1GI2A

A novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
publication title A novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site.
pubmed doi rcsb
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2001-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gi2A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gi2A02
1F92A 2ZCLP 2VH0A 2OC8A 1GHZA 1LPGB 1Y5UT 1AI8H 1XVMA 6LPRA 1UTQA 4IN2A 2GV6A 1ZSJA 2B7DH 3NZIA 3V7TA 1LVMA 1KXDA 4O3UA 4J1YA 3DD2H 1BTWA 1A0LA 3LONA 4GVUA 4WMEA 3RXGA 1WYKA 1H9LB 3U69H 2O8LA 3FVFB 1QTFA 1OPHB 3BTFE 4I8GA 1QGFA 1XUKA 4CR5A 1Z7KA 2QV1A 5JYIA 4CHAB 4NFEA 2ODYB 3S7HB 3D62A 3MU8A 4Z0KA 3Q77A 1ZMLA 1LVOA 1HAHH 1ANBA 1GHBG 2O8TA 3S9CA 2G52A 5DJ7A 1QB6A 1K1PA 4GLYA 1K21H 3SNCA 2FI3E 4ZKOU 1C5XB 2PR3A 2BOHB 3EA9A 5C3NA 1RJXB 2BD9A 1C2MA 2VVCA 2GT7A 3V0XA 4XFQA 1MKXK 2FLBH 3MO6A 3E90B 3RXTA 4CR9A 1CU1A 3AASA 2QXIA 1E38B 1DT2A 1FAXA 1O39A 1NY22 1EB1H 3VB5A 1GBLA 5JBAS 3DT0H 1IQGA 1F2SE 1J8AA 4ISHH 1UVPA 3F9EA 1MBMA 3SU1A 4MDSA 1DITH 1DXPA 1DUAA 4D9QA 1CT2E 1IQNA 3LU9B 1O35A 1A4WH 1HXFH 5HM9A 1FY4A 1MTWA 1SOTA 1ZRKA 2TGDA 3L33A 3LPRA 5JPMH 4IGDA 1FPHH 3GCTG 4B1TA 1GG6B 3P6ZB 1SBWA 3BIVH 4X8SH 1QFKH 4TYDA 1O5EH 1P2KA 1GVLA 1MZDA 4A92A 1Y3XA 3SN8A 1TGBA 2IOTA 1SLVB 1RFNA 3GY6A 2EEKA 4BANB 4DVAU 5C5NA 1C4Y2 1P04A 1SLXB 3RXOA 1MQ6A 3P8NA 1G2MA 3EA7A 4MLFB 2VB0A 4B74A 1ZJKA 1QBOA 5J4SA 5DP3A 4M7GA 2FIRH 2J4IA 4DY7B 2HGTH 2NU4E 3W94A 2H1UA 3ELAH 1TWXB 2BDCA 1YYY1 1KTTB 1C2JA 1TONA 1DLEA 1FJSA 2G00A 4Y8ZA 2TPIZ 3LGTA 1O3JA 1VGCC 2FESH 2ZO3H 3UNRA 3ZZDA 1O5GH 1SMFE 2RA0A 3MMGA 1ELAA 1S82A 3RU4D 1GI7B 1P0SH 1B7XB 1LMWB 3SJ9A 1FQ3A 1UTKA 2V6NA 1SQOA 2EA3A 4JYTA 5A2MH 2KAIB 1HJ9A 3QK1A 1C5QA 2WINI 4SGAE 1XKBC 2Z9JA 1AU8A 4IBLH 2ODPA 4JK5A 3UREA 1EJMA 4AORA 2ZHDA 4HI3A 4BTUB 2W5EA 2ANKH 3RMLH 3JZ1B 1UVUH 1C5VA 4DCDA 5GXPA 1B5GH 1ZSKA 3BEUA 3LDXH 3SQHE 2VIPA 4YT6H 1C4V2 3VB4A 1T8NA 4XBDA 1QL9A 3FAOA 4BAHB 1DX5M 1NRQH 3P92A 4AFQA 1H9IE 5DO4H 1DY9A 2P94A 3T5FH 1SLUB 1VR1H 8ESTE 1FLEE 1GBDA 2FEQH 4FXGH 3CS0A 3SUFA 2QF3A 2THFB 1QBVH 2V3OH 1DVAH 1HIAB 2WPKS 3MU0A 3QTOH 8GCHF 2TGPZ 5GDSH 2D8WA 3ZZ3A 1A5IA 1O2ZA 3ATMA 1BA8B 2ZPQA 3OU0A 4RKOB 2FOAA 3RXMA 3Q00A 3DFJA 2R0LA 1K1NA 4FU7A 1HAZB 3TH3H 1HDTH 2PW8H 1HPGA 1KXAA 2AMQA 3M3TA 4FUEA 3RLWH 1THSH 1HIAA 1LHCH 1E34B 2GTBA 5CMXH 4D9RA 4NA9H 1O3EA 4F4OC 2BX4A 2HOBA 2VGCB 4IC6A 2AIQA 3ZVFA 1Y3WA 2ZPSA 5LPEA 3GY5A 5T6GA 2GV7A 4SGBE 2LNCA 4FU9A 1BMMH 4FUHA 1LHGH 3TLOA 1G3BA 3A8CA 4Q80A 1QBNA 3M7QA 1QB9A 1GBMA 1O2OA 5FX6A 4Y71A 2ZEBA 1OKXA 1NS3A 1TOMH 2OQUA 3U8RH 1GBIA 1PPCE 3ODFA 4K60A 1AWFH 3T2NA 4GHTA 3PO1C 4I31A 1HJ8A 1ZR0A 3SUDA 4TWWA 1A0HB 4X1NU 2XRCA 1ZPCA 1O2GH 1DICA 3P8FA 3E6PH 2STBE 1C1MA 3E0NB 1SL3A 2A7JA 2A2QH 3A80A 2HWLB 1O3OA 5E0GA 4HFPB 1LQEA 4OGXA 1JRSA 2Z9IA 3P95A 2WPMS 4JYVH 3T28A 3E1XB 2B8OH 4YM9A 1ELDE 3M7UA 1P12E 3BIUH 5LGOA 1SGDE 2UUYA 4FUDA 4KTCA 4ABGA 1QQ4A 1BZXE 2ZP0H 1V2UT 1RD3B 1AZZA 2G81E 1T8LA 5L30H 3GCHB 3JZ2B 1L2EA 1PPGE 1C2IA 1TMBH 4UFFH 5A8XA 1A5GH 4DIHH 1XVOA 4GUXA 3UWJH 1D3PB 4ZAEA 5JBBS 2C93B 1ETSH 2BDGA 3AVZA 1FAKH 2Y7XA 4INKA 1W3CA 1BRUP 1L4ZA 1GJ4H 1O2SA 2F83A 5FX5A 2BQ7B 3UOPA 1GI1A 1YKTA 1PQ5A 2BLWA 4YLQH 4Q7XA 2C3SA 1D4PB 1ELTA 4CRDA 1WU1A 1W7GH 3P8GA 3A7XA 2BYAX 3C1KA 2AH4X 3BG4C 1PPEE 1C2EA 3M7TA 4Y7AA 2F9NA 2QY0B 4YTAA 4A1VA 1KDQB 1GL1A 1KXBA 3SBKA 1V2VT 1O3KA 2P93A 2G55A 1EX3A 4BAQB 1GBAA 3PV4A 5C20A 5AVDA 4B2AA 1SHHB 1GGDC 1EZSC 4YESB 4A1TA 2C90B 2FOCA 5DG6A 1T32A 2A5IA 2BDYA 1O5AB 4IMZA 2ZIQH 3PMBB 1FY5A 1O2LA 2QC2A 4JZDH 3SU0A 4Y8XA 1GDQA 1B0FA 2Z9KA 2YNAA 1C1PA 4GPGA 3OYPA 3T62A 1EKBB 1OWIA 2PSYA 2NU1E 2UUKB 1GHBF 1THRH 1NU9A 3EAJA 4B2BA 1RTKA 1TGTA 1YGCH 1T4UH 2Q1JA 4FU8A 5E2PA 2ZFFH 1BDAA 4NIWA 3BG4B 3R0FA 3KIDU 1YPGH 1G3EA 1TMTH 1FXYA 1SGRE 2H6MA 2SNVA 2BLOA 1SGCA 2BLQA 4Q7ZA 4X2YA 1ETRH 3M61U 4I8JA 1ELBA 4NA8A 1BJVA 1GMCF 2AGEX 2UWOA 3A7VA 2P3TB 1MAXA 3SI3H 1D6RA 2WUCA 4VGCC 3BTHE 1C9PA 1SI5H 1RIWC 1UTPA 1UVSH 8GCHG 4U01A 1TX8A 1GI9B 2GGVB 4HGCA 4JZEH 6ESTA 3LGUA 1LDTT 3RMNH 5CE1A 2FXRA 3MO9A 1D3QB 1UTJA 1YCPH 3MO3A 3QX5H 3TU7H 5J4QA 2XWBI 1N6XA 2XC0A 4FVBA 3QN7A 1NFYA 2ZQ2A 5DGJA 1S83A 4K69A 4NIVA 3U8TH 2DE8A 5DKMA 3BEFB 1YPEH 4DOQA 5GWZA 2GX4A 1GPZA 4JCNA 1VJAU 8LPRA 2Q6DA 4BTTB 1J14A 2BY8X 1GDUA 4JZFH 1AVWA 1T8OA 3GYMA 4DURA 1ZTJA 4FVDA 1O2JA 3VXEH 3ZZ9A 1XUIA 1YPHE 1EZUC 1HLTH 1GVKB 1OWHA 3BTGE 3MNCA 2G5NA 3BTME 1EUFA 5F6MA 2XC4A 1G37A 1HJAC 1TPOA 4AB9A 2PKSB 1IHTH 1ETTH 1P2MA 1ELGA 1SLWB 2I6QA 1LKBA 1HAGE 4NWLA 2EC9H 3NXPA 3ODDA 4BXWA 1XUGA 1S0QA 3RP2A 2BD3A 2ZU5A 1IHSH 2OC7A 1GI4A 1P2JA 2JH6D 4ISOA 2W7UA 1ELVA 2XYAA 2SGQE 3D23A 4CRGA 1N8OC 5AHGH 3LH1A 3K2UA 1BTUA 2GD4B 1J15A 1GBFA 4X2VA 1KIGH 1C5TA 1ZGIA 2PHBA 1FY1A 1GJ6A 1P2OA 5TCAA 1VITG 1UVTH 2Y5GA 3RXDA 1HAIH 1GDNA 1JBUH 1QURH 4JYUH 4Y0ZE 1AB9C 3LGVA 2FODA 5L2YH 3VB3A 3PROA 6CHAB 1CVWH 3EA8A 4AB8A 1NROH 4MG3A 2HALA 3KCGH 1NRSH 3BEIB 9LPRA 4ABBA 3VXFH 3A83A 3LC5A 1G36A 4CRBA 4JZ1A 1H1BA 1WV7H 2FS8A 2ANMH 3E0PB 3GY2A 1KTSB 4ISIH 4Y0YE 5F03A 2BD5A 1BRBE 2GVFA 2H9EH 2PUQH 2G4UA 2PGQB 1QHRB 1V6DA 3TITA 5GJ4B 2QXGA 1Z8JB 3O8RA 1TB6H 3RXEA 1FY3A 5JB8S 1W13U 1O2XA 2ANWA 5AFZH 2Y81A 3ZVBA 4LXBH 1ABIH 4DT7B 1Y3UA 2BX3A 1AFQC 1C5NH 1N8OB 2C8XB 1DLKB 2A31A 3SGAE 1HAPH 1BTPA 1GHXH 1NN6A 3HKIB 5BRRE 1BHXB 1BRCE 1GMHG 4A7IB 1UCYH 1NFWA 3UWIA 5FPYA 2BQWB 1N1LA 3P8OA 2ANYA 1O37A 2GDEH 3EDXB 1AFEH 1DXWA 1SB1H 2OLGA 1AB9B 2YNBA 3LJOA 4R0IA 4AOQA 2Y80A 1Z71A 5C1UA 1EB2A 1O3IA 1GI0A 2Y5HA 1IQJA 2VVUA 1ARCA 1QRZA 3NCLA 3VPKA 1CE5A 1CHOF 2GMTC 1YPJH 1GBHA 2GCTC 2CV3A 2EI8A 1KSNA 3OY5U 1TNHA 5TJXA 5A8ZA 3DHKH 3GY4A 1UTMA 1TIOA 4JMYA 1PPBH 2AEIH 1T7CA 2ZHWH 3DFLA 6GCHF 1WBGB 1O2RA 5LPRA 5L2ZH 1MH0A 1PQAA 4OS1A 3UOUA 1OWJA 2BVSH 3A87A 3QO6A 1XKAC 5E8EH 2ZHQH 3UNSA 1WCZA 2ALVA 2W3IA 1EAIA 3RM0H 1ZRBA 5AFYH 2Q6FA 3S69A 1RTLA 1BB0B 2XNIA 4INHA 4UEHH 4Y6DA 4BOHA 4Z6AH 1KXCA 1SGYE 3FZZA 1GMCG 5FAHA 1PPHE 1E36B 1ORFA 1ELFA 1FI8A 2WPLS 2WYJA 3ZV8A 3BN9A 1WQSA 4BXSA 4X1SU 3A7TA 1A0JA 1QB1A 1V2OT 4NWKA 1C1NA 3EYDA 3LGYA 3ATLA 2AIPA 5HGGA 4A6LA 2ZCHP 2PLXA 5ESTE 1QA7A 3U8OH 1OX1A 1UTNA 3C27B 1RGQA 2GZ9A 4XBBA 3A86A 3F1SB 1S84A 2NU3E 1DDJA 2BY7X 1UCYK 1RS0A 3M5LA 1FPCH 1Y59T 1JIRA 2G4TA 1NFUA 2FI4E 2HPQH 3SNBA 2ZHFH 1IOEA 3KQEA 3S7KB 1BIOA 4RKJB 1W2KH 2J38A 1P09A 1KXFA 2CN0H 2UUJB 3QZRA 1DPOA 4GHQA 1BBRH 3KN2A 4ZHLU 2ESTE 2OC0A 1C2GA 1W12U 3HPTB 1TE0A 1GI6A 1J9CH 4CREA 4H6TA 2H9TH 2ALPA 1TPPA 2OQ5A 1EASA 4XE4A 3HK6B 3QLPH 1OWEA 1JIMA 3M5NA 2VINA 3TIUA 4YOGA 5GCHG 1EAUA 2ZKSA 1EP5A 2SFAA 1KXEA 1W14U 2QA9E 1C1RA 2G51A 1AN1E 1H8DH 1SGNE 2RA3A 1L1JA 2BY6X 2ODQA 1C5RA 5F8ZA 3SU5A 3NWUA 4KTUA 1O2UA 2V0BA 3GISB 2A4OA 1V2LT 3U98H 1AIXH 1THPB 5FHTA 1FV9A 2Z6BD 1AGJA 1C5SA 3NK8A 3URCA 1KLJH 4WH8A 3VEQB 2H9HA 2SGFE 4UFEH 4YOJA 1EP6A 1YPHC 2VWOA 3SV6A 4OS2A 1TPSA 2BVRH 4MPXA 1O2NA 3STJA 4I8HA 1MU8B 3MWIU 1GHYH 5CHAC 2DE9A 4MPVA 1D3DB 1K1LA 2FX4A 3BTKE 3RMMH 1O5FH 1EPTC 1HRTH 2CJIA 3VFEA 4J2YB 1SG8B 2P95A 2GDDA 3SJ8A 4O03A 1VGCB 1F7ZA 1QRXA 5H4IB 2FX6A 3DA9B 1CHGA 1WTHD 4K5ZA 1GHVH 4U32A 4D76A 2XWAA 1P02A 2VNTA 3SNAA 2VU8E 3QZQA 5HM2A 1ZPBA 2WUBA 4K3JA 1PQ8A 3GY7A 1HUTH 4IS5A 2GZ7A 1N6YA 1NESE 1W11U 1CO7E 2Y82A 3ATIA 1AHTH 1BBRK 2CF8H 3FP8E 3ZVEA 1F0TA 3NKKA 4TPYA 5G4BA 5E0HA 2QN5T 3RMOH 1INCA 2B0FA 2PTNA 2BDHA 1O34A 1O2PA 1CBWC 1UK2A 5DP4A 3S9BA 4U2WA 1VJ9U 1CGHA 2WV4A 4X6MA 2IN2A 1O2HA 2JH0D 2ZF0H 2Q6GA 4ZXXH 2VIDA 4MNWA 4Y7BA 2RDLA 3IITA 1H8IH 3PTBA 3PMJA 3ZVAA 3A85A 7KMEH 1O32A 3SORA 3KHVA 2FMJA 1TQ0B 3T25A 1AVGH 1DY8A 1MU6B 1PQ7A 3U1JB 3TH4H 1TBRH 1TABE 3GY3A 5SGAE 3TH2H 1ANCA 1Q3XA 5GPIB 3FZDA 2ZU1A 3H7OA 2CHAC 3RXUA 2ZGHA 3LGWA 1SQTA 1VCWA 2A4GA 4K8BA 2PKAB 4OS6A 1F0UA 5I25A 2OXSA 1CHOG 2PUXB 1O3GA 1C2FA 1ESTA 2ZFSA 3M5MA 1NC6A 3RC5A 1YLCA 1ZHMA 4FUFA 3TK5A 4WXIA 1CT0E 2QXJA 3URDA 2BXTH 3ZZAA 6GCHG 1C1WH 3MNSA 2PKAA 4LZ4B 1O3LA 2SGAA 1MTUA 3BTWE 1C4U2 2H5DA 2FOHA 1W7XH 1VITF 2OC1A 1C2KA 5FCKA 1ZMNA 3OY6U 1SPJA 2R3UA 3GCNA 1C2LA 3MU5A 2I6SA 3SHCH 2PV9B 4K1TA 4WWYA 2ZFQH 5EW2H 4CRFA 3SW2B 1IQLA 1P03A 3MFJA 1SGQE 1K2I1 2BZAA 3FP6E 3PTNA 2VVVA 5JBTA 1ESBA 2DUCA 4ABAA 2J95A 3PO1B 5K7RA 3P17H 2ZPRA 3LKWA 1SFQB 5PTPA 3FFGA 1C5YB 3PMAB 5HYOA 4NZQA 4XSKU 4X0WU 3F68H 3B9FH 3BTTE 7LPRA 2F9UA 1VZQH 3BTDE 2FM2A 3E16B 1BMLA 2ZHEH 2K1QA 4BAMB 1GJ8B 3K9XB 2P8OC 4ZROA 1ZZZA 2GP9B 2ULLA 1GBEA 4TPIZ 4X2WA 4NIYA 2PWXA 1GMHF 1TA6A 2BB4A 2NU2E 2ZDNA 1BOQA 2ZTXA 4MTBA 5EQSA 5A0AE 1K22H 4Y76A 2F3CE 2FDAA 1CA8B 4BNRA 1A1RA 3Q3KA 4K1SA 3ZZBA 1S85A 3TGJE 3UUZA 4IN1A 1CT4E 4B76A 3MI4A 1ELCA 4UDWH 4UE7H 3RXRA 3MU1A 1YP9A 5I46H 1AO5A 1L4DA 1XXFA 3RXLA 3GYLB 1V2WT 4BAKB 2XC5A 2FOBA 4ISLA 4E7NA 3E8LA 4WJG2 1KLIH 2BTCE 1O2TA 4I33A 1WQVH 3SJIA 4AFUA 3V12A 1DWCH 2J92A 2ZFPH 5ESBA 2CF9H 4ASHA 1MD8A 1UK3A 1C1UH 1Z1JA 5EXLA 1Y5AT 2VIWA 2ZCKP 1W8BH 1GJBB 1GWAA 5FXLA 3AAVA 2P8OB 3F9FA 4ZHMU 2VIVA 4X1RU 2Y5FA 4WH6A 1MZAA 3KF2A 4RSPA 1OP8A 5B6OA 1MAYA 1Q31A 2AYWA 3T26A 2UWLA 1P3CA 3TVJB 2Z9GA 3KQCA 1TMUH 3LIWA 1GGDB 3PWBA 1C5UA 2ZDKA 4I8LA 3SU3A 2A7CA 5EPNA 2WPJS 3RXJA 1ZOMA 2Z3CA 2P59A 1FN8A 1TGNA 2ZDMA 1BTHH 1F5LA 1RRKA 1T4VH 1YM0A 2WV5A 4Q7YA 5L6NH 1C1VH 2XBXA 2R2MB 1NRNH 3A7YA 2ZGCA 1OXGA 5T3HA 1KYNA 1OWKA 1XXDA 1CSOE 4AYVB 2VWLA 2F9VA 1C5ZB 3HATH 3F9GA 4A5TS 2XBYA 5IDKA 1LHDH 1TPAE 2FZZA 3VB7A 5EXMA 1LVBA 1AZ8A 2HNTE 1V2NT 1D6WA 1XUHA 1LKAA 1P2NA 3DUXH 2A7HA 2O9QA 2CMYA 3TK6A 1P06A 2C8YB 4DG4A 1GCDA 2RCEA 1G9IE 3ZZCA 1BTYA 1ZLRA 2OD3B 1P05A 1FNIA 2C4FH 4O3TA 1Y8TA 1GJ5H 1MCVA 3O8DA 3K6ZA 1UO6A 1PYTC 3ZZ8A 2ZFRH 2XW9A 3UTUH 4ZMAH 2W3KA 1DM4B 1FONA 4WY3A 4U30A 1FIWA 2BY5X 1P3EA 1O2QA 1TGCA 4CH8B 1C5OH 1XUFA 1AWHB 4VGCB 2SGEE 5GCHF 1O3AA 3ZZ5A 2XBVA 4INLA 3AAUA 1O36A 1RIWB 3E3TA 1P8VC 1GI8B 1QNJA 1OOKB 2FLRH 1CA0C 5C1YA 3TJVA 1MTNC 2ZC9H 1Z8IB 1SHYA 3R3GB 2HRVA 5F8XA 2VH6A 1GL0E 5F8TA 3A8DA 2VWMA 4AX9H 2FPZA 3O8BA 1MKWK 1EZXC 1P10A 4MNYA 1S0RA 1TNGA 2HVXA 3HGNA 4NGAH 3ZV9A 2VIQA 4AFZA 1FUJA 4HZHA 4NA7A 1F5RA 4NIXA 3SZNA 3TNSA 3CP7A 1O31A 2W7SA 1QJ1B 1NTPA 3MH7A 1FN6A 4D7FA 3RU4T 2GT8A 4KELA 3L3TA 3SJOA 1C5PA 3ATKA 3SJKA 1SQAA 1IAUA 1V2TT 4DIIH 3KNXA 3S0NA 1ZSLA 1Z8GA 5E0JA 3UNQA 4NFFA 2JETC 2WYGA 2ZFTA 3PM3A 1Y3YA 4ZXYH 4WVPE 1BMNH 4K8YA 3K65B 1K1IA 3RXPA 2ZU3A 1NO9H 2BLVA 3RXFA 1HJAB 3OTJE 3M37A 2PTCE 1HAOH 2C8ZB 1GCTC 3SU2A 2BMGB 1YBWA 4CRCA 1O2WA 2FOGA 1MTSA 1BUIA 4ZH8A 3UPEA 3TGKE 1LHEH 3OSYA 1S6HA 2FO9A 1QQUA 1EQ9A 2UWPA 1O3NA 4IMQA 2AGGX 2R0KA 4GSOA 4TY6A 4CHAC 2A5AA 4KKDA 1O2VA 2ILNA 4MNVA 1VCQA 1O2KA 1LO6A 1JMOH 1UTOA 1DUEA 3LT3A 1C5WB 1QL7A 4XDEA 1QA0A 2ZGBH 3QGNB 1GBBA 5DK1A 5HMAA 1BCUH 4I8KA 2H5CA 1MBQA 2LPRA 1LPZB 1Z6JH 2G8TA 4KP0A 2V3HH 1UHBB 3PYHA 1GHWH 1BITA 5FCRA 4AG1A 4A1XA 5EOKA 4AN7A 2BQ6B 1A5HA 1IQIA 4KGAA 4BTIB 1NZQH 3UY9A 1E0FD 3VB6A 5EODA 1YPKH 2F9BH 2ZWLH 2EI6A 1GCTB 1O0DH 1UHBA 4R8TB 2TBSA 5A0CA 1TRMA 3ZZ4A 1LQDB 5LPFA 1ZHRA 2P16A 1BMAA 3M35A 1OWDA 4B71A 3ESTA 2QCYA 1LTOA 1O30A 2AERH 2XCNA 2F9OA 3RU4E 1PPFE 3KQDA 5EQQA 2IPHA 4TY7A 1TX6A 1GMDF 3ZVGA 1GG6C 1FDPA 3UQOA 1AFQB 3I29A 1TOCB 1BQYA 1O3FA 2ZU4A 4X2XA 1TGSZ 2CXVA 1ABJH 1GI5A 1GHAF 2CGAA 4NCYA 2A45B 1D9IA 1LCYA 1TNJA 3E91A 4X8UH 3ZZ7A 3SGQE 1UCYE 3I78A 2O8UA 1C9TA 1O3BA 2NWNA 4TWYA 2TGTA 4X8VH 4NG9H 4H6SB 2BY9X 2BVXH 3T27A 3CS7A 1E35B 4AFSA 1UMAH 3SNDA 4JK6A 1IQFA 2EI7A 3FANA 3MTYA 3AW1A 3BG8A 2ZGJA 3ZZ6A 5JDUB 1BTZA 1MTVA 2R3YA 1OYTH 5C2ZA 1Z1IA 2GMTB 2GCTB 1AQ7A 4YLUA 1GJ7B 4THNH 1AE5A 1UK4A 3H7TA 1W0YH 1TX7A 5T6DA 2M5TA 5EGMA 4QT8C 1SGFG 3M36A 1TFXA 3N7OA 4ABHA 2GKVE 1IQEA 4UONA 1UJ1A 1WAYB 1SGIB 4X1QU 1HCGA 3SNEA 1K1MA 4AG2A 1F0SA 2O8WA 3GY8A 3CENA 1P2IA 2P3UB 3PLBA 4UFDH 4K1EA 2ZA5A 5JB9S 1T8MA 2ZZUH 1O3HA 1CGJE 1VCPA 3U9AH 1WTGH 2ZGXH 2HPPH 2ZTZA 1O5BB 1ZPZA 1TNIA 5C67A 4X8TH 4XOJA 2HNTC 3TJOA 2J94A 2OBQA 2IJOB 1GJDB 4Y8YA 1K9OE 1AUJA 1MUEB 3WY8A 1D3TB 5K0HA 2WPIS 2Y6TA 2BD2A 1P01A 1NPMA 4IC5A 3B8JA 3SV9A 1OS8A 2SNWA 2HNTF 3Q76A 1AMHA 4MPWA 1G2LA 3MYWA 1J17T 2ZNKH 2QAAA 3BTEE 1SVPA 4O9VA 2GCHF 1GJCB 1CQQA 1IQHA 1TBZH 5A09A 5DPAA 1JRTA 4CRAA 1A61H 3F9HA 1AVXA 4X1PU 1V2MT 2VGCC 4E7RG 4GAWA 3RXKA 4AGKA 2A0QB 1ELEE 1A7SA 3MOCA 1RXPA 4UFGH 5DP5A 1XUJA 2KAIA 2STAE 1BBRE 1ZYOA 1NRPH 4OS7A 3RXIA 1C1OA 2XXLA 4FUIA 3FP7E 2G5VA 1P11E 3SV2H 1QY6A 1V2PT 1QJ7B 3MNXA 1U6QA 5A8YA 4YT7H 5EXNA 4AGJA 4WXVA 4K2YA 1FY8E 5EW1H 2VIOA 3SHAH 7GCHG 1UVOA 1GJ9B 4IW4E 2ZTYA 2ASUB 1ARBA 4AZ2B 1S6FA 1TNLA 1DWBH 1ANEA 4X6NA 2BDIA 2H2ZA 4FUCA 1PFXC 2FI5E 2ZDAH 3RXVA 3A82A 2OP9A 4ABJA 1H9HE 1OP0A 4OGYA 2OINA 2ZDVH 1UTLM 1C2HA 1GVZA 1KLTA 2NU0E 3RXAA 1MMJN 3Q3YA 4OS4A 4DJZB 3RXCA 1C1TA 5TCCA 4LOYH 5CHAB 1ZHPA 1YCPM 2AMDA 3EQ0H 2QF0A 1ID5H 1HGTH 5AF9H 2OUAA 3L6PA 1EPTB 2F91A 2VJ1A 2ZG0H 4D7GA 2BD4A 2O8MA 5E2OA 3GCHC 2YOLA 5GIBA 1AD8H 2Z94A 3HKJB 1GBKA 5ABWA 3A89A 3ZVCA 1DANH 1NFXA 1F0RA 2R2WU 3QDZB 3TK9A 1F5KU 1YF4A 1SSXA 4WF8A 1EPTA 2D2DA 1IQMA 1PPZA 2TRMA 3RXBA 3GDVA 3SV7A 3UR9A 1FZZA 2FTMA 1ZTLA 2Y7ZA 1MQ5A 4ABEA 1ESAA 3TJNA 3TJUA 2BD8A 2AFQB 1GMDG 3U1IB 4RN6A 1KY9A 4OS5A 2D26C 1CBWB 3M3SA 3RC4A 4JZIA 5JBCS 5FPTA 2ZQ1A 1GHAG 5EU8A 1V2ST 1J16A 1TALA 3LOXA 4F49A 1A46H 4D8NA 1C5MD 3MU4A 1PYTD 1C2DA 1TNKA 1JWTA 2QIQA 3GOVB 3MNBA 1O33A 3RXSA 1GI2A 1BRAA 4MQAA 3RC6A 4I7YH 3LGIA 3A7WA 1W0ZU 2BZ6H 3D49H 4E05H 4NZLA 1DSUA 2A4QA 4ESTE 2CHAB 1HBTH 1YLDA 3AW0A 4ABDA 1ZTKA 4ABIA 2PGBB 1M9UA 1V2RT 2C8WB 2A1DB 4CBOA 5DP6A 4B73A 1HAXB 2J34A 1OYQA 1ZMJA 2TIOA 2QGRA 3HK3B 1AY6H 3SOSA 3SO3A 1AUTC 1B0EA 1GI3A 1EXFA 1BTXA 2SGPE 2J9NA 3PLPA 1TBQH 2OTVA 2F9PA 3A8AA 1AE8H 3KL6A 1Y5BT 1HNEE 1GBCA 4GCHF 3KGPA 3MH5A 2WPHS 1C5LH 4LZ1H 4FUBA 3MHWU 9ESTA 4XBCA 4CBNA 3TPIZ 1TAWA 2V35A 3LC3A 4Y79A 7ESTE 3A81A 1O2YA 2ZDLA 3OX7U 3STIA 3A8BA 1C1QA 4ZUHA 3G01A 2OCVB 3RXHA 1TQ7B 1KDQA 3SGBE 2SGDE 1ZGVA 1GBTA 4Q2KA 4YZUA 5A0BA 3PB1E 4YOIA 1NT1A 2AS9A 1EJAA 1W10U 1BT7A 2FS9A 3D65E 3SV8A 3UFAA 1TYNA 8KME2 2Z9LA 3PMHB 1LHFH 1O3DA 5FBIA 1K1OA 2GCHG 2TGAA 2RG3A 3ENSB 1G30B 2J2UA 4I32A 3ATWA 3BSQA 4B75A 1L1GA 1YC0A 3SUEA 1EAXA 3Q3XA 1MKWH 3SI4H 4NSVA 1XX9A 3VGCC 2AGIX 4LK4A 3TNTA 1NU7B 1AKSB 3BF6H 1SC8U 3F6UH 1YPMH 5C1XA 4YO9A 5EQRA 1QCPA 1A3BH 5C5OA 2QXHA 1NM6A 2JKHA 1BJUA 1T31A 1QJ6B 3QUMP 5IYTA 1SGTA 1TLDA 1DFPA 1WUNH 1A2CH 2FOFA 4DW2U 2A32A 1AKSA 4KTSA 3PLKA 1QIXB 2BDBA 2PKSC 1O3PB 3LJJA 2GZ8A 3RM2H 1SOZA 1HYLA 3GDSA 1Z8RA 1RTFB 4O97A 1P2QA 1HV7A 1A3EH 1TRYA 4H42U 4ZKSU 2Z3DA 1G3DA 1XMNB 3SU6A 4NSYA 4AYYB 1S5SA 1TRNA 1V2JT 2BHGA 2PSXA 3GDUA 2BM2A 2XCFA 5FPSA 1EZQA 4BAOB 1G3CA 5ETXA 3GCTF 3P70B 1P9SA 2A2XH 2D1JA 4E06H 2BD7A 1GBJA 5BPEA 1GJAB 3IG6B 1PJPA 4WMDA 1YPLH 2AMPA 1OP2A 1HB0B 1EJNA 4FUGA 4ZKNU 2A4RA 1DSTA 1EOJA 2Z3EA 1WSSH 3M3VA 2R9PA 2FOEA 1JOUB 1OSSA 1Y3VA 3VGCB 4MVNA 3T29A 4Y11E 1WOFA 3BV9B 3GCOA 3H5CB 2UUFB 5EPYA 1O3MA 3ITIA 3A7ZA 1IQKA 2FP7B 1HAYB 3PWCA 2FYQA 1E37B 2P3FH 6CHAC 1Q2WA 2FOMB 4Y10E 2FWWA 1C1SA 1O5DH 5LH8A 3KQBA 1O2IA 2VWNA 4PROA 1JXPA 1P57B 5DP7A 3W95A 2B9LA 1SGFA 2XBWA 3QGJA 1H4WA 1LVYA 1XM1A 4H4FA 3ZYDA 1DWEH 4MPUA 2W26A 3B23B 1V2KT 1L1NA 3O8CA 3RUOA 3MH6A 3NPSA 1K1JA 2FYRA 1SFIA 4WMFA 4X6OA 2HLCA 1CGIE 1FMGA 1K28D 4UD9H 3A84A 5EG4A 3MH4A 1VITH 3UQVA 1SGPE 1EAWA 4DGJA 4HTCH 3BTQE 1G32B 3GICB 2ZU2A 3EE0B 3SU4A 3SQEE 2FTLE 3A88A 3M5OA 1Z6EA 4MNXA 1L0ZA 3RLYH 4FUJA 1O2MA 3K6YA 5DP9A 7GCHF 3QWCH 3HGPA 1HXEH 2BDAA 1ACBE 3I77A 1LPKB 1YCPK 2JH5D 4ABFA 2B5TB 4ZHAA 3ZVDA 3EGKH 1CA0B 2BXUH 1BHXF 2ZI2H 1MTNB 1DS2E 4B2CA 1QL8A 1NRRH 4ISNA 2Z7FE 2OBOA 1DWDH 1SGEE 1MKXH 2A5KA 3RXQA 3IWMA 3ZYEA 1ZJDA 1O3CA 3QTVH 1EATA 2XTTB 3UR6A 3V13A 1P9UA 1S81A 4X6PA 1DE7H 3RDZA 2PFEA 1EOLA 3LH3A 5DP8A 1QRWA 5T6FA 5FBEA 1SR5C 1HFDA 1MD7A 3NUMA 1HAVB 1FIZA 1TA2A 3UIRA 3TGIE 3SUGA 5HXFA 1O5CB 1QR3E 2BOKA 2ZECA 1O38A 1MCTA 1V3XA 2QYIA 1X7AC 4ZKRU 4CH2B 4GCHG 1ANDA 1DOJA 1HAVA 2JETB 3V3MA 3KEEA 3S9AA 1V2QT
chains in the Genus database with same CATH superfamily
1F92A 2ZCLP 2VH0A 2OC8A 1GHZA 1LPGB 1Y5UT 1KMHB 1AI8H 1XVMA 6LPRA 1UTQA 4IN2A 2GV6A 1ZSJA 2B7DH 3NZIA 3V7TA 1LVMA 1KXDA 1SQRA 4O3UA 4J1YA 3DD2H 1BTWA 1A0LA 3LONA 4GVUA 4WMEA 5CHBA 3RXGA 1WYKA 1H9LB 3U69H 2O8LA 3FVFB 1QTFA 1OPHB 3BTFE 4I8GA 1QGFA 1XUKA 4CR5A 1Z7KA 2QV1A 4P00A 5JYIA 3W1EA 4CHAB 4NFEA 2ODYB 3S7HB 3D62A 3MU8A 4Z0KA 3Q77A 1ZMLA 1LVOA 1HAHH 1ANBA 1GHBG 2O8TA 3S9CA 2G52A 5DJ7A 1QB6A 1K1PA 4GLYA 1K21H 3SNCA 2FI3E 3GS9A 4ZKOU 1C5XB 2PR3A 2BOHB 3EA9A 4FETA 5C3NA 1RJXB 2BD9A 1C2MA 2VVCA 2GT7A 3OEED 3V0XA 4XFQA 1MKXK 2FLBH 3MO6A 3E90B 3RXTA 4CR9A 1CU1A 2QF5A 3AASA 2QXIA 1E38B 1DT2A 1FAXA 1O39A 1NY22 1EB1H 3VB5A 1GBLA 5JBAS 3DT0H 5FL7D 1IQGA 1F2SE 1J8AA 4ISHH 1UVPA 3F9EA 1MBMA 3SU1A 4MDSA 1DITH 1DXPA 1DUAA 1OHHD 4D9QA 1CT2E 1IQNA 3LU9B 1O35A 3MQKC 1A4WH 1HXFH 5HM9A 1FY4A 5C94A 2HLDD 1MTWA 1SOTA 1ZRKA 2TGDA 3L33A 3LPRA 5JPMH 4IGDA 1FPHH 4XRNA 3GCTG 4B1TA 1GG6B 3P6ZB 1SBWA 3BIVH 4X8SH 2KM0A 1QFKH 4TYDA 1O5EH 1P2KA 1GVLA 1MZDA 4A92A 1Y3XA 3SN8A 1TGBA 2IOTA 1SLVB 1RFNA 3GY6A 2EEKA 4BANB 4DVAU 5C5NA 1C4Y2 1P04A 1SLXB 3RXOA 3WWFA 1MQ6A 1YY3A 3P8NA 1G2MA 3EA7A 4MLFB 2VB0A 4B74A 1ZJKA 1QBOA 3F2FA 5J4SA 5DP3A 4M7GA 2FIRH 2J4IA 4DY7B 2HGTH 2NU4E 1WXRA 3W94A 2H1UA 3ELAH 1TWXB 2BDCA 1YYY1 1KTTB 1C2JA 1TONA 1DLEA 1FJSA 2G00A 4Y8ZA 2TPIZ 3LGTA 1O3JA 1VGCC 2FESH 2ZO3H 5HKKD 3UNRA 3ZZDA 1O5GH 1SMFE 2RA0A 3MMGA 1ELAA 1S82A 3RU4D 1GI7B 1P0SH 1B7XB 1LMWB 3SJ9A 1FQ3A 1UTKA 2V6NA 4RT1A 1SQOA 2EA3A 4JYTA 4P02A 5A2MH 2KAIB 1HJ9A 3QK1A 1C5QA 2WINI 4SGAE 1XKBC 2Z9JA 1AU8A 4IBLH 2ODPA 1K0HA 4JK5A 1FX0B 3UREA 1EJMA 4AORA 1QZ8A 2WV9A 2ZHDA 4HI3A 4BTUB 2W5EA 2ANKH 3RMLH 3JZ1B 1UVUH 1C5VA 4DCDA 5GXPA 1B5GH 1ZSKA 3BEUA 3LDXH 3SQHE 4DT4A 2VIPA 4YT6H 1C4V2 3VB4A 1T8NA 4XBDA 1QL9A 2F4LA 3FAOA 4TT3D 4BAHB 1DX5M 1NRQH 3P92A 4AFQA 1H9IE 5DO4H 1DY9A 2P94A 3T5FH 1SLUB 1VR1H 8ESTE 1FLEE 1GBDA 2FEQH 4FXGH 3CS0A 3SUFA 3SZEA 2QF3A 2THFB 1QBVH 2V3OH 1DVAH 1HIAB 2WPKS 1VKYA 3MU0A 3QTOH 8GCHF 2TGPZ 5GDSH 2D8WA 3ZZ3A 1A5IA 1O2ZA 3ATMA 1BA8B 2ZPQA 3OU0A 4RKOB 2FOAA 3RXMA 3Q00A 3DFJA 5KECA 2R0LA 1K1NA 4FU7A 1HAZB 3TH3H 1HDTH 2PW8H 1HPGA 1KXAA 2AMQA 3M3TA 4FUEA 3RLWH 1THSH 1HIAA 1LHCH 1E34B 2GTBA 5CMXH 4D9RA 4NA9H 1E79D 1O3EA 4F4OC 2JDID 2BX4A 2HOBA 2VGCB 4IC6A 2AIQA 3ZVFA 1Y3WA 4ZCNA 2ZPSA 5LPEA 3GY5A 5T6GA 2GV7A 4SGBE 2LNCA 4FU9A 1BMMH 4FUHA 1LHGH 2J98B 3TLOA 1G3BA 3A8CA 4Q80A 1QBNA 3M7QA 1QB9A 1GBMA 1O2OA 5FX6A 4Y71A 5B6LA 2ZEBA 1OKXA 1NS3A 2J98A 1TOMH 2OQUA 3U8RH 1GBIA 1PPCE 3ODFA 4K60A 1AWFH 3T2NA 4GHTA 3PO1C 3F3BA 4I31A 1HJ8A 1ZR0A 3SUDA 2WZQA 4TWWA 1A0HB 4X1NU 2XRCA 1ZPCA 1O2GH 1DICA 3P8FA 3E6PH 2STBE 1C1MA 3E0NB 1SL3A 2A7JA 2A2QH 3A80A 4F55A 2KZ4A 2HWLB 1O3OA 5E0GA 3PV2A 4HFPB 1LQEA 4OGXA 1JRSA 2Z9IA 3P95A 2WPMS 4JYVH 3T28A 3E1XB 2B8OH 4YM9A 1ELDE 3M7UA 1P12E 3BIUH 5LGOA 1SGDE 2UUYA 4FUDA 4KTCA 2WPDD 1QQ4A 1BZXE 4ABGA 2ZP0H 1V2UT 1RD3B 1AZZA 2G81E 1T8LA 5L30H 3GCHB 3JZ2B 1L2EA 1PPGE 1C2IA 1TMBH 4UFFH 5A8XA 1A5GH 4DIHH 1XVOA 2J5UA 4GUXA 3UWJH 1D3PB 4ZAEA 5JBBS 2C93B 1ETSH 2BDGA 3AVZA 1FAKH 2Y7XA 4INKA 1W3CA 1BRUP 1L4ZA 1GJ4H 3U28C 1O2SA 2F83A 5FX5A 2BQ7B 3UOPA 1GI1A 1YKTA 1PQ5A 2BLWA 4YLQH 4Q7XA 2C3SA 1D4PB 1ELTA 4CRDA 1WU1A 1W7GH 3P8GA 3A7XA 2BYAX 3C1KA 2AH4X 3BG4C 1PPEE 1C2EA 3M7TA 4Y7AA 2F9NA 2QY0B 4YTAA 4A1VA 5IK2D 1KDQB 1GL1A 1KXBA 3SBKA 1V2VT 1O3KA 2P93A 2G55A 1EX3A 4BAQB 1GBAA 3PV4A 5C20A 5AVDA 2YMSC 4B2AA 1SHHB 4OM9A 1GGDC 1EZSC 4YESB 4A1TA 2C90B 2FOCA 5DG6A 1T32A 2A5IA 2KFWA 2BDYA 3DCLA 1O5AB 4IMZA 2ZIQH 3PMBB 1FY5A 1O2LA 2QC2A 4JZDH 3SU0A 1WDIA 4Y8XA 1GDQA 1B0FA 2Z9KA 2YNAA 1C1PA 2XOKD 4GPGA 3OYPA 3F0OA 3T62A 4Z1MD 1EKBB 1OWIA 2PSYA 2NU1E 2UUKB 1GHBF 1THRH 1NU9A 3EAJA 4B2BA 3NRLA 1RTKA 1TGTA 1YGCH 1T4UH 2Q1JA 4FU8A 2LP6A 5E2PA 2ZFFH 1BDAA 4NIWA 3BG4B 3R0FA 3KIDU 1YPGH 1G3EA 1TMTH 1FXYA 1W0JD 1SGRE 2H6MA 2SNVA 2BLOA 1SGCA 2BLQA 4Q7ZA 4X2YA 1ETRH 3M61U 4I8JA 1ELBA 4NA8A 1BJVA 1GMCF 1UW7A 2AGEX 2UWOA 3A7VA 2P3TB 1MAXA 3SI3H 1D6RA 2WUCA 4VGCC 3BTHE 1C9PA 1SI5H 1RIWC 1UTPA 1UVSH 8GCHG 4U01A 1TX8A 1GI9B 2GGVB 4HGCA 4JZEH 6ESTA 3LGUA 1LDTT 3RMNH 5CE1A 2FXRA 3MO9A 1D3QB 1UTJA 1YCPH 3MO3A 3QX5H 3TU7H 5J4QA 2XWBI 1N6XA 2XC0A 4FVBA 3QN7A 1NFYA 2ZQ2A 5DGJA 1S83A 4K69A 4NIVA 3U8TH 2DE8A 5DKMA 3BEFB 1YPEH 4DOQA 5GWZA 2GX4A 1GPZA 4JCNA 1VJAU 8LPRA 2Q6DA 4BTTB 1J14A 2BY8X 1GDUA 4JZFH 1AVWA 1T8OA 3GYMA 3KYGA 4DURA 1ZTJA 4FVDA 1O2JA 3VXEH 3ZZ9A 1XUIA 1YPHE 1EZUC 1HLTH 1GVKB 1OWHA 3BTGE 3MNCA 2G5NA 3BTME 1EUFA 5F6MA 2XC4A 1G37A 1HJAC 1TPOA 4AB9A 2PKSB 1IHTH 1ETTH 1P2MA 1ELGA 1SLWB 2I6QA 5T1VA 2WSSD 1LKBA 1HAGE 4NWLA 2EC9H 3NXPA 3ODDA 4BXWA 1XUGA 1S0QA 3RP2A 2BD3A 2ZU5A 1IHSH 2OC7A 1GI4A 1P2JA 4Q63A 2JH6D 4ISOA 2W7UA 3VG8A 1ELVA 2XYAA 2SGQE 3D23A 4CRGA 1N8OC 5AHGH 3LH1A 3K2UA 1BTUA 2GD4B 1J15A 1GBFA 4X2VA 1KIGH 1C5TA 1ZGIA 1E1QD 2PHBA 1FY1A 1GJ6A 1P2OA 5TCAA 1VITG 1UVTH 2Y5GA 3RXDA 1HAIH 1GDNA 1JBUH 1QURH 4JYUH 4Y0ZE 1AB9C 1EFRD 3LGVA 2FODA 5F53A 5L2YH 3VB3A 3PROA 6CHAB 1CVWH 3EA8A 4AB8A 1NROH 4MG3A 2HALA 3KCGH 1NRSH 3BEIB 9LPRA 4ABBA 3VXFH 3A83A 3LC5A 1G36A 4CRBA 4JZ1A 1H1BA 3FO8D 1WV7H 2FS8A 2ANMH 3E0PB 3GY2A 1KTSB 4FOUC 4ISIH 4Y0YE 5F03A 1NBME 2BD5A 1BRBE 2GVFA 2H9EH 2PUQH 2G4UA 2PGQB 1QHRB 1V6DA 3CNRA 5GJ4B 3TITA 2QXGA 1Z8JB 3EE7A 3O8RA 1TB6H 2KCPA 3RXEA 1FY3A 5JB8S 1W13U 1O2XA 2ANWA 3KYFA 5AFZH 2Y81A 3ZVBA 4LXBH 1ABIH 4DT7B 1Y3UA 2BX3A 1AFQC 1C5NH 1N8OB 2C8XB 1DLKB 2A31A 3SGAE 1HAPH 1BTPA 1GHXH 1NN6A 3HKIB 5BRRE 1BHXB 1BRCE 1GMHG 4A7IB 1UCYH 1NFWA 3UWIA 5FPYA 2BQWB 1N1LA 3P8OA 2ANYA 1O37A 2GDEH 3EDXB 1AFEH 1DXWA 1SB1H 2OLGA 1AB9B 2YNBA 3LJOA 4R0IA 4AOQA 2Y80A 1Z71A 5C1UA 1EB2A 1O3IA 3OFND 1GI0A 2Y5HA 1IQJA 2VVUA 1ARCA 3FKSD 1QRZA 3NCLA 2F43B 3VPKA 1CE5A 1CHOF 2GMTC 1YPJH 1GBHA 2GCTC 2CV3A 2EI8A 1KSNA 3OY5U 1TNHA 5TJXA 5A8ZA 3DHKH 3GY4A 1UTMA 1TIOA 4JMYA 1PPBH 2AEIH 1T7CA 2ZHWH 3DFLA 6GCHF 1WBGB 1O2RA 2CK3D 5LPRA 5L2ZH 1MH0A 1PQAA 4OS1A 3UOUA 1OWJA 2BVSH 3A87A 3QO6A 1XKAC 5E8EH 2ZHQH 3UNSA 2OK5A 1WCZA 2ALVA 2W3IA 1EAIA 3RM0H 1ZRBA 5AFYH 2Q6FA 3S69A 1RTLA 1BB0B 2XNIA 2VBCA 4INHA 4UEHH 4Y6DA 4BOHA 4Z6AH 1KXCA 1SGYE 3FZZA 1GMCG 5FAHA 1PPHE 1E36B 1ORFA 1ELFA 1FI8A 2WPLS 2WYJA 3ZV8A 3BN9A 1WQSA 4BXSA 4X1SU 3A7TA 1A0JA 1QB1A 1V2OT 4NWKA 1C1NA 3EYDA 3LGYA 3ATLA 2AIPA 5HGGA 4A6LA 2ZCHP 2PLXA 5ESTE 1QA7A 3U8OH 1OX1A 1UTNA 3C27B 1RGQA 2GZ9A 4XBBA 3A86A 3F1SB 1S84A 2NU3E 1DDJA 2BY7X 1UCYK 1RS0A 3M5LA 1FPCH 1Y59T 1JIRA 2G4TA 1NFUA 4ASUD 2FI4E 2HPQH 3SNBA 2ZHFH 1IOEA 3KQEA 3S7KB 1BIOA 4RKJB 2HVYB 1W2KH 2J38A 1P09A 1KXFA 2AHME 2CN0H 2UUJB 3QZRA 1DPOA 4GHQA 1BBRH 3KN2A 4ZHLU 2V3MA 2ESTE 2OC0A 1C2GA 1W12U 3HPTB 1TE0A 1GI6A 1J9CH 4CREA 4H6TA 2H9TH 2ALPA 1TPPA 2OQ5A 1EASA 4ACAA 4XE4A 3HK6B 3QLPH 1OWEA 1JIMA 3M5NA 2VINA 3TIUA 4YOGA 5GCHG 1EAUA 2ZKSA 1EP5A 2SFAA 1KXEA 1W14U 2QA9E 1C1RA 2G51A 1AN1E 1H8DH 3UAIC 1SGNE 2RA3A 1L1JA 2BY6X 2ODQA 1C5RA 5F8ZA 3SU5A 3NWUA 4KTUA 1O2UA 2V0BA 3GISB 2A4OA 1V2LT 3U98H 1AIXH 1THPB 5FHTA 1FV9A 2Z6BD 1AGJA 1C5SA 3NK8A 3URCA 1KLJH 4WH8A 3VEQB 2H9HA 2SGFE 4UFEH 4YOJA 1EP6A 1YPHC 2VWOA 3SV6A 4OS2A 1TPSA 3F2GA 2BVRH 4MPXA 1O2NA 3STJA 4I8HA 1MU8B 3MWIU 1GHYH 1S6LA 5CHAC 2DE9A 4MPVA 1D3DB 1K1LA 2FX4A 3BTKE 3RMMH 1O5FH 1EPTC 1HRTH 2CJIA 2YMSD 3VFEA 4J2YB 1SG8B 2P95A 2GDDA 3SJ8A 4O03A 1VGCB 1F7ZA 1QRXA 5H4IB 2FX6A 3DA9B 1CHGA 1WTHD 4K5ZA 1GHVH 4U32A 4D76A 2XWAA 1P02A 2VNTA 3SNAA 2VU8E 3QZQA 5HM2A 1ZPBA 2WUBA 4K3JA 1PQ8A 3GY7A 1HUTH 4IS5A 5EJLA 2GZ7A 1N6YA 1NESE 1W11U 1CO7E 2Y82A 3ATIA 1AHTH 1BBRK 2CF8H 3FP8E 3ZVEA 1F0TA 3NKKA 4TPYA 5G4BA 5E0HA 2QN5T 3RMOH 1INCA 2B0FA 2PTNA 2BDHA 1O34A 1O2PA 1CBWC 1UK2A 5DP4A 3S9BA 4U2WA 2KCOA 1VJ9U 1CGHA 2WV4A 4X6MA 2IN2A 1O2HA 2JH0D 2ZF0H 2Q6GA 4ZXXH 4HG6A 2VIDA 4MNWA 4Y7BA 2RDLA 3IITA 1H8IH 3PTBA 3PMJA 3ZVAA 3A85A 3PRDA 7KMEH 1O32A 3SORA 3KHVA 2FMJA 1TQ0B 3T25A 1AVGH 1DY8A 1MU6B 1PQ7A 3U1JB 3TH4H 1TBRH 1TABE 5GNDA 3GY3A 5SGAE 3TH2H 1ANCA 1Q3XA 5GPIB 3DSOA 3FZDA 2ZU1A 3H7OA 2CHAC 3RXUA 2ZGHA 3LGWA 1SQTA 1VCWA 2A4GA 4K8BA 2PKAB 4OS6A 1F0UA 5I25A 2OXSA 1CHOG 2K0QA 2PUXB 1O3GA 1C2FA 1ESTA 2ZFSA 3M5MA 1NC6A 3RC5A 1YLCA 1ZHMA 4FUFA 3TK5A 4WXIA 1CT0E 4I86A 2QXJA 3URDA 2BXTH 3ZZAA 6GCHG 1C1WH 3MNSA 2PKAA 4LZ4B 1O3LA 2SGAA 1MTUA 3BTWE 1C4U2 2H5DA 2FOHA 1W7XH 1VITF 2OC1A 1C2KA 3H09A 5FCKA 4B6FA 1ZMNA 3OY6U 1SPJA 2R3UA 3GCNA 1C2LA 3MU5A 2I6SA 3SHCH 2PV9B 4K1TA 4WWYA 2ZFQH 5EW2H 4CRFA 3SW2B 3KQ5A 1IQLA 1P03A 3MFJA 1SGQE 1K2I1 2BZAA 3FP6E 3PTNA 2VVVA 5JBTA 1ESBA 2DUCA 4ABAA 2J95A 3PO1B 5K7RA 3P17H 4ACBA 2ZPRA 3LKWA 1SFQB 5PTPA 3FFGA 1C5YB 3PMAB 5HYOA 4NZQA 4XSKU 4X0WU 3F68H 3B9FH 3BTTE 7LPRA 2F9UA 1VZQH 3BTDE 2FM2A 3E16B 1BMLA 2ZHEH 2K1QA 4BAMB 1GJ8B 3K9XB 2P8OC 4ZROA 1ZZZA 2GP9B 1YLNA 2ULLA 3F2HA 1GBEA 3N7DA 4TPIZ 4X2WA 4NIYA 2PWXA 1GMHF 1TA6A 2BB4A 2NU2E 2ZDNA 1BOQA 2ZTXA 4MTBA 5EQSA 5A0AE 1K22H 4Y76A 2F3CE 2FDAA 1CA8B 4BNRA 1A1RA 3Q3KA 4K1SA 3ZZBA 1S85A 3TGJE 3UUZA 4IN1A 1CT4E 4B76A 3MI4A 1ELCA 4UDWH 4UE7H 3RXRA 3MU1A 1YP9A 5I46H 1AO5A 1L4DA 1XXFA 3RXLA 3AK5A 3GYLB 1V2WT 4BAKB 2XC5A 2FOBA 4ISLA 4E7NA 3E8LA 4WJG2 1KLIH 2BTCE 1O2TA 4I33A 1WQVH 3SJIA 4AFUA 3V12A 1DWCH 2J92A 2ZFPH 5ESBA 2CF9H 4ASHA 1MD8A 1UK3A 1C1UH 1Z1JA 5EXLA 1Y5AT 2VIWA 2ZCKP 1W8BH 1GJBB 1GWAA 5FXLA 3AAVA 2P8OB 3F9FA 4ZHMU 2VIVA 4X1RU 2Y5FA 4RT0A 4WH6A 1MZAA 3KF2A 4RSPA 1OP8A 5B6OA 1MAYA 2LELA 1Q31A 2AYWA 2YMSB 2UWLA 1P3CA 3T26A 2Z9GA 3TVJB 3KQCA 1TMUH 3LIWA 4F48B 1GGDB 3PWBA 3OEHD 1C5UA 2ZDKA 4I8LA 3SU3A 2A7CA 5EPNA 2KCYA 2WPJS 3RXJA 1ZOMA 2Z3CA 2P59A 1FN8A 1TGNA 2ZDMA 1BTHH 1F5LA 1RRKA 1T4VH 1YM0A 2WV5A 4Q7YA 5L6NH 1C1VH 2XBXA 2R2MB 1NRNH 3A7YA 2ZGCA 1OXGA 5T3HA 1KYNA 1OWKA 1XXDA 1CSOE 4AYVB 2VWLA 2F9VA 1C5ZB 3HATH 3F9GA 4A5TS 2XBYA 5IDKA 1LHDH 1TPAE 2FZZA 3VB7A 5EXMA 1LVBA 1AZ8A 2HNTE 1V2NT 2JJ1D 1D6WA 1XUHA 1LKAA 1P2NA 3DUXH 2A7HA 2O9QA 2CMYA 3TK6A 1P06A 2C8YB 4DG4A 1GCDA 2RCEA 1G9IE 3ZZCA 1BTYA 1ZLRA 2OD3B 1P05A 1FNIA 2C4FH 4O3TA 3OAAD 1Y8TA 1GJ5H 1MCVA 3O8DA 3K6ZA 1UO6A 1PYTC 3ZZ8A 2ZFRH 3WW7A 2XW9A 3UTUH 4ZMAH 2W3KA 1DM4B 1FONA 4WY3A 4U30A 1FIWA 2BY5X 1P3EA 1O2QA 2WHXA 1TGCA 4CH8B 1C5OH 1XUFA 1AWHB 4VGCB 2SGEE 5GCHF 1O3AA 3ZZ5A 2XBVA 4INLA 3AAUA 1O36A 1RIWB 3E3TA 1P8VC 1GI8B 1QNJA 1OOKB 2FLRH 1CA0C 5C1YA 3TJVA 1MTNC 2ZC9H 1Z8IB 1SHYA 3R3GB 2HRVA 5F8XA 2VH6A 1GL0E 5F8TA 3A8DA 5EJZA 3PRBA 2VWMA 4AX9H 2EY4C 2FPZA 3O8BA 1MKWK 1EZXC 1P10A 4MNYA 1S0RA 1TNGA 2HVXA 3HGNA 4NGAH 3ZV9A 2VIQA 4AFZA 1FUJA 4HZHA 4NA7A 1F5RA 4NIXA 3SZNA 3TNSA 3CP7A 1O31A 2W7SA 1QJ1B 1NTPA 3MH7A 1FN6A 4D7FA 3RU4T 2GT8A 4KELA 3L3TA 3SJOA 1C5PA 3ATKA 3SJKA 1SQAA 1IAUA 1V2TT 4DIIH 3KNXA 4B6EA 3S0NA 1ZSLA 1Z8GA 5E0JA 3UNQA 4NFFA 2JETC 2WYGA 2ZFTA 3PM3A 1Y3YA 4ZXYH 4WVPE 1BMNH 4K8YA 3K65B 1K1IA 3RXPA 2ZU3A 1NO9H 2BLVA 3RXFA 1HJAB 3OTJE 3M37A 2PTCE 1HAOH 2C8ZB 1GCTC 3SU2A 2BMGB 1YBWA 4CRCA 1O2WA 2FOGA 1MTSA 1BUIA 4ZH8A 3UPEA 3TGKE 1LHEH 3OSYA 1S6HA 3ZIAD 2FO9A 1QQUA 1EQ9A 2L74A 2UWPA 1O3NA 4IMQA 2AGGX 2R0KA 4GSOA 4TY6A 4CHAC 2A5AA 4KKDA 1O2VA 2ILNA 4MNVA 3F0PA 1VCQA 1O2KA 1LO6A 1JMOH 1UTOA 1DUEA 3LT3A 1C5WB 1QL7A 4XDEA 1QA0A 2ZGBH 3QGNB 1GBBA 5DK1A 5HMAA 1BCUH 4I8KA 3N99A 2H5CA 1MBQA 2LPRA 1LPZB 1Z6JH 2G8TA 4KP0A 2V3HH 1UHBB 3PYHA 1GHWH 1BITA 5FCRA 4AG1A 4A1XA 5EOKA 4AN7A 2BQ6B 1A5HA 1IQIA 4KGAA 4BTIB 1NZQH 3UY9A 3N7EA 1E0FD 3VB6A 5EODA 1YPKH 2F9BH 2ZWLH 2EI6A 1GCTB 1O0DH 1UHBA 4R8TB 2RDEA 2TBSA 5A0CA 1TRMA 2J97A 3ZZ4A 1LQDB 5LPFA 1ZHRA 2P16A 1BMAA 3M35A 1OWDA 4B71A 3ESTA 2QCYA 1LTOA 1O30A 2AERH 2XCNA 2F9OA 3RU4E 1PPFE 3KQDA 5EQQA 2IPHA 4TY7A 1TX6A 1GMDF 3ZVGA 1GG6C 1FDPA 3UQOA 1AFQB 3I29A 1TOCB 1BQYA 1O3FA 2ZU4A 4X2XA 1TGSZ 2CXVA 1ABJH 1GI5A 1GHAF 2CGAA 4NCYA 2A45B 1D9IA 1LCYA 1TNJA 3E91A 4X8UH 2XNDD 3ZZ7A 3SGQE 1UCYE 3I78A 4AC9A 2O8UA 2K8IA 1C9TA 1O3BA 2NWNA 4TWYA 2TGTA 4X8VH 4NG9H 4H6SB 2BY9X 2BVXH 3T27A 3CS7A 1E35B 4AFSA 1UMAH 3SNDA 4JK6A 1IQFA 2EI7A 1NBMD 3FANA 3MTYA 2IPQX 3AW1A 3BG8A 2ZGJA 3ZZ6A 5JDUB 1BTZA 4Q4LA 1MTVA 2R3YA 1OYTH 5C2ZA 1Z1IA 2GMTB 2GCTB 1AQ7A 4YLUA 1GJ7B 4THNH 1AE5A 1UK4A 3H7TA 2RFKC 1W0YH 1TX7A 5T6DA 2JIZD 2M5TA 5EGMA 4QT8C 1SGFG 3M36A 1TFXA 3UB0A 3N7OA 4ABHA 2GKVE 1IQEA 4UONA 1UJ1A 1WAYB 1SGIB 4X1QU 1HCGA 3SNEA 2W6JD 3SYJA 1K1MA 4AG2A 1F0SA 2O8WA 3DSPA 3GY8A 3CENA 1P2IA 2P3UB 3PLBA 4UFDH 4K1EA 2ZA5A 5JB9S 1T8MA 2ZZUH 1O3HA 1CGJE 3WWBA 1VCPA 3U9AH 1WTGH 2ZGXH 2HPPH 2ZTZA 1O5BB 2QE7D 1H8ED 1ZPZA 1TNIA 5C67A 2M2AA 4X8TH 4XOJA 2HNTC 3TJOA 2J94A 2OBQA 2IJOB 1GJDB 4Y8YA 1K9OE 1AUJA 1MUEB 3WY8A 1D3TB 5DSFA 5K0HA 2WPIS 2Y6TA 2BD2A 1P01A 1NPMA 3OE7D 4IC5A 3B8JA 3SV9A 1OS8A 2SNWA 2HNTF 3Q76A 1AMHA 4MPWA 1G2LA 3MYWA 1J17T 2ZNKH 2QAAA 3BTEE 1SVPA 4O9VA 2GCHF 1GJCB 1CQQA 1IQHA 1TBZH 5A09A 5DPAA 1JRTA 4CRAA 1A61H 3F9HA 1AVXA 4X1PU 1V2MT 2VGCC 4E7RG 4GAWA 3RXKA 4AGKA 2A0QB 1ELEE 1A7SA 3MOCA 1RXPA 4UFGH 5DP5A 1XUJA 2KAIA 2STAE 1BBRE 1ZYOA 1NRPH 4OS7A 3RXIA 1C1OA 2XXLA 4FUIA 3FP7E 2G5VA 1P11E 3SV2H 1QY6A 1V2PT 1QJ7B 3MNXA 1U6QA 5A8YA 4YT7H 5EXNA 4AGJA 4WXVA 4K2YA 1FY8E 5EW1H 2VIOA 3SHAH 7GCHG 1UVOA 1GJ9B 4IW4E 2ZTYA 2ASUB 1ARBA 4AZ2B 1S6FA 1TNLA 1DWBH 1ANEA 4X6NA 2BDIA 2H2ZA 4FUCA 1PFXC 2FI5E 2ZDAH 3RXVA 3A82A 2OP9A 4ABJA 1H9HE 1OP0A 4OGYA 2OINA 2ZDVH 1UTLM 1C2HA 1GVZA 1KLTA 2NU0E 3RXAA 1MMJN 2QF4A 3DSGA 3Q3YA 1W0KD 4OS4A 4DJZB 3RXCA 1C1TA 5TCCA 4LOYH 5CHAB 1ZHPA 1YCPM 2AMDA 3EQ0H 2KX4A 2QF0A 1ID5H 1HGTH 5AF9H 2OUAA 3L6PA 1EPTB 2F91A 2VJ1A 2ZG0H 4D7GA 2BD4A 2O8MA 5E2OA 3GCHC 2YOLA 5GIBA 1AD8H 2Z94A 3HKJB 1GBKA 5ABWA 3A89A 3ZVCA 1DANH 1NFXA 1F0RA 2R2WU 3QDZB 3TK9A 1F5KU 1YF4A 1SSXA 5EIYA 4WF8A 1EPTA 2D2DA 1IQMA 1PPZA 2IJD1 2TRMA 3RXBA 3GDVA 3SV7A 3UR9A 1FZZA 2FTMA 1ZTLA 2Y7ZA 1MQ5A 4ABEA 1ESAA 3TJNA 3TJUA 2BD8A 4TSFD 2AFQB 1GMDG 3U1IB 4RN6A 1KY9A 4OS5A 2D26C 1CBWB 3M3SA 3RC4A 4JZIA 5JBCS 5FPTA 2ZQ1A 1GHAG 5EU8A 1V2ST 1J16A 1TALA 3LOXA 4F49A 1A46H 4D8NA 1C5MD 3MU4A 1PYTD 1C2DA 1TNKA 1JWTA 2QIQA 3GOVB 3MNBA 1O33A 3RXSA 1GI2A 1BRAA 2JJ2D 4MQAA 3RC6A 3LGIA 4I7YH 3A7WA 1W0ZU 2BZ6H 3D49H 4E05H 4NZLA 1DSUA 2A4QA 4ESTE 4YXWD 2CHAB 1HBTH 1YLDA 3AW0A 4ABDA 1ZTKA 4ABIA 2PGBB 1M9UA 5KEDA 1V2RT 2C8WB 2A1DB 4CBOA 5DP6A 4B73A 1HAXB 2J34A 1H8HD 1OYQA 1ZMJA 2TIOA 2QGRA 3HK3B 1AY6H 3SOSA 3SO3A 1AUTC 1B0EA 1GI3A 1EXFA 1BTXA 2SGPE 2J9NA 4RI0A 3PLPA 1TBQH 2OTVA 2F9PA 3A8AA 1AE8H 3KL6A 1Y5BT 1HNEE 1GBCA 4GCHF 3KGPA 3MH5A 2WPHS 1C5LH 4LZ1H 4FUBA 3MHWU 9ESTA 4XBCA 4CBNA 3TPIZ 1TAWA 2V35A 5HIYA 3LC3A 4Y79A 7ESTE 3A81A 1O2YA 2ZDLA 3OX7U 3STIA 3A8BA 1C1QA 4ZUHA 3G01A 2OCVB 3RXHA 1TQ7B 2PP6A 1KDQA 4M9FA 3SGBE 2GJGA 2SGDE 1ZGVA 1GBTA 4Q2KA 4YZUA 5A0BA 3PB1E 4YOIA 5KGOA 1NT1A 2AS9A 1EJAA 1W10U 1BT7A 2FS9A 3D65E 3SV8A 3UFAA 1TYNA 8KME2 2Z9LA 3PMHB 1LHFH 1O3DA 5FBIA 1K1OA 2GCHG 5C17A 2TGAA 2RG3A 3ENSB 1G30B 2J2UA 4XD7D 4I32A 3ATWA 3BSQA 4B75A 1L1GA 1YC0A 3SUEA 1EAXA 3Q3XA 1MKWH 3SI4H 4NSVA 1XX9A 3VGCC 2AGIX 4LK4A 3TNTA 1NU7B 1E1RD 1AKSB 5DN6D 3BF6H 1SC8U 3F6UH 1YPMH 5C1XA 4YO9A 5EQRA 1QCPA 1A3BH 5C5OA 2QXHA 1NM6A 2JKHA 1BJUA 1T31A 1QJ6B 3QUMP 5IYTA 2KCAA 1SGTA 1TLDA 1DFPA 1WUNH 1A2CH 2FOFA 4DW2U 2A32A 1AKSA 4KTSA 3PLKA 1QIXB 2BDBA 2PKSC 5HIZA 1O3PB 3LJJA 2GZ8A 3RM2H 1SOZA 1HYLA 3GDSA 1Z8RA 1RTFB 4O97A 1P2QA 1HV7A 1A3EH 5CDFE 2L6OA 1TRYA 4H42U 4ZKSU 2Z3DA 1G3DA 1XMNB 3SU6A 4NSYA 4AYYB 1S5SA 1TRNA 1V2JT 2BHGA 2PSXA 3GDUA 2BM2A 2XCFA 5FPSA 1EZQA 4BAOB 1G3CA 5ETXA 3GCTF 3P70B 1P9SA 2A2XH 2D1JA 4E06H 2BD7A 1GBJA 5BPEA 1GJAB 3IG6B 1PJPA 4WMDA 1YPLH 2AMPA 1OP2A 1HB0B 1EJNA 4FUGA 4ZKNU 2A4RA 1DSTA 1EOJA 2Z3EA 1WSSH 3M3VA 2R9PA 2FOEA 1JOUB 1OSSA 1Y3VA 3VGCB 4MVNA 3T29A 4Y11E 1WOFA 3BV9B 3GCOA 3H5CB 2UUFB 2V7QD 5EPYA 1O3MA 2KR7A 3ITIA 3A7ZA 1IQKA 2FP7B 1HAYB 3PWCA 2FYQA 1E37B 2P3FH 6CHAC 1Q2WA 2FOMB 4Y10E 2FWWA 1C1SA 1O5DH 5LH8A 3KQBA 1YWUA 1O2IA 2VWNA 4PROA 1JXPA 1P57B 5DP7A 3W95A 2B9LA 1SGFA 2XBWA 3PV5A 3QGJA 1H4WA 1LVYA 1XM1A 4H4FA 3ZYDA 5EJ1A 2EQNA 1DWEH 4MPUA 2W26A 3B23B 1V2KT 1L1NA 3O8CA 3RUOA 3MH6A 3NPSA 1K1JA 2FYRA 1SFIA 4WMFA 4X6OA 2HLCA 1CGIE 1FMGA 1K28D 5C0UA 4UD9H 3A84A 5EG4A 3MH4A 1VITH 3UQVA 1SGPE 1EAWA 4DGJA 4HTCH 1SKYE 3BTQE 1G32B 3GICB 2ZU2A 3EE0B 3FN8A 3SU4A 3SQEE 2FTLE 3A88A 3M5OA 1Z6EA 4MNXA 1L0ZA 3RLYH 4FUJA 1O2MA 3K6YA 5DP9A 7GCHF 3QWCH 3HGPA 1HXEH 2BDAA 1ACBE 3I77A 1LPKB 1YCPK 2JH5D 4ABFA 2B5TB 4ZHAA 3ZVDA 3EGKH 1CA0B 2BXUH 1BHXF 2ZI2H 1MTNB 1DS2E 4B2CA 1QL8A 1NRRH 4ISNA 2Z7FE 2OBOA 1DWDH 1SGEE 1MKXH 2A5KA 3RXQA 3IWMA 3ZYEA 1ZJDA 1O3CA 3QTVH 1EATA 2XTTB 3UR6A 3V13A 1P9UA 1S81A 4X6PA 1DE7H 3RDZA 2PFEA 1EOLA 3FOAA 3LH3A 5DP8A 1QRWA 5T6FA 5FBEA 5C0TA 1SR5C 1HFDA 1MD7A 3NUMA 1HAVB 1FIZA 1BMFD 1TA2A 3UIRA 3TGIE 3SUGA 5HXFA 1O5CB 1COWD 1QR3E 2BOKA 2ZECA 1O38A 2W6ID 1MCTA 1V3XA 2QYIA 1X7AC 4ZKRU 4CH2B 4GCHG 1ANDA 1DOJA 1HAVA 1MABB 2JETB 3V3MA 3KEEA 3S9AA 1V2QT 3OTPA
chains in the Genus database with same CATH topology
1F92A 2ZCLP 2VH0A 2OC8A 1GHZA 1LPGB 1Y5UT 1AI8H 1XVMA 6LPRA 1UTQA 4IN2A 2GV6A 1ZSJA 2B7DH 3NZIA 3V7TA 1LVMA 1KXDA 4O3UA 4J1YA 3DD2H 1BTWA 1A0LA 3LONA 4GVUA 4WMEA 3RXGA 1WYKA 1H9LB 3U69H 2O8LA 3FVFB 1QTFA 1OPHB 3BTFE 4I8GA 1QGFA 1XUKA 4CR5A 1Z7KA 2QV1A 5JYIA 4CHAB 4NFEA 2ODYB 3S7HB 3D62A 3MU8A 4Z0KA 3Q77A 1ZMLA 1LVOA 1HAHH 1ANBA 1GHBG 2O8TA 3S9CA 2G52A 5DJ7A 1QB6A 1K1PA 4GLYA 1K21H 3SNCA 2FI3E 4ZKOU 1C5XB 2PR3A 2BOHB 3EA9A 5C3NA 1RJXB 2BD9A 1C2MA 2VVCA 2GT7A 3V0XA 4XFQA 1MKXK 2FLBH 3MO6A 3E90B 3RXTA 4CR9A 1CU1A 3AASA 2QXIA 1E38B 1DT2A 1FAXA 1O39A 1NY22 1EB1H 3VB5A 1GBLA 5JBAS 3DT0H 1IQGA 1F2SE 1J8AA 4ISHH 1UVPA 3F9EA 1MBMA 3SU1A 4MDSA 1DITH 1DXPA 1DUAA 4D9QA 1CT2E 1IQNA 3LU9B 1O35A 1A4WH 1HXFH 5HM9A 1FY4A 1MTWA 1SOTA 1ZRKA 2TGDA 3L33A 3LPRA 5JPMH 4IGDA 1FPHH 3GCTG 4B1TA 1GG6B 3P6ZB 1SBWA 3BIVH 4X8SH 1QFKH 4TYDA 1O5EH 1P2KA 1GVLA 1MZDA 4A92A 1Y3XA 3SN8A 1TGBA 2IOTA 1SLVB 1RFNA 3GY6A 2EEKA 4BANB 4DVAU 5C5NA 1C4Y2 1P04A 1SLXB 3RXOA 1MQ6A 3P8NA 1G2MA 3EA7A 4MLFB 2VB0A 4B74A 1ZJKA 1QBOA 5J4SA 5DP3A 4M7GA 2FIRH 2J4IA 4DY7B 2HGTH 2NU4E 3W94A 2H1UA 3ELAH 1TWXB 2BDCA 1YYY1 1KTTB 1C2JA 1TONA 1DLEA 1FJSA 2G00A 4Y8ZA 2TPIZ 3LGTA 1O3JA 1VGCC 2FESH 2ZO3H 3UNRA 3ZZDA 1O5GH 1SMFE 2RA0A 3MMGA 1ELAA 1S82A 3RU4D 1GI7B 1P0SH 1B7XB 1LMWB 3SJ9A 1FQ3A 1UTKA 2V6NA 1SQOA 2EA3A 4JYTA 5A2MH 2KAIB 1HJ9A 3QK1A 1C5QA 2WINI 4SGAE 1XKBC 2Z9JA 1AU8A 4IBLH 2ODPA 4JK5A 3UREA 1EJMA 4AORA 2ZHDA 4HI3A 4BTUB 2W5EA 2ANKH 3RMLH 3JZ1B 1UVUH 1C5VA 4DCDA 5GXPA 1B5GH 1ZSKA 3BEUA 3LDXH 3SQHE 2VIPA 4YT6H 1C4V2 3VB4A 1T8NA 4XBDA 1QL9A 3FAOA 4BAHB 1DX5M 1NRQH 3P92A 4AFQA 1H9IE 5DO4H 1DY9A 2P94A 3T5FH 1SLUB 1VR1H 8ESTE 1FLEE 1GBDA 2FEQH 4FXGH 3CS0A 3SUFA 2QF3A 2THFB 1QBVH 2V3OH 1DVAH 1HIAB 2WPKS 3MU0A 3QTOH 8GCHF 2TGPZ 5GDSH 2D8WA 3ZZ3A 1A5IA 1O2ZA 3ATMA 1BA8B 2ZPQA 3OU0A 4RKOB 2FOAA 3RXMA 3Q00A 3DFJA 2R0LA 1K1NA 4FU7A 1HAZB 3TH3H 1HDTH 2PW8H 1HPGA 1KXAA 2AMQA 3M3TA 4FUEA 3RLWH 1THSH 1HIAA 1LHCH 1E34B 2GTBA 5CMXH 4D9RA 4NA9H 1O3EA 4F4OC 2BX4A 2HOBA 2VGCB 4IC6A 2AIQA 3ZVFA 1Y3WA 2ZPSA 5LPEA 3GY5A 5T6GA 2GV7A 4SGBE 2LNCA 4FU9A 1BMMH 4FUHA 1LHGH 3TLOA 1G3BA 3A8CA 4Q80A 1QBNA 3M7QA 1QB9A 1GBMA 1O2OA 5FX6A 4Y71A 2ZEBA 1OKXA 1NS3A 1TOMH 2OQUA 3U8RH 1GBIA 1PPCE 3ODFA 4K60A 1AWFH 3T2NA 4GHTA 3PO1C 4I31A 1HJ8A 1ZR0A 3SUDA 4TWWA 1A0HB 4X1NU 2XRCA 1ZPCA 1O2GH 1DICA 3P8FA 3E6PH 2STBE 1C1MA 3E0NB 1SL3A 2A7JA 2A2QH 3A80A 2HWLB 1O3OA 5E0GA 4HFPB 1LQEA 4OGXA 1JRSA 2Z9IA 3P95A 2WPMS 4JYVH 3T28A 3E1XB 2B8OH 4YM9A 1ELDE 3M7UA 1P12E 3BIUH 5LGOA 1SGDE 2UUYA 4FUDA 4KTCA 4ABGA 1QQ4A 1BZXE 2ZP0H 1V2UT 1RD3B 1AZZA 2G81E 1T8LA 5L30H 3GCHB 3JZ2B 1L2EA 1PPGE 1C2IA 1TMBH 4UFFH 5A8XA 1A5GH 4DIHH 1XVOA 4GUXA 3UWJH 1D3PB 4ZAEA 5JBBS 2C93B 1ETSH 2BDGA 3AVZA 1FAKH 2Y7XA 4INKA 1W3CA 1BRUP 1L4ZA 1GJ4H 1O2SA 2F83A 5FX5A 2BQ7B 3UOPA 1GI1A 1YKTA 1PQ5A 2BLWA 4YLQH 4Q7XA 2C3SA 1D4PB 1ELTA 4CRDA 1WU1A 1W7GH 3P8GA 3A7XA 2BYAX 3C1KA 2AH4X 3BG4C 1PPEE 1C2EA 3M7TA 4Y7AA 2F9NA 2QY0B 4YTAA 4A1VA 1KDQB 1GL1A 1KXBA 3SBKA 1V2VT 1O3KA 2P93A 2G55A 1EX3A 4BAQB 1GBAA 3PV4A 5C20A 5AVDA 4B2AA 1SHHB 1GGDC 1EZSC 4YESB 4A1TA 2C90B 2FOCA 5DG6A 1T32A 2A5IA 2BDYA 1O5AB 4IMZA 2ZIQH 3PMBB 1FY5A 1O2LA 2QC2A 4JZDH 3SU0A 4Y8XA 1GDQA 1B0FA 2Z9KA 2YNAA 1C1PA 4GPGA 3OYPA 3T62A 1EKBB 1OWIA 2PSYA 2NU1E 2UUKB 1GHBF 1THRH 1NU9A 3EAJA 4B2BA 1RTKA 1TGTA 1YGCH 1T4UH 2Q1JA 4FU8A 5E2PA 2ZFFH 1BDAA 4NIWA 3BG4B 3R0FA 3KIDU 1YPGH 1G3EA 1TMTH 1FXYA 1SGRE 2H6MA 2SNVA 2BLOA 1SGCA 2BLQA 4Q7ZA 4X2YA 1ETRH 3M61U 4I8JA 1ELBA 4NA8A 1BJVA 1GMCF 2AGEX 2UWOA 3A7VA 2P3TB 1MAXA 3SI3H 1D6RA 2WUCA 4VGCC 3BTHE 1C9PA 1SI5H 1RIWC 1UTPA 1UVSH 8GCHG 4U01A 1TX8A 1GI9B 2GGVB 4HGCA 4JZEH 6ESTA 3LGUA 1LDTT 3RMNH 5CE1A 2FXRA 3MO9A 1D3QB 1UTJA 1YCPH 3MO3A 3QX5H 3TU7H 5J4QA 2XWBI 1N6XA 2XC0A 4FVBA 3QN7A 1NFYA 2ZQ2A 5DGJA 1S83A 4K69A 4NIVA 3U8TH 2DE8A 5DKMA 3BEFB 1YPEH 4DOQA 5GWZA 2GX4A 1GPZA 4JCNA 1VJAU 8LPRA 2Q6DA 4BTTB 1J14A 2BY8X 1GDUA 4JZFH 1AVWA 1T8OA 3GYMA 4DURA 1ZTJA 4FVDA 1O2JA 3VXEH 3ZZ9A 1XUIA 1YPHE 1EZUC 1HLTH 1GVKB 1OWHA 3BTGE 3MNCA 2G5NA 3BTME 1EUFA 5F6MA 2XC4A 1G37A 1HJAC 1TPOA 4AB9A 2PKSB 1IHTH 1ETTH 1P2MA 1ELGA 1SLWB 2I6QA 1LKBA 1HAGE 4NWLA 2EC9H 3NXPA 3ODDA 4BXWA 1XUGA 1S0QA 3RP2A 2BD3A 2ZU5A 1IHSH 2OC7A 1GI4A 1P2JA 2JH6D 4ISOA 2W7UA 1ELVA 2XYAA 2SGQE 3D23A 4CRGA 1N8OC 5AHGH 3LH1A 3K2UA 1BTUA 2GD4B 1J15A 1GBFA 4X2VA 1KIGH 1C5TA 1ZGIA 2PHBA 1FY1A 1GJ6A 1P2OA 5TCAA 1VITG 1UVTH 2Y5GA 3RXDA 1HAIH 1GDNA 1JBUH 1QURH 4JYUH 4Y0ZE 1AB9C 3LGVA 2FODA 5L2YH 3VB3A 3PROA 6CHAB 1CVWH 3EA8A 4AB8A 1NROH 4MG3A 2HALA 3KCGH 1NRSH 3BEIB 9LPRA 4ABBA 3VXFH 3A83A 3LC5A 1G36A 4CRBA 4JZ1A 1H1BA 1WV7H 2FS8A 2ANMH 3E0PB 3GY2A 1KTSB 4ISIH 4Y0YE 5F03A 2BD5A 1BRBE 2GVFA 2H9EH 2PUQH 2G4UA 2PGQB 1QHRB 1V6DA 3TITA 5GJ4B 2QXGA 1Z8JB 3O8RA 1TB6H 3RXEA 1FY3A 5JB8S 1W13U 1O2XA 2ANWA 5AFZH 2Y81A 3ZVBA 4LXBH 1ABIH 4DT7B 1Y3UA 2BX3A 1AFQC 1C5NH 1N8OB 2C8XB 1DLKB 2A31A 3SGAE 1HAPH 1BTPA 1GHXH 1NN6A 3HKIB 5BRRE 1BHXB 1BRCE 1GMHG 4A7IB 1UCYH 1NFWA 3UWIA 5FPYA 2BQWB 1N1LA 3P8OA 2ANYA 1O37A 2GDEH 3EDXB 1AFEH 1DXWA 1SB1H 2OLGA 1AB9B 2YNBA 3LJOA 4R0IA 4AOQA 2Y80A 1Z71A 5C1UA 1EB2A 1O3IA 1GI0A 2Y5HA 1IQJA 2VVUA 1ARCA 1QRZA 3NCLA 3VPKA 1CE5A 1CHOF 2GMTC 1YPJH 1GBHA 2GCTC 2CV3A 2EI8A 1KSNA 3OY5U 1TNHA 5TJXA 5A8ZA 3DHKH 3GY4A 1UTMA 1TIOA 4JMYA 1PPBH 2AEIH 1T7CA 2ZHWH 3DFLA 6GCHF 1WBGB 1O2RA 5LPRA 5L2ZH 1MH0A 1PQAA 4OS1A 3UOUA 1OWJA 2BVSH 3A87A 3QO6A 1XKAC 5E8EH 2ZHQH 3UNSA 1WCZA 2ALVA 2W3IA 1EAIA 3RM0H 1ZRBA 5AFYH 2Q6FA 3S69A 1RTLA 1BB0B 2XNIA 4INHA 4UEHH 4Y6DA 4BOHA 4Z6AH 1KXCA 1SGYE 3FZZA 1GMCG 5FAHA 1PPHE 1E36B 1ORFA 1ELFA 1FI8A 2WPLS 2WYJA 3ZV8A 3BN9A 1WQSA 4BXSA 4X1SU 3A7TA 1A0JA 1QB1A 1V2OT 4NWKA 1C1NA 3EYDA 3LGYA 3ATLA 2AIPA 5HGGA 4A6LA 2ZCHP 2PLXA 5ESTE 1QA7A 3U8OH 1OX1A 1UTNA 3C27B 1RGQA 2GZ9A 4XBBA 3A86A 3F1SB 1S84A 2NU3E 1DDJA 2BY7X 1UCYK 1RS0A 3M5LA 1FPCH 1Y59T 1JIRA 2G4TA 1NFUA 2FI4E 2HPQH 3SNBA 2ZHFH 1IOEA 3KQEA 3S7KB 1BIOA 4RKJB 1W2KH 2J38A 1P09A 1KXFA 2CN0H 2UUJB 3QZRA 1DPOA 4GHQA 1BBRH 3KN2A 4ZHLU 2ESTE 2OC0A 1C2GA 1W12U 3HPTB 1TE0A 1GI6A 1J9CH 4CREA 4H6TA 2H9TH 2ALPA 1TPPA 2OQ5A 1EASA 4XE4A 3HK6B 3QLPH 1OWEA 1JIMA 3M5NA 2VINA 3TIUA 4YOGA 5GCHG 1EAUA 2ZKSA 1EP5A 2SFAA 1KXEA 1W14U 2QA9E 1C1RA 2G51A 1AN1E 1H8DH 1SGNE 2RA3A 1L1JA 2BY6X 2ODQA 1C5RA 5F8ZA 3SU5A 3NWUA 4KTUA 1O2UA 2V0BA 3GISB 2A4OA 1V2LT 3U98H 1AIXH 1THPB 5FHTA 1FV9A 2Z6BD 1AGJA 1C5SA 3NK8A 3URCA 1KLJH 4WH8A 3VEQB 2H9HA 2SGFE 4UFEH 4YOJA 1EP6A 1YPHC 2VWOA 3SV6A 4OS2A 1TPSA 2BVRH 4MPXA 1O2NA 3STJA 4I8HA 1MU8B 3MWIU 1GHYH 5CHAC 2DE9A 4MPVA 1D3DB 1K1LA 2FX4A 3BTKE 3RMMH 1O5FH 1EPTC 1HRTH 2CJIA 3VFEA 4J2YB 1SG8B 2P95A 2GDDA 3SJ8A 4O03A 1VGCB 1F7ZA 1QRXA 5H4IB 2FX6A 3DA9B 1CHGA 1WTHD 4K5ZA 1GHVH 4U32A 4D76A 2XWAA 1P02A 2VNTA 3SNAA 2VU8E 3QZQA 5HM2A 1ZPBA 2WUBA 4K3JA 1PQ8A 3GY7A 1HUTH 4IS5A 2GZ7A 1N6YA 1NESE 1W11U 1CO7E 2Y82A 3ATIA 1AHTH 1BBRK 2CF8H 3FP8E 3ZVEA 1F0TA 3NKKA 4TPYA 5G4BA 5E0HA 2QN5T 3RMOH 1INCA 2B0FA 2PTNA 2BDHA 1O34A 1O2PA 1CBWC 1UK2A 5DP4A 3S9BA 4U2WA 1VJ9U 1CGHA 2WV4A 4X6MA 2IN2A 1O2HA 2JH0D 2ZF0H 2Q6GA 4ZXXH 2VIDA 4MNWA 4Y7BA 2RDLA 3IITA 1H8IH 3PTBA 3PMJA 3ZVAA 3A85A 7KMEH 1O32A 3SORA 3KHVA 2FMJA 1TQ0B 3T25A 1AVGH 1DY8A 1MU6B 1PQ7A 3U1JB 3TH4H 1TBRH 1TABE 3GY3A 5SGAE 3TH2H 1ANCA 1Q3XA 5GPIB 3FZDA 2ZU1A 3H7OA 2CHAC 3RXUA 2ZGHA 3LGWA 1SQTA 1VCWA 2A4GA 4K8BA 2PKAB 4OS6A 1F0UA 5I25A 2OXSA 1CHOG 2PUXB 1O3GA 1C2FA 1ESTA 2ZFSA 3M5MA 1NC6A 3RC5A 1YLCA 1ZHMA 4FUFA 3TK5A 4WXIA 1CT0E 2QXJA 3URDA 2BXTH 3ZZAA 6GCHG 1C1WH 3MNSA 2PKAA 4LZ4B 1O3LA 2SGAA 1MTUA 3BTWE 1C4U2 2H5DA 2FOHA 1W7XH 1VITF 2OC1A 1C2KA 5FCKA 1ZMNA 3OY6U 1SPJA 2R3UA 3GCNA 1C2LA 3MU5A 2I6SA 3SHCH 2PV9B 4K1TA 4WWYA 2ZFQH 5EW2H 4CRFA 3SW2B 1IQLA 1P03A 3MFJA 1SGQE 1K2I1 2BZAA 3FP6E 3PTNA 2VVVA 5JBTA 1ESBA 2DUCA 4ABAA 2J95A 3PO1B 5K7RA 3P17H 2ZPRA 3LKWA 1SFQB 5PTPA 3FFGA 1C5YB 3PMAB 5HYOA 4NZQA 4XSKU 4X0WU 3F68H 3B9FH