3MU1A

Comparison of the character and the speed of x-ray-induced structural changes of porcine pancreatic elastase at two temperatures, 100 and 15k. the data set was collected from region a of the crystal. fifth step of radiation damage
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Chymotrypsin-like elastase family member 1
publication title X-ray-induced deterioration of disulfide bridges at atomic resolution.
pubmed doi rcsb
total genus 65
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2010-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mu1A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mu1A01
1O2JA 3H7OA 4CRBA 2EC9H 3QZQA 4X8VH 1D3DB 1MU6B 1D3PB 1KLTA 3ZZ7A 3O8RA 2CHAB 3PO1C 2ZDMA 3P70B 4AFSA 3M5OA 4BAQB 3KN2A 1GBLA 2FTMA 4B2AA 1CQQA 3RM2H 2UUYA 3RMNH 3MU0A 3UY9A 4YT6H 1LHGH 3MNSA 1VR1H 1EP5A 1C5PA 1SGCA 3GYMA 2ZTXA 4B2BA 3M3TA 5ABWA 1DOJA 5EW1H 2ZEBA 3F6UH 2H9HA 1GGDB 2O9QA 2RA3A 4MVNA 3SU3A 5EPNA 1BTXA 5L30H 4BNRA 3ZZ5A 4NFFA 3W94A 4IGDA 1AVWA 2ZDAH 1GPZA 2GT7A 3GDSA 3SV8A 2GDEH 2GDDA 2C90B 4GCHG 5CE1A 2GZ8A 2KAIA 1BT7A 1YGCH 1THPB 2BY5X 1KLIH 5G4BA 2VWOA 1LVMA 5H4IB 3UWIA 4OGXA 3ZVAA 1BOQA 3A80A 5C5OA 1BUIA 1AB9B 3D23A 5LH8A 3VPKA 2Y82A 4K60A 2ZFPH 3TGIE 1OKXA 3GOVB 4FUFA 5HGGA 4WH8A 2G55A 2FLBH 1DLKB 1W0YH 2ANWA 2W5EA 2FIRH 2ZHEH 1GWAA 1ESBA 3LGTA 3ZYEA 3UTUH 1PPEE 2J38A 5DGJA 1Z8JB 4UDWH 1YP9A 4JK6A 1GBAA 3MU4A 1THSH 2QGRA 3SV9A 1C4U2 3SGAE 2Y81A 2VVVA 3RXUA 2G4UA 4NIVA 3F68H 1VJAU 3GCTG 3UR9A 4B76A 3MH5A 3I78A 3SI4H 3BTGE 1FDPA 3DHKH 1MTUA 2O8LA 2C3SA 2GMTB 2K1QA 1E38B 4DG4A 1KLJH 1UVSH 1FY4A 4ISNA 1QB6A 3LJOA 3ZVEA 2FOFA 5GIBA 1TQ7B 1RFNA 1P09A 2Y5GA 3ZZ9A 2GT8A 1Z71A 4CR5A 1FY8E 2BDYA 4ABHA 1C1RA 2ANMH 1PQAA 3HATH 3BTEE 1NRRH 5AHGH 3RXPA 2R3YA 1WBGB 3M35A 3MOCA 1EZSC 1GMDF 2AGEX 4FUGA 3GY6A 1DS2E 1FNIA 4Y7AA 3K65B 1L4DA 3K9XB 1EOJA 1QRZA 2BD2A 1F7ZA 1QGFA 3L3TA 3T5FH 4FUDA 1H9IE 4J1YA 2A7JA 1LVYA 1AZZA 3SU2A 3M7TA 3STJA 3Q3XA 4AX9H 3VGCB 1MBMA 5JBCS 1D6RA 1UTOA 3URDA 4ABBA 1ZHMA 4LOYH 2UWOA 3H5CB 1QQUA 5K7RA 2FM2A 4K2YA 1F0UA 3RXCA 2WV5A 4X6PA 2F9PA 4NSVA 3U1IB 1B7XB 3U69H 4MNYA 3LJJA 3ZVFA 5CHAC 1AWHB 1ELCA 4GVUA 2WV4A 5FCRA 2HNTC 4MNWA 4NZQA 4X1QU 4E7RG 1O2LA 1JMOH 1PFXC 2P8OC 3Q76A 1NRPH 3RXOA 1C4Y2 4UD9H 5AFYH 1RTKA 2Y6TA 3FANA 1W14U 1TGNA 1GI0A 4IMQA 1HAPH 1P2OA 2BD4A 4CH2B 2H2ZA 1XKAC 2ZIQH 3S0NA 2J94A 2P94A 4A6LA 1ZMJA 2C4FH 1JIMA 4I8HA 1C5SA 4D9RA 3KGPA 3SGBE 4DIIH 1KXCA 3N7OA 3CS0A 3SU1A 3OY5U 1F92A 1KXDA 5HM9A 1OS8A 1C1VH 4ZKRU 2GZ7A 4TWYA 2TGTA 3EE0B 4D7GA 3V0XA 3FP7E 2ZGJA 1FAXA 5ESTE 1Y5UT 2OTVA 3PWCA 1GBKA 1UCYK 5EW2H 3A7ZA 3TITA 1BTWA 1TALA 4FUBA 4INLA 2VH0A 3RXEA 1RIWB 4CHAB 1VITG 2ZFFH 1K1PA 3TIUA 1PPGE 1ZSJA 1V2WT 2PLXA 1O2KA 1A2CH 3TGJE 1CA0B 3RUOA 2J34A 4IMZA 1QNJA 2F9VA 5FXLA 1ZTJA 4NWLA 3B23B 1O3JA 3ZZ4A 2ZA5A 3SHAH 2HNTE 1G30B 1AKSA 3L6PA 1ANDA 1ZGIA 2O8WA 6GCHG 3SU6A 3NKKA 4DGJA 1HAOH 2TGPZ 1J16A 1TX8A 1ZYOA 3LOXA 3UOPA 4MPXA 1GL0E 1WYKA 4XSKU 1S84A 3RMMH 3UOUA 5DO4H 1OYTH 1GDQA 4GSOA 2JETB 4WMEA 1QIXB 1Z6JH 3MHWU 1GBMA 1TPOA 1YC0A 3A7VA 1QBVH 2Z3CA 4HI3A 2VWNA 5EXLA 3SORA 3BEUA 5FX6A 5C3NA 3TJOA 1Y3VA 2RA0A 3GY5A 3KEEA 3PV4A 2WUBA 4NIXA 3UREA 1C5QA 1GHBG 1OXGA 2ZP0H 4WXVA 2G81E 4X1NU 5ESBA 1NZQH 2SFAA 2UUJB 2AERH 1NS3A 3T2NA 1GJCB 2PTNA 2BX3A 2BTCE 1GJ8B 1C9PA 3AAVA 1HJ8A 1C2FA 1TNIA 2B7DH 2Y7XA 2Q1JA 2BLVA 4NCYA 4ZHLU 2ZZUH 1U6QA 1LMWB 3GY4A 1MMJN 4D8NA 2UUFB 2ZU4A 4FXGH 5PTPA 4BTIB 1GJBB 1GMHF 3V13A 1A0LA 1FJSA 1SGNE 1HDTH 1V6DA 1GJAB 3SQHE 2AS9A 3PLKA 1K2I1 3RXRA 3MO6A 2R9PA 4YO9A 5SGAE 1FN6A 1MZAA 2H5CA 1EAXA 1NPMA 2H5DA 2FP7B 1GG6B 3AASA 1O2VA 2ODYB 1SHHB 1CA8B 4PROA 1C2DA 3U8TH 1BRAA 3GCNA 5J4QA 1KTTB 1Y5AT 1DUAA 5IYTA 3T25A 2XNIA 5IDKA 1UVUH 1A5GH 3MO9A 3TJVA 2THFB 3QTVH 2BQWB 5LPFA 4FUCA 4IW4E 2FX6A 5EXMA 1TRMA 2Z3DA 2ZO3H 1ELDE 2R2MB 1ZMLA 4TPYA 3CENA 2VGCC 3SJ9A 1HPGA 3SQEE 1EQ9A 3URCA 1ACBE 1NN6A 1O35A 2V3OH 3F1SB 9ESTA 4CRGA 5FX5A 1O2TA 3A81A 1KTSB 4HFPB 4I7YH 4KGAA 2ZGHA 1MTNB 1EASA 1G9IE 4CREA 4WMFA 1AY6H 2V0BA 1UCYH 1TX6A 4CBOA 2VB0A 4F49A 4WY3A 3A8DA 1HAHH 5ETXA 5DP7A 5F8XA 1GCDA 2FOCA 1VGCC 1TMBH 1MQ6A 5A8YA 1BTZA 1IAUA 1TAWA 2XW9A 1O2ZA 1O3OA 4NZLA 3MYWA 1UVOA 4Y79A 1H4WA 1RTLA 1SVPA 4I8JA 1ANCA 1V2OT 2IOTA 2OINA 1HUTH 6LPRA 5AVDA 1P2JA 4QT8C 3BIVH 1E35B 1K1IA 2F83A 1YPHE 2ILNA 3ATLA 3ZZDA 1PQ8A 2A5AA 4Y0YE 1BA8B 2A4RA 3AW0A 5DJ7A 4MPVA 3GCHC 1O34A 5C1XA 1MH0A 3ZVDA 4DCDA 4ZKSU 3FZDA 4I8GA 1PPBH 1NU7B 2Z9LA 1HIAB 1E34B 1K1NA 1O2MA 2FOAA 1LCYA 3UQVA 1GJDB 2B5TB 4NA9H 2D26C 4BXSA 4OS6A 1CHGA 3E3TA 3A85A 4GHQA 1O3CA 1JOUB 5JPMH 3U1JB 2VIVA 3PWBA 2XWBI 1MUEB 4IN1A 1IQKA 3JZ2B 3FAOA 4Y71A 1AWFH 2W26A 3BG4B 3SOSA 2EA3A 2FLRH 4I8KA 5B6OA 1O32A 1V2QT 1SGEE 1P2KA 4JK5A 3UQOA 2GV7A 1CGJE 1GBHA 2ALPA 2TBSA 2R2WU 5I25A 3S9CA 2VIPA 4ABAA 3ATWA 1IQNA 1IQFA 1EAIA 1QFKH 1EZQA 4VGCB 2Q6FA 1AUJA 2QXIA 2GCTB 2NU1E 4FUIA 1UO6A 3OX7U 5FBIA 1HRTH 1NM6A 4A92A 4X1PU 2OBOA 3EA8A 2VVUA 1BTYA 1LPZB 1HLTH 1G36A 4B73A 1Y59T 1L1JA 4FVDA 3T62A 1NO9H 1Z8IB 1DDJA 3KNXA 1ELTA 2WINI 1GHXH 1P02A 1F0SA 1T4VH 1OWHA 1ANBA 1AUTC 1O2RA 4RSPA 2PR3A 2H9EH 2QCYA 1BMMH 3T28A 4WMDA 1A0JA 1CT4E 2XXLA 3M5MA 3SV7A 1LO6A 4SGBE 5J4SA 4J2YB 3LGYA 3Q3YA 4LXBH 1CT0E 2PSYA 4INKA 1HJAB 1QB9A 1GJ5H 1ZRKA 3GCTF 2ZG0H 2XBYA 1XXFA 1V2JT 2WPKS 3LGIA 2FI3E 1FPCH 2XC4A 4AZ2B 1GDNA 1O3HA 2SGEE 3VB7A 1DXPA 3S69A 1TGCA 4RN6A 1AHTH 1VCQA 2HPQH 1Y8TA 2BVXH 3HGPA 4AYYB 5HMAA 2ODPA 1SSXA 1N8OB 4RKJB 4Z0KA 1NU9A 1ZPBA 2BX4A 1TIOA 2PGQB 1TMUH 4GUXA 2VIWA 3MU5A 2XC5A 1C1NA 1C2GA 4ABIA 5HXFA 1AI8H 3MU1A 1G3BA 1C5ZB 3HK6B 2W7SA 2GMTC 3LC3A 3OYPA 2H1UA 3BTQE 3BTHE 1HAIH 1L0ZA 1TA6A 4A1TA 2AMQA 2A2QH 1WUNH 1FV9A 4CRCA 1SOZA 1V2PT 2HWLB 4ZKNU 1G3DA 1W3CA 1ELEE 5JB9S 1NRNH 1EP6A 3ATKA 4XBDA 1BBRE 1QL9A 2FDAA 2P95A 1PJPA 1T7CA 3L33A 1YPMH 1YF4A 2WYGA 4WH6A 1TNLA 4LZ1H 1NFXA 4DOQA 2CXVA 2EEKA 1AGJA 1AZ8A 3SJKA 3VGCC 2BQ7B 1O30A 4UFEH 3ZVBA 3VB3A 1ZR0A 2A1DB 1PYTC 1RJXB 3U9AH 2BDCA 3SU4A 2ZWLH 4K8YA 4ZXYH 1O2XA 3OSYA 4JYVH 2Z3EA 2BOKA 5JB8S 1SB1H 1TFXA 1C2HA 3ATIA 1KSNA 3BTME 1V2MT 3GDUA 2A32A 2V6NA 2BY7X 1UTLM 5JBAS 1NFYA 2G51A 1BQYA 1AD8H 3E6PH 3C1KA 5EQRA 1YPEH 1LDTT 2A7CA 1QR3E 2J4IA 3A86A 1TPAE 1ZTKA 1O2WA 1QJ6B 3QO6A 3A88A 3RXDA 1JXPA 2FTLE 2GD4B 3SNDA 3SO3A 1ZGVA 2D1JA 5DP8A 4DVAU 3MH7A 5LGOA 2AIQA 5GCHG 4AB8A 3RXBA 3EA9A 1MD8A 3RXIA 1UK3A 2AYWA 2QIQA 1ELFA 2NU0E 4JZIA 5EGMA 4NGAH 2ZGXH 3UUZA 4Y0ZE 3RXQA 2FODA 3A84A 1L2EA 1Q31A 2QF3A 4OS1A 2GTBA 1VITF 2WPJS 3S9BA 1SQOA 1JRTA 1T32A 2BD9A 1GI2A 5DP9A 4X8SH 1SL3A 1TNGA 3SU0A 4SGAE 3LGWA 2D2DA 1O2PA 2FEQH 3TH4H 1NY22 1QL8A 5FBEA 1O2NA 5GDSH 1UVTH 4HZHA 3RC5A 1ARCA 1C2EA 1LQDB 3K6YA 4WJG2 2VWMA 4A7IB 3ELAH 3O8BA 1B5GH 6GCHF 1Z8GA 3GICB 1RGQA 4ABDA 4CHAC 1D3QB 2HNTF 1F5RA 2STAE 2SGQE 1LTOA 1F0RA 1NTPA 2NWNA 1CA0C 2FI4E 3MH6A 5DP4A 4YLQH 1ZTLA 1C1TA 1TNKA 8ESTE 3KQCA 4I31A 4ASHA 1GBEA 4M7GA 1O3NA 1SBWA 3SNBA 1O5EH 1K21H 1L4ZA 4NWKA 4MQAA 3V12A 3ATMA 1AQ7A 3PO1B 2XRCA 2ZU2A 1O3BA 1GDUA 3B8JA 1A1RA 2HGTH 1DWDH 4ZH8A 1C5NH 4D7FA 1CBWC 3QX5H 3MI4A 5TJXA 1PPHE 1N6XA 1AFQB 1GHBF 4MNVA 2ZHWH 2FOGA 2BQ6B 1KDQB 2Z9JA 4F4OC 1DE7H 2A4QA 1OWJA 5JBBS 1C9TA 4H6SB 4NA8A 1FZZA 4TWWA 1ESTA 1OPHB 2BY6X 4Z6AH 1C1OA 1XM1A 4ISLA 2HOBA 4K1EA 1GJ6A 3SJOA 1HGTH 3D62A 1TNHA 1NRQH 5AF9H 1W2KH 1CU1A 1DWEH 1ETRH 1BJUA 3RC6A 1EPTB 1EXFA 5TCCA 1K28D 1QA0A 1OWEA 1QA7A 1DVAH 1NROH 1QTFA 1Z1JA 4O03A 2F9BH 1EUFA 7GCHG 1IQLA 3PLBA 1GI7B 1HAZB 5A2MH 2JH5D 3BTTE 1O3EA 5L6NH 2BZ6H 2JH6D 2ZU5A 4JZFH 4BAHB 1AVXA 2ZTYA 1ELAA 4NFEA 3SW2B 2BVRH 3AAUA 3LH3A 3TH3H 4TY7A 1ZZZA 1W11U 2BDHA 3RXVA 1GHWH 1ORFA 3PTBA 3DUXH 1T8NA 2CMYA 1LVBA 4MPWA 4AGJA 3QN7A 3RMOH 3VFEA 1UHBA 2FO9A 3C27B 3T26A 4JZEH 1RD3B 1O5CB 5CMXH 1GG6C 1XUKA 4B74A 3S9AA 4Y76A 4YESB 2ZCHP 1P2MA 4IBLH 1O3PB 3TJNA 2XTTB 3QZRA 3M5NA 6CHAC 3P8FA 1SC8U 2BMGB 4NSYA 3ZZAA 2ZKSA 3ODDA 4X2WA 2C8YB 2ZC9H 3LDXH 4YTAA 4A1VA 1CE5A 1UVPA 1SMFE 1A4WH 1EAUA 4ZHAA 3E91A 4X1RU 1O36A 1C5OH 1T8LA 1HAGE 2P59A 3SUDA 2ALVA 5DP5A 4AFQA 3FP8E 2GP9B 4NA7A 2XYAA 1KIGH 1GBBA 5A0AE 1GJ7B 1O3DA 2QAAA 2PKSB 2QA9E 2V35A 2TPIZ 3K6ZA 4ZKOU 1X7AC 2Z6BD 4H42U 5EOKA 1ZLRA 1GMDG 1C4V2 3BTWE 3EQ0H 3F9HA 2BM2A 3P8GA 2HALA 4O9VA 2Y5FA 1O2GH 2PKAB 2QYIA 1SFQB 2FYQA 5F6MA 1ELBA 1FPHH 4E05H 1LVOA 2W3KA 1VCPA 4MLFB 5CHAB 1SHYA 1XXDA 2P3TB 4Y6DA 3LGVA 4ZXXH 2BDGA 5DP6A 2ANYA 2P8OB 4ABFA 2YOLA 1ZRBA 2WPMS 4I33A 1ZSLA 3IITA 1CO7E 1EB2A 1NFUA 4UFGH 1GBTA 2C8WB 1PQ5A 1V2ST 2R0LA 4TPIZ 3KHVA 2ZFTA 4XFQA 3SN8A 1Z1IA 1MU8B 1C5YB 1ZMNA 2Z9KA 1YCPK 3ZZBA 5F8TA 2BXUH 1SQTA 1Y3WA 5FCKA 4DIHH 4H6TA 4OS7A 2QN5T 3I29A 2DE9A 1SGFG 1W12U 3PROA 3MH4A 1A61H 1BHXF 1GVZA 1IQIA 3FFGA 4X2XA 3LPRA 4AOQA 2FOEA 3STIA 5EG4A 1NC6A 1MKWK 2IPHA 2FS9A 3LU9B 3A8BA 2A5IA 2PHBA 1P12E 1Z6EA 4Q7XA 1O31A 1EJNA 4WXIA 1YCPM 1YPHC 1WOFA 3SBKA 2Y5HA 4ZHMU 1MZDA 1SR5C 3RMLH 3GY7A 4Q7ZA 3LIWA 3BG4C 1TLDA 4JYUH 3MMGA 3RXJA 1EB1H 3SUEA 3TH2H 2O8MA 1XVOA 4TY6A 3MNCA 1AO5A 3MTYA 1Y3UA 1CHOG 1IQJA 2KAIB 4FU8A 2GCTC 1EJMA 1DUEA 2BDBA 4IS5A 4K5ZA 1QBNA 2LPRA 4JYTA 1C5RA 3M61U 1D3TB 1BCUH 2G8TA 3TLOA 2J92A 1JIRA 4U30A 3A82A 2SGPE 1W8BH 1BTPA 5HYOA 4ISIH 3SJIA 1GHZA 3MFJA 1NFWA 3SNCA 1UTQA 2QC2A 3MNBA 5C1YA 5L2ZH 2VIQA 1L1GA 1EKBB 2BHGA 2JKHA 1TB6H 1BJVA 1A3EH 3S7KB 2NU3E 4FU7A 4K69A 2WYJA 4BTUB 3E1XB 1GCTB 5C2ZA 4WWYA 2G00A 3ZV8A 1O2YA 3QTOH 3VXFH 3TU7H 4ZUHA 4MTBA 1J8AA 2OQ5A 3RXKA 1C2JA 1ARBA 1TQ0B 1O3GA 1S6FA 2PFEA 5TCAA 1GI3A 1RXPA 3SHCH 1K22H 1C5UA 1P8VC 2QXHA 4ZMAH 1MKXK 1O39A 1VJ9U 1SI5H 4Y8ZA 2BD8A 4MPUA 5GJ4B 4GLYA 3RLYH 1N8OC 4O3TA 1DICA 4OS5A 3NUMA 1TGTA 2I6QA 3QDZB 2H9TH 1KDQA 4B2CA 1NESE 5BRRE 2OCVB 2AEIH 1A5IA 1E36B 1VZQH 4UE7H 2YNAA 4BAOB 1TGSZ 1OSSA 2FS8A 1KXFA 2FZZA 3ZZ3A 4ZROA 1IQMA 1SLWB 4JZ1A 3KQDA 3SJ8A 1C1WH 1P11E 2PTCE 1O0DH 1YPKH 1O33A 1SGIB 1UK2A 2VH6A 1TONA 1A5HA 1DITH 2PSXA 4UEHH 2FXRA 5T6DA 1EPTA 4DY7B 1C1PA 1TABE 1THRH 1QHRB 3HKIB 1YPLH 5F03A 2CHAC 4U01A 1WQVH 1B0FA 2GX4A 1AIXH 3KIDU 4DT7B 4AG2A 1GHYH 4ISHH 2NU4E 3FVFB 4K1SA 8GCHG 1DY9A 1O2UA 2AMPA 1O3LA 1WCZA 4GCHF 4OS4A 2BLWA 4DW2U 1ZOMA 1K9OE 1EZUC 1W7XH 1GGDC 2DE8A 1YCPH 3HKJB 4BANB 1XUJA 2ZNKH 1HFDA 1RTFB 3V7TA 5DG6A 3A7WA 4AYVB 3UR6A 8KME2 1ESAA 5GCHF 1O38A 2XBWA 1AU8A 7ESTE 1O2IA 1DFPA 1A0HB 4GAWA 3SI3H 1MKWH 2H6MA 3LT3A 2OLGA 1O3IA 2ZHFH 1K1OA 1UMAH 3RU4T 1FMGA 1WSSH 2A5KA 1GJ4H 3RU4D 1GI8B 1AB9C 4WVPE 1SFIA 1XUIA 4AFUA 5A0BA 3TNSA 1BZXE 1S82A 1FLEE 1DLEA 4AFZA 3NK8A 1TX7A 3T27A 4ISOA 3P95A 2FOHA 1GHVH 3RXGA 2ZDKA 5T6FA 3TNTA 4X2VA 1VGCB 3GYLB 1V2UT 4Q2KA 2W3IA 2TGDA 4X0WU 1Z7KA 3A8AA 1V2VT 1A7SA 2BZAA 3RP2A 1J14A 1GBFA 1SGPE 2TIOA 4ABEA 4DURA 1C2MA 3RC4A 1HBTH 3UNSA 3RXSA 3Q77A 1ETTH 1JRSA 3HGNA 1P2IA 4Q7YA 4KKDA 2B0FA 1YPJH 1F2SE 3GCHB 4HGCA 2G52A 2PGBB 1OP8A 1C1UH 1CSOE 1S5SA 1TPPA 1CVWH 1HCGA 1ZHPA 4NG9H 1G32B 2BD5A 2DUCA 1YLCA 1CGIE 3ZZ6A 3A7TA 3BTFE 1V3XA 3NWUA 1K1JA 4CH8B 2AMDA 4XOJA 4Q80A 3KQEA 2P16A 1GMCG 2VIOA 1ZJKA 4IC6A 4INHA 2ZFSA 2GZ9A 1O5DH 1SGDE 3BN9A 3M3VA 2BY8X 2SGAA 4FUEA 2Z9IA 2XWAA 7KMEH 3TPIZ 1MKXH 2GKVE 2RDLA 2IN2A 3ZVGA 1TRNA 1TMTH 4Y11E 3PTNA 1C5WB 2CF8H 4CBNA 4U2WA 2BLQA 2BB4A 2OUAA 1UTMA 2ASUB 1BTHH 1HXFH 1AFQC 1RS0A 3R3GB 1GHAG 1FXYA 4UFFH 5EXNA 1DX5M 3A89A 4YOGA 3BSQA 3SUFA 2BXTH 2GCHG 1S0QA 1IHSH 3EYDA 1IQEA 1GBCA 1HAVB 1SGFA 4ABJA 7GCHF 1YBWA 2SGFE 2ZTZA 3PB1E 2GVFA 2B8OH 4X6OA 1P2QA 1CGHA 1O3KA 3NCLA 1W10U 1LQEA 1O3AA 1A46H 5I46H 2BY9X 5DP3A 5LPEA 1O3FA 1UCYE 2HLCA 1S83A 1P3EA 1QJ1B 3CP7A 4XE4A 4B71A 1EJAA 1KY9A 2ZI2H 3M5LA 3SGQE 1EPTC 2P3UB 2A2XH 1LPKB 5E0GA 1G2LA 1T8OA 4XBBA 1W7GH 1OWDA 4U32A 3D65E 1O2HA 2AH4X 1GI5A 3IG6B 4LK4A 2J2UA 1P9UA 1PQ7A 1LKBA 2V3HH 3G01A 2XBXA 1SLUB 3AVZA 1Y3XA 4CRDA 1D9IA 4X2YA 2A4GA 1QL7A 3D49H 3UNQA 3E90B 1OWIA 4K8BA 3M7QA 1W13U 2BDAA 3T29A 1GI1A 3MWIU 4BXWA 1XUGA 8LPRA 5T6GA 1NT1A 3I77A 1DXWA 2ZGCA 1FY1A 1RIWC 2BD3A 2ZQ1A 1BMNH 3BG8A 3TVJB 3F9EA 2A4OA 4AN7A 1O37A 3M7UA 5GWZA 2OC7A 2P3FH 1UTJA 3SZNA 1BB0B 1AVGH 1JBUH 5GXPA 2C93B 3RU4E 1AN1E 1BTUA 1TWXB 1VCWA 1D6WA 4O97A 3E0PB 1SLXB 3E8LA 3M37A 3A7XA 4I8LA 4BOHA 1HIAA 1P06A 1HNEE 3ZV9A 1C2IA 1PPFE 1F5KU 1ETSH 3UNRA 1C1QA 1UTKA 1OP0A 1WTGH 1OP2A 1K1MA 5EODA 2PKSC 2QF0A 4X6NA 1HAYB 4R0IA 5A8XA 1SOTA 2JETC 2B9LA 5DKMA 1UK4A 4RKOB 1B0EA 1KXAA 4YOIA 3S7HB 1ZHRA 5BPEA 3LGUA 2ZHQH 1C1SA 1CT2E 4AGKA 1MAXA 2ZPRA 1V2LT 3RM0H 1XUFA 3P8NA 1FY5A 1GI6A 3M3SA 4I32A 1OYQA 1BDAA 2OP9A 2LNCA 1AE5A 1BBRK 1C5VA 1C1MA 2QV1A 3MNXA 1C5MD 4R8TB 1BMLA 2ZDVH 2Z9GA 2R3UA 1EZXC 5EQQA 1ZPZA 1GI9B 3RDZA 1DWCH 3SUGA 4A5TS 3DFJA 3EAJA 2OD3B 2WPHS 1TOCB 3A7YA 2J9NA 4KTUA 3RXHA 3MU8A 4UFDH 1Y3YA 1O2SA 3PLPA 2STBE 3IWMA 3V3MA 2F3CE 1EAWA 1C2LA 3P8OA 2ZCKP 5FPTA 1P9SA 2ULLA 1KXEA 1TBZH 1O2OA 3B9FH 1IQGA 1EOLA 3KL6A 3PYHA 2ZDLA 4O3UA 2A7HA 1QBOA 1E37B 2F91A 1SGRE 3BV9B 4OS2A 3VXEH 1SQAA 3ENSB 3TK9A 1SGQE 3EDXB 6ESTA 1SG8B 5E0JA 3GISB 1CHOF 3TK6A 2EI8A 1GI4A 1KXBA 3QK1A 1F0TA 4FVBA 2ZU1A 3Q3KA 4KELA 2SNWA 1QRWA 2VNTA 1QRXA 2JH0D 2VINA 3EGKH 5E0HA 4TYDA 1J17T 2ZF0H 3FZZA 1UTNA 1S85A 1QURH 1YLDA 4D76A 5A09A 2SNVA 4FUHA 2ZGBH 1AE8H 1AMHA 2BDIA 1ANEA 3SNAA 1SGTA 1BRCE 2D8WA 3TGKE 3NXPA 4X1SU 1INCA 3BTDE 3ZZCA 4D9QA 3P92A 4UONA 1OWKA 2OXSA 3UFAA 1MTNC 1MTSA 1E0FD 1YYY1 1GVLA 3KCGH 2F9NA 1DY8A 4B1TA 2C8ZB 3PM3A 1FI8A 1FAKH 1N1LA 4K3JA 5C1UA 3LONA 1NRSH 2RG3A 2VIDA 2FWWA 3QGJA 4H4FA 1CBWB 1Q3XA 1G2MA 1GBJA 2PWXA 4ZAEA 1MTWA 4JCNA 4THNH 5FAHA 3P6ZB 4Y7BA 2EI6A 1N6YA 1Z8RA 3SNEA 1GCTC 1P57B 1ELVA 1TRYA 4Y8XA 1L1NA 5A8ZA 3PMAB 1P05A 1MD7A 2G5NA 5JBTA 1SGYE 1SPJA 1T31A 2GGVB 1MAYA 5E2PA 5JYIA 1H9LB 2R0KA 1P10A 3H7TA 1OX1A 1P01A 2ZPQA 4NIYA 1GBIA 2OQUA 1J15A 3RXTA 1S6HA 1OOKB 2BYAX 2CF9H 1H8DH 2F9OA 1XKBC 4FU9A 4A1XA 4OGYA 1HAVA 1O2QA 3QWCH 1C2KA 1DT2A 4GHTA 2UWPA 2FI5E 2PUXB 4B75A 4XDEA 3ZZ8A 4DJZB 5E2OA 1FONA 5F8ZA 2G5VA 3WY8A 2QY0B 3A83A 5C5NA 8GCHF 1DSTA 3U8RH 3BEIB 1BBRH 3U98H 4ABGA 2C8XB 3PMHB 4JMYA 1MCVA 3GCOA 2ZPSA 3PMBB 1TBQH 2OC1A 3RXLA 1DM4B 3RLWH 1UJ1A 2UUKB 3F9FA 4VGCC 2Z7FE 3JZ1B 2XCFA 2RCEA 3SV6A 2PW8H 2AIPA 2BOHB 2Q6DA 3UWJH 6CHAB 1D4PB 1ABIH 5EPYA 1FUJA 1TOMH 1RRKA 1MBQA 1ZPCA 2XC0A 2WPIS 1YM0A 2Z94A 5JDUB 2J95A 1UTPA 5C20A 1BIOA 1T8MA 2QXGA 2W7UA 4CRFA 4IN2A 1P2NA 2FOMB 4MDSA 4LZ4B 4K1TA 2OC8A 1IHTH 1KYNA 3FP6E 5E8EH 4MNXA 2I6SA 5GPIB 4AB9A 2TRMA 4X6MA 1HYLA 1PPCE 1K1LA 1EX3A 2ZCLP 3BTKE 2AGGX 3CS7A 3DT0H 3R0FA 2VWLA 1TNJA 2NU2E 4E06H 2FX4A 3O8CA 1MQ5A 4X8UH 1W0ZU 4BAKB 3VB6A 3A87A 3BIUH 3K2UA 4X8TH 1G3CA 4BAMB 2FOBA 1WQSA 4Y10E 2AFQB 1FQ3A 1Q2WA 4Y8YA 1FY3A 1HJAC 2XCNA 3VEQB 4BTTB 3GY8A 2WPLS 4AORA 4CRAA 1V2RT 5EQSA 1GVKB 1M9UA 1TBRH 1IQHA 3DA9B 1TYNA 2UWLA 3LKWA 2Y7ZA 1FIWA 5EU8A 3ODFA 3KQBA 5C67A 1J9CH 1HV7A 1WU1A 1TGBA 1LPGB 4KP0A 2F9UA 3HK3B 1WAYB 1GJ9B 1Y5BT 2O8TA 1BRBE 1V2TT 1FIZA 4YT7H 1GBDA 3EA7A 1IOEA 2OC0A 4YOJA 4CR9A 1XX9A 2GV6A 3ITIA 1PPZA 1GMCF 4AG1A 1WTHD 3QUMP 4KTCA 1C5XB 1S0RA 3ZVCA 2ZECA 2Y80A 3TK5A 4HTCH 4WF8A 1LHDH 1EATA 1TA2A 4XBCA 3LH1A 3OU0A 2EI7A 5L2YH 1G37A 5K0HA 1XMNB 1S81A 4GPGA 3F9GA 2ANKH 1P04A 1O5FH 3TJUA 3UPEA 3KF2A 3BF6H 1GMHG 2ZFRH 1P3CA 4E7NA 2A0QB 4JZDH 3SU5A 3VB4A 4YM9A 5FPYA 1DPOA 2WUCA 2Q6GA 1P03A 2FMJA 2SGDE 1V2NT 1O5GH 1GHAF 4NIWA 3BEFB 1ZJDA 1ZSKA 2AGIX 2P93A 2XBVA 3ESTA 3OY6U 1H8IH 2GCHF 3SV2H 2ODQA 1JWTA 2QXJA 2VGCB 3RXMA 3NPSA 1QB1A 1DANH 1C5TA 3GY2A 4YZUA 2CGAA 1DSUA 1MCTA 1G3EA 1BHXB 1QCPA 2CN0H 1HJ9A 1LHEH 3AW1A 1PYTD 2HRVA 3QLPH 1BMAA 1TPSA 3DD2H 1H9HE 1HAXB 2CJIA 2CV3A 2HVXA 2A31A 1V2KT 3DFLA 4YLUA 1TE0A 1XUHA 2ESTE 3UIRA 1GL1A 1A3BH 2YNBA 2G4TA 5FHTA 1FN8A 3NZIA 1BRUP 3P17H 2BVSH 2ZDNA 3O8DA 3U8OH 2VJ1A 1XVMA 1HXEH 2ZQ2A 4IC5A 5A0CA 1QY6A 3HPTB 2VVCA 2FYRA 1UHBB 3PMJA 1WV7H 1T4UH 1ABJH 5DPAA 4ESTE 2OBQA 3RXAA 1YPGH 2TGAA 3MO3A 3E0NB 5AFZH 1SLVB 2BD7A 1LHFH 4MG3A 1VITH 5FPSA 2IJOB 2M5TA 2PKAA 2PUQH 1QJ7B 2O8UA 1AKSB 1O3MA 3W95A 3QGNB 4KTSA 2ZU3A 1YKTA 3GY3A 1O5AB 4FUJA 1LHCH 5T3HA 1AFEH 5LPRA 2FESH 1LKAA 9LPRA 3OTJE 3RXFA 1QQ4A 5DK1A 2FPZA 1P0SH 2HPPH 2PV9B 2ZHDA 1C5LH 1ELGA 3E16B 3ZYDA 2VU8E 1MTVA 7LPRA 5HM2A 1BITA 1O5BB 1ID5H 2A45B 1HB0B 1DWBH 3A8CA 3M36A 3LC5A 3VB5A 1H1BA 2ZFQH 3Q00A 1F5LA 2BLOA 3GDVA
chains in the Genus database with same CATH superfamily
1O2JA 3H7OA 4CRBA 2EC9H 3OEHD 3QZQA 4X8VH 1D3DB 1MU6B 1D3PB 1KLTA 3ZZ7A 3O8RA 2CHAB 3FN8A 2J98B 3PO1C 2ZDMA 3P70B 4AFSA 3M5OA 4BAQB 3KN2A 1GBLA 2FTMA 4B2AA 1CQQA 3RM2H 2UUYA 3RMNH 3MU0A 3UY9A 4YT6H 1LHGH 3MNSA 1VR1H 1EP5A 1C5PA 1SGCA 3GYMA 2ZTXA 4B2BA 3M3TA 5ABWA 1DOJA 5EW1H 2ZEBA 3F6UH 2H9HA 1GGDB 2O9QA 2RA3A 4MVNA 3SU3A 5EPNA 1BTXA 5L30H 4BNRA 3ZZ5A 4NFFA 5DSFA 3W94A 3OFND 4IGDA 1AVWA 2ZDAH 1GPZA 2GT7A 3GDSA 2JIZD 3SV8A 2GDEH 5HIYA 2GDDA 2C90B 4GCHG 5CE1A 2GZ8A 2KAIA 1BT7A 1YGCH 1THPB 2BY5X 1KLIH 5G4BA 2VWOA 1LVMA 4F48B 5H4IB 3UWIA 4OGXA 3ZVAA 1BOQA 3A80A 5C5OA 1BUIA 1AB9B 3D23A 5LH8A 3VPKA 2Y82A 4K60A 2ZFPH 3TGIE 1OKXA 3GOVB 4FUFA 5HGGA 4WH8A 2G55A 2FLBH 1DLKB 1W0YH 2ANWA 2W5EA 2FIRH 2ZHEH 1GWAA 1ESBA 3LGTA 3ZYEA 3UTUH 1PPEE 2J38A 5DGJA 1Z8JB 4UDWH 1YP9A 4JK6A 1GBAA 3MU4A 1S6LA 1THSH 2QGRA 3SV9A 1C4U2 3SGAE 2Y81A 2VVVA 3RXUA 2G4UA 4NIVA 3F68H 1VJAU 3GCTG 3UR9A 4B76A 3MH5A 3I78A 3SI4H 3BTGE 1FDPA 3DHKH 1MTUA 2O8LA 2C3SA 2GMTB 2K1QA 1E38B 4DG4A 1KLJH 1UVSH 1FY4A 4ISNA 1QB6A 3LJOA 3ZVEA 3DSPA 2FOFA 5GIBA 1TQ7B 1E79D 1P09A 1RFNA 2Y5GA 2GT8A 3ZZ9A 1Z71A 4CR5A 1FY8E 2BDYA 4ABHA 1C1RA 2ANMH 1PQAA 3HATH 3BTEE 1NRRH 5AHGH 3UAIC 3RXPA 2R3YA 1WBGB 3M35A 3MOCA 1EZSC 1GMDF 2AGEX 2KX4A 4FUGA 3GY6A 1DS2E 1FNIA 3NRLA 4Y7AA 3K65B 1L4DA 3K9XB 1EOJA 1QRZA 2BD2A 2WSSD 1F7ZA 1QGFA 3L3TA 3T5FH 4FUDA 1H9IE 4J1YA 2A7JA 1LVYA 1AZZA 3SU2A 3M7TA 3STJA 3Q3XA 4AX9H 3VGCB 1MBMA 5JBCS 1D6RA 1UTOA 3URDA 4ABBA 1ZHMA 4LOYH 3UB0A 1E1QD 3F0OA 2UWOA 3KYGA 3H5CB 1QQUA 5K7RA 2FM2A 4K2YA 1F0UA 3RXCA 2WV5A 4X6PA 2F9PA 4NSVA 3U1IB 1B7XB 3FO8D 3U69H 4MNYA 3LJJA 3ZVFA 5CHAC 1AWHB 1ELCA 4GVUA 2WV4A 5FCRA 3U28C 2HNTC 4MNWA 4NZQA 4X1QU 4E7RG 1O2LA 1JMOH 1PFXC 2P8OC 3Q76A 1NRPH 3RXOA 1C4Y2 4UD9H 5AFYH 1RTKA 2Y6TA 3FANA 1W14U 2J5UA 1TGNA 1GI0A 4IMQA 1HAPH 1P2OA 2BD4A 3SZEA 2H2ZA 4CH2B 1XKAC 2ZIQH 1YWUA 3S0NA 2J94A 2P94A 4A6LA 1ZMJA 2C4FH 1JIMA 4I8HA 1C5SA 4D9RA 3KGPA 3SGBE 4DIIH 1KXCA 3N7OA 3CS0A 3SU1A 3OY5U 1F92A 1KXDA 4TSFD 5HM9A 1OS8A 1C1VH 4ZKRU 2GZ7A 4TWYA 2TGTA 3EE0B 4D7GA 3V0XA 3FP7E 4B6FA 2ZGJA 1FAXA 3F2GA 5ESTE 1Y5UT 2OTVA 3PWCA 1GBKA 1UCYK 5EW2H 3A7ZA 3TITA 1BTWA 2KCPA 1TALA 4FUBA 4INLA 2VH0A 3RXEA 1RIWB 4CHAB 1VITG 2ZFFH 1K1PA 3TIUA 1PPGE 1ZSJA 1V2WT 2PLXA 1O2KA 1A2CH 3TGJE 1CA0B 3RUOA 2J34A 4IMZA 1QNJA 2F9VA 5FXLA 1ZTJA 5C94A 4NWLA 3B23B 1O3JA 3ZZ4A 2ZA5A 3SHAH 2HNTE 1G30B 1AKSA 3L6PA 1ANDA 1ZGIA 2O8WA 6GCHG 3SU6A 3NKKA 4DGJA 1HAOH 2TGPZ 1J16A 1TX8A 1ZYOA 3LOXA 3UOPA 4MPXA 1GL0E 1WYKA 2KM0A 4XSKU 1S84A 3RMMH 3UOUA 5DO4H 1OYTH 2WZQA 1GDQA 4GSOA 2JETB 4WMEA 1QIXB 1Z6JH 3MHWU 1GBMA 1TPOA 1YC0A 3A7VA 1QBVH 2Z3CA 4HI3A 2VWNA 5EXLA 3SORA 3BEUA 5FX6A 5C3NA 3TJOA 1Y3VA 2RA0A 3GY5A 3KEEA 3PV4A 2WUBA 4NIXA 3UREA 1C5QA 1GHBG 1OXGA 2ZP0H 4WXVA 2G81E 4X1NU 5ESBA 1NZQH 2SFAA 2UUJB 2AERH 1NS3A 2J97A 3T2NA 1GJCB 2PTNA 2BX3A 2BTCE 1GJ8B 1C9PA 3AAVA 1HJ8A 1C2FA 1TNIA 2B7DH 2Y7XA 2Q1JA 2BLVA 4NCYA 4ZHLU 2ZZUH 1U6QA 1E1RD 1LMWB 3GY4A 1MMJN 4D8NA 5EIYA 2UUFB 2ZU4A 4FXGH 5PTPA 4BTIB 1GJBB 1GMHF 3V13A 1A0LA 1FJSA 1SGNE 1HDTH 1V6DA 1GJAB 3SQHE 2AS9A 3PLKA 1K2I1 3RXRA 3MO6A 2R9PA 4YO9A 5SGAE 1FN6A 1MZAA 2H5CA 1EAXA 1NPMA 2H5DA 2FP7B 1GG6B 3AASA 1O2VA 2ODYB 1SHHB 1CA8B 4PROA 1C2DA 3U8TH 1BRAA 3GCNA 5J4QA 1KTTB 1Y5AT 1DUAA 5IYTA 3T25A 2XNIA 5IDKA 1UVUH 1A5GH 3MO9A 3TJVA 2THFB 3QTVH 2BQWB 5LPFA 4FUCA 4IW4E 2FX6A 5EXMA 1TRMA 2Z3DA 2ZO3H 1ELDE 2R2MB 3N7EA 1ZMLA 4TPYA 3CENA 2VGCC 3SJ9A 1HPGA 3SQEE 1EQ9A 3URCA 1ACBE 1NN6A 1O35A 2V3OH 3F1SB 9ESTA 4CRGA 5FX5A 1O2TA 3A81A 1KTSB 4HFPB 4I7YH 4KGAA 2WV9A 1MTNB 2ZGHA 1EASA 4YXWD 1G9IE 4CREA 3F2FA 4WMFA 1AY6H 2V0BA 1UCYH 2YMSB 1TX6A 4CBOA 5DN6D 2VB0A 4F49A 4WY3A 3A8DA 1HAHH 5ETXA 5DP7A 5F8XA 1GCDA 2FOCA 1VGCC 1TMBH 1MQ6A 3N7DA 5A8YA 1BTZA 1IAUA 1TAWA 2XW9A 1O2ZA 1O3OA 4NZLA 3MYWA 1UVOA 4Y79A 1H4WA 1RTLA 1SVPA 4I8JA 1ANCA 1V2OT 2IOTA 2OINA 1HUTH 6LPRA 5AVDA 1P2JA 4QT8C 3BIVH 1E35B 1K1IA 2F83A 1YPHE 2ILNA 3ATLA 3ZZDA 1PQ8A 2A5AA 4Y0YE 1BA8B 2A4RA 3AW0A 4XRNA 5DJ7A 4MPVA 3GCHC 1WXRA 1SKYE 1O34A 5C1XA 1MH0A 3ZVDA 4DCDA 4ZKSU 3FZDA 4I8GA 1PPBH 1NU7B 2Z9LA 1HIAB 1E34B 1K1NA 1O2MA 2FOAA 1LCYA 3UQVA 1GJDB 2B5TB 4NA9H 2D26C 4BXSA 4OS6A 2QE7D 1CHGA 3E3TA 3A85A 4GHQA 3DCLA 1O3CA 1JOUB 5JPMH 3U1JB 2VIVA 3PWBA 2XWBI 1MUEB 4IN1A 1IQKA 3JZ2B 3FAOA 4Y71A 1AWFH 2W26A 3BG4B 3SOSA 2EA3A 2FLRH 4I8KA 5B6OA 1O32A 1V2QT 1SGEE 1P2KA 4JK5A 3UQOA 2GV7A 1CGJE 1GBHA 1QZ8A 2ALPA 2TBSA 2W6ID 2R2WU 5I25A 3S9CA 2VIPA 4ABAA 3ATWA 1IQNA 1IQFA 1EAIA 1QFKH 1EZQA 4VGCB 2Q6FA 5C0UA 1AUJA 3WWBA 2QXIA 2GCTB 5C17A 2NU1E 4FUIA 1UO6A 3OX7U 5FBIA 1HRTH 1NM6A 4A92A 4X1PU 2OBOA 3EA8A 2VVUA 1BTYA 2KCOA 1LPZB 1HLTH 1G36A 4B73A 1Y59T 1L1JA 4FVDA 3T62A 1NO9H 1Z8IB 1DDJA 2PP6A 3KNXA 1ELTA 2WINI 1GHXH 2QF4A 1P02A 1F0SA 1T4VH 1OWHA 1ANBA 1AUTC 1O2RA 4RSPA 2PR3A 2H9EH 2QCYA 1BMMH 3T28A 3W1EA 4WMDA 1A0JA 1CT4E 2XXLA 3M5MA 3SV7A 1LO6A 4SGBE 5J4SA 4J2YB 3LGYA 3Q3YA 4LXBH 2W6JD 1CT0E 2PSYA 4INKA 1HJAB 1QB9A 1GJ5H 1ZRKA 3GCTF 2ZG0H 2XBYA 1XXFA 1V2JT 2WPKS 3LGIA 2FI3E 1FPCH 2XC4A 4AZ2B 2WHXA 1GDNA 1O3HA 2SGEE 3VB7A 1DXPA 3S69A 1TGCA 4RN6A 1AHTH 1VCQA 2HPQH 1Y8TA 2BVXH 3HGPA 4AYYB 5HMAA 2ODPA 1SSXA 1N8OB 4RKJB 4Z0KA 1NU9A 1ZPBA 2BX4A 1TIOA 2PGQB 1TMUH 4GUXA 2VIWA 2KFWA 3MU5A 2XC5A 1C1NA 1C2GA 4ABIA 5HXFA 1AI8H 2HVYB 3MU1A 1G3BA 1C5ZB 3HK6B 2W7SA 2GMTC 3LC3A 4FOUC 3OYPA 2L74A 2H1UA 3BTQE 3BTHE 1HAIH 1L0ZA 1TA6A 4A1TA 2AMQA 2A2QH 1WUNH 1FV9A 1OHHD 4CRCA 1SOZA 1WDIA 1V2PT 2HWLB 4ZKNU 1G3DA 1W3CA 1ELEE 5JB9S 1NRNH 1EP6A 3ATKA 4XBDA 1BBRE 1QL9A 2FDAA 2P95A 1PJPA 1T7CA 3L33A 1YPMH 1YF4A 2QF5A 2WYGA 4WH6A 1TNLA 4LZ1H 1NFXA 1EFRD 4DOQA 3WWFA 2K8IA 2CXVA 2EEKA 1AGJA 3SYJA 1AZ8A 3SJKA 4Z1MD 3VGCC 2BQ7B 1O30A 4UFEH 3ZVBA 3VB3A 1ZR0A 2A1DB 1PYTC 1RJXB 3U9AH 2BDCA 3SU4A 2ZWLH 4K8YA 4ZXYH 2XOKD 1O2XA 3OSYA 4JYVH 2Z3EA 2BOKA 5JB8S 1SB1H 1TFXA 1C2HA 3ATIA 1KSNA 3BTME 1V2MT 3GDUA 2A32A 2V6NA 2BY7X 1UTLM 5JBAS 1NFYA 2G51A 1BQYA 1AD8H 3E6PH 3C1KA 5EQRA 1YPEH 1LDTT 2A7CA 1QR3E 2J4IA 3A86A 1TPAE 1ZTKA 1O2WA 1QJ6B 3QO6A 3A88A 3RXDA 1JXPA 2FTLE 2GD4B 3SNDA 3SO3A 1ZGVA 2D1JA 5DP8A 4DVAU 3MH7A 5LGOA 2AIQA 5GCHG 4AB8A 3DSGA 3RXBA 3EA9A 1MD8A 3RXIA 1UK3A 2AYWA 2QIQA 1ELFA 2NU0E 4JZIA 5EGMA 4NGAH 2ZGXH 3UUZA 4Y0ZE 3RXQA 2FODA 3A84A 1L2EA 1Q31A 2QF3A 4OS1A 2GTBA 1VITF 2WPJS 3S9BA 1SQOA 1JRTA 1T32A 2BD9A 1K0HA 1GI2A 5DP9A 4X8SH 1SL3A 1TNGA 3SU0A 4SGAE 3LGWA 2D2DA 1O2PA 5CHBA 2FEQH 2RDEA 1NY22 1QL8A 3TH4H 5FBEA 1O2NA 5GDSH 1UVTH 4HZHA 3RC5A 1ARCA 1C2EA 1LQDB 3K6YA 4WJG2 2VWMA 4A7IB 3ELAH 3O8BA 1B5GH 6GCHF 1Z8GA 3GICB 5KECA 1RGQA 4ABDA 4CHAC 1D3QB 2HNTF 1F5RA 2STAE 2SGQE 1LTOA 1F0RA 1NTPA 2NWNA 1CA0C 2FI4E 3MH6A 5DP4A 4YLQH 1ZTLA 1C1TA 1TNKA 8ESTE 3KQCA 4I31A 4ASHA 1GBEA 4M7GA 1O3NA 1SBWA 3SNBA 1O5EH 1K21H 1L4ZA 4NWKA 4MQAA 3V12A 3ATMA 1AQ7A 3PO1B 2XRCA 2ZU2A 1NBMD 1O3BA 1GDUA 3B8JA 1A1RA 2HGTH 1DWDH 4ZH8A 1C5NH 4D7FA 1CBWC 3QX5H 3MI4A 5TJXA 1PPHE 1N6XA 1AFQB 1GHBF 4MNVA 2ZHWH 2FOGA 2BQ6B 1KDQB 2Z9JA 4F4OC 1DE7H 2A4QA 1OWJA 2YMSD 5JBBS 4B6EA 1C9TA 4H6SB 4NA8A 1FZZA 4TWWA 1ESTA 1OPHB 2BY6X 4Z6AH 1C1OA 1XM1A 4ISLA 2HOBA 4K1EA 1GJ6A 3SJOA 1HGTH 3D62A 1TNHA 1NRQH 5AF9H 1W2KH 1CU1A 1DWEH 1ETRH 1BJUA 3RC6A 1EPTB 1EXFA 5TCCA 1K28D 1QA0A 1OWEA 1QA7A 1DVAH 1NROH 1QTFA 1Z1JA 4O03A 2F9BH 1EUFA 7GCHG 1IQLA 3PLBA 1GI7B 1HAZB 5A2MH 2JH5D 3BTTE 1O3EA 5L6NH 2BZ6H 2JH6D 2ZU5A 4JZFH 4BAHB 1AVXA 2ZTYA 1ELAA 4NFEA 3SW2B 2BVRH 3AAUA 3LH3A 3TH3H 4TY7A 1ZZZA 1W11U 2BDHA 3RXVA 1GHWH 1ORFA 3PTBA 3DUXH 1T8NA 2CMYA 1LVBA 4MPWA 3N99A 4AGJA 3QN7A 3RMOH 3VFEA 4AC9A 1UHBA 2FO9A 3C27B 3T26A 5C0TA 4JZEH 1RD3B 1O5CB 5CMXH 1GG6C 1XUKA 4B74A 3S9AA 4Y76A 4YESB 2ZCHP 1P2MA 4IBLH 5HIZA 1O3PB 3TJNA 2XTTB 3QZRA 3M5NA 6CHAC 3P8FA 1SC8U 2BMGB 4NSYA 3ZZAA 2ZKSA 3ODDA 4X2WA 2C8YB 2ZC9H 3LDXH 4YTAA 4A1VA 1CE5A 1UVPA 1SMFE 1A4WH 1EAUA 4ZHAA 3E91A 4X1RU 1O36A 1C5OH 1T8LA 1HAGE 2P59A 3SUDA 2ALVA 5DP5A 4AFQA 3FP8E 2GP9B 4NA7A 2XYAA 2LELA 1KIGH 1GBBA 5A0AE 1GJ7B 1O3DA 2QAAA 2PKSB 2QA9E 2V35A 2TPIZ 3K6ZA 4ZKOU 1X7AC 3PRDA 2Z6BD 4H42U 5EOKA 1ZLRA 1GMDG 1C4V2 3BTWE 3EQ0H 3F9HA 2BM2A 3P8GA 2HALA 4O9VA 2Y5FA 1O2GH 2PKAB 2M2AA 2QYIA 1SFQB 2FYQA 2J98A 5F6MA 1ELBA 1FPHH 4E05H 1LVOA 2W3KA 1VCPA 4MLFB 5CHAB 1SHYA 1XXDA 2P3TB 3OEED 4Y6DA 3LGVA 4ZXXH 3F0PA 2BDGA 5DP6A 2ANYA 2P8OB 4ABFA 2YOLA 1ZRBA 2WPMS 4I86A 4I33A 1ZSLA 3IITA 1CO7E 1EB2A 1NFUA 4UFGH 1GBTA 2C8WB 1PQ5A 1V2ST 2R0LA 4TPIZ 3KHVA 2KCYA 2ZFTA 4XFQA 3SN8A 1Z1IA 1MU8B 1C5YB 1ZMNA 2Z9KA 1YCPK 3ZZBA 5F8TA 5F53A 2BXUH 1SQTA 1Y3WA 5FCKA 4DIHH 4H6TA 4OS7A 2QN5T 3I29A 2DE9A 1SGFG 1W12U 3PROA 3MH4A 1A61H 1BHXF 1GVZA 1IQIA 3FFGA 4X2XA 3LPRA 4AOQA 2FOEA 3STIA 5EG4A 1NC6A 1MKWK 2IPHA 2FS9A 3LU9B 3A8BA 2A5IA 2PHBA 4DT4A 1P12E 1Z6EA 4Q7XA 1O31A 1EJNA 4WXIA 4ASUD 1YCPM 1YPHC 1WOFA 3SBKA 2Y5HA 4ZHMU 1MZDA 1SR5C 3RMLH 3GY7A 4Q7ZA 3LIWA 3H09A 3BG4C 4Q63A 1TLDA 4JYUH 3MMGA 3RXJA 1EB1H 3SUEA 3TH2H 2O8MA 1XVOA 4TY6A 2IJD1 3MNCA 1AO5A 3MTYA 1Y3UA 1CHOG 1IQJA 2KAIB 4FU8A 3FKSD 2GCTC 1EJMA 1DUEA 2BDBA 4IS5A 4K5ZA 3KYFA 4FETA 1QBNA 2LPRA 4JYTA 1C5RA 3M61U 1D3TB 1BCUH 2G8TA 3TLOA 2J92A 1JIRA 4U30A 3A82A 2SGPE 1W8BH 1BTPA 5HYOA 4ISIH 3SJIA 1GHZA 3MFJA 1NFWA 3SNCA 1UTQA 2QC2A 3MNBA 5C1YA 5L2ZH 2VIQA 1L1GA 1EKBB 2BHGA 2JKHA 1TB6H 1BJVA 1A3EH 3S7KB 2NU3E 4FU7A 5T1VA 4K69A 2WYJA 4BTUB 3E1XB 1GCTB 5C2ZA 4WWYA 2G00A 3ZV8A 1O2YA 3QTOH 3VXFH 3TU7H 4ZUHA 4MTBA 1J8AA 2OQ5A 3RXKA 1C2JA 1ARBA 1TQ0B 1O3GA 1S6FA 2PFEA 5TCAA 1GI3A 4M9FA 1RXPA 3SHCH 1H8ED 1K22H 1C5UA 1P8VC 2QXHA 4ZMAH 1MKXK 1KMHB 1O39A 1VJ9U 1SI5H 4Y8ZA 2BD8A 4MPUA 5GJ4B 4GLYA 3RLYH 1N8OC 4O3TA 1DICA 4OS5A 3NUMA 1TGTA 2I6QA 3QDZB 2H9TH 1KDQA 4B2CA 1NESE 5BRRE 2OCVB 2AEIH 1A5IA 1E36B 1VZQH 4UE7H 2YNAA 4BAOB 1TGSZ 1OSSA 2FS8A 1KXFA 2FZZA 3ZZ3A 4ZROA 1IQMA 1SLWB 1W0JD 4JZ1A 3KQDA 3SJ8A 1C1WH 4OM9A 1P11E 4F55A 2PTCE 1O0DH 1YPKH 1O33A 1SGIB 1UK2A 2VH6A 1TONA 1A5HA 1DITH 2PSXA 4UEHH 2FXRA 5T6DA 1EPTA 4DY7B 1C1PA 1TABE 1THRH 1QHRB 3HKIB 1YPLH 5F03A 2CHAC 4U01A 1WQVH 3ZIAD 1B0FA 2GX4A 1AIXH 3KIDU 4DT7B 4AG2A 1GHYH 4ISHH 2NU4E 3FVFB 4K1SA 8GCHG 1DY9A 1O2UA 2RFKC 2AMPA 1O3LA 1WCZA 4GCHF 4OS4A 2BLWA 4DW2U 1ZOMA 1K9OE 1EZUC 1W7XH 3KQ5A 1GGDC 2DE8A 1YCPH 3HKJB 4BANB 1XUJA 2ZNKH 1HFDA 1RTFB 3V7TA 5DG6A 3A7WA 4AYVB 3UR6A 8KME2 1ESAA 5GCHF 1O38A 2XBWA 1AU8A 7ESTE 1O2IA 1DFPA 1A0HB 4GAWA 3SI3H 1MKWH 2H6MA 3LT3A 2OLGA 1O3IA 2EQNA 2ZHFH 1K1OA 1UMAH 3RU4T 1FMGA 1WSSH 2A5KA 1GJ4H 3RU4D 1GI8B 1AB9C 4WVPE 1SFIA 1XUIA 4AFUA 5A0BA 3TNSA 1BZXE 1S82A 1FLEE 1DLEA 4AFZA 3NK8A 1TX7A 3T27A 3FOAA 4ISOA 3F2HA 3P95A 2FOHA 1GHVH 3RXGA 4RI0A 2ZDKA 5T6FA 3TNTA 3OE7D 4X2VA 1VGCB 3GYLB 1V2UT 3PV2A 4Q2KA 2W3IA 2TGDA 4X0WU 1Z7KA 3A8AA 1V2VT 1A7SA 2BZAA 3RP2A 1J14A 1GBFA 1SGPE 2TIOA 4ABEA 4DURA 1C2MA 3RC4A 1HBTH 3UNSA 3RXSA 3Q77A 1ETTH 1JRSA 3HGNA 1P2IA 4Q7YA 4KKDA 2B0FA 1YPJH 1F2SE 3GCHB 4HGCA 2G52A 2PGBB 1OP8A 1C1UH 1CSOE 1S5SA 5GNDA 1TPPA 1CVWH 1HCGA 1ZHPA 4NG9H 1G32B 2BD5A 2DUCA 1YLCA 1CGIE 3ZZ6A 3A7TA 3BTFE 1V3XA 3NWUA 1K1JA 4CH8B 2AMDA 4XOJA 4Q80A 2JDID 3KQEA 2P16A 1GMCG 2VIOA 1ZJKA 4IC6A 4INHA 2VBCA 2GZ9A 1O5DH 2V7QD 1SGDE 2ZFSA 3BN9A 3M3VA 2BY8X 2SGAA 3F3BA 4FUEA 2Z9IA 2XWAA 7KMEH 3TPIZ 5FL7D 1MKXH 2EY4C 2GKVE 2RDLA 2IN2A 3ZVGA 1TRNA 1TMTH 4Y11E 3PTNA 1C5WB 2AHME 2CF8H 4U2WA 2BLQA 2BB4A 4CBNA 2OUAA 1UTMA 2ASUB 1BTHH 1HXFH 1AFQC 1RS0A 3R3GB 1GHAG 1FXYA 4UFFH 5EXNA 1DX5M 3A89A 4YOGA 3BSQA 1YY3A 3SUFA 2BXTH 2GCHG 1S0QA 1IHSH 3EYDA 1IQEA 1GBCA 1HAVB 1SGFA 4ABJA 7GCHF 1YBWA 2SGFE 2ZTZA 3PB1E 2GVFA 2B8OH 4X6OA 1P2QA 1CGHA 1O3KA 3NCLA 4Q4LA 1W10U 1LQEA 1O3AA 1A46H 5I46H 2BY9X 5DP3A 5LPEA 1O3FA 1UCYE 2HLCA 1S83A 1P3EA 1QJ1B 3CP7A 4XE4A 4B71A 1EJAA 1KY9A 2ZI2H 3M5LA 3SGQE 1EPTC 2P3UB 2A2XH 1LPKB 5E0GA 1G2LA 1T8OA 4XBBA 1W7GH 1OWDA 4U32A 3D65E 1O2HA 3GS9A 2AH4X 1GI5A 3IG6B 2V3MA 4LK4A 2J2UA 1P9UA 1PQ7A 1LKBA 2V3HH 3G01A 2XBXA 1SLUB 3AVZA 1Y3XA 4CRDA 1D9IA 4X2YA 2GJGA 2A4GA 1QL7A 3D49H 3UNQA 3E90B 1OWIA 4K8BA 3M7QA 1W13U 2BDAA 3T29A 1GI1A 3MWIU 4BXWA 1XUGA 8LPRA 5T6GA 1NT1A 3I77A 1DXWA 2ZGCA 1FY1A 1RIWC 2BD3A 2ZQ1A 1BMNH 3BG8A 3TVJB 3F9EA 2A4OA 4AN7A 1O37A 3M7UA 2KZ4A 5GWZA 1SQRA 2OC7A 2P3FH 1UTJA 3SZNA 1BB0B 3PV5A 1AVGH 1JBUH 5GXPA 2C93B 3RU4E 1AN1E 1BTUA 1TWXB 1VCWA 1VKYA 1D6WA 4O97A 3E0PB 1SLXB 3E8LA 3M37A 5KEDA 3A7XA 4I8LA 4BOHA 1HIAA 1P06A 1HNEE 3ZV9A 1C2IA 1PPFE 1F5KU 1ETSH 3UNRA 1C1QA 1UTKA 1OP0A 1WTGH 1OP2A 1K1MA 4RT1A 5EODA 2PKSC 2QF0A 4X6NA 1HAYB 4R0IA 5A8XA 1SOTA 2JETC 2B9LA 5DKMA 1UK4A 4RKOB 1B0EA 1KXAA 4YOIA 3S7HB 1ZHRA 5BPEA 3LGUA 2ZHQH 1C1SA 1CT2E 4AGKA 1MAXA 2ZPRA 1V2LT 3RM0H 4ZCNA 1XUFA 3P8NA 1FY5A 1GI6A 3M3SA 4I32A 1OYQA 1BDAA 2OP9A 2LNCA 1AE5A 1BBRK 1C5VA 1C1MA 2QV1A 3MNXA 5EJ1A 1C5MD 4R8TB 1BMLA 2ZDVH 2Z9GA 2R3UA 1EZXC 5EQQA 1ZPZA 1GI9B 3RDZA 1DWCH 3SUGA 2IPQX 4A5TS 3DFJA 3EAJA 2OD3B 2WPHS 1TOCB 3A7YA 2J9NA 4KTUA 3RXHA 3MU8A 4UFDH 5IK2D 1Y3YA 1O2SA 3PLPA 2STBE 3IWMA 3V3MA 2F3CE 1EAWA 1YLNA 1C2LA 3P8OA 2ZCKP 5FPTA 1P9SA 2ULLA 2F43B 1KXEA 1TBZH 1O2OA 3B9FH 5CDFE 1IQGA 1EOLA 3KL6A 3PYHA 2ZDLA 4O3UA 2A7HA 1QBOA 1E37B 2F91A 1SGRE 3BV9B 4OS2A 3VXEH 1SQAA 3ENSB 3TK9A 1SGQE 3EDXB 6ESTA 1SG8B 5E0JA 3GISB 1CHOF 3TK6A 2EI8A 1GI4A 1KXBA 3QK1A 1F0TA 4FVBA 2ZU1A 3Q3KA 4KELA 2SNWA 1QRWA 2VNTA 1QRXA 2JH0D 2VINA 3EGKH 1W0KD 5E0HA 4TYDA 1J17T 2ZF0H 3FZZA 1UTNA 1S85A 1QURH 1YLDA 4D76A 5A09A 2SNVA 4FUHA 2ZGBH 1AE8H 1AMHA 2BDIA 1ANEA 3SNAA 3OTPA 1SGTA 1BRCE 2D8WA 3TGKE 3NXPA 4X1SU 2F4LA 1INCA 3BTDE 3ZZCA 4D9QA 3P92A 4UONA 1OWKA 2OXSA 3UFAA 1MTNC 1MTSA 1E0FD 1YYY1 1GVLA 3KCGH 2F9NA 1DY8A 4B1TA 2C8ZB 3PM3A 2YMSC 1FI8A 1FAKH 1N1LA 4K3JA 5C1UA 3LONA 1NRSH 2RG3A 2VIDA 2FWWA 3QGJA 4H4FA 1CBWB 1Q3XA 1G2MA 1GBJA 2PWXA 4ZAEA 1MTWA 4JCNA 4RT0A 4THNH 5FAHA 3P6ZB 4Y7BA 2EI6A 1N6YA 1Z8RA 3SNEA 1GCTC 1P57B 1ELVA 1TRYA 4Y8XA 1L1NA 5A8ZA 3PMAB 1P05A 1MD7A 2G5NA 1MABB 5JBTA 1SGYE 1SPJA 1T31A 2GGVB 1MAYA 5E2PA 4ACAA 4HG6A 5JYIA 1H9LB 2R0KA 1P10A 3H7TA 1OX1A 1P01A 2ZPQA 4NIYA 1UW7A 1GBIA 2OQUA 1J15A 3RXTA 1S6HA 1OOKB 2BYAX 2CF9H 1H8DH 2F9OA 1XKBC 1NBME 4FU9A 4A1XA 4OGYA 3OAAD 1HAVA 1O2QA 3QWCH 1C2KA 1DT2A 4GHTA 2UWPA 2FI5E 2PUXB 4B75A 4XDEA 3WW7A 1COWD 3ZZ8A 4DJZB 5E2OA 1FONA 5F8ZA 2G5VA 3WY8A 2QY0B 3A83A 5C5NA 8GCHF 1DSTA 3U8RH 3BEIB 1BBRH 3U98H 4ABGA 2OK5A 2C8XB 3PMHB 4JMYA 1MCVA 2JJ2D 3GCOA 4TT3D 2ZPSA 3PMBB 5B6LA 2WPDD 1TBQH 2OC1A 3RXLA 1DM4B 3RLWH 1UJ1A 2UUKB 3F9FA 4VGCC 2Z7FE 3JZ1B 4XD7D 2XCFA 2RCEA 3SV6A 2PW8H 2AIPA 2BOHB 2Q6DA 3UWJH 6CHAB 1D4PB 1ABIH 5EPYA 1FUJA 1TOMH 1RRKA 1MBQA 1ZPCA 2XC0A 2WPIS 1YM0A 2Z94A 5JDUB 2J95A 1UTPA 5C20A 1BIOA 1T8MA 3MQKC 2QXGA 2W7UA 4CRFA 4IN2A 1P2NA 2FOMB 4MDSA 4LZ4B 4K1TA 2OC8A 1IHTH 1KYNA 3FP6E 5E8EH 4MNXA 2I6SA 5GPIB 4AB9A 2TRMA 4X6MA 1HYLA 1PPCE 1K1LA 1EX3A 2K0QA 2ZCLP 3BTKE 2AGGX 3CS7A 3DT0H 3R0FA 2VWLA 1TNJA 2NU2E 4E06H 2FX4A 3O8CA 1MQ5A 4X8UH 1W0ZU 2HLDD 4BAKB 3VB6A 3A87A 3EE7A 2LP6A 3BIUH 3K2UA 4X8TH 1G3CA 4BAMB 2FOBA 1WQSA 4Y10E 2AFQB 1FQ3A 1Q2WA 4Y8YA 1FY3A 1HJAC 2XCNA 3VEQB 4BTTB 3GY8A 2WPLS 4AORA 4CRAA 1V2RT 5EQSA 1GVKB 1M9UA 1TBRH 1IQHA 3DA9B 1TYNA 2UWLA 3LKWA 2Y7ZA 1FIWA 5EU8A 3ODFA 3KQBA 5C67A 1J9CH 1HV7A 1WU1A 1TGBA 1LPGB 3DSOA 4KP0A 2F9UA 3HK3B 1WAYB 1GJ9B 1Y5BT 3CNRA 2O8TA 1BRBE 1V2TT 1FIZA 4YT7H 1GBDA 3EA7A 1IOEA 2OC0A 4YOJA 4CR9A 1XX9A 2GV6A 3ITIA 1PPZA 1GMCF 4AG1A 1WTHD 3QUMP 4KTCA 1C5XB 1BMFD 1S0RA 3ZVCA 2ZECA 2Y80A 3TK5A 4HTCH 4WF8A 1LHDH 1EATA 1TA2A 4XBCA 3LH1A 3OU0A 2EI7A 5L2YH 1G37A 5K0HA 1XMNB 1S81A 4GPGA 3F9GA 2ANKH 1P04A 1O5FH 3TJUA 3UPEA 3KF2A 3BF6H 1GMHG 2ZFRH 1P3CA 4E7NA 3PRBA 2A0QB 4JZDH 3SU5A 3VB4A 2KCAA 4YM9A 5FPYA 1DPOA 2WUCA 2Q6GA 1P03A 2FMJA 2SGDE 1V2NT 1O5GH 5EJZA 1GHAF 4NIWA 3BEFB 1ZJDA 1ZSKA 2AGIX 2P93A 2XBVA 3ESTA 3OY6U 1H8IH 2GCHF 3SV2H 2ODQA 1JWTA 2QXJA 2VGCB 3RXMA 3NPSA 1QB1A 1DANH 2L6OA 5KGOA 1C5TA 3GY2A 4YZUA 2CGAA 1DSUA 1MCTA 1G3EA 1BHXB 1QCPA 2CN0H 1HJ9A 1LHEH 3AW1A 1PYTD 2HRVA 3QLPH 1BMAA 1TPSA 5HKKD 3DD2H 1H9HE 1HAXB 2CJIA 2CV3A 2HVXA 2A31A 1V2KT 3DFLA 4YLUA 1TE0A 1XUHA 2ESTE 3UIRA 1GL1A 1A3BH 2YNBA 2G4TA 5FHTA 1FN8A 3NZIA 1BRUP 3P17H 2BVSH 2ZDNA 3O8DA 3U8OH 3VG8A 2VJ1A 1H8HD 1XVMA 1HXEH 2ZQ2A 4P02A 4IC5A 5A0CA 1QY6A 3HPTB 2VVCA 2FYRA 1UHBB 3PMJA 1WV7H 1T4UH 1ABJH 2KR7A 5DPAA 2OBQA 4ESTE 3RXAA 1YPGH 2JJ1D 2TGAA 3MO3A 3E0NB 5AFZH 1SLVB 3AK5A 2BD7A 1LHFH 4MG3A 1VITH 5FPSA 2IJOB 2M5TA 2PKAA 2PUQH 4ACBA 1QJ7B 2O8UA 1AKSB 1O3MA 2CK3D 3QGNB 4KTSA 2ZU3A 3W95A 2XNDD 1YKTA 1FX0B 3GY3A 1O5AB 4FUJA 1LHCH 5T3HA 1AFEH 5LPRA 2FESH 1LKAA 9LPRA 3OTJE 3RXFA 1QQ4A 5DK1A 2FPZA 1P0SH 2HPPH 2PV9B 2ZHDA 1C5LH 1ELGA 3E16B 3ZYDA 2VU8E 1MTVA 7LPRA 5HM2A 1BITA 1O5BB 4P00A 1ID5H 2A45B 1HB0B 1DWBH 3A8CA 3M36A 5EJLA 3LC5A 3VB5A 1H1BA 2ZFQH 3Q00A 1F5LA 2BLOA 3GDVA
chains in the Genus database with same CATH topology
1O2JA 3H7OA 4CRBA 2EC9H 3QZQA 4X8VH 1D3DB 1MU6B 1D3PB 1KLTA 3ZZ7A 3O8RA 2CHAB 3PO1C 2ZDMA 3P70B 4AFSA 3M5OA 4BAQB 3KN2A 1GBLA 2FTMA 4B2AA 1CQQA 3RM2H 2UUYA 3RMNH 3MU0A 3UY9A 4YT6H 1LHGH 3MNSA 1VR1H 1EP5A 1C5PA 1SGCA 3GYMA 2ZTXA 4B2BA 3M3TA 5ABWA 1DOJA 5EW1H 2ZEBA 3F6UH 2H9HA 1GGDB 2O9QA 2RA3A 4MVNA 3SU3A 5EPNA 1BTXA 5L30H 4BNRA 3ZZ5A 4NFFA 3W94A 4IGDA 1AVWA 2ZDAH 1GPZA 2GT7A 3GDSA 3SV8A 2GDEH 2GDDA 2C90B 4GCHG 5CE1A 2GZ8A 2KAIA 1BT7A 1YGCH 1THPB 2BY5X 1KLIH 5G4BA 2VWOA 1LVMA 5H4IB 3UWIA 4OGXA 3ZVAA 1BOQA 3A80A 5C5OA 1BUIA 1AB9B 3D23A 5LH8A 3VPKA 2Y82A 4K60A 2ZFPH 3TGIE 1OKXA 3GOVB 4FUFA 5HGGA 4WH8A 2G55A 2FLBH 1DLKB 1W0YH 2ANWA 2W5EA 2FIRH 2ZHEH 1GWAA 1ESBA 3LGTA 3ZYEA 3UTUH 1PPEE 2J38A 5DGJA 1Z8JB 4UDWH 1YP9A 4JK6A 1GBAA 3MU4A 1THSH 2QGRA 3SV9A 1C4U2 3SGAE 2Y81A 2VVVA 3RXUA 2G4UA 4NIVA 3F68H 1VJAU 3GCTG 3UR9A 4B76A 3MH5A 3I78A 3SI4H 3BTGE 1FDPA 3DHKH 1MTUA 2O8LA 2C3SA 2GMTB 2K1QA 1E38B 4DG4A 1KLJH 1UVSH 1FY4A 4ISNA 1QB6A 3LJOA 3ZVEA 2FOFA 5GIBA 1TQ7B 1RFNA 1P09A 2Y5GA 3ZZ9A 2GT8A 1Z71A 4CR5A 1FY8E 2BDYA 4ABHA 1C1RA 2ANMH 1PQAA 3HATH 3BTEE 1NRRH 5AHGH 3RXPA 2R3YA 1WBGB 3M35A 3MOCA 1EZSC 1GMDF 2AGEX 4FUGA 3GY6A 1DS2E 1FNIA 4Y7AA 3K65B 1L4DA 3K9XB 1EOJA 1QRZA 2BD2A 1F7ZA 1QGFA 3L3TA 3T5FH 4FUDA 1H9IE 4J1YA 2A7JA 1LVYA 1AZZA 3SU2A 3M7TA 3STJA 3Q3XA 4AX9H 3VGCB 1MBMA 5JBCS 1D6RA 1UTOA 3URDA 4ABBA 1ZHMA 4LOYH 2UWOA 3H5CB 1QQUA 5K7RA 2FM2A 4K2YA 1F0UA 3RXCA 2WV5A 4X6PA 2F9PA 4NSVA 3U1IB 1B7XB 3U69H 4MNYA 3LJJA 3ZVFA 5CHAC 1AWHB 1ELCA 4GVUA 2WV4A 5FCRA 2HNTC 4MNWA 4NZQA 4X1QU 4E7RG 1O2LA 1JMOH 1PFXC 2P8OC 3Q76A 1NRPH 3RXOA 1C4Y2 4UD9H 5AFYH 1RTKA 2Y6TA 3FANA 1W14U 1TGNA 1GI0A 4IMQA 1HAPH 1P2OA 2BD4A 4CH2B 2H2ZA 1XKAC 2ZIQH 3S0NA 2J94A 2P94A 4A6LA 1ZMJA 2C4FH 1JIMA 4I8HA 1C5SA 4D9RA 3KGPA 3SGBE 4DIIH 1KXCA 3N7OA 3CS0A 3SU1A 3OY5U 1F92A 1KXDA 5HM9A 1OS8A 1C1VH 4ZKRU 2GZ7A 4TWYA 2TGTA 3EE0B 4D7GA 3V0XA 3FP7E 2ZGJA 1FAXA 5ESTE 1Y5UT 2OTVA 3PWCA 1GBKA 1UCYK 5EW2H 3A7ZA 3TITA 1BTWA 1TALA 4FUBA 4INLA 2VH0A 3RXEA 1RIWB 4CHAB 1VITG 2ZFFH 1K1PA 3TIUA 1PPGE 1ZSJA 1V2WT 2PLXA 1O2KA 1A2CH 3TGJE 1CA0B 3RUOA 2J34A 4IMZA 1QNJA 2F9VA 5FXLA 1ZTJA 4NWLA 3B23B 1O3JA 3ZZ4A 2ZA5A 3SHAH 2HNTE 1G30B 1AKSA 3L6PA 1ANDA 1ZGIA 2O8WA 6GCHG 3SU6A 3NKKA 4DGJA 1HAOH 2TGPZ 1J16A 1TX8A 1ZYOA 3LOXA 3UOPA 4MPXA 1GL0E 1WYKA 4XSKU 1S84A 3RMMH 3UOUA 5DO4H 1OYTH 1GDQA 4GSOA 2JETB 4WMEA 1QIXB 1Z6JH 3MHWU 1GBMA 1TPOA 1YC0A 3A7VA 1QBVH 2Z3CA 4HI3A 2VWNA 5EXLA 3SORA 3BEUA 5FX6A 5C3NA 3TJOA 1Y3VA 2RA0A 3GY5A 3KEEA 3PV4A 2WUBA 4NIXA 3UREA 1C5QA 1GHBG 1OXGA 2ZP0H 4WXVA 2G81E 4X1NU 5ESBA 1NZQH 2SFAA 2UUJB 2AERH 1NS3A 3T2NA 1GJCB 2PTNA 2BX3A 2BTCE 1GJ8B 1C9PA 3AAVA 1HJ8A 1C2FA 1TNIA 2B7DH 2Y7XA 2Q1JA 2BLVA 4NCYA 4ZHLU 2ZZUH 1U6QA 1LMWB 3GY4A 1MMJN 4D8NA 2UUFB 2ZU4A 4FXGH 5PTPA 4BTIB 1GJBB 1GMHF 3V13A 1A0LA 1FJSA 1SGNE 1HDTH 1V6DA 1GJAB 3SQHE 2AS9A 3PLKA 1K2I1 3RXRA 3MO6A 2R9PA 4YO9A 5SGAE 1FN6A 1MZAA 2H5CA 1EAXA 1NPMA 2H5DA 2FP7B 1GG6B 3AASA 1O2VA 2ODYB 1SHHB 1CA8B 4PROA 1C2DA 3U8TH 1BRAA 3GCNA 5J4QA 1KTTB 1Y5AT 1DUAA 5IYTA 3T25A 2XNIA 5IDKA 1UVUH 1A5GH 3MO9A 3TJVA 2THFB 3QTVH 2BQWB 5LPFA 4FUCA 4IW4E 2FX6A 5EXMA 1TRMA 2Z3DA 2ZO3H 1ELDE 2R2MB 1ZMLA 4TPYA 3CENA 2VGCC 3SJ9A 1HPGA 3SQEE 1EQ9A 3URCA 1ACBE 1NN6A 1O35A 2V3OH 3F1SB 9ESTA 4CRGA 5FX5A 1O2TA 3A81A 1KTSB 4HFPB 4I7YH 4KGAA 2ZGHA 1MTNB 1EASA 1G9IE 4CREA 4WMFA 1AY6H 2V0BA 1UCYH 1TX6A 4CBOA 2VB0A 4F49A 4WY3A 3A8DA 1HAHH 5ETXA 5DP7A 5F8XA 1GCDA 2FOCA 1VGCC 1TMBH 1MQ6A 5A8YA 1BTZA 1IAUA 1TAWA 2XW9A 1O2ZA 1O3OA 4NZLA 3MYWA 1UVOA 4Y79A 1H4WA 1RTLA 1SVPA 4I8JA 1ANCA 1V2OT 2IOTA 2OINA 1HUTH 6LPRA 5AVDA 1P2JA 4QT8C 3BIVH 1E35B 1K1IA 2F83A 1YPHE 2ILNA 3ATLA 3ZZDA 1PQ8A 2A5AA 4Y0YE 1BA8B 2A4RA 3AW0A 5DJ7A 4MPVA 3GCHC 1O34A 5C1XA 1MH0A 3ZVDA 4DCDA 4ZKSU 3FZDA 4I8GA 1PPBH 1NU7B 2Z9LA 1HIAB 1E34B 1K1NA 1O2MA 2FOAA 1LCYA 3UQVA 1GJDB 2B5TB 4NA9H 2D26C 4BXSA 4OS6A 1CHGA 3E3TA 3A85A 4GHQA 1O3CA 1JOUB 5JPMH 3U1JB 2VIVA 3PWBA 2XWBI 1MUEB 4IN1A 1IQKA 3JZ2B 3FAOA 4Y71A 1AWFH 2W26A 3BG4B 3SOSA 2EA3A 2FLRH 4I8KA 5B6OA 1O32A 1V2QT 1SGEE 1P2KA 4JK5A 3UQOA 2GV7A 1CGJE 1GBHA 2ALPA 2TBSA 2R2WU 5I25A 3S9CA 2VIPA 4ABAA 3ATWA 1IQNA 1IQFA 1EAIA 1QFKH 1EZQA 4VGCB 2Q6FA 1AUJA 2QXIA 2GCTB 2NU1E 4FUIA 1UO6A 3OX7U 5FBIA 1HRTH 1NM6A 4A92A 4X1PU 2OBOA 3EA8A 2VVUA 1BTYA 1LPZB 1HLTH 1G36A 4B73A 1Y59T 1L1JA 4FVDA 3T62A 1NO9H 1Z8IB 1DDJA 3KNXA 1ELTA 2WINI 1GHXH 1P02A 1F0SA 1T4VH 1OWHA 1ANBA 1AUTC 1O2RA 4RSPA 2PR3A 2H9EH 2QCYA 1BMMH 3T28A 4WMDA 1A0JA 1CT4E 2XXLA 3M5MA 3SV7A 1LO6A 4SGBE 5J4SA 4J2YB 3LGYA 3Q3YA 4LXBH 1CT0E 2PSYA 4INKA 1HJAB 1QB9A 1GJ5H 1ZRKA 3GCTF 2ZG0H 2XBYA 1XXFA 1V2JT 2WPKS 3LGIA 2FI3E 1FPCH 2XC4A 4AZ2B 1GDNA 1O3HA 2SGEE 3VB7A 1DXPA 3S69A 1TGCA 4RN6A 1AHTH 1VCQA 2HPQH 1Y8TA 2BVXH 3HGPA 4AYYB 5HMAA 2ODPA 1SSXA 1N8OB 4RKJB 4Z0KA 1NU9A 1ZPBA 2BX4A 1TIOA 2PGQB 1TMUH 4GUXA 2VIWA 3MU5A 2XC5A 1C1NA 1C2GA 4ABIA 5HXFA 1AI8H 3MU1A 1G3BA 1C5ZB 3HK6B 2W7SA 2GMTC 3LC3A 3OYPA 2H1UA 3BTQE 3BTHE 1HAIH 1L0ZA 1TA6A 4A1TA 2AMQA 2A2QH 1WUNH 1FV9A 4CRCA 1SOZA 1V2PT 2HWLB 4ZKNU 1G3DA 1W3CA 1ELEE 5JB9S 1NRNH 1EP6A 3ATKA 4XBDA 1BBRE 1QL9A 2FDAA 2P95A 1PJPA 1T7CA 3L33A 1YPMH 1YF4A 2WYGA 4WH6A 1TNLA 4LZ1H 1NFXA 4DOQA 2CXVA 2EEKA 1AGJA 1AZ8A 3SJKA 3VGCC 2BQ7B 1O30A 4UFEH 3ZVBA 3VB3A 1ZR0A 2A1DB 1PYTC 1RJXB 3U9AH 2BDCA 3SU4A 2ZWLH 4K8YA 4ZXYH 1O2XA 3OSYA 4JYVH 2Z3EA 2BOKA 5JB8S 1SB1H 1TFXA 1C2HA 3ATIA 1KSNA 3BTME 1V2MT 3GDUA 2A32A 2V6NA 2BY7X 1UTLM 5JBAS 1NFYA 2G51A 1BQYA 1AD8H 3E6PH 3C1KA 5EQRA 1YPEH 1LDTT 2A7CA 1QR3E 2J4IA 3A86A 1TPAE 1ZTKA 1O2WA 1QJ6B 3QO6A 3A88A 3RXDA 1JXPA 2FTLE 2GD4B 3SNDA 3SO3A 1ZGVA 2D1JA 5DP8A 4DVAU 3MH7A 5LGOA 2AIQA 5GCHG 4AB8A 3RXBA 3EA9A 1MD8A 3RXIA 1UK3A 2AYWA 2QIQA 1ELFA 2NU0E 4JZIA 5EGMA 4NGAH 2ZGXH 3UUZA 4Y0ZE 3RXQA 2FODA 3A84A 1L2EA 1Q31A 2QF3A 4OS1A 2GTBA 1VITF 2WPJS 3S9BA 1SQOA 1JRTA 1T32A 2BD9A 1GI2A 5DP9A 4X8SH 1SL3A 1TNGA 3SU0A 4SGAE 3LGWA 2D2DA 1O2PA 2FEQH 3TH4H 1NY22 1QL8A 5FBEA 1O2NA 5GDSH 1UVTH 4HZHA 3RC5A 1ARCA 1C2EA 1LQDB 3K6YA 4WJG2 2VWMA 4A7IB 3ELAH 3O8BA 1B5GH 6GCHF 1Z8GA 3GICB 1RGQA 4ABDA 4CHAC 1D3QB 2HNTF 1F5RA 2STAE 2SGQE 1LTOA 1F0RA 1NTPA 2NWNA 1CA0C 2FI4E 3MH6A 5DP4A 4YLQH 1ZTLA 1C1TA 1TNKA 8ESTE 3KQCA 4I31A 4ASHA 1GBEA 4M7GA 1O3NA 1SBWA 3SNBA 1O5EH 1K21H 1L4ZA 4NWKA 4MQAA 3V12A 3ATMA 1AQ7A 3PO1B 2XRCA 2ZU2A 1O3BA 1GDUA 3B8JA 1A1RA 2HGTH 1DWDH 4ZH8A 1C5NH 4D7FA 1CBWC 3QX5H 3MI4A 5TJXA 1PPHE 1N6XA 1AFQB 1GHBF 4MNVA 2ZHWH 2FOGA 2BQ6B 1KDQB 2Z9JA 4F4OC 1DE7H 2A4QA 1OWJA 5JBBS 1C9TA 4H6SB 4NA8A 1FZZA 4TWWA 1ESTA 1OPHB 2BY6X 4Z6AH 1C1OA 1XM1A 4ISLA 2HOBA 4K1EA 1GJ6A 3SJOA 1HGTH 3D62A 1TNHA 1NRQH 5AF9H 1W2KH 1CU1A 1DWEH 1ETRH 1BJUA 3RC6A 1EPTB 1EXFA 5TCCA 1K28D 1QA0A 1OWEA 1QA7A 1DVAH 1NROH 1QTFA 1Z1JA 4O03A 2F9BH 1EUFA 7GCHG 1IQLA 3PLBA 1GI7B 1HAZB 5A2MH 2JH5D 3BTTE 1O3EA 5L6NH 2BZ6H 2JH6D 2ZU5A 4JZFH 4BAHB 1AVXA 2ZTYA 1ELAA 4NFEA 3SW2B 2BVRH 3AAUA 3LH3A 3TH3H 4TY7A 1ZZZA 1W11U 2BDHA 3RXVA 1GHWH 1ORFA 3PTBA 3DUXH 1T8NA 2CMYA 1LVBA 4MPWA 4AGJA 3QN7A 3RMOH 3VFEA 1UHBA 2FO9A 3C27B 3T26A 4JZEH 1RD3B 1O5CB 5CMXH 1GG6C 1XUKA 4B74A 3S9AA 4Y76A 4YESB 2ZCHP 1P2MA 4IBLH 1O3PB 3TJNA 2XTTB 3QZRA 3M5NA 6CHAC 3P8FA 1SC8U 2BMGB 4NSYA 3ZZAA 2ZKSA 3ODDA 4X2WA 2C8YB 2ZC9H 3LDXH 4YTAA 4A1VA 1CE5A 1UVPA 1SMFE 1A4WH 1EAUA 4ZHAA 3E91A 4X1RU 1O36A 1C5OH 1T8LA 1HAGE 2P59A 3SUDA 2ALVA 5DP5A 4AFQA 3FP8E 2GP9B 4NA7A 2XYAA 1KIGH 1GBBA 5A0AE 1GJ7B 1O3DA 2QAAA 2PKSB 2QA9E 2V35A 2TPIZ 3K6ZA 4ZKOU 1X7AC 2Z6BD 4H42U 5EOKA 1ZLRA 1GMDG 1C4V2 3BTWE 3EQ0H 3F9HA 2BM2A 3P8GA 2HALA 4O9VA 2Y5FA 1O2GH 2PKAB 2QYIA 1SFQB 2FYQA 5F6MA 1ELBA 1FPHH 4E05H 1LVOA 2W3KA 1VCPA 4MLFB 5CHAB 1SHYA 1XXDA 2P3TB 4Y6DA 3LGVA 4ZXXH 2BDGA 5DP6A 2ANYA 2P8OB 4ABFA 2YOLA 1ZRBA 2WPMS 4I33A 1ZSLA 3IITA 1CO7E 1EB2A 1NFUA 4UFGH 1GBTA 2C8WB 1PQ5A 1V2ST 2R0LA 4TPIZ 3KHVA 2ZFTA 4XFQA 3SN8A 1Z1IA 1MU8B 1C5YB 1ZMNA 2Z9KA 1YCPK 3ZZBA 5F8TA <