1O2OA 3M35A 1CVWH 2PKAA 1YCPH 4OGYA 1B0EA 1PYTC 1CO7E 3M7UA 5B6OA 2Y7ZA 2G4UA 1ESAA 2ZP0H 3TH4H 1TGSZ 4VGCC 1TPSA 4ZHLU 2TBSA 1RGQA 4B76A 1BTXA 1MZAA 1O33A 3P17H 4A1TA 1Z8IB 2BOHB 2BTCE 1TGBA 2KAIB 3VEQB 4Q7ZA 1NC6A 1FUJA 1FAXA 2AYWA 4O9VA 1OSSA 4RKJB 2FS8A 1GI3A 1O0DH 3BTQE 3BEUA 3RLWH 1O2RA 1XUFA 3PTNA 4CRAA 1YGCH 1TONA 4FXGH 2BZ6H 3V13A 3RXSA 1SOZA 2IN2A 4CRGA 5EODA 3LH1A 1ABJH 1C1QA 2YOLA 4UFDH 3SU6A 1CA8B 4NIWA 2BY6X 3GCTF 3A89A 1NFXA 2NU0E 2XCFA 1SHYA 1YCPK 5A2MH 1HXEH 1S0RA 1A1RA 1TX7A 2FX6A 5EXMA 1YYY1 1S6HA 3T5FH 5EGMA 2FZZA 3RXIA 3MNXA 2G52A 1L4ZA 1O2UA 1QL7A 1EATA 1MAYA 5EU8A 3BTKE 4ZKNU 2BVSH 1JXPA 5FBIA 1W0ZU 2FO9A 4IBLH 1VITF 3LONA 2IJOB 3N7OA 5DK1A 4I33A 4ABAA 3IWMA 4ESTE 3LGIA 1GGDB 3GY8A 2OC7A 1BA8B 4INKA 4UONA 1TX8A 3QDZB 3MU5A 6GCHF 5H4IB 1DSTA 4SGAE 4NIYA 1G2MA 5EXNA 3S9CA 4JZEH 4B6FA 1K1PA 4ZKRU 1FY4A 5A8XA 1BMNH 4D7GA 1P9SA 5E2OA 1ETRH 5DKMA 4LK4A 3PLBA 5B6LA 3M3TA 3QK1A 1HJ8A 1ZHMA 3RUOA 3P8OA 1O5GH 1HRTH 2ZPSA 4JZIA 1JBUH 3KEEA 2A4RA 3M3VA 1AU8A 3AK5A 1FY1A 3PV4A 3SNAA 1O3GA 2EEKA 4Q7XA 3PV2A 3E1XB 1IQFA 1SL3A 1NRPH 1GMHF 3SU3A 2Y7XA 3MNBA 2ODYB 4YO9A 2XXLA 2QAAA 1O2YA 5E0JA 1RTKA 2ESTE 4LZ4B 1A61H 1A3BH 4KTCA 1N6XA 1BTHH 2SNWA 2VWNA 1G36A 2FPZA 3NZIA 3LKWA 1HJAB 2Z9GA 1O3HA 1ESBA 1D6WA 1JWTA 2RG3A 3RXQA 1ZTKA 2ANMH 2TGPZ 3U98H 1TBQH 4FU9A 4X2XA 5GCHG 1V6DA 4YT6H 4IC5A 3UIRA 1YP9A 1Y3UA 2DE9A 2GMTC 1OWKA 5G4BA 2VGCB 5A8YA 1TBRH 1K1NA 2HLCA 2A4OA 3HK6B 3RU4T 2Z7FE 3UOUA 2FTLE 2QIQA 3AASA 3DT0H 1MAXA 5EPYA 1O2LA 1GBTA 1P2QA 3ZZ7A 4BOHA 2VINA 4I32A 1AZ8A 1NTPA 5EXLA 1D4PB 1YPHE 2XRCA 1XX9A 1NPMA 1HIAA 2RDLA 1GBFA 1G3BA 3KQBA 1CQQA 2G4TA 5HM2A 5I25A 4NSYA 3DD2H 1PPFE 3FZZA 1O5FH 2XBYA 5FPYA 1XVOA 3SW2B 3V7TA 5EPNA 1GVKB 1DITH 1G37A 2ZIQH 2Z3EA 6CHAC 1ZPCA 3MO6A 1VGCB 2ZGBH 1ZR0A 1GJ4H 1A5HA 1MQ5A 3BG8A 1O36A 3A7XA 1OPHB 2OTVA 4R0IA 3RMOH 2WPLS 1N8OC 2AGGX 1MH0A 2P3UB 1WV7H 1P11E 1KTSB 3IG6B 1P8VC 1QQUA 1HB0B 2J4IA 4X1QU 1C1SA 3GCOA 3Q00A 4K3JA 4Z0KA 1O3OA 3TJOA 3GY5A 1SOTA 2P16A 2QN5T 2FOGA 2OCVB 3SU0A 3VXFH 1GI1A 4KTSA 4RN6A 1XUKA 4K2YA 2GZ8A 2ODPA 1XXDA 3RC5A 3SUGA 4A1VA 2ANKH 3B8JA 2XCNA 4FU8A 1ZRKA 4Y7BA 4I7YH 4BAKB 1TE0A 1NY22 1T8NA 2FOHA 3EAJA 1V2VT 4MPXA 1OYTH 3MOCA 5LGOA 1NS3A 1K1IA 4NFEA 1LHFH 1OX1A 1WTHD 2IJD1 5CE1A 2CV3A 3A87A 1VZQH 1THPB 2FOAA 2SNVA 1GMHG 3PO1C 3TNSA 1GJBB 1GGDC 1UTNA 4A92A 2QXJA 5HGGA 3U9AH 4Y0ZE 2ZU1A 3SU1A 1QA0A 5ESTE 3ZZ5A 1SVPA 2V3HH 3SZEA 3VB4A 3S9BA 3O8BA 4X2WA 1VITH 2Z9LA 1OOKB 3SUEA 1C1VH 1BDAA 1GJDB 1W7XH 4TPYA 4R8TB 3U1JB 4B6EA 2VU8E 2ZG0H 1Q2WA 5DP4A 3JZ2B 1ELTA 2ZDKA 1GJ6A 3TK5A 1EAIA 3T25A 3RXKA 1ANEA 1EQ9A 3TGIE 1WUNH 2GT8A 2BYAX 3S7KB 5LPRA 3U8TH 1ZPBA 2JETC 3E3TA 4IN2A 8LPRA 1T32A 1AHTH 1ZHRA 2Q6GA 2F9NA 1HNEE 2CHAC 3U69H 4CRBA 2AIPA 1KY9A 3RXRA 4ABJA 4MDSA 1AFEH 1UK4A 1HFDA 3M36A 5C20A 1LVBA 1CA0B 1BBRK 2H6MA 1OP2A 2AS9A 4UD9H 1ZTJA 2PGBB 2IOTA 3CS0A 1TMUH 3TK6A 2BX3A 2FMJA 3ZZ6A 3UNQA 2J34A 3QZQA 3OY6U 1NESE 1QJ6B 2ULLA 5A09A 1PPBH 1GBDA 2W26A 4FUBA 1TNHA 3EA8A 1KXDA 3LT3A 1A5IA 1M9UA 3ZVFA 2GGVB 5DP9A 1OP8A 1A3EH 1LPGB 1GCDA 1O3KA 2WPIS 1C2LA 4Y10E 1KTTB 1W13U 3OX7U 1Y5UT 1EPTB 1O5CB 4BAQB 4JZDH 2HWLB 1DANH 1QL8A 4NIXA 1BOQA 4DW2U 1GHAF 1FQ3A 1KDQB 2OP9A 2Q6DA 3DUXH 1O5AB 1P06A 3UQVA 3RM0H 1EZXC 4X2YA 5IDKA 3FP8E 5DP8A 4QT8C 1LO6A 1INCA 2D26C 2H5CA 3ZV9A 5FHTA 4YM9A 4WY3A 5DO4H 4B2BA 1GWAA 1RJXB 1ARCA 3VB5A 4AB9A 1LCYA 2ZHDA 2BVXH 5FX5A 5J4SA 2BM2A 2ZA5A 2UUKB 3ZVDA 1GBCA 1FY8E 1WYKA 3A8CA 3A88A 1XKBC 2P3FH 4LZ1H 4YOIA 1AQ7A 1YBWA 2SGEE 3KQEA 4ZUHA 1H8IH 1IQIA 3WY8A 1O5BB 1HUTH 4TYDA 1EKBB 1NZQH 4CH2B 1QJ1B 3QX5H 1HV7A 2G51A 1EP5A 4OS2A 3W95A 5HXFA 1HAXB 2ZZUH 4J1YA 3MYWA 1GMDG 2O8UA 2PKAB 4KELA 2WV5A 3QGJA 3HGNA 1OP0A 3C27B 1SGNE 2ANWA 3AAVA 5E0HA 3FAOA 5CMXH 3ESTA 1TPAE 5ESBA 3MTYA 1MTUA 1XUGA 2GVFA 4UFFH 1HAPH 2GZ9A 1K2I1 4CRFA 1P12E 5AVDA 1YLCA 2FIRH 3SV8A 3CENA 3RXVA 2FEQH 4B73A 1S82A 1G3CA 1Y3YA 1GI8B 3SGAE 2VWOA 2QA9E 1K22H 1QBOA 1MTNB 1NFUA 1SHHB 5A0AE 1LVYA 2SGDE 2EI8A 2ZHFH 2SFAA 2A45B 3RXDA 4IN1A 3ZZCA 3MI4A 3W94A 3SUDA 4Y6DA 1RFNA 1BMMH 1V2JT 4E7RG 4I8HA 1QIXB 1ZSKA 2VB0A 2XBXA 1LPZB 1HAIH 4O03A 2AERH 1BHXB 3VXEH 4X8TH 4OS7A 3Q3YA 2FOCA 1UHBB 1ZTLA 1F5RA 4TWWA 1EAUA 3A8DA 1T8MA 1KIGH 4E05H 2O8TA 2Q6FA 2TGDA 3B23B 3OY5U 2AMPA 1QB6A 3D23A 3OSYA 4B2AA 3BEFB 2A0QB 2G8TA 1TGNA 2H1UA 3O8RA 2GCHF 1C9PA 1RTFB 1XUJA 1TQ7B 1KXFA 1F0SA 3ZZ3A 3S69A 1ARBA 1IQGA 1BJVA 1PPCE 1C4Y2 4GHTA 3ZZ9A 2VIVA 2YNAA 4MPWA 1C2GA 3QTOH 3RM2H 3RXPA 1ZLRA 1UCYK 1W11U 1LQDB 7KMEH 2SGQE 2K1QA 1N6YA 2QC2A 2PHBA 1CSOE 3BIUH 1IHSH 4I8JA 2F83A 2I6QA 4XBDA 4WWYA 1O2IA 1AWFH 1EXFA 3DFJA 1C1MA 1Z7KA 4F4OC 3R0FA 3K65B 1O2VA 1DWBH 1GI4A 1GHBG 5JPMH 3NWUA 2OC0A 4I8GA 1EPTC 2G55A 2FLRH 1SB1H 1GBHA 4DVAU 2GDEH 2P95A 1Z8GA 3BTME 2UWLA 3U1IB 4IS5A 2ZGHA 1A0LA 4XSKU 2ZU5A 4FVDA 3SQHE 1ANCA 2VIOA 3AAUA 4WMFA 4M7GA 1DLEA 1O2WA 1FN8A 2V0BA 1MD8A 2CF9H 2ZDNA 1BTYA 3HGPA 4ISOA 1GBJA 2Z9JA 3MO3A 1SR5C 4AYVB 4GHQA 4JZ1A 3ZZ8A 1J9CH 4K60A 2V35A 1E36B 3OYPA 2H9EH 1BTWA 4MPUA 3UWJH 2ZFQH 5DP5A 4AFQA 4SGBE 2FTMA 5K7RA 3SU5A 1QHRB 1Z1IA 2R9PA 1TNJA 1IOEA 2P8OB 1L4DA 1C5WB 1OWDA 2HOBA 3QTVH 2O8MA 3PROA 2OUAA 3GYLB 1HIAB 3ZYDA 5LH8A 3ZZBA 5GJ4B 1ELBA 3A7WA 3A7YA 2EI7A 3K2UA 1KLTA 3M61U 1DWEH 1GBEA 1JRTA 3KIDU 3LC3A 1BMAA 5GCHF 2ODQA 1P10A 1GG6B 5A0CA 1CHOF 5L6NH 2GCHG 1L1GA 2Y82A 1RS0A 2WINI 2J2UA 3I77A 4K8BA 2XNIA 1GCTC 3F9FA 3MH7A 1MQ6A 4X6OA 1MTNC 3V0XA 1DFPA 1C5SA 3BTWE 2HPPH 5DPAA 4BTIB 1EOJA 2J95A 3HKJB 2G5NA 1BQYA 1FN6A 1O2NA 5HYOA 2F91A 3Q3XA 1C1NA 3ZZDA 1UHBA 2R3UA 4CHAB 4CBNA 1EZSC 1SGQE 4ZMAH 2F9VA 1HXFH 1ABIH 4ISIH 1D6RA 1TRYA 2ZCLP 5E8EH 4BAHB 2XWAA 3QGNB 1L1NA 3RXCA 1IAUA 8GCHG 1GHYH 1GVLA 1TPPA 1GJ5H 1ZJDA 1P2KA 1RIWB 3SJKA 3IITA 4U01A 3SJIA 2V3OH 1ZMLA 3PYHA 1AUTC 1L1JA 1AO5A 1GBLA 1O2QA 4AFZA 4ABFA 1FY3A 3M5LA 1GI2A 2VJ1A 4GUXA 2VIQA 5EOKA 1UTKA 3RXBA 1GJ8B 2FDAA 1O30A 1YM0A 3H7TA 1QY6A 3KQCA 1AIXH 1W14U 3A84A 5BPEA 1O3BA 2LNCA 4BXWA 4D9RA 3KL6A 1YLDA 5CHAC 4AN7A 3ATKA 2Z9IA 1C5VA 1ZJKA 2I6SA 1AE8H 3RXLA 1EZQA 5F8TA 3UWIA 5DP7A 1DXPA 1F0UA 1O3MA 2OQUA 1UTPA 2JH0D 1TNLA 1HBTH 4KTUA 2PKSC 4H42U 2BQWB 2G00A 3VGCB 2AGEX 5T3HA 1WSSH 3MFJA 4FUJA 3VFEA 5F6MA 3PLPA 5GWZA 2ZTYA 2PLXA 1LHGH 3E0NB 3ZVBA 3RMMH 1O39A 1VJ9U 3RXUA 3GDUA 4THNH 1MZDA 1HAOH 3A81A 4GCHG 1EOLA 3HK3B 1NFWA 1FJSA 1CHOG 4NZLA 1MTVA 1ZSJA 3SOSA 1EB1H 3RC4A 1NRSH 2QXIA 3BG4B 1FPHH 2EC9H 5C2ZA 3SO3A 3BTDE 4YTAA 1K1LA 4TWYA 4D7FA 5HM9A 1WAYB 1JIRA 1ZYOA 1AB9B 5JDUB 3TJVA 1O34A 1AWHB 4IW4E 3SBKA 1GPZA 1W7GH 1J17T 3M7TA 2Y5HA 2F9OA 1P2MA 2IPHA 5K0HA 1C4U2 1NU7B 3T2NA 2F4LA 2NU4E 2O9QA 5L2ZH 1IHTH 3LH3A 4K69A 1ACBE 1H8DH 2P8OC 4NIVA 1S83A 2GCTB 3ATMA 5FBEA 2W3KA 1EUFA 1FAKH 4BTUB 2H9TH 2J92A 2NU3E 2ZCKP 4M9FA 1AVXA 1BMLA 4YLQH 2TGAA 3RXFA 1V3XA 1LHDH 3MH6A 1S85A 5GPIB 4ZXXH 5T6FA 1H9HE 1U6QA 4UE7H 2STAE 1XM1A 2BD9A 3GDSA 3RU4D 4D9QA 1AZZA 4ABIA 1T8OA 1LDTT 2ZWLH 3T28A 3GCNA 5JYIA 1DDJA 1IQJA 1F0RA 2VIDA 2THFB 2UUFB 2Q1JA 4ISHH 5C3NA 3SZNA 1TYNA 3QZRA 3UFAA 4DOQA 1J14A 3RC6A 3CP7A 4UEHH 3UNSA 2PSYA 5GIBA 2B0FA 4Y8ZA 2W7SA 3MU1A 2ZFSA 2ZI2H 3I29A 1GI9B 1C5RA 2OBQA 3STIA 1IQNA 5EQQA 1NFYA 5AFYH 3RXOA 4ZHMU 5C5NA 5DGJA 1PQ5A 3JZ1B 3MMGA 3S7HB 2PV9B 2RA3A 1TQ0B 2AMQA 1ZOMA 1TX6A 1S84A 2B8OH 1ETSH 3D62A 4A7IB 1RIWC 1P0SH 5ABWA 4A5TS 1LKBA 2C93B 1Z8RA 2GV6A 2EA3A 1FI8A 1E38B 4MNWA 4DG4A 3VB7A 2SGPE 1UMAH 5F8ZA 5IYTA 1ZMNA 1GMDF 1TGCA 3ZZ4A 1C1PA 3RXMA 1O3PB 2PGQB 1P05A 2A4QA 3TK9A 5C67A 1SGYE 1W2KH 1V2KT 1IQMA 1G32B 4DIIH 2ZFTA 1XVMA 3UTUH 1MCTA 1BZXE 1W10U 2A5KA 3P8NA 4FUEA 4Y71A 1G3DA 2VWMA 1C5MD 1WU1A 3SU4A 3TGKE 3SJ9A 4MG3A 3FANA 1PQ7A 4CR5A 3OTPA 5FCKA 1WXRA 5JBAS 4D76A 2ZQ2A 1IQHA 1LHCH 1K21H 1GDUA 1UO6A 5GXPA 3PMHB 1FIWA 1TWXB 1CGHA 4UFGH 1SGCA 1TGTA 5A0BA 1C4V2 3A82A 1AUJA 3H5CB 1DUAA 3SUFA 1BITA 3UUZA 1ORFA 3BSQA 2PTNA 2OBOA 1GJ7B 3NUMA 1O37A 1Z6EA 2OQ5A 2BDCA 2F3CE 1DS2E 1HJAC 3A7TA 3P8GA 1CBWB 2P94A 2UUYA 4BAOB 1OWEA 2HNTC 1W12U 3A8BA 2ZGCA 5TCCA 1O3EA 5C1UA 2VGCC 1HCGA 3DA9B 1C5ZB 1O2SA 2P93A 1OWHA 1A2CH 1QURH 2Z6BD 2BDHA 2TIOA 5FPTA 1ZGIA 1QFKH 4YESB 1CT2E 3NXPA 1DUEA 1BTZA 3ATLA 1F5LA 5GNDA 2FS9A 1QBNA 3T27A 1YKTA 3B9FH 3RXTA 4MNXA 3SHCH 4I8KA 1C1OA 2GCTC 3E90B 3FFGA 2TPIZ 1BHXF 5LPFA 3H7OA 4K8YA 2C4FH 1YPGH 1YPMH 3SI3H 2GZ7A 2C8WB 3BTEE 4DIHH 1K1MA 2BLOA 1VGCC 3S0NA 4AGJA 1TLDA 3Q77A 4JYVH 4XBCA 2ZKSA 2VH6A 3Q3KA 1VCPA 3TU7H 3E0PB 1FZZA 4ABBA 3LIWA 1RD3B 1GHBF 2FESH 3RXJA 3PTBA 1DT2A 1O2JA 1LKAA 3I78A 3L3TA 1AD8H 1TOCB 1GMCG 1BRUP 1TIOA 1NT1A 1EAWA 1FPCH 3T26A 4BXSA 1Q31A 4HZHA 1PPZA 1V2LT 2Z3DA 1J15A 2ZU3A 6ESTA 1GHXH 1A0JA 3G01A 2QCYA 1DLKB 2FOFA 3PM3A 2HGTH 1W3CA 1FNIA 4IMZA 5E0GA 1SBWA 2W3IA 2HVXA 3O8CA 1GBIA 2ZTXA 5EQRA 4XBBA 1G2LA 1LTOA 2A7CA 5T6GA 1V2OT 3F68H 2V6NA 4DT7B 5JBTA 1T7CA 2D8WA 4TPIZ 1WQVH 1QCPA 3NKKA 3TNTA 3UREA 1SFQB 1UVUH 1AI8H 1Y59T 1F7ZA 2OK5A 1SLUB 4WF8A 2BDYA 2LPRA 1Z71A 4K1SA 3NPSA 2A5IA 1UVSH 1X7AC 1RRKA 2TGTA 1HDTH 3SN8A 1GI7B 2F9UA 1MU6B 1GHVH 3ITIA 2Z3CA 4CBOA 3TPIZ 4K1EA 4Y0YE 1QRWA 1A46H 2GP9B 1FONA 2UWOA 1YC0A 3E16B 3BTGE 1CT4E 2ZHEH 3ENSB 1C2FA 4MPVA 2PWXA 3LGWA 4ABDA 4B2CA 2WZQA 1D3TB 1O5DH 3KCGH 4LXBH 1P02A 3LGVA 1O32A 3ZVEA 3SYJA 1FLEE 1O5EH 2G5VA 3DHKH 1KLJH 2OD3B 3RLYH 1HYLA 1PJPA 4ISLA 2CMYA 1ANBA 1NRRH 3ODDA 3LDXH 2XBWA 4X1PU 1CA0C 2OXSA 4CH8B 4NA7A 2UWPA 2QV1A 2FOMB 2QY0B 3S9AA 3OTJE 2FM2A 4U30A 4XFQA 3LU9B 4ZAEA 4NSVA 3RMLH 4DJZB 1CBWC 1IQEA 1QGFA 2BXTH 1NRNH 1MKXH 1LVOA 1EAXA 2DUCA 8GCHF 1OWJA 1Y5BT 3LOXA 3PMJA 1THSH 4AG2A 1SC8U 3M7QA 3STJA 1KXAA 2JH6D 1YPKH 2TRMA 5C5OA 5T6DA 1SGDE 3SV9A 1O2KA 1UK2A 4Y8XA 2SGAA 1JOUB 3TVJB 2OLGA 2BDAA 2AGIX 1D3QB 1DM4B 2ZO3H 3ATIA 3PMAB 4NWKA 1ESTA 3VPKA 1C2KA 1O2XA 4OS4A 4UFEH 2CF8H 4MNVA 1PPHE 3NCLA 4X8SH 3V3MA 3SHAH 4AGKA 1WCZA 1GJ9B 1H9LB 2C90B 1BRBE 1OYQA 2VWLA 4XDEA 1XMNB 3F9EA 3MNSA 1ZGVA 3TIUA 1O3AA 1HGTH 1SGIB 2ALPA 3M5OA 4AFUA 7LPRA 1SPJA 3MU4A 1GBBA 2A4GA 2BLWA 3D49H 4Y79A 1AKSA 3M3SA 1F5KU 2GDDA 5DP3A 4RSPA 4AOQA 2BLQA 1WTGH 1V2NT 2GMTB 2H5DA 1GVZA 1KSNA 4HGCA 1P2JA 1DSUA 4IC6A 1C5TA 3EA9A 3P92A 2BDBA 1GHWH 5EW1H 1HAVB 2WPKS 1H4WA 3FP6E 3FZDA 2Y80A 1S6FA 1L2EA 3LJJA 4A1XA 1BIOA 1FXYA 2BD2A 4GCHF 3VB6A 1Q3XA 1G9IE 2CXVA 2GD4B 1GBAA 3ELAH 2ZTZA 1TBZH 2BMGB 3T62A 4X8UH 2VIWA 3PLKA 2BY5X 1PFXC 2WPMS 1O38A 1P3CA 1XUHA 1DX5M 2C8XB 5LPEA 4GAWA 3HPTB 3D65E 3R3GB 1B7XB 1XUIA 2WUCA 1HJ9A 2YNBA 1UVTH 4MTBA 4H6SB 1VCQA 3ZV8A 4AYYB 6CHAB 4DGJA 5FCRA 1SFIA 1T8LA 2QGRA 3TLOA 1ANDA 3TJUA 1NN6A 5TCAA 4AZ2B 3ZVAA 1YPEH 4GLYA 3K9XB 1N8OB 2FOEA 2VIPA 2PFEA 2BDGA 1C2EA 4INLA 3A7VA 5HMAA 9ESTA 1CGIE 2XBVA 4E7NA 3RDZA 1O2HA 2D2DA 3ZVCA 2FYQA 4Q7YA 4MNYA 3MU0A 2VVCA 4ISNA 1V2QT 3AW1A 1O3NA 3UQOA 2HNTF 2ZDLA 1ZZZA 1CHGA 4Y7AA 1UTOA 3U8OH 1WOFA 2RCEA 1VCWA 3MO9A 5DJ7A 2UUJB 4YT7H 1TRMA 2XW9A 1C5OH 1JRSA 1SLVB 1DY9A 3AW0A 5I46H 3TGJE 1HLTH 1QTFA 3KGPA 1B0FA 7ESTE 1PQAA 2G81E 3VB3A 5C1YA 1QB9A 1J8AA 1W8BH 1Y3XA 1G3EA 3LGUA 4GSOA 1Y8TA 1ELDE 4NG9H 4WH6A 3GISB 4JK5A 1D3DB 1LPKB 2Z94A 1C5XB 5A8ZA 2WV9A 3BF6H 3PO1B 1ELAA 4E06H 3A80A 2R3YA 1GI5A 1MKWH 2BY9X 1C1RA 1Z1JA 4OS6A 4BTTB 3PB1E 3SNDA 4FUHA 1GHZA 1SGFA 1ZHPA 1DWDH 4B1TA 4Q2KA 1GJCB 8ESTE 2M5TA 1DE7H 4NFFA 1CU1A 1P2OA 2ZQ1A 1T4VH 3BN9A 3PWCA 1EX3A 2OINA 5L30H 5C1XA 2PSXA 3V12A 1P04A 4OS5A 3SV7A 3U8RH 1QL9A 1RTLA 2R0KA 5EW2H 4AX9H 2Y6TA 1MTWA 2Y5GA 1TOMH 1NU9A 1CGJE 2ZDMA 3AVZA 3T29A 1QNJA 2ZU2A 2CGAA 1E37B 1V2UT 2JETB 4H6TA 5AHGH 7GCHG 1SMFE 2C3SA 4Q80A 3GDVA 4O3UA 2ANYA 1YF4A 2CJIA 2WYJA 4HTCH 2HPQH 3MH4A 1V2RT 4K1TA 1YPJH 2FWWA 2CHAB 1LMWB 4INHA 2XC0A 3SNEA 3BV9B 1AVGH 1SQOA 4H4FA 1C5QA 3RXHA 3C1KA 1OWIA 3EE0B 3EA7A 1MKWK 2O8WA 2ZEBA 1Y3WA 3URCA 2VVUA 1AY6H 4WJG2 4YOJA 1VJAU 1TABE 3P8FA 2Y81A 4X2VA 2H2ZA 5JBCS 1LVMA 3TITA 1DOJA 1THRH 3PWBA 2BY7X 4JCNA 1P2IA 1C5LH 3LGTA 2ZC9H 1WQSA 1SI5H 1NROH 1CT0E 1TFXA 1RXPA 4DURA 4WVPE 1O3JA 2AIQA 3GY2A 2ZF0H 1A0HB 3OU0A 3KHVA 5EQSA 4CRDA 3RP2A 1HAVA 1C2HA 3F6UH 1CE5A 6LPRA 1NM6A 2WYGA 1C5PA 1ZMJA 5L2YH 1LQEA 1F2SE 1FY5A 1TRNA 2BX4A 1AN1E 3PMBB 3F9HA 3RXEA 3H09A 1BUIA 1AVWA 3F1SB 1ID5H 3GCTG 1OXGA 1PPEE 1V2WT 2QF3A 3P70B 4GPGA 3SNBA 4F49A 3SQEE 2WPJS 2FI3E 1T31A 2QF0A 1Z8JB 2BDIA 1TAWA 1QB1A 4AB8A 1GG6C 1BCUH 4JYTA 3URDA 2QXGA 2KAIA 1TA6A 5TJXA 3RU4E 5DP6A 1DVAH 2F9PA 3O8DA 4CREA 2ZDAH 3GY4A 4HI3A 1O3CA 4FUGA 2ZFPH 4Y8YA 2B5TB 2JH5D 2BOKA 3L6PA 4WXVA 4ZH8A 1V2PT 1VITG 1ELVA 4B71A 1N1LA 4AG1A 1TA2A 2NU1E 1SSXA 1C5YB 2A5AA 2RA0A 2ZGJA 1MMJN 3E6PH 3M37A 1E0FD 1C5NH 2EI6A 3LPRA 4CHAC 6GCHG 3RXAA 3BTTE 1ZRBA 3PV5A 1KXBA 1MD7A 1ELGA 1L0ZA 2BD3A 2A32A 4KP0A 1G30B 1MBQA 1P09A 1S81A 4BAMB 1TNIA 2HNTE 3GICB 3ODFA 1XXFA 2FP7B 3M5NA 3A86A 3K6ZA 4OGXA 1O3LA 1O2MA 2P3TB 1AGJA 1LHEH 2BD8A 1P01A 2BB4A 1Y5AT 1S0QA 2NWNA 3SGBE 1DXWA 1EJMA 1AFQB 4X8VH 1BBRE 1KXCA 1O2TA 1YCPM 3Q76A 2FOBA 2F9BH 2XYAA 1BJUA 2BY8X 1B5GH 1GMCF 1YPHC 2BVRH 4O97A 1P57B 3MH5A 3DFLA 4WH8A 3TH2H 2WV4A 1GI6A 3L33A 1BRCE 4XOJA 3TH3H 4RKOB 1BBRH 3HATH 1QRZA 1HPGA 4FUIA 2ILNA 2AEIH 4LOYH 2AMDA 2DE8A 4X6NA 1XKAC 4WMDA 4X1SU 4U32A 2ALVA 4NZQA 1KXEA 4XE4A 4YLUA 3QN7A 3E91A 2B9LA 1SQTA 1Z6JH 5GDSH 1D3PB 3BTHE 3HKIB 2QXHA 3EYDA 3CS7A 4B74A 4DCDA 3SV6A 1H9IE 3GY6A 3NK8A 2GV7A 4RI0A 2ZHQH 3GY3A 3SNCA 3A85A 3VGCC 4X6PA 5FX6A 3SJ8A 4NA9H 3SU2A 5JB9S 2A31A 3ZVGA 1F0TA 2C8YB 1HAYB 4OM9A 1JMOH 3F9GA 1O2ZA 9LPRA 4FUFA 4WXIA 4NA8A 2GT7A 1E34B 1NRQH 4JMYA 4NCYA 4MQAA 1TALA 2ZPQA 2FLBH 1A7SA 2Y5FA 4J2YB 1IQKA 1GL1A 1UTLM 3TJNA 1C5UA 3P95A 1PQ8A 2ZDVH 4ZXYH 3BG4C 3MHWU 5PTPA 1AE5A 1O3DA 1QR3E 4ZHAA 1NO9H 1AB9C 3QUMP 3A7ZA 5ETXA 1FV9A 1IQLA 2BZAA 4FVBA 3GCHB 1TNGA 3GYMA 1SGTA 1C1TA 2FI4E 3SV2H 4ZKOU 4ZKSU 2A1DB 4ABEA 4CR9A 5JBBS 3SORA 4CRCA 3EGKH 4AFSA 2C8ZB 5AF9H 4ABGA 4D8NA 1BB0B 3A8AA 3E8LA 1YPLH 2BXUH 5J4QA 4O3TA 3KQDA 2VNTA 1V2ST 2ASUB 2D1JA 4MLFB 2R2WU 1MCVA 2NU2E 2WUBA 5BRRE 1ELEE 3MU8A 3RXGA 2FODA 2B7DH 1DWCH 1FMGA 1JIMA 3GOVB 2P59A 1OS8A 4Y76A 2BLVA 1E35B 2J9NA 3QWCH 2BD7A 2PUXB 3QO6A 1AKSB 4I8LA 1SLXB 4K5ZA 3UR9A 1BRAA 2FI5E 3RMNH 2GTBA 1SLWB 1EASA 1UVPA 4YZUA 1UK3A 1HAGE 3A83A 4KGAA 4Y11E 2W7UA 4FUDA 2H9HA 1P3EA 4JYUH 4X1RU 5DG6A 2O8LA 5F03A 1C2MA 4NWLA 1QJ7B 1O2PA 3SGQE 2VVVA 1C2DA 4GVUA 1O31A 1WBGB 1HAHH 4VGCB 4FU7A 1H1BA 3QLPH 1O35A 2A2XH 1AMHA 2BHGA 3BIVH 1EB2A 1K1OA 1BT7A 2FYRA 2OC8A 3M5MA 4JZFH 1O3IA 1TB6H 3BEIB 5SGAE 3EQ0H 1UJ1A 1SGRE 4B75A 2Z9KA 5FXLA 1Y3VA 2PR3A 1C2IA 2VH0A 1P2NA 2AFQB 1AFQC 4HFPB 3KNXA 1TMTH 1SGPE 4ASHA 1GCTB 2JKHA 1A5GH 1QQ4A 2QYIA 2FX4A 2HALA 1O3FA 2J38A 2ZCHP 4TY7A 4JK6A 1UCYE 1ETTH 1V2MT 1FDPA 2PUQH 4TY6A 1ELCA 2ZFFH 1GL0E 1TNKA 2BD5A 2SGFE 5EG4A 3GY7A 1K9OE 4IGDA 1TMBH 1C1WH 1EJAA 1ZSLA 4BANB 3P6ZB 1C1UH 2A2QH 2FXRA 3FP7E 1EP6A 2STBE 4UDWH 1UCYH 4DY7B 1MTSA 5FPSA
chains in the Genus database with same CATH superfamily
1P9UA 4YOGA 8KME2 2W5EA 2GKVE 1VR1H 3BTFE 1ZPZA 4X0WU 2J98A 3K6YA 3SJOA 5T1VA 1DICA 1TPOA 3MNCA 2A7JA 2ZPRA 2ZNKH 4ZROA 3ATWA 4FUCA 5FAHA 1C9TA 1GI0A 3SI4H 1DPOA 2ZFRH 2VBCA 1GHAG 1ELFA 2XTTB 5E2PA 2BD4A 1QBVH 1A4WH 2ZU4A 1SG8B 2BQ7B 1BTUA 2ZHWH 4U2WA 2KFWA 2WPHS 3EDXB 1UTJA 1UTQA 1UVOA 1PYTD 3UPEA 1DY8A 1F92A 2GX4A 2J94A 5F8XA 4AORA 5CHAB 1T4UH 4WMEA 3MWIU 1MU8B 1O2GH 1EJNA 1OKXA 2QF4A 1HAZB 5JB8S 1SGEE 4Z6AH 3GCHC 1PPGE 1P03A 5AFZH 1V2TT 2R0LA 1D9IA 1UTMA 3F0PA 1K28D 1MUEB 2XC5A 2HRVA 1GBMA 1J16A 3UOPA 2A7HA 1EPTA 3UY9A 3UNRA 2KM0A 2PKSB 4X6MA 1KDQA 4KKDA 3UR6A 2JIZD 4A6LA 2PW8H 2ZGXH 1BTPA 2XWBI 4ABHA 4PROA 1SQAA 1GJAB 2CN0H 4OS1A 2PTCE 3KF2A 2XC4A 1MKXK 4NGAH 2WHXA 4I31A 1VKYA 1SGFG 1C2JA 1GDQA 1MBMA 3LC5A 3ZZAA 4BNRA 1QA7A 3ZYEA 2AH4X 2R2MB 1NBMD 1EZUC 1QRXA 1S5SA 1GDNA 3LGYA 3KN2A 7GCHF 4IMQA 3FVFB 3LJOA 3ZIAD 2ZECA 1W0YH 1K1JA 1KLIH 4X1NU 2BQ6B 4MVNA 2OC1A 1KYNA 1GBKA 1FIZA 1O2OA 3M35A 1CVWH 2PKAA 1YCPH 4OGYA 1B0EA 1PYTC 1CO7E 3M7UA 5B6OA 2Y7ZA 2G4UA 1ESAA 2ZP0H 3TH4H 1TGSZ 4VGCC 1TPSA 4ZHLU 1BMFD 2TBSA 1RGQA 4B76A 1BTXA 1MZAA 1O33A 3P17H 4A1TA 1Z8IB 2BOHB 2BTCE 1TGBA 2KAIB 2LP6A 3VEQB 4Q7ZA 1NC6A 1FUJA 1FAXA 2AYWA 4O9VA 1OSSA 4RKJB 2FS8A 1GI3A 1O0DH 3BTQE 3BEUA 3RLWH 1O2RA 1XUFA 3PTNA 4CRAA 1YGCH 1TONA 4FXGH 2BZ6H 3V13A 3RXSA 1SOZA 2IN2A 4CRGA 5EODA 4TSFD 3LH1A 1ABJH 1C1QA 2YOLA 3PRBA 4UFDH 3SU6A 1CA8B 4NIWA 2BY6X 3GCTF 3A89A 1NFXA 2NU0E 2XCFA 1SHYA 1YCPK 5A2MH 1HXEH 1S0RA 1A1RA 1TX7A 2FX6A 5EXMA 1YYY1 1S6HA 3T5FH 5EGMA 2FZZA 3RXIA 3MNXA 2G52A 1L4ZA 1O2UA 1QL7A 1EATA 1MAYA 5EU8A 3BTKE 5KGOA 4ZKNU 2BVSH 1JXPA 5FBIA 1W0ZU 2FO9A 4IBLH 1VITF 3LONA 2IJOB 3N7OA 2PP6A 5DK1A 4I33A 4ABAA 3IWMA 3UB0A 4ESTE 3LGIA 1GGDB 3GY8A 2OC7A 1BA8B 4INKA 4UONA 1TX8A 3QDZB 3MU5A 6GCHF 5H4IB 1DSTA 4SGAE 4NIYA 1G2MA 5EXNA 3S9CA 2QF5A 4JZEH 4B6FA 1K1PA 4ZKRU 1FY4A 5A8XA 1BMNH 4D7GA 5EJ1A 1P9SA 5E2OA 1ETRH 1H8ED 5DKMA 4LK4A 3PLBA 5B6LA 3M3TA 3QK1A 1HJ8A 1ZHMA 3RUOA 3P8OA 1O5GH 1HRTH 2ZPSA 4JZIA 1JBUH 3KEEA 2A4RA 5KECA 3M3VA 1AU8A 2L6OA 2KCYA 3AK5A 1FY1A 3PV4A 3SNAA 1O3GA 2EEKA 2WSSD 4Q7XA 3PV2A 3E1XB 1IQFA 1SL3A 1NRPH 1GMHF 3SU3A 2Y7XA 3MNBA 2ODYB 3N7EA 4YO9A 2XXLA 2QAAA 1O2YA 5E0JA 1RTKA 2ESTE 4LZ4B 1A61H 1A3BH 4KTCA 1N6XA 1BTHH 2SNWA 2VWNA 1G36A 5KEDA 2FPZA 3NZIA 3LKWA 1HJAB 2Z9GA 1O3HA 1ESBA 1D6WA 1JWTA 2RG3A 3RXQA 1ZTKA 2ANMH 2TGPZ 3U98H 1TBQH 4FU9A 4X2XA 5GCHG 1V6DA 4YT6H 4IC5A 3UIRA 1YP9A 2LELA 1Y3UA 2DE9A 2GMTC 1OWKA 5G4BA 2VGCB 5A8YA 1TBRH 1K1NA 2HLCA 2A4OA 3HK6B 3RU4T 5CDFE 2Z7FE 3UOUA 2FTLE 2QIQA 3AASA 3DT0H 1MAXA 5EPYA 3F2HA 1O2LA 1GBTA 1P2QA 3ZZ7A 4BOHA 2VINA 4I32A 1AZ8A 1NTPA 5EXLA 1D4PB 1YPHE 2XRCA 3DSOA 1XX9A 1NPMA 1HIAA 2RDLA 1GBFA 1G3BA 3KQBA 1CQQA 2G4TA 3F3BA 5HM2A 5I25A 5F53A 4NSYA 3DD2H 1PPFE 3FZZA 1O5FH 1KMHB 4F55A 2XBYA 5FPYA 1XVOA 3SW2B 3V7TA 5EPNA 1GVKB 1DITH 1G37A 2ZIQH 2Z3EA 6CHAC 1ZPCA 3MO6A 1VGCB 2ZGBH 1ZR0A 1GJ4H 1A5HA 1MQ5A 3BG8A 2RFKC 1O36A 3A7XA 1OPHB 2OTVA 4R0IA 3RMOH 2WPLS 1N8OC 2AGGX 1MH0A 2P3UB 1WV7H 1P11E 1KTSB 3IG6B 1P8VC 1QQUA 1HB0B 2J4IA 4X1QU 1C1SA 3GCOA 3Q00A 4K3JA 4Z0KA 1O3OA 3TJOA 3GY5A 1SOTA 2P16A 2QN5T 2FOGA 2OCVB 2W6JD 3SU0A 3VXFH 1GI1A 4HG6A 4KTSA 4RN6A 1XUKA 4K2YA 2GZ8A 2ODPA 1XXDA 3RC5A 3SUGA 4A1VA 2ANKH 3B8JA 2XCNA 4FU8A 1ZRKA 4Y7BA 4I7YH 4BAKB 1TE0A 1NY22 1T8NA 2FOHA 3EAJA 1V2VT 4MPXA 1OYTH 5HKKD 3DSGA 3MOCA 5LGOA 1NS3A 1K1IA 4NFEA 1LHFH 1OX1A 1WTHD 2IJD1 5CE1A 2CV3A 3A87A 1VZQH 1THPB 2FOAA 2J97A 2SNVA 1GMHG 3PO1C 3TNSA 1GJBB 1GGDC 1UTNA 4A92A 2QXJA 5HGGA 3U9AH 4Y0ZE 2ZU1A 3SU1A 1QA0A 5ESTE 3ZZ5A 1SVPA 2V3HH 3SZEA 3VB4A 3S9BA 3O8BA 4X2WA 1VITH 2YMSB 2Z9LA 1OOKB 3SUEA 1C1VH 1BDAA 1GJDB 1W7XH 4TPYA 4R8TB 3U1JB 4B6EA 2VU8E 2ZG0H 1Q2WA 5DP4A 3JZ2B 1ELTA 2ZDKA 3UAIC 1GJ6A 3TK5A 1EAIA 3T25A 3RXKA 1ANEA 1EQ9A 3TGIE 1WUNH 2GT8A 3KYFA 2BYAX 3S7KB 5LPRA 3U8TH 1ZPBA 2JETC 3E3TA 4IN2A 3N99A 8LPRA 2J98B 1T32A 1AHTH 1ZHRA 2Q6GA 2F9NA 1HNEE 2CHAC 3U69H 4CRBA 2AIPA 1KY9A 3RXRA 4ABJA 4MDSA 1AFEH 1UK4A 1HFDA 3M36A 5C20A 1LVBA 1CA0B 1BBRK 2H6MA 1OP2A 2AS9A 4UD9H 1ZTJA 2PGBB 2IOTA 3CS0A 1TMUH 3TK6A 2BX3A 2FMJA 3ZZ6A 3UNQA 2J34A 3QZQA 3OY6U 1NESE 1QJ6B 2ULLA 5A09A 1PPBH 1GBDA 2W26A 4FUBA 1TNHA 3EA8A 1KXDA 3LT3A 1A5IA 1M9UA 3ZVFA 2GGVB 5DP9A 1OP8A 1A3EH 1LPGB 1GCDA 1O3KA 2WPIS 1C2LA 4Y10E 1KTTB 1W13U 3OX7U 1Y5UT 1EPTB 1O5CB 4BAQB 4JZDH 2HWLB 1DANH 1QL8A 4NIXA 1BOQA 4DW2U 1GHAF 1FQ3A 1KDQB 2OP9A 2Q6DA 3DUXH 1O5AB 1P06A 3UQVA 3RM0H 1EZXC 4X2YA 5IDKA 3FP8E 5DP8A 4QT8C 1LO6A 1INCA 2D26C 2H5CA 3ZV9A 5FHTA 4YM9A 4WY3A 5DO4H 4B2BA 1GWAA 1RJXB 1ARCA 3VB5A 4AB9A 2YMSD 1LCYA 2ZHDA 2BVXH 5FX5A 5J4SA 2BM2A 2K0QA 2ZA5A 2UUKB 3ZVDA 1GBCA 1FY8E 1WYKA 3A8CA 3A88A 1XKBC 2P3FH 4LZ1H 4YOIA 1AQ7A 1YBWA 2SGEE 3KQEA 4ZUHA 1H8IH 1IQIA 3WY8A 1O5BB 1HUTH 4TYDA 1EKBB 1NZQH 4CH2B 1QJ1B 3QX5H 1HV7A 2G51A 1EP5A 4OS2A 3W95A 5HXFA 1HAXB 2ZZUH 4J1YA 3MYWA 1GMDG 2O8UA 2PKAB 4KELA 2WV5A 3QGJA 3HGNA 1OP0A 3C27B 1SGNE 2ANWA 3AAVA 5E0HA 3FAOA 1W0KD 5CMXH 3ESTA 1TPAE 5ESBA 3MTYA 1MTUA 1XUGA 2GVFA 4UFFH 1HAPH 2GZ9A 1K2I1 4CRFA 1P12E 5AVDA 1YLCA 5CHBA 2FIRH 3SV8A 3CENA 3RXVA 2FEQH 4B73A 1S82A 1G3CA 1Y3YA 1GI8B 3SGAE 2VWOA 2QA9E 1K22H 1QBOA 1MTNB 1NFUA 1SHHB 5A0AE 1LVYA 2SGDE 2EI8A 2ZHFH 2SFAA 2A45B 3RXDA 4IN1A 3ZZCA 3MI4A 3W94A 3SUDA 4Y6DA 1RFNA 1BMMH 1V2JT 4E7RG 4I8HA 1QIXB 1ZSKA 2VB0A 2XBXA 1LPZB 1HAIH 4O03A 2AERH 1BHXB 3VXEH 4X8TH 4OS7A 3Q3YA 2FOCA 1UHBB 1ZTLA 1F5RA 3FO8D 4TWWA 1EAUA 3A8DA 1T8MA 1KIGH 4E05H 2O8TA 2Q6FA 2TGDA 3B23B 3OY5U 2AMPA 1QB6A 3D23A 3OSYA 4B2AA 3BEFB 2A0QB 2G8TA 1TGNA 2H1UA 3O8RA 2GCHF 1C9PA 1RTFB 1XUJA 1TQ7B 1KXFA 4TT3D 1F0SA 3DSPA 3ZZ3A 3S69A 1ARBA 1IQGA 1BJVA 1PPCE 1C4Y2 4GHTA 3ZZ9A 2VIVA 2YNAA 1YY3A 4MPWA 1MABB 1C2GA 3QTOH 3RM2H 3RXPA 1ZLRA 1UCYK 1W11U 1LQDB 7KMEH 2SGQE 2K1QA 1N6YA 2QC2A 2PHBA 1CSOE 3BIUH 3VG8A 1IHSH 4I8JA 2F83A 2I6QA 4XBDA 2CK3D 4WWYA 1O2IA 1AWFH 1EXFA 3DFJA 1C1MA 1Z7KA 4F4OC 3R0FA 3K65B 1O2VA 1DWBH 1GI4A 1GHBG 5JPMH 2M2AA 3NWUA 2OC0A 4I8GA 1EPTC 2G55A 2FLRH 1SB1H 1GBHA 4DVAU 2GDEH 2P95A 1Z8GA 3BTME 2UWLA 3U1IB 4IS5A 2ZGHA 1A0LA 4XSKU 2ZU5A 4FVDA 3SQHE 1ANCA 2VIOA 3AAUA 4WMFA 1S6LA 1NBME 4M7GA 1DLEA 1O2WA 1FN8A 2V0BA 1MD8A 2CF9H 3MQKC 2ZDNA 1BTYA 3HGPA 4ISOA 1GBJA 2Z9JA 3MO3A 1SR5C 4AYVB 2K8IA 4GHQA 4JZ1A 3ZZ8A 3DCLA 1J9CH 4K60A 2V35A 1E36B 3OYPA 2H9EH 1BTWA 4MPUA 3UWJH 2ZFQH 5DP5A 4AFQA 4SGBE 2FTMA 5K7RA 3SU5A 1QHRB 1Z1IA 2R9PA 1TNJA 1IOEA 2P8OB 1L4DA 1C5WB 1OWDA 4ZCNA 3PRDA 2HOBA 3QTVH 2O8MA 3PROA 2OUAA 3GYLB 1HIAB 3ZYDA 5LH8A 3ZZBA 5GJ4B 1ELBA 3A7WA 3A7YA 2EI7A 3K2UA 1KLTA 3M61U 1DWEH 1GBEA 1JRTA 3KIDU 3LC3A 1BMAA 5GCHF 2ODQA 1P10A 2KCPA 1GG6B 5A0CA 1CHOF 5L6NH 2GCHG 1L1GA 2Y82A 1RS0A 2WINI 2J2UA 3I77A 4K8BA 2XNIA 1GCTC 3F9FA 3MH7A 5C94A 1MQ6A 4X6OA 1MTNC 3V0XA 1DFPA 1C5SA 3BTWE 2HPPH 5DPAA 4BTIB 1EOJA 2J95A 3HKJB 2G5NA 1BQYA 1FN6A 1O2NA 5HYOA 2F91A 3Q3XA 1C1NA 3ZZDA 1UHBA 2R3UA 3FN8A 4CHAB 4CBNA 1EZSC 4RT1A 1SGQE 4ZMAH 2F9VA 1HXFH 1ABIH 4ISIH 1D6RA 1TRYA 2ZCLP 5E8EH 4BAHB 2XWAA 3QGNB 1L1NA 3RXCA 1IAUA 8GCHG 1GHYH 1GVLA 1TPPA 1GJ5H 1ZJDA 1P2KA 1RIWB 3SJKA 3IITA 4U01A 3SJIA 2V3OH 1ZMLA 3PYHA 1AUTC 1L1JA 1AO5A 1GBLA 1O2QA 4AFZA 4ABFA 1FY3A 3M5LA 1GI2A 2VJ1A 4GUXA 2VIQA 5EOKA 1UTKA 3RXBA 1GJ8B 2FDAA 1O30A 1YM0A 3H7TA 1QY6A 3KQCA 1AIXH 1W14U 3A84A 5BPEA 1O3BA 2LNCA 4BXWA 4D9RA 4F48B 3KL6A 1YLDA 4DT4A 5CHAC 4AN7A 3ATKA 2Z9IA 1C5VA 1ZJKA 2I6SA 1AE8H 3RXLA 1EZQA 5F8TA 3UWIA 5DP7A 1DXPA 1F0UA 1O3MA 2OQUA 5EIYA 1UTPA 2JH0D 1TNLA 1HBTH 4KTUA 2PKSC 4H42U 2BQWB 2G00A 3VGCB 2AGEX 5T3HA 2HVYB 1WSSH 5IK2D 3KQ5A 3MFJA 4FUJA 3VFEA 5F6MA 3PLPA 5GWZA 2ZTYA 2PLXA 1LHGH 3E0NB 3ZVBA 2GJGA 3RMMH 1O39A 1VJ9U 3RXUA 3U28C 3GDUA 4THNH 1MZDA 1HAOH 3A81A 4GCHG 1EOLA 3HK3B 1NFWA 1FJSA 1CHOG 4NZLA 1MTVA 1ZSJA 3SOSA 1EB1H 3RC4A 1NRSH 2QXIA 3BG4B 1FPHH 2EC9H 5C2ZA 3SO3A 3BTDE 4YTAA 1K1LA 4TWYA 3OEED 4D7FA 5HM9A 1WAYB 1JIRA 1ZYOA 1AB9B 5JDUB 3TJVA 1O34A 1AWHB 4IW4E 3SBKA 1GPZA 1W7GH 1J17T 3M7TA 2Y5HA 2F9OA 1P2MA 2IPHA 5K0HA 1C4U2 1NU7B 3T2NA 2F4LA 2NU4E 2O9QA 5L2ZH 1IHTH 3LH3A 4K69A 1ACBE 1H8DH 2P8OC 4NIVA 1S83A 2GCTB 3ATMA 3NRLA 5FBEA 2W3KA 1EUFA 1FAKH 4BTUB 2H9TH 2J92A 2NU3E 2ZCKP 4M9FA 1AVXA 1BMLA 1YLNA 4YLQH 2TGAA 3RXFA 1V3XA 1LHDH 3MH6A 1S85A 5GPIB 4ZXXH 5T6FA 1H9HE 1U6QA 4UE7H 5EJLA 2STAE 1XM1A 2BD9A 3GDSA 3RU4D 4D9QA 1AZZA 4ABIA 1T8OA 1LDTT 2ZWLH 3T28A 3GCNA 5JYIA 4YXWD 1DDJA 1IQJA 1F0RA 2VIDA 1W0JD 2THFB 2UUFB 2Q1JA 4ISHH 5C3NA 3SZNA 1TYNA 3QZRA 3UFAA 4DOQA 1K0HA 1J14A 3RC6A 3CP7A 4UEHH 3UNSA 2PSYA 5GIBA 2B0FA 4Y8ZA 2W7SA 2RDEA 3MU1A 2ZFSA 2ZI2H 3I29A 1GI9B 1C5RA 2OBQA 3STIA 1IQNA 5EQQA 1NFYA 5AFYH 3RXOA 4ZHMU 5C5NA 1E1QD 5DGJA 1PQ5A 3JZ1B 3MMGA 3S7HB 2PV9B 2RA3A 1TQ0B 3OEHD 2AMQA 1ZOMA 1TX6A 1S84A 2B8OH 1ETSH 3D62A 4A7IB 1RIWC 1P0SH 5ABWA 4A5TS 1LKBA 2C93B 3WW7A 1Z8RA 2GV6A 2EA3A 1FI8A 1E38B 4MNWA 4DG4A 3VB7A 2SGPE 1UMAH 5F8ZA 5IYTA 1ZMNA 1GMDF 1TGCA 3ZZ4A 1C1PA 3RXMA 1O3PB 2PGQB 1P05A 2A4QA 3TK9A 5C67A 1SGYE 1W2KH 1V2KT 1IQMA 1G32B 4DIIH 2ZFTA 1XVMA 3UTUH 1MCTA 1BZXE 1W10U 2A5KA 3P8NA 4FUEA 4Y71A 1G3DA 2VWMA 1C5MD 1WU1A 3F2GA 3SU4A 3TGKE 3SJ9A 4MG3A 3FANA 1PQ7A 4CR5A 3OTPA 5FCKA 1WXRA 5JBAS 4D76A 2ZQ2A 1IQHA 1LHCH 1K21H 1GDUA 1UO6A 5GXPA 3PMHB 2XOKD 1FIWA 1TWXB 1CGHA 4UFGH 1SGCA 1TGTA 5A0BA 1C4V2 3A82A 1AUJA 3H5CB 1DUAA 3SUFA 1BITA 3UUZA 1ORFA 3BSQA 2PTNA 2OBOA 1GJ7B 3NUMA 1O37A 1Z6EA 2OQ5A 2BDCA 2F3CE 2WPDD 1DS2E 1HJAC 3A7TA 3P8GA 1CBWB 2P94A 2UUYA 4BAOB 1OWEA 2HNTC 1W12U 3A8BA 2ZGCA 5TCCA 1O3EA 5C1UA 2VGCC 1HCGA 3DA9B 1C5ZB 1O2SA 2P93A 1OWHA 1A2CH 1QURH 2Z6BD 4P02A 2BDHA 2TIOA 5FPTA 1ZGIA 1QFKH 4YESB 1CT2E 1E1RD 3NXPA 1DUEA 1BTZA 3ATLA 1F5LA 5GNDA 2FS9A 1QBNA 3T27A 1YKTA 3B9FH 3RXTA 4MNXA 3SHCH 4I8KA 1C1OA 2GCTC 3E90B 3FFGA 2TPIZ 1BHXF 2KCOA 5LPFA 3H7OA 4K8YA 2C4FH 1YPGH 1YPMH 3SI3H 3OE7D 2GZ7A 2C8WB 3BTEE 4DIHH 2QE7D 5EJZA 1K1MA 2BLOA 1VGCC 3S0NA 4AGJA 1TLDA 3Q77A 4JYVH 4XBCA 2ZKSA 2VH6A 3Q3KA 1VCPA 3TU7H 3E0PB 1FZZA 4ABBA 3LIWA 1RD3B 1GHBF 2FESH 3RXJA 3PTBA 1DT2A 1O2JA 1LKAA 3I78A 3L3TA 1AD8H 1TOCB 1GMCG 1BRUP 1TIOA 4XRNA 1NT1A 1EAWA 1FPCH 3T26A 4BXSA 1Q31A 4HZHA 1PPZA 1V2LT 2Z3DA 1J15A 2ZU3A 6ESTA 1GHXH 1A0JA 2IPQX 3G01A 2QCYA 1DLKB 2FOFA 3PM3A 4XD7D 2HGTH 1W3CA 1FNIA 2V3MA 4IMZA 4ACBA 5E0GA 1SBWA 2W3IA 2HVXA 3O8CA 1GBIA 2ZTXA 5EQRA 4XBBA 1G2LA 1LTOA 2A7CA 5T6GA 1V2OT 4Q63A 3F68H 2V6NA 4DT7B 5JBTA 1T7CA 2D8WA 4TPIZ 1WQVH 1SKYE 1QCPA 3F0OA 3NKKA 3TNTA 1QZ8A 3UREA 1SFQB 1UVUH 1AI8H 1Y59T 1F7ZA 2YMSC 1SLUB 2OK5A 4WF8A 2BDYA 2LPRA 1Z71A 2V7QD 4K1SA 3NPSA 2A5IA 1UVSH 1X7AC 1RRKA 2TGTA 1HDTH 3SN8A 1GI7B 2F9UA 1MU6B 1GHVH 3ITIA 2Z3CA 4CBOA 3TPIZ 4K1EA 4Y0YE 1QRWA 1A46H 2GP9B 1FONA 2UWOA 1YC0A 3E16B 1SQRA 3BTGE 1CT4E 2ZHEH 3ENSB 1C2FA 4MPVA 2PWXA 3LGWA 4ABDA 4B2CA 2WZQA 1D3TB 1E79D 1O5DH 3KCGH 4LXBH 1P02A 3LGVA 1O32A 3ZVEA 3SYJA 1FLEE 1UW7A 1O5EH 2G5VA 3DHKH 1KLJH 2OD3B 3RLYH 1HYLA 1COWD 1PJPA 4ISLA 2CMYA 1ANBA 1NRRH 3ODDA 3LDXH 2XBWA 4X1PU 5C0TA 1CA0C 2OXSA 4CH8B 4NA7A 2UWPA 2QV1A 2FOMB 2QY0B 3S9AA 3OTJE 2FM2A 4U30A 4XFQA 3LU9B 4ZAEA 4NSVA 3RMLH 4DJZB 1CBWC 1IQEA 1QGFA 3CNRA 2BXTH 1NRNH 1MKXH 1LVOA 1EAXA 2DUCA 8GCHF 1OWJA 1Y5BT 2W6ID 3LOXA 3PMJA 1THSH 4AG2A 1SC8U 3M7QA 3STJA 1KXAA 2JH6D 1YPKH 2TRMA 5C5OA 5T6DA 1SGDE 3SV9A 1O2KA 1UK2A 4Y8XA 2SGAA 5HIYA 1JOUB 3TVJB 2OLGA 2BDAA 2AGIX 1D3QB 1DM4B 2ZO3H 3ATIA 3PMAB 4NWKA 1ESTA 3VPKA 1C2KA 1O2XA 4OS4A 4UFEH 2EY4C 2CF8H 4MNVA 1PPHE 3NCLA 4X8SH 3V3MA 3SHAH 4AGKA 1WCZA 1GJ9B 1H9LB 2C90B 1BRBE 1OYQA 2VWLA 4XDEA 1XMNB 3F9EA 3FOAA 3MNSA 1ZGVA 1WDIA 3TIUA 1O3AA 1HGTH 1SGIB 2ALPA 3M5OA 4AFUA 7LPRA 1SPJA 3MU4A 1GBBA 2A4GA 2BLWA 3D49H 4Y79A 1AKSA 3M3SA 1F5KU 2GDDA 5DP3A 4RSPA 4AOQA 2BLQA 1WTGH 1V2NT 2GMTB 2H5DA 1GVZA 1KSNA 4HGCA 1P2JA 1DSUA 4IC6A 1C5TA 3EA9A 3P92A 2BDBA 1GHWH 5EW1H 1HAVB 2WPKS 5FL7D 1H4WA 3FP6E 3FZDA 2Y80A 1S6FA 1L2EA 3LJJA 4A1XA 1BIOA 1FXYA 2BD2A 4GCHF 3VB6A 1Q3XA 1G9IE 2CXVA 2GD4B 1GBAA 3ELAH 2ZTZA 1TBZH 2BMGB 3T62A 4X8UH 4FOUC 2VIWA 3PLKA 2BY5X 1PFXC 2WPMS 1O38A 1P3CA 1XUHA 1DX5M 2C8XB 5LPEA 4GAWA 3HPTB 3D65E 3R3GB 1B7XB 1XUIA 2WUCA 1HJ9A 2YNBA 4Z1MD 1UVTH 4MTBA 4H6SB 1VCQA 3ZV8A 4AYYB 6CHAB 4DGJA 4I86A 5FCRA 1SFIA 1T8LA 2QGRA 3TLOA 1ANDA 3TJUA 1NN6A 5TCAA 4AZ2B 3ZVAA 1YPEH 4GLYA 3K9XB 1N8OB 2FOEA 2VIPA 2PFEA 2BDGA 1C2EA 4INLA 3A7VA 5HMAA 9ESTA 1CGIE 2XBVA 4E7NA 3RDZA 1O2HA 2D2DA 2KR7A 3ZVCA 2FYQA 4Q7YA 4MNYA 3MU0A 2VVCA 4ISNA 1V2QT 3AW1A 1O3NA 3UQOA 2HNTF 2ZDLA 1ZZZA 1CHGA 4Y7AA 1UTOA 3U8OH 1WOFA 2RCEA 1VCWA 3MO9A 5DJ7A 2UUJB 4YT7H 1TRMA 2XW9A 1C5OH 3W1EA 1JRSA 1SLVB 1DY9A 3AW0A 5I46H 3TGJE 1HLTH 1QTFA 3KGPA 1B0FA 7ESTE 1PQAA 2G81E 3VB3A 5C1YA 1QB9A 1J8AA 1W8BH 1Y3XA 1G3EA 3LGUA 4GSOA 1Y8TA 1ELDE 4NG9H 4WH6A 3GISB 4JK5A 1D3DB 1LPKB 2Z94A 1C5XB 5A8ZA 2WV9A 3BF6H 3PO1B 1ELAA 4E06H 3A80A 2R3YA 1GI5A 1MKWH 2BY9X 1C1RA 1Z1JA 4OS6A 4BTTB 3PB1E 3SNDA 4FUHA 1GHZA 1SGFA 1ZHPA 1DWDH 4B1TA 4Q2KA 1GJCB 8ESTE 2M5TA 1DE7H 4NFFA 1CU1A 1P2OA 2ZQ1A 1T4VH 3BN9A 3PWCA 1EX3A 2OINA 5L30H 5C1XA 2PSXA 3V12A 1P04A 4OS5A 3SV7A 3U8RH 1QL9A 1RTLA 2R0KA 2XNDD 5EW2H 4AX9H 2Y6TA 1MTWA 2Y5GA 1TOMH 4ACAA 1NU9A 1CGJE 2ZDMA 3AVZA 3T29A 1QNJA 2ZU2A 2CGAA 1E37B 1V2UT 2JETB 4H6TA 5AHGH 7GCHG 1SMFE 2C3SA 4Q80A 3GDVA 4O3UA 2ANYA 1YF4A 2CJIA 2F43B 2WYJA 4HTCH 2HPQH 3MH4A 1V2RT 4K1TA 1YPJH 2FWWA 2CHAB 2KCAA 1LMWB 4INHA 2XC0A 3SNEA 3BV9B 1AVGH 1SQOA 4H4FA 1C5QA 3RXHA 3C1KA 1OWIA 3EE0B 3EA7A 1MKWK 2O8WA 2ZEBA 1Y3WA 3URCA 2VVUA 1AY6H 4WJG2 4YOJA 1VJAU 1TABE 1YWUA 3P8FA 2Y81A 4X2VA 2H2ZA 5JBCS 1LVMA 3TITA 1DOJA 1THRH 3PWBA 2BY7X 4JCNA 1P2IA 1C5LH 3LGTA 2ZC9H 1WQSA 1SI5H 1NROH 1CT0E 1TFXA 1RXPA 4DURA 4WVPE 1O3JA 2AIQA 3GY2A 2ZF0H 1A0HB 3OU0A 3KHVA 5EQSA 2AHME 3WWBA 3RP2A 1HAVA 4CRDA 1C2HA 3EE7A 3F6UH 1CE5A 6LPRA 1NM6A 2WYGA 1C5PA 1ZMJA 5L2YH 1LQEA 1F2SE 1FY5A 1TRNA 2BX4A 1AN1E 3PMBB 4RT0A 3F9HA 3H09A 3RXEA 1BUIA 3N7DA 1AVWA 3F1SB 1ID5H 3GCTG 1OXGA 1PPEE 1V2WT 2QF3A 3P70B 4GPGA 3SNBA 4F49A 3SQEE 2WPJS 2FI3E 1T31A 2QF0A 1Z8JB 2BDIA 1TAWA 1QB1A 4AB8A 1GG6C 1BCUH 4JYTA 3URDA 2QXGA 2KAIA 1TA6A 5TJXA 3RU4E 5DP6A 1DVAH 2F9PA 3O8DA 4CREA 2ZDAH 3GY4A 4HI3A 1O3CA 4FUGA 2ZFPH 4Y8YA 2B5TB 2JH5D 2BOKA 3L6PA 4WXVA 2JDID 4ZH8A 1V2PT 1VITG 1ELVA 4B71A 1N1LA 4AG1A 1TA2A 2NU1E 1SSXA 1C5YB 2A5AA 2RA0A 2ZGJA 1MMJN 3E6PH 3M37A 1E0FD 1C5NH 2EI6A 3LPRA 4CHAC 6GCHG 3RXAA 3BTTE 3WWFA 1ZRBA 3PV5A 1KXBA 1MD7A 1ELGA 1L0ZA 1EFRD 2BD3A 2A32A 4KP0A 1G30B 1MBQA 2HLDD 1P09A 1S81A 4BAMB 1TNIA 2HNTE 3GICB 3ODFA 1XXFA 2FP7B 3M5NA 3A86A 4P00A 3K6ZA 4OGXA 1O3LA 1O2MA 2P3TB 1AGJA 1LHEH 2BD8A 1P01A 2BB4A 1Y5AT 1S0QA 2NWNA 3SGBE 1DXWA 1EJMA 1AFQB 4X8VH 1BBRE 5DSFA 1KXCA 1O2TA 1YCPM 3Q76A 2FOBA 2F9BH 2XYAA 1BJUA 2BY8X 1B5GH 1GMCF 1YPHC 2BVRH 4O97A 1P57B 3MH5A 4Q4LA 3DFLA 4WH8A 3TH2H 2WV4A 1GI6A 3L33A 1BRCE 4XOJA 3TH3H 4RKOB 1BBRH 3HATH 1QRZA 1HPGA 4FUIA 2ILNA 2AEIH 4LOYH 2AMDA 2DE8A 4X6NA 1XKAC 4WMDA 4X1SU 4U32A 2ALVA 4NZQA 1KXEA 4XE4A 4YLUA 3QN7A 3E91A 2B9LA 1SQTA 1Z6JH 5GDSH 3KYGA 1D3PB 3BTHE 3HKIB 2QXHA 3OAAD 3EYDA 3CS7A 4B74A 4DCDA 3SV6A 1H9IE 3GY6A 3NK8A 2GV7A 4RI0A 2ZHQH 3GY3A 3SNCA 3A85A 3VGCC 4X6PA 1H8HD 5FX6A 3SJ8A 4NA9H 3SU2A 5JB9S 2A31A 3ZVGA 1F0TA 2C8YB 1HAYB 4OM9A 1JMOH 3F9GA 1O2ZA 9LPRA 4FUFA 4WXIA 4NA8A 2GT7A 1E34B 1NRQH 4JMYA 4NCYA 4MQAA 1TALA 2ZPQA 2FLBH 1A7SA 2Y5FA 4J2YB 1IQKA 1GL1A 1UTLM 3TJNA 1C5UA 3P95A 1PQ8A 2ZDVH 4ZXYH 3BG4C 3F2FA 3MHWU 4AC9A 5PTPA 1AE5A 1O3DA 2KZ4A 1QR3E 4ZHAA 1NO9H 1AB9C 5DN6D 3QUMP 1OHHD 3A7ZA 5ETXA 1FV9A 1IQLA 2BZAA 4FVBA 3GCHB 1TNGA 3GYMA 1SGTA 1C1TA 2FI4E 3SV2H 4ZKOU 4ZKSU 2A1DB 4ABEA 4CR9A 5JBBS 3SORA 4CRCA 3EGKH 4AFSA 2C8ZB 5AF9H 4ABGA 4D8NA 1BB0B 3A8AA 3E8LA 1YPLH 2BXUH 5J4QA 4O3TA 3KQDA 2VNTA 1V2ST 2ASUB 2D1JA 4MLFB 2R2WU 1MCVA 2NU2E 2WUBA 5BRRE 1ELEE 3MU8A 3RXGA 2FODA 2B7DH 1DWCH 1FMGA 1JIMA 3GOVB 2P59A 2L74A 1OS8A 4Y76A 2BLVA 1E35B 2J9NA 3QWCH 2BD7A 2PUXB 3QO6A 1AKSB 4I8LA 1SLXB 4K5ZA 3UR9A 1BRAA 2FI5E 3RMNH 2GTBA 4FETA 1SLWB 1EASA 1UVPA 4YZUA 1UK3A 1HAGE 3A83A 4KGAA 4Y11E 2W7UA 4FUDA 2H9HA 1P3EA 4JYUH 4X1RU 5DG6A 2O8LA 5F03A 1C2MA 4NWLA 1QJ7B 1O2PA 1FX0B 3SGQE 2EQNA 2VVVA 1C2DA 4GVUA 1O31A 1WBGB 1HAHH 4VGCB 5HIZA 4FU7A 2J5UA 1H1BA 3QLPH 1O35A 2A2XH 1AMHA 2BHGA 3BIVH 4ASUD 1EB2A 1K1OA 1BT7A 2FYRA 2OC8A 3M5MA 4JZFH 3FKSD 1O3IA 1TB6H 3BEIB 5SGAE 3EQ0H 1UJ1A 1SGRE 4B75A 2KX4A 2Z9KA 5FXLA 1Y3VA 2JJ1D 2PR3A 1C2IA 2VH0A 1P2NA 2AFQB 1AFQC 4HFPB 3KNXA 1TMTH 1SGPE 4ASHA 1GCTB 2JKHA 1A5GH 1QQ4A 2QYIA 2FX4A 2HALA 1O3FA 2J38A 2ZCHP 4TY7A 5C0UA 4JK6A 3GS9A 1UCYE 1ETTH 3OFND 1V2MT 1FDPA 2PUQH 4TY6A 1ELCA 2ZFFH 1GL0E 1TNKA 2BD5A 2SGFE 5EG4A 3GY7A 1K9OE 4IGDA 1TMBH 1C1WH 1EJAA 1ZSLA 2JJ2D 4BANB 3P6ZB 1C1UH 5C17A 2A2QH 2FXRA 3FP7E 1EP6A 2STBE 4UDWH 1UCYH 4DY7B 1MTSA 5FPSA
chains in the Genus database with same CATH topology
1P9UA 4YOGA 8KME2 2W5EA 2GKVE 1VR1H 3BTFE 1ZPZA 4X0WU 3K6YA 3SJOA 5T1VA 1DICA 1TPOA 3MNCA 2A7JA 2ZPRA 2ZNKH 4ZROA 3ATWA 4FUCA 5FAHA 1C9TA 1GI0A 3SI4H 1DPOA 2ZFRH 2VBCA 1GHAG 1ELFA 2XTTB 5E2PA 2BD4A 1QBVH 1A4WH 2ZU4A 1SG8B 2BQ7B 1BTUA 2ZHWH 4U2WA 3EDXB 2WPHS 2KFWA 1UTJA 1UTQA 1UVOA 1PYTD 3UPEA 1DY8A 1F92A 2GX4A 2J94A 5F8XA 4AORA 5CHAB 1T4UH 4WMEA 3MWIU 1MU8B 1O2GH 1EJNA 1OKXA 2QF4A 1HAZB 5JB8S 1SGEE 4Z6AH 3GCHC 1PPGE 1P03A 5AFZH 1V2TT 2R0LA 1D9IA 1UTMA 3F0PA 1K28D 1MUEB 2XC5A 2HRVA 1GBMA 1J16A 3UOPA 2A7HA 1EPTA 3UY9A 3UNRA 2KM0A 2PKSB 4X6MA 1KDQA 4KKDA 3UR6A 2JIZD 4A6LA 2PW8H 2ZGXH 1BTPA 2XWBI 4ABHA 4PROA 1SQAA 1GJAB 2CN0H 4OS1A 2PTCE 3KF2A 2XC4A 1MKXK 4NGAH 2WHXA 4I31A 1SGFG 1C2JA 1GDQA 1MBMA 3LC5A 3ZZAA 4BNRA 1QA7A 3ZYEA 2AH4X 2R2MB 1NBMD 1EZUC 1QRXA 1S5SA 1GDNA 3LGYA 3KN2A 7GCHF 4IMQA 3FVFB 3LJOA 3ZIAD 2ZECA 1W0YH 1K1JA 1KLIH 4X1NU 2BQ6B 4MVNA 2OC1A 1KYNA 1GBKA 1FIZA 1O2OA 3M35A 1CVWH 2PKAA 1YCPH 4OGYA 1B0EA 1PYTC 1CO7E 3M7UA 5B6OA 2Y7ZA 2G4UA 1ESAA 2ZP0H 3TH4H 1TGSZ 4VGCC 1TPSA 4ZHLU 1BMFD 2TBSA 1RGQA 4B76A 1BTXA 1MZAA 1O33A 3P17H 4A1TA 1Z8IB 2BOHB 2BTCE 1TGBA 2KAIB 3VEQB 4Q7ZA 1NC6A 1FUJA 1FAXA 2AYWA 4O9VA 1OSSA 4RKJB 2FS8A 1GI3A 1O0DH 3BTQE 3BEUA 3RLWH 1O2RA 1XUFA 3PTNA 4CRAA 1YGCH 1TONA 4FXGH 2BZ6H 3V13A 3RXSA 1SOZA 2IN2A 4CRGA 5EODA 4TSFD 3LH1A 1ABJH 1C1QA 2YOLA 4UFDH 3PRBA 3SU6A 1CA8B 4NIWA 2BY6X 3GCTF 3A89A 1NFXA 2NU0E 2XCFA 1SHYA 1YCPK 5A2MH 1HXEH 1S0RA 1A1RA 1TX7A 2FX6A 5EXMA 1YYY1 1S6HA 3T5FH 5EGMA 2FZZA 3RXIA 3MNXA 2G52A 1L4ZA 1O2UA 1QL7A 1EATA 1MAYA 5EU8A 3BTKE 4ZKNU 2BVSH 1JXPA 5FBIA 1W0ZU 2FO9A 4IBLH 1VITF 3LONA 2IJOB 3N7OA 5DK1A 4I33A 4ABAA 3IWMA 3UB0A 4ESTE 3LGIA 1GGDB 3GY8A 2OC7A 1BA8B 4INKA 4UONA 1TX8A 3QDZB 3MU5A 6GCHF 5H4IB 1DSTA 4SGAE 4NIYA 1G2MA 5EXNA 3S9CA 2QF5A 4JZEH 4B6FA 1K1PA 4ZKRU 1FY4A 5A8XA 1BMNH 4D7GA 1P9SA 5E2OA 1ETRH 1H8ED 5DKMA 4LK4A 3PLBA 5B6LA 3M3TA 3QK1A 1HJ8A 1ZHMA 3RUOA 3P8OA 1O5GH 1HRTH 2ZPSA 4JZIA 1JBUH 3KEEA 2A4RA 3M3VA 1AU8A 2L6OA 2KCYA 3AK5A 1FY1A 3PV4A 3SNAA 1O3GA 2EEKA 2WSSD 4Q7XA 3PV2A 3E1XB 1IQFA 1SL3A 1NRPH 1GMHF 3SU3A 2Y7XA 3MNBA 2ODYB 3N7EA 4YO9A 2XXLA 2QAAA 1O2YA 5E0JA 1RTKA 2ESTE 4LZ4B 1A61H 1A3BH 4KTCA 1N6XA 1BTHH 2SNWA 2VWNA 1G36A 2FPZA 3NZIA 3LKWA 1HJAB 2Z9GA 1O3HA 1ESBA 1D6WA 1JWTA 2RG3A 3RXQA 1ZTKA 2ANMH 2TGPZ 3U98H 1TBQH 4FU9A 4X2XA 5GCHG 1V6DA 4YT6H 4IC5A 3UIRA 1YP9A 2LELA 1Y3UA 2DE9A 2GMTC 1OWKA 5G4BA 2VGCB 5A8YA 1TBRH 1K1NA 2HLCA 2A4OA 3HK6B 3RU4T 5CDFE 2Z7FE 3UOUA 2FTLE 2QIQA 3AASA 3DT0H 1MAXA 5EPYA 3F2HA 1O2LA 1GBTA 1P2QA 3ZZ7A 4BOHA 2VINA 4I32A 1AZ8A 1NTPA 5EXLA 1D4PB 1YPHE 2XRCA 3DSOA 1XX9A 1NPMA 1HIAA 2RDLA 1GBFA 1G3BA 3KQBA 1CQQA 2G4TA 3F3BA 5HM2A 5I25A 5F53A 4NSYA 3DD2H 1PPFE 3FZZA 1O5FH 1KMHB 4F55A 2XBYA 5FPYA 1XVOA 3SW2B 3V7TA 5EPNA 1GVKB 1DITH 1G37A 2ZIQH 2Z3EA 6CHAC 1ZPCA 3MO6A 1VGCB 2ZGBH 1ZR0A 1GJ4H 1A5HA 1MQ5A 3BG8A 1O36A 3A7XA 1OPHB 2OTVA 4R0IA 3RMOH 2WPLS 1N8OC 2AGGX 1MH0A 2P3UB 1WV7H 1P11E 1KTSB 3IG6B 1P8VC 1QQUA 1HB0B 2J4IA 4X1QU 1C1SA 3GCOA 3Q00A 4K3JA 4Z0KA 1O3OA 3TJOA 3GY5A 1SOTA 2P16A 2QN5T 2FOGA 2OCVB 3SU0A 2W6JD 3VXFH 1GI1A 4KTSA 4RN6A 1XUKA 4K2YA 2GZ8A 2ODPA 1XXDA 3RC5A 3SUGA 4A1VA 2ANKH 3B8JA 2XCNA 4FU8A 1ZRKA 4Y7BA 4I7YH 4BAKB 1TE0A 1NY22 1T8NA 2FOHA 3EAJA 1V2VT 4MPXA 1OYTH 5HKKD 3MOCA 5LGOA 1NS3A 1K1IA 4NFEA 1LHFH 1OX1A 1WTHD 2IJD1 5CE1A 2CV3A 3A87A 1VZQH 1THPB 2FOAA 2SNVA 1GMHG 3PO1C 3TNSA 1GJBB 1GGDC 1UTNA 4A92A 2QXJA 5HGGA 3U9AH 4Y0ZE 2ZU1A 3SU1A 1QA0A 5ESTE 3ZZ5A 1SVPA 2V3HH 3SZEA 3VB4A 3S9BA 3O8BA 4X2WA 1VITH 2YMSB 2Z9LA 1OOKB 3SUEA 1C1VH 1BDAA 1GJDB 1W7XH 4TPYA 4R8TB 3U1JB 4B6EA 2VU8E 2ZG0H 1Q2WA 5DP4A 3JZ2B 1ELTA 2ZDKA 1GJ6A 3TK5A 1EAIA 3T25A 3RXKA 1ANEA 1EQ9A 3TGIE 1WUNH 2GT8A 2BYAX 3S7KB 5LPRA 3U8TH 1ZPBA 2JETC 3E3TA 4IN2A 3N99A 8LPRA 1T32A 1AHTH 1ZHRA 2Q6GA 2F9NA 1HNEE 2CHAC 3U69H 4CRBA 2AIPA 1KY9A 3RXRA 4ABJA 4MDSA 1AFEH 1UK4A 1HFDA 3M36A 5C20A 1LVBA 1CA0B 1BBRK 2H6MA 1OP2A 2AS9A 4UD9H 1ZTJA 2PGBB 2IOTA 3CS0A 1TMUH 3TK6A 2BX3A 2FMJA 3ZZ6A 3UNQA 2J34A 3QZQA 3OY6U 1NESE 1QJ6B 2ULLA 5A09A 1PPBH 1GBDA 2W26A 4FUBA 1TNHA 3EA8A 1KXDA 3LT3A 1A5IA 1M9UA 3ZVFA 2GGVB 5DP9A 1OP8A 1A3EH 1LPGB 1GCDA 1O3KA 2WPIS 1C2LA 4Y10E 1KTTB 1W13U 3OX7U 1Y5UT 1EPTB 1O5CB 4BAQB 4JZDH 2HWLB 1DANH 1QL8A 4NIXA 1BOQA 4DW2U 1GHAF 1FQ3A 1KDQB 2OP9A 2Q6DA 3DUXH 1O5AB 1P06A 3UQVA 3RM0H 1EZXC 4X2YA 5IDKA 3FP8E 5DP8A 4QT8C 1LO6A 1INCA 2D26C 2H5CA 3ZV9A 5FHTA 4YM9A 4WY3A 5DO4H 4B2BA 1GWAA 1RJXB 1ARCA 3VB5A 4AB9A 2YMSD 1LCYA 2ZHDA 2BVXH 5FX5A 5J4SA 2BM2A 2K0QA 2ZA5A 2UUKB 3ZVDA 1GBCA 1FY8E 1WYKA 3A8CA 3A88A 1XKBC 2P3FH 4LZ1H 4YOIA 1AQ7A 1YBWA 2SGEE 3KQEA 4ZUHA 1H8IH 1IQIA 3WY8A 1O5BB 1HUTH 4TYDA 1EKBB 1NZQH 4CH2B 1QJ1B 3QX5H 1HV7A 2G51A 1EP5A 4OS2A 3W95A 5HXFA 1HAXB 2ZZUH 4J1YA 3MYWA 1GMDG 2O8UA 2PKAB 4KELA 2WV5A 3QGJA 3HGNA 1OP0A 3C27B 1SGNE 2ANWA 3AAVA 5E0HA 3FAOA 1W0KD 5CMXH 3ESTA 1TPAE 5ESBA 3MTYA 1MTUA 1XUGA 2GVFA 4UFFH 1HAPH 2GZ9A 1K2I1 4CRFA 1P12E 5AVDA 1YLCA 5CHBA 2FIRH 3SV8A 3CENA 3RXVA 2FEQH 4B73A 1S82A 1G3CA 1Y3YA 1GI8B 3SGAE 2VWOA 2QA9E 1K22H 1QBOA 1MTNB 1NFUA 1SHHB 5A0AE 1LVYA 2SGDE 2EI8A 2ZHFH 2SFAA 2A45B 3RXDA 4IN1A 3ZZCA 3MI4A 3W94A 3SUDA 4Y6DA 1RFNA 1BMMH 1V2JT 4E7RG 4I8HA 1QIXB 1ZSKA 2VB0A 2XBXA 1LPZB 1HAIH 4O03A 2AERH 1BHXB 3VXEH 4X8TH 4OS7A 3Q3YA 2FOCA 1UHBB 1ZTLA 1F5RA 3FO8D 4TWWA 1EAUA 3A8DA 1T8MA 1KIGH 4E05H 2O8TA 2Q6FA 2TGDA 3B23B 3OY5U 2AMPA 1QB6A 3D23A 3OSYA 4B2AA 3BEFB 2A0QB 2G8TA 1TGNA 2H1UA 3O8RA 2GCHF 1C9PA 1RTFB 1XUJA 1TQ7B 1KXFA 4TT3D 1F0SA 3DSPA 3ZZ3A 3S69A 1ARBA 1IQGA 1BJVA 1PPCE 1C4Y2 4GHTA 3ZZ9A 2VIVA 2YNAA 4MPWA 1MABB 1C2GA 3QTOH 3RM2H 3RXPA 1ZLRA 1UCYK 1W11U 1LQDB 7KMEH 2SGQE 2K1QA 1N6YA 2QC2A 2PHBA 1CSOE 3BIUH 3VG8A 1IHSH 4I8JA 2F83A 2I6QA 4XBDA 4WWYA 2CK3D 1O2IA 1AWFH 1EXFA 3DFJA 1C1MA 1Z7KA 4F4OC 3R0FA 3K65B 1O2VA 1DWBH 1GI4A 1GHBG 5JPMH 2M2AA 3NWUA 2OC0A 4I8GA 1EPTC 2G55A 2FLRH 1SB1H 1GBHA 4DVAU 2GDEH 2P95A 1Z8GA 3BTME 2UWLA 3U1IB 4IS5A 2ZGHA 1A0LA 4XSKU 2ZU5A 4FVDA 3SQHE 1ANCA 2VIOA 3AAUA 4WMFA 1S6LA 1NBME 4M7GA 1DLEA 1O2WA 1FN8A 2V0BA 1MD8A 2CF9H 2ZDNA 1BTYA 3HGPA 4ISOA 1GBJA 2Z9JA 3MO3A 1SR5C 4AYVB 2K8IA 4GHQA 4JZ1A 3ZZ8A 3DCLA 1J9CH 4K60A 2V35A 1E36B 3OYPA 2H9EH 1BTWA 4MPUA 3UWJH 2ZFQH 5DP5A 4AFQA 4SGBE 2FTMA 5K7RA 3SU5A 1QHRB 1Z1IA 2R9PA 1TNJA 1IOEA 2P8OB 1L4DA 1C5WB 1OWDA 4ZCNA 3PRDA 2HOBA 3QTVH 2O8MA 3PROA 2OUAA 3GYLB 1HIAB 3ZYDA 5LH8A 3ZZBA 5GJ4B 1ELBA 3A7WA 3A7YA 2EI7A 3K2UA 1KLTA 3M61U 1DWEH 1GBEA 1JRTA 3KIDU 3LC3A 1BMAA 5GCHF 2ODQA 1P10A 2KCPA 1GG6B 5A0CA 1CHOF 5L6NH 2GCHG 1L1GA 2Y82A 1RS0A 2WINI 2J2UA 3I77A 4K8BA 2XNIA 1GCTC 3F9FA 3MH7A 1MQ6A 4X6OA 1MTNC 3V0XA 1DFPA 1C5SA 3BTWE 2HPPH 5DPAA 4BTIB 1EOJA 2J95A 3HKJB 2G5NA 1BQYA 1FN6A 1O2NA 5HYOA 2F91A 3Q3XA 1C1NA 3ZZDA 1UHBA 2R3UA 3FN8A 4CHAB 4CBNA 1EZSC 1SGQE 4ZMAH 2F9VA 1HXFH 1ABIH 4ISIH 1D6RA 1TRYA 2ZCLP 5E8EH 4BAHB 2XWAA 3QGNB 1L1NA 3RXCA 1IAUA 8GCHG 1GHYH 1GVLA 1TPPA 1GJ5H 1ZJDA 1P2KA 1RIWB 3SJKA 3IITA 4U01A 3SJIA 2V3OH 1ZMLA 3PYHA 1AUTC 1L1JA 1AO5A 1GBLA 1O2QA 4AFZA 4ABFA 1FY3A 3M5LA 1GI2A 2VJ1A 4GUXA 2VIQA 5EOKA 1UTKA 3RXBA 1GJ8B 2FDAA 1O30A 1YM0A 3H7TA 1QY6A 3KQCA 1AIXH 1W14U 3A84A 5BPEA 1O3BA 2LNCA 4BXWA 4D9RA 3KL6A 1YLDA 4DT4A 5CHAC 4AN7A 3ATKA 2Z9IA 1C5VA 1ZJKA 2I6SA 1AE8H 3RXLA 1EZQA 5F8TA 3UWIA 5DP7A 1DXPA 1F0UA 1O3MA 2OQUA 1UTPA 2JH0D 1TNLA 1HBTH 4KTUA 2PKSC 4H42U 2BQWB 2G00A 3VGCB 2AGEX 5T3HA 1WSSH 5IK2D 3MFJA 4FUJA 3VFEA 5F6MA 3PLPA 5GWZA 2ZTYA 2PLXA 1LHGH 3E0NB 3ZVBA 3RMMH 1O39A 1VJ9U 3RXUA 3GDUA 4THNH 1MZDA 1HAOH 3A81A 4GCHG 1EOLA 3HK3B 1NFWA 1FJSA 1CHOG 4NZLA 1MTVA 1ZSJA 3SOSA 1EB1H 3RC4A 1NRSH 2QXIA 3BG4B 1FPHH 2EC9H 5C2ZA 3SO3A 3BTDE 4YTAA 1K1LA 4TWYA 3OEED 4D7FA 5HM9A 1WAYB 1JIRA 1ZYOA 1AB9B 5JDUB 3TJVA <