1GI2A

A novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title A novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site.
pubmed doi rcsb
molecule tags Hydrolase
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2001-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gi2A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gi2A02
1HGTH 3MOCA 6GCHG 2QYIA 3HATH 1YPGH 1V6DA 1RD3B 1IQMA 2QAAA 4D7GA 1GJBB 1IQHA 1EB1H 4NA7A 1ELDE 1JRSA 1V2KT 5CHAB 2WUCA 3A85A 1YCPK 1T4UH 3DA9B 4GLYA 1LMWB 1P3EA 4JMYA 3ZVGA 3DFLA 3EGKH 1KXBA 3H7OA 4ZMAH 3UNSA 3MH6A 1E34B 5C1XA 1O3BA 5FBEA 3RDZA 1ZLRA 2BHGA 2ZA5A 4FUEA 3OX7U 4WH6A 1IQJA 3PLBA 1BTWA 3Q3KA 1TPAE 8ESTE 4Y71A 3BSQA 1YPMH 1WOFA 1WV7H 2W5EA 3E91A 1AKSA 1O5AB 1QGFA 2FOAA 1RJXB 1EZXC 1K2I1 1K1JA 3UREA 5C67A 1YBWA 3GY6A 3TJUA 2B0FA 1GMHG 1SGTA 8GCHG 3M7UA 1TRNA 1AB9B 7LPRA 2XWAA 4E7NA 3MHWU 2A32A 1MQ5A 4AFZA 2R2MB 1V3XA 2P8OC 2ZEBA 2CF9H 1G9IE 2OLGA 4X2VA 3GY5A 1F0SA 1S0QA 2YOLA 4UONA 1O35A 1OWKA 1OSSA 1O5FH 5L6NH 1T32A 3I77A 1GBAA 4ZHLU 2ZZUH 1C4V2 2VIQA 2B9LA 2R0LA 4XSKU 1P02A 1EOJA 1GBBA 1ZMNA 3RXLA 3K6YA 2BD4A 4X8TH 4ZAEA 1ETTH 2AH4X 4A1XA 1WQSA 4WMFA 4U30A 2FOCA 1A0HB 1TBRH 3W94A 4BAKB 1O36A 4FUHA 2D2DA 3DHKH 4D9RA 4NA9H 1UVUH 1V2LT 1GBEA 3M3VA 3V3MA 1UVTH 4PROA 4B2AA 2PW8H 4ZKSU 3ZYDA 3U9AH 3TH4H 3LGVA 3VB3A 3T5FH 3BTKE 2W7UA 4NZQA 4YESB 3BTGE 4ASHA 1AU8A 2VIVA 1EAXA 5BRRE 5DG6A 4INKA 3RM0H 3KQDA 1ELFA 4RN6A 3SV6A 3UY9A 2P59A 3SUGA 1DY8A 2A2QH 1RXPA 2ZQ2A 1PQ8A 2BYAX 2G00A 3SJIA 3STJA 1H1BA 1PYTC 1KXFA 1GMCG 1UVPA 4B76A 2ANYA 4AGKA 2O9QA 3P8NA 2Z3CA 2OC0A 1T8OA 1LKAA 5F8TA 3ZVCA 3FVFB 1GVKB 1CGJE 2ZCLP 3PWCA 3RMOH 1TB6H 1QBOA 2FYQA 2XCFA 2CJIA 5EXNA 4X8UH 3TK9A 1ZTJA 4B74A 5DP7A 5A8XA 5GDSH 3QTVH 3VEQB 4CRBA 3KQEA 2ZGCA 4KELA 1GI6A 1LQEA 1D4PB 4FVBA 4A6LA 2G81E 2AS9A 1HXEH 2TGDA 5C5NA 3UUZA 3PB1E 4B2BA 1TABE 1TX7A 2FI3E 3M3TA 4YOIA 3CP7A 1W11U 1F92A 2ZHEH 4X2YA 1SOTA 1VITH 4YLQH 1SGYE 3M7QA 3SHAH 1TAWA 4NWLA 3SGAE 1MTSA 1GWAA 3PV4A 1QB6A 2ZO3H 3OU0A 2BXUH 1D3DB 2P8OB 1KXAA 3KEEA 2J9NA 1GDUA 4OS1A 4WWYA 2AMDA 2HVXA 1P57B 3A7XA 3FANA 2D8WA 4TY7A 4I8HA 2B7DH 4BAOB 1MQ6A 2J95A 1ZGVA 1O3KA 4IW4E 1AD8H 3AAVA 3EYDA 3EAJA 3BTME 1GBCA 4X1RU 3ODDA 2XBVA 5AFZH 1GMDF 1OPHB 3JZ2B 2Z3EA 2UUKB 1BBRK 1D3QB 1XUIA 3RXIA 1K22H 2BDGA 2GX4A 3RP2A 3A82A 3FFGA 3VB7A 4RKOB 1GI8B 4KTCA 1AIXH 1CGHA 1THPB 3MU4A 4H6SB 3DD2H 4E06H 2GVFA 5FPSA 3GDSA 1OX1A 3GCHC 1K1LA 2VGCC 1QL7A 2CHAC 2BX3A 3CENA 2FOFA 4OS2A 1F0TA 1P2JA 1SGQE 2FX6A 1HRTH 1SC8U 2PFEA 1BOQA 1OWEA 4Y0ZE 1ARCA 1A5HA 2HWLB 2XC4A 1GCTB 1G2MA 1TRYA 4UFGH 1DXWA 1ZHPA 1GJ4H 1TA6A 4A7IB 3TJNA 2ZFFH 4GPGA 1PPZA 2VIWA 3U1JB 2EI6A 2ZF0H 2GGVB 1GMHF 2F3CE 3MO3A 5DP8A 1XM1A 5GWZA 4Y76A 2SGAA 2HLCA 2NU3E 2SGFE 3ITIA 4FUGA 3A86A 3UR9A 2HPQH 2FPZA 3RMNH 2RG3A 1DANH 1P03A 4IN2A 1ZMJA 4XDEA 5DO4H 1N1LA 5DP5A 1SGIB 3F68H 4INLA 3A80A 1XXFA 3ATIA 1HJAC 1PPGE 2YNBA 2VIPA 1E0FD 1AFEH 1O3OA 3LC3A 1BRBE 3BG8A 3UOUA 1DDJA 2QXIA 2ZTZA 3UIRA 4NFFA 1KDQA 2FM2A 1DUAA 1DY9A 1DXPA 3BTTE 1DICA 2JKHA 2VH6A 1J16A 3ESTA 1GHVH 5DKMA 1TX6A 3I78A 4MNWA 3TK5A 3UR6A 4X6MA 1IQIA 4D8NA 3FP6E 2H9HA 3ZZDA 1C2EA 4DURA 5ESTE 4ABAA 4FUCA 2QF0A 1W8BH 1MTNB 1BMNH 3SV8A 2VNTA 4BAQB 2BD7A 2THFB 1CT0E 1QFKH 1GI7B 2XTTB 5A0BA 5A8YA 1GBFA 4X8VH 1GBIA 1O3LA 1SFQB 1UTOA 1O2PA 4ESTE 3QX5H 1DFPA 3TVJB 4CRFA 1FY3A 1GJ8B 1LPKB 5EODA 3GICB 3ENSB 1DWDH 2G4TA 2FI4E 4ABBA 3ATLA 4NA8A 3E0NB 3ATMA 1C2HA 3PWBA 3O8BA 1O2NA 5TCCA 1MU8B 1TPOA 1V2NT 5LPFA 1WBGB 4MQAA 1INCA 1Z8RA 1Q31A 4TPIZ 3GY8A 2CXVA 3ZZ8A 4MG3A 3KHVA 1ELAA 4XBDA 1KLJH 3GY3A 1BJVA 1Z6EA 4OGYA 3VB4A 3GCHB 2VGCB 1UTNA 3ZZ3A 2XBWA 1SLVB 4KTUA 1XVOA 4BOHA 5L2ZH 4X1QU 1C2FA 3RU4D 1QJ1B 2Y82A 2BY6X 1LHCH 3BIUH 1O3GA 3M37A 1X7AC 2GT8A 2JH5D 4Y0YE 3TGKE 3EDXB 1CHOF 3A7ZA 2OC8A 4FUFA 4NSYA 1AVXA 2BQWB 1G37A 3M7TA 2C8YB 2AMQA 1VCPA 3P17H 3RXAA 3FP8E 1TNLA 1C2DA 2G5NA 3A8BA 2VB0A 5E0HA 1AWHB 3TK6A 3VB6A 3MFJA 1ELEE 4B71A 3P6ZB 2OBOA 1TLDA 1V2OT 4K3JA 3MYWA 3UFAA 4LXBH 2XWBI 1C1PA 1ANDA 1UTQA 1EXFA 2GMTC 3LH1A 3SI3H 1C5QA 1QRZA 1CT4E 2C90B 9ESTA 3GY7A 5JBAS 1SGNE 5A0AE 3A87A 3GY2A 1W7XH 1B0EA 1AFQC 4HI3A 4U2WA 1MKWH 4U32A 1UVOA 4JK6A 4CH2B 3QWCH 4WJG2 5C2ZA 4ISHH 2VVVA 2SGQE 1BB0B 4K8YA 1SMFE 1BDAA 1MBMA 4GUXA 3SI4H 1NPMA 3V0XA 4Y7AA 1IAUA 1GL1A 1S83A 2RDLA 3NUMA 5JB8S 1CO7E 2WPMS 1J9CH 1VGCC 4TWYA 1FONA 1WCZA 2H2ZA 4JZIA 3GCNA 1AE5A 3V12A 1O2GH 1OP2A 1BTXA 2TGAA 1GCDA 3A89A 1FLEE 1ZOMA 4H6TA 4UDWH 1F5KU 2J34A 5GJ4B 1IQNA 2V6NA 4AFUA 1AKSB 2BD3A 1HV7A 4JYTA 3SV7A 3W95A 1P06A 1NO9H 3M3SA 1HIAA 4Y79A 4ZXYH 1ARBA 4ZXXH 2YNAA 2O8LA 1GPZA 2Y81A 5EXMA 2IJOB 4BTTB 1P01A 1RTKA 4CRCA 4K1TA 1SPJA 2O8MA 1GHWH 1TBZH 4GAWA 1DX5M 1GI3A 4BTIB 1PQ5A 2C93B 1AGJA 3UNRA 1GBKA 2FDAA 4NIVA 1O2YA 8KME2 5FPYA 1HAGE 1TNKA 3AAUA 2Y6TA 3GYMA 3LGYA 1FPHH 1ELTA 2BDYA 2Y7ZA 4YZUA 4AX9H 1YF4A 1C1TA 1LKBA 2BXTH 1N8OC 1FZZA 3I29A 3IG6B 5A8ZA 3S9BA 1YPJH 4X2XA 2D1JA 4I8JA 3GISB 1RFNA 3UNQA 1NM6A 5C20A 1J15A 4INHA 2QCYA 1C5XB 1W14U 2NWNA 4YT7H 3RXDA 1C2MA 1K1MA 3MH7A 3RXBA 3ZZ5A 2FESH 2Q6DA 3PTNA 1O39A 2W26A 2GMTB 3EQ0H 1C9TA 2J4IA 3E8LA 1YM0A 2FMJA 3M36A 3QZQA 1GJ6A 1Y3UA 2PKAA 1P2IA 4H42U 4AZ2B 3GYLB 4CBOA 2FEQH 1NRNH 4HFPB 2JH6D 1ANCA 1EZSC 2ASUB 3B9FH 1BRCE 1BCUH 2ZU4A 1P8VC 1VZQH 1O2MA 1Z71A 3F6UH 3RXKA 1P11E 1B0FA 1UCYK 2XW9A 3RM2H 1BT7A 4WXIA 3D65E 3SO3A 1MD8A 1T4VH 4LOYH 3UOPA 4NG9H 3A7YA 5L30H 1QB9A 1S0RA 2FOGA 3U8TH 3DUXH 1JIMA 1TBQH 1AWFH 1QCPA 1GHAF 1TALA 1YCPH 1MMJN 2RA0A 3ZV9A 2A4GA 2BM2A 1VGCB 3MNCA 2P3UB 1C2LA 5B6OA 1N6YA 5PTPA 4R8TB 5BPEA 3KGPA 2XBXA 3UQVA 2GT7A 1V2TT 1VITG 3T27A 1ZZZA 3KL6A 3Q3YA 2AGGX 1GHYH 4THNH 1IHSH 3G01A 1Z1IA 1NESE 1LVMA 1UMAH 1O2KA 1TOMH 2PGQB 3MH4A 1GJ5H 1Z6JH 2Z9LA 1F0UA 4WMEA 3SV2H 1TNJA 1ELGA 1SBWA 1D6RA 4GSOA 1HAVA 3ZZ4A 3RXQA 4O3TA 2SGDE 1O5CB 4FUIA 4O97A 2OBQA 3LOXA 1H9LB 4NZLA 1BZXE 2ZU1A 1O3PB 1P3CA 1ETSH 1DLKB 1EAIA 1MUEB 2FODA 5F03A 2ZU3A 3IWMA 2VIDA 2J92A 3L6PA 1GBHA 3CS7A 1CHGA 1ZSLA 1O2HA 2A1DB 1O2RA 1SLXB 4ZKNU 2XNIA 3BG4B 4UFEH 4J2YB 1FJSA 1V2WT 2FX4A 1P2KA 1N8OB 3A7VA 5AHGH 1TNIA 3T62A 1C2KA 1THSH 2NU0E 4I33A 3P70B 5F8ZA 4JK5A 1FDPA 3LGTA 3QLPH 4VGCB 1BMMH 2A7CA 3A83A 2BLVA 3RXMA 4DW2U 4GCHG 1IQKA 1YC0A 3F1SB 4CREA 3SU1A 3FP7E 3RXTA 1BBRE 4B2CA 4YO9A 3TU7H 4I7YH 4JYUH 4K60A 5TCAA 1SGFA 1UHBA 4UEHH 3S9AA 3VXEH 3OTJE 1E37B 4JZEH 2BDCA 4I8KA 1HAYB 2NU4E 1O2LA 1A7SA 2ZP0H 1FUJA 3BTQE 1SQTA 5C1YA 2Y7XA 5E8EH 5FXLA 1EZQA 3K9XB 2CV3A 1YCPM 3QK1A 1UTJA 2VVUA 3LGUA 5C1UA 2ZFTA 1EPTC 3MO9A 1UK4A 3SHCH 3U1IB 2A5KA 4CRAA 1LHGH 5E0GA 3S9CA 1GVZA 4NIYA 2PHBA 1TGCA 1RIWC 4Y8YA 1L0ZA 2BTCE 1YPKH 4AORA 1FNIA 1V2RT 1C9PA 4TYDA 5DK1A 1HAPH 3SU2A 1BTZA 2W3KA 5EQSA 2GZ7A 3EA8A 3QGNB 2GCHG 2H6MA 3LONA 3SW2B 1K9OE 2BVRH 4FU8A 1LVBA 1C1MA 1DWEH 3SJ9A 1SR5C 1A4WH 1GBLA 3IITA 2QXJA 2TPIZ 3M5LA 4DJZB 1YPHE 4FU7A 4YTAA 2OP9A 1DITH 1C4U2 1QQUA 4ABGA 1CVWH 1Y3XA 1A5GH 2ZECA 2BDIA 2Q6FA 1SB1H 2XC0A 1P2NA 4FUBA 2ALVA 2F9NA 1KYNA 1UTMA 3LGWA 9LPRA 4K1EA 2TIOA 2OC7A 1Z8JB 1MAYA 2SNVA 2ODYB 1HLTH 2ZDVH 4CRDA 4MLFB 4NSVA 2GDDA 2PTCE 3M5OA 4XBCA 3PMAB 2BY5X 2WPHS 3LJOA 1BBRH 1C5YB 2OCVB 2A5IA 2EEKA 1O5DH 4SGBE 5JDUB 5EQQA 2BD5A 1AY6H 3RC5A 1ANBA 3BIVH 1MZAA 1KTSB 3RUOA 1BA8B 2Y5HA 4B1TA 1G3BA 2QGRA 1E38B 3AW1A 4YOGA 1O3NA 1O0DH 4JZ1A 6GCHF 3U69H 1PPFE 2FS8A 3M5NA 3OY5U 1EOLA 1AI8H 3NKKA 1CA0C 2V3OH 2EC9H 3GCTG 1AVGH 2ANWA 1TX8A 3RLWH 4WY3A 3GY4A 1FAKH 5FAHA 5FBIA 1K1NA 3QGJA 1EKBB 4NCYA 1IQLA 3PLKA 5AF9H 1TPPA 3UWJH 4YT6H 3B23B 2EI8A 3PO1C 2A4RA 1FV9A 1NN6A 1H9HE 2BOKA 1EPTB 3ODFA 2BY8X 1NRSH 1EJAA 1YGCH 1KIGH 4Q2KA 5FX6A 7GCHG 2ZGXH 1HAOH 3RXEA 1RIWB 1CT2E 2V35A 4A5TS 4BANB 2ZPRA 4DGJA 8GCHF 3P8GA 4GHTA 2KAIA 2W7SA 1LPGB 1CBWC 1LDTT 1P04A 2ESTE 1GJDB 1MCTA 2VJ1A 3ZVEA 1MKXK 5FCRA 3PMHB 3SORA 1O3AA 1HAXB 1AZ8A 1TYNA 2BVXH 2HNTC 2XCNA 1W0ZU 2ZI2H 3U98H 3SV9A 1YP9A 3URDA 3SU5A 2P93A 1NZQH 4HZHA 4ZROA 4JYVH 4Q7YA 3ATWA 3TH2H 5L2YH 1Z8GA 2VINA 4IC6A 4O03A 1WSSH 2WV5A 3K6ZA 2VIOA 1JMOH 2ZTXA 4NWKA 3RMMH 4DG4A 1KLIH 1O37A 4KGAA 2VU8E 4ISOA 4I8LA 4BNRA 3MNBA 3S0NA 2QXGA 2BDAA 1BTYA 5JPMH 1B7XB 1L1GA 2BD2A 2ZFPH 4A1VA 3LGIA 1G36A 1GI0A 1O2IA 4E7RG 1V2UT 1JOUB 1HCGA 3UPEA 1KSNA 4X6OA 3L33A 4WF8A 4ZKOU 3NZIA 3TGJE 5E2PA 1KY9A 4TPYA 3SJOA 2K1QA 2ZTYA 4NGAH 3T2NA 2WINI 3F9EA 4IC5A 1A2CH 2BD8A 3LT3A 4MPUA 3QUMP 3R3GB 1LVOA 1GGDC 1ZHMA 2FWWA 1OOKB 1SQOA 1S6HA 2R2WU 1EP6A 1HAIH 1ZRKA 1Y3YA 2ODPA 2Z9GA 1IOEA 4LZ4B 4DY7B 2F83A 4FU9A 5FCKA 1CA0B 1GMCF 2HALA 2OINA 1A0JA 2FTLE 3SNCA 1C1WH 1KXCA 3Q77A 3H7TA 1EUFA 2Y5GA 1ZPBA 2ZPSA 5HYOA 5CMXH 4Z0KA 1WQVH 3T28A 5A0CA 3RLYH 2F9UA 1S84A 4AGJA 2ZFSA 3M61U 2CHAB 1UVSH 3BV9B 1O3CA 2FZZA 1FY4A 4MPXA 2WPKS 4MDSA 1EP5A 5HM9A 1PPHE 1VCWA 2AIPA 1XUGA 1FN6A 1K28D 1P2MA 3OY6U 4AFQA 1P9SA 1NFYA 1FN8A 1FIZA 2I6QA 1NRRH 1TMBH 4Q7XA 3BEFB 4O3UA 5EW2H 4Q7ZA 1PQ7A 2RA3A 3GDUA 5HGGA 1NFUA 5EOKA 1EAUA 2OC1A 1PPCE 1KLTA 1GHBG 1QL8A 4DVAU 2VH0A 1GBJA 2A7JA 2BOHB 4IBLH 5I25A 4AG2A 1XVMA 1HXFH 5JBBS 2V3HH 1ZPZA 1ABJH 2Q6GA 1HJAB 1MZDA 2A5AA 5DJ7A 4D7FA 1WTGH 2J38A 3ZZ6A 1D3PB 1HPGA 1SGEE 1OP0A 1W13U 5EU8A 3E16B 3ZZBA 3TJVA 2FIRH 3O8CA 4ABIA 1MBQA 4K2YA 3T26A 4I31A 1BITA 1SLWB 3C27B 3MTYA 4Y7BA 1UCYE 1F5RA 4A92A 3TLOA 3B8JA 1BHXB 1KTTB 1C5MD 6LPRA 1XXDA 1LHDH 1O2VA 2PUQH 3PM3A 4XOJA 1GBDA 1S6FA 1ZYOA 1SGCA 3DT0H 2GV6A 1C5WB 1MTUA 4K5ZA 2XBYA 1P10A 3MNXA 5DP6A 3H5CB 2IPHA 3ZYEA 2F9PA 1B5GH 1Y59T 3LU9B 1CGIE 3F9HA 1G3DA 1SHYA 3SGBE 1EASA 1NU7B 4OS7A 1P2QA 1UK3A 1O3EA 2ZU5A 3U8OH 7GCHF 1ABIH 1HJ9A 5AFYH 4X6NA 1C1QA 3VXFH 2XYAA 5E0JA 1YKTA 4UFFH 4AB9A 1NFWA 1RS0A 1C5NH 1L1NA 3RXSA 1GDNA 4GHQA 1GL0E 3QTOH 1C1OA 2AGEX 1P2OA 2BY9X 2FLBH 3ZVFA 4UFDH 4M7GA 3EE0B 3BTDE 3RXHA 3O8RA 1IHTH 1HDTH 2O8UA 3JZ1B 5G4BA 1WTHD 1VCQA 3TGIE 2FYRA 2R3YA 1XUKA 3ZVAA 2QA9E 1O2JA 3MU0A 2P94A 1SGRE 1SVPA 2FOEA 2ZDLA 1DT2A 4DCDA 5GIBA 3UQOA 4AFSA 2UWOA 4FVDA 2O8TA 2ZIQH 3P92A 1S85A 1C5TA 2SGPE 3V13A 1C2IA 2ZNKH 2A0QB 2B5TB 1SGFG 1PYTD 1GJAB 5GCHG 3LPRA 4WVPE 3PMJA 2WPJS 2B8OH 5H4IB 1LHFH 3LJJA 3Q3XA 4ZHMU 3P8OA 1ZR0A 4FXGH 1QBNA 3SU6A 2GD4B 3KIDU 1AHTH 5JBCS 3CS0A 1FMGA 2A7HA 5EPYA 2P3FH 1QJ6B 2QXHA 1UCYH 1NTPA 4ZHAA 1AB9C 2H5DA 1C1RA 1MD7A 2C4FH 1K1OA 1XX9A 3OYPA 2PSXA 1Y5UT 1CE5A 1PQAA 2BZAA 6CHAC 1JIRA 1QB1A 1K1PA 3R0FA 2PR3A 1YLDA 2G55A 1AFQB 3FZZA 1GDQA 1NROH 1TWXB 2PSYA 3RC6A 3MU5A 3SOSA 3N7OA 1G32B 5DP3A 4O9VA 5JYIA 4CRGA 1THRH 3RC4A 3VGCC 5LPRA 1YPLH 1O2UA 1JWTA 2EI7A 1C5VA 3P8FA 3SJ8A 2F9BH 1T8NA 1O31A 2ZCKP 4X1PU 4I32A 5JB9S 5K7RA 4IMZA 4DIIH 2CN0H 1BTPA 1HBTH 1TNGA 2ZDMA 1AUTC 2FXRA 4BAMB 2ILNA 2UUYA 2CGAA 3LIWA 2O8WA 1A1RA 5IYTA 3PTBA 1WUNH 3K65B 1O38A 1IQGA 4WXVA 1O5BB 3SQEE 3SUDA 2J2UA 4X1SU 1GI9B 1NFXA 1FIWA 3KQCA 5GXPA 4NIWA 5GPIB 3ZV8A 2VWLA 1TOCB 4X1NU 4BXWA 1C5SA 4MVNA 3QO6A 2G52A 4Q80A 3BTFE 1C1NA 2P16A 1GI1A 3NXPA 3OSYA 1T8MA 1J14A 4ISIH 5DPAA 1DVAH 2RCEA 3SN8A 1C5ZB 2WYJA 1MCVA 3C1KA 2H1UA 2FS9A 1OWIA 2UUJB 2ZCHP 2HNTF 4CH8B 1W12U 5DP9A 4CHAC 1XUJA 1BTHH 3MNSA 3BF6H 2SFAA 5CE1A 2H9EH 1YPEH 1HB0B 2PV9B 2DE8A 3AVZA 1SLUB 2GV7A 1G3CA 2AERH 1W2KH 4UD9H 3LKWA 1TFXA 3UWIA 6ESTA 2WPLS 5SGAE 4SGAE 2F9VA 1HJ8A 5EQRA 1QTFA 2BQ6B 4AOQA 1W3CA 1AVWA 3O8DA 1IQEA 2BVSH 5K0HA 1OP8A 3UTUH 1OWHA 3ZVBA 3TITA 3A84A 1BHXF 2ZGBH 1TMUH 3ATKA 1TONA 3RXFA 1FPCH 1D3TB 3AASA 3SNDA 2Z94A 4JZFH 3HKIB 3ZZCA 1O32A 1Q3XA 3SNBA 5C3NA 1WAYB 4GVUA 3RXRA 2C8XB 2G5VA 1E35B 1AUJA 1AN1E 1XMNB 2ZDAH 4ABFA 1FQ3A 2BLWA 3MWIU 4WH8A 2PGBB 6CHAB 1UTPA 1PFXC 2BB4A 1AE8H 3SJKA 1CQQA 3SZNA 1SOZA 2BLOA 2XRCA 2FOHA 3A7WA 1LQDB 4U01A 3VGCB 3A88A 1DPOA 4OS4A 1ZMLA 2KAIB 1GG6C 3E90B 1DM4B 4RKJB 1C5RA 1BMAA 1ZGIA 2ZFQH 1ELCA 1TQ7B 2NU2E 1BIOA 3SUEA 1EX3A 1Y8TA 2PLXA 4OS5A 8LPRA 2QN5T 1C5PA 1QIXB 1L1JA 1EZUC 5HMAA 3ZZAA 4YLUA 1T31A 3DFJA 1HAZB 1DWBH 1XUHA 4XE4A 2WUBA 1KDQB 4ISLA 3A8DA 1ZRBA 2VVCA 2H5CA 2W3IA 1SL3A 3A8CA 2Z6BD 2ALPA 5E2OA 1UK2A 3PROA 3MU8A 3ZZ7A 1OWJA 5GCHF 5HXFA 1HFDA 1C4Y2 2HRVA 4ABDA 1A46H 1EB2A 1DSUA 1GCTC 5A09A 2FP7B 1C5LH 1N6XA 1UO6A 1AO5A 5I46H 2AYWA 4BXSA 4NIXA 1NRQH 1F5LA 2BMGB 2QC2A 1LVYA 1NY22 2TGTA 3FAOA 2CMYA 4MNXA 3BN9A 1ACBE 1C2JA 4AYYB 4CHAB 4QT8C 2OQ5A 4CR5A 1ZTLA 3GOVB 3LC5A 1GJ7B 1TE0A 2FLRH 2HOBA 2LPRA 3LH3A 2TRMA 2R9PA 1GJ9B 3A8AA 3NPSA 1Z7KA 5DGJA 5LGOA 1SQAA 1GI5A 1QL9A 1UTLM 2ZPQA 1G30B 2Y5FA 2ZGJA 1UJ1A 2XC5A 1L2EA 5TJXA 1P12E 2PWXA 1NT1A 2VWOA 4ISNA 2FOBA 1A0LA 1QURH 1Z8IB 2H9TH 2CF8H 1RRKA 3HGNA 2Z9IA 4RSPA 2ODQA 3SU4A 3HKJB 4YOJA 2HGTH 4MPWA 2F9OA 2ZHWH 1GBMA 3EA7A 1O2SA 2ZFRH 3D62A 1CHOG 1TGNA 3SNAA 4ABEA 1UTKA 1V2MT 5AVDA 1SGDE 2JETC 1MTNC 1PJPA 4KP0A 5F6MA 1IQFA 1VITF 1K21H 1ESTA 2F91A 2SGEE 1FY8E 2GTBA 2UWPA 1EJMA 3RU4T 3M5MA 1ZSJA 4DIHH 3SBKA 1ELBA 1ZTKA 1LCYA 3QN7A 5T6GA 4AB8A 4DT7B 1TGSZ 2A31A 2PUXB 3PMBB 2UUFB 5J4SA 1S82A 2ZC9H 5F8XA 1VJ9U 4CBNA 3SQHE 1L4DA 1TGBA 1GG6B 1O2WA 1CU1A 1DOJA 1OXGA 2J94A 2IN2A 1TIOA 3GCOA 2TGPZ 4D76A 1ELVA 2FI5E 3QZRA 1MKXH 3Q76A 2PTNA 3E0PB 4ZUHA 3RU4E 1QBVH 4F4OC 1BUIA 1GJCB 3MO6A 3VB5A 2BX4A 4J1YA 3SGQE 2I6SA 1ANEA 3BTHE 1C1SA 3NK8A 4X8SH 4JZDH 1H9IE 2GZ8A 3RXCA 1E36B 1V2QT 2OUAA 1O3IA 2OTVA 1PPEE 4KKDA 1P05A 2PKSC 1FY1A 2Q1JA 3F9FA 3MI4A 1DSTA 1O3MA 2GKVE 1TNHA 1MH0A 1KXDA 4Y8ZA 1O2XA 5LH8A 1A3BH 1S81A 2ZKSA 4GCHF 1HAHH 2GZ9A 5EPNA 3RXUA 2UWLA 1ID5H 3HK3B 3PLPA 1D9IA 4X0WU 2G4UA 1HNEE 1C5UA 3TH3H 2XXLA 2FOMB 2C8WB 1GBTA 1HIAB 5DP4A 2ZHQH 2R0KA 1YLCA 4LK4A 1OYTH 2BY7X 3BEUA 4MTBA 1T7CA 1ESBA 4ABHA 1OYQA 1H8IH 3RMLH 4B73A 1CSOE 2ZHDA 1A3EH 4ZH8A 2IOTA 2WPIS 2OD3B 2ZU2A 3U8RH 1NS3A 2JETB 3E3TA 3ELAH 1V2PT 1QA7A 1SFIA 3AW0A 3S69A 1O3FA 4MNVA 2VWNA 4H4FA 5EGMA 4R0IA 2FTMA 1EAWA 1J17T 2ZGHA 3GDVA 1Y3VA 1SHHB 4HGCA 4D9QA 1GHXH 1NRPH 2G8TA 1F7ZA 3A81A 4OGXA 3VPKA 1DE7H 5FPTA 1J8AA 1OS8A 2Z3DA 2GCHF 4Z6AH 1TPSA 1GVLA 1XUFA 2HPPH 4WMDA 4Y10E 3HK6B 3HGPA 1DUEA 1BRAA 1MTVA 1EATA 5EXLA 1LHEH 1W0YH 3K2UA 3L3TA 2ZG0H 3MU1A 3PO1B 2BD9A 4IGDA 2P3TB 2SNWA 1F2SE 1L4ZA 3KN2A 1MU6B 1MTWA 3D49H 1TQ0B 2AMPA 2Z9KA 3ZVDA 2PKAB 1VR1H 2STAE 4I8GA 1TGTA 1BTUA 7ESTE 3S7HB 1QRXA 4ABJA 1GHAG 3KCGH 4XBBA 5HM2A 4AN7A 5C5OA 1Q2WA 1O3HA 2GCTC 1LO6A 3V7TA 3BTEE 4TY6A 1CBWB 3NWUA 1QA0A 1OWDA 1TMTH 1WYKA 2QY0B 1PPBH 2DUCA 2PKSB 5LPEA 1EJNA 3ZZ9A 1ZHRA 2ZHFH 1P0SH 1AQ7A 4AG1A 1O3JA 3SU0A 3EA9A 1O5GH 1O3DA 4IN1A 2BQ7B 1QJ7B 1F0RA 3F9GA 2AGIX 1HYLA 7KMEH 4MNYA 1XKBC 4LZ1H 1K1IA 1M9UA 4CR9A 2GDEH 3SU3A 1D6WA 1T8LA 1GI4A 3GCTF 3RXPA 1O33A 1O30A 2GP9B 1EPTA 1QR3E 1WU1A 1O34A 2ZQ1A 5T6FA 1ZSKA 5J4QA 1O2ZA 1V2JT 1FXYA 1RTLA 1W7GH 1LTOA 1CA8B 4BAHB 1H8DH 4FUDA 2JH0D 1QHRB 1HAVB 1C1UH 5IDKA 3D23A 1P9UA 2A4OA 3TJOA 2D26C 4K8BA 1ESAA 5JBTA 3KF2A 1QRWA 3KNXA 3MH5A 4BTUB 3NCLA 4HTCH 2AFQB 2A4QA 2DE9A 2A2XH 3E1XB 1GGDB 1V2ST 1H4WA 1SSXA 4B75A 2ZWLH 4DOQA 2V0BA 5A2MH 1QNJA 3RXGA 3TIUA 3KQBA 5T3HA 1QY6A 1MKWK 3T25A 2Y80A 1JBUH 4A1TA 2LNCA 4XFQA 1W10U 2FO9A 2AEIH 4Y6DA 4OS6A 2OQUA 1DLEA 1KXEA 2G51A 2M5TA 5EG4A 1XKAC 3BEIB 3LDXH 3FZDA 3TNTA 5CHAC 2R3UA 1LPZB 3STIA 3WY8A 1BJUA 1G3EA 1NU9A 1Y5BT 1AZZA 2WV4A 2C8ZB 2HNTE 3M35A 2ZDNA 1GHZA 3SNEA 1SG8B 2Z9JA 1Y5AT 2ANKH 4MPVA 3URCA 3P95A 1UHBB 3SUFA 2QIQA 1FI8A 4TWWA 1JXPA 1EQ9A 4K69A 4NFEA 2GCTB 1P09A 1RTFB 5T6DA 1ZJKA 4YM9A 2BDHA 4KTSA 3RXOA 2BLQA 1ETRH 1AMHA 1S5SA 5FX5A 2NU1E 1G2LA 2ZDKA 3RXJA 2TBSA 3RXVA 2Z7FE 2STBE 1U6QA 5ABWA 3BG4C 2ANMH 3T29A 2C3SA 1FAXA 1YPHC 2BZ6H 1HUTH 1Z1JA 4FUJA 1NC6A 1JRTA 1DS2E 2P95A 1A61H 1TA2A 3HPTB 1VJAU 4IMQA 1O5EH 1YYY1 3TPIZ 1V2VT 1C2GA 3QDZB 3PYHA 4X6PA 4K1SA 1ZJDA 4VGCC 1SGPE 2AIQA 5ESBA 1BQYA 4Y8XA 1FY5A 4IS5A 4X2WA 1C5OH 2EA3A 2OXSA 1ORFA 2A45B 1MAXA 2WYGA 3BTWE 5FHTA 1Y3WA 3A7TA 3E6PH 1OKXA 5EW1H 2QV1A 2BDBA 4F49A 3TNSA 1DWCH 3Q00A 4JCNA 4E05H 3S7KB 1SI5H 1GI2A 4UE7H 1RGQA 3MMGA 1QQ4A 5ETXA 1O2OA 1ZPCA 3VFEA 1O2TA 1BRUP 2ULLA 1O2QA 1BMLA 4AYVB 1GHBF 4Y11E 1C1VH 4ZKRU 2VWMA 2QF3A 1TRMA 1A5IA 1GMDG
chains in the Genus database with same CATH superfamily
1HGTH 3MOCA 6GCHG 2QYIA 3HATH 1YPGH 4Q4LA 1V6DA 1RD3B 1IQMA 2QAAA 4D7GA 1GJBB 1IQHA 1EB1H 4NA7A 2VBCA 1ELDE 1JRSA 5KECA 1V2KT 5CHAB 2WUCA 3A85A 1YCPK 1T4UH 3DA9B 4GLYA 1LMWB 1P3EA 1E1RD 4JMYA 3ZVGA 3DFLA 3EGKH 1KXBA 5KGOA 3H7OA 4ZMAH 3UNSA 3MH6A 1E34B 5C1XA 1O3BA 5FBEA 3RDZA 1ZLRA 2BHGA 2ZA5A 4FUEA 3OX7U 4WH6A 1IQJA 3PLBA 1BTWA 3Q3KA 1TPAE 8ESTE 4Y71A 3BSQA 1YPMH 1WOFA 1WV7H 2W5EA 3E91A 1AKSA 1O5AB 1QGFA 2FOAA 5C94A 1RJXB 4TT3D 1EZXC 1K2I1 1K1JA 3UREA 5C67A 1YBWA 1BMFD 3GY6A 3TJUA 2B0FA 4ASUD 1GMHG 1SGTA 8GCHG 3M7UA 1TRNA 1AB9B 7LPRA 2XWAA 4E7NA 3MHWU 2A32A 1MQ5A 4AFZA 2R2MB 5HKKD 1V3XA 2P8OC 2ZEBA 2CF9H 1G9IE 2OLGA 2M2AA 3GY5A 4X2VA 1F0SA 1S0QA 2YOLA 4UONA 1O35A 1OWKA 1OSSA 1O5FH 5L6NH 1T32A 3I77A 1GBAA 4ZHLU 2ZZUH 1C4V2 2VIQA 2B9LA 2R0LA 4XSKU 1P02A 1EOJA 1GBBA 1ZMNA 3RXLA 3K6YA 2BD4A 4X8TH 4ZAEA 1ETTH 2AH4X 4A1XA 1WQSA 4WMFA 4U30A 2FOCA 1A0HB 1TBRH 3W94A 4BAKB 1O36A 4FUHA 2D2DA 3DHKH 4D9RA 4NA9H 1UVUH 1V2LT 1GBEA 3M3VA 3V3MA 1UVTH 4PROA 4B2AA 2PW8H 4ZKSU 3ZYDA 3U9AH 3TH4H 3LGVA 3VB3A 3T5FH 3BTKE 2W7UA 4NZQA 4YESB 3BTGE 4F48B 4ASHA 1AU8A 2VIVA 1EAXA 5BRRE 5DG6A 4INKA 3RM0H 3KQDA 1ELFA 4RN6A 3SV6A 3UY9A 2P59A 3SUGA 1DY8A 2A2QH 1RXPA 2ZQ2A 1PQ8A 2BYAX 2G00A 3SJIA 3STJA 1H1BA 1PYTC 1KXFA 1GMCG 1UVPA 4B76A 2ANYA 4AGKA 2O9QA 3P8NA 2Z3CA 2OC0A 1T8OA 1LKAA 5F8TA 3ZVCA 3FVFB 1GVKB 1CGJE 2ZCLP 3PWCA 3RMOH 1TB6H 1QBOA 2FYQA 2XCFA 2CJIA 5EXNA 4X8UH 3TK9A 1ZTJA 4B74A 5DP7A 5A8XA 5GDSH 3QTVH 3VEQB 4CRBA 3KQEA 2ZGCA 4KELA 1GI6A 1LQEA 1D4PB 4FVBA 4A6LA 2G81E 2AS9A 1HXEH 2TGDA 5C5NA 3UUZA 3PB1E 4B2BA 1TABE 1TX7A 2FI3E 3M3TA 4YOIA 2KM0A 3CP7A 3KYGA 1W11U 1F92A 2ZHEH 4X2YA 1SOTA 4M9FA 1VITH 4YLQH 1SGYE 3M7QA 4ZCNA 3SHAH 1TAWA 4NWLA 3SGAE 1MTSA 1GWAA 3PV4A 1QB6A 2ZO3H 3OU0A 2BXUH 1D3DB 2P8OB 1KXAA 3KEEA 2J9NA 1GDUA 4OS1A 4WWYA 2AMDA 2HVXA 1P57B 3A7XA 3FANA 2D8WA 4TY7A 4I8HA 2B7DH 4BAOB 1MQ6A 2J95A 1ZGVA 1O3KA 4IW4E 1AD8H 3AAVA 3EYDA 3EAJA 3BTME 1GBCA 4X1RU 3ODDA 2XBVA 5AFZH 1GMDF 1OPHB 3JZ2B 2Z3EA 2UUKB 1BBRK 1D3QB 1XUIA 3RXIA 1K22H 2BDGA 2GX4A 3RP2A 3A82A 3FFGA 3VB7A 4RKOB 1GI8B 4KTCA 1AIXH 1CGHA 1THPB 3MU4A 4H6SB 3DD2H 4E06H 2GVFA 5FPSA 3GDSA 1OX1A 3GCHC 1K1LA 2VGCC 1QL7A 2CHAC 2BX3A 3CENA 2FOFA 4OS2A 1F0TA 1P2JA 1SGQE 2FX6A 1HRTH 1SC8U 2PFEA 1BOQA 1OWEA 4Y0ZE 1ARCA 1A5HA 2HWLB 2XC4A 2W6JD 1GCTB 1G2MA 1TRYA 4UFGH 1DXWA 1ZHPA 1GJ4H 1TA6A 4A7IB 3TJNA 2ZFFH 4GPGA 1PPZA 2VIWA 3U1JB 2EI6A 2ZF0H 2GGVB 1GMHF 2F3CE 3MO3A 5DP8A 1XM1A 5GWZA 4Y76A 2SGAA 2HLCA 2NU3E 2SGFE 3ITIA 4FUGA 3A86A 3UR9A 2HPQH 2FPZA 3RMNH 2RG3A 1DANH 1P03A 4IN2A 1ZMJA 4XDEA 1YLNA 5DO4H 1N1LA 5DP5A 1SGIB 3F68H 4INLA 3A80A 1XXFA 3ATIA 1HJAC 1PPGE 2YNBA 2VIPA 1E0FD 4AC9A 1AFEH 1O3OA 3LC3A 1BRBE 3BG8A 3UOUA 1DDJA 3MQKC 2QXIA 2ZTZA 3UIRA 4NFFA 1KDQA 4B6FA 1W0KD 2FM2A 1DUAA 1DY9A 1DXPA 3BTTE 1DICA 2JKHA 2VH6A 1J16A 3ESTA 1GHVH 5DKMA 1TX6A 3I78A 4MNWA 3TK5A 3UR6A 3PV2A 4X6MA 1IQIA 4D8NA 3FP6E 2H9HA 3ZZDA 1C2EA 4DURA 5ESTE 4ABAA 4FUCA 2QF0A 1W8BH 1MTNB 1BMNH 5B6LA 3SV8A 2VNTA 4BAQB 2BD7A 2THFB 1CT0E 1QFKH 1GI7B 2XTTB 5A0BA 5A8YA 1GBFA 2WZQA 4I86A 4X8VH 1COWD 1GBIA 1O3LA 1SFQB 1UTOA 1O2PA 4ESTE 3QX5H 1DFPA 3TVJB 4CRFA 1FY3A 1GJ8B 1LPKB 5EODA 2LELA 3GICB 3ENSB 1DWDH 2G4TA 2FI4E 4RI0A 4ABBA 3ATLA 2J98B 4NA8A 3E0NB 3ATMA 1C2HA 3PWBA 3O8BA 1O2NA 5TCCA 1MU8B 1TPOA 1V2NT 5LPFA 1WBGB 4MQAA 1INCA 1Z8RA 1Q31A 4TPIZ 3GY8A 2CXVA 5EJLA 3ZZ8A 4MG3A 3KHVA 1ELAA 4XBDA 1KLJH 3GY3A 1BJVA 1Z6EA 4OGYA 3VB4A 3GCHB 2VGCB 1UTNA 1NBME 3ZZ3A 2XBWA 1SLVB 4KTUA 1XVOA 4BOHA 5L2ZH 4X1QU 1C2FA 3RU4D 1QJ1B 2Y82A 2BY6X 1LHCH 3BIUH 1O3GA 3M37A 1X7AC 2GT8A 2JH5D 4Y0YE 3TGKE 3EDXB 1CHOF 3A7ZA 2OC8A 4FUFA 4NSYA 1AVXA 2BQWB 1G37A 2KFWA 3M7TA 2C8YB 2AMQA 1VCPA 2WV9A 3P17H 3OEED 3RXAA 3FP8E 1TNLA 1C2DA 2G5NA 3A8BA 2VB0A 5E0HA 1AWHB 3TK6A 3VB6A 3MFJA 1ELEE 4B71A 3P6ZB 2OBOA 1TLDA 1V2OT 4K3JA 3MYWA 3UFAA 4LXBH 2XWBI 1C1PA 1ANDA 1UTQA 1EXFA 2GMTC 3LH1A 3SI3H 1C5QA 1QRZA 1CT4E 2C90B 9ESTA 3GY7A 5JBAS 1SGNE 5A0AE 3A87A 3GY2A 1W7XH 1B0EA 1AFQC 4HI3A 4U2WA 1MKWH 4U32A 1UVOA 4JK6A 4CH2B 3QWCH 4WJG2 5C2ZA 4ISHH 2VVVA 2SGQE 1BB0B 4K8YA 1SMFE 1BDAA 1MBMA 4GUXA 3SI4H 1NPMA 3V0XA 4Y7AA 1IAUA 1GL1A 1S83A 2RDLA 3NUMA 5JB8S 1CO7E 2XOKD 2WPMS 1J9CH 1VGCC 4TWYA 2QF5A 1FONA 1WCZA 2H2ZA 4JZIA 3GCNA 1AE5A 3V12A 1O2GH 1OP2A 1BTXA 2TGAA 1GCDA 3A89A 1FLEE 1ZOMA 4H6TA 4UDWH 1F5KU 2J34A 5GJ4B 1IQNA 2V6NA 3OEHD 4AFUA 1AKSB 2BD3A 1HV7A 4JYTA 3SV7A 3W95A 1P06A 1NO9H 3M3SA 1HIAA 4Y79A 4ZXYH 1ARBA 4ZXXH 2YNAA 2O8LA 5DSFA 3N99A 1GPZA 2Y81A 5EXMA 2IJOB 4BTTB 1P01A 1RTKA 4CRCA 4K1TA 1SPJA 2O8MA 1GHWH 1TBZH 4GAWA 1DX5M 1GI3A 4BTIB 2J97A 1PQ5A 2C93B 1AGJA 3UNRA 1GBKA 2FDAA 4NIVA 1O2YA 8KME2 3UAIC 5FPYA 1HAGE 1TNKA 3AAUA 2Y6TA 2IPQX 3GYMA 3LGYA 1FPHH 1ELTA 2BDYA 2Y7ZA 4YZUA 1NBMD 4AX9H 1YF4A 1C1TA 1EFRD 2BXTH 1LKBA 1N8OC 1FZZA 3I29A 3IG6B 5A8ZA 3S9BA 1YPJH 4X2XA 2D1JA 4I8JA 3GISB 1RFNA 3UNQA 1NM6A 2L74A 5C20A 1J15A 4INHA 2QCYA 1C5XB 1W14U 2NWNA 4YT7H 3RXDA 1C2MA 1K1MA 3MH7A 3RXBA 3ZZ5A 2FESH 3SYJA 2Q6DA 3PTNA 1O39A 2W26A 2GMTB 3EQ0H 1C9TA 2J4IA 3E8LA 1YM0A 2FMJA 3M36A 3QZQA 1GJ6A 1Y3UA 2PKAA 1P2IA 4H42U 4AZ2B 3GYLB 4CBOA 2FEQH 1NRNH 4HFPB 2JH6D 1ANCA 1EZSC 2ASUB 3B9FH 1BRCE 1BCUH 2ZU4A 1P8VC 1VZQH 1O2MA 1Z71A 3F6UH 3RXKA 1P11E 1B0FA 3KQ5A 1UCYK 2XW9A 3RM2H 1BT7A 4WXIA 3D65E 3SO3A 1MD8A 1T4VH 4LOYH 3UOPA 3DSPA 4NG9H 3A7YA 5L30H 1QB9A 1S0RA 2FOGA 3U8TH 3DUXH 5C0UA 1JIMA 1TBQH 1AWFH 1QCPA 1GHAF 1TALA 1YCPH 1MMJN 2RA0A 3FO8D 3ZV9A 2A4GA 2BM2A 1VGCB 2V7QD 3MNCA 2P3UB 1C2LA 5B6OA 1N6YA 5PTPA 4R8TB 5BPEA 3KGPA 2XBXA 3UQVA 2GT7A 1V2TT 1VITG 3T27A 2F4LA 1ZZZA 3KL6A 2YMSC 3Q3YA 2AGGX 1GHYH 3WWFA 4THNH 1IHSH 3G01A 1Z1IA 1NESE 1LVMA 1UMAH 1O2KA 1TOMH 2PGQB 3MH4A 1GJ5H 1Z6JH 2Z9LA 1F0UA 4WMEA 3SV2H 1TNJA 1ELGA 1SBWA 1D6RA 4GSOA 1HAVA 3ZZ4A 3RXQA 4RT1A 4O3TA 2SGDE 1O5CB 3N7EA 4FUIA 4O97A 2OBQA 3LOXA 1H9LB 4NZLA 1BZXE 2ZU1A 1O3PB 1P3CA 1ETSH 1DLKB 1EAIA 1MUEB 2FODA 5F03A 2ZU3A 3IWMA 2VIDA 2J92A 3L6PA 1GBHA 3CS7A 1CHGA 1ZSLA 1O2HA 2A1DB 1O2RA 1SLXB 4ZKNU 2XNIA 3BG4B 4UFEH 4J2YB 1FJSA 3DSGA 1V2WT 2FX4A 1P2KA 1N8OB 3A7VA 5AHGH 1TNIA 3T62A 1C2KA 1THSH 2KCPA 2NU0E 4I33A 3P70B 5F8ZA 4JK5A 1FDPA 3LGTA 3QLPH 4VGCB 1BMMH 2A7CA 3A83A 2BLVA 3RXMA 4DW2U 4GCHG 1IQKA 1YC0A 3F1SB 4CREA 3SU1A 3FP7E 3OE7D 1BBRE 3RXTA 4B2CA 4YO9A 3TU7H 4I7YH 4JYUH 4K60A 5TCAA 1SGFA 1UHBA 4UEHH 3S9AA 3VXEH 3OTJE 1E37B 4JZEH 2BDCA 4I8KA 1UW7A 1HAYB 2NU4E 1O2LA 1A7SA 2ZP0H 1FUJA 3BTQE 1SQTA 5C1YA 2Y7XA 5E8EH 5FXLA 1EZQA 1QZ8A 2GJGA 4XD7D 3K9XB 2CV3A 1YCPM 3QK1A 1UTJA 2VVUA 3LGUA 5C1UA 2ZFTA 1EPTC 3MO9A 1UK4A 3SHCH 3U1IB 2A5KA 4CRAA 1LHGH 5E0GA 3S9CA 2YMSB 5CDFE 1GVZA 4NIYA 2JIZD 2PHBA 1TGCA 1RIWC 4Y8YA 1L0ZA 2BTCE 1YPKH 4AORA 1FNIA 1V2RT 1C9PA 4TYDA 5DK1A 1HAPH 3SU2A 1BTZA 2W3KA 5EQSA 2GZ7A 3EA8A 3QGNB 2GCHG 2H6MA 2JJ2D 3LONA 3SW2B 1K9OE 2BVRH 4FU8A 1LVBA 1C1MA 1DWEH 3SJ9A 1SR5C 1A4WH 1GBLA 3IITA 2QXJA 2TPIZ 3M5LA 4DJZB 1YPHE 4FU7A 4YTAA 1H8HD 2OP9A 1DITH 1C4U2 1QQUA 4ABGA 1CVWH 1Y3XA 1A5GH 2ZECA 2BDIA 2Q6FA 1SB1H 2XC0A 1P2NA 4FUBA 2ALVA 2F9NA 1KYNA 1UTMA 3LGWA 9LPRA 4K1EA 2TIOA 2OC7A 1Z8JB 1MAYA 2SNVA 2ODYB 1HLTH 2ZDVH 4CRDA 4MLFB 4NSVA 2GDDA 2PTCE 3M5OA 4XBCA 3PMAB 2BY5X 2WPHS 3LJOA 1BBRH 1C5YB 2OCVB 2A5IA 2EEKA 1O5DH 4SGBE 5JDUB 5EQQA 3UB0A 2BD5A 1AY6H 3RC5A 1ANBA 3BIVH 1MZAA 1KTSB 3RUOA 1BA8B 2Y5HA 4B1TA 1G3BA 2JDID 2QGRA 1E38B 3AW1A 4YOGA 1O3NA 1O0DH 4JZ1A 6GCHF 3U69H 3PRDA 1PPFE 2FS8A 3M5NA 3OY5U 1EOLA 1AI8H 3NKKA 1CA0C 2V3OH 2EC9H 3GCTG 1AVGH 2ANWA 1TX8A 3RLWH 4WY3A 3GY4A 1FAKH 5FAHA 5FBIA 1K1NA 3QGJA 1EKBB 4NCYA 1IQLA 3F2HA 3PLKA 5AF9H 1TPPA 3UWJH 4YT6H 3B23B 2EI8A 3PO1C 2A4RA 1FV9A 1NN6A 1H9HE 5F53A 2BOKA 1EPTB 3ODFA 2BY8X 1NRSH 1EJAA 1YGCH 1KIGH 4Q2KA 5FX6A 7GCHG 2ZGXH 1HAOH 1YY3A 3RXEA 1RIWB 1CT2E 2V35A 4A5TS 4BANB 2ZPRA 5HIYA 4DGJA 8GCHF 3P8GA 4GHTA 2KAIA 2W7SA 1LPGB 1CBWC 1LDTT 1P04A 2ESTE 1GJDB 1MCTA 2VJ1A 3ZVEA 1MKXK 5FCRA 3PMHB 3SORA 1O3AA 1HAXB 1AZ8A 1TYNA 2BVXH 2HNTC 2XCNA 1W0ZU 2ZI2H 3U98H 3SV9A 2EQNA 3PV5A 1YP9A 2QF4A 3URDA 3SU5A 2P93A 1NZQH 4HZHA 4ZROA 4JYVH 4Q7YA 3ATWA 3TH2H 5L2YH 1Z8GA 2VINA 2KCYA 4IC6A 4O03A 1WSSH 2WV5A 3K6ZA 2VIOA 1JMOH 2ZTXA 4NWKA 3RMMH 4DG4A 1KLIH 1O37A 4KGAA 2VU8E 4ISOA 4I8LA 4BNRA 3MNBA 3S0NA 2K8IA 2QXGA 2BDAA 1BTYA 5JPMH 1B7XB 1L1GA 2BD2A 2ZFPH 4A1VA 3LGIA 1G36A 1GI0A 1O2IA 4E7RG 1V2UT 1JOUB 1HCGA 3UPEA 1KSNA 4X6OA 3L33A 4WF8A 4ZKOU 3NZIA 3TGJE 5E2PA 1KY9A 4TPYA 3SJOA 2K1QA 2ZTYA 4NGAH 5T1VA 3T2NA 2WINI 3F9EA 4IC5A 2K0QA 1A2CH 2BD8A 3LT3A 4MPUA 3QUMP 3R3GB 1LVOA 1GGDC 1ZHMA 2FWWA 1OOKB 1SQOA 1S6HA 2R2WU 1EP6A 1HAIH 1ZRKA 1Y3YA 2ODPA 2Z9GA 1IOEA 4LZ4B 2KCOA 4DY7B 2F83A 4FU9A 5FCKA 1CA0B 1GMCF 2HALA 2OINA 1A0JA 2FTLE 3SNCA 1C1WH 1KXCA 3Q77A 3H7TA 1EUFA 2Y5GA 1ZPBA 2ZPSA 5HYOA 5CMXH 4F55A 4Z0KA 1WQVH 3T28A 5A0CA 3RLYH 1KMHB 2F9UA 1S84A 4AGJA 2ZFSA 3M61U 2CHAB 1UVSH 3BV9B 1O3CA 2FZZA 1FY4A 4MPXA 2WPKS 4MDSA 1EP5A 5HM9A 1PPHE 1VCWA 2AIPA 1XUGA 1FN6A 1K28D 1P2MA 3OY6U 4AFQA 1P9SA 2W6ID 1NFYA 1FN8A 1FIZA 2I6QA 1NRRH 1TMBH 4Q7XA 3BEFB 4O3UA 5EW2H 4Q7ZA 1PQ7A 2RA3A 3GDUA 5HGGA 5CHBA 1NFUA 5EOKA 1EAUA 2OC1A 1PPCE 2WHXA 1KLTA 1GHBG 1QL8A 4DVAU 2VH0A 3F2GA 1GBJA 5GNDA 2A7JA 2BOHB 4IBLH 5I25A 4AG2A 1XVMA 1HXFH 5JBBS 2V3HH 1ZPZA 1ABJH 2Q6GA 1HJAB 1MZDA 2A5AA 5DJ7A 4D7FA 1WTGH 2J38A 3ZZ6A 1D3PB 1HPGA 1SGEE 2EY4C 1OP0A 1W13U 2J5UA 5EU8A 3E16B 3ZZBA 3TJVA 2FIRH 3O8CA 4ABIA 1MBQA 4K2YA 3T26A 4I31A 1BITA 2HLDD 1SLWB 3C27B 3MTYA 4Y7BA 1UCYE 1F5RA 4A92A 3TLOA 3B8JA 1BHXB 1KTTB 1C5MD 6LPRA 1XXDA 1LHDH 1O2VA 2PUQH 3PM3A 4XOJA 1GBDA 1S6FA 1ZYOA 1SGCA 3DT0H 2GV6A 1C5WB 1MTUA 3FKSD 4K5ZA 2XBYA 1P10A 3MNXA 5DP6A 3H5CB 2IPHA 3ZYEA 2F9PA 1B5GH 3EE7A 1Y59T 3LU9B 1CGIE 3F9HA 1G3DA 3OTPA 1SHYA 2HVYB 3SGBE 1EASA 1NU7B 4OS7A 1P2QA 4RT0A 1UK3A 1O3EA 2ZU5A 3U8OH 4ACBA 7GCHF 1ABIH 1HJ9A 5AFYH 4X6NA 1C1QA 3VXFH 1VKYA 2XYAA 5E0JA 1YKTA 4UFFH 4AB9A 1NFWA 1RS0A 1C5NH 1L1NA 3RXSA 1GDNA 4GHQA 1GL0E 3QTOH 1C1OA 2AGEX 5KEDA 1P2OA 2BY9X 2FLBH 3ZVFA 4UFDH 4M7GA 3EE0B 3BTDE 3RXHA 3O8RA 1IHTH 1HDTH 2O8UA 3JZ1B 5G4BA 1WTHD 1VCQA 3TGIE 2FYRA 2R3YA 1XUKA 3ZVAA 2QA9E 1O2JA 3MU0A 2P94A 1SGRE 1SVPA 2FOEA 2ZDLA 1DT2A 4DCDA 5GIBA 3UQOA 4AFSA 3N7DA 2UWOA 4FVDA 2PP6A 2O8TA 2ZIQH 3P92A 1S85A 1C5TA 2SGPE 3V13A 1C2IA 2ZNKH 2A0QB 2B5TB 1WXRA 1SGFG 1PYTD 1GJAB 5GCHG 3LPRA 4WVPE 3PMJA 3CNRA 2WPJS 3WWBA 2B8OH 5H4IB 1LHFH 3LJJA 3Q3XA 4ZHMU 2J98A 3P8OA 1ZR0A 4FXGH 1QBNA 3SU6A 2GD4B 3KIDU 1AHTH 5JBCS 3CS0A 1FMGA 3F3BA 2A7HA 2KCAA 5EPYA 2P3FH 1QJ6B 2QXHA 4Q63A 1UCYH 1NTPA 4ZHAA 1AB9C 2H5DA 1C1RA 1MD7A 2C4FH 1K1OA 1XX9A 3OYPA 2PSXA 1Y5UT 1CE5A 1PQAA 2BZAA 6CHAC 1JIRA 1QB1A 1K1PA 3R0FA 2PR3A 1YLDA 2G55A 1AFQB 3FZZA 1GDQA 1NROH 1TWXB 2PSYA 3RC6A 3MU5A 3SOSA 3N7OA 1G32B 5DP3A 4O9VA 5JYIA 4CRGA 1THRH 3RC4A 3VGCC 5LPRA 1YPLH 3VG8A 1O2UA 1JWTA 2EI7A 1C5VA 3P8FA 3SJ8A 2F9BH 1T8NA 1O31A 2ZCKP 2KX4A 4X1PU 4I32A 5JB9S 2KR7A 5K7RA 4IMZA 4DIIH 2CN0H 4XRNA 1BTPA 1HBTH 1TNGA 2ZDMA 1AUTC 2FXRA 4BAMB 2ILNA 2UUYA 2CGAA 3LIWA 2O8WA 1A1RA 5IYTA 3PTBA 1WUNH 3K65B 2QE7D 1O38A 1IQGA 4WXVA 1O5BB 3SQEE 3SUDA 2J2UA 4X1SU 1GI9B 1NFXA 1FIWA 3KQCA 5GXPA 4NIWA 5GPIB 3ZV8A 2VWLA 1TOCB 4X1NU 4BXWA 1C5SA 4MVNA 3QO6A 2G52A 4Q80A 3BTFE 1C1NA 2P16A 1GI1A 3NXPA 3OSYA 1T8MA 5FL7D 1J14A 3W1EA 2CK3D 4P02A 4ISIH 5DPAA 1DVAH 2RCEA 3SN8A 2V3MA 1C5ZB 2WYJA 1MCVA 3C1KA 2H1UA 2FS9A 1OWIA 2UUJB 2ZCHP 2HNTF 4CH8B 1W12U 5DP9A 4CHAC 1XUJA 1BTHH 3MNSA 3BF6H 2SFAA 4Z1MD 5CE1A 2H9EH 1YPEH 1HB0B 2PV9B 2DE8A 3AVZA 1SLUB 2GV7A 1G3CA 2AERH 1W2KH 4P00A 4UD9H 3LKWA 1TFXA 5EJ1A 3UWIA 6ESTA 2WPLS 5SGAE 1MABB 4SGAE 2F9VA 1HJ8A 5EQRA 1QTFA 2BQ6B 4AOQA 1W3CA 1AVWA 3O8DA 1IQEA 2BVSH 5K0HA 1OP8A 3UTUH 1OWHA 3ZVBA 3TITA 3A84A 1BHXF 2ZGBH 1TMUH 3ATKA 1S6LA 1TONA 3RXFA 1FPCH 1D3TB 3AASA 3SNDA 2Z94A 2RDEA 4JZFH 3HKIB 3ZZCA 1O32A 1Q3XA 3SNBA 5C3NA 1WAYB 4GVUA 3RXRA 2C8XB 2G5VA 1E35B 1AUJA 1AN1E 1XMNB 2ZDAH 4ABFA 1FQ3A 2BLWA 3MWIU 4WH8A 2PGBB 6CHAB 1UTPA 1PFXC 2BB4A 1AE8H 3SJKA 1CQQA 3SZNA 1SOZA 2BLOA 2XRCA 2FOHA 3A7WA 1LQDB 4U01A 3VGCB 3A88A 2WPDD 1DPOA 4OS4A 1ZMLA 2KAIB 1GG6C 2KZ4A 1DM4B 3E90B 4RKJB 1C5RA 1BMAA 1ZGIA 2ZFQH 1ELCA 1TQ7B 2NU2E 1BIOA 3SUEA 1EX3A 1Y8TA 2PLXA 4OS5A 8LPRA 2QN5T 1C5PA 1QIXB 1L1JA 1EZUC 5HMAA 1E79D 3ZZAA 3NRLA 4YLUA 1T31A 3DFJA 1HAZB 1DWBH 1XUHA 4XE4A 2WUBA 1KDQB 4ISLA 3A8DA 1ZRBA 2VVCA 2H5CA 2W3IA 3F0OA 1YWUA 1SL3A 3A8CA 2Z6BD 2ALPA 5E2OA 1UK2A 3PROA 3MU8A 3ZZ7A 1OWJA 5GCHF 5HXFA 1HFDA 1C4Y2 1SQRA 2HRVA 4HG6A 4ABDA 1A46H 1EB2A 4FETA 2JJ1D 1FX0B 1DSUA 1GCTC 5A09A 2FP7B 1C5LH 1N6XA 1UO6A 1AO5A 5I46H 2AYWA 4BXSA 5C0TA 4NIXA 1NRQH 1F5LA 2BMGB 2QC2A 1LVYA 1NY22 2TGTA 4ACAA 3FAOA 2CMYA 4MNXA 3BN9A 3ZIAD 1ACBE 1C2JA 4AYYB 4CHAB 4QT8C 2OQ5A 4CR5A 1ZTLA 3GOVB 3LC5A 1GJ7B 1TE0A 2FLRH 2HOBA 2LPRA 3LH3A 2TRMA 2R9PA 1GJ9B 3A8AA 3NPSA 1Z7KA 5DGJA 5LGOA 1SQAA 1GI5A 1QL9A 1UTLM 2ZPQA 1G30B 2Y5FA 2ZGJA 1UJ1A 2XC5A 1L2EA 5TJXA 1P12E 2PWXA 1NT1A 2VWOA 4ISNA 2FOBA 1A0LA 1QURH 1Z8IB 2H9TH 2CF8H 1RRKA 3HGNA 2Z9IA 4RSPA 2ODQA 3SU4A 3HKJB 4YOJA 2HGTH 4MPWA 2F9OA 2ZHWH 4TSFD 1GBMA 3EA7A 1O2SA 2ZFRH 3D62A 1CHOG 1TGNA 3SNAA 4ABEA 1UTKA 1V2MT 5AVDA 2F43B 1SGDE 2JETC 5C17A 1MTNC 1PJPA 4KP0A 5F6MA 4FOUC 1IQFA 1VITF 1K21H 1ESTA 2F91A 2SGEE 1FY8E 2GTBA 2UWPA 1EJMA 3RU4T 3M5MA 1ZSJA 2XNDD 4DIHH 3SBKA 1ELBA 1ZTKA 1LCYA 3QN7A 5T6GA 4AB8A 4DT7B 1TGSZ 2A31A 2PUXB 3PMBB 2UUFB 5J4SA 1S82A 2ZC9H 5F8XA 1VJ9U 4CBNA 3SQHE 1L4DA 1TGBA 3U28C 1GG6B 3WW7A 1O2WA 1CU1A 1DOJA 1OXGA 2J94A 2IN2A 1TIOA 3GCOA 2TGPZ 4D76A 3DSOA 1ELVA 2FI5E 3QZRA 1MKXH 3Q76A 2PTNA 3E0PB 4ZUHA 3RU4E 1QBVH 4F4OC 1BUIA 5EJZA 1GJCB 3MO6A 3VB5A 2BX4A 4J1YA 3SGQE 2I6SA 1H8ED 1ANEA 3BTHE 1C1SA 3NK8A 4X8SH 3F0PA 4JZDH 1H9IE 2GZ8A 3RXCA 1E36B 1V2QT 2OUAA 1O3IA 2OTVA 1PPEE 4KKDA 1P05A 2PKSC 1FY1A 2Q1JA 3F9FA 3MI4A 5IK2D 1DSTA 1O3MA 2GKVE 1TNHA 1MH0A 1KXDA 4Y8ZA 1O2XA 5LH8A 1A3BH 1S81A 2ZKSA 4GCHF 1HAHH 2GZ9A 5EPNA 3RXUA 2UWLA 1ID5H 3HK3B 3PLPA 1D9IA 4X0WU 2G4UA 1HNEE 1C5UA 3TH3H 2XXLA 2FOMB 2C8WB 1GBTA 3PRBA 1HIAB 5DP4A 2ZHQH 2R0KA 1YLCA 4LK4A 5EIYA 1OYTH 1K0HA 2BY7X 3BEUA 4MTBA 1T7CA 1ESBA 4ABHA 4YXWD 1OYQA 1H8IH 3RMLH 2RFKC 4B73A 1CSOE 2ZHDA 1A3EH 4ZH8A 2IOTA 2WPIS 2OD3B 2ZU2A 3U8RH 1NS3A 3OFND 2JETB 3E3TA 3ELAH 1V2PT 1QA7A 1SFIA 3AW0A 3S69A 1O3FA 4MNVA 2VWNA 4H4FA 5EGMA 4R0IA 2FTMA 1EAWA 1J17T 1W0JD 2ZGHA 3GDVA 1Y3VA 1SHHB 4HGCA 4D9QA 1GHXH 1NRPH 2G8TA 1F7ZA 3A81A 4OGXA 3VPKA 1DE7H 5FPTA 1J8AA 1OS8A 2Z3DA 2GCHF 4Z6AH 1TPSA 1GVLA 1XUFA 3FN8A 2HPPH 4WMDA 4Y10E 3HK6B 3HGPA 1DUEA 1BRAA 1MTVA 1EATA 5EXLA 1LHEH 1W0YH 3K2UA 3L3TA 2ZG0H 3MU1A 3PO1B 2BD9A 3FOAA 4IGDA 2P3TB 2SNWA 1F2SE 1L4ZA 3KN2A 1E1QD 1MU6B 1MTWA 3D49H 1TQ0B 2AMPA 2Z9KA 2YMSD 3ZVDA 2PKAB 1VR1H 2STAE 4I8GA 1TGTA 1BTUA 3F2FA 7ESTE 1QRXA 4ABJA 3S7HB 1GHAG 3KCGH 4XBBA 5HM2A 4AN7A 5C5OA 1Q2WA 1O3HA 2GCTC 1LO6A 3V7TA 3BTEE 4TY6A 1CBWB 3NWUA 1QA0A 1OHHD 1OWDA 1TMTH 1WYKA 2QY0B 1PPBH 2DUCA 2PKSB 3H09A 4OM9A 5LPEA 1EJNA 3ZZ9A 1ZHRA 2ZHFH 1P0SH 1AQ7A 4AG1A 3KYFA 2WSSD 1O3JA 3SU0A 3EA9A 1O5GH 1O3DA 4IN1A 2BQ7B 3OAAD 1QJ7B 1F0RA 3F9GA 1SKYE 2AGIX 3AK5A 1HYLA 7KMEH 4MNYA 1XKBC 4LZ1H 1K1IA 1M9UA 4CR9A 2GDEH 3SU3A 1D6WA 1T8LA 1GI4A 3GCTF 3RXPA 1O33A 1O30A 2GP9B 1EPTA 1QR3E 1WU1A 1O34A 2ZQ1A 5T6FA 1ZSKA 5J4QA 1O2ZA 1V2JT 1FXYA 1RTLA 1W7GH 1LTOA 1CA8B 4BAHB 1H8DH 4FUDA 2JH0D 1QHRB 1HAVB 1C1UH 5IDKA 3D23A 1P9UA 2A4OA 3TJOA 2D26C 4K8BA 1ESAA 5JBTA 3KF2A 1QRWA 3KNXA 3MH5A 4BTUB 3NCLA 4HTCH 2AFQB 2A4QA 2DE9A 2A2XH 3E1XB 1GGDB 1V2ST 1H4WA 1SSXA 4B75A 2ZWLH 4DOQA 2V0BA 5A2MH 1QNJA 3RXGA 3TIUA 2L6OA 3KQBA 5T3HA 1QY6A 1MKWK 3T25A 2Y80A 1JBUH 4A1TA 2LNCA 4XFQA 1W10U 2FO9A 2AEIH 4Y6DA 4OS6A 2OQUA 1DLEA 1KXEA 2G51A 2M5TA 5EG4A 1XKAC 3BEIB 3LDXH 3FZDA 3TNTA 5CHAC 2R3UA 1LPZB 3STIA 5HIZA 3WY8A 1BJUA 1G3EA 3DCLA 1NU9A 2OK5A 1Y5BT 1AZZA 2WV4A 2C8ZB 2HNTE 3M35A 2ZDNA 1GHZA 3SNEA 1SG8B 4DT4A 2Z9JA 2LP6A 1Y5AT 2ANKH 4MPVA 3URCA 3P95A 1UHBB 3SUFA 2QIQA 1FI8A 4TWWA 1JXPA 1EQ9A 4K69A 4NFEA 2GCTB 1P09A 1RTFB 5T6DA 1ZJKA 4YM9A 2BDHA 4KTSA 3RXOA 2BLQA 1ETRH 1AMHA 1S5SA 5FX5A 2NU1E 1G2LA 2ZDKA 3RXJA 2TBSA 3RXVA 2Z7FE 2STBE 1U6QA 5ABWA 3BG4C 2ANMH 3SZEA 3T29A 2C3SA 1FAXA 1YPHC 2BZ6H 1HUTH 1Z1JA 4FUJA 1NC6A 1JRTA 1DS2E 2P95A 1A61H 1TA2A 3HPTB 1VJAU 4IMQA 1O5EH 1YYY1 3TPIZ 1V2VT 4B6EA 1C2GA 3QDZB 3PYHA 3GS9A 4K1SA 4X6PA 1ZJDA 4VGCC 1SGPE 2AIQA 5ESBA 1BQYA 4Y8XA 1FY5A 4IS5A 4X2WA 1C5OH 2EA3A 2OXSA 1ORFA 2A45B 1MAXA 2WYGA 3BTWE 5FHTA 1Y3WA 3A7TA 3E6PH 1OKXA 5EW1H 2QV1A 2BDBA 4F49A 3TNSA 1DWCH 5DN6D 3Q00A 4JCNA 4E05H 3S7KB 1SI5H 1GI2A 4UE7H 1RGQA 3MMGA 1QQ4A 5ETXA 1O2OA 1ZPCA 3VFEA 1O2TA 1BRUP 2ULLA 1O2QA 1BMLA 2AHME 4AYVB 1GHBF 4Y11E 1C1VH 4ZKRU 1WDIA 2QF3A 1TRMA 2IJD1 2VWMA 1A5IA 1GMDG
chains in the Genus database with same CATH topology
1HGTH 3MOCA 6GCHG 2QYIA 3HATH 1YPGH 1V6DA 1RD3B 1IQMA 2QAAA 4D7GA 1GJBB 1IQHA 1EB1H 4NA7A 1ELDE 1JRSA 1V2KT 5CHAB 2WUCA 3A85A 1YCPK 1T4UH 3DA9B 4GLYA 1LMWB 1P3EA 4JMYA 3ZVGA 3DFLA 3EGKH 1KXBA 3H7OA 4ZMAH 3UNSA 3MH6A 1E34B 5C1XA 1O3BA 5FBEA 3RDZA 1ZLRA 2BHGA 2ZA5A 4FUEA 3OX7U 4WH6A 1IQJA 3PLBA 1BTWA 3Q3KA 1TPAE 8ESTE 4Y71A 3BSQA 1YPMH 1WOFA 1WV7H 2W5EA 3E91A 1AKSA 1O5AB 1QGFA 2FOAA 1RJXB 1EZXC 1K2I1 1K1JA 3UREA 5C67A 1YBWA 3GY6A 3TJUA 2B0FA 1GMHG 1SGTA 8GCHG 3M7UA 1TRNA 1AB9B 7LPRA 2XWAA 4E7NA 3MHWU 2A32A 1MQ5A 4AFZA 2R2MB 1V3XA 2P8OC 2ZEBA 2CF9H 1G9IE 2OLGA 4X2VA 3GY5A 1F0SA 1S0QA 2YOLA 4UONA 1O35A 1OWKA 1OSSA 1O5FH 5L6NH 1T32A 3I77A 1GBAA 4ZHLU 2ZZUH 1C4V2 2VIQA 2B9LA 2R0LA 4XSKU 1P02A 1EOJA 1GBBA 1ZMNA 3RXLA 3K6YA 2BD4A 4X8TH 4ZAEA 1ETTH 2AH4X 4A1XA 1WQSA 4WMFA 4U30A 2FOCA 1A0HB 1TBRH 3W94A 4BAKB 1O36A 4FUHA 2D2DA 3DHKH 4D9RA 4NA9H 1UVUH 1V2LT 1GBEA 3M3VA 3V3MA 1UVTH 4PROA 4B2AA 2PW8H 4ZKSU 3ZYDA 3U9AH 3TH4H 3LGVA 3VB3A 3T5FH 3BTKE 2W7UA 4NZQA 4YESB 3BTGE 4ASHA 1AU8A 2VIVA 1EAXA 5BRRE 5DG6A 4INKA 3RM0H 3KQDA 1ELFA 4RN6A 3SV6A 3UY9A 2P59A 3SUGA 1DY8A 2A2QH 1RXPA 2ZQ2A 1PQ8A 2BYAX 2G00A 3SJIA 3STJA 1H1BA 1PYTC 1KXFA 1GMCG 1UVPA 4B76A 2ANYA 4AGKA 2O9QA 3P8NA 2Z3CA 2OC0A 1T8OA 1LKAA 5F8TA 3ZVCA 3FVFB 1GVKB 1CGJE 2ZCLP 3PWCA 3RMOH 1TB6H 1QBOA 2FYQA 2XCFA 2CJIA 5EXNA 4X8UH 3TK9A 1ZTJA 4B74A 5DP7A 5A8XA 5GDSH 3QTVH 3VEQB 4CRBA 3KQEA 2ZGCA 4KELA 1GI6A 1LQEA 1D4PB 4FVBA 4A6LA 2G81E 2AS9A 1HXEH 2TGDA 5C5NA 3UUZA 3PB1E 4B2BA 1TABE 1TX7A 2FI3E 3M3TA 4YOIA 3CP7A 1W11U 1F92A 2ZHEH 4X2YA 1SOTA 1VITH 4YLQH 1SGYE 3M7QA 3SHAH 1TAWA 4NWLA 3SGAE 1MTSA 1GWAA 3PV4A 1QB6A 2ZO3H 3OU0A 2BXUH 1D3DB 2P8OB 1KXAA 3KEEA 2J9NA 1GDUA 4OS1A 4WWYA 2AMDA 2HVXA 1P57B 3A7XA 3FANA 2D8WA 4TY7A 4I8HA 2B7DH 4BAOB 1MQ6A 2J95A 1ZGVA 1O3KA 4IW4E 1AD8H 3AAVA 3EYDA 3EAJA 3BTME 1GBCA 4X1RU 3ODDA 2XBVA 5AFZH 1GMDF 1OPHB 3JZ2B 2Z3EA 2UUKB 1BBRK 1D3QB 1XUIA 3RXIA 1K22H 2BDGA 2GX4A 3RP2A 3A82A 3FFGA 3VB7A 4RKOB 1GI8B 4KTCA 1AIXH 1CGHA 1THPB 3MU4A 4H6SB 3DD2H 4E06H 2GVFA 5FPSA 3GDSA 1OX1A 3GCHC 1K1LA 2VGCC 1QL7A 2CHAC 2BX3A 3CENA 2FOFA 4OS2A 1F0TA 1P2JA 1SGQE 2FX6A 1HRTH 1SC8U 2PFEA 1BOQA 1OWEA 4Y0ZE 1ARCA 1A5HA 2HWLB 2XC4A 1GCTB 1G2MA 1TRYA 4UFGH 1DXWA 1ZHPA 1GJ4H 1TA6A 4A7IB 3TJNA 2ZFFH 4GPGA 1PPZA 2VIWA 3U1JB 2EI6A 2ZF0H 2GGVB 1GMHF 2F3CE 3MO3A 5DP8A 1XM1A 5GWZA 4Y76A 2SGAA 2HLCA 2NU3E 2SGFE 3ITIA 4FUGA 3A86A 3UR9A 2HPQH 2FPZA 3RMNH 2RG3A 1DANH 1P03A 4IN2A 1ZMJA 4XDEA 5DO4H 1N1LA 5DP5A 1SGIB 3F68H 4INLA 3A80A 1XXFA 3ATIA 1HJAC 1PPGE 2YNBA 2VIPA 1E0FD 1AFEH 1O3OA 3LC3A 1BRBE 3BG8A 3UOUA 1DDJA 2QXIA 2ZTZA 3UIRA 4NFFA 1KDQA 2FM2A 1DUAA 1DY9A 1DXPA 3BTTE 1DICA 2JKHA 2VH6A 1J16A 3ESTA 1GHVH 5DKMA 1TX6A 3I78A 4MNWA 3TK5A 3UR6A 4X6MA 1IQIA 4D8NA 3FP6E 2H9HA 3ZZDA 1C2EA 4DURA 5ESTE 4ABAA 4FUCA 2QF0A 1W8BH 1MTNB 1BMNH 3SV8A 2VNTA 4BAQB 2BD7A 2THFB 1CT0E 1QFKH 1GI7B 2XTTB 5A0BA 5A8YA 1GBFA 4X8VH 1GBIA 1O3LA 1SFQB 1UTOA 1O2PA 4ESTE 3QX5H 1DFPA 3TVJB 4CRFA 1FY3A 1GJ8B 1LPKB 5EODA 3GICB 3ENSB 1DWDH 2G4TA 2FI4E 4ABBA 3ATLA 4NA8A 3E0NB 3ATMA 1C2HA 3PWBA 3O8BA 1O2NA 5TCCA 1MU8B 1TPOA 1V2NT 5LPFA 1WBGB 4MQAA 1INCA 1Z8RA 1Q31A 4TPIZ 3GY8A 2CXVA 3ZZ8A 4MG3A 3KHVA 1ELAA 4XBDA 1KLJH 3GY3A 1BJVA 1Z6EA 4OGYA 3VB4A 3GCHB 2VGCB 1UTNA 3ZZ3A 2XBWA 1SLVB 4KTUA 1XVOA 4BOHA 5L2ZH 4X1QU 1C2FA 3RU4D 1QJ1B 2Y82A 2BY6X 1LHCH 3BIUH 1O3GA 3M37A 1X7AC 2GT8A 2JH5D 4Y0YE 3TGKE 3EDXB 1CHOF 3A7ZA 2OC8A 4FUFA 4NSYA 1AVXA 2BQWB 1G37A 3M7TA 2C8YB 2AMQA 1VCPA 3P17H 3RXAA 3FP8E 1TNLA 1C2DA 2G5NA 3A8BA 2VB0A 5E0HA 1AWHB 3TK6A 3VB6A 3MFJA 1ELEE 4B71A 3P6ZB 2OBOA 1TLDA 1V2OT 4K3JA 3MYWA 3UFAA 4LXBH 2XWBI 1C1PA 1ANDA 1UTQA 1EXFA 2GMTC 3LH1A 3SI3H 1C5QA 1QRZA 1CT4E 2C90B 9ESTA 3GY7A 5JBAS 1SGNE 5A0AE 3A87A 3GY2A 1W7XH 1B0EA 1AFQC 4HI3A 4U2WA 1MKWH 4U32A 1UVOA 4JK6A 4CH2B 3QWCH 4WJG2 5C2ZA 4ISHH 2VVVA 2SGQE 1BB0B 4K8YA 1SMFE 1BDAA 1MBMA 4GUXA 3SI4H 1NPMA 3V0XA 4Y7AA 1IAUA 1GL1A 1S83A 2RDLA 3NUMA 5JB8S 1CO7E 2WPMS 1J9CH 1VGCC 4TWYA 1FONA 1WCZA 2H2ZA 4JZIA 3GCNA 1AE5A 3V12A 1O2GH 1OP2A 1BTXA 2TGAA 1GCDA 3A89A 1FLEE 1ZOMA 4H6TA 4UDWH 1F5KU 2J34A 5GJ4B 1IQNA 2V6NA 4AFUA 1AKSB 2BD3A 1HV7A 4JYTA 3SV7A 3W95A 1P06A 1NO9H 3M3SA 1HIAA 4Y79A 4ZXYH 1ARBA 4ZXXH 2YNAA 2O8LA 1GPZA 2Y81A 5EXMA 2IJOB 4BTTB 1P01A 1RTKA 4CRCA 4K1TA 1SPJA 2O8MA 1GHWH 1TBZH 4GAWA 1DX5M 1GI3A 4BTIB 1PQ5A 2C93B 1AGJA 3UNRA 1GBKA 2FDAA 4NIVA 1O2YA 8KME2 5FPYA 1HAGE 1TNKA 3AAUA 2Y6TA 3GYMA 3LGYA 1FPHH 1ELTA 2BDYA 2Y7ZA 4YZUA 4AX9H 1YF4A 1C1TA 1LKBA 2BXTH 1N8OC 1FZZA 3I29A 3IG6B 5A8ZA 3S9BA 1YPJH 4X2XA 2D1JA 4I8JA 3GISB 1RFNA 3UNQA 1NM6A 5C20A 1J15A 4INHA 2QCYA 1C5XB 1W14U 2NWNA 4YT7H 3RXDA 1C2MA 1K1MA 3MH7A 3RXBA 3ZZ5A 2FESH 2Q6DA 3PTNA 1O39A 2W26A 2GMTB 3EQ0H 1C9TA 2J4IA 3E8LA 1YM0A 2FMJA 3M36A 3QZQA 1GJ6A 1Y3UA 2PKAA 1P2IA 4H42U 4AZ2B 3GYLB 4CBOA 2FEQH 1NRNH 4HFPB 2JH6D 1ANCA 1EZSC 2ASUB 3B9FH 1BRCE 1BCUH 2ZU4A 1P8VC 1VZQH 1O2MA 1Z71A 3F6UH 3RXKA 1P11E 1B0FA 1UCYK 2XW9A 3RM2H 1BT7A 4WXIA 3D65E 3SO3A 1MD8A 1T4VH 4LOYH 3UOPA 4NG9H 3A7YA 5L30H 1QB9A 1S0RA 2FOGA 3U8TH 3DUXH 1JIMA 1TBQH 1AWFH 1QCPA 1GHAF 1TALA 1YCPH 1MMJN 2RA0A 3ZV9A 2A4GA 2BM2A 1VGCB 3MNCA 2P3UB 1C2LA 5B6OA 1N6YA 5PTPA 4R8TB 5BPEA 3KGPA 2XBXA 3UQVA 2GT7A 1V2TT 1VITG 3T27A 1ZZZA 3KL6A 3Q3YA 2AGGX 1GHYH 4THNH 1IHSH 3G01A 1Z1IA 1NESE 1LVMA 1UMAH 1O2KA 1TOMH 2PGQB 3MH4A 1GJ5H 1Z6JH 2Z9LA 1F0UA 4WMEA 3SV2H 1TNJA 1ELGA 1SBWA 1D6RA 4GSOA 1HAVA 3ZZ4A 3RXQA 4O3TA 2SGDE 1O5CB 4FUIA 4O97A 2OBQA 3LOXA 1H9LB 4NZLA 1BZXE 2ZU1A 1O3PB 1P3CA 1ETSH 1DLKB 1EAIA 1MUEB 2FODA 5F03A 2ZU3A 3IWMA 2VIDA 2J92A 3L6PA 1GBHA 3CS7A 1CHGA 1ZSLA 1O2HA 2A1DB 1O2RA 1SLXB 4ZKNU 2XNIA 3BG4B 4UFEH 4J2YB 1FJSA 1V2WT 2FX4A 1P2KA 1N8OB 3A7VA 5AHGH 1TNIA 3T62A 1C2KA 1THSH 2NU0E 4I33A 3P70B 5F8ZA 4JK5A 1FDPA 3LGTA 3QLPH 4VGCB 1BMMH 2A7CA 3A83A 2BLVA 3RXMA 4DW2U 4GCHG 1IQKA 1YC0A 3F1SB 4CREA 3SU1A 3FP7E 3RXTA 1BBRE 4B2CA 4YO9A 3TU7H 4I7YH 4JYUH 4K60A 5TCAA 1SGFA 1UHBA 4UEHH 3S9AA 3VXEH 3OTJE 1E37B 4JZEH 2BDCA 4I8KA 1HAYB 2NU4E 1O2LA 1A7SA 2ZP0H 1FUJA 3BTQE 1SQTA 5C1YA 2Y7XA 5E8EH 5FXLA 1EZQA 3K9XB 2CV3A 1YCPM 3QK1A 1UTJA 2VVUA 3LGUA 5C1UA 2ZFTA 1EPTC 3MO9A 1UK4A 3SHCH 3U1IB 2A5KA 4CRAA 1LHGH 5E0GA 3S9CA 1GVZA 4NIYA 2PHBA 1TGCA 1RIWC 4Y8YA 1L0ZA 2BTCE 1YPKH 4AORA 1FNIA 1V2RT 1C9PA 4TYDA 5DK1A 1HAPH 3SU2A 1BTZA 2W3KA 5EQSA 2GZ7A 3EA8A 3QGNB 2GCHG 2H6MA 3LONA 3SW2B 1K9OE 2BVRH 4FU8A 1LVBA 1C1MA 1DWEH 3SJ9A 1SR5C 1A4WH 1GBLA 3IITA 2QXJA 2TPIZ 3M5LA 4DJZB 1YPHE 4FU7A 4YTAA 2OP9A 1DITH 1C4U2 1QQUA 4ABGA 1CVWH 1Y3XA 1A5GH 2ZECA 2BDIA 2Q6FA 1SB1H 2XC0A 1P2NA 4FUBA 2ALVA 2F9NA 1KYNA 1UTMA 3LGWA 9LPRA 4K1EA 2TIOA 2OC7A 1Z8JB 1MAYA 2SNVA 2ODYB 1HLTH 2ZDVH 4CRDA 4MLFB 4NSVA 2GDDA 2PTCE 3M5OA 4XBCA 3PMAB 2BY5X 2WPHS 3LJOA 1BBRH 1C5YB 2OCVB 2A5IA 2EEKA 1O5DH 4SGBE 5JDUB 5EQQA 2BD5A 1AY6H 3RC5A 1ANBA 3BIVH 1MZAA 1KTSB 3RUOA 1BA8B 2Y5HA 4B1TA 1G3BA 2QGRA 1E38B 3AW1A 4YOGA 1O3NA 1O0DH 4JZ1A 6GCHF 3U69H 1PPFE 2FS8A 3M5NA 3OY5U 1EOLA 1AI8H 3NKKA 1CA0C 2V3OH 2EC9H 3GCTG 1AVGH 2ANWA 1TX8A 3RLWH 4WY3A 3GY4A 1FAKH 5FAHA 5FBIA 1K1NA 3QGJA 1EKBB 4NCYA 1IQLA 3PLKA 5AF9H 1TPPA 3UWJH 4YT6H 3B23B 2EI8A 3PO1C 2A4RA 1FV9A 1NN6A 1H9HE 2BOKA 1EPTB 3ODFA 2BY8X 1NRSH 1EJAA 1YGCH 1KIGH 4Q2KA 5FX6A 7GCHG 2ZGXH 1HAOH 3RXEA 1RIWB 1CT2E 2V35A 4A5TS 4BANB 2ZPRA 4DGJA 8GCHF 3P8GA 4GHTA 2KAIA 2W7SA 1LPGB 1CBWC 1LDTT 1P04A 2ESTE 1GJDB 1MCTA 2VJ1A 3ZVEA 1MKXK 5FCRA 3PMHB 3SORA 1O3AA 1HAXB 1AZ8A 1TYNA 2BVXH 2HNTC 2XCNA 1W0ZU 2ZI2H 3U98H 3SV9A 1YP9A 3URDA 3SU5A 2P93A 1NZQH 4HZHA 4ZROA 4JYVH 4Q7YA 3ATWA 3TH2H 5L2YH 1Z8GA 2VINA 4IC6A 4O03A 1WSSH 2WV5A 3K6ZA 2VIOA 1JMOH 2ZTXA 4NWKA 3RMMH 4DG4A 1KLIH 1O37A 4KGAA 2VU8E 4ISOA 4I8LA 4BNRA 3MNBA 3S0NA 2QXGA 2BDAA 1BTYA 5JPMH 1B7XB 1L1GA 2BD2A 2ZFPH 4A1VA 3LGIA 1G36A 1GI0A 1O2IA 4E7RG 1V2UT 1JOUB 1HCGA 3UPEA 1KSNA 4X6OA 3L33A 4WF8A 4ZKOU 3NZIA 3TGJE 5E2PA 1KY9A 4TPYA 3SJOA 2K1QA 2ZTYA <