3MU1A

Comparison of the character and the speed of x-ray-induced structural changes of porcine pancreatic elastase at two temperatures, 100 and 15k. the data set was collected from region a of the crystal. fifth step of radiation damage
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chymotrypsin-like elastase family member 1
publication title X-ray-induced deterioration of disulfide bridges at atomic resolution.
pubmed doi rcsb
molecule tags Hydrolase
total genus 65
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2010-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mu1A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mu1A01
1FXYA 1SGFG 2GVFA 3QGJA 1BTUA 3ITIA 4O3UA 1Y3YA 3SU3A 1P10A 1C5MD 1FPHH 1AZZA 3AW0A 4AYYB 1MUEB 4K5ZA 1C5YB 1QURH 3PO1C 4YESB 4Y8ZA 2J2UA 5GWZA 3IG6B 2FLRH 4LZ4B 1GMHF 5HM9A 1RIWC 2A32A 3LJOA 1NTPA 3HPTB 1QL9A 1GBEA 3BTKE 1YPMH 5FX5A 3RDZA 3SZNA 1ELCA 1A3EH 3JZ2B 3EGKH 1YP9A 1C5NH 1DXPA 1XM1A 3MU4A 5AFYH 2FDAA 1KXBA 2F9OA 1GI4A 2ZU5A 2BLVA 4I8GA 1W3CA 1UVOA 3GY8A 3LKWA 2YOLA 1DUEA 1H1BA 4ESTE 5HM2A 3W95A 1O38A 4CR9A 4Y71A 4MVNA 1UCYH 1O3IA 4BTTB 1DITH 3U8OH 4FU8A 1C2JA 2Z6BD 3U8TH 2XCNA 4UFGH 4MLFB 5JB9S 1LPZB 4Y6DA 3ZVEA 4X1PU 1P2IA 1IQFA 4TWWA 4ZKRU 4UD9H 4MNYA 5I25A 1QB9A 2XTTB 3ZVCA 1SGFA 1F2SE 1DLEA 1W8BH 4ZXYH 1TNJA 3M3TA 1BOQA 1TMUH 2BD3A 2R2MB 3UNRA 1HGTH 1LVBA 1O3HA 2XBWA 4Y0ZE 3UQVA 1C1TA 4A7IB 4X2YA 3ODDA 1BIOA 3GY5A 3S9AA 1EAWA 1GHBG 4SGAE 3E0PB 1EJMA 1GJDB 2C90B 4WH6A 2R3UA 1GJ4H 4NA7A 1GDQA 4IBLH 1IQJA 3BEFB 1BBRK 5C67A 4WJG2 1EATA 1HAPH 2THFB 5FXLA 1CU1A 2W7UA 2GT8A 3PMJA 2VH0A 5SGAE 1EB1H 4WVPE 1CHOF 3URDA 1BHXF 2BOHB 1V3XA 4YO9A 1O31A 4AB9A 1FPCH 3OTJE 1BJUA 2YNAA 2STBE 4KKDA 1QQ4A 3E3TA 3A85A 1YC0A 2BLOA 2KAIA 1BRCE 1T7CA 3SU4A 2QCYA 2F9UA 4KELA 4X1QU 1KLTA 1Y59T 2JH5D 1VGCB 3E90B 4IN2A 3VXFH 3MU8A 1B0EA 1O5CB 4NFFA 3DT0H 1TONA 4BAOB 1SOTA 1QA0A 1C1RA 2O8WA 1NRQH 3TVJB 2BDHA 2ZTYA 1U6QA 2ANKH 4B75A 1NROH 1PPZA 2FTMA 2H5CA 4Q7ZA 3QTVH 3UWIA 1T31A 3LGIA 1C1VH 2BZ6H 1H9LB 3SJIA 4NSVA 3GDSA 3HKJB 1O32A 1ABJH 4IMQA 1XVMA 4NG9H 4D8NA 4WXIA 2Q6GA 2J38A 2OINA 1Y5BT 1EP6A 5BPEA 4ABDA 1EZXC 1XX9A 2FWWA 4INKA 3PLBA 5FPTA 1H4WA 1GHBF 3RXTA 3BIUH 1AWFH 1ZPZA 1ELBA 5DP8A 3EYDA 1UVSH 4AX9H 2Z9LA 1DDJA 2IJOB 2ZHWH 1HAXB 2C8ZB 1HAIH 2W7SA 5IDKA 2FX6A 1UTOA 2ODYB 1HDTH 4GHQA 1QQUA 4ABFA 1S5SA 1VJ9U 4DCDA 4O9VA 1Z8IB 3BTDE 3LGWA 2BDAA 2HWLB 1V6DA 2G4UA 5JBTA 1ZTJA 2CF8H 2QGRA 1HIAB 1UHBB 1MD8A 1QL8A 4Z6AH 2CMYA 3K6ZA 2H2ZA 5J4SA 1O5DH 2HRVA 1AQ7A 3A82A 3ATLA 1OYTH 1VCQA 3KEEA 3LONA 2ZGBH 4U30A 1C1QA 2ZFSA 5LPEA 1IHTH 5C3NA 3ZZAA 2GV6A 2NU3E 1P12E 2OCVB 5AHGH 1MTNB 3U98H 3GDUA 1Z8JB 1XUKA 3Q3KA 2GX4A 3ATWA 1QR3E 1CVWH 3MYWA 1GG6B 1HCGA 1A5IA 3SGQE 1O2SA 3F6UH 4O97A 1ANEA 4X6OA 2BQ7B 2M5TA 3QDZB 1J9CH 1L4DA 3SUEA 1YPKH 1V2UT 3T62A 2J92A 6LPRA 3U9AH 1P2NA 3W94A 1O5EH 2ZO3H 3P8OA 1KYNA 2WPKS 2ZDMA 1MAXA 4NIVA 1S6FA 3C27B 2Q1JA 1ELDE 3BTWE 1GVLA 2VINA 4NGAH 2OBOA 3BTEE 1MU6B 3BTQE 2P95A 2LNCA 2VWNA 1SB1H 4X8TH 3UTUH 5A0BA 2W3KA 1UVPA 1UTNA 4CBOA 1SGCA 1TA2A 2Y5HA 4ZHMU 2FX4A 1OX1A 1CT0E 1G3BA 1Q3XA 1GMCF 2GCTC 2A2QH 2BLWA 4I7YH 3BTFE 3B8JA 1YYY1 1JIMA 1P2KA 1BDAA 1BZXE 1C2DA 3KF2A 1RJXB 3E1XB 1AB9C 2H9TH 2DUCA 9LPRA 2A0QB 2QA9E 3ZV9A 2OC8A 5F6MA 1A2CH 4D9QA 2B9LA 1HRTH 2ZIQH 1K1IA 1NFYA 3P92A 2GDEH 3A88A 2ZFPH 1OXGA 2JETC 1W7GH 5FBIA 1JIRA 4GCHG 2GKVE 4YLQH 4OS1A 3NCLA 5AF9H 4CRGA 2VGCC 3VB6A 2R0LA 2O8TA 3TJOA 5EQSA 4B2CA 4ABHA 1FV9A 2G52A 4X8UH 1A3BH 1E0FD 2PUQH 4DIIH 3O8RA 1EOLA 1ANDA 2BZAA 3RXEA 1SMFE 3GCOA 1SGNE 2WYJA 5DPAA 1DSTA 3QGNB 1QCPA 1ZYOA 1HXFH 1PPBH 4K2YA 1IQGA 2OTVA 1A46H 2BMGB 1JOUB 4I8LA 1DLKB 1BT7A 3SHCH 3KGPA 4JMYA 3S7KB 3T27A 2XBVA 1JXPA 2P16A 1HJAC 4LOYH 2CF9H 4I33A 5F8ZA 4BAHB 1NN6A 1RTFB 3V7TA 1BTZA 1YLDA 2NWNA 1MTUA 2HOBA 4I32A 3UUZA 3ZVAA 1UTPA 4CRBA 3A89A 1NZQH 2BDIA 1E34B 3RXCA 1DWBH 3NK8A 1CSOE 1GHYH 2W5EA 1AFQC 1CGIE 3SU5A 1EX3A 1BBRH 2ZHFH 4Q2KA 4XBDA 3MWIU 1LPKB 2OQUA 2SNVA 3E6PH 1CA0C 1KTSB 4K8BA 4AGJA 5L30H 1O2RA 4XSKU 3DD2H 4O03A 1C2MA 3QN7A 4FU7A 4X6MA 2DE9A 1OKXA 4X8SH 1K2I1 2TBSA 1ELAA 3PTNA 1CGHA 4UFDH 4ASHA 4PROA 2ZPSA 1Y3XA 1O2XA 1MMJN 4GCHF 1PYTD 4K3JA 2P3FH 1C5RA 2V6NA 3OX7U 3LOXA 1CT2E 1C5SA 1X7AC 1HLTH 1PQ8A 2BX3A 4THNH 1P57B 1RFNA 1GHAG 3EQ0H 3RXHA 4FUFA 4OS6A 3RLWH 1TB6H 6CHAC 1GI6A 3ZZ5A 1AE8H 4TY6A 1J14A 2ZG0H 4ZUHA 1QGFA 1BB0B 2FP7B 2ZHEH 2Y80A 3RXKA 2GGVB 4JYVH 2PKSC 1P04A 3MU1A 4FXGH 3VXEH 1P06A 2BQ6B 2D26C 2Z3DA 4JZ1A 2PV9B 3LDXH 4MNVA 4UE7H 2QV1A 5ESBA 4HI3A 3SUDA 4E05H 4XE4A 1GJ6A 1O3JA 1TNLA 3F1SB 5DP5A 1EPTC 1BCUH 1BHXB 3G01A 4IC6A 1W2KH 3HK3B 1SPJA 2GZ8A 2KAIB 2VIOA 2P3UB 1WUNH 4YOGA 2HNTC 1JRTA 2FYQA 4O3TA 2ZF0H 1ORFA 4MG3A 1FN6A 1ESTA 1WAYB 2WPHS 3Q77A 4MTBA 2FM2A 1AO5A 3LGTA 3ZZ9A 5ETXA 2VNTA 4OGYA 1YM0A 3DFLA 1O3EA 1SGPE 3M3SA 3H7TA 1A0LA 1LMWB 1NU9A 2BDBA 5T6FA 2BY8X 2RDLA 2ZI2H 3MU5A 3VB4A 2H9HA 1XUHA 3OY5U 3Q3YA 1HV7A 3RXDA 1GHAF 2Y7XA 3PWCA 4B2AA 1H9IE 1UK4A 1GDNA 4B2BA 1C5XB 4FUEA 3ZZDA 3OYPA 1FAXA 1LKBA 1TRMA 2GTBA 1LQDB 3LH3A 1OWJA 3SGAE 1ZRKA 4AN7A 1GI3A 1GMHG 3NPSA 2W26A 2Y82A 1EZSC 5EOKA 3TH3H 4ISHH 5AFZH 2HPQH 2IPHA 1C5WB 4BAQB 3M5LA 3PMBB 5FBEA 3QWCH 1O2JA 1F0RA 1MD7A 1P11E 1NRSH 1L1JA 3E8LA 1D3DB 1EAXA 1RRKA 2FS8A 1PFXC 3M36A 3A8BA 2A5KA 3R0FA 1C2FA 2ANMH 1FIWA 1GBLA 4YM9A 1D3TB 1DXWA 2XNIA 3UR9A 1HAVB 4GLYA 1C9PA 4ABJA 4F4OC 3T26A 1PQ7A 5LPRA 2GD4B 1CHGA 1ETTH 2AFQB 2PSXA 3PB1E 3B9FH 2F9VA 1TPSA 6ESTA 1ZHRA 3FVFB 4KP0A 1OYQA 2RCEA 1NRPH 3RP2A 3VEQB 1ELVA 1C5OH 1QRZA 3TJUA 1GBMA 2O9QA 4AFSA 5DGJA 3S9BA 1DOJA 1GBDA 1MZAA 4K69A 4MNXA 1GJCB 1W0ZU 1ZHMA 4YOIA 1O2NA 1C1WH 1UTMA 1FZZA 4ISNA 1HUTH 8GCHF 1UVTH 1BRUP 2SGFE 1THSH 1QB1A 3NZIA 3EE0B 1IAUA 3ODFA 1PQ5A 2BHGA 1QFKH 1G32B 3LJJA 1O2KA 1ETRH 2C3SA 4I31A 1T8OA 1LVYA 1EAUA 2AIPA 2UUYA 1CBWB 4NA9H 2UWOA 1GGDC 3O8DA 4OS5A 1GBIA 2F91A 4R8TB 4Y8YA 3UOUA 4CBNA 8LPRA 1SGRE 1WTHD 7ESTE 2ZGXH 2H9EH 5FHTA 3A86A 3T25A 4ABBA 1GBKA 1G30B 1QRXA 5EW2H 1AB9B 1FONA 4AGKA 3HGNA 3HK6B 1HJ8A 5E2OA 1CHOG 1UK3A 1NRRH 1SR5C 1NO9H 3TGIE 3MOCA 2Z94A 3BSQA 1O3AA 1BRAA 1YLCA 5T3HA 3ZVFA 2O8LA 1P09A 1FY1A 1ZMJA 2PGBB 1O34A 3PMHB 6GCHG 1Q2WA 5CHAC 4H42U 3QZQA 2TGAA 3AAVA 3ATKA 4GPGA 2EEKA 1W14U 2ZA5A 3RUOA 3A7TA 2GP9B 1K1JA 1TMBH 3SNAA 2RA3A 2HLCA 2ZTXA 3TJVA 1ZPCA 2BD2A 3SHAH 3STJA 2GMTC 1C2HA 1P2MA 1P03A 4AOQA 1YCPK 3MH4A 3PYHA 1FDPA 3GCHB 4X2WA 5A0CA 3TH4H 3RXVA 1LQEA 5EXNA 1WSSH 3GY2A 4CHAC 2A45B 2ZFFH 1ZR0A 3KQDA 3QX5H 5EXLA 2OC7A 2V35A 4Y7AA 3RXUA 1AUTC 5TCAA 5EPYA 1KIGH 1TNHA 2D2DA 3UR6A 5HYOA 3SU2A 4LXBH 2ZCKP 2H6MA 3EA8A 5JPMH 1EXFA 1OP0A 1UCYE 2VH6A 1GJ8B 1O36A 1P3CA 1L0ZA 3MNCA 1O3LA 3M35A 2DE8A 2FODA 4HTCH 3LC3A 1K1NA 2Q6DA 3Q00A 5L2ZH 4AG1A 5JBAS 3A80A 2ZFQH 4QT8C 4CRCA 6GCHF 3MO6A 4A92A 4UDWH 2HGTH 2BYAX 4RKJB 3TK6A 2FOFA 3ZZ3A 1BTHH 1W10U 2XBXA 1SBWA 3SU6A 4JYTA 1GHZA 1OSSA 3BG4C 1A5HA 1YCPM 1CGJE 3K2UA 3AAUA 1SGTA 1C4U2 1GCTC 1AVXA 1ETSH 4LZ1H 4MPVA 1A5GH 1MKWK 1YBWA 3SNBA 3EDXB 4RN6A 3MH6A 1O2HA 2FOCA 2FTLE 1D4PB 2RA0A 3QK1A 5A8ZA 1N8OB 4GVUA 1G36A 1Z1IA 3B23B 3M7QA 4SGBE 4B71A 1SGDE 2Y7ZA 2NU1E 5GPIB 4WH8A 4Q7XA 4IC5A 2P3TB 2CJIA 1DUAA 1RXPA 1H8DH 1O33A 2D8WA 3ZZ7A 1TRNA 7GCHG 3RU4E 2HALA 1BITA 2Y5GA 3EA7A 4FUDA 1O0DH 3VGCC 3RM2H 2ZECA 1P9UA 2VU8E 4VGCC 5FCKA 3P6ZB 1SLWB 4E7NA 4FUJA 5JDUB 1KDQA 2ZDAH 2CHAB 4ISLA 1IOEA 3GDVA 2WPJS 4NIYA 2JH0D 3IWMA 3BF6H 1HAVA 1DS2E 1TLDA 3SI3H 1VR1H 3SQEE 3RC4A 2Z9KA 1V2WT 1GMCG 3FP8E 1DWDH 1C1OA 5A8XA 4Y10E 1FJSA 2SGAA 2BB4A 1G2MA 1GBHA 5C1YA 2BD5A 2QXIA 3SNDA 2FPZA 1UTJA 4IS5A 1ABIH 1W12U 4Y0YE 2QF0A 5E0JA 4GSOA 3TGKE 1ZGVA 3UFAA 3EA9A 4Y8XA 1ZGIA 1PPGE 3Q76A 2EI8A 3ESTA 5GCHF 5JB8S 4BTUB 1DICA 1DSUA 5A8YA 2A5AA 3STIA 5GJ4B 1AN1E 2F9NA 1IQKA 4AFZA 2UUKB 3MNBA 3MTYA 3KQBA 1KXFA 5ESTE 2VWOA 4BXSA 4CRAA 1MCVA 4DGJA 2WYGA 1SOZA 2EI6A 3UWJH 4D9RA 3AW1A 4DW2U 4U32A 1NFXA 2VJ1A 1P2OA 1F0TA 1OWKA 2CGAA 1SC8U 1E35B 5AVDA 7GCHF 1KSNA 1G3DA 3M37A 2PKAA 2TPIZ 2EA3A 1LHFH 1Z8GA 1KY9A 1C2EA 2FO9A 3FZDA 1VCPA 2XC4A 5C5OA 1O3DA 1FY5A 2VWLA 1ZLRA 2VIQA 2WPMS 2G8TA 5T6DA 1TGCA 1S6HA 1ARCA 1AU8A 5JYIA 3U8RH 5A2MH 2ZU2A 2SGPE 3GYLB 4BANB 1EKBB 3ZZCA 2RG3A 3A7YA 3KCGH 1VITH 2PW8H 1LCYA 1IQIA 3HATH 1F5RA 1ZPBA 2PGQB 1HAOH 1K1PA 3I78A 5FAHA 2NU4E 3C1KA 1RTKA 1JWTA 1MU8B 3PO1B 3P70B 3T28A 2ULLA 1PPHE 1EQ9A 1UTLM 1W11U 1RIWB 1P02A 3I29A 3F9GA 1B5GH 3LT3A 4X2VA 3GICB 3SV2H 3LGVA 1XUJA 1BUIA 3V0XA 2FXRA 1KTTB 2OBQA 1QNJA 1A7SA 3ATMA 4A6LA 2G5NA 1NFUA 4GUXA 1GBCA 2HNTE 2XRCA 3K65B 1SGEE 3U1IB 4OS4A 4X8VH 2BOKA 4FVDA 3Q3XA 2WPIS 3JZ1B 4ABEA 4TPIZ 2BY6X 4I8KA 3PTBA 2AGIX 3D49H 7LPRA 1O2YA 1LVOA 1JBUH 4Q80A 2ZQ1A 1SQOA 1YCPH 2AS9A 1PYTC 5IYTA 3N7OA 1RGQA 1ZJDA 2A1DB 3ZVGA 4BTIB 5F8TA 4MDSA 4JZDH 2F9BH 2SFAA 4X1NU 2FYRA 4X1RU 3SNCA 1XUGA 1NFWA 1TBZH 4OS2A 1TGBA 1MBQA 5EPNA 1B0FA 1EJNA 1SVPA 3BG8A 1TNGA 1TGSZ 1AMHA 1OWDA 2GCHG 2ZPQA 2JKHA 2ILNA 1NY22 5K7RA 1TPPA 2A7CA 3ZZ8A 1YGCH 2IN2A 3RXSA 1OP8A 1TNKA 4YT7H 2C8YB 1TAWA 3RXPA 2A7HA 3DHKH 4K60A 4B1TA 1XKAC 1IQMA 5FPYA 3A7VA 2G4TA 3D23A 2VIVA 1O2TA 3RXAA 1TNIA 3MHWU 1KLJH 3PWBA 3M5NA 1BJVA 1SLXB 3RMNH 2ZP0H 1THRH 1O3PB 1FN8A 1GI5A 2D1JA 3DA9B 1F92A 3V13A 3LGUA 1FLEE 3SU0A 2P8OC 3BTME 2OC1A 1TOMH 1KLIH 1EPTA 1DX5M 2OQ5A 3M7UA 1TX8A 1C1PA 2TGTA 2GDDA 2ZTZA 4ZHAA 3A8CA 2B0FA 3HKIB 3L3TA 3S69A 1PJPA 1VGCC 1V2MT 4Y76A 4ZKNU 1ZSJA 5EGMA 1GI1A 1JRSA 1P9SA 2J34A 1MKWH 2HNTF 4TWYA 1BBRE 4Z0KA 1TYNA 2FEQH 1V2PT 8ESTE 3KQCA 4IGDA 4KTCA 3E91A 3ELAH 1EZQA 1S85A 2O8MA 4D7FA 1AIXH 5DP9A 3A81A 1NM6A 1C1MA 3BEIB 4DJZB 2SGEE 2FMJA 1YPHC 4X6PA 1TPOA 3A83A 3SN8A 1W7XH 3BIVH 2ZDVH 1Y3VA 1MAYA 2ESTE 2A4OA 3VB7A 3UREA 1UK2A 1GJ7B 2GCHF 2FOHA 3QO6A 3D65E 1VCWA 1TPAE 1Z8RA 4OS7A 4XFQA 1GJ5H 4CR5A 1O3KA 2P94A 3LC5A 2AGGX 3R3GB 1M9UA 4DOQA 4TY7A 2OD3B 2XC0A 4DG4A 3MO9A 1AVWA 1SHYA 4IW4E 3RXIA 2ZQ2A 3LIWA 1SI5H 2VIWA 3EAJA 4AYVB 1ZTKA 3BTHE 1A61H 5TCCA 1XXFA 3SUGA 3RXOA 2BXTH 1MKXK 4ZMAH 2AYWA 1SGQE 1C5UA 4M7GA 4BOHA 2CN0H 1Z6JH 2GZ7A 3AVZA 2IOTA 4DY7B 2JH6D 8GCHG 1BTPA 4MQAA 1TBQH 3RXMA 2LPRA 5C1UA 2EI7A 2ZGHA 3RXRA 4UONA 1CE5A 5GXPA 3NUMA 4KTUA 1GHWH 4NWKA 1GCDA 2FI4E 4U2WA 4X2XA 1SLVB 5DP7A 2XYAA 1BMNH 2AH4X 2FI3E 4ISIH 4DURA 1N1LA 1QBOA 2AMDA 3P8FA 1EOJA 1WQSA 4X6NA 5E2PA 5CMXH 4ABGA 1L1NA 1L1GA 3FZZA 1QHRB 1KDQB 1AD8H 1P8VC 1WV7H 1XUFA 2FOGA 1C2GA 2FS9A 1MTNC 1GI9B 1C5VA 2ZC9H 3WY8A 1O2GH 3MFJA 1AWHB 4A1VA 1OPHB 1QJ6B 1S0RA 4FUBA 2ZU1A 1AE5A 5H4IB 3RXQA 3TU7H 1O5BB 2Z9JA 3UOPA 1V2ST 1O3OA 1ANBA 2FI5E 5G4BA 1SGYE 4AZ2B 3P95A 1WBGB 3LGYA 5DKMA 2Z7FE 1GMDG 4H6SB 4AG2A 1ZRBA 2PLXA 3T29A 2WUCA 2G51A 1HNEE 1O2WA 4YTAA 1TALA 3UNQA 1FNIA 1WTGH 2VVUA 1OS8A 1P05A 1O2UA 1A0HB 1Z71A 2J9NA 3VPKA 4CRFA 1WOFA 2C93B 1ZOMA 2GT7A 2NU2E 2ZGCA 3M61U 2A4GA 3SJ8A 1OWHA 3SU1A 1GDUA 4XDEA 2SGDE 2QIQA 1UJ1A 2A5IA 4A5TS 1ELEE 5TJXA 5C5NA 7KMEH 1A0JA 5PTPA 5GIBA 1ARBA 1EUFA 1AGJA 2FIRH 1W0YH 2GCTB 2OP9A 1ZHPA 1LO6A 3SORA 2PKAB 3FP7E 1S81A 1K1OA 3GCTF 4E06H 5K0HA 1W13U 2GZ9A 4B74A 4XOJA 5CE1A 3SV8A 1DY9A 1BQYA 3ZVBA 3H5CB 2F3CE 1G2LA 2F9PA 3TJNA 1GVZA 2BD4A 2ZDNA 3E0NB 1GJAB 4E7RG 1KXDA 4ISOA 2Q6FA 2ANYA 1TMTH 1AUJA 2VB0A 1B7XB 2SNWA 3TNTA 1TGNA 3S0NA 2ODPA 5A09A 1QRWA 2JETB 1FMGA 2ZCLP 2BDGA 3U1JB 1DPOA 3NXPA 9ESTA 3NWUA 2VGCB 1FUJA 4WMEA 1JMOH 2VVVA 3RU4T 1INCA 5C2ZA 1GMDF 3RMLH 3IITA 3ZYDA 4ZROA 2BD8A 1UO6A 2CV3A 1SHHB 1K1LA 1TFXA 4IN1A 2AGEX 1TGTA 2ZFRH 1TX7A 4ZKOU 4FUIA 2G81E 1V2KT 1ZJKA 1O2MA 5EU8A 3SV7A 1TRYA 2Y6TA 2QF3A 4D7GA 1OP2A 4JK5A 3SJKA 2OUAA 1ESBA 1TQ7B 2A31A 4I8HA 1HJAB 1MZDA 2J94A 4B73A 3OU0A 2UUJB 3H7OA 3U69H 1LKAA 4MPXA 5EXMA 1T32A 1IHSH 1PPEE 1C2IA 3SO3A 1O39A 3M5MA 4IMZA 3SV6A 3BEUA 2BY5X 2NU0E 1AFQB 1LHDH 2FOEA 2Z9IA 2R3YA 1HBTH 1LDTT 4NIWA 1BTYA 3PROA 1CA0B 1LPGB 1ZTLA 1HAZB 1Z6EA 1BTWA 2CXVA 2K1QA 1XKBC 1RD3B 4TYDA 2ZCHP 3F9EA 3AASA 4JZIA 1RTLA 3RXFA 1FQ3A 1RS0A 3MNXA 2XXLA 2BX4A 8KME2 1HPGA 1NU7B 1DM4B 1Z7KA 1TE0A 3CS7A 1GL1A 1K9OE 2WV4A 2PFEA 4Y79A 1O5FH 1O2OA 2P59A 1AY6H 1QIXB 3SI4H 1QBVH 1GHVH 1ZMLA 2GV7A 1DE7H 2A4QA 1PPCE 2XCFA 2P8OB 5E0HA 5BRRE 2Z3EA 6CHAB 1UTKA 1NT1A 1O2IA 1HAGE 1O2VA 5LGOA 2QXGA 1BMMH 2G5VA 2FOBA 1G9IE 1C5PA 3BV9B 1F0SA 3RXLA 4FUGA 1D3QB 3NKKA 1SGIB 3RMMH 4AFQA 3MH5A 2PKSB 4WWYA 5GCHG 1P2QA 1WCZA 2BXUH 1T4VH 1DVAH 1IQEA 1QBNA 2C8WB 3RC6A 2VVCA 1P2JA 1MTVA 3LH1A 5B6OA 1OWEA 4K1TA 4NFEA 3UNSA 3MU0A 5DP4A 2ZEBA 1CQQA 1EPTB 1EJAA 3V12A 2OXSA 1T8LA 3URCA 1UMAH 1AHTH 3V3MA 4BAMB 5J4QA 4K1SA 2PTCE 1KXCA 2O8UA 3K6YA 2XWAA 3KN2A 1MKXH 4XBCA 4HZHA 5T6GA 1YPLH 2BQWB 3CENA 1IQNA 1K28D 1MTSA 1XMNB 4WMFA 1F5KU 2FZZA 5F03A 1K21H 1L2EA 4Y7BA 1E38B 3QZRA 2TGPZ 1O37A 1G3CA 2AMPA 1V2LT 1F7ZA 1O2ZA 4KGAA 2PR3A 3FP6E 1F5LA 4I8JA 4BAKB 1QJ7B 1CT4E 4MPUA 4J2YB 2F83A 2WINI 3S9CA 4FVBA 1J8AA 1V2NT 3UY9A 4NZLA 1QL7A 1DWEH 1TABE 2ALPA 3SJOA 1C9TA 1MQ6A 3GISB 1ANCA 2PTNA 1EZUC 4JYUH 4KTSA 3KL6A 1Z1JA 2W3IA 4JCNA 2C4FH 1BMLA 1GJ9B 4UFFH 1SLUB 1WU1A 3TIUA 1IQLA 4YT6H 5HGGA 3VB5A 2UWPA 3K9XB 4TPYA 3SNEA 3QLPH 5FCRA 1SFIA 1NPMA 4NWLA 1C5QA 1YF4A 4ZH8A 1BMAA 4AFUA 2P93A 1H8IH 4NA8A 5HMAA 3ZVDA 5JBCS 2FESH 3SQHE 2ZHQH 4X0WU 4JZFH 1BA8B 1NESE 3A7ZA 1D6WA 5DO4H 4NSYA 3PLPA 1TBRH 1SL3A 4Y11E 1PQAA 5FPSA 4XBBA 1AI8H 3ZZBA 2SGQE 1TWXB 2UWLA 3ENSB 2C8XB 5DJ7A 1GI0A 4MPWA 3CP7A 1P3EA 1GHXH 2QN5T 4INHA 4AB8A 3MH7A 4NZQA 1C5ZB 2AERH 1G3EA 4U01A 4R0IA 1GL0E 2ANWA 1QY6A 3QUMP 3SBKA 1G37A 2BVRH 5GDSH 1O5GH 3PV4A 1J16A 4Q7YA 1KXAA 2ZWLH 4CREA 1NS3A 4YZUA 2QXHA 1YPGH 5L2YH 1HXEH 1XXDA 1DWCH 4ABIA 3MI4A 1GBFA 1C1UH 4DT7B 2WUBA 3GCNA 3P8GA 1WQVH 1AKSB 3SJ9A 3PMAB 2V3OH 2R0KA 4ZXXH 1CBWC 2OC0A 3TLOA 2I6QA 1K22H 5LPFA 4WY3A 2ZDLA 2V0BA 2BDYA 3OY6U 2QAAA 2BY9X 2ZKSA 3A7XA 1GGDB 1AFEH 1C5TA 1A4WH 1MQ5A 5EG4A 4FUCA 1SQTA 1NC6A 3QTOH 3VB3A 3MMGA 3RXGA 2A2XH 1GVKB 2ZGJA 3A84A 1MH0A 2BD9A 1FAKH 1YPHE 1HJ9A 1QTFA 2BLQA 1SSXA 3PM3A 5JBBS 3ATIA 4CRDA 1GI2A 1HYLA 4X1SU 1GI8B 2B8OH 2WPLS 4GHTA 1ACBE 5L6NH 1O3NA 2BVSH 5EQQA 3FAOA 2WV5A 4ABAA 2BDCA 2QC2A 1V2VT 1GBBA 1SG8B 1TIOA 4CH8B 1J15A 1GBTA 2ZDKA 4DIHH 4D76A 2HVXA 3GY7A 2HPPH 3RC5A 5CHAB 4INLA 3P17H 3SGBE 1CA8B 3DUXH 1D9IA 3TNSA 3DFJA 1T8MA 1ELTA 1XUIA 3L6PA 1J17T 1HAHH 1O35A 3BN9A 4JZEH 3TPIZ 3A7WA 3S7HB 1O2LA 1O3FA 1D3PB 2BVXH 2H1UA 2ZPRA 3PLKA 3VFEA 4A1XA 2TIOA 2A7JA 1EB2A 1ZMNA 3GCHC 1VITG 1LVMA 5DP3A 3RU4D 3TK9A 2BM2A 2GMTB 2TGDA 3A8AA 2QYIA 1C1NA 1UCYK 3RM0H 1OOKB 2VWMA 1T8NA 3TH2H 3RMOH 2A4RA 5LH8A 2Y81A 4JK6A 2EC9H 1ZSLA 2ZNKH 1C2LA 1P01A 5E8EH 1O3CA 3O8BA 1THPB 4CHAB 4J1YA 4GAWA 1Y5AT 3KIDU 1ELFA 1E36B 4HGCA 2V3HH 3LPRA 1H9HE 3ZYEA 2PHBA 3KNXA 1HFDA 5DG6A 1F0UA 3A8DA 5I46H 2J4IA 1LHEH 4NIXA 3F68H 4FUHA 1UTQA 2AMQA 3ZZ6A 4UEHH 2Z3CA 3UQOA 1L4ZA 4CH2B 1ELGA 2BTCE 1YPEH 3MO3A 2AIQA 2B7DH 3MNSA 1V2QT 2ZHDA 2XW9A 3SUFA 1KXEA 1Q31A 4H4FA 5A0AE 1D6RA 5EQRA 4HFPB 1A1RA 3I77A 3A87A 1E37B 5EODA 5C20A 5EW1H 2G55A 1EP5A 5FX6A 1EASA 3TK5A 1TOCB 1VZQH 4YOJA 5E0GA 3RLYH 3TGJE 1S84A 1LHGH 2FLBH 1FI8A 1ZSKA 2XBYA 2Z9GA 5HXFA 3BG4B 1GPZA 1VITF 3UPEA 1C5LH 4A1TA 3RXJA 2H5DA 1GI7B 4F49A 3M7TA 1DFPA 1YKTA 4RKOB 1GCTB 2I6SA 3F9FA 1N8OC 1S82A 4DVAU 1GWAA 1O2PA 1XVOA 1SFQB 4LK4A 3ZZ4A 1LTOA 1Y8TA 1Y3WA 3GY3A 4BNRA 3L33A 4AORA 1FY4A 2VIPA 1Y3UA 3E16B 1O3MA 1MTWA 1S0QA 1V2TT 4K8YA 1IQHA 3SOSA 1SQAA 1DT2A 1S83A 2TRMA 5DP6A 1T4UH 1C2KA 4BXWA 3GY4A 4WMDA 3CS0A 4ZKSU 1HIAA 1EAIA 1UHBA 2STAE 3T2NA 3T5FH 1LHCH 2R2WU 5DK1A 2XC5A 1WYKA 3LU9B 4WXVA 1K1MA 1OWIA 3F9HA 2CHAC 3VGCB 1ID5H 1BTXA 2AEIH 1P0SH 2QXJA 4VGCB 3O8CA 1HB0B 1QA7A 1V2OT 3KHVA 1CO7E 2UUFB 1DY8A 1GBAA 1UVUH 1BRBE 3SW2B 1MCTA 2PWXA 4FU9A 1V2RT 1DANH 1FIZA 2ZFTA 1O5AB 2ZU3A 3OSYA 1PPFE 1MBMA 3M5OA 1C1SA 3GCTG 2PUXB 1N6YA 4RSPA 2J95A 2XWBI 1C4Y2 3ZV8A 5C1XA 2FOAA 2VIDA 3D62A 3HGPA 2FOMB 2ZU4A 1VJAU 1ZZZA 1QB6A 2ODQA 2ASUB 1O3GA 1HAYB 2PSYA 1GG6C 1AZ8A 5ABWA 1GBJA 1TA6A 2B5TB 4B76A 3GYMA 3FFGA 3KQEA 1N6XA 3P8NA 2Y5FA 2YNBA 2G00A 1NRNH 1TQ0B 1O2QA 4MNWA 1AKSA 4H6TA 2BY7X 1FY3A 4WF8A 2R9PA 1AVGH 1QJ1B 3M3VA 4YLUA 1ESAA 3FANA 4OGXA 4ZAEA 4K1EA 3GY6A 2ZZUH 1YPJH 4ZHLU 3BTTE 4NCYA 2QY0B 1O30A 5F8XA 3TITA 3RXBA 4UFEH 3GOVB 3SV9A 1V2JT 1Y5UT 3UIRA 1FY8E 1O3BA 2ALVA 1GJBB 2OLGA 3BTGE 2BD7A 1TX6A 1C4V2
chains in the Genus database with same CATH superfamily
1FXYA 1SGFG 2GVFA 3QGJA 1BTUA 3ITIA 4O3UA 1Y3YA 3SU3A 1P10A 1C5MD 1FPHH 1AZZA 3AW0A 3FN8A 4AYYB 1MUEB 4K5ZA 1C5YB 1QURH 3PO1C 4YESB 2V7QD 4Y8ZA 2J2UA 1HUTH 5GWZA 3IG6B 2FLRH 4LZ4B 1GMHF 5HM9A 1RIWC 2A32A 3LJOA 1NTPA 2M2AA 2CK3D 3HPTB 1QL9A 1GBEA 3BTKE 1YPMH 5FX5A 3RDZA 3SZNA 1ELCA 1A3EH 3JZ2B 3EGKH 1YP9A 1C5NH 1DXPA 1XM1A 3MU4A 5AFYH 2FDAA 1KXBA 2F9OA 1GI4A 2ZU5A 2BLVA 4I8GA 1W3CA 1SQRA 1UVOA 3GY8A 3LKWA 2YOLA 1DUEA 1H1BA 4ACAA 4ESTE 5HM2A 3W95A 1O38A 4CR9A 4Y71A 4MVNA 1UCYH 1O3IA 4BTTB 1DITH 3U8OH 4FU8A 1C2JA 2Z6BD 3U8TH 2XCNA 4UFGH 4MLFB 5JB9S 1LPZB 4Y6DA 3ZVEA 4OM9A 4X1PU 1P2IA 3W1EA 1IQFA 4TWWA 4ZKRU 4UD9H 4MNYA 5I25A 1QB9A 2XTTB 3ZVCA 1SGFA 1F2SE 1DLEA 1W8BH 4ZXYH 1TNJA 3M3TA 1BOQA 1TMUH 2BD3A 2R2MB 3UNRA 1HGTH 1LVBA 1O3HA 2XBWA 4Y0ZE 3UQVA 1C1TA 4A7IB 3N7EA 4X2YA 3ODDA 1BIOA 3GY5A 2IPQX 1EAWA 1GHBG 4SGAE 3S9AA 3E0PB 1EJMA 1GJDB 2C90B 4WH6A 2R3UA 2L6OA 1GJ4H 4NA7A 1GDQA 4IBLH 1IQJA 3BEFB 1BBRK 5C67A 4WJG2 1EATA 1HAPH 2THFB 5FXLA 1CU1A 5HKKD 2W7UA 2GT8A 3PMJA 2VH0A 5SGAE 4ZCNA 1EB1H 4WVPE 1CHOF 3URDA 2KZ4A 1BHXF 2BOHB 1V3XA 4YO9A 1O31A 4AB9A 1FPCH 2VBCA 3OTJE 1BJUA 2YNAA 4Q4LA 2STBE 4KKDA 1QQ4A 3E3TA 3UB0A 3A85A 1YC0A 2BLOA 2KAIA 1BRCE 1T7CA 3SU4A 2QCYA 2F9UA 4KELA 4X1QU 1KLTA 1Y59T 2JH5D 1VGCB 3E90B 4IN2A 3VXFH 3MU8A 1B0EA 1O5CB 4NFFA 3DT0H 1TONA 4BAOB 1SOTA 1QA0A 1C1RA 2O8WA 1NRQH 3WWBA 5B6LA 3AK5A 3TVJB 1KMHB 2BDHA 2ZTYA 1U6QA 2ANKH 4B75A 1NROH 1PPZA 2FTMA 2H5CA 4Q7ZA 3QTVH 3UWIA 1T31A 3LGIA 1C1VH 2BZ6H 1H9LB 3SJIA 4NSVA 3GDSA 3HKJB 1O32A 1ABJH 4IMQA 1XVMA 4NG9H 4D8NA 4WXIA 2Q6GA 2J38A 2OINA 1Y5BT 1EP6A 5BPEA 4ABDA 1EZXC 1XX9A 2FWWA 4INKA 3PLBA 5FPTA 1H4WA 1GHBF 3RXTA 3BIUH 1AWFH 1ZPZA 3F2HA 1ELBA 4Z1MD 5DP8A 3EYDA 1UVSH 4AX9H 2Z9LA 1DDJA 2IJOB 2ZHWH 1HAXB 2C8ZB 1HAIH 2W7SA 5IDKA 2FX6A 1UTOA 2ODYB 1HDTH 4GHQA 1QQUA 4ABFA 1S5SA 1VJ9U 4DCDA 4O9VA 1Z8IB 3BTDE 3LGWA 2BDAA 3PRBA 2HWLB 3KYFA 2RFKC 1V6DA 2G4UA 5JBTA 1ZTJA 2CF8H 2QGRA 1HIAB 5C94A 1UHBB 1MD8A 1QL8A 4Z6AH 2CMYA 3K6ZA 2H2ZA 5J4SA 1O5DH 2HRVA 3DSOA 1AQ7A 3A82A 3ATLA 1OYTH 1VCQA 3KEEA 3LONA 2ZGBH 4U30A 1C1QA 2HVYB 2ZFSA 5LPEA 1IHTH 5C3NA 3ZZAA 2GV6A 2NU3E 1P12E 2OCVB 5AHGH 1MTNB 3U98H 3GDUA 1Z8JB 1XUKA 3Q3KA 4B6EA 2GX4A 3ATWA 1QR3E 1CVWH 3VG8A 3MYWA 1GG6B 1HCGA 1A5IA 3SGQE 1O2SA 3F6UH 4O97A 1ANEA 4X6OA 2BQ7B 2M5TA 3QDZB 1J9CH 1L4DA 3SUEA 1YPKH 1V2UT 3T62A 2J92A 6LPRA 3U9AH 1P2NA 1SKYE 3W94A 1O5EH 2ZO3H 3P8OA 1KYNA 2WPKS 4ACBA 2ZDMA 1MAXA 4NIVA 1S6FA 5IK2D 3C27B 2Q1JA 1ELDE 3BTWE 1GVLA 2VINA 4NGAH 2OBOA 3BTEE 1MU6B 3BTQE 2P95A 2LNCA 2VWNA 1SB1H 4X8TH 3UTUH 5A0BA 2W3KA 1UVPA 1UTNA 4CBOA 4XD7D 1SGCA 1TA2A 2L74A 2Y5HA 4ZHMU 2FX4A 1OX1A 1CT0E 1G3BA 1Q3XA 1GMCF 2YMSD 2GCTC 2A2QH 2BLWA 4I7YH 3BTFE 3B8JA 1YYY1 1JIMA 1P2KA 1BDAA 1BZXE 1C2DA 3KF2A 1RJXB 3E1XB 1VKYA 1AB9C 2H9TH 2DUCA 9LPRA 2A0QB 2QA9E 3ZV9A 2OC8A 5F6MA 1A2CH 4D9QA 2B9LA 1HRTH 4Q63A 2ZIQH 1K1IA 1NFYA 3P92A 2GDEH 3A88A 2ZFPH 1OXGA 2JETC 1W7GH 3ZIAD 5FBIA 1JIRA 4GCHG 2GKVE 4YLQH 4OS1A 3NCLA 5AF9H 4CRGA 2VGCC 3VB6A 2R0LA 2O8TA 3TJOA 5EQSA 4B2CA 4ABHA 1FV9A 2G52A 4X8UH 1A3BH 1E0FD 2PUQH 4DIIH 3O8RA 1EOLA 1ANDA 2BZAA 3RXEA 1SMFE 3GCOA 1SGNE 2WYJA 5DPAA 1DSTA 3QGNB 1QCPA 1ZYOA 4B6FA 1HXFH 1PPBH 4K2YA 1IQGA 2OTVA 1A46H 2BMGB 1JOUB 4I8LA 1DLKB 1BT7A 3SHCH 3KGPA 4JMYA 3S7KB 3T27A 2XBVA 2KCOA 1JXPA 2P16A 1HJAC 4LOYH 2CF9H 4I33A 5F8ZA 4BAHB 1NN6A 1RTFB 3V7TA 1BTZA 1YLDA 2NWNA 1MTUA 2HOBA 4I32A 3UUZA 3ZVAA 1UTPA 4CRBA 3A89A 1NZQH 2BDIA 1E34B 3RXCA 1DWBH 3NK8A 1CSOE 1GHYH 2W5EA 1AFQC 1CGIE 3SU5A 1EX3A 1BBRH 2ZHFH 4Q2KA 4XBDA 3MWIU 1LPKB 2QE7D 2OQUA 2SNVA 3E6PH 1CA0C 1KTSB 4K8BA 4AGJA 5L30H 1O2RA 4XSKU 3DD2H 4O03A 1C2MA 3QN7A 4FU7A 4X6MA 2DE9A 1OKXA 4X8SH 1K2I1 2TBSA 1ELAA 1H8ED 3PTNA 1CGHA 4UFDH 4ASHA 4PROA 2ZPSA 1Y3XA 1O2XA 3F0PA 1MMJN 4GCHF 1PYTD 4K3JA 2P3FH 1E1QD 1C5RA 2V6NA 4FOUC 3OX7U 3LOXA 1CT2E 1C5SA 1X7AC 1HLTH 1PQ8A 2BX3A 4THNH 1P57B 1RFNA 1GHAG 3EQ0H 3RXHA 4FUFA 4OS6A 3RLWH 1TB6H 6CHAC 1GI6A 3ZZ5A 1AE8H 4TY6A 1J14A 2ZG0H 4ZUHA 1QGFA 1BB0B 2FP7B 2ZHEH 2Y80A 3RXKA 2GGVB 4JYVH 2PKSC 3OFND 1P04A 3MU1A 4FXGH 3VXEH 1P06A 2BQ6B 2D26C 2Z3DA 4JZ1A 2PV9B 1QZ8A 3LDXH 4MNVA 4UE7H 2QV1A 5ESBA 4HI3A 3SUDA 4E05H 4XE4A 1GJ6A 1O3JA 1TNLA 3F1SB 5DP5A 1EPTC 1BCUH 1BHXB 3G01A 4IC6A 1W2KH 3HK3B 1SPJA 2GZ8A 4AC9A 2KAIB 2VIOA 2P3UB 1WUNH 4YOGA 2HNTC 1JRTA 2FYQA 4O3TA 2ZF0H 1ORFA 4MG3A 1FN6A 1ESTA 1WAYB 2WPHS 3Q77A 4MTBA 2FM2A 1AO5A 3LGTA 3ZZ9A 5ETXA 2VNTA 4OGYA 1YM0A 3DFLA 1O3EA 1SGPE 3M3SA 3H7TA 1A0LA 2KCYA 1LMWB 1NU9A 2BDBA 5T6FA 1E79D 2BY8X 2RDLA 2ZI2H 3MU5A 3VB4A 2H9HA 1XUHA 3OY5U 3Q3YA 1HV7A 5EIYA 1W0JD 3RXDA 1GHAF 2Y7XA 3PWCA 4B2AA 1H9IE 1UK4A 1GDNA 4B2BA 1C5XB 4FUEA 3ZZDA 3OYPA 1FAXA 1LKBA 2JJ2D 1TRMA 2GTBA 1LQDB 3LH3A 1OWJA 3SGAE 1ZRKA 4AN7A 1GI3A 1GMHG 3NPSA 2W26A 2Y82A 1EZSC 5EOKA 3TH3H 4ISHH 5AFZH 2HPQH 2IPHA 1C5WB 4BAQB 3M5LA 3DCLA 3PMBB 5FBEA 3QWCH 1O2JA 1F0RA 1MD7A 1P11E 1NRSH 1L1JA 3E8LA 1D3DB 1EAXA 1RRKA 2FS8A 1PFXC 3M36A 3A8BA 2A5KA 3R0FA 1C2FA 2ANMH 1FIWA 1GBLA 4YM9A 1D3TB 1DXWA 2XNIA 3UR9A 1HAVB 4GLYA 1C9PA 4ABJA 4F4OC 3T26A 1PQ7A 5LPRA 2GD4B 1CHGA 3GS9A 5DN6D 1ETTH 2AFQB 2PSXA 3PB1E 3B9FH 2F9VA 1TPSA 6ESTA 1ZHRA 3FVFB 4KP0A 1OYQA 2RCEA 1NRPH 2F4LA 3RP2A 3VEQB 1ELVA 1C5OH 1QRZA 3TJUA 1GBMA 2O9QA 4AFSA 5DGJA 3S9BA 1DOJA 2J97A 1GBDA 1MZAA 4K69A 4MNXA 1GJCB 1W0ZU 1ZHMA 2QF4A 1O2NA 1C1WH 1UTMA 1FZZA 4ISNA 4YOIA 8GCHF 1UVTH 1BRUP 2SGFE 1THSH 1QB1A 3NZIA 3EE0B 1IAUA 3ODFA 1PQ5A 2BHGA 1QFKH 1G32B 3LJJA 1O2KA 4DT4A 1ETRH 2C3SA 4I31A 1T8OA 1LVYA 1EAUA 2AIPA 2UUYA 1CBWB 4NA9H 2UWOA 1GGDC 3O8DA 4OS5A 1GBIA 2F91A 4R8TB 4Y8YA 3UOUA 4CBNA 8LPRA 1SGRE 1WTHD 7ESTE 2ZGXH 2H9EH 5FHTA 3A86A 3T25A 4ABBA 1GBKA 1G30B 1QRXA 5EW2H 1AB9B 1FONA 4AGKA 3HGNA 3HK6B 1HJ8A 5E2OA 1CHOG 1UK3A 1NRRH 1SR5C 1NO9H 3TGIE 3MOCA 2Z94A 3BSQA 1O3AA 1BRAA 1YLCA 5T3HA 3ZVFA 2O8LA 1P09A 1FY1A 1ZMJA 2PGBB 1O34A 3PMHB 6GCHG 1Q2WA 5CHAC 4H42U 3QZQA 2TGAA 3AAVA 3ATKA 3KYGA 4GPGA 2EEKA 1W14U 2ZA5A 3RUOA 1K0HA 3A7TA 2GP9B 1K1JA 1TMBH 3SNAA 2RA3A 2HLCA 2ZTXA 3TJVA 1ZPCA 2BD2A 1W0KD 3SHAH 3STJA 2GMTC 3OE7D 1C2HA 1P2MA 1P03A 4AOQA 5KGOA 1YCPK 3MH4A 3PYHA 1FDPA 3GCHB 4X2WA 5A0CA 3TH4H 3RXVA 1LQEA 5EXNA 1WSSH 2JIZD 3GY2A 4CHAC 2A45B 2ZFFH 1ZR0A 3KQDA 3QX5H 5EXLA 2OC7A 2V35A 4Y7AA 3RXUA 1AUTC 5TCAA 5EPYA 1KIGH 1TNHA 2D2DA 3UR6A 5HYOA 3SU2A 4LXBH 2ZCKP 2JJ1D 2H6MA 3EA8A 5JPMH 1EXFA 1OP0A 1UCYE 1WDIA 1GJ8B 2VH6A 1O36A 1P3CA 3EE7A 1L0ZA 1E1RD 3MNCA 3MQKC 1O3LA 3M35A 2DE8A 5C0UA 2FODA 4HTCH 3LC3A 1K1NA 2Q6DA 3Q00A 3OEHD 5L2ZH 4AG1A 1NBMD 5JBAS 3A80A 2ZFQH 4QT8C 4CRCA 6GCHF 3MO6A 4A92A 4UDWH 2HGTH 2BYAX 4RKJB 3TK6A 2FOFA 5C0TA 3ZZ3A 1BTHH 1W10U 2XBXA 1SBWA 3SU6A 4JYTA 1GHZA 1OSSA 4TT3D 3BG4C 1A5HA 1YCPM 1CGJE 3K2UA 3AAUA 1SGTA 1C4U2 1GCTC 1AVXA 1ETSH 4LZ1H 4MPVA 1A5GH 1MKWK 1YBWA 3SNBA 3EDXB 4RN6A 1UW7A 3MH6A 1O2HA 2FOCA 2FTLE 1H8HD 2WHXA 1D4PB 2RA0A 3QK1A 5A8ZA 1N8OB 4GVUA 2KM0A 1G36A 1Z1IA 3B23B 3M7QA 4SGBE 4B71A 1SGDE 2Y7ZA 2NU1E 5GPIB 2J5UA 4Q7XA 4IC5A 4WH8A 2P3TB 2CJIA 1DUAA 1RXPA 1H8DH 1O33A 2D8WA 3ZZ7A 1TRNA 7GCHG 3RU4E 2HALA 1BITA 2Y5GA 3EA7A 2WPDD 4FUDA 1O0DH 3VGCC 3RM2H 2ZECA 1P9UA 2VU8E 4VGCC 5FCKA 3P6ZB 1SLWB 4E7NA 4ASUD 4FUJA 5JDUB 1KDQA 2ZDAH 2CHAB 4ISLA 1IOEA 3GDVA 2WPJS 4NIYA 2JH0D 3IWMA 1WXRA 3BF6H 2LP6A 1HAVA 1DS2E 1TLDA 3SI3H 1VR1H 3SQEE 3RC4A 2Z9KA 1V2WT 1GMCG 3FP8E 1DWDH 1C1OA 5A8XA 4Y10E 1FJSA 2SGAA 2BB4A 1G2MA 1GBHA 5C1YA 2BD5A 2K8IA 2QXIA 3SNDA 2FPZA 1UTJA 4IS5A 1ABIH 1W12U 2PP6A 2QF0A 4Y0YE 4GSOA 5E0JA 1ZGVA 3UFAA 3TGKE 3EA9A 4Y8XA 1ZGIA 1PPGE 3Q76A 2EI8A 3ESTA 5GCHF 5JB8S 4BTUB 1DICA 3PRDA 1DSUA 5A8YA 2A5AA 3STIA 2YMSC 5GJ4B 1AN1E 2F9NA 1IQKA 4AFZA 5KEDA 4FETA 2UUKB 3MNBA 3MTYA 3KQBA 5DSFA 1KXFA 5ESTE 2VWOA 4BXSA 4CRAA 1MCVA 4DGJA 2WYGA 1SOZA 2EI6A 3UWJH 4D9RA 3AW1A 4DW2U 4U32A 1NFXA 2VJ1A 1P2OA 1F0TA 1OWKA 2CGAA 1SC8U 1E35B 5AVDA 7GCHF 1KSNA 1G3DA 3M37A 2PKAA 2TPIZ 2EA3A 1LHFH 1Z8GA 1KY9A 1C2EA 2FO9A 3FZDA 1VCPA 2XC4A 5C5OA 1O3DA 1FY5A 2VWLA 1ZLRA 2VIQA 4F48B 2WPMS 2G8TA 5T6DA 1TGCA 1S6HA 1ARCA 5HIYA 1AU8A 5JYIA 3U8RH 5A2MH 2ZU2A 2SGPE 1S6LA 3GYLB 4BANB 1EKBB 3ZZCA 2RG3A 3A7YA 3KCGH 1VITH 2PW8H 1LCYA 1IQIA 3HATH 1F5RA 1ZPBA 2PGQB 3SZEA 1HAOH 1K1PA 3I78A 5FAHA 2NU4E 3C1KA 1RTKA 1JWTA 1MU8B 3PO1B 3P70B 3T28A 2ULLA 1PPHE 1EQ9A 1UTLM 1W11U 1RIWB 1P02A 3I29A 3F9GA 1B5GH 3LT3A 4X2VA 3GICB 3SV2H 3LGVA 1XUJA 1BUIA 3V0XA 2V3MA 2FXRA 1KTTB 2KFWA 2OBQA 1QNJA 1A7SA 3ATMA 4A6LA 2G5NA 1NFUA 4GUXA 1GBCA 2HNTE 2XRCA 3K65B 1SGEE 3U1IB 4OS4A 4X8VH 3NRLA 2BOKA 4FVDA 3Q3XA 2WPIS 3JZ1B 4ABEA 4TPIZ 2BY6X 4I8KA 3PTBA 2AGIX 3D49H 7LPRA 1O2YA 1LVOA 1JBUH 4Q80A 2ZQ1A 1SQOA 1YCPH 2AS9A 1PYTC 2WV9A 5IYTA 3N7OA 1RGQA 1ZJDA 2A1DB 3ZVGA 4BTIB 5F8TA 4MDSA 4JZDH 2F9BH 2SFAA 4X1NU 2FYRA 4X1RU 3SNCA 1XUGA 1NFWA 1TBZH 4OS2A 1TGBA 1MBQA 5EPNA 3UAIC 1B0FA 1EJNA 1SVPA 3BG8A 1TNGA 1TGSZ 1AMHA 1OWDA 2GCHG 2ZPQA 2JKHA 2ILNA 1NY22 5K7RA 1TPPA 1YWUA 2A7CA 3ZZ8A 1YGCH 2IN2A 3RXSA 1OP8A 5HIZA 1TNKA 4YT7H 2C8YB 1TAWA 3RXPA 2A7HA 3DHKH 4K60A 4B1TA 1XKAC 1IQMA 5FPYA 3A7VA 2G4TA 3D23A 2VIVA 1O2TA 3RXAA 1TNIA 3MHWU 1KLJH 3PWBA 3M5NA 1BJVA 1SLXB 3RMNH 2ZP0H 1THRH 1O3PB 1FN8A 1GI5A 2D1JA 3DA9B 4RT1A 1F92A 3PV2A 3V13A 3LGUA 1FLEE 3SU0A 2P8OC 3BTME 2OC1A 1TOMH 1KLIH 1EPTA 1DX5M 2OQ5A 3M7UA 1TX8A 1C1PA 2TGTA 2GDDA 2ZTZA 4ZHAA 3A8CA 2B0FA 3HKIB 3L3TA 3S69A 1PJPA 1VGCC 1V2MT 4Y76A 4ZKNU 1ZSJA 5EGMA 1GI1A 1JRSA 1P9SA 2J34A 3DSPA 1MKWH 2HNTF 4TWYA 1BBRE 4Z0KA 1TYNA 2FEQH 1V2PT 8ESTE 3KQCA 4IGDA 4KTCA 3E91A 3ELAH 3N99A 1EZQA 1S85A 2O8MA 4D7FA 1AIXH 5DP9A 3A81A 1NM6A 1C1MA 3BEIB 5EJ1A 4DJZB 2SGEE 2FMJA 1YPHC 4X6PA 3FKSD 1TPOA 3A83A 3SN8A 1W7XH 3BIVH 2ZDVH 1Y3VA 1MAYA 2ESTE 2A4OA 3VB7A 3UREA 1UK2A 1GJ7B 2GCHF 2FOHA 3QO6A 3D65E 1VCWA 1TPAE 1Z8RA 4OS7A 4XFQA 1GJ5H 3F3BA 4CR5A 1O3KA 2P94A 3LC5A 2AGGX 3R3GB 1M9UA 4DOQA 4TY7A 2OD3B 2XC0A 4DG4A 3MO9A 1AVWA 1SHYA 4IW4E 3RXIA 2ZQ2A 3LIWA 1SI5H 2VIWA 3EAJA 4AYVB 1ZTKA 3BTHE 1A61H 5TCCA 1XXFA 3SUGA 3RXOA 2BXTH 1MKXK 4ZMAH 2AYWA 1SGQE 1C5UA 2JDID 4M7GA 2CN0H 1Z6JH 4BOHA 2GZ7A 3AVZA 2IOTA 4DY7B 2JH6D 8GCHG 1BTPA 4MQAA 1TBQH 3RXMA 2LPRA 5C1UA 2EI7A 2ZGHA 3RXRA 4UONA 1CE5A 5GXPA 3NUMA 4KTUA 1GHWH 4NWKA 1GCDA 2FI4E 4U2WA 4X2XA 5T1VA 3U28C 1SLVB 5DP7A 3OTPA 2XYAA 1BMNH 2WSSD 2AH4X 2FI3E 2EY4C 4ISIH 4DURA 3PV5A 1N1LA 1QBOA 2AMDA 3P8FA 1EOJA 1WQSA 4X6NA 5E2PA 5CMXH 4ABGA 1L1NA 1L1GA 3FZZA 1QHRB 1KDQB 1AD8H 1P8VC 1WV7H 1XUFA 2FOGA 1C2GA 2FS9A 1MTNC 1GI9B 1C5VA 2ZC9H 3WY8A 1O2GH 3MFJA 1AWHB 4A1VA 1OPHB 1QJ6B 1S0RA 4FUBA 2ZU1A 1AE5A 5H4IB 3RXQA 3TU7H 1O5BB 2Z9JA 3UOPA 1V2ST 1O3OA 1ANBA 4F55A 2FI5E 5G4BA 1SGYE 4AZ2B 3P95A 1WBGB 3LGYA 5DKMA 2GJGA 2Z7FE 1GMDG 4H6SB 4AG2A 1ZRBA 2PLXA 3T29A 2WUCA 2G51A 1HNEE 3F2FA 1O2WA 4YTAA 1TALA 3UNQA 1FNIA 1WTGH 2VVUA 1OS8A 1P05A 1O2UA 1A0HB 1Z71A 2J9NA 2W6JD 3VPKA 4CRFA 1WOFA 2C93B 1ZOMA 2GT7A 2NU2E 2ZGCA 1BMFD 2QF5A 3M61U 2A4GA 2OK5A 3SJ8A 5EJLA 1OWHA 3SU1A 1GDUA 4XDEA 2SGDE 2QIQA 1UJ1A 2A5IA 4A5TS 1ELEE 5TJXA 5C5NA 7KMEH 1A0JA 5PTPA 5GIBA 1ARBA 1EUFA 1AGJA 2FIRH 1W0YH 2GCTB 2OP9A 1ZHPA 1LO6A 3SORA 2PKAB 3FP7E 1S81A 1K1OA 3GCTF 4E06H 5K0HA 1W13U 2GZ9A 4B74A 4RI0A 2KR7A 4XOJA 5CE1A 3SV8A 1DY9A 1BQYA 3ZVBA 3H5CB 2F3CE 1G2LA 2F9PA 3TJNA 1GVZA 2BD4A 2ZDNA 3E0NB 1GJAB 4E7RG 1KXDA 4ISOA 2Q6FA 2J98A 2ANYA 1TMTH 1AUJA 2VB0A 1B7XB 2SNWA 3TNTA 1TGNA 3S0NA 2ODPA 5A09A 1QRWA 2JETB 1FMGA 2ZCLP 2BDGA 3U1JB 1DPOA 3NXPA 9ESTA 3NWUA 5C17A 2VGCB 1FUJA 4WMEA 1JMOH 2VVVA 3RU4T 1INCA 5C2ZA 1GMDF 3RMLH 3IITA 3ZYDA 5KECA 4ZROA 2BD8A 1UO6A 4YXWD 2CV3A 1SHHB 1K1LA 1TFXA 4IN1A 2AGEX 1TGTA 2ZFRH 3FO8D 1TX7A 4ZKOU 4FUIA 2G81E 1V2KT 1ZJKA 1O2MA 5EU8A 3SV7A 1TRYA 2Y6TA 2QF3A 4D7GA 1OP2A 4JK5A 3SJKA 2OUAA 1ESBA 1TQ7B 2A31A 4I8HA 1HJAB 1MZDA 2J94A 4B73A 3OU0A 2UUJB 3H7OA 3U69H 1LKAA 4MPXA 5EXMA 1T32A 2RDEA 2IJD1 3H09A 1IHSH 1PPEE 1C2IA 3SO3A 1O39A 3M5MA 4IMZA 3SV6A 3BEUA 2BY5X 2NU0E 1AFQB 1LHDH 2FOEA 2Z9IA 2R3YA 1HBTH 1LDTT 4NIWA 1BTYA 3PROA 1CA0B 1LPGB 1ZTLA 1HAZB 1Z6EA 1BTWA 2CXVA 2K1QA 1XKBC 1RD3B 4TYDA 2ZCHP 3F9EA 2K0QA 3AASA 4JZIA 1RTLA 3RXFA 1FQ3A 1RS0A 3MNXA 4HG6A 2XXLA 2XOKD 2BX4A 8KME2 1HPGA 1NU7B 1DM4B 1Z7KA 1TE0A 3CS7A 1GL1A 1K9OE 2WV4A 4M9FA 2PFEA 4Y79A 1O5FH 1O2OA 2P59A 1AY6H 1FX0B 1QIXB 3SI4H 1QBVH 1GHVH 1ZMLA 2GV7A 1DE7H 2A4QA 1PPCE 2XCFA 2P8OB 3FOAA 5E0HA 5BRRE 2Z3EA 3F2GA 6CHAB 1UTKA 1NT1A 1O2IA 1HAGE 1O2VA 5LGOA 2QXGA 1BMMH 2G5VA 2FOBA 1G9IE 1C5PA 3BV9B 1F0SA 3RXLA 4FUGA 1D3QB 3NKKA 1SGIB 3RMMH 4AFQA 3MH5A 2PKSB 4WWYA 3WW7A 5GCHG 1P2QA 1WCZA 2BXUH 1T4VH 1DVAH 1IQEA 1QBNA 2C8WB 3RC6A 5CDFE 2VVCA 1P2JA 5EJZA 5F53A 1MTVA 3LH1A 5B6OA 1OWEA 4K1TA 4NFEA 3UNSA 3MU0A 5DP4A 2ZEBA 1CQQA 1EPTB 1EJAA 3V12A 2OXSA 1T8LA 3URCA 1UMAH 1AHTH 3V3MA 4BAMB 5J4QA 4K1SA 2PTCE 1KXCA 2O8UA 3K6YA 2XWAA 3KN2A 1MKXH 4XBCA 4HZHA 5T6GA 1YPLH 2BQWB 3CENA 1IQNA 1K28D 1MTSA 1XMNB 4WMFA 1F5KU 2FZZA 5F03A 1K21H 1L2EA 4Y7BA 1E38B 3QZRA 2TGPZ 1O37A 1G3CA 2AMPA 1V2LT 1F7ZA 1O2ZA 4KGAA 2PR3A 3FP6E 1F5LA 4I8JA 4BAKB 1QJ7B 1CT4E 4MPUA 4J2YB 2F83A 2WINI 3S9CA 4FVBA 1J8AA 2AHME 1V2NT 3UY9A 4NZLA 1QL7A 1DWEH 1TABE 2ALPA 3SJOA 1C9TA 1MQ6A 3GISB 1ANCA 2PTNA 1EZUC 4JYUH 4KTSA 3KL6A 1Z1JA 2W3IA 4JCNA 2C4FH 1BMLA 1GJ9B 4UFFH 2WZQA 1SLUB 1WU1A 2W6ID 3TIUA 2HLDD 1IQLA 4YT6H 3WWFA 5HGGA 1YY3A 3VB5A 2UWPA 3K9XB 4TPYA 3SNEA 3QLPH 5FCRA 1SFIA 1NPMA 4NWLA 1C5QA 1YF4A 4ZH8A 1BMAA 4AFUA 2P93A 1H8IH 4NA8A 5HMAA 3ZVDA 5JBCS 2FESH 3SQHE 2ZHQH 4X0WU 4JZFH 1BA8B 1NESE 3A7ZA 1D6WA 5DO4H 4NSYA 3PLPA 1TBRH 1SL3A 4Y11E 1PQAA 5FPSA 4XBBA 1AI8H 3ZZBA 2SGQE 1TWXB 2UWLA 3ENSB 2C8XB 5DJ7A 1GI0A 4MPWA 3CP7A 1P3EA 1GHXH 2QN5T 4INHA 4AB8A 3MH7A 4NZQA 1C5ZB 2AERH 1G3EA 4U01A 4R0IA 1GL0E 2ANWA 1QY6A 3QUMP 3SBKA 1G37A 2BVRH 5GDSH 1O5GH 3PV4A 1J16A 4Q7YA 1KXAA 2ZWLH 4CREA 1NS3A 4YZUA 2QXHA 1YPGH 5L2YH 1HXEH 1XXDA 1DWCH 3DSGA 4ABIA 3MI4A 1GBFA 1C1UH 4DT7B 2KX4A 2WUBA 3GCNA 3P8GA 1WQVH 1AKSB 3SJ9A 3PMAB 2V3OH 2R0KA 4ZXXH 1CBWC 2OC0A 3TLOA 2I6QA 4I86A 1K22H 5LPFA 4WY3A 2ZDLA 2V0BA 2BDYA 3OY6U 2QAAA 2BY9X 2ZKSA 3A7XA 1GGDB 1AFEH 1C5TA 1A4WH 1MQ5A 5EG4A 4FUCA 1SQTA 1NC6A 3QTOH 5GNDA 3VB3A 3MMGA 3RXGA 4P00A 2A2XH 1GVKB 2ZGJA 3A84A 1MH0A 4XRNA 2BD9A 1FAKH 1YPHE 1HJ9A 1QTFA 2BLQA 1SSXA 3PM3A 5JBBS 3ATIA 4CRDA 1GI2A 1HYLA 4X1SU 1GI8B 2B8OH 2WPLS 4GHTA 1ACBE 5L6NH 1O3NA 2BVSH 5EQQA 3FAOA 2WV5A 4ABAA 2BDCA 2QC2A 1V2VT 1GBBA 1SG8B 1TIOA 4CH8B 1J15A 1GBTA 2ZDKA 4DIHH 4D76A 3N7DA 2HVXA 3GY7A 2HPPH 3RC5A 4TSFD 5CHAB 4INLA 3P17H 3SGBE 1CA8B 3DUXH 1D9IA 3TNSA 3DFJA 1T8MA 1ELTA 1XUIA 3L6PA 1J17T 1HAHH 1O35A 3BN9A 4JZEH 3TPIZ 3A7WA 3S7HB 1O2LA 1O3FA 2J98B 1D3PB 2BVXH 2H1UA 2ZPRA 3PLKA 3VFEA 4A1XA 2TIOA 2A7JA 1EB2A 1ZMNA 3GCHC 1VITG 1LVMA 5DP3A 3RU4D 3TK9A 2BM2A 2GMTB 2TGDA 3A8AA 2QYIA 1C1NA 1UCYK 3RM0H 1OOKB 2VWMA 1MABB 1YLNA 1T8NA 3TH2H 3RMOH 2A4RA 5LH8A 2Y81A 4JK6A 2EC9H 1ZSLA 2ZNKH 1C2LA 1P01A 5E8EH 1O3CA 3O8BA 2F43B 1THPB 4CHAB 4J1YA 4GAWA 1Y5AT 3KIDU 1ELFA 1E36B 4HGCA 2V3HH 3LPRA 1H9HE 3ZYEA 2PHBA 3F0OA 3KNXA 1HFDA 5DG6A 1F0UA 3A8DA 5I46H 2J4IA 1LHEH 4NIXA 3F68H 4FUHA 1UTQA 2AMQA 3ZZ6A 4UEHH 2Z3CA 3UQOA 1L4ZA 4CH2B 1ELGA 2BTCE 3SYJA 1YPEH 3MO3A 2AIQA 2B7DH 3MNSA 1V2QT 2ZHDA 2XW9A 3SUFA 1KXEA 1Q31A 4H4FA 5A0AE 1D6RA 5EQRA 4HFPB 1A1RA 3I77A 3A87A 1E37B 5EODA 5C20A 5EW1H 3KQ5A 2G55A 1EP5A 5FX6A 1EASA 3TK5A 1TOCB 1VZQH 2XNDD 4YOJA 5E0GA 3RLYH 3TGJE 1S84A 1LHGH 2FLBH 1FI8A 1ZSKA 2XBYA 2Z9GA 5HXFA 3BG4B 1GPZA 1VITF 3UPEA 1C5LH 4A1TA 3RXJA 2H5DA 1GI7B 4F49A 3M7TA 1DFPA 1YKTA 4RKOB 1GCTB 2I6SA 3F9FA 1N8OC 4RT0A 1S82A 4DVAU 1GWAA 1O2PA 1XVOA 1SFQB 4LK4A 3ZZ4A 1LTOA 1Y8TA 1Y3WA 3GY3A 4BNRA 3L33A 4AORA 1FY4A 2VIPA 1Y3UA 3E16B 1O3MA 1MTWA 1S0QA 1V2TT 4K8YA 1IQHA 3SOSA 1SQAA 1DT2A 1S83A 2TRMA 5DP6A 1T4UH 1C2KA 4BXWA 3GY4A 4WMDA 3CS0A 4ZKSU 1HIAA 1EAIA 1UHBA 2STAE 3T2NA 3T5FH 1LHCH 2R2WU 5DK1A 2XC5A 1WYKA 3OAAD 3LU9B 4WXVA 1K1MA 1OWIA 3F9HA 2CHAC 3VGCB 1ID5H 1BTXA 2AEIH 1P0SH 2QXJA 4VGCB 3O8CA 1HB0B 1QA7A 1V2OT 3KHVA 1CO7E 2UUFB 1DY8A 1GBAA 1UVUH 1BRBE 3SW2B 1MCTA 2KCAA 2PWXA 4FU9A 1V2RT 1DANH 1OHHD 5CHBA 1FIZA 2ZFTA 1O5AB 4P02A 2ZU3A 3OSYA 1PPFE 1MBMA 3M5OA 1C1SA 3GCTG 2PUXB 1N6YA 4RSPA 2J95A 2XWBI 1C4Y2 3ZV8A 5C1XA 2FOAA 2VIDA 3OEED 3D62A 3HGPA 2FOMB 2ZU4A 1VJAU 1ZZZA 1QB6A 3CNRA 2ODQA 2ASUB 1NBME 1O3GA 1HAYB 2PSYA 5FL7D 1GG6C 1AZ8A 5ABWA 1GBJA 1TA6A 2B5TB 4B76A 3GYMA 3FFGA 3KQEA 1N6XA 3P8NA 2Y5FA 2YNBA 2YMSB 2G00A 1NRNH 1TQ0B 2KCPA 1O2QA 4MNWA 1AKSA 4H6TA 2BY7X 1FY3A 4WF8A 2R9PA 1AVGH 1QJ1B 3M3VA 4YLUA 1ESAA 3FANA 4OGXA 4ZAEA 4K1EA 3GY6A 2ZZUH 1YPJH 4ZHLU 1COWD 3BTTE 4NCYA 2QY0B 1O30A 5F8XA 3TITA 3RXBA 4UFEH 2EQNA 3GOVB 3SV9A 1V2JT 1Y5UT 3UIRA 1FY8E 1O3BA 2ALVA 1GJBB 2OLGA 3BTGE 2BD7A 1TX6A 1C4V2 2LELA 1EFRD
chains in the Genus database with same CATH topology
1FXYA 1SGFG 2GVFA 3QGJA 1BTUA 3ITIA 4O3UA 1Y3YA 3SU3A 1P10A 1C5MD 1FPHH 1AZZA 3AW0A 4AYYB 1MUEB 4K5ZA 1C5YB 1QURH 3PO1C 4YESB 4Y8ZA 2J2UA 5GWZA 3IG6B 2FLRH 4LZ4B 1GMHF 5HM9A 1RIWC 2A32A 3LJOA 1NTPA 3HPTB 1QL9A 1GBEA 3BTKE 1YPMH 5FX5A 3RDZA 3SZNA 1ELCA 1A3EH 3JZ2B 3EGKH 1YP9A 1C5NH 1DXPA 1XM1A 3MU4A 5AFYH 2FDAA 1KXBA 2F9OA 1GI4A 2ZU5A 2BLVA 4I8GA 1W3CA 1UVOA 3GY8A 3LKWA 2YOLA 1DUEA 1H1BA 4ESTE 5HM2A 3W95A 1O38A 4CR9A 4Y71A 4MVNA 1UCYH 1O3IA 4BTTB 1DITH 3U8OH 4FU8A 1C2JA 2Z6BD 3U8TH 2XCNA 4UFGH 4MLFB 5JB9S 1LPZB 4Y6DA 3ZVEA 4X1PU 1P2IA 1IQFA 4TWWA 4ZKRU 4UD9H 4MNYA 5I25A 1QB9A 2XTTB 3ZVCA 1SGFA 1F2SE 1DLEA 1W8BH 4ZXYH 1TNJA 3M3TA 1BOQA 1TMUH 2BD3A 2R2MB 3UNRA 1HGTH 1LVBA 1O3HA 2XBWA 4Y0ZE 3UQVA 1C1TA 4A7IB 4X2YA 3ODDA 1BIOA 3GY5A 3S9AA 1EAWA 1GHBG 4SGAE 3E0PB 1EJMA 1GJDB 2C90B 4WH6A 2R3UA 1GJ4H 4NA7A 1GDQA 4IBLH 1IQJA 3BEFB 1BBRK 5C67A 4WJG2 1EATA 1HAPH 2THFB 5FXLA 1CU1A 2W7UA 2GT8A 3PMJA 2VH0A 5SGAE 1EB1H 4WVPE 1CHOF 3URDA 1BHXF 2BOHB 1V3XA 4YO9A 1O31A 4AB9A 1FPCH 3OTJE 1BJUA 2YNAA 2STBE 4KKDA 1QQ4A 3E3TA 3A85A 1YC0A 2BLOA 2KAIA 1BRCE 1T7CA 3SU4A 2QCYA 2F9UA 4KELA 4X1QU 1KLTA 1Y59T 2JH5D 1VGCB 3E90B 4IN2A 3VXFH 3MU8A 1B0EA 1O5CB 4NFFA 3DT0H 1TONA 4BAOB 1SOTA 1QA0A 1C1RA 2O8WA 1NRQH 3TVJB 2BDHA 2ZTYA 1U6QA 2ANKH 4B75A 1NROH 1PPZA 2FTMA 2H5CA 4Q7ZA 3QTVH 3UWIA 1T31A 3LGIA 1C1VH 2BZ6H 1H9LB 3SJIA 4NSVA 3GDSA 3HKJB 1O32A 1ABJH 4IMQA 1XVMA 4NG9H 4D8NA 4WXIA 2Q6GA 2J38A 2OINA 1Y5BT 1EP6A 5BPEA 4ABDA 1EZXC 1XX9A 2FWWA 4INKA 3PLBA 5FPTA 1H4WA 1GHBF 3RXTA 3BIUH 1AWFH 1ZPZA 1ELBA 5DP8A 3EYDA 1UVSH 4AX9H 2Z9LA 1DDJA 2IJOB 2ZHWH 1HAXB 2C8ZB 1HAIH 2W7SA 5IDKA 2FX6A 1UTOA 2ODYB 1HDTH 4GHQA 1QQUA 4ABFA 1S5SA 1VJ9U 4DCDA 4O9VA 1Z8IB 3BTDE 3LGWA 2BDAA 2HWLB 1V6DA 2G4UA 5JBTA 1ZTJA 2CF8H 2QGRA 1HIAB 1UHBB 1MD8A 1QL8A 4Z6AH 2CMYA 3K6ZA 2H2ZA 5J4SA 1O5DH 2HRVA 1AQ7A 3A82A 3ATLA 1OYTH 1VCQA 3KEEA 3LONA 2ZGBH 4U30A 1C1QA 2ZFSA 5LPEA 1IHTH 5C3NA 3ZZAA 2GV6A 2NU3E 1P12E 2OCVB 5AHGH 1MTNB 3U98H 3GDUA 1Z8JB 1XUKA 3Q3KA 2GX4A 3ATWA 1QR3E 1CVWH 3MYWA 1GG6B 1HCGA 1A5IA 3SGQE 1O2SA 3F6UH 4O97A 1ANEA 4X6OA 2BQ7B 2M5TA 3QDZB 1J9CH 1L4DA 3SUEA 1YPKH 1V2UT 3T62A 2J92A 6LPRA 3U9AH 1P2NA 3W94A 1O5EH 2ZO3H 3P8OA 1KYNA 2WPKS 2ZDMA 1MAXA 4NIVA 1S6FA 3C27B 2Q1JA 1ELDE 3BTWE 1GVLA 2VINA 4NGAH 2OBOA 3BTEE 1MU6B 3BTQE 2P95A 2LNCA 2VWNA 1SB1H 4X8TH 3UTUH 5A0BA 2W3KA 1UVPA 1UTNA 4CBOA 1SGCA 1TA2A 2Y5HA 4ZHMU 2FX4A 1OX1A 1CT0E 1G3BA 1Q3XA 1GMCF 2GCTC 2A2QH 2BLWA 4I7YH 3BTFE 3B8JA 1YYY1 1JIMA 1P2KA 1BDAA 1BZXE 1C2DA 3KF2A 1RJXB 3E1XB 1AB9C 2H9TH 2DUCA 9LPRA 2A0QB 2QA9E 3ZV9A 2OC8A 5F6MA 1A2CH 4D9QA 2B9LA 1HRTH 2ZIQH 1K1IA 1NFYA 3P92A 2GDEH 3A88A 2ZFPH 1OXGA 2JETC 1W7GH 5FBIA 1JIRA 4GCHG 2GKVE 4YLQH 4OS1A 3NCLA 5AF9H 4CRGA 2VGCC 3VB6A 2R0LA 2O8TA 3TJOA 5EQSA 4B2CA 4ABHA 1FV9A 2G52A 4X8UH 1A3BH 1E0FD 2PUQH 4DIIH 3O8RA 1EOLA 1ANDA 2BZAA 3RXEA 1SMFE 3GCOA 1SGNE 2WYJA 5DPAA 1DSTA 3QGNB 1QCPA 1ZYOA 1HXFH 1PPBH 4K2YA 1IQGA 2OTVA 1A46H 2BMGB 1JOUB 4I8LA 1DLKB 1BT7A 3SHCH 3KGPA 4JMYA 3S7KB 3T27A 2XBVA 1JXPA 2P16A 1HJAC 4LOYH 2CF9H 4I33A 5F8ZA 4BAHB 1NN6A 1RTFB 3V7TA 1BTZA 1YLDA 2NWNA 1MTUA 2HOBA 4I32A 3UUZA 3ZVAA 1UTPA 4CRBA 3A89A 1NZQH 2BDIA 1E34B 3RXCA 1DWBH 3NK8A 1CSOE 1GHYH 2W5EA 1AFQC 1CGIE 3SU5A 1EX3A 1BBRH 2ZHFH 4Q2KA 4XBDA 3MWIU 1LPKB 2OQUA 2SNVA 3E6PH 1CA0C 1KTSB 4K8BA 4AGJA 5L30H 1O2RA 4XSKU 3DD2H 4O03A 1C2MA 3QN7A 4FU7A 4X6MA 2DE9A 1OKXA 4X8SH 1K2I1 2TBSA 1ELAA 3PTNA 1CGHA 4UFDH 4ASHA 4PROA 2ZPSA 1Y3XA 1O2XA 1MMJN 4GCHF 1PYTD 4K3JA 2P3FH 1C5RA 2V6NA 3OX7U 3LOXA 1CT2E 1C5SA 1X7AC 1HLTH 1PQ8A 2BX3A 4THNH 1P57B 1RFNA 1GHAG 3EQ0H 3RXHA 4FUFA 4OS6A 3RLWH 1TB6H 6CHAC 1GI6A 3ZZ5A 1AE8H 4TY6A 1J14A 2ZG0H 4ZUHA 1QGFA 1BB0B 2FP7B 2ZHEH 2Y80A 3RXKA 2GGVB 4JYVH 2PKSC 1P04A 3MU1A 4FXGH 3VXEH 1P06A 2BQ6B 2D26C 2Z3DA 4JZ1A 2PV9B 3LDXH 4MNVA 4UE7H 2QV1A 5ESBA 4HI3A 3SUDA 4E05H 4XE4A 1GJ6A 1O3JA 1TNLA 3F1SB 5DP5A 1EPTC 1BCUH 1BHXB 3G01A 4IC6A 1W2KH 3HK3B 1SPJA 2GZ8A 2KAIB 2VIOA 2P3UB 1WUNH 4YOGA 2HNTC 1JRTA 2FYQA 4O3TA 2ZF0H 1ORFA 4MG3A 1FN6A 1ESTA 1WAYB 2WPHS 3Q77A 4MTBA 2FM2A 1AO5A 3LGTA 3ZZ9A 5ETXA 2VNTA 4OGYA 1YM0A 3DFLA 1O3EA 1SGPE 3M3SA 3H7TA 1A0LA 1LMWB 1NU9A 2BDBA 5T6FA 2BY8X 2RDLA 2ZI2H 3MU5A 3VB4A 2H9HA 1XUHA 3OY5U 3Q3YA 1HV7A 3RXDA 1GHAF 2Y7XA 3PWCA 4B2AA 1H9IE 1UK4A 1GDNA 4B2BA 1C5XB 4FUEA 3ZZDA 3OYPA 1FAXA 1LKBA 1TRMA 2GTBA 1LQDB 3LH3A 1OWJA 3SGAE 1ZRKA 4AN7A 1GI3A 1GMHG 3NPSA 2W26A 2Y82A 1EZSC 5EOKA 3TH3H 4ISHH 5AFZH 2HPQH 2IPHA 1C5WB 4BAQB 3M5LA 3PMBB 5FBEA 3QWCH 1O2JA 1F0RA 1MD7A 1P11E 1NRSH 1L1JA 3E8LA 1D3DB 1EAXA 1RRKA 2FS8A 1PFXC 3M36A 3A8BA 2A5KA 3R0FA 1C2FA 2ANMH 1FIWA 1GBLA 4YM9A 1D3TB 1DXWA 2XNIA 3UR9A 1HAVB 4GLYA 1C9PA 4ABJA 4F4OC 3T26A 1PQ7A 5LPRA 2GD4B 1CHGA 1ETTH 2AFQB 2PSXA 3PB1E 3B9FH 2F9VA 1TPSA 6ESTA 1ZHRA 3FVFB 4KP0A 1OYQA 2RCEA 1NRPH 3RP2A 3VEQB 1ELVA 1C5OH 1QRZA 3TJUA 1GBMA 2O9QA 4AFSA 5DGJA 3S9BA 1DOJA 1GBDA 1MZAA 4K69A 4MNXA 1GJCB 1W0ZU 1ZHMA 4YOIA 1O2NA 1C1WH 1UTMA 1FZZA 4ISNA 1HUTH 8GCHF 1UVTH 1BRUP 2SGFE 1THSH 1QB1A 3NZIA 3EE0B 1IAUA 3ODFA 1PQ5A 2BHGA 1QFKH 1G32B 3LJJA 1O2KA 1ETRH 2C3SA 4I31A 1T8OA 1LVYA 1EAUA 2AIPA 2UUYA 1CBWB 4NA9H 2UWOA 1GGDC 3O8DA 4OS5A 1GBIA 2F91A 4R8TB 4Y8YA 3UOUA 4CBNA 8LPRA 1SGRE 1WTHD 7ESTE 2ZGXH 2H9EH 5FHTA 3A86A 3T25A 4ABBA 1GBKA 1G30B 1QRXA 5EW2H 1AB9B 1FONA 4AGKA 3HGNA 3HK6B 1HJ8A 5E2OA 1CHOG 1UK3A 1NRRH 1SR5C 1NO9H 3TGIE 3MOCA 2Z94A 3BSQA 1O3AA 1BRAA 1YLCA 5T3HA 3ZVFA 2O8LA 1P09A 1FY1A 1ZMJA 2PGBB 1O34A 3PMHB 6GCHG 1Q2WA 5CHAC 4H42U 3QZQA 2TGAA 3AAVA 3ATKA 4GPGA 2EEKA 1W14U 2ZA5A 3RUOA 3A7TA 2GP9B 1K1JA 1TMBH 3SNAA 2RA3A 2HLCA 2ZTXA 3TJVA 1ZPCA 2BD2A 3SHAH 3STJA 2GMTC 1C2HA 1P2MA 1P03A 4AOQA 1YCPK 3MH4A 3PYHA 1FDPA 3GCHB 4X2WA 5A0CA 3TH4H 3RXVA 1LQEA 5EXNA 1WSSH 3GY2A 4CHAC 2A45B 2ZFFH 1ZR0A 3KQDA 3QX5H 5EXLA 2OC7A 2V35A 4Y7AA 3RXUA 1AUTC 5TCAA 5EPYA 1KIGH 1TNHA 2D2DA 3UR6A 5HYOA 3SU2A 4LXBH 2ZCKP 2H6MA 3EA8A 5JPMH 1EXFA 1OP0A 1UCYE 2VH6A 1GJ8B 1O36A 1P3CA 1L0ZA 3MNCA 1O3LA 3M35A 2DE8A 2FODA 4HTCH 3LC3A 1K1NA 2Q6DA 3Q00A 5L2ZH 4AG1A 5JBAS 3A80A 2ZFQH 4QT8C 4CRCA 6GCHF 3MO6A 4A92A 4UDWH 2HGTH 2BYAX 4RKJB 3TK6A 2FOFA 3ZZ3A 1BTHH 1W10U 2XBXA 1SBWA 3SU6A 4JYTA 1GHZA 1OSSA 3BG4C 1A5HA 1YCPM 1CGJE 3K2UA 3AAUA 1SGTA 1C4U2 1GCTC 1AVXA 1ETSH 4LZ1H 4MPVA 1A5GH 1MKWK 1YBWA 3SNBA 3EDXB 4RN6A 3MH6A 1O2HA 2FOCA 2FTLE 1D4PB 2RA0A 3QK1A 5A8ZA 1N8OB 4GVUA 1G36A 1Z1IA 3B23B 3M7QA 4SGBE 4B71A 1SGDE 2Y7ZA 2NU1E 5GPIB 4WH8A 4Q7XA 4IC5A 2P3TB 2CJIA 1DUAA 1RXPA 1H8DH 1O33A 2D8WA 3ZZ7A 1TRNA 7GCHG 3RU4E 2HALA 1BITA 2Y5GA 3EA7A 4FUDA 1O0DH 3VGCC 3RM2H 2ZECA 1P9UA 2VU8E 4VGCC 5FCKA 3P6ZB 1SLWB 4E7NA 4FUJA 5JDUB 1KDQA 2ZDAH 2CHAB 4ISLA 1IOEA 3GDVA 2WPJS 4NIYA 2JH0D 3IWMA 3BF6H 1HAVA 1DS2E 1TLDA 3SI3H 1VR1H 3SQEE 3RC4A 2Z9KA 1V2WT 1GMCG 3FP8E 1DWDH 1C1OA 5A8XA 4Y10E 1FJSA 2SGAA 2BB4A 1G2MA 1GBHA 5C1YA 2BD5A 2QXIA 3SNDA 2FPZA 1UTJA 4IS5A 1ABIH 1W12U 4Y0YE 2QF0A 5E0JA 4GSOA 3TGKE 1ZGVA 3UFAA 3EA9A 4Y8XA 1ZGIA 1PPGE 3Q76A 2EI8A 3ESTA 5GCHF 5JB8S 4BTUB 1DICA 1DSUA 5A8YA 2A5AA 3STIA 5GJ4B 1AN1E 2F9NA 1IQKA 4AFZA 2UUKB 3MNBA 3MTYA 3KQBA 1KXFA 5ESTE 2VWOA 4BXSA 4CRAA 1MCVA 4DGJA 2WYGA 1SOZA 2EI6A 3UWJH 4D9RA 3AW1A 4DW2U 4U32A 1NFXA 2VJ1A 1P2OA 1F0TA 1OWKA 2CGAA 1SC8U 1E35B 5AVDA 7GCHF 1KSNA 1G3DA 3M37A 2PKAA 2TPIZ 2EA3A 1LHFH 1Z8GA 1KY9A 1C2EA 2FO9A 3FZDA 1VCPA 2XC4A 5C5OA 1O3DA 1FY5A 2VWLA 1ZLRA 2VIQA 2WPMS 2G8TA 5T6DA 1TGCA 1S6HA 1ARCA 1AU8A 5JYIA 3U8RH 5A2MH 2ZU2A 2SGPE 3GYLB 4BANB 1EKBB 3ZZCA 2RG3A 3A7YA 3KCGH 1VITH 2PW8H 1LCYA 1IQIA 3HATH 1F5RA 1ZPBA 2PGQB 1HAOH 1K1PA 3I78A 5FAHA 2NU4E 3C1KA 1RTKA 1JWTA 1MU8B 3PO1B 3P70B 3T28A 2ULLA 1PPHE 1EQ9A 1UTLM 1W11U 1RIWB 1P02A 3I29A 3F9GA 1B5GH 3LT3A 4X2VA 3GICB 3SV2H 3LGVA 1XUJA 1BUIA 3V0XA 2FXRA 1KTTB 2OBQA 1QNJA 1A7SA 3ATMA 4A6LA 2G5NA 1NFUA 4GUXA 1GBCA 2HNTE 2XRCA 3K65B 1SGEE 3U1IB 4OS4A 4X8VH 2BOKA 4FVDA 3Q3XA 2WPIS 3JZ1B 4ABEA 4TPIZ