2OC0A

Structure of ns3 complexed with a ketoamide inhibitor sch491762
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
181
structure length
181
Chain Sequence
APITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVAKAVDFIPVENLETTMRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Hepatitis C Virus
publication title Discovery of the HCV NS3/4A protease inhibitor (1R,5S)-N-[3-amino-1-(cyclobutylmethyl)-2,3-dioxopropyl]-3- [2(S)-[[[(1,1-dimethylethyl)amino]carbonyl]amino]-3,3-dimethyl-1-oxobutyl]- 6,6-dimethyl-3-azabicyclo[3.1.0]hexan-2(S)-carboxamide (Sch 503034) II. Key steps in structure-based optimization.
pubmed doi rcsb
source organism Hepatitis c virus
total genus 40
structure length 181
sequence length 181
chains with identical sequence C
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2oc0A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2oc0A01
4YLUA 1O2LA 2QCYA 2C8WB 5C1XA 4Q7YA 1AVXA 4MPXA 3S9BA 1VGCC 2TPIZ 3T29A 3PROA 1CGIE 3ZYDA 3O8RA 1ELEE 4OS6A 3U8TH 1AE8H 1S83A 1N8OB 4O9VA 3SGBE 1EZQA 1JBUH 2SGPE 3CENA 2Z3CA 2QXHA 3ODFA 1XKBC 1YP9A 3MHWU 1KXFA 1JXPA 3LKWA 1L1JA 1BA8B 3MFJA 4WMFA 2VIPA 1SGNE 2J92A 5K7RA 2HNTE 1O3DA 1P57B 2FDAA 4IGDA 3MNCA 1OYTH 4AFZA 3Q76A 3U1IB 1O36A 3A8BA 3RXKA 3UQVA 3SZNA 5LPRA 2C4FH 3GY5A 5A8XA 5BPEA 3V3MA 3ATLA 4F49A 3DFJA 4AGKA 4MNYA 5GJ4B 4MVNA 3MYWA 4Y8ZA 3H5CB 4AN7A 4RKJB 2BD2A 1DWDH 2P94A 3ZZ9A 5E8EH 1FI8A 2BX4A 3RU4E 2JETC 1K21H 2Z9KA 4DW2U 4E7RG 2FZZA 1T4VH 1J16A 2GDEH 2J4IA 4KELA 3ZVAA 1O2WA 3RXEA 3RP2A 2R3YA 2Q6GA 3A82A 1C4Y2 5HM2A 2Y5HA 1DLKB 2SFAA 4YZUA 1UTOA 2FS9A 2UUFB 1SMFE 1WQVH 1BQYA 4MDSA 5F8TA 2BHGA 4Q7ZA 2A7JA 1FONA 3PMHB 2FOBA 3SHCH 1GBKA 3QZRA 1T7CA 3A7WA 4WY3A 3FVFB 3P8NA 2A0QB 1V2JT 1SLWB 4FU9A 1HAXB 2TRMA 2GDDA 2IN2A 3ZVDA 3PO1B 3ATWA 3ZVCA 2WUCA 5EPNA 3RXAA 2PTNA 2VWMA 2BY8X 2WPHS 2PGQB 1H8DH 2ANYA 1ZPBA 4NIVA 2HALA 3EYDA 1O38A 2ZWLH 4Y6DA 1GBAA 1GHWH 4WH8A 3BTFE 2NU2E 3UR9A 3MWIU 2ZP0H 3SJKA 1TQ7B 4X2VA 2A5KA 7GCHF 2GVFA 1P12E 1SGEE 4B6FA 1TA2A 2GZ9A 1V2NT 1GI8B 1O5BB 2WHXA 4JK6A 3E91A 4K5ZA 1HIAB 1DITH 3SNDA 1RIWC 1IQJA 1CT2E 3RLYH 1AHTH 1JIRA 3HK3B 1IQGA 4Q2KA 1CT4E 1UO6A 1GJ7B 5IDKA 2VIOA 4PROA 1F0TA 3P8OA 2OC0A 4FUJA 3AK5A 3NKKA 2B7DH 1W8BH 5FHTA 5JDUB 3A7TA 2F9PA 1FPCH 2OTVA 6CHAB 1O2YA 1TABE 1GBDA 1NC6A 2WV5A 1CA0C 1G32B 1O5DH 1SVPA 1MD8A 2GT7A 1LCYA 1QHRB 1O3AA 2QV1A 2FLRH 3TJVA 1BMLA 1GBTA 1MH0A 1ZPCA 4O3TA 1TX7A 5F8ZA 1C5MD 3LGUA 1CHOG 3ENSB 3GYMA 2ZIQH 1P2MA 4D9QA 3BTQE 3RXUA 4BAOB 5EQQA 3B9FH 5CMXH 1CBWC 1EX3A 3GY4A 2C8XB 1TGTA 3UNSA 4NA7A 4H4FA 4OS2A 1BMAA 2A4OA 3M3TA 3MU8A 1SGRE 3LH1A 1PJPA 2ZZUH 3KNXA 2QC2A 1AFEH 3P95A 4UONA 2PKAB 3BSQA 1SHHB 1J9CH 4KTUA 3GY2A 4MG3A 1SFIA 1KXEA 3IG6B 5SGAE 3OSYA 1EZUC 6ESTA 2ZHWH 1P3CA 1J8AA 2ZGCA 5L2YH 1C1SA 3CS0A 2H9EH 1QJ7B 3V12A 1O2OA 1YPMH 1GHXH 2GMTC 1C5OH 2BVRH 3Q3KA 3AW0A 1FUJA 1VCPA 4JYUH 1ABIH 1TNJA 1LPGB 3TVJB 3HKIB 3LIWA 1QL7A 1LHEH 4RSPA 1EAWA 5HYOA 1ABJH 4O3UA 1UTNA 1C2EA 2CV3A 2VWNA 4DIIH 2J2UA 1VGCB 4H6SB 2AIPA 4CRGA 1JRTA 1GDNA 2PUQH 1C5LH 1CHGA 5A0BA 1ELAA 1S82A 1P9UA 2BTCE 3ZVFA 4FUGA 5L2ZH 2EC9H 4NFFA 2HLCA 1SOTA 3S7HB 2G8TA 3H7OA 4BAMB 1ESBA 3BTEE 1F5RA 2SNWA 4CRCA 1C5UA 5ABWA 8GCHG 2VBCA 1MTSA 1QFKH 3K9XB 4AYVB 3ATMA 3NPSA 1V2QT 2V3HH 1T8LA 2HGTH 1O3OA 4M9FA 4Y0ZE 1DWBH 2F9VA 2XBYA 1WAYB 2SGQE 1JWTA 4KGAA 1MTVA 4GAWA 1MKWH 1O2SA 3M7TA 3T62A 1SI5H 1A3BH 1OX1A 5T3HA 1A7SA 1CU1A 3M35A 2JETB 3RXSA 1QCPA 1S84A 3A8CA 3LC5A 2A1DB 1O31A 3TGIE 2FOFA 1D3DB 4FUIA 2B5TB 1F0RA 1L4ZA 1UMAH 1CGHA 3A8AA 1HB0B 2ZCLP 4TY6A 5DPAA 4TWWA 1MCVA 4NSVA 3PWCA 3UY9A 3ZZ4A 3QTVH 1SR5C 1O2UA 2JH5D 1MTNC 1WV7H 4HTCH 1Y5AT 4E7NA 1BDAA 2BMGB 1FNIA 1YPJH 2XC4A 1W7GH 4IMZA 3S7KB 3ZZCA 2OBQA 3IITA 3SORA 3FP7E 1HAZB 1VCWA 1Y59T 3BG8A 4I8LA 1GMDG 4X6OA 1B0FA 5CE1A 3U9AH 5AVDA 1O5AB 3SNBA 2AMPA 1K1OA 1S0QA 4ESTE 2WUBA 4NIYA 2W7SA 1LVOA 1OWJA 3JZ2B 2BY5X 3GDSA 4D7FA 2HNTF 2A4GA 3EDXB 3MH6A 1N8OC 3GCOA 1SQTA 4FU8A 3SYJA 1F5KU 3T26A 1YLDA 4XBDA 1NO9H 1TMTH 1TAWA 3GOVB 3BTDE 1V2MT 2O8TA 1H9HE 2Y7ZA 1GI2A 1ELDE 1IQFA 4FVBA 2ZU2A 3QK1A 1DM4B 3S69A 3TNSA 2AYWA 1S6HA 1O3MA 1TNKA 4ZXXH 1QJ6B 1FMGA 1YPHC 3OY5U 2Y6TA 5FXLA 2G55A 2ZQ1A 1Z1JA 2K1QA 3EA8A 1D3PB 2XXLA 1RIWB 3Q3YA 3L3TA 1OP8A 2BOHB 1CO7E 2XRCA 4JYTA 3ZV9A 1GI9B 3HPTB 5LPEA 1UVOA 1V2OT 1LQDB 1SHYA 1MAYA 2I6QA 1BJUA 2F83A 1CHOF 2G5VA 2W7UA 3U8OH 2GKVE 3BTHE 2BM2A 1FAKH 3STIA 4A7IB 1K1MA 1ESAA 3TIUA 2PKAA 1K2I1 1FIWA 4ZHMU 4LOYH 5C1YA 1QURH 1GHAG 3MH5A 1VZQH 1JIMA 1UK2A 5EXNA 1M9UA 1MKWK 1P04A 1CBWB 1XKAC 1P2IA 2NU0E 1W0YH 1G30B 1SGYE 1TMBH 4YOGA 1Z6JH 3KQBA 1C2HA 1QB9A 3TK6A 3HGNA 1O2ZA 4YT7H 1GDQA 2NU1E 5C3NA 4A1TA 1EPTA 2V0BA 4A5TS 1TB6H 1OWEA 3M61U 1V2VT 2UWPA 4LK4A 3M3SA 2GCHG 2C90B 4U32A 1SGFG 1HNEE 1Z71A 1ZTJA 2ZO3H 1TX6A 1Z1IA 1P01A 3E16B 1C1QA 1C2LA 3D49H 5EQRA 1V6DA 3SNEA 1GCDA 1GVZA 1MU6B 2RA3A 4Z6AH 1E38B 1Q31A 4DIHH 1BIOA 1C1PA 1NTPA 1UTQA 3SOSA 4TWYA 1W0ZU 1GBIA 5DKMA 3QLPH 2AEIH 2HRVA 1ZZZA 2GMTB 4K69A 1GHVH 2FX4A 4UFFH 2AERH 1C5PA 1NU7B 1O5FH 4IC6A 5ESBA 1NESE 1NRPH 4INHA 4B2CA 4ABIA 3SJ9A 4SGAE 4WMEA 1GMCG 1RRKA 4D8NA 1LTOA 1S5SA 3KCGH 1KLTA 4NGAH 1T8MA 3U98H 4AGJA 3ATIA 2FEQH 1K1JA 1A2CH 3BF6H 2OQUA 2XNIA 3AASA 4BTIB 2PKSC 2ZFFH 4YM9A 3BTGE 2ZHFH 2Q1JA 5GDSH 1A0HB 4ZH8A 3RXIA 4Q80A 4X2YA 1OP2A 4BNRA 1KDQA 3Q3XA 3O8CA 1XXFA 2TGAA 3V7TA 1KSNA 1G3DA 1Z7KA 1QY6A 2H5CA 5JBBS 1JOUB 3O8DA 1EAXA 4AOQA 1DY9A 2ZHDA 1AY6H 3FANA 1BJVA 1GPZA 3ZZBA 4DVAU 1GJ9B 2JH6D 4A92A 1QQ4A 1YGCH 2UUKB 4ASHA 3R3GB 4KP0A 2KAIA 3RUOA 1DVAH 1AKSA 3QWCH 2HWLB 1OWHA 5EQSA 4AFUA 1ETSH 2ZDNA 2A32A 3N7OA 2AFQB 1KTTB 1MTUA 5G4BA 5HMAA 5AF9H 4X8VH 3VGCC 3P17H 2ZDLA 2ANKH 1GBFA 5A8YA 2GCTC 3F9FA 5H4IB 3SGQE 3PLPA 1O2TA 1C9PA 2VNTA 1V2TT 1JMOH 3SU2A 1FY1A 1D6WA 1HJAB 1LQEA 3RXVA 3TK5A 7ESTE 1SPJA 2Z9IA 1IQNA 1CA8B 1K1PA 1GL0E 1C1WH 5EXLA 2DE8A 3RDZA 1G36A 1ANEA 1D4PB 2F9NA 3FAOA 2R2WU 1GHZA 3PV4A 1DWCH 1NZQH 1ELFA 5E0GA 5C1UA 1ZSLA 1C1UH 4I32A 3SU6A 1HJ9A 2ANMH 1GJ5H 2IJD1 1EAIA 2TGPZ 1OKXA 5AHGH 1ESTA 2PWXA 1DXPA 1PPCE 2VJ1A 1NY22 1K1LA 2R0KA 3RLWH 3RC6A 2Z3DA 2P3UB 4D7GA 1WYKA 1SQAA 4MPVA 4U01A 1S0RA 3LGTA 1GI6A 4UFDH 4CBNA 2FTMA 5ETXA 1HAIH 1QA7A 3NXPA 1AO5A 2FESH 3ZZDA 4GSOA 1YM0A 3RMLH 1O2GH 4MPUA 1O0DH 1MQ5A 2O8UA 2UWLA 1TOCB 4JZEH 3BTWE 4AFQA 4B75A 2A4QA 2ZGJA 3RM2H 1DY8A 1QA0A 2A4RA 3P8FA 3F68H 5LH8A 1O5CB 1SGIB 1YF4A 4GCHF 1PQAA 3A89A 5F8XA 1TOMH 1Q2WA 3TH2H 1QRWA 1NRQH 3OX7U 1GHAF 3TJUA 5DGJA 1T8OA 1C2KA 1C1TA 1HAVA 2YNBA 2O8MA 5C20A 2Y5FA 1GI0A 3A7YA 2Y80A 3M37A 5GWZA 1GG6C 2QAAA 1WSSH 1PYTC 1TFXA 3NK8A 2BDYA 1O3JA 2PGBB 1OOKB 3QUMP 4NIXA 5EODA 2DUCA 1FN8A 1ZTKA 2STAE 1XMNB 3W94A 2ZGBH 3AAUA 2FOMB 1OP0A 2ULLA 2WZQA 2GCHF 2ZA5A 1XM1A 4I33A 1ARCA 1C2GA 4X8UH 5A0CA 1H9IE 1GHYH 4BOHA 1Y3YA 3HKJB 1C5XB 4U30A 1A0JA 2FMJA 3EA7A 1TRMA 2A2QH 2SNVA 5B6OA 1H1BA 4YOJA 1IQMA 2F4LA 4B6EA 3HGPA 3SJIA 1MD7A 1P2NA 1DT2A 1O3FA 5TCAA 1Y3WA 1C2MA 2BLWA 4NZLA 1F0SA 2UWOA 3DHKH 4BAQB 3UPEA 3GCHC 1AUJA 1HXEH 1P2JA 5EU8A 2FM2A 1A61H 1RTLA 1GJ6A 1UHBB 4MNXA 4OS1A 3MU5A 3BIVH 1ELGA 4Y7AA 3UIRA 4OGXA 3GISB 1GMCF 1SLUB 1A3EH 1XUIA 1NPMA 4DURA 2Z9GA 1ZGVA 4IS5A 4GUXA 3KHVA 1BCUH 1KLJH 1NRSH 3VB7A 1NFWA 1ZHMA 3M7QA 2B8OH 1BMNH 2AH4X 1IQLA 4K1TA 2UUJB 1GDUA 1QR3E 4FU7A 1P2OA 1Y5UT 4WMDA 3PMBB 4HI3A 3ZV8A 3RXLA 3SV7A 1IHSH 1O35A 1X7AC 2OXSA 4CH8B 2PKSB 2VB0A 1AGJA 3UR6A 1TBZH 4DJZB 5FPTA 3SZEA 3UREA 2XC5A 4Y7BA 1THPB 1UCYH 2EI8A 2G00A 1TONA 1L2EA 4YOIA 2G81E 3BEUA 2ZKSA 2BDBA 2C8YB 1P3EA 2IPHA 2R3UA 4BAKB 1F7ZA 2OQ5A 1O3NA 4CHAC 1HYLA 2WPJS 4WXIA 2VGCC 5DP5A 2V6NA 3SNCA 1O32A 1QL9A 1ZPZA 1W12U 5EPYA 1C5QA 2G51A 4ISIH 3DUXH 3RXFA 2P95A 1O2IA 2ZU4A 3GCTG 3STJA 1TRNA 3ZZ6A 3OU0A 1SL3A 3E6PH 3UWIA 4BTUB 1DSUA 4UEHH 1E37B 4WVPE 3VPKA 4E06H 1FV9A 1XUJA 3A83A 4A1VA 3WY8A 1ZJKA 3RMMH 1RGQA 3A8DA 3P6ZB 1LHDH 2PW8H 1KY9A 3VGCB 3M5LA 1O2PA 2GCTB 1PPZA 1WUNH 5K0HA 3P92A 5PTPA 3SHAH 2H1UA 4JZ1A 1KIGH 2H6MA 7LPRA 1BBRH 2ZEBA 4ABGA 1V2LT 1TRYA 3LPRA 1MTWA 5GPIB 3UNRA 2WPLS 2R2MB 4AYYB 2AGEX 4NZQA 1B7XB 1GI1A 5C2ZA 2XYAA 4K8YA 2QGRA 3GY6A 1O5GH 4VGCC 3SUFA 3ZZ5A 1NRNH 1HAHH 1H9LB 2D1JA 4K8BA 3MI4A 4TPYA 1S85A 3VFEA 1MCTA 2RG3A 2GP9B 2CF9H 2BZ6H 5FPYA 1QBOA 2FOAA 2RDLA 1N6XA 2VH0A 3MTYA 4WH6A 5EW2H 3MU4A 3TU7H 4FUDA 4D9RA 2VINA 1C5WB 3MNSA 1E34B 2G4UA 2B9LA 2ZQ2A 2EA3A 3PLBA 2ZDMA 1ETTH 1G2MA 3GDVA 3C1KA 1P09A 1UK3A 1ZOMA 2BY7X 1OSSA 4KTSA 1QGFA 1O33A 2WPMS 2A45B 4XOJA 1LHGH 2H9HA 4RN6A 4ZKRU 2ZGHA 1DX5M 1D9IA 2ODYB 1TE0A 1C5ZB 2P16A 3KGPA 4THNH 1LPKB 4XE4A 2GV6A 1C2DA 1EZXC 4Y76A 1RD3B 3MU0A 1TPPA 5FX6A 4GPGA 2DE9A 2FTLE 2WPIS 2Z94A 2FODA 1GL1A 4MQAA 5I25A 1EASA 2ZFPH 1HCGA 4H6TA 1HDTH 2FO9A 1FY4A 1UCYE 1BTZA 4K60A 1GJBB 4Y8YA 4ZKSU 1EB1H 2BY6X 5JPMH 1UJ1A 3BG4C 1AVWA 5BRRE 2C93B 1NM6A 1HBTH 2BDHA 1C5VA 2TBSA 4YO9A 2RA0A 4LZ4B 3A84A 3MU1A 1AZ8A 4I8KA 1GG6B 1ZR0A 1XUHA 3V13A 1ETRH 4DCDA 1FIZA 2EI6A 3OYPA 8ESTE 1HJAC 1AMHA 4RKOB 3ZZ7A 3SI3H 1BTYA 1LVYA 5A8ZA 1F2SE 2AGGX 1GJ4H 2VWOA 1C4V2 3M5NA 1QTFA 5EW1H 3FP6E 2BD3A 1Y3UA 2ZDAH 4FUCA 1ZHRA 1BITA 4UFGH 3RXRA 3BEIB 1Y5BT 2AMQA 1O5EH 1ZRKA 3B23B 3TPIZ 2BD4A 1PPBH 1K1NA 1NRRH 3F9GA 4UFEH 3GDUA 1BTXA 2CF8H 3LGIA 2SGDE 1P06A 1EJAA 5TCCA 4UD9H 1TA6A 1BBRE 2BVXH 6GCHG 2XC0A 3SJOA 1GI7B 3F9HA 1HAYB 3GCHB 1HIAA 2BZAA 1P02A 3SN8A 4K2YA 4HFPB 3PTNA 3A81A 4ABAA 2BOKA 1C1OA 1QBNA 1SC8U 2D8WA 1UVTH 2AMDA 7KMEH 1P05A 1TPSA 5FCRA 3LT3A 1ANDA 2GT8A 1EJMA 2XBXA 1VJ9U 2IOTA 1G2LA 2XW9A 1EXFA 3JZ1B 1TMUH 1P0SH 2HNTC 2VVVA 1K22H 4I31A 2R0LA 1GVKB 4BXWA 3NZIA 3W95A 3SI4H 3UFAA 4Q7XA 2UUYA 2WV9A 2ZU1A 2EEKA 1Z6EA 1TPAE 2A2XH 1HAPH 4DOQA 1YPLH 1J14A 5FX5A 2HPPH 1HLTH 3IWMA 1NN6A 3SO3A 1DWEH 4NA9H 4E05H 4NSYA 1GWAA 1OWKA 2BQ6B 1N6YA 1O3HA 4DY7B 4ZKNU 1YC0A 1QB1A 1BTPA 3RXTA 1P2QA 1C5RA 1YYY1 2H2ZA 2W3IA 1AU8A 3PB1E 1THRH 2ZPRA 1BTWA 2Y5GA 4X1QU 4CHAB 4F4OC 1OXGA 1Y3XA 4Y71A 2VGCB 1EAUA 1BMMH 1ZMLA 3UUZA 3H7TA 1BRUP 2OC7A 4NA8A 3SJ8A 2XBWA 3E3TA 3KQCA 4ZUHA 1WQSA 2O9QA 5DP4A 1HV7A 3GY3A 1O2JA 1GJCB 1ZHPA 3RXMA 4NWLA 4AFSA 1C4U2 2VH6A 2PFEA 2THFB 5F6MA 4XFQA 2IJOB 1C2JA 5JBCS 3RXOA 1LHFH 5E0HA 1W7XH 1EJNA 1O2KA 3LJJA 1D6RA 1F5LA 2EI7A 2H9TH 1PQ8A 1UTPA 1EOJA 5B6LA 1EQ9A 3FZDA 3LDXH 3O8BA 3VB3A 3SGAE 2BDCA 5GXPA 2AS9A 1PPHE 4ABDA 1T31A 2P3TB 1KXBA 2BD5A 1IAUA 1NU9A 2ZHEH 2QY0B 2BXTH 1MBMA 2WPKS 4VGCB 3LGVA 2LNCA 3RXCA 5C5OA 5FAHA 3BV9B 5AFYH 1NROH 2Z6BD 1C1NA 1LVMA 1TPOA 4IN1A 5JYIA 5GCHG 3I29A 2P93A 2OC8A 2R9PA 1O3IA 4IBLH 4AB9A 4ZHAA 2PTCE 3SQEE 1OS8A 1ZSKA 4B74A 2XTTB 4AZ2B 1V2ST 2VIWA 1HXFH 2W3KA 5TJXA 1Y3VA 3HK6B 5FBIA 2FXRA 5I46H 1SB1H 4MNWA 4JZIA 1DOJA 1YBWA 8GCHF 1IQKA 1P11E 1U6QA 1ID5H 3QDZB 1G9IE 1DXWA 1EP5A 4BAHB 5L30H 4ISHH 2TGTA 9LPRA 1H4WA 4Y10E 2J95A 4R0IA 2BLVA 2FP7B 2FS8A 1W2KH 2ALPA 3G01A 3LONA 1AFQC 1V2RT 1FJSA 1BHXF 1XXDA 2V3OH 2ZFRH 2ZTXA 5CHAC 1VR1H 4ZMAH 4B71A 1FY3A 2VIQA 1MQ6A 2A7CA 3T5FH 1LDTT 3M36A 3FFGA 4NG9H 4A1XA 8KME2 1SLVB 1TQ0B 1SFQB 1SBWA 4B76A 3M5MA 3MMGA 3PMAB 1FY5A 2OINA 3BG4B 5FBEA 2PR3A 1SOZA 3BTKE 3A7XA 3D62A 1SGDE 1MZDA 1W11U 4AB8A 4AG2A 1LMWB 3BTTE 1C1MA 4ISNA 3ZYEA 5EXMA 3PMJA 4RI0A 3ZVEA 2GD4B 1CT0E 4X8SH 3A80A 2TGDA 2FOGA 2XWAA 4WF8A 3T2NA 3K65B 2P3FH 1GMDF 4TYDA 3RXDA 4B1TA 3ODDA 5T6GA 1IQIA 4GHTA 1O34A 6GCHF 5DK1A 1HAGE 2BY9X 3S0NA 4IW4E 4IC5A 1YCPH 1AE5A 3ZZ8A 1LO6A 1DLEA 2JKHA 1YLCA 5EG4A 3I77A 3M5OA 4XDEA 3PV5A 1EPTC 4Y0YE 3EQ0H 5E2OA 1MKXH 1GCTC 5JB8S 3VXEH 1KXCA 3RM0H 2V35A 3TNTA 2G5NA 1ZMNA 3KL6A 1LPZB 2J9NA 3NUMA 2OD3B 1WTHD 1TGNA 4AG1A 3Q00A 5EGMA 1XX9A 5E0JA 1BT7A 1QB6A 3TLOA 3C27B 4I8GA 3EAJA 3RXQA 9ESTA 1DS2E 1W14U 2P8OC 4CRBA 1NS3A 1GJ8B 1UVPA 3RXGA 3MO3A 1FY8E 1K1IA 1QRXA 1TBQH 1QRZA 3TK9A 3A86A 1FZZA 2P59A 1ELTA 3OTJE 3CS7A 1G3CA 1IQHA 2GV7A 3MH4A 3BN9A 2YNAA 1DFPA 2JH0D 4SGBE 3MO6A 4KKDA 4YT6H 2CMYA 1INCA 1FN6A 1V3XA 1YPHE 1GBHA 1PPEE 1SG8B 1L0ZA 1SGCA 4K3JA 1O3LA 1RXPA 2W26A 4A6LA 1BZXE 2OK5A 3F9EA 1WTGH 1XUGA 3LOXA 1GBCA 3GYLB 1O3BA 2FX6A 1EB2A 2ZG0H 1RFNA 1RS0A 3RMNH 1FQ3A 2ODPA 1DUEA 2ZU5A 3HATH 2VIVA 3TGJE 2J94A 1T8NA 2FI5E 1V2WT 3QZQA 1BRBE 1CVWH 4INKA 1QQUA 2J34A 2NU3E 3T28A 1GGDC 1GI4A 3UQOA 2ANWA 1B0EA 3SW2B 3KEEA 2CHAC 4NIWA 3PTBA 5DG6A 3P70B 2FOEA 4X6PA 1KXDA 2OUAA 1XUKA 2ESTE 3SV6A 5DO4H 2M5TA 2OBOA 2WYGA 2FLBH 1KLIH 1QNJA 2AGIX 1HPGA 1YCPK 1SQOA 4H42U 1CQQA 5DP8A 2CJIA 3SUEA 1PFXC 4D76A 1YCPM 1AQ7A 2PLXA 4O97A 5GCHF 3FP8E 1O3GA 1A5IA 2ZCHP 1YKTA 4B2BA 2B0FA 4JZDH 5ESTE 1MKXK 2TIOA 4ABFA 2XWBI 2FIRH 1E35B 1CE5A 4YESB 3VB6A 1EKBB 2J38A 3ATKA 2QA9E 4AORA 4AX9H 1AVGH 1LHCH 3RU4T 1C5TA 4U2WA 3PV2A 1UTJA 1BTHH 1GHBG 3A87A 4MTBA 1NFYA 3BEFB 1FAXA 2ZCKP 3SU4A 2QXGA 2SGFE 1AB9B 1JRSA 2F9BH 1QL8A 2O8LA 3E90B 1A46H 2VIDA 4ABHA 1EATA 5JBTA 3NCLA 1GBEA 4X6MA 3U69H 1WCZA 2Q6DA 2ZFTA 3LU9B 1AFQB 3DT0H 5CHAB 2ZHQH 1FDPA 1Q3XA 3RU4D 1MZAA 4X1PU 1O2QA 1UVSH 4CREA 3KN2A 5LPFA 3F6UH 3P8GA 4OGYA 1EP6A 3QGNB 1IOEA 1BHXB 2VVCA 3GICB 5DP7A 4WJG2 2WINI 4I8JA 4JYVH 1TNGA 1ZLRA 3AAVA 1ANBA 1TNIA 2ZDKA 1BOQA 2ASUB 1O39A 1GJDB 2QIQA 4ZAEA 5IYTA 1ELCA 3RXPA 3LGWA 1GI3A 1VJAU 2ALVA 2ODQA 3RC4A 3LJOA 4ABJA 1CSOE 5FCKA 1AI8H 1SGQE 2PHBA 1IHTH 1DANH 3QGJA 4X6NA 4XBBA 4FUHA 3RXHA 4LXBH 4BXSA 1Z8IB 1LKBA 1ZJDA 1QIXB 1H8IH 2Z7FE 1F92A 4K1SA 1UTMA 2FWWA 3TGKE 1J15A 1KYNA 2Z9LA 1EPTB 1ANCA 1W3CA 1BB0B 1VITG 3E0NB 1GCTB 1TNLA 4XBCA 3FZZA 1MMJN 3MOCA 2Y82A 1THSH 1W10U 4X0WU 1A5HA 2GX4A 4Z0KA 4TY7A 1V2UT 5T6DA 8LPRA 1TLDA 1F0UA 2OCVB 2OP9A 1NFXA 2QXJA 2QYIA 2BDIA 2P8OB 2C3SA 1NFUA 3URCA 2VU8E 4MLFB 1XUFA 1ZYOA 3ZVGA 1WBGB 4DT7B 3E8LA 3EA9A 1B5GH 2FYRA 2HOBA 3A7ZA 3GCNA 1XVOA 2FI4E 1J17T 1HFDA 1DUAA 4J1YA 1O2VA 1WOFA 1UCYK 3L33A 5J4QA 3MO9A 4LZ1H 2SGAA 1ZTLA 3PYHA 2VWLA 1C5NH 3SQHE 1K9OE 2LPRA 2SGEE 4OS4A 3RC5A 5JBAS 1PQ5A 2D2DA 2BD9A 4ZHLU 3ZZAA 1C5YB 2YOLA 4IN2A 1O2HA 1TIOA 4YTAA 3TJNA 3GY8A 2ZECA 3UOUA 3ELAH 1T32A 2CN0H 1QBVH 2BQWB 4GVUA 1SLXB 2PSXA 2BLQA 1Y8TA 2Q6FA 2A31A 2FPZA 3M3VA 1LKAA 2AIQA 2QXIA 3I78A 4MNVA 1P10A 3CP7A 1KDQB 2A5AA 1OYQA 2FI3E 3MNBA 3DD2H 2QF3A 1TX8A 1UHBA 1C1RA 5E2PA 4GLYA 3KIDU 2GZ8A 1DPOA 1ACBE 1GGDB 2H5DA 4XSKU 1ZRBA 1MUEB 1WXRA 4FVDA 6LPRA 4IMQA 3UTUH 3DA9B 1YPGH 1O37A 2CHAB 2BDAA 2Z9JA 1PPGE 1BBRK 2KAIB 1SGTA 1YPKH 1AKSB 3OY6U 4ZKOU 1ZMJA 3VEQB 1D3QB 3K2UA 4R8TB 1EUFA 3ESTA 3KF2A 3SU0A 1DICA 5FPSA 2ILNA 1P8VC 3H09A 2ZU3A 2BVSH 3KQDA 1O2NA 5DP6A 3AW1A 5L6NH 5DJ7A 4CH2B 3SU1A 4JK5A 4X1RU 2G52A 1HGTH 3PWBA 1ELVA 2ZGXH 3T27A 1HAOH 1S6FA 1Z8JB 1VCQA 1GBJA 1GBLA 4I8HA 4HGCA 2QF0A 1BTUA 5A2MH 1C9TA 1GMHG 1AWFH 1DSTA 2XCNA 1K28D 2NWNA 1GJAB 5JB9S 4MPWA 4NWKA 1TNHA 1Z8GA 4TPIZ 1GHBF 3RXJA 4YLQH 1PQ7A 4ISLA 1OWIA 2Y7XA 1MU8B 1O3PB 1C1VH 3L6PA 5F03A 3B8JA 2FOHA 1KTSB 1T4UH 3K6YA 1C2FA 2C8ZB 1O2RA 5A09A 1HJ8A 4UDWH 1O2XA 3A85A 2ZI2H 5EOKA 5HM9A 2ZFQH 2RCEA 1XVMA 3F1SB 4X2WA 1E0FD 1MBQA 1EZSC 1UTKA 2PSYA 1O2MA 4B73A 3U8RH 4Y11E 1PPFE 2CGAA 2A5IA 3M7UA 3SV9A 1GI5A 1AUTC 1G3BA 3GCTF 1SGPE 2I6SA 2NU4E 4WWYA 3SBKA 4WXVA 4OS7A 1LVBA 3UNQA 3QTOH 1E36B 2F91A 3SUGA 5J4SA 1IQEA 1GBMA 1CA0B 1L1GA 1L1NA 1QJ1B 4Y8XA 4GCHG 4DGJA 4NFEA 3DFLA 2Y81A 1PYTD 1GBBA 1TALA 1P03A 2XBVA 5T1VA 3K6ZA 4GHQA 3E1XB 2ZPQA 3D23A 3TITA 2W5EA 3S9CA 5AFZH 1A1RA 3QO6A 3ITIA 1TGBA 1C5SA 1TGCA 5DP9A 1ZSJA 3VXFH 4HZHA 3QN7A 1HAVB 2GZ7A 3LGYA 4CRFA 1V2PT 3R0FA 3D65E 2ZTYA 1KXAA 1C2IA 1FLEE 3OTPA 1W13U 2BD8A 2WYJA 2ZDVH 1NT1A 1V2KT 1EOLA 1VITF 4JMYA 4ABBA 1MAXA 4NCYA 3V0XA 3PO1C 4J2YB 1TGSZ 3URDA 1FXYA 5C5NA 5HGGA 3RMOH 3ZVBA 1TBRH 4JCNA 4ABEA 1BRCE 3LH3A 5LGOA 5HXFA 1RTFB 4ISOA 1UK4A 4DG4A 3TH3H 1ORFA 3QX5H 4CR5A 1WU1A 3Q77A 1G37A 2FYQA 1S81A 2BX3A 1UVUH 4X1SU 2STBE 3PM3A 1TYNA 3EE0B 2F3CE 1AN1E 4Y79A 2ZFSA 2ZTZA 4INLA 2BB4A 1AB9C 1OPHB 3SV2H 3BIUH 2Z3EA 1TWXB 2A7HA 7GCHG 3U1JB 2F9OA 2BQ7B 4ZROA 1O3CA 1P2KA 1ZGIA 3SUDA 4CBOA 3TH4H 6CHAC 2PUXB 2ZPSA 3PLKA 4QT8C 2D26C 5GNDA 3EGKH 3S9AA 3GY7A 3LC3A 2BYAX 2BXUH 1YPEH 3E0PB 4OM9A 5C67A 3NWUA 1CGJE 4OS5A 1D3TB 2HVXA 1OWDA 4ZXYH 3A7VA 1L4DA 4X2XA 4K1EA 2FOCA 4X1NU 4FUBA 1SGFA 2ZF0H 4M7GA 1ARBA 1RJXB 1HUTH 3MNXA 4B2AA 1O3EA 1A0LA 1DE7H 3UWJH 1O3KA 4O03A 3VB4A 5DP3A 4UE7H 4FUFA 1HRTH 4FXGH 4FUEA 2GGVB 3BTME 2VVUA 1Z8RA 2O8WA 2BD7A 1A5GH 1AIXH 3UOPA 3ZZ3A 2PV9B 1GVLA 1AWHB 1RTKA 3A88A 1P9SA 1BUIA 3TJOA 2BDGA 4I7YH 2HPQH 4KTCA 2F9UA 2GTBA 2ZC9H 2BLOA 2G4TA 4BTTB 2ZNKH 1BRAA 3RXBA 1FPHH 3AVZA 1N1LA 1G3EA 1ELBA 1MTNB 5T6FA 1UTLM 2CXVA 5GIBA 3MH7A 3KQEA 3SV8A 2OLGA 1AD8H 4CRAA 4JZFH 3T25A 4BANB 3SU3A 2QN5T 3SU5A 1AZZA 4X8TH 1GMHF 3SNAA 2XCFA 1DDJA 1VITH 2WV4A 2OC1A 1SSXA 1A4WH 4CRDA 4CR9A 1O30A 5A0AE 3VB5A
chains in the Genus database with same CATH superfamily
4YLUA 1O2LA 2QCYA 2C8WB 5C1XA 5EIYA 4Q7YA 1AVXA 4MPXA 3S9BA 1VGCC 2TPIZ 3T29A 2W6ID 3PROA 1CGIE 3ZYDA 3O8RA 1ELEE 4OS6A 3U8TH 1AE8H 1S83A 1N8OB 4O9VA 3SGBE 1EZQA 1JBUH 2SGPE 3CENA 2Z3CA 2QXHA 3ODFA 1XKBC 1YP9A 3MHWU 1KXFA 1JXPA 3LKWA 1L1JA 1BA8B 3MFJA 4WMFA 2VIPA 1SGNE 2J92A 5K7RA 2HNTE 1O3DA 1P57B 2FDAA 4IGDA 3MNCA 1OYTH 4AFZA 3Q76A 3U1IB 1O36A 4I86A 3A8BA 3RXKA 3UQVA 3SZNA 5LPRA 2C4FH 3GY5A 5A8XA 5BPEA 3V3MA 3ATLA 4F49A 3DFJA 4AGKA 4MNYA 5GJ4B 4MVNA 3MYWA 4Y8ZA 3H5CB 4AN7A 4RKJB 2BD2A 1DWDH 1NBME 2P94A 3ZZ9A 5E8EH 2HLDD 1FI8A 2BX4A 3RU4E 2JETC 1K21H 2Z9KA 4DW2U 4E7RG 2FZZA 1T4VH 2KZ4A 1J16A 2GDEH 2J4IA 4KELA 3ZVAA 1O2WA 3RXEA 3RP2A 2R3YA 2Q6GA 1KMHB 3A82A 1C4Y2 5HM2A 2Y5HA 1DLKB 2SFAA 4YZUA 1UTOA 2FS9A 2UUFB 1SMFE 1WQVH 1BQYA 4MDSA 5F8TA 2BHGA 4Q7ZA 2A7JA 1FONA 3PMHB 2FOBA 4TSFD 3SHCH 1GBKA 3QZRA 1T7CA 3KYFA 3A7WA 4WY3A 3FVFB 3P8NA 2A0QB 3F2GA 1V2JT 1SLWB 4FU9A 1HAXB 2TRMA 2GDDA 2IN2A 3ZVDA 3PO1B 3ATWA 3ZVCA 2WUCA 5EPNA 3RXAA 2PTNA 2VWMA 2BY8X 2WPHS 2PGQB 1H8DH 2ANYA 4P00A 1ZPBA 4NIVA 2HALA 3EYDA 1O38A 2ZWLH 4Y6DA 1GBAA 1GHWH 4WH8A 3BTFE 2NU2E 3UR9A 3MWIU 2ZP0H 3SJKA 1TQ7B 4X2VA 2A5KA 7GCHF 2GVFA 1P12E 1SGEE 4B6FA 1TA2A 2GZ9A 1V2NT 1GI8B 1O5BB 2WHXA 4JK6A 3E91A 4K5ZA 1HIAB 1DITH 3SNDA 1RIWC 1IQJA 1CT2E 3RLYH 1AHTH 1JIRA 3HK3B 1IQGA 4Q2KA 1CT4E 1UO6A 3F2HA 1GJ7B 3DSPA 3W1EA 5IDKA 2VIOA 4PROA 1F0TA 3P8OA 2OC0A 4FUJA 3AK5A 3NKKA 2B7DH 1W8BH 4ACAA 5FHTA 5JDUB 2LP6A 3A7TA 2F9PA 1FPCH 2OTVA 6CHAB 1O2YA 1TABE 1GBDA 1NC6A 2WV5A 1CA0C 1G32B 1O5DH 1SVPA 1MD8A 2GT7A 1LCYA 1QHRB 1O3AA 2QV1A 2FLRH 1EFRD 3TJVA 1BMLA 1GBTA 1MH0A 1ZPCA 4O3TA 1TX7A 5F8ZA 1C5MD 3LGUA 1CHOG 3ENSB 3GYMA 2ZIQH 1P2MA 4D9QA 3BTQE 3RXUA 4BAOB 5EQQA 3B9FH 5CMXH 1CBWC 1EX3A 1QZ8A 3GY4A 2C8XB 1TGTA 3UNSA 4NA7A 4H4FA 4OS2A 1BMAA 2A4OA 3M3TA 1SQRA 3MU8A 1SGRE 3LH1A 1PJPA 2ZZUH 3KNXA 2QC2A 1AFEH 3P95A 4UONA 2PKAB 3BSQA 1SHHB 1J9CH 4KTUA 3GY2A 4MG3A 1SFIA 3FOAA 1KXEA 3IG6B 5SGAE 3OSYA 1EZUC 6ESTA 2ZHWH 1P3CA 1J8AA 2ZGCA 5L2YH 1C1SA 3CS0A 2H9EH 1QJ7B 3V12A 1O2OA 1YPMH 1GHXH 2GMTC 1C5OH 2BVRH 3Q3KA 3AW0A 1FUJA 1VCPA 4JYUH 1ABIH 1TNJA 1LPGB 3TVJB 5IK2D 3HKIB 3LIWA 1QL7A 1LHEH 4RSPA 1EAWA 3UB0A 5HYOA 1ABJH 4O3UA 1UTNA 1C2EA 2CV3A 2VWNA 4DIIH 2J2UA 1VGCB 4H6SB 2AIPA 4CRGA 1JRTA 1GDNA 2PUQH 1C5LH 1CHGA 5A0BA 1ELAA 1S82A 1P9UA 2BTCE 3ZVFA 4FUGA 5L2ZH 2EC9H 4NFFA 2HLCA 2YMSC 1SOTA 3S7HB 2G8TA 3H7OA 4BAMB 1ESBA 5HIZA 3BTEE 1F5RA 2SNWA 4CRCA 1C5UA 5ABWA 2VBCA 8GCHG 1MTSA 1QFKH 3K9XB 4AYVB 3ATMA 3NPSA 1V2QT 2V3HH 1T8LA 2HGTH 1O3OA 4M9FA 4Y0ZE 1DWBH 2F9VA 2XBYA 1WAYB 2SGQE 1JWTA 4KGAA 1MTVA 4GAWA 1MKWH 1O2SA 3M7TA 3T62A 2J5UA 1SI5H 1A3BH 1OX1A 5T3HA 1A7SA 1CU1A 3M35A 1OHHD 1H8HD 2JETB 3RXSA 1QCPA 1S84A 3A8CA 3LC5A 5DN6D 2A1DB 1O31A 3TGIE 2FOFA 1D3DB 4FUIA 2B5TB 1F0RA 1L4ZA 1UMAH 1CGHA 3A8AA 1HB0B 2ZCLP 4TY6A 5DPAA 4TWWA 1MCVA 4NSVA 3KQ5A 3PWCA 3UY9A 3ZZ4A 3QTVH 1SR5C 1O2UA 2JH5D 1MTNC 1WV7H 4HTCH 1Y5AT 4E7NA 1BDAA 2BMGB 2PP6A 1FNIA 1YPJH 2XC4A 1W7GH 4IMZA 3S7KB 3ZZCA 2OBQA 3IITA 3SORA 3FP7E 1HAZB 1VCWA 1Y59T 3BG8A 4I8LA 1GMDG 4X6OA 1B0FA 5CE1A 3U9AH 5AVDA 1O5AB 3SNBA 2AMPA 1K1OA 1S0QA 4ESTE 2WUBA 4NIYA 2W7SA 1LVOA 1OWJA 3JZ2B 2BY5X 3GDSA 4D7FA 2HNTF 2A4GA 3EDXB 3MH6A 1N8OC 3GCOA 1SQTA 4FU8A 3SYJA 1F5KU 1MABB 3T26A 1YLDA 4XBDA 1NO9H 1TMTH 1TAWA 3GOVB 3BTDE 1V2MT 2O8TA 1H9HE 2Y7ZA 1GI2A 1ELDE 1IQFA 4FVBA 2ZU2A 3QK1A 1DM4B 3S69A 3TNSA 2KCPA 2AYWA 1S6HA 1O3MA 1TNKA 4ZXXH 1QJ6B 1FMGA 1YPHC 3OY5U 2Y6TA 5FXLA 2G55A 2ZQ1A 1Z1JA 2K1QA 3EA8A 1D3PB 2XXLA 1RIWB 3Q3YA 1VKYA 3L3TA 1OP8A 2BOHB 1CO7E 2XRCA 4JYTA 3ZV9A 1GI9B 3HPTB 5LPEA 1UVOA 1V2OT 1LQDB 1SHYA 1MAYA 2I6QA 1BJUA 2F83A 4AC9A 1CHOF 2G5VA 2W7UA 3U8OH 2GKVE 3BTHE 2BM2A 1FAKH 3STIA 4A7IB 1K1MA 1ESAA 3TIUA 2PKAA 1K2I1 1FIWA 4ZHMU 4LOYH 5C1YA 1QURH 1GHAG 3MH5A 1VZQH 5CDFE 1JIMA 1UK2A 5EXNA 1M9UA 1MKWK 1P04A 1CBWB 1XKAC 1P2IA 1W0YH 1G30B 1SGYE 1TMBH 2NU0E 4YOGA 1Z6JH 3KQBA 1C2HA 1QB9A 3TK6A 3HGNA 1O2ZA 4YT7H 1GDQA 3OAAD 2NU1E 5C3NA 4A1TA 1EPTA 2V0BA 4A5TS 1TB6H 1OWEA 3M61U 1V2VT 2UWPA 4LK4A 3M3SA 2GCHG 2C90B 4U32A 1ZTJA 1HNEE 1SGFG 2KM0A 1Z71A 1TX6A 1Z1IA 1P01A 2ZO3H 3E16B 1C1QA 1C2LA 3D49H 5EQRA 3OEED 1V6DA 3SNEA 1GCDA 1GVZA 1MU6B 2RA3A 4Z6AH 1E38B 1Q31A 4DIHH 1BIOA 1C1PA 1NTPA 1UTQA 3SOSA 4TWYA 1W0ZU 1GBIA 5DKMA 3QLPH 2AEIH 2HRVA 1ZZZA 2GMTB 4K69A 1GHVH 2FX4A 4UFFH 2AERH 1C5PA 1NU7B 1O5FH 4IC6A 5ESBA 1NESE 1NRPH 4INHA 4B2CA 4ABIA 3SJ9A 4SGAE 4WMEA 1GMCG 1RRKA 4D8NA 1LTOA 1S5SA 3KCGH 1KLTA 4NGAH 1T8MA 3U98H 4AGJA 3ATIA 2FEQH 1K1JA 1A2CH 3BF6H 2OQUA 2XNIA 3AASA 4BTIB 2PKSC 2ZFFH 4YM9A 3BTGE 3UAIC 2ZHFH 4ASUD 2Q1JA 5GDSH 1A0HB 4ZH8A 3RXIA 4Q80A 4X2YA 1OP2A 4BNRA 1KDQA 3Q3XA 3O8CA 1XXFA 2TGAA 3V7TA 1KSNA 1G3DA 1Z7KA 1QY6A 2H5CA 5JBBS 1JOUB 3O8DA 1EAXA 4AOQA 1DY9A 2YMSB 2ZHDA 1AY6H 3FANA 1BJVA 1GPZA 2HVYB 3ZZBA 4DVAU 1GJ9B 2JH6D 4A92A 1QQ4A 1YGCH 2UUKB 4ASHA 3R3GB 4KP0A 2KAIA 3RUOA 1DVAH 1AKSA 3QWCH 2HWLB 1OWHA 5EQSA 4AFUA 1ETSH 2ZDNA 2A32A 3N7OA 2AFQB 1KTTB 1MTUA 5G4BA 5HMAA 5AF9H 4X8VH 3VGCC 3P17H 2ZDLA 2ANKH 1H8ED 1GBFA 5A8YA 2GCTC 3F9FA 5H4IB 3SGQE 3PLPA 1O2TA 1C9PA 2VNTA 1V2TT 1JMOH 3SU2A 4FETA 2LELA 1FY1A 1D6WA 1HJAB 1LQEA 3RXVA 3TK5A 7ESTE 1SPJA 2Z9IA 1IQNA 1CA8B 1K1PA 1GL0E 1C1WH 5EXLA 2DE8A 3RDZA 1G36A 1ANEA 1D4PB 2F9NA 3FAOA 2R2WU 1GHZA 3PV4A 1DWCH 1NZQH 1ELFA 5E0GA 5C1UA 1ZSLA 1C1UH 4I32A 3SU6A 1HJ9A 2ANMH 1GJ5H 2IJD1 1EAIA 2TGPZ 1OKXA 5AHGH 1ESTA 2PWXA 1DXPA 1PPCE 2VJ1A 1NY22 1K1LA 4F55A 2R0KA 3RLWH 3RC6A 2Z3DA 2P3UB 1YY3A 4D7GA 1WYKA 1SQAA 4MPVA 4U01A 1S0RA 3LGTA 1GI6A 4UFDH 4CBNA 2FTMA 5ETXA 1HAIH 1QA7A 3NXPA 1AO5A 4RT1A 2FESH 3ZZDA 2QE7D 4GSOA 1YM0A 3RMLH 1O2GH 4MPUA 3DSGA 1O0DH 1MQ5A 2O8UA 2UWLA 1TOCB 4JZEH 3BTWE 4AFQA 4B75A 2A4QA 2ZGJA 3RM2H 1DY8A 1QA0A 2A4RA 3P8FA 3F68H 3WW7A 5LH8A 1O5CB 1SGIB 1YF4A 4GCHF 1PQAA 3A89A 5F8XA 1TOMH 1Q2WA 3TH2H 1QRWA 1NRQH 3OX7U 1GHAF 3TJUA 5DGJA 1T8OA 1C2KA 1C1TA 1HAVA 2YNBA 2O8MA 5C20A 2Y5FA 1GI0A 3A7YA 2V7QD 2Y80A 3M37A 5GWZA 1GG6C 2QAAA 1WSSH 1PYTC 1TFXA 3NK8A 2BDYA 1O3JA 2PGBB 1OOKB 3QUMP 4NIXA 5EODA 2DUCA 1FN8A 1ZTKA 2STAE 1XMNB 3W94A 2ZGBH 3AAUA 2EY4C 2FOMB 1OP0A 2ULLA 2WZQA 2GCHF 2ZA5A 1XM1A 4I33A 1ARCA 3CNRA 1C2GA 4X8UH 5A0CA 1H9IE 1S6LA 1GHYH 4BOHA 1Y3YA 3HKJB 1C5XB 4U30A 1A0JA 2FMJA 3EA7A 1TRMA 2A2QH 2SNVA 5B6OA 2QF4A 1H1BA 2F4LA 1IQMA 4B6EA 4YOJA 3HGPA 3SJIA 1MD7A 1P2NA 1DT2A 1O3FA 2IPQX 5TCAA 1Y3WA 1C2MA 2BLWA 4NZLA 1F0SA 2UWOA 3DHKH 4BAQB 3UPEA 3GCHC 1AUJA 1HXEH 1P2JA 5EU8A 2FM2A 1A61H 1RTLA 1GJ6A 3F2FA 1UHBB 4MNXA 4OS1A 3MU5A 5KECA 1K0HA 3BIVH 1ELGA 4Y7AA 3UIRA 4OGXA 3GISB 1GMCF 1SLUB 1A3EH 1XUIA 1NPMA 2JJ1D 4DURA 2Z9GA 1ZGVA 4IS5A 4GUXA 3KHVA 1BCUH 1KLJH 1NRSH 3VB7A 1NFWA 1ZHMA 3M7QA 2B8OH 1BMNH 2AH4X 4F48B 1IQLA 4K1TA 2UUJB 1GDUA 1QR3E 4FU7A 1P2OA 1Y5UT 4WMDA 3PMBB 4HI3A 3ZV8A 3RXLA 3SV7A 1IHSH 1O35A 1X7AC 2OXSA 4CH8B 2PKSB 2VB0A 1AGJA 3UR6A 1TBZH 4DJZB 5FPTA 3SZEA 2AHME 3UREA 2XC5A 4Y7BA 1THPB 1UCYH 2EI8A 2G00A 1WDIA 1TONA 1L2EA 4YOIA 2G81E 3BEUA 2ZKSA 2BDBA 2C8YB 1P3EA 2IPHA 2R3UA 4BAKB 1F7ZA 2OQ5A 1O3NA 4CHAC 1HYLA 2WPJS 2J98B 4WXIA 2VGCC 5DP5A 2V6NA 3SNCA 1O32A 1QL9A 1ZPZA 1W12U 5EPYA 1C5QA 2CK3D 2G51A 4ISIH 3DUXH 3RXFA 1O2IA 2P95A 2ZU4A 3GCTG 3STJA 1TRNA 3ZZ6A 3OU0A 1SL3A 3E6PH 3UWIA 4BTUB 1DSUA 4UEHH 1E37B 4WVPE 3VPKA 4E06H 1FV9A 1XUJA 3A83A 4A1VA 3WY8A 1ZJKA 3RMMH 1RGQA 3A8DA 3P6ZB 1LHDH 2PW8H 1KY9A 3VGCB 3M5LA 1O2PA 2GCTB 1PPZA 1WUNH 5K0HA 3P92A 5PTPA 3SHAH 2H1UA 4JZ1A 1KIGH 2H6MA 7LPRA 1BBRH 2ZEBA 4ABGA 1V2LT 1TRYA 3LPRA 1MTWA 5GPIB 2KCYA 3UNRA 2WPLS 2R2MB 4AYYB 2AGEX 4NZQA 1B7XB 1GI1A 5C2ZA 2XYAA 3FN8A 4K8YA 2QGRA 3GY6A 1O5GH 4VGCC 3SUFA 3ZZ5A 1NRNH 1HAHH 1H9LB 2D1JA 4K8BA 3DSOA 3MI4A 4TPYA 1S85A 3VFEA 5C0UA 1MCTA 2RG3A 2GP9B 2CF9H 2BZ6H 5FPYA 1QBOA 2FOAA 2RDLA 1N6XA 2VH0A 3MTYA 4WH6A 5EW2H 3MU4A 3TU7H 4FUDA 4D9RA 2VINA 1C5WB 3MNSA 1E34B 2G4UA 2B9LA 2ZQ2A 2EA3A 3PLBA 2ZDMA 1ETTH 1G2MA 3GDVA 3C1KA 1P09A 1UK3A 1ZOMA 2BY7X 3KYGA 1OSSA 4KTSA 1QGFA 1O33A 2WPMS 2A45B 4XOJA 1LHGH 5C0TA 2H9HA 4RN6A 4ZKRU 2ZGHA 1DX5M 1D9IA 2ODYB 4P02A 1TE0A 1C5ZB 2P16A 3KGPA 4THNH 1LPKB 4XE4A 2GV6A 1C2DA 1EZXC 4Y76A 1RD3B 3MU0A 1TPPA 5FX6A 4GPGA 2DE9A 2FTLE 2WPIS 2Z94A 2FODA 1GL1A 4MQAA 5I25A 1EASA 2ZFPH 1HCGA 4H6TA 1HDTH 2FO9A 1FY4A 1UCYE 1BTZA 4K60A 1GJBB 4Y8YA 4ZKSU 1EB1H 2BY6X 2RDEA 5JPMH 1UJ1A 3BG4C 1AVWA 5BRRE 2C93B 1NM6A 1HBTH 2BDHA 1C5VA 2TBSA 4YO9A 2RA0A 4LZ4B 3A84A 3MU1A 1AZ8A 4I8KA 1GG6B 1ZR0A 1XUHA 3V13A 1ETRH 4DCDA 1FIZA 2EI6A 3OYPA 8ESTE 1HJAC 1AMHA 4RKOB 3ZZ7A 3SI3H 1BTYA 1LVYA 5A8ZA 1F2SE 2AGGX 1GJ4H 2VWOA 1C4V2 3M5NA 1QTFA 5EW1H 3FP6E 2BD3A 1Y3UA 2ZDAH 4FUCA 1ZHRA 1BITA 4UFGH 3RXRA 3BEIB 1Y5BT 2AMQA 1O5EH 1ZRKA 3B23B 3TPIZ 2BD4A 1PPBH 1K1NA 1NRRH 3F9GA 4UFEH 3GDUA 1BTXA 2CF8H 3LGIA 2SGDE 5CHBA 1P06A 1FX0B 1EJAA 5TCCA 2JJ2D 4UD9H 1TA6A 1BBRE 2BVXH 6GCHG 2XC0A 3SJOA 1GI7B 3F9HA 1HAYB 3GCHB 1HIAA 2BZAA 1P02A 3SN8A 4K2YA 4HFPB 3PTNA 3A81A 4ABAA 2BOKA 1C1OA 1QBNA 1SC8U 2D8WA 1UVTH 2AMDA 7KMEH 1P05A 1TPSA 5FCRA 3LT3A 1ANDA 2GT8A 1EJMA 2XBXA 5KEDA 1VJ9U 2IOTA 1G2LA 2XW9A 1EXFA 3JZ1B 1TMUH 1P0SH 2HNTC 2VVVA 1K22H 4I31A 2R0LA 1GVKB 4BXWA 3NZIA 3W95A 3SI4H 3UFAA 4Q7XA 2UUYA 2WV9A 2ZU1A 2EEKA 1Z6EA 1TPAE 2A2XH 1HAPH 4DOQA 1YPLH 1YWUA 1J14A 5FX5A 2HPPH 1HLTH 2KCOA 3IWMA 1NN6A 3SO3A 1DWEH 4NA9H 4E05H 4NSYA 1GWAA 1OWKA 2BQ6B 1N6YA 1O3HA 4DY7B 4ZKNU 5EJZA 1YC0A 1QB1A 1BTPA 3RXTA 1P2QA 1C5RA 1YYY1 2H2ZA 2W3IA 1AU8A 3PB1E 1THRH 2ZPRA 1BTWA 2Y5GA 4X1QU 4CHAB 4F4OC 1OXGA 1Y3XA 4Y71A 2VGCB 1EAUA 1BMMH 1ZMLA 3UUZA 3H7TA 1BRUP 2OC7A 4NA8A 3SJ8A 2M2AA 2XBWA 3E3TA 3KQCA 4ZUHA 1WQSA 2O9QA 5DP4A 1HV7A 3GY3A 1O2JA 1GJCB 1ZHPA 3RXMA 4NWLA 4AFSA 1C4U2 2VH6A 2PFEA 2THFB 5F6MA 4XFQA 2IJOB 1C2JA 5JBCS 3RXOA 1LHFH 5E0HA 1W7XH 1EJNA 1O2KA 3LJJA 1D6RA 1F5LA 3FKSD 2EI7A 2H9TH 1PQ8A 1UTPA 1EOJA 5B6LA 2QF5A 1EQ9A 3FZDA 3LDXH 3O8BA 3VB3A 3SGAE 2BDCA 5C17A 5GXPA 2AS9A 1PPHE 4ABDA 1T31A 4RT0A 2P3TB 1KXBA 2BD5A 1IAUA 1NU9A 2ZHEH 2QY0B 2BXTH 1MBMA 2WPKS 4VGCB 3LGVA 2LNCA 3RXCA 2RFKC 4XRNA 5C5OA 5FAHA 3BV9B 4ACBA 1BMFD 5AFYH 1NROH 2Z6BD 1C1NA 1LVMA 1TPOA 4IN1A 5JYIA 5GCHG 3I29A 2P93A 2OC8A 2R9PA 1O3IA 4IBLH 4AB9A 4ZHAA 2PTCE 3SQEE 1OS8A 1ZSKA 4B74A 2XTTB 4AZ2B 1V2ST 2VIWA 1HXFH 2W3KA 5TJXA 1Y3VA 3HK6B 5FBIA 2FXRA 5I46H 1SB1H 4MNWA 4JZIA 1DOJA 1YBWA 8GCHF 1IQKA 1P11E 1U6QA 1ID5H 3QDZB 1G9IE 1DXWA 1EP5A 4BAHB 5L30H 4ISHH 2TGTA 9LPRA 1H4WA 4Y10E 2J95A 4R0IA 2BLVA 2FP7B 2FS8A 1W2KH 2ALPA 3G01A 3LONA 1AFQC 1V2RT 1FJSA 1BHXF 1XXDA 2V3OH 2ZFRH 2ZTXA 3DCLA 1VR1H 5CHAC 4ZMAH 4B71A 1FY3A 2VIQA 1MQ6A 2A7CA 3T5FH 1LDTT 3M36A 3FFGA 4NG9H 4A1XA 8KME2 1SLVB 1TQ0B 1SFQB 1SBWA 4B76A 3M5MA 3MMGA 3PMAB 1FY5A 2OINA 3BG4B 5FBEA 2PR3A 1W0KD 1SOZA 4Q63A 3BTKE 3A7XA 3D62A 1SGDE 1MZDA 1W11U 4AB8A 4AG2A 3F0OA 1LMWB 3BTTE 1C1MA 4ISNA 3ZYEA 5EXMA 3PMJA 4RI0A 3ZVEA 2GD4B 1CT0E 4X8SH 3A80A 2TGDA 2FOGA 2XWAA 4WF8A 3T2NA 3K65B 2P3FH 1GMDF 4TYDA 1E1RD 3RXDA 4B1TA 3ODDA 5T6GA 1IQIA 4GHTA 1O34A 6GCHF 5DK1A 1HAGE 2BY9X 3S0NA 4IW4E 4IC5A 1YCPH 1AE5A 3ZZ8A 3MQKC 1LO6A 1DLEA 2JKHA 1YLCA 5EG4A 3I77A 3M5OA 3PV5A 4XDEA 5EJLA 1EPTC 4Y0YE 3EQ0H 5E2OA 1MKXH 1GCTC 5JB8S 3VXEH 1KXCA 3RM0H 2V35A 3TNTA 2G5NA 1ZMNA 3KL6A 1LPZB 2J9NA 3NUMA 2OD3B 1WTHD 1TGNA 4AG1A 3Q00A 2JDID 5EGMA 1XX9A 5E0JA 1BT7A 1QB6A 3TLOA 3PRBA 3C27B 3EE7A 4I8GA 3EAJA 3RXQA 4HG6A 9ESTA 1DS2E 1W14U 2P8OC 4Z1MD 4CRBA 1NS3A 1GJ8B 1UVPA 3OEHD 3RXGA 3MO3A 3WWFA 1FY8E 1K1IA 1QRXA 1TBQH 1QRZA 3TK9A 3A86A 1FZZA 2P59A 5HIYA 1ELTA 3OTJE 2XOKD 3CS7A 5EJ1A 1G3CA 1IQHA 2GV7A 3MH4A 3BN9A 2YNAA 1DFPA 2JH0D 4SGBE 3MO6A 4KKDA 4YT6H 2YMSD 2CMYA 1INCA 1FN6A 1V3XA 1YPHE 1GBHA 1PPEE 1SG8B 1L0ZA 1SGCA 4K3JA 1O3LA 1RXPA 2W26A 4A6LA 1BZXE 2OK5A 3F9EA 1WTGH 5KGOA 1XUGA 3LOXA 1GBCA 3GYLB 1O3BA 2FX6A 1EB2A 2ZG0H 1RFNA 1RS0A 3RMNH 5FL7D 1FQ3A 2ODPA 1DUEA 2ZU5A 3HATH 2VIVA 3TGJE 2J94A 1T8NA 4TT3D 2FI5E 1V2WT 3QZQA 1BRBE 1CVWH 4INKA 1QQUA 2J34A 2NU3E 3T28A 1GGDC 1GI4A 3UQOA 2ANWA 1B0EA 3SW2B 3KEEA 2CHAC 4NIWA 3PTBA 5DG6A 3P70B 2FOEA 4X6PA 1KXDA 2OUAA 1XUKA 2ESTE 3SV6A 5DO4H 2M5TA 2OBOA 2WYGA 2FLBH 1KLIH 1QNJA 2AGIX 1HPGA 1YCPK 1SQOA 5HKKD 4H42U 1CQQA 5DP8A 2CJIA 3SUEA 1PFXC 4D76A 1YCPM 1AQ7A 2PLXA 4O97A 5GCHF 3FP8E 1O3GA 1A5IA 2ZCHP 1YKTA 3F3BA 4B2BA 2B0FA 4JZDH 5ESTE 1MKXK 2TIOA 4ABFA 2XWBI 2FIRH 1E35B 1CE5A 4YESB 3VB6A 1EKBB 2J38A 3ATKA 2QA9E 4AORA 4AX9H 1AVGH 1LHCH 3RU4T 1C5TA 3PV2A 4U2WA 1UTJA 1BTHH 1GHBG 3A87A 4MTBA 1NFYA 3BEFB 1FAXA 2KFWA 2ZCKP 3SU4A 2QXGA 2SGFE 1AB9B 1JRSA 2F9BH 1QL8A 2O8LA 3E90B 1A46H 2VIDA 4ABHA 1EATA 5JBTA 3NCLA 1GBEA 4X6MA 3U69H 1WCZA 2L74A 2Q6DA 2ZFTA 3LU9B 1AFQB 1E1QD 1NBMD 3DT0H 5CHAB 2ZHQH 1FDPA 1Q3XA 2EQNA 3RU4D 3N7EA 1MZAA 4X1PU 1O2QA 1UVSH 4CREA 1E79D 3KN2A 5LPFA 3PRDA 3F6UH 3P8GA 4OGYA 1EP6A 2V3MA 3QGNB 1IOEA 1BHXB 2VVCA 3GICB 5DP7A 4WJG2 4XD7D 2WINI 4I8JA 4JYVH 1TNGA 1ZLRA 3AAVA 1ANBA 1TNIA 2ZDKA 1BOQA 2ASUB 1O39A 3FO8D 1GJDB 2QIQA 4ZAEA 5IYTA 1ELCA 2KCAA 3RXPA 3LGWA 1GI3A 1VJAU 2ALVA 2J97A 2XNDD 2ODQA 3RC4A 3LJOA 4ABJA 1CSOE 5FCKA 1AI8H 3NRLA 1SGQE 2W6JD 2PHBA 1IHTH 1DANH 3QGJA 2K8IA 4X6NA 4FUHA 4XBBA 4LXBH 3RXHA 4BXSA 1Z8IB 4ZCNA 1LKBA 1ZJDA 1QIXB 1H8IH 2Z7FE 1F92A 4K1SA 1UTMA 2FWWA 3TGKE 1J15A 1KYNA 1W0JD 2Z9LA 1EPTB 1ANCA 1W3CA 1BB0B 1VITG 3E0NB 1GCTB 1TNLA 4XBCA 3FZZA 1MMJN 3MOCA 2Y82A 1THSH 1W10U 4X0WU 1A5HA 2GX4A 4Z0KA 4TY7A 1V2UT 5T6DA 8LPRA 1TLDA 1F0UA 2OCVB 2OP9A 1NFXA 2KR7A 2QXJA 2QYIA 2BDIA 2P8OB 2C3SA 1NFUA 3URCA 2VU8E 4MLFB 1XUFA 1ZYOA 3ZVGA 1WBGB 4DT7B 3E8LA 3EA9A 1B5GH 2FYRA 2HOBA 3A7ZA 3GCNA 1XVOA 2FI4E 1J17T 1HFDA 1DUAA 4J1YA 1O2VA 1WOFA 1UCYK 3L33A 5J4QA 3MO9A 4LZ1H 2SGAA 1ZTLA 3PYHA 2VWLA 1C5NH 3SQHE 1K9OE 2LPRA 2SGEE 4OS4A 3RC5A 5JBAS 1PQ5A 2D2DA 2BD9A 4ZHLU 3ZZAA 1C5YB 2YOLA 4IN2A 1O2HA 1TIOA 3N99A 4YTAA 3TJNA 3GY8A 2ZECA 3UOUA 3ELAH 1T32A 2CN0H 1QBVH 2BQWB 4GVUA 1SLXB 2PSXA 2BLQA 1Y8TA 2Q6FA 2A31A 2FPZA 3M3VA 3OE7D 1LKAA 2AIQA 2QXIA 3I78A 4MNVA 1P10A 3CP7A 1KDQB 2A5AA 1OYQA 2FI3E 3MNBA 3DD2H 2QF3A 1TX8A 1UHBA 1C1RA 4FOUC 5E2PA 4GLYA 3KIDU 2GZ8A 1DPOA 1ACBE 1GGDB 2H5DA 4XSKU 1ZRBA 1MUEB 2JIZD 1WXRA 4FVDA 6LPRA 4IMQA 3UTUH 3DA9B 1YPGH 1O37A 2CHAB 2BDAA 2Z9JA 1PPGE 1BBRK 2KAIB 1SGTA 1YPKH 1AKSB 3OY6U 3OFND 4Q4LA 1ZMJA 4ZKOU 3VEQB 1D3QB 3K2UA 4R8TB 1EUFA 3ESTA 3KF2A 3SU0A 1DICA 5FPSA 2ILNA 1P8VC 3H09A 2ZU3A 2BVSH 3KQDA 1O2NA 5DP6A 3AW1A 5L6NH 5DJ7A 4CH2B 3WWBA 3SU1A 4JK5A 4X1RU 2G52A 1HGTH 3PWBA 1ELVA 2ZGXH 3T27A 1HAOH 1S6FA 1Z8JB 3F0PA 1VCQA 1GBJA 1GBLA 4I8HA 4HGCA 2QF0A 1BTUA 5A2MH 1C9TA 1GMHG 1AWFH 1DSTA 2XCNA 1K28D 2NWNA 1GJAB 5JB9S 4MPWA 4NWKA 1TNHA 3ZIAD 1Z8GA 4TPIZ 1GHBF 3RXJA 4YLQH 1PQ7A 4ISLA 1OWIA 2Y7XA 1MU8B 1O3PB 2J98A 1C1VH 3L6PA 5F03A 3B8JA 2FOHA 1KTSB 1T4UH 3K6YA 1C2FA 2C8ZB 1O2RA 5A09A 1HJ8A 4UDWH 1O2XA 3A85A 2ZI2H 5EOKA 2F43B 5HM9A 2ZFQH 2RCEA 1XVMA 3F1SB 4X2WA 1E0FD 1MBQA 5F53A 1EZSC 1UTKA 2PSYA 1O2MA 4B73A 3U8RH 4Y11E 1PPFE 2CGAA 2A5IA 3M7UA 3GS9A 1GI5A 3SV9A 1AUTC 1G3BA 3GCTF 1SGPE 2I6SA 2NU4E 4WWYA 3SBKA 4WXVA 4OS7A 1LVBA 3UNQA 3QTOH 1E36B 2F91A 3SUGA 5J4SA 1IQEA 1GBMA 1CA0B 1L1GA 1L1NA 1COWD 1QJ1B 4Y8XA 4GCHG 4DGJA 4NFEA 3DFLA 2Y81A 4YXWD 1PYTD 2KX4A 1GBBA 1TALA 2GJGA 1P03A 2XBVA 5T1VA 3K6ZA 4GHQA 3E1XB 2ZPQA 3D23A 3TITA 2W5EA 3S9CA 5AFZH 1A1RA 3QO6A 3ITIA 1TGBA 1C5SA 1TGCA 5DP9A 1ZSJA 3VXFH 4HZHA 3QN7A 1HAVB 2GZ7A 3LGYA 4CRFA 1V2PT 3R0FA 3D65E 4DT4A 2ZTYA 1KXAA 1C2IA 1FLEE 3OTPA 1W13U 5DSFA 2BD8A 2WYJA 2ZDVH 1NT1A 1V2KT 1EOLA 1VITF 4JMYA 4ABBA 1MAXA 4NCYA 3V0XA 3PO1C 4J2YB 1TGSZ 3URDA 1UW7A 1FXYA 5C5NA 5HGGA 3RMOH 3ZVBA 1TBRH 4JCNA 4ABEA 1BRCE 2K0QA 3LH3A 5LGOA 5HXFA 1RTFB 4ISOA 1UK4A 1YLNA 4DG4A 3TH3H 5C94A 1ORFA 3QX5H 4CR5A 1WU1A 3Q77A 1G37A 2FYQA 1S81A 2BX3A 1UVUH 4X1SU 2STBE 3PM3A 1TYNA 3EE0B 2F3CE 1AN1E 4Y79A 2ZFSA 3VG8A 2ZTZA 4INLA 2BB4A 1AB9C 1OPHB 3SV2H 3BIUH 2Z3EA 1TWXB 2A7HA 7GCHG 3U1JB 2F9OA 2BQ7B 4ZROA 1O3CA 1P2KA 3U28C 1ZGIA 3SUDA 4CBOA 3TH4H 6CHAC 2PUXB 2ZPSA 3PLKA 4QT8C 2D26C 5GNDA 3EGKH 3S9AA 3GY7A 3LC3A 2BYAX 2BXUH 1YPEH 3E0PB 4OM9A 5C67A 3NWUA 1CGJE 4OS5A 1D3TB 2HVXA 1OWDA 4ZXYH 3A7VA 1L4DA 4X2XA 4K1EA 2FOCA 4X1NU 4FUBA 1SGFA 2ZF0H 4M7GA 1ARBA 1RJXB 1HUTH 3MNXA 4B2AA 1O3EA 1A0LA 1DE7H 3UWJH 1O3KA 4O03A 3VB4A 5DP3A 4UE7H 4FUFA 1HRTH 4FXGH 4FUEA 2GGVB 3BTME 2VVUA 1Z8RA 2O8WA 2BD7A 1A5GH 1AIXH 3UOPA 3ZZ3A 2PV9B 1GVLA 1AWHB 1RTKA 3A88A 1P9SA 1BUIA 3TJOA 2BDGA 4I7YH 2HPQH 4KTCA 2F9UA 2GTBA 2ZC9H 2BLOA 2G4TA 4BTTB 2ZNKH 1BRAA 3RXBA 2WPDD 1FPHH 3AVZA 1N1LA 1G3EA 2WSSD 1ELBA 1MTNB 2L6OA 3N7DA 1UTLM 2CXVA 5GIBA 5T6FA 3MH7A 3KQEA 3SV8A 2OLGA 1AD8H 4CRAA 4JZFH 3T25A 4BANB 3SU3A 2QN5T 3SU5A 1AZZA 4X8TH 1GMHF 3SNAA 2XCFA 1DDJA 1VITH 2WV4A 2OC1A 1SSXA 1A4WH 4CRDA 4CR9A 1SKYE 1O30A 5A0AE 3VB5A
chains in the Genus database with same CATH topology
4YLUA 1O2LA 2QCYA 2C8WB 5C1XA 4Q7YA 1AVXA 4MPXA 3S9BA 1VGCC 2TPIZ 3T29A 3PROA 2W6ID 1CGIE 3ZYDA 3O8RA 1ELEE 4OS6A 3U8TH 1AE8H 1S83A 1N8OB 4O9VA 3SGBE 1EZQA 1JBUH 2SGPE 3CENA 2Z3CA 2QXHA 3ODFA 1XKBC 1YP9A 3MHWU 1KXFA 1JXPA 3LKWA 1L1JA 1BA8B 3MFJA 4WMFA 2VIPA 1SGNE 2J92A 5K7RA 2HNTE 1O3DA 1P57B 2FDAA 4IGDA 3MNCA 1OYTH 4AFZA 3Q76A 3U1IB 1O36A 3A8BA 3RXKA 3UQVA 3SZNA 5LPRA 2C4FH 3GY5A 5A8XA 5BPEA 3V3MA 3ATLA 4F49A 3DFJA 4AGKA 4MNYA 5GJ4B 4MVNA 3MYWA 4Y8ZA 3H5CB 4AN7A 4RKJB 2BD2A 1DWDH 1NBME 2P94A 3ZZ9A 5E8EH 2HLDD 1FI8A 2BX4A 3RU4E 2JETC 1K21H 2Z9KA 4DW2U 4E7RG 2FZZA 1T4VH 2KZ4A 1J16A 2GDEH 2J4IA 4KELA 3ZVAA 1O2WA 3RXEA 3RP2A 2R3YA 2Q6GA 1KMHB 3A82A 1C4Y2 5HM2A 2Y5HA 1DLKB 2SFAA 4YZUA 1UTOA 2FS9A 2UUFB 1SMFE 1WQVH 1BQYA 4MDSA 5F8TA 2BHGA 4Q7ZA 2A7JA 1FONA 3PMHB 2FOBA 4TSFD 3SHCH 1GBKA 3QZRA 1T7CA 3A7WA 4WY3A 3FVFB 3P8NA 2A0QB 3F2GA 1V2JT 1SLWB 4FU9A 1HAXB 2TRMA 2GDDA 2IN2A 3ZVDA 3PO1B 3ATWA 3ZVCA 2WUCA 5EPNA 3RXAA 2PTNA 2VWMA 2BY8X 2WPHS 2PGQB 1H8DH 2ANYA 1ZPBA 4NIVA 2HALA 3EYDA 1O38A 2ZWLH 4Y6DA 1GBAA 1GHWH 4WH8A 3BTFE 2NU2E 3UR9A 3MWIU 2ZP0H 3SJKA 1TQ7B 4X2VA 2A5KA 7GCHF 2GVFA 1P12E 1SGEE 4B6FA 1TA2A 2GZ9A 1V2NT 1GI8B 1O5BB 2WHXA 4JK6A 3E91A 4K5ZA 1HIAB 1DITH 3SNDA 1RIWC 1IQJA 1CT2E 3RLYH 1AHTH 1JIRA 3HK3B 1IQGA 4Q2KA 1CT4E 1UO6A 3F2HA 1GJ7B 3DSPA 3W1EA 5IDKA 2VIOA 4PROA 1F0TA 3P8OA 2OC0A 4FUJA 3AK5A 3NKKA 2B7DH 1W8BH 5FHTA 5JDUB 3A7TA 2F9PA 1FPCH 2OTVA 6CHAB 1O2YA 1TABE 1GBDA 1NC6A 2WV5A 1CA0C 1G32B 1O5DH 1SVPA 1MD8A 2GT7A 1LCYA 1QHRB 1O3AA 2QV1A 2FLRH 3TJVA 1EFRD 1BMLA 1GBTA 1MH0A 1ZPCA 4O3TA 1TX7A 5F8ZA 1C5MD 3LGUA 1CHOG 3ENSB 3GYMA 2ZIQH 1P2MA 4D9QA 3BTQE 3RXUA 4BAOB 5EQQA 3B9FH 5CMXH 1CBWC 1EX3A 3GY4A 2C8XB 1TGTA 3UNSA 4NA7A 4H4FA 4OS2A 1BMAA 2A4OA 3M3TA 3MU8A 1SGRE 3LH1A 1PJPA 2ZZUH 3KNXA 2QC2A 1AFEH 3P95A 4UONA 2PKAB 3BSQA 1SHHB 1J9CH 4KTUA 3GY2A 4MG3A 1SFIA 3FOAA 1KXEA 3IG6B 5SGAE 3OSYA 1EZUC 6ESTA 2ZHWH 1P3CA 1J8AA 2ZGCA 5L2YH 1C1SA 3CS0A 2H9EH 1QJ7B 3V12A 1O2OA 1YPMH 1GHXH 2GMTC 1C5OH 2BVRH 3Q3KA 3AW0A 1FUJA 1VCPA 4JYUH 1ABIH 1TNJA 1LPGB 3TVJB 5IK2D 3HKIB 3LIWA 1QL7A 1LHEH 4RSPA 1EAWA 3UB0A 5HYOA 1ABJH 4O3UA 1UTNA 1C2EA 2CV3A 2VWNA 4DIIH 2J2UA 1VGCB 4H6SB 2AIPA 4CRGA 1JRTA 1GDNA 2PUQH 1C5LH 1CHGA 5A0BA 1ELAA 1S82A 1P9UA 2BTCE 3ZVFA 4FUGA 5L2ZH 2EC9H 4NFFA 2HLCA 2YMSC 1SOTA 3S7HB 2G8TA 3H7OA 4BAMB 1ESBA 3BTEE 1F5RA 2SNWA 4CRCA 1C5UA 5ABWA 8GCHG 2VBCA 1MTSA 1QFKH 3K9XB 4AYVB 3ATMA 3NPSA 1V2QT 2V3HH 1T8LA 2HGTH 1O3OA 4M9FA 4Y0ZE 1DWBH 2F9VA 2XBYA 1WAYB 2SGQE 1JWTA 4KGAA 1MTVA 4GAWA 1MKWH 1O2SA 3M7TA 3T62A 2J5UA 1SI5H 1A3BH 1OX1A 5T3HA 1A7SA 1CU1A 3M35A 1OHHD 1H8HD 2JETB 3RXSA 1QCPA 1S84A 3A8CA 3LC5A 5DN6D 2A1DB 1O31A 3TGIE 2FOFA 1D3DB 4FUIA 2B5TB 1F0RA 1L4ZA 1UMAH 1CGHA 3A8AA 1HB0B 2ZCLP 4TY6A 5DPAA 4TWWA 1MCVA 4NSVA 3PWCA 3UY9A 3ZZ4A 3QTVH 1SR5C 1O2UA 2JH5D 1MTNC 1WV7H 4HTCH 1Y5AT 4E7NA 1BDAA 2BMGB 1FNIA 1YPJH 2XC4A 1W7GH 4IMZA 3S7KB 3ZZCA 2OBQA 3IITA 3SORA 3FP7E 1HAZB 1VCWA 1Y59T 3BG8A 4I8LA 1GMDG 4X6OA 1B0FA 5CE1A 3U9AH 5AVDA 1O5AB 3SNBA 2AMPA 1K1OA 1S0QA 4ESTE 2WUBA 4NIYA 2W7SA 1LVOA 1OWJA 3JZ2B 2BY5X 3GDSA 4D7FA 2HNTF 2A4GA 3EDXB 3MH6A 1N8OC 3GCOA 1SQTA 4FU8A 3SYJA 1F5KU 3T26A 1MABB 1YLDA 4XBDA 1NO9H 1TMTH 1TAWA 3GOVB 3BTDE 1V2MT 2O8TA 1H9HE 2Y7ZA 1GI2A 1ELDE 1IQFA 4FVBA 2ZU2A 3QK1A 1DM4B 3S69A 3TNSA 2KCPA 2AYWA 1S6HA 1O3MA 1TNKA 4ZXXH 1QJ6B 1FMGA 1YPHC 3OY5U 2Y6TA 5FXLA 2G55A 2ZQ1A 1Z1JA 2K1QA 3EA8A 1D3PB 2XXLA 1RIWB 3Q3YA 3L3TA 1OP8A 2BOHB 1CO7E 2XRCA 4JYTA 3ZV9A 1GI9B 3HPTB 5LPEA 1UVOA 1V2OT 1LQDB 1SHYA 1MAYA 2I6QA 1BJUA 2F83A 1CHOF 2G5VA 2W7UA 3U8OH 2GKVE 3BTHE 2BM2A 1FAKH 3STIA 4A7IB 1K1MA 1ESAA 3TIUA 2PKAA 1K2I1 1FIWA 4ZHMU 4LOYH 5C1YA 1QURH 1GHAG 3MH5A 1VZQH 5CDFE 1JIMA 1UK2A 5EXNA 1M9UA 1MKWK 1P04A 1CBWB 1XKAC 1P2IA 2NU0E 1W0YH 1G30B 1SGYE 1TMBH 4YOGA 1Z6JH 3KQBA 1C2HA 1QB9A 3TK6A 3HGNA 1O2ZA 4YT7H 1GDQA 3OAAD 2NU1E 5C3NA 4A1TA 1EPTA 2V0BA 4A5TS 1TB6H 1OWEA 3M61U 1V2VT 2UWPA 4LK4A 3M3SA 2GCHG 2C90B 4U32A 1SGFG 1HNEE 1Z71A 1ZTJA 2ZO3H 1TX6A 1Z1IA 1P01A 2KM0A 3E16B 1C1QA 1C2LA 3D49H 5EQRA 3OEED 1V6DA 3SNEA 1GCDA 1GVZA 1MU6B 2RA3A 4Z6AH 1E38B 1Q31A 4DIHH 1BIOA 1C1PA 1NTPA 1UTQA 3SOSA 4TWYA 1W0ZU 1GBIA 5DKMA 3QLPH 2AEIH 2HRVA 1ZZZA 2GMTB 4K69A 1GHVH 2FX4A 4UFFH 2AERH 1C5PA 1NU7B 1O5FH 4IC6A 5ESBA 1NESE 1NRPH 4INHA 4B2CA 4ABIA 3SJ9A 4SGAE 4WMEA 1GMCG 1RRKA 4D8NA 1LTOA 1S5SA 3KCGH 1KLTA 4NGAH 1T8MA 3U98H 4AGJA 3ATIA 2FEQH 1K1JA 1A2CH 3BF6H 2OQUA 2XNIA 3AASA 4BTIB 2PKSC 2ZFFH 4YM9A 3BTGE 2ZHFH 4ASUD 2Q1JA 5GDSH 1A0HB 4ZH8A 3RXIA 4Q80A 4X2YA 1OP2A 4BNRA 1KDQA 3Q3XA 3O8CA 1XXFA 2TGAA 3V7TA 1KSNA 1G3DA 1Z7KA 1QY6A 2H5CA 5JBBS 1JOUB 3O8DA 1EAXA 4AOQA 1DY9A 2YMSB 2ZHDA 1AY6H 3FANA 1BJVA 1GPZA 3ZZBA 4DVAU 1GJ9B 2JH6D 4A92A 1QQ4A 1YGCH 2UUKB 4ASHA 3R3GB 4KP0A 2KAIA 3RUOA 1DVAH 1AKSA 3QWCH 2HWLB 1OWHA 5EQSA 4AFUA 1ETSH 2ZDNA 2A32A 3N7OA 2AFQB 1KTTB 1MTUA 5G4BA 5HMAA 5AF9H 4X8VH 3VGCC 3P17H 2ZDLA 2ANKH 1H8ED 1GBFA 5A8YA 2GCTC 3F9FA 5H4IB 3SGQE 3PLPA 1O2TA 1C9PA 2VNTA 1V2TT 1JMOH 3SU2A 4FETA 2LELA 1FY1A 1D6WA 1HJAB 1LQEA 3RXVA 3TK5A 7ESTE 1SPJA 2Z9IA 1IQNA 1CA8B 1K1PA 1GL0E 1C1WH 5EXLA 2DE8A 3RDZA 1G36A 1ANEA 1D4PB 2F9NA 3FAOA 2R2WU 1GHZA 3PV4A 1DWCH 1NZQH 1ELFA 5E0GA 5C1UA 1ZSLA 1C1UH 4I32A 3SU6A 1HJ9A 2ANMH 1GJ5H 2IJD1 1EAIA 2TGPZ 1OKXA 5AHGH 1ESTA 2PWXA 1DXPA 1PPCE 2VJ1A 1NY22 1K1LA 4F55A 2R0KA 3RLWH 3RC6A 2Z3DA 2P3UB 4D7GA 1WYKA 1SQAA 4MPVA 4U01A 1S0RA 3LGTA 1GI6A 4UFDH 4CBNA 2FTMA 5ETXA 1HAIH 1QA7A 3NXPA 1AO5A 2FESH 3ZZDA 2QE7D 4GSOA 1YM0A 3RMLH 1O2GH 4MPUA 1O0DH 1MQ5A 2O8UA 2UWLA 1TOCB 4JZEH 3BTWE 4AFQA 4B75A 2A4QA 2ZGJA 3RM2H 1DY8A 1QA0A 2A4RA 3P8FA 3F68H 3WW7A 5LH8A 1O5CB 1SGIB 1YF4A 4GCHF 1PQAA 3A89A 5F8XA 1TOMH 1Q2WA 3TH2H 1QRWA 1NRQH 3OX7U 1GHAF 3TJUA 5DGJA 1T8OA 1C2KA 1C1TA 1HAVA 2YNBA 2O8MA 5C20A 2Y5FA 1GI0A 3A7YA 2Y80A 3M37A 2V7QD 5GWZA 1GG6C 2QAAA 1WSSH 1PYTC 1TFXA 3NK8A 2BDYA 1O3JA 2PGBB 1OOKB 3QUMP 4NIXA 5EODA 2DUCA 1FN8A 1ZTKA 2STAE 1XMNB 3W94A 2ZGBH 3AAUA 2FOMB 1OP0A 2ULLA 2WZQA 2GCHF 2ZA5A 1XM1A 4I33A 1ARCA 1C2GA 4X8UH 5A0CA 1H9IE 1S6LA 1GHYH 4BOHA 1Y3YA 3HKJB 1C5XB 4U30A 1A0JA 2FMJA 3EA7A 1TRMA 2A2QH 2SNVA 5B6OA 2QF4A 1H1BA 4YOJA 1IQMA 2F4LA 4B6EA 3HGPA 3SJIA 1MD7A 1P2NA 1DT2A 1O3FA 5TCAA 1Y3WA 1C2MA 2BLWA 4NZLA 1F0SA 2UWOA 3DHKH 4BAQB 3UPEA 3GCHC 1AUJA 1HXEH 1P2JA 5EU8A 2FM2A 1A61H 1RTLA 1GJ6A 3F2FA 1UHBB 4MNXA 4OS1A 3MU5A 3BIVH 1ELGA 4Y7AA 3UIRA 4OGXA 3GISB 1GMCF 1SLUB 1A3EH 1XUIA 1NPMA 2JJ1D 4DURA 2Z9GA 1ZGVA 4IS5A 4GUXA 3KHVA 1BCUH 1KLJH 1NRSH 3VB7A 1NFWA 1ZHMA 3M7QA 2B8OH 1BMNH 2AH4X 1IQLA 4K1TA 2UUJB 1GDUA 1QR3E 4FU7A 1P2OA 1Y5UT 4WMDA 3PMBB 4HI3A 3ZV8A 3RXLA 3SV7A 1IHSH 1O35A 1X7AC 2OXSA 4CH8B 2PKSB 2VB0A 1AGJA 3UR6A 1TBZH 4DJZB 5FPTA 3SZEA 2AHME 3UREA 2XC5A 4Y7BA 1THPB 1UCYH 2EI8A 2G00A 1TONA 1L2EA 4YOIA 2G81E 3BEUA 2ZKSA 2BDBA 2C8YB 1P3EA 2IPHA 2R3UA 4BAKB 1F7ZA 2OQ5A 1O3NA 4CHAC 1HYLA 2WPJS 4WXIA 2VGCC 5DP5A 2V6NA 3SNCA 1O32A 1QL9A 1ZPZA 1W12U 5EPYA 1C5QA 2CK3D 2G51A 4ISIH 3DUXH 3RXFA 2P95A 1O2IA 2ZU4A 3GCTG 3STJA 1TRNA 3ZZ6A 3OU0A 1SL3A 3E6PH 3UWIA 4BTUB 1DSUA 4UEHH 1E37B 4WVPE 3VPKA 4E06H 1FV9A 1XUJA 3A83A 4A1VA 3WY8A 1ZJKA 3RMMH 1RGQA 3A8DA 3P6ZB 1LHDH 2PW8H 1KY9A 3VGCB 3M5LA 1O2PA 2GCTB 1PPZA 1WUNH 5K0HA 3P92A 5PTPA 3SHAH 2H1UA 4JZ1A 1KIGH 2H6MA 7LPRA 1BBRH 2ZEBA 4ABGA 1V2LT 1TRYA 3LPRA 1MTWA 5GPIB 2KCYA 3UNRA 2WPLS 2R2MB 4AYYB 2AGEX 4NZQA 1B7XB 1GI1A 5C2ZA 2XYAA 4K8YA 3FN8A 2QGRA 3GY6A 1O5GH 4VGCC 3SUFA 3ZZ5A 1NRNH 1HAHH 1H9LB 2D1JA 4K8BA 3DSOA 3MI4A 4TPYA 1S85A 3VFEA 5C0UA 1MCTA 2RG3A 2GP9B 2CF9H 2BZ6H 5FPYA 1QBOA 2FOAA 2RDLA 1N6XA 2VH0A 3MTYA 4WH6A 5EW2H 3MU4A 3TU7H 4FUDA 4D9RA 2VINA 1C5WB 3MNSA 1E34B 2G4UA 2B9LA 2ZQ2A 2EA3A 3PLBA 2ZDMA 1ETTH 1G2MA