3GY5A

A comparative study on the inhibition of bovine beta-trypsin by bis-benzamidines diminazene and pentamidine by x-ray crystallography and itc
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cationic trypsin
publication title Structural binding evidence of the trypanocidal drugs Berenil and Pentacarinate active principles to a serine protease model.
pubmed doi rcsb
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gy5A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gy5A02
1NFWA 5LH8A 1ZPZA 3VPKA 1BB0B 3BTTE 4D8NA 4BANB 2J92A 2VVCA 3SV8A 3GY5A 4ISIH 1TMBH 4X0WU 2AMDA 5EW1H 3ATMA 1O5BB 5FCKA 4BAQB 3HGPA 2O8UA 3RC6A 1QTFA 2OBQA 1LDTT 3RP2A 1C5TA 4JK6A 3RXPA 1BTYA 3AAVA 4CH8B 1NESE 5AFYH 1DSUA 1A61H 1IHTH 2P3TB 2OCVB 5A0CA 3E16B 2BZ6H 1DWCH 5GXPA 3PLKA 2V35A 3UPEA 4NA9H 1GI4A 3SJOA 1VITF 1GG6C 1J15A 1OP8A 3A85A 1V2KT 1ELDE 4Q2KA 1X7AC 4ZKRU 3BN9A 5F8XA 7ESTE 1ZJDA 1O2GH 2ZI2H 4GPGA 1THPB 4H6SB 3RXRA 1QBOA 2FM2A 2OC0A 4IN2A 5ESTE 2BX4A 4XBCA 5AFZH 3UOPA 3E1XB 3M7UA 4X6MA 1K22H 2UUKB 2PV9B 1GBDA 5EQSA 2XBWA 2BD3A 5L2ZH 2UUYA 3KGPA 1GDNA 5ESBA 2TIOA 1JRTA 1QB9A 1P03A 1QL9A 4JYTA 1UTNA 4YT6H 3QX5H 3UFAA 4BAMB 1W11U 1EQ9A 2CF9H 3OSYA 2G52A 4K1SA 5HGGA 2GCHF 2ZQ2A 1DUEA 1ZMJA 1BTXA 3RXGA 2AGEX 4UFFH 1G2LA 1GJ5H 2Y80A 3KF2A 3ELAH 1O3JA 4H4FA 1KTTB 1C1VH 4NG9H 4O03A 3SZNA 4E7RG 1D3DB 3L3TA 3V13A 3ODFA 5GCHG 5A0AE 1BT7A 3MH6A 3BTFE 1SR5C 1GHYH 4WY3A 1LHDH 1O3CA 1EASA 3SI3H 2G8TA 1AHTH 2VIWA 2FP7B 2O8WA 3F6UH 5JBBS 2HGTH 2VU8E 3NWUA 2O9QA 4LXBH 2ZPRA 1FY4A 1RTLA 1LQEA 1QB6A 3D65E 1EJMA 3BV9B 3MU5A 1EAWA 1ELCA 1F92A 2M5TA 2ZTZA 3RUOA 1C1SA 1PQ8A 3QK1A 3LONA 2BY8X 1ZPCA 2GZ9A 2QV1A 3D23A 3F9EA 1C9TA 1TBQH 4WXVA 5BRRE 2VIPA 1W10U 4WWYA 1DWDH 1AVWA 1OWIA 5JB9S 4OGXA 3ITIA 1T4UH 2Y5FA 1MKWH 1LO6A 1LQDB 2NU1E 2PHBA 1D3PB 3VGCB 1A5GH 4NZLA 2ESTE 2ANKH 4WJG2 2PTNA 3RMLH 3LGVA 3TJOA 3ZV8A 1O3BA 2VVUA 3SHAH 1ZJKA 4NWKA 3GYMA 3F9FA 3A81A 1O32A 2J2UA 4OS1A 3BSQA 1FNIA 1EAUA 1HIAA 1S0QA 5T6FA 3GDSA 1HRTH 1O3HA 4Y76A 1AFQB 2FMJA 1BJUA 1FLEE 1EOLA 1L1GA 1OPHB 3HGNA 1G3BA 3SNBA 1DX5M 5DP4A 1UVPA 8KME2 1IQMA 3A7WA 2ZU2A 2J95A 3A7YA 2ZFPH 5DKMA 3B9FH 2VIQA 2CMYA 3SI4H 2Z3DA 4THNH 3CS7A 3ZVAA 1CSOE 1B0FA 1GI8B 1IQFA 1LVOA 2W3IA 1F0SA 4ZKSU 2Z9JA 1UTKA 4FVBA 3E3TA 1K1NA 1CVWH 1GCDA 4LOYH 1O5GH 3UQOA 2GT8A 1DVAH 3SORA 3Q00A 1D3QB 4HZHA 3SV7A 3QZQA 1O39A 2FI3E 1XXFA 1ZGVA 4FUGA 1V2VT 3VGCC 2FOEA 4J1YA 5HMAA 3T28A 1D4PB 1Z71A 1ELTA 1O2SA 1JIMA 1NY22 2OQ5A 1KXAA 1WOFA 3UWIA 5DP8A 3TU7H 5JYIA 3R3GB 1IQIA 4IMQA 1EJAA 4BAHB 3M3TA 1WAYB 4KP0A 2GP9B 1AIXH 2AMQA 3C1KA 4K2YA 2DE9A 1AFQC 1DUAA 1ZSKA 2ANWA 2OTVA 4KTUA 2BDAA 3RXJA 3A83A 3QTOH 1C1NA 5E8EH 1BRBE 1XVOA 3ZYEA 3BTQE 1EATA 2ZCLP 4JZEH 1O2IA 1S85A 1TABE 2YNBA 1GJCB 1YPJH 4NCYA 1QA0A 4O3UA 1FIZA 1GMCG 2ZCHP 3QTVH 3OY5U 1ZTKA 1HAZB 1WUNH 2VINA 1RJXB 1S0RA 1TRNA 4TYDA 3ZZ6A 2A7HA 2XC4A 3BF6H 3M36A 5F03A 3UREA 1SGRE 3SU0A 2BVRH 1MMJN 1N6YA 2TPIZ 1AVGH 2SGQE 4B76A 1OSSA 5DP6A 1P2JA 1AI8H 1WBGB 2BXUH 1RIWC 3LH1A 2IN2A 2B5TB 4X1NU 1DWEH 3PMAB 1HAGE 2QC2A 3URCA 1P57B 2Y5GA 2OQUA 3ZZDA 2XWBI 3OTJE 3UR6A 1Y3WA 1Z1JA 2ZGHA 1EZSC 2GDEH 2ZECA 5DO4H 1V2UT 3A8AA 1C5WB 1AUJA 1FJSA 4A1XA 3AASA 3UWJH 1IQGA 1SL3A 1DICA 1TX7A 1YPHE 3SGQE 3W94A 2Z9LA 1TALA 2ZGXH 1O2MA 1SGNE 3JZ1B 1MBMA 1HJ9A 2H9EH 4ABIA 2A5KA 4QT8C 2GV6A 3GICB 1P09A 2BY5X 2TRMA 1C5ZB 1O2RA 4IBLH 1GBCA 3MNCA 2O8MA 1HAVB 2BYAX 4RN6A 4A92A 3Q3KA 1MKXK 2QA9E 1CE5A 4ABDA 2PKAB 1AB9C 1B5GH 2IPHA 4BTIB 3S0NA 1O5CB 3GY8A 3RM2H 3BEUA 4Q7ZA 4DIIH 5T6GA 1DXPA 4ABHA 1TQ0B 1E38B 2BQ7B 2Y7XA 1VJ9U 3RXCA 1J9CH 1F7ZA 3M5MA 1GMHF 6GCHF 1O3LA 1O3OA 6CHAB 2WYGA 3MTYA 2FPZA 2HWLB 4CBOA 3FFGA 4ISNA 1GHZA 4OS5A 1LKBA 1TB6H 1C2KA 3GDUA 4Y0ZE 2J4IA 3SJIA 1ZHRA 1YCPH 1L1NA 2A31A 3UQVA 1P05A 1KDQA 3V12A 1YYY1 1EUFA 3SNCA 3Q3XA 2ZFQH 1W7GH 3U8RH 1C2FA 3HKJB 3N7OA 1C1RA 5EXMA 5A8YA 1SG8B 3AW0A 2WUBA 4KKDA 1Q31A 4INHA 2H9HA 4D9RA 1MQ5A 1V2QT 2OUAA 3PLPA 5C1YA 4AB9A 1ANDA 2XC0A 4ISOA 5E2PA 4NIYA 1GMDG 3SU4A 2TGAA 1PFXC 2BX3A 3M35A 5LPFA 1BMLA 3M37A 1OX1A 2PWXA 1J17T 1K1PA 3MNSA 4IS5A 5DP7A 1DSTA 1ID5H 2XRCA 6CHAC 1CHOG 3S69A 1AZ8A 2XCFA 3MI4A 2GDDA 2HPQH 1O2YA 5L6NH 1AD8H 2AIPA 2VIOA 1BTPA 3Q3YA 1AWHB 1GDUA 1O2OA 2UUFB 1DS2E 1KXEA 2V3OH 4Q7XA 2P8OB 1IQNA 1YBWA 1E37B 1L1JA 4MNWA 1H9IE 4LK4A 2KAIB 3VFEA 1UTPA 2UWLA 2ZG0H 1AY6H 1MTUA 1LMWB 3KL6A 2FOAA 1O5DH 1ZOMA 2QXJA 4I32A 1UTQA 1O5FH 1LVYA 3TJVA 1FQ3A 3KQDA 2NU0E 2AEIH 2Y81A 4H42U 1EZQA 4AX9H 1EJNA 2UWPA 2ZU3A 4CRDA 1HFDA 2ZFFH 3TK6A 1UMAH 1GJBB 2GMTB 1GI6A 4YTAA 2F9NA 2A1DB 3SUDA 2Y6TA 1JMOH 2ALVA 5DP9A 4TWWA 1ETTH 2WPLS 1XKAC 4Y8ZA 2XBYA 4JZ1A 5K7RA 1CA8B 2VWMA 2F91A 1GJ9B 2TGPZ 1GI9B 1H9LB 1QJ1B 1T32A 7GCHF 1THSH 3VB5A 3ZVDA 4O3TA 1UK4A 3KNXA 1HIAB 1IQJA 2D8WA 2P8OC 2ZA5A 3CENA 4GHQA 3BIUH 3K9XB 1V2PT 5T3HA 4YOJA 1H8DH 1KXFA 2EC9H 1SGQE 5L30H 1BBRE 2BY9X 1Y59T 1PPBH 1IHSH 7LPRA 1TPOA 3SU2A 1DY8A 4DW2U 1SVPA 1BTZA 2UUJB 4DIHH 1SSXA 2FX6A 5IYTA 4RSPA 1K1MA 1YPKH 2Y7ZA 1BJVA 2R2WU 5E2OA 4ZROA 1C4U2 1O33A 3TH3H 1UTJA 4X2WA 2CV3A 4MTBA 2ODPA 2ZEBA 5EXLA 1CGIE 1YKTA 2OD3B 3F9HA 3LC3A 1O2ZA 4AOQA 3B23B 4NFEA 1SGTA 4NSVA 1HUTH 1AE5A 3A8BA 2QN5T 3EA8A 4X2YA 1SGPE 3EA9A 5DG6A 4INLA 2PFEA 1O2XA 2GT7A 1O2UA 1HAOH 1FONA 1O3DA 4A7IB 1T8NA 4X6OA 1SI5H 3BTME 3LU9B 4NZQA 2SGFE 3ZZAA 1XVMA 2R9PA 1NTPA 1V2ST 2BD5A 1KTSB 3E8LA 1EAIA 5CHAB 2FI5E 1LHEH 2VWLA 2HPPH 3JZ2B 1CT4E 1T8MA 1NZQH 2ZKSA 4BTTB 1K1IA 5IDKA 4A1VA 2LNCA 4WF8A 1MTVA 3KQCA 2CJIA 2A2QH 4IGDA 1N8OB 2FOFA 3BTHE 1TPPA 2VGCB 1M9UA 1UK2A 2AIQA 4YOGA 4K60A 4IC5A 2PKAA 2HOBA 1D6WA 5E0HA 1T8OA 1KSNA 1C5VA 1P2QA 4K8BA 3PO1C 1C2HA 2QYIA 3KHVA 1HDTH 3M5LA 1AVXA 3QZRA 2VWNA 1BZXE 3MHWU 8ESTE 4X8UH 2F9VA 4BXSA 3UOUA 1O2HA 1FUJA 1GMCF 3GCOA 2Y82A 2XCNA 3D62A 2R3UA 1OP0A 1ETRH 4SGBE 3OY6U 5GDSH 3U8OH 3QLPH 1ELEE 1UO6A 1SFIA 3MO3A 3ATLA 3I29A 4AFSA 3QGJA 5EGMA 1QQUA 1XUGA 4CRFA 1C2IA 5TJXA 4KGAA 4DG4A 3UY9A 3G01A 1HXEH 1HLTH 5CHAC 2A4GA 3MO6A 3PYHA 3NCLA 1NRNH 2OLGA 1YPHC 1O2JA 1EPTC 3VXFH 1XUKA 1YM0A 3AAUA 4ZHMU 3RXHA 2BDHA 1LCYA 1GJDB 1BTHH 3BG4B 1TA6A 1ETSH 1FMGA 1N8OC 4XBBA 3SU6A 1CGJE 4ABGA 2VGCC 4YM9A 2C90B 4LZ1H 3MU8A 2QXIA 3TPIZ 4ESTE 3ATIA 4ABAA 1HAXB 2W7SA 1O36A 1HB0B 2H1UA 1DLKB 1GHWH 3ZVEA 1GBJA 3A86A 2FDAA 2VIVA 4HFPB 4TY6A 4Y11E 1FY3A 1HV7A 2R2MB 3Q77A 3DUXH 3BEFB 5TCAA 2PGQB 5FHTA 5EG4A 1E36B 1P2MA 1S81A 1W3CA 2FS8A 2GZ7A 2FZZA 3E91A 3ZVCA 1VZQH 2JH0D 1QFKH 2ZNKH 1MZAA 2BD9A 1BHXF 1RGQA 2BY7X 2PR3A 4CR9A 1C1MA 3RXEA 2ZU4A 1BMNH 3OX7U 3PMJA 4KTCA 4NIWA 3TNTA 3SU3A 5L2YH 2QAAA 4WH6A 1CHGA 1QBNA 3DD2H 1C1OA 4ABJA 2R0LA 4AG2A 1SGIB 1H4WA 4JYVH 4I31A 3ZZ9A 3NXPA 3U9AH 2KAIA 4ZHAA 1KDQB 1V2RT 4UFGH 1O2TA 3HK6B 3S9AA 4AFUA 1TNGA 1FPHH 3LOXA 1C1TA 3BG4C 4R8TB 5CMXH 1ANBA 5AVDA 1SC8U 2K1QA 1ZRBA 1MKXH 1K1OA 1HJ8A 4WXIA 3A84A 2Z3EA 1KXBA 2P3FH 3F68H 1WU1A 1YLCA 3LJOA 1C1QA 1E0FD 4BAOB 3FP6E 1UVSH 1FN8A 2H5DA 3MNXA 3SJ9A 3A8CA 1W0ZU 1C5LH 1TBZH 1BRAA 1W13U 4CH2B 1TPAE 1C5XB 1J14A 1FXYA 1W2KH 1QRWA 1GDQA 1NFXA 1TA2A 2ZGJA 1OXGA 2SGDE 4Y79A 1T8LA 1Z1IA 3NK8A 3R0FA 5DGJA 1F5LA 5JDUB 2BDIA 1A0HB 1GPZA 2ZTYA 3OU0A 1C4Y2 4MPUA 3M61U 1Y5UT 1Z6EA 1EZUC 1C2MA 2BM2A 2FEQH 2OC8A 1TNKA 1SQTA 4BNRA 3DHKH 1XX9A 3ZVFA 2WPKS 1UCYK 9LPRA 5J4QA 3PWBA 2ZDNA 2FXRA 4NIVA 4MPVA 1O3GA 4YESB 1PQ5A 4X1PU 1AUTC 2R3YA 4NIXA 1C5MD 2BDBA 5PTPA 2ZU1A 1S84A 3SNDA 1HCGA 1ESTA 4Y10E 3BTEE 2HNTC 1F2SE 1FZZA 2VIDA 2IOTA 2FS9A 1RIWB 1GBEA 1O3AA 4MPXA 4WH8A 5JB8S 2RA0A 1OWKA 4X8VH 1H8IH 2HRVA 1EKBB 1WQSA 1TNLA 2NU4E 1IQLA 1DDJA 4RKJB 1WSSH 4AFZA 8GCHF 1QL8A 1PQ7A 1O2KA 4CBNA 5FCRA 1FAKH 4WMEA 1NN6A 1WQVH 2BQWB 3ENSB 1TX8A 1KYNA 1UK3A 1BOQA 5EXNA 1FAXA 1BRUP 1BTUA 2ZP0H 3TH2H 3FANA 4X1QU 4K1EA 1E35B 1TNIA 1EPTA 3RXIA 1GHAG 1Z8IB 1GBAA 1AFEH 5AF9H 3NPSA 1CU1A 4JYUH 5CE1A 1TGNA 1GBHA 1GBLA 3GCTF 3LGYA 2BD2A 2BLVA 2D1JA 4ASHA 5A8XA 4U01A 3TGKE 5FX5A 4K8YA 3ZZ8A 5DPAA 1UTMA 3S9BA 1GVKB 4GCHF 4E06H 5B6OA 1AB9B 1ZSLA 2PSXA 1OKXA 2F9BH 1QHRB 5F6MA 3KQEA 1GCTB 3F9GA 2CHAB 4RKOB 3M3SA 4F49A 1A7SA 4X8TH 3RM0H 1G36A 2G4UA 1GHBF 1LHFH 4UDWH 2A4RA 2SGPE 4HGCA 2OINA 8LPRA 3ZYDA 4TPYA 3TGIE 1TAWA 2QXGA 4JMYA 4D7GA 1YP9A 5LPEA 1O38A 1OYQA 2FX4A 3SHCH 3P8NA 1VITG 1ZHMA 4GVUA 2ALPA 1OWJA 1AO5A 3PV4A 3QDZB 2GVFA 1LHGH 2GX4A 3PLBA 3M5OA 1ELVA 1NPMA 3T25A 3SBKA 2W26A 3E0NB 3RXMA 3MWIU 1FDPA 1EOJA 2BLWA 1TIOA 1GI1A 1GBMA 2FOMB 1TQ7B 2BD8A 3SOSA 2AH4X 1JBUH 1AU8A 1XUIA 5TCCA 3PMBB 2F83A 4YZUA 3RMMH 3LPRA 4Y7BA 4AN7A 2AGGX 1KIGH 2AERH 5H4IB 2Q6FA 1GCTC 1CT0E 2CHAC 2ZDMA 3MNBA 1F5RA 1FY1A 4ISHH 1IQHA 1YCPM 2GCHG 2G81E 1FY8E 1YGCH 3S7KB 3A89A 3A7VA 2EI7A 4ZKOU 1GL1A 3IWMA 3AVZA 5F8TA 1V2JT 1OS8A 4D7FA 1GGDB 4A6LA 1OWHA 4O9VA 4OGYA 2WPJS 1DPOA 1TNHA 4UEHH 3QWCH 1DM4B 2PKSB 4ABBA 2F9PA 2ZFSA 1UHBB 3LIWA 3TK9A 2B7DH 1V2NT 2STAE 1D6RA 2WPIS 1JXPA 2BD7A 4DOQA 2GV7A 2Z94A 2ZPSA 2SNVA 1T31A 2G4TA 4XFQA 1DITH 3EE0B 4DGJA 4FXGH 3TITA 5HM9A 3RXVA 1MCTA 3U98H 5FBEA 3MFJA 5FAHA 1P3CA 3A8DA 1O37A 1LPZB 1O3FA 1GJ4H 2RA3A 1K28D 2Z9GA 3KCGH 3SU5A 1O30A 4FU9A 2P59A 2QXHA 2I6SA 1N1LA 1Y3UA 3MH5A 1P2OA 1SGCA 3HPTB 5LPRA 1WTGH 3O8RA 2ZFTA 3RXUA 1TNJA 4Q80A 3T62A 2ZDAH 1F0UA 2J34A 1TX6A 4X8SH 4AZ2B 1BIOA 1TONA 3M7TA 1P04A 2P95A 3LKWA 2FODA 3A7TA 3OYPA 5K0HA 1GGDC 3KEEA 2FOGA 3QGNB 1XKBC 1EB2A 4JZDH 1CGHA 3PM3A 2A7CA 3A7ZA 1WCZA 2WPHS 2FOHA 3F1SB 3GY4A 2F9OA 4I8GA 5JBAS 1P02A 2CN0H 3S7HB 1NU7B 5GPIB 1THRH 2PKSC 2BDYA 2ZC9H 1FI8A 3GY6A 1GWAA 4D76A 1GBFA 4UFDH 2OC1A 2Q6GA 5GCHF 1XM1A 2OC7A 5SGAE 2RDLA 1MCVA 1S5SA 3NKKA 4Z6AH 3PWCA 1B0EA 3ATKA 1GJAB 2BOKA 5AHGH 5EQQA 1NT1A 1P06A 1RFNA 2BXTH 4MLFB 4XE4A 4NSYA 3TJNA 3UTUH 3NUMA 3ZZCA 1TGTA 1ELGA 2QF0A 3V3MA 2NU3E 4GAWA 3P70B 4A1TA 3O8BA 4K3JA 5C2ZA 1NRQH 1YLDA 5EU8A 5FXLA 3SJKA 3QUMP 2XBXA 2EEKA 1DFPA 1O2VA 4I8HA 2ODQA 3RMOH 1ARCA 3BTWE 1BUIA 3MU0A 1J8AA 1W8BH 2FI4E 2J9NA 1TMTH 3V7TA 1GJ7B 1T7CA 2FLBH 3RMNH 1H1BA 3S9CA 2G5VA 1V2LT 1A3EH 4MNVA 1GJ6A 2A45B 3P8OA 1P11E 4B73A 4X2XA 4UE7H 5ETXA 4ABFA 2P93A 2P3UB 3IITA 2DE8A 5G4BA 3H7TA 2XXLA 1OOKB 2W7UA 1DOJA 3BIVH 1LKAA 2GKVE 4LZ4B 2G5NA 2JH6D 3E90B 1JRSA 1C1UH 4K5ZA 2THFB 4MVNA 1ZYOA 1GHVH 1YC0A 2XTTB 2O8LA 1FPCH 1QA7A 5A0BA 1P0SH 4CR5A 4WVPE 1TBRH 1HAPH 1O5AB 3PO1B 2HLCA 2BVXH 2AGIX 1HGTH 3M5NA 3RXQA 1LVMA 1N6XA 2ZU5A 1LVBA 5GJ4B 4XSKU 4FUEA 1P2KA 1CBWB 2WV4A 2FIRH 5HM2A 1DT2A 1P2IA 5EQRA 3SNEA 3T5FH 4B74A 5C3NA 1TRYA 4ZAEA 1S82A 1V3XA 1C5NH 4GUXA 4ZXXH 3U69H 4PROA 2WUCA 2W5EA 4AYVB 1AMHA 1Z8GA 3GCNA 1VCWA 1SFQB 4CREA 5HXFA 2UWOA 1UCYH 1O3EA 4FUJA 3RXBA 2GCTB 1L4ZA 1FY5A 4ISLA 1EPTB 3STJA 2Q1JA 4X6NA 4NA7A 3I77A 1ZMLA 4Z0KA 1QURH 3T26A 1GBIA 1NM6A 1ZGIA 2Y5HA 1EP6A 4X6PA 1VCQA 1UTLM 1OP2A 2B0FA 2XW9A 3NZIA 2NWNA 3ZV9A 1YPMH 2P16A 4X2VA 2XC5A 2FTLE 1TE0A 2CF8H 4FUBA 2EI6A 4UD9H 4NWLA 1Y3XA 1RRKA 1BDAA 4KELA 4A5TS 1K1JA 2WV5A 2B9LA 1O2NA 4I8LA 1CBWC 3I78A 1IAUA 3PROA 2ODYB 2JETB 2VVVA 4JZIA 1C5OH 1GMHG 4XDEA 6GCHG 1NU9A 1NRRH 4D9QA 2A2XH 3LGTA 3RXFA 1RD3B 3FP8E 4ZMAH 4MDSA 1GI3A 4YT7H 1UHBA 2GCTC 3ODDA 2R0KA 3LGUA 1YF4A 3VB4A 1QY6A 1TWXB 3KQBA 1CQQA 1RTFB 5ABWA 2H6MA 4YLUA 3DT0H 4DVAU 1FN6A 1G3DA 1A46H 4DY7B 1C2LA 2ZFRH 4O97A 2A4OA 3A80A 4AFQA 2I6QA 4NGAH 2BQ6B 1GI0A 1ABIH 1QIXB 3STIA 1SOTA 3K2UA 4R0IA 1GVLA 2ANMH 1AKSB 4AGKA 3PMHB 5FPTA 1OWDA 4JZFH 1C5YB 2G51A 1O2WA 4I7YH 1J16A 3M3VA 2A7JA 2XYAA 1UVOA 5HYOA 4IMZA 2JETC 1KLJH 1TGCA 2EI8A 3E0PB 1MBQA 1MAYA 5EPYA 2W3KA 2BZAA 2ZQ1A 2ZGBH 3ZVGA 2CXVA 1SLXB 3E6PH 3LJJA 3RC4A 2ZDKA 1IOEA 1L0ZA 4FU7A 2O8TA 2HVXA 4JCNA 1MTSA 3CS0A 1O31A 3LGWA 4IW4E 1UVTH 4FUIA 4CHAB 1TRMA 5C1XA 1HXFH 1A3BH 1H9HE 1EXFA 1MQ6A 4AORA 1HJAB 1NFUA 4TPIZ 1SBWA 1CO7E 1QL7A 3DA9B 4K1TA 3RDZA 1RS0A 2V0BA 2ZGCA 1ORFA 2C8ZB 3P17H 4DURA 1SGEE 4U32A 2FYQA 1TYNA 3SUGA 2ZZUH 4B2CA 1MH0A 1QR3E 1V2MT 3L6PA 3MU1A 1G30B 1C2GA 2JH5D 1LTOA 1GVZA 3DFLA 1K9OE 1C5UA 2RCEA 1Z8JB 2WINI 3RXSA 4H6TA 5C5OA 1EZXC 1NS3A 2SGEE 3FZZA 3GYLB 1PYTC 4MPWA 1A5HA 1EP5A 4Y6DA 3T29A 4HI3A 5E0GA 4Y7AA 1ZZZA 3MO9A 2A5AA 1V2OT 2P94A 1A5IA 3IG6B 3A82A 4GLYA 1INCA 1GMDF 4AYYB 4OS6A 1OYTH 5C1UA 1O2PA 1QGFA 1QRXA 1A4WH 3SN8A 4CRAA 1ESBA 1DLEA 2GGVB 7GCHG 1DXWA 1WTHD 4U2WA 1O2QA 4WMFA 3AW1A 1CHOF 1QJ6B 2QCYA 4CHAC 3MH4A 1JWTA 1P8VC 3TH4H 2GD4B 1CA0B 1HJAC 2PW8H 2BD4A 4XOJA 3SV6A 4DCDA 1HNEE 1ESAA 2AS9A 1SOZA 5DP3A 2ZPQA 2D2DA 2PTCE 1WV7H 3MMGA 1G3EA 4I8JA 2JKHA 4BXWA 2CGAA 1A1RA 1AE8H 3QO6A 1MU6B 1SLUB 3UIRA 1Y8TA 2LPRA 5F8ZA 1Y3YA 5JBCS 1BBRK 2HALA 4Y8XA 2QIQA 1T4VH 2XNIA 1Y5AT 2VNTA 3P8FA 4IN1A 1V2TT 3RXTA 2J38A 1C5SA 5EODA 2C8WB 5JBTA 1PJPA 1O3KA 5LGOA 3ESTA 4NA8A 1SGFA 3KIDU 3RXOA 2XBVA 1QNJA 5JPMH 1Q3XA 1TOCB 9ESTA 1IQKA 1OWEA 2J94A 4NFFA 2H9TH 4ABEA 4B2BA 1ZR0A 2XWAA 1ABJH 2Z3CA 4K69A 2Z6BD 2BLOA 2A4QA 2WPMS 3VEQB 2YNAA 3GY7A 3PTBA 2BHGA 4OS7A 1KLIH 2D26C 3P8GA 1QQ4A 2DUCA 3TNSA 3WY8A 3ZVBA 1CA0C 1KXCA 1GJ8B 4BOHA 4Q7YA 1C2DA 1UTOA 3SV9A 5EW2H 2NU2E 3PTNA 1IQEA 1Y3VA 4IC6A 1QCPA 1WYKA 3A7XA 4X1RU 4DJZB 3TIUA 4OS4A 1VITH 2ZF0H 1K21H 1S6FA 5E0JA 1TMUH 5A09A 1EB1H 2Z7FE 2AYWA 1V2WT 2ZHFH 1Y5BT 1A0LA 1O3NA 3SNAA 3UUZA 3DFJA 1SQOA 1MTNB 4CRBA 3TVJB 1G2MA 3GDVA 2VH0A 4BTUB 4FVDA 3K6ZA 1FV9A 4MNYA 1BMAA 1MU8B 1QJ7B 3SGAE 1C1WH 4ZXYH 1YPGH 1V6DA 2Q6DA 2TBSA 4SGAE 3V0XA 1C9PA 1TOMH 3O8DA 1LHCH 3KN2A 1ZTLA 2BB4A 2PUXB 2SFAA 1CT2E 3SGBE 5I46H 3SO3A 2A5IA 5I25A 3ZZ4A 1TFXA 2YOLA 1TPSA 2H5CA 3K6YA 4BAKB 1O0DH 2BDCA 3TLOA 1G32B 3EDXB 1NC6A 1W0YH 4YO9A 3VB3A 2HNTF 1EAXA 5GIBA 4MG3A 4E05H 1GI7B 3H7OA 1ZTJA 1AKSA 3LT3A 1HAYB 2BVSH 1BITA 1DE7H 3MH7A 4YLQH 1AN1E 1UVUH 3GISB 2ZWLH 2IJOB 3HKIB 1A2CH 1NRPH 2EA3A 3D49H 1MTNC 1C5RA 2BDGA 3B8JA 1D3TB 3BTKE 5DJ7A 1MAXA 3TJUA 3A87A 2PSYA 3MU4A 1PPCE 5C67A 3RXAA 3GY3A 1W12U 4M7GA 3SQHE 3ATWA 1HPGA 4B71A 3VB7A 3H5CB 3O8CA 1ZPBA 1VCPA 3RU4T 1RTKA 4XBDA 6ESTA 1VJAU 3BEIB 1ANEA 5J4SA 1LPKB 3BTDE 1MKWK 2ZCKP 1SHHB 1PQAA 3EQ0H 3FVFB 1F0RA 1YPEH 2AFQB 2A0QB 4UFEH 4DT7B 1Q2WA 1PYTD 1O2LA 1GL0E 1SMFE 4TWYA 1A0JA 1TGSZ 1NFYA 2VWOA 2ULLA 3TK5A 1ACBE 5EPNA 2PGBB 3SJ8A 2BY6X 2FESH 1ZHPA 4GHTA 5T6DA 1VGCB 1RXPA 4KTSA 2OBOA 1BMMH 1PPGE 2PLXA 2ZDLA 1P10A 1SGFG 1XMNB 1P12E 1SHYA 1ZMNA 3RXKA 1AZZA 1O3PB 1TGBA 5DK1A 1SLVB 1JOUB 1C1PA 4Y8YA 5C5NA 2ZDVH 1G37A 1SGDE 2Z9KA 2ZO3H 3FZDA 4E7NA 1JIRA 2ANYA 1W14U 1SGYE 1ANCA 1L2EA 3PB1E 2FO9A 2GTBA 3MOCA 4TY7A 4X1SU 1P3EA 3SV2H 2BLQA 1C5PA 3CP7A 1DWBH 4ZUHA 1G3CA 3LGIA 1W7XH 2OXSA 3LC5A 1XUJA 1C2JA 2V6NA 1ELFA 3A88A 1SLWB 1C4V2 1C5QA 2C3SA 3RXLA 4I33A 3RC5A 3GY2A 2C93B 1QBVH 2BMGB 2B8OH 1BRCE 4MQAA 3RLYH 4FUCA 2ASUB 3UNQA 1P9SA 3UNRA 3LH3A 3C27B 5FBIA 5EOKA 1NO9H 5FPSA 7KMEH 2ILNA 1VR1H 1VGCC 4AGJA 2C8XB 1XUHA 2BTCE 1DY9A 4MNXA 1KXDA 1P2NA 3HATH 4B75A 1K1LA 1HAHH 2ZHWH 1KY9A 3U1IB 2F9UA 2OP9A 1F5KU 4JK5A 1ARBA 2FLRH 3EA7A 2ZHQH 3P95A 2ZHEH 1GI2A 1AQ7A 3BTGE 5C20A 3RLWH 3RXDA 2HNTE 1G9IE 1KLTA 3U1JB 2PUQH 1BA8B 1BQYA 2C8YB 1S6HA 2C4FH 2F3CE 2SGAA 2SNWA 3UNSA 4OS2A 1K2I1 3UR9A 5FX6A 1L4DA 1DANH 1ELBA 4AG1A 8GCHG 1P01A 1MUEB 3MYWA 1XUFA 3L33A 4AB8A 4Y71A 3VB6A 1BCUH 2V3HH 3BG8A 1NRSH 3EYDA 1ZSJA 1PPZA 4FUFA 1LPGB 4HTCH 1HYLA 1BHXB 3GOVB 3M7QA 1MZDA 3GCHB 1PPHE 3ZZ3A 2H2ZA 1FIWA 1ELAA 1GHXH 1SQAA 1D9IA 2FTMA 1PPFE 1O35A 3SQEE 1UCYE 3K65B 4ZH8A 1BTWA 1HAIH 1TLDA 3RU4D 3TGJE 1GBBA 1SB1H 1UJ1A 1QRZA 2QGRA 3GCTG 1ZRKA 4VGCB 1ZLRA 2WYJA 1U6QA 2Z9IA 4INKA 1GBKA 4I8KA 3EAJA 2STBE 1C2EA 1XXDA 2FOCA 3FP7E 4FUHA 1QB1A 3LDXH 4CRCA 4UONA 4Y0YE 4GCHG 3P92A 1GI5A 1MTWA 1Z7KA 3EGKH 2VH6A 1MD7A 2ZIQH 4GSOA 2ZHDA 1Z6JH 1E34B 2A32A 1GBTA 2GZ8A 1O3IA 3ZZ7A 4ZKNU 4U30A 2ZTXA 1GHBG 3T27A 4ZHLU 1AWFH 4J2YB 3VXEH 3T2NA 1HBTH 3RU4E 4FUDA 1P9UA 2G55A 3U8TH 2BOHB 2GMTC 3Q76A 5FPYA 4B1TA 2G00A 3ZZ5A 2FOBA 4WMDA 2TGTA 4B2AA 3GCHC 5DP5A 3SUFA 3QN7A 2RG3A 1EX3A 3HK3B 5BPEA 3P6ZB 5A2MH 3W95A 2QF3A 2VJ1A 1O34A 1GG6B 1PPEE 2VB0A 1O5EH 2TGDA 3SW2B 1BBRH 3ZZBA 1S83A 1MD8A 1YCPK 4VGCC 2AMPA 1GHAF 2QY0B 3URDA 2FYRA 5A8ZA 5GWZA 3SUEA 1B7XB 3SU1A 1NROH 6LPRA 4CRGA 1F0TA 1YPLH 1AGJA 3FAOA 4FU8A 4YOIA 4F4OC 1O3MA 1SPJA 1HAVA 2FWWA 1Z8RA
chains in the Genus database with same CATH superfamily
1NFWA 5LH8A 1ZPZA 3VPKA 1BB0B 3BTTE 4D8NA 4BANB 2J92A 2VVCA 3SV8A 3GY5A 4ISIH 1TMBH 4X0WU 2AMDA 2L6OA 5EW1H 3ATMA 1O5BB 5FCKA 4BAQB 3HGPA 2O8UA 3RC6A 1QTFA 2OBQA 1LDTT 3RP2A 1C5TA 4JK6A 3RXPA 1BTYA 3AAVA 2YMSD 4CH8B 1NESE 5AFYH 1DSUA 1A61H 1IHTH 2P3TB 2OCVB 5A0CA 3E16B 2BZ6H 1DWCH 5GXPA 3PLKA 2V35A 3UPEA 4NA9H 1GI4A 3KYGA 3SJOA 1VITF 1GG6C 1J15A 1OP8A 3A85A 1V2KT 1ELDE 2QF4A 4Q2KA 1X7AC 4ZKRU 3BN9A 5F8XA 7ESTE 1ZJDA 1O2GH 3N7DA 2ZI2H 4GPGA 1THPB 4H6SB 3RXRA 1QBOA 2FM2A 2KM0A 2OC0A 4IN2A 5ESTE 2BX4A 4XBCA 5AFZH 3UOPA 3E1XB 3M7UA 4X6MA 1K22H 2UUKB 2PV9B 1GBDA 5EQSA 2XBWA 2BD3A 5L2ZH 2UUYA 3KGPA 1GDNA 5ESBA 2TIOA 1JRTA 1QB9A 1P03A 1QL9A 4JYTA 1UTNA 4YT6H 1UW7A 3QX5H 3OAAD 3UFAA 4BAMB 1W11U 1EQ9A 2CF9H 3OSYA 2G52A 4K1SA 5HGGA 2GCHF 2ZQ2A 1DUEA 1ZMJA 1BTXA 3RXGA 2AGEX 4UFFH 1G2LA 1GJ5H 2Y80A 3KF2A 3ELAH 1O3JA 4H4FA 1KTTB 1C1VH 4NG9H 4O03A 3SZNA 4E7RG 1D3DB 3L3TA 3V13A 3ODFA 5GCHG 5A0AE 1BT7A 3MH6A 3BTFE 1SR5C 1GHYH 4WY3A 1LHDH 2WPDD 1O3CA 1EASA 3SI3H 2G8TA 1AHTH 2VIWA 2FP7B 2O8WA 3F6UH 5JBBS 2HGTH 2VU8E 3NWUA 2O9QA 4LXBH 2ZPRA 1FY4A 1RTLA 1LQEA 1QB6A 3D65E 1EJMA 3BV9B 3MU5A 1EAWA 1ELCA 1F92A 2M5TA 2ZTZA 3RUOA 1C1SA 1PQ8A 3QK1A 3LONA 2BY8X 1ZPCA 4ASUD 2GZ9A 2QV1A 3D23A 3F9EA 1C9TA 1TBQH 4WXVA 5BRRE 2VIPA 1W10U 4WWYA 1DWDH 1AVWA 1OWIA 5JB9S 3ZIAD 4OGXA 3ITIA 1T4UH 2Y5FA 1MKWH 1LO6A 1LQDB 2NU1E 2PHBA 1D3PB 3VGCB 1QZ8A 1A5GH 4ACBA 4NZLA 2ESTE 2ANKH 4WJG2 2PTNA 3RMLH 3LGVA 3TJOA 3ZV8A 1O3BA 2VVUA 3SHAH 1ZJKA 4NWKA 3GYMA 4AC9A 3F9FA 3A81A 1O32A 2J2UA 4OS1A 3BSQA 1FNIA 1EAUA 1HIAA 1S0QA 5T6FA 3GDSA 1HRTH 1O3HA 4Y76A 1AFQB 2FMJA 1BJUA 1FLEE 1EOLA 1L1GA 1OPHB 3HGNA 1G3BA 3SNBA 1DX5M 5DP4A 1UVPA 8KME2 1IQMA 3A7WA 2ZU2A 2J95A 3A7YA 2ZFPH 5DKMA 3B9FH 2VIQA 2CMYA 3SI4H 2Z3DA 4THNH 5C94A 3MQKC 3CS7A 3AK5A 3KYFA 3ZVAA 1CSOE 1B0FA 1GI8B 1IQFA 1LVOA 2W3IA 1F0SA 4ZKSU 2Z9JA 1UTKA 4FVBA 3E3TA 1K1NA 1CVWH 1GCDA 4LOYH 1O5GH 3UQOA 2GT8A 1DVAH 3SORA 3Q00A 1D3QB 4HZHA 3SV7A 3QZQA 1O39A 2FI3E 1XXFA 1ZGVA 4FUGA 1V2VT 3VGCC 2FOEA 4J1YA 5HMAA 3T28A 1D4PB 1Z71A 1ELTA 1O2SA 1JIMA 1NY22 2OQ5A 5B6LA 1KXAA 1WOFA 3UWIA 5DP8A 3TU7H 5JYIA 3R3GB 1IQIA 4IMQA 1EJAA 4BAHB 3M3TA 1WAYB 4KP0A 2GP9B 1AIXH 2AMQA 1KMHB 3C1KA 4K2YA 2DE9A 1AFQC 3PV5A 1DUAA 1ZSKA 2ANWA 2OTVA 4KTUA 2BDAA 3RXJA 3A83A 3QTOH 3SYJA 1C1NA 5E8EH 1BRBE 1XVOA 3ZYEA 3BTQE 1EATA 2ZCLP 4JZEH 1O2IA 1S85A 1TABE 2YNBA 1GJCB 1YPJH 4NCYA 1QA0A 4O3UA 1FIZA 1GMCG 2ZCHP 3QTVH 3OY5U 1ZTKA 1HAZB 1WUNH 2VINA 1RJXB 1S0RA 1TRNA 4TYDA 3ZZ6A 2A7HA 2XC4A 3BF6H 3M36A 5F03A 3UREA 1SGRE 3SU0A 2BVRH 1MMJN 1N6YA 2TPIZ 1AVGH 1NBMD 2SGQE 4B76A 1OSSA 5DP6A 1P2JA 1AI8H 1WBGB 2BXUH 1RIWC 2JJ2D 3LH1A 2IN2A 2B5TB 4X1NU 1DWEH 3PMAB 1HAGE 2QC2A 3URCA 1P57B 2Y5GA 2OQUA 3ZZDA 2XWBI 3OTJE 3UR6A 1Y3WA 1Z1JA 2QE7D 2ZGHA 1EZSC 2GDEH 2ZECA 5DO4H 1V2UT 3A8AA 1C5WB 1AUJA 3CNRA 1FJSA 4A1XA 3F0OA 3AASA 3UWJH 1IQGA 1SL3A 1DICA 1TX7A 4YXWD 1YPHE 3SGQE 3W94A 2Z9LA 1TALA 2ZGXH 1O2MA 1SGNE 3JZ1B 1MBMA 1H8ED 1HJ9A 2H9EH 4ABIA 2A5KA 4QT8C 2GV6A 3GICB 1P09A 2BY5X 2TRMA 1C5ZB 1O2RA 4IBLH 1GBCA 3MNCA 2O8MA 1HAVB 2BYAX 4RN6A 4A92A 3Q3KA 1MKXK 2QA9E 1CE5A 4ABDA 2PKAB 1AB9C 1B5GH 2IPHA 4BTIB 3S0NA 2HLDD 1O5CB 3GY8A 3RM2H 3BEUA 4Q7ZA 4DIIH 5T6GA 1DXPA 4ABHA 1TQ0B 1E38B 2BQ7B 2Y7XA 1VJ9U 3RXCA 1J9CH 1F7ZA 3M5MA 1GMHF 6GCHF 1O3LA 1O3OA 6CHAB 2WYGA 3MTYA 2FPZA 2HWLB 4CBOA 3FFGA 4ISNA 1GHZA 4OS5A 1LKBA 1TB6H 2JIZD 1C2KA 3GDUA 4Y0ZE 2J4IA 3SJIA 1ZHRA 4OM9A 1YCPH 1L1NA 2A31A 3UQVA 1P05A 1KDQA 3V12A 1YYY1 1EUFA 3SNCA 3WW7A 3Q3XA 2ZFQH 1W7GH 3U8RH 1C2FA 1YY3A 3HKJB 1OHHD 3N7OA 1C1RA 5EXMA 5A8YA 1SG8B 3AW0A 2WUBA 4KKDA 1Q31A 3PRBA 4INHA 3FKSD 2H9HA 4D9RA 1MQ5A 1V2QT 2OUAA 3PLPA 5C1YA 4AB9A 2KCOA 1ANDA 2XC0A 4ISOA 5E2PA 4NIYA 1GMDG 3WWFA 3SU4A 2TGAA 1PFXC 2BX3A 3M35A 5LPFA 1BMLA 3M37A 1OX1A 2PWXA 1J17T 1K1PA 3MNSA 4IS5A 5DP7A 1DSTA 3F2HA 1ID5H 3OE7D 2XRCA 6CHAC 1CHOG 3S69A 1AZ8A 3NRLA 2XCFA 3MI4A 2GDDA 2HPQH 1O2YA 5L6NH 1AD8H 2AIPA 2VIOA 1BTPA 3Q3YA 5EJLA 1AWHB 1GDUA 1O2OA 2UUFB 1DS2E 1KXEA 2V3OH 4Q7XA 2P8OB 1IQNA 1YBWA 1E37B 1L1JA 4MNWA 1H9IE 4LK4A 2KAIB 3VFEA 1UTPA 2UWLA 2ZG0H 1AY6H 1MTUA 1LMWB 3KL6A 2FOAA 1O5DH 1ZOMA 2QXJA 4I32A 1UTQA 1O5FH 1LVYA 3TJVA 1FQ3A 3KQDA 2NU0E 2AEIH 2Y81A 4H42U 1EZQA 4AX9H 1EJNA 2UWPA 2ZU3A 4CRDA 1HFDA 2ZFFH 3TK6A 1UMAH 1GJBB 2GMTB 1GI6A 4YTAA 2F9NA 2A1DB 3SUDA 2Y6TA 1JMOH 2ALVA 5DP9A 4TWWA 1ETTH 2WPLS 1XKAC 4Y8ZA 2XBYA 4JZ1A 5K7RA 1CA8B 2VWMA 2F91A 1GJ9B 2TGPZ 1GI9B 1H9LB 1QJ1B 1WXRA 1T32A 7GCHF 1THSH 3VB5A 3ZVDA 4O3TA 1UK4A 3KNXA 1HIAB 1IQJA 2D8WA 2P8OC 2ZA5A 3CENA 4GHQA 3BIUH 3K9XB 1V2PT 5T3HA 4YOJA 1H8DH 1KXFA 2EC9H 1SGQE 5L30H 1BBRE 2BY9X 1Y59T 4FOUC 1PPBH 1IHSH 7LPRA 1TPOA 3SU2A 1DY8A 4DW2U 3SZEA 1SVPA 1BTZA 2UUJB 4DIHH 1YLNA 1SSXA 2FX6A 5IYTA 4RSPA 1K1MA 1YPKH 2Y7ZA 1BJVA 2R2WU 5E2OA 4ZROA 1C4U2 1O33A 3TH3H 1UTJA 2IJD1 4X2WA 2CV3A 4MTBA 2ODPA 2ZEBA 5EXLA 1CGIE 1YKTA 2OD3B 3F9HA 3LC3A 1O2ZA 4AOQA 3B23B 4NFEA 1SGTA 4NSVA 1HUTH 1AE5A 3A8BA 2QN5T 3EA8A 4X2YA 1SGPE 3EA9A 5DG6A 4INLA 3FO8D 2PFEA 1O2XA 2GT7A 1O2UA 1HAOH 1FONA 1O3DA 1WDIA 2LP6A 4A7IB 1T8NA 4X6OA 1SI5H 2CK3D 3BTME 3LU9B 4NZQA 2KZ4A 2SGFE 3ZZAA 1XVMA 2R9PA 1NTPA 1V2ST 2BD5A 1KTSB 3E8LA 1EAIA 5CHAB 2FI5E 1LHEH 2VWLA 2HPPH 3JZ2B 1CT4E 1T8MA 1NZQH 2ZKSA 4BTTB 1K1IA 5IDKA 4A1VA 2LNCA 4WF8A 1MTVA 3KQCA 2CJIA 2A2QH 4IGDA 1N8OB 2FOFA 3BTHE 1TPPA 2VGCB 1M9UA 1UK2A 2AIQA 4YOGA 4K60A 4IC5A 2PKAA 2HOBA 1D6WA 5E0HA 1T8OA 1KSNA 1C5VA 1P2QA 4K8BA 4P00A 3PO1C 1C2HA 2QYIA 3KHVA 1HDTH 3M5LA 1AVXA 3QZRA 2KCPA 2VWNA 1BZXE 3MHWU 8ESTE 4X8UH 2F9VA 4BXSA 3UOUA 1O2HA 1FUJA 1GMCF 3GCOA 2Y82A 2XCNA 3D62A 2R3UA 1OP0A 1ETRH 4SGBE 3OY6U 5GDSH 3U8OH 3QLPH 1ELEE 1UO6A 4TT3D 1SFIA 3MO3A 3ATLA 3I29A 4AFSA 3QGJA 5EGMA 1QQUA 1XUGA 4CRFA 1C2IA 5TJXA 4KGAA 4DG4A 3UY9A 3G01A 1HXEH 1HLTH 5CHAC 2A4GA 3MO6A 3PYHA 3NCLA 1NRNH 2OLGA 1YPHC 1O2JA 1EPTC 3VXFH 1XUKA 1YM0A 3AAUA 4ZHMU 3RXHA 2BDHA 1LCYA 1GJDB 1BTHH 3BG4B 1TA6A 1ETSH 1FMGA 1N8OC 4XBBA 3SU6A 1CGJE 4ABGA 2VGCC 4YM9A 2C90B 4LZ1H 3MU8A 2QXIA 3OEED 3TPIZ 4ESTE 3ATIA 4ABAA 1HAXB 2W7SA 1O36A 1HB0B 2H1UA 1DLKB 1GHWH 3ZVEA 1GBJA 3DSPA 3A86A 2FDAA 2VIVA 4HFPB 4TY6A 4Y11E 1FY3A 1HV7A 2R2MB 3Q77A 3DUXH 3BEFB 5TCAA 2PGQB 5FHTA 5EG4A 1E36B 1P2MA 1S81A 1W3CA 2FS8A 2GZ7A 4RT0A 2FZZA 3E91A 3ZVCA 1VZQH 2JH0D 1QFKH 2ZNKH 1MZAA 2BD9A 1BHXF 1RGQA 2BY7X 2PR3A 4CR9A 1C1MA 3RXEA 2ZU4A 1BMNH 3OX7U 3PMJA 4KTCA 4NIWA 3TNTA 3SU3A 5L2YH 2QAAA 4WH6A 1CHGA 1QBNA 3DD2H 1C1OA 4ABJA 2R0LA 4AG2A 1SGIB 1H4WA 4JYVH 4F48B 4I31A 3ZZ9A 3NXPA 3U9AH 2KAIA 3FOAA 4ZHAA 1KDQB 1V2RT 4UFGH 1O2TA 3FN8A 3HK6B 3S9AA 4ACAA 4AFUA 5KECA 1TNGA 1FPHH 3LOXA 1C1TA 3BG4C 5EIYA 4R8TB 5CMXH 1ANBA 5AVDA 3DSGA 1SC8U 2K1QA 1ZRBA 1MKXH 1K1OA 1HJ8A 4WXIA 3A84A 2Z3EA 1KXBA 2P3FH 3F68H 1WU1A 1YLCA 3LJOA 1C1QA 1E0FD 4BAOB 5C0TA 1MABB 3FP6E 1UVSH 1FN8A 2H5DA 3MNXA 3SJ9A 5CHBA 3A8CA 1W0ZU 1C5LH 1TBZH 1BRAA 1W13U 4CH2B 1TPAE 1C5XB 1J14A 1FXYA 1W2KH 1QRWA 1GDQA 1NFXA 1TA2A 2ZGJA 3EE7A 1OXGA 2SGDE 2GJGA 4Y79A 4XRNA 1T8LA 1Z1IA 3NK8A 3R0FA 5DGJA 1F5LA 5KGOA 5JDUB 2BDIA 1A0HB 1GPZA 2ZTYA 3OU0A 1C4Y2 4MPUA 3M61U 1Y5UT 1Z6EA 1EZUC 1C2MA 2BM2A 2FEQH 3KQ5A 2OC8A 1TNKA 1SQTA 4BNRA 3DHKH 1XX9A 3ZVFA 2WPKS 1UCYK 9LPRA 5J4QA 3PWBA 2ZDNA 4F55A 2FXRA 4NIVA 4MPVA 1O3GA 4YESB 1PQ5A 4X1PU 1AUTC 2R3YA 4NIXA 1C5MD 2BDBA 5PTPA 2ZU1A 1S84A 2F43B 2LELA 2XOKD 3SNDA 1HCGA 1ESTA 4Y10E 3BTEE 2HNTC 1F2SE 3DCLA 2RFKC 1FZZA 2VIDA 2IOTA 2FS9A 1RIWB 1GBEA 3F0PA 1O3AA 3OTPA 4MPXA 4WH8A 5JB8S 2RA0A 1OWKA 4X8VH 1H8IH 2HRVA 1EKBB 1WQSA 1TNLA 2NU4E 1IQLA 1DDJA 4RKJB 1E1QD 1WSSH 4AFZA 8GCHF 1QL8A 1PQ7A 1O2KA 4CBNA 5FCRA 1FAKH 4WMEA 1NN6A 1WQVH 2BQWB 3ENSB 1TX8A 1KYNA 4Z1MD 1UK3A 1BOQA 5EXNA 1FAXA 1BRUP 1BTUA 2ZP0H 3TH2H 3FANA 4X1QU 4K1EA 1E35B 1TNIA 1EPTA 3RXIA 5KEDA 1GHAG 1Z8IB 1GBAA 1AFEH 5AF9H 3NPSA 1CU1A 4JYUH 5CE1A 1TGNA 1GBHA 1GBLA 3GCTF 4I86A 3LGYA 2BD2A 2BLVA 2D1JA 4ASHA 5A8XA 2WV9A 4U01A 3TGKE 5FX5A 4K8YA 3ZZ8A 5DPAA 1UTMA 3S9BA 1GVKB 4GCHF 4E06H 5B6OA 1AB9B 2V7QD 1ZSLA 2PSXA 1OKXA 2F9BH 1QHRB 5F6MA 3KQEA 1GCTB 3F9GA 2CHAB 4RKOB 3M3SA 4F49A 3F2GA 1A7SA 4X8TH 3RM0H 1G36A 2G4UA 4P02A 2KX4A 1GHBF 1LHFH 4UDWH 2A4RA 2SGPE 4HGCA 2OINA 8LPRA 3ZYDA 4TPYA 3TGIE 1TAWA 2QXGA 4JMYA 4D7GA 1YP9A 5LPEA 1O38A 1OYQA 2FX4A 3SHCH 3P8NA 1VITG 1ZHMA 4GVUA 2ALPA 1OWJA 1AO5A 3PV4A 3QDZB 2GVFA 1LHGH 2GX4A 3PLBA 3M5OA 1ELVA 1NPMA 3T25A 3SBKA 2W26A 1NBME 3E0NB 3RXMA 3MWIU 1FDPA 1EOJA 2BLWA 1TIOA 1GI1A 1GBMA 2FOMB 1TQ7B 2BD8A 3SOSA 2AH4X 1JBUH 1AU8A 2YMSB 1XUIA 5TCCA 3PMBB 2F83A 4YZUA 3RMMH 3LPRA 4Y7BA 4AN7A 2AGGX 1KIGH 2M2AA 2AERH 5H4IB 2Q6FA 1GCTC 1CT0E 2CHAC 2ZDMA 3MNBA 1F5RA 1FY1A 4ISHH 4DT4A 1IQHA 1YCPM 2GCHG 2G81E 1FY8E 1YGCH 3S7KB 3A89A 3A7VA 2EI7A 4ZKOU 1GL1A 3IWMA 3AVZA 5F8TA 3VG8A 1V2JT 1OS8A 4D7FA 1GGDB 4A6LA 1OWHA 4O9VA 4OGYA 2WPJS 1DPOA 1TNHA 4UEHH 3QWCH 2QF5A 5EJ1A 1DM4B 2PKSB 4ABBA 2F9PA 2ZFSA 1UHBB 3LIWA 3TK9A 2B7DH 1V2NT 2STAE 1D6RA 2WPIS 1JXPA 2BD7A 4DOQA 2GV7A 2Z94A 2ZPSA 2SNVA 1T31A 2G4TA 4XFQA 1DITH 3EE0B 4DGJA 4FXGH 3TITA 5HM9A 3RXVA 1MCTA 3U98H 2YMSC 5FBEA 3MFJA 5FAHA 1P3CA 3A8DA 1O37A 2KCAA 1LPZB 1O3FA 1GJ4H 2RA3A 1K28D 2Z9GA 3KCGH 3SU5A 1O30A 4FU9A 2P59A 2QXHA 2I6SA 1N1LA 1Y3UA 3MH5A 4B6EA 1P2OA 1SGCA 3HPTB 5LPRA 1WTGH 3O8RA 2ZFTA 3RXUA 1TNJA 4Q80A 3T62A 2ZDAH 5FL7D 1F0UA 2J34A 1TX6A 4X8SH 4AZ2B 1BIOA 4Q63A 1TONA 3M7TA 5DN6D 1P04A 1W0KD 2P95A 3LKWA 2FODA 3A7TA 3OYPA 5K0HA 1GGDC 3KEEA 2FOGA 3QGNB 1XKBC 1EB2A 4JZDH 1CGHA 3PM3A 2A7CA 3A7ZA 1WCZA 2WPHS 3UAIC 2FOHA 3F1SB 3GY4A 2F9OA 4I8GA 5JBAS 1P02A 2CN0H 3S7HB 1NU7B 5GPIB 3U28C 1THRH 2PKSC 2BDYA 2ZC9H 1FI8A 3GY6A 1GWAA 4D76A 1GBFA 4Q4LA 4UFDH 2OC1A 2Q6GA 5GCHF 1XM1A 3OEHD 2OC7A 5SGAE 2RDLA 1MCVA 1S5SA 3NKKA 4Z6AH 3PWCA 1B0EA 3ATKA 1GJAB 2BOKA 5AHGH 5EQQA 1NT1A 1P06A 1RFNA 2BXTH 4MLFB 4XE4A 4NSYA 2EY4C 3TJNA 3UTUH 3NUMA 3ZZCA 1TGTA 1ELGA 2QF0A 3V3MA 2NU3E 4GAWA 3P70B 4A1TA 3O8BA 4K3JA 5C2ZA 1NRQH 1YLDA 5EU8A 5FXLA 3SJKA 3QUMP 2XBXA 2EEKA 2J98A 1DFPA 1O2VA 4I8HA 2ODQA 3RMOH 1ARCA 3BTWE 1BUIA 3MU0A 1J8AA 1W8BH 2FI4E 2VBCA 2J9NA 1TMTH 3V7TA 1GJ7B 1T7CA 2FLBH 3RMNH 1H1BA 3S9CA 2G5VA 1V2LT 1A3EH 4MNVA 1GJ6A 2A45B 3F2FA 3P8OA 1P11E 4B73A 4X2XA 4UE7H 5ETXA 4ABFA 2P93A 2P3UB 3IITA 2DE8A 5G4BA 3H7TA 2XXLA 1OOKB 2W7UA 2WSSD 1DOJA 3BIVH 1LKAA 2GKVE 4LZ4B 2G5NA 2JH6D 3E90B 1JRSA 1C1UH 4K5ZA 2THFB 4MVNA 1ZYOA 1GHVH 1YC0A 2XTTB 1FPCH 1QA7A 2O8LA 5A0BA 1P0SH 4CR5A 4WVPE 1TBRH 1HAPH 1O5AB 4XD7D 2JJ1D 3PO1B 2HLCA 2BVXH 2AGIX 1HGTH 3M5NA 3RXQA 1LVMA 1N6XA 2ZU5A 1LVBA 2KFWA 5GJ4B 4XSKU 4FUEA 1P2KA 1CBWB 2WV4A 2FIRH 5HM2A 1DT2A 1P2IA 5EQRA 3SNEA 3T5FH 4B74A 5C3NA 1TRYA 4ZAEA 1S82A 1V3XA 1C5NH 4GUXA 4ZXXH 3U69H 4PROA 2WUCA 2W5EA 4AYVB 1AMHA 1Z8GA 3GCNA 1VCWA 1SFQB 4CREA 5HXFA 2UWOA 1UCYH 1O3EA 4FUJA 3RXBA 2GCTB 1L4ZA 1FY5A 4ISLA 1EPTB 3STJA 2Q1JA 4X6NA 4NA7A 3I77A 1ZMLA 4Z0KA 2PP6A 1QURH 3T26A 1GBIA 1NM6A 1ZGIA 2Y5HA 1EP6A 4X6PA 1VCQA 1UTLM 1OP2A 2B0FA 2XW9A 3NZIA 2NWNA 3ZV9A 1YPMH 2P16A 4X2VA 2XC5A 2FTLE 1TE0A 2CF8H 4FUBA 2EI6A 2WZQA 4UD9H 4NWLA 1Y3XA 1RRKA 1BDAA 4KELA 4A5TS 1K1JA 2WV5A 1H8HD 2B9LA 1O2NA 4I8LA 1CBWC 3I78A 1IAUA 3PROA 2ODYB 2JETB 2VVVA 4JZIA 1C5OH 1GMHG 4XDEA 6GCHG 1NU9A 1NRRH 4D9QA 2A2XH 3UB0A 3PRDA 3LGTA 3RXFA 1RD3B 3FP8E 4ZMAH 4HG6A 4MDSA 1GI3A 4YT7H 1UHBA 2GCTC 3ODDA 2R0KA 3LGUA 1YF4A 3VB4A 1QY6A 1TWXB 3KQBA 1CQQA 1RTFB 5ABWA 2H6MA 4YLUA 3DT0H 4DVAU 1FN6A 1G3DA 1A46H 4DY7B 1C2LA 2ZFRH 4O97A 2A4OA 3A80A 4AFQA 2I6QA 4NGAH 5HIZA 2BQ6B 1FX0B 1GI0A 2K8IA 1ABIH 1QIXB 3STIA 1SOTA 3K2UA 4R0IA 1GVLA 2ANMH 1AKSB 2W6JD 4AGKA 3PMHB 5FPTA 1OWDA 4JZFH 1C5YB 2G51A 1O2WA 4I7YH 1J16A 3M3VA 2A7JA 2XYAA 1UVOA 5HYOA 4IMZA 2JETC 1KLJH 1TGCA 2EI8A 3E0PB 5C17A 1MBQA 1MAYA 5EPYA 2W3KA 2BZAA 2ZQ1A 2ZGBH 3N7EA 5GNDA 2CXVA 1SLXB 3ZVGA 3E6PH 3LJJA 3RC4A 2ZDKA 1IOEA 1L0ZA 4FU7A 2O8TA 2HVXA 4JCNA 2OK5A 1MTSA 3CS0A 1O31A 2KCYA 3LGWA 4IW4E 1UVTH 4FUIA 4CHAB 1TRMA 5C1XA 5T1VA 1HXFH 1A3BH 1H9HE 1EXFA 1MQ6A 4AORA 1HJAB 1NFUA 4TPIZ 1SBWA 1CO7E 1QL7A 3DA9B 4K1TA 3RDZA 1RS0A 2V0BA 2ZGCA 1ORFA 2C8ZB 3P17H 4DURA 1SGEE 4U32A 2FYQA 1TYNA 3SUGA 2ZZUH 4B2CA 1MH0A 3WWBA 1QR3E 1V2MT 3L6PA 3MU1A 1G30B 1C2GA 2JH5D 1LTOA 2J97A 1GVZA 3DFLA 1K9OE 1C5UA 2RCEA 4ZCNA 1Z8JB 2WINI 3RXSA 4H6TA 5C5OA 1EZXC 1NS3A 2SGEE 3FZZA 3GYLB 1PYTC 4MPWA 1A5HA 1EP5A 4Y6DA 3T29A 3W1EA 4HI3A 5E0GA 4Y7AA 1ZZZA 3MO9A 2A5AA 1V2OT 2JDID 2P94A 1A5IA 3IG6B 3A82A 4GLYA 1INCA 1SQRA 1GMDF 4AYYB 4OS6A 1OYTH 5C1UA 1O2PA 1QGFA 1QRXA 1A4WH 3SN8A 4CRAA 1ESBA 1DLEA 2GGVB 7GCHG 1DXWA 1WTHD 4U2WA 1O2QA 1SKYE 4WMFA 3AW1A 1CHOF 1QJ6B 2QCYA 4CHAC 3MH4A 1JWTA 1P8VC 3TH4H 5EJZA 2GD4B 1CA0B 1HJAC 2PW8H 2BD4A 4XOJA 3SV6A 4DCDA 1HNEE 1ESAA 2AS9A 1SOZA 5DP3A 2ZPQA 2D2DA 2PTCE 1WV7H 3MMGA 1G3EA 4I8JA 2JKHA 5DSFA 4BXWA 2CGAA 1A1RA 1AE8H 3QO6A 1MU6B 1SLUB 3UIRA 1Y8TA 2LPRA 5F8ZA 1Y3YA 5JBCS 1BBRK 2HALA 4Y8XA 2QIQA 1T4VH 2XNIA 1Y5AT 2VNTA 3P8FA 2W6ID 4IN1A 1V2TT 3RXTA 2J38A 1C5SA 5EODA 2C8WB 5JBTA 1PJPA 2XNDD 1O3KA 5LGOA 3ESTA 4NA8A 1SGFA 3KIDU 3RXOA 2XBVA 1QNJA 1W0JD 2J98B 5JPMH 1Q3XA 1TOCB 9ESTA 1IQKA 1OWEA 2J94A 4NFFA 2H9TH 4ABEA 4B2BA 1ZR0A 2XWAA 1ABJH 2Z3CA 4K69A 2Z6BD 2BLOA 2A4QA 2WPMS 3VEQB 2YNAA 3GY7A 3PTBA 2BHGA 4OS7A 1KLIH 2D26C 1K0HA 3P8GA 1QQ4A 2DUCA 1BMFD 3TNSA 3WY8A 3ZVBA 1CA0C 1KXCA 3N99A 1GJ8B 4BOHA 4Q7YA 1C2DA 1UTOA 3SV9A 5EW2H 2NU2E 3PTNA 1IQEA 1Y3VA 4IC6A 1QCPA 1WYKA 3A7XA 4X1RU 4DJZB 3TIUA 4OS4A 1VITH 2ZF0H 1K21H 1S6FA 1E79D 5E0JA 1TMUH 5A09A 1EB1H 2Z7FE 2AYWA 1V2WT 2ZHFH 1Y5BT 2L74A 1A0LA 1O3NA 3SNAA 3UUZA 3DFJA 1SQOA 2EQNA 1MTNB 4CRBA 3TVJB 1G2MA 3GDVA 2VH0A 4BTUB 4FVDA 3K6ZA 1FV9A 4MNYA 1BMAA 1MU8B 1QJ7B 5HKKD 3SGAE 1C1WH 4ZXYH 1YPGH 1V6DA 2Q6DA 2TBSA 4SGAE 1COWD 3V0XA 1C9PA 1TOMH 3O8DA 1LHCH 3KN2A 1ZTLA 2BB4A 2PUXB 2SFAA 1CT2E 3SGBE 5I46H 3SO3A 2A5IA 5I25A 3ZZ4A 1TFXA 2YOLA 1TPSA 2IPQX 2H5CA 3K6YA 4BAKB 1O0DH 2BDCA 3TLOA 1G32B 3EDXB 1NC6A 1W0YH 4YO9A 3VB3A 2HNTF 1EAXA 5GIBA 4MG3A 4E05H 1GI7B 2WHXA 3H7OA 1ZTJA 1AKSA 3LT3A 1HAYB 2BVSH 3OFND 1BITA 1DE7H 3MH7A 4YLQH 2V3MA 1AN1E 1UVUH 3GISB 5IK2D 2ZWLH 2IJOB 3HKIB 1A2CH 1NRPH 2EA3A 3D49H 1MTNC 1C5RA 2BDGA 3B8JA 1D3TB 3BTKE 5DJ7A 1MAXA 2RDEA 3TJUA 3A87A 2PSYA 3MU4A 1PPCE 5C67A 3RXAA 3GY3A 1W12U 4M7GA 3SQHE 3ATWA 1HPGA 4B71A 3VB7A 3H5CB 3O8CA 1ZPBA 1VCPA 3RU4T 1RTKA 4XBDA 6ESTA 1VJAU 3BEIB 1ANEA 5J4SA 1LPKB 3BTDE 1MKWK 2ZCKP 1EFRD 1SHHB 1PQAA 3EQ0H 3FVFB 1F0RA 1YPEH 2AFQB 2A0QB 4UFEH 4DT7B 1Q2WA 1PYTD 1O2LA 1GL0E 1SMFE 4TWYA 1A0JA 1TGSZ 1NFYA 2VWOA 2ULLA 3TK5A 1ACBE 5EPNA 2PGBB 3SJ8A 2BY6X 2FESH 1ZHPA 4GHTA 5T6DA 1VGCB 5CDFE 1RXPA 4KTSA 2OBOA 1BMMH 1PPGE 2PLXA 2ZDLA 1P10A 1SGFG 1XMNB 1P12E 3GS9A 1SHYA 1ZMNA 3RXKA 1AZZA 1O3PB 1TGBA 5DK1A 1SLVB 1JOUB 1C1PA 4Y8YA 5C5NA 2ZDVH 1G37A 1SGDE 2Z9KA 2ZO3H 3FZDA 4E7NA 1JIRA 2ANYA 1W14U 1SGYE 1ANCA 1L2EA 3PB1E 2FO9A 2GTBA 3MOCA 4TY7A 4X1SU 1P3EA 3SV2H 5C0UA 2BLQA 1C5PA 3CP7A 1DWBH 4ZUHA 1G3CA 3LGIA 2HVYB 1W7XH 2OXSA 3LC5A 1XUJA 1C2JA 2V6NA 1ELFA 3A88A 1SLWB 4M9FA 1C4V2 1C5QA 2C3SA 3RXLA 4I33A 3RC5A 3GY2A 3DSOA 2C93B 1QBVH 2BMGB 2B8OH 1BRCE 4MQAA 3RLYH 4FUCA 2ASUB 3UNQA 4RT1A 1P9SA 3UNRA 3LH3A 3C27B 5FBIA 5EOKA 1NO9H 5FPSA 4B6FA 7KMEH 2ILNA 1VR1H 1VGCC 4AGJA 2C8XB 1XUHA 2BTCE 1DY9A 4MNXA 1KXDA 1P2NA 3HATH 4B75A 1K1LA 1HAHH 2ZHWH 1KY9A 5F53A 3U1IB 2F9UA 2OP9A 1F5KU 4JK5A 1ARBA 2FLRH 3EA7A 2ZHQH 3P95A 2ZHEH 1GI2A 1AQ7A 3BTGE 5C20A 3RLWH 3RXDA 2HNTE 1G9IE 1KLTA 3U1JB 2PUQH 1BA8B 1BQYA 2C8YB 1S6HA 2C4FH 2F3CE 2SGAA 2SNWA 3UNSA 4OS2A 1K2I1 3UR9A 5FX6A 1L4DA 1DANH 1ELBA 4AG1A 8GCHG 1P01A 1MUEB 3MYWA 1XUFA 3L33A 4AB8A 4Y71A 3VB6A 1BCUH 2V3HH 3BG8A 1NRSH 3EYDA 1ZSJA 2K0QA 1PPZA 4FUFA 1LPGB 4HTCH 1HYLA 1BHXB 3GOVB 3M7QA 1MZDA 3GCHB 1PPHE 3ZZ3A 2H2ZA 1FIWA 1ELAA 1GHXH 1SQAA 1D9IA 2FTMA 1PPFE 1O35A 3SQEE 1UCYE 3K65B 4ZH8A 1BTWA 1HAIH 1TLDA 3RU4D 3TGJE 1GBBA 2F4LA 1SB1H 1UJ1A 1QRZA 2QGRA 3GCTG 1E1RD 1ZRKA 4VGCB 1ZLRA 2WYJA 1U6QA 2Z9IA 4INKA 4TSFD 1GBKA 4I8KA 2KR7A 3EAJA 4FETA 2STBE 1C2EA 1XXDA 2FOCA 3FP7E 4FUHA 1QB1A 3LDXH 1VKYA 4CRCA 4RI0A 4UONA 4Y0YE 4GCHG 3P92A 1GI5A 1MTWA 1Z7KA 1YWUA 3EGKH 2VH6A 1MD7A 2ZIQH 1S6LA 4GSOA 2ZHDA 1Z6JH 1E34B 2A32A 1GBTA 2GZ8A 1O3IA 3ZZ7A 2J5UA 4ZKNU 4U30A 2ZTXA 1GHBG 3T27A 4ZHLU 1AWFH 4J2YB 3VXEH 3T2NA 1HBTH 3RU4E 4FUDA 1P9UA 2G55A 3U8TH 2BOHB 2GMTC 3Q76A 5FPYA 4B1TA 2G00A 3ZZ5A 3F3BA 2FOBA 3PV2A 4WMDA 2TGTA 4B2AA 3GCHC 5DP5A 3SUFA 3QN7A 2RG3A 1EX3A 3HK3B 5BPEA 3P6ZB 5A2MH 3W95A 2QF3A 2VJ1A 1O34A 1GG6B 1PPEE 2VB0A 1O5EH 2TGDA 3SW2B 1BBRH 3ZZBA 1S83A 1MD8A 1YCPK 4VGCC 2AMPA 1GHAF 2QY0B 3URDA 2FYRA 5A8ZA 5GWZA 3SUEA 1B7XB 3SU1A 1NROH 6LPRA 4CRGA 1F0TA 3H09A 1YPLH 1AGJA 3FAOA 4FU8A 4YOIA 4F4OC 1O3MA 5HIYA 1SPJA 1HAVA 2AHME 2FWWA 1Z8RA
chains in the Genus database with same CATH topology
1NFWA 5LH8A 1ZPZA 3VPKA 1BB0B 3BTTE 4D8NA 4BANB 2J92A 2VVCA 3SV8A 3GY5A 4ISIH 1TMBH 4X0WU 2AMDA 5EW1H 3ATMA 1O5BB 5FCKA 4BAQB 3HGPA 2O8UA 3RC6A 1QTFA 2OBQA 1LDTT 3RP2A 1C5TA 4JK6A 3RXPA 1BTYA 3AAVA 4CH8B 1NESE 5AFYH 1DSUA 1A61H 1IHTH 2P3TB 2OCVB 5A0CA 3E16B 2BZ6H 1DWCH 5GXPA 3PLKA 2V35A 3UPEA 4NA9H 1GI4A 3SJOA 1VITF 1GG6C 1J15A 1OP8A 3A85A 1V2KT 1ELDE 4Q2KA 1X7AC 4ZKRU 3BN9A 5F8XA 7ESTE 1ZJDA 1O2GH 2ZI2H 4GPGA 1THPB 4H6SB 3RXRA 1QBOA 2FM2A 2OC0A 4IN2A 5ESTE 2BX4A 4XBCA 5AFZH 3UOPA 3E1XB 3M7UA 4X6MA 1K22H 2UUKB 2PV9B 1GBDA 5EQSA 2XBWA 2BD3A 5L2ZH 2UUYA 3KGPA 1GDNA 5ESBA 2TIOA 1JRTA 1QB9A 1P03A 1QL9A 4JYTA 1UTNA 4YT6H 3QX5H 3UFAA 4BAMB 1W11U 1EQ9A 2CF9H 3OSYA 2G52A 4K1SA 5HGGA 2GCHF 2ZQ2A 1DUEA 1ZMJA 1BTXA 3RXGA 2AGEX 4UFFH 1G2LA 1GJ5H 2Y80A 3KF2A 3ELAH 1O3JA 4H4FA 1KTTB 1C1VH 4NG9H 4O03A 3SZNA 4E7RG 1D3DB 3L3TA 3V13A 3ODFA 5GCHG 5A0AE 1BT7A 3MH6A 3BTFE 1SR5C 1GHYH 4WY3A 1LHDH 1O3CA 1EASA 3SI3H 2G8TA 1AHTH 2VIWA 2FP7B 2O8WA 3F6UH 5JBBS 2HGTH 2VU8E 3NWUA 2O9QA 4LXBH 2ZPRA 1FY4A 1RTLA 1LQEA 1QB6A 3D65E 1EJMA 3BV9B 3MU5A 1EAWA 1ELCA 1F92A 2M5TA 2ZTZA 3RUOA 1C1SA 1PQ8A 3QK1A 3LONA 2BY8X 1ZPCA 2GZ9A 2QV1A 3D23A 3F9EA 1C9TA 1TBQH 4WXVA 5BRRE 2VIPA 1W10U 4WWYA 1DWDH 1AVWA 1OWIA 5JB9S 4OGXA 3ITIA 1T4UH 2Y5FA 1MKWH 1LO6A 1LQDB 2NU1E 2PHBA 1D3PB 3VGCB 1A5GH 4NZLA 2ESTE 2ANKH 4WJG2 2PTNA 3RMLH 3LGVA 3TJOA 3ZV8A 1O3BA 2VVUA 3SHAH 1ZJKA 4NWKA 3GYMA 3F9FA 3A81A 1O32A 2J2UA 4OS1A 3BSQA 1FNIA 1EAUA 1HIAA 1S0QA 5T6FA 3GDSA 1HRTH 1O3HA 4Y76A 1AFQB 2FMJA 1BJUA 1FLEE 1EOLA 1L1GA 1OPHB 3HGNA 1G3BA 3SNBA 1DX5M 5DP4A 1UVPA 8KME2 1IQMA 3A7WA 2ZU2A 2J95A 3A7YA 2ZFPH 5DKMA 3B9FH 2VIQA 2CMYA 3SI4H 2Z3DA 4THNH 3CS7A 3ZVAA 1CSOE 1B0FA 1GI8B 1IQFA 1LVOA 2W3IA 1F0SA 4ZKSU 2Z9JA 1UTKA 4FVBA 3E3TA 1K1NA 1CVWH 1GCDA 4LOYH 1O5GH 3UQOA 2GT8A 1DVAH 3SORA 3Q00A 1D3QB 4HZHA 3SV7A 3QZQA 1O39A 2FI3E 1XXFA 1ZGVA 4FUGA 1V2VT 3VGCC 2FOEA 4J1YA 5HMAA 3T28A 1D4PB 1Z71A 1ELTA 1O2SA 1JIMA 1NY22 2OQ5A 1KXAA 1WOFA 3UWIA 5DP8A 3TU7H 5JYIA 3R3GB 1IQIA 4IMQA 1EJAA 4BAHB 3M3TA 1WAYB 4KP0A 2GP9B 1AIXH 2AMQA 3C1KA 4K2YA 2DE9A 1AFQC 1DUAA 1ZSKA 2ANWA 2OTVA 4KTUA 2BDAA 3RXJA 3A83A 3QTOH 1C1NA 5E8EH 1BRBE 1XVOA 3ZYEA 3BTQE 1EATA 2ZCLP 4JZEH 1O2IA 1S85A 1TABE 2YNBA 1GJCB 1YPJH 4NCYA 1QA0A 4O3UA 1FIZA 1GMCG 2ZCHP 3QTVH 3OY5U 1ZTKA 1HAZB 1WUNH 2VINA 1RJXB 1S0RA 1TRNA 4TYDA 3ZZ6A 2A7HA 2XC4A 3BF6H 3M36A 5F03A 3UREA 1SGRE 3SU0A 2BVRH 1MMJN 1N6YA 2TPIZ 1AVGH 2SGQE 4B76A 1OSSA 5DP6A 1P2JA 1AI8H 1WBGB 2BXUH 1RIWC 3LH1A 2IN2A 2B5TB 4X1NU 1DWEH 3PMAB 1HAGE 2QC2A 3URCA 1P57B 2Y5GA 2OQUA 3ZZDA 2XWBI 3OTJE 3UR6A 1Y3WA 1Z1JA 2ZGHA 1EZSC 2GDEH 2ZECA 5DO4H 1V2UT 3A8AA 1C5WB 1AUJA 1FJSA 4A1XA 3AASA 3UWJH 1IQGA 1SL3A 1DICA 1TX7A 1YPHE 3SGQE 3W94A 2Z9LA 1TALA 2ZGXH 1O2MA 1SGNE 3JZ1B 1MBMA 1HJ9A 2H9EH 4ABIA 2A5KA 4QT8C 2GV6A 3GICB 1P09A 2BY5X 2TRMA 1C5ZB 1O2RA 4IBLH 1GBCA 3MNCA 2O8MA 1HAVB 2BYAX 4RN6A 4A92A 3Q3KA 1MKXK 2QA9E 1CE5A 4ABDA 2PKAB 1AB9C 1B5GH 2IPHA 4BTIB 3S0NA 1O5CB 3GY8A 3RM2H 3BEUA 4Q7ZA 4DIIH 5T6GA 1DXPA 4ABHA 1TQ0B 1E38B 2BQ7B 2Y7XA 1VJ9U 3RXCA 1J9CH 1F7ZA 3M5MA 1GMHF 6GCHF 1O3LA 1O3OA 6CHAB 2WYGA 3MTYA 2FPZA 2HWLB 4CBOA 3FFGA 4ISNA 1GHZA 4OS5A 1LKBA 1TB6H 1C2KA 3GDUA 4Y0ZE 2J4IA 3SJIA 1ZHRA 1YCPH 1L1NA 2A31A 3UQVA 1P05A 1KDQA 3V12A 1YYY1 1EUFA 3SNCA 3Q3XA 2ZFQH 1W7GH 3U8RH 1C2FA 3HKJB 3N7OA 1C1RA 5EXMA 5A8YA 1SG8B 3AW0A 2WUBA 4KKDA 1Q31A 4INHA 2H9HA 4D9RA 1MQ5A 1V2QT 2OUAA 3PLPA 5C1YA 4AB9A 1ANDA 2XC0A 4ISOA 5E2PA 4NIYA 1GMDG 3SU4A 2TGAA 1PFXC 2BX3A 3M35A 5LPFA 1BMLA 3M37A 1OX1A 2PWXA 1J17T 1K1PA 3MNSA 4IS5A 5DP7A 1DSTA 1ID5H 2XRCA 6CHAC 1CHOG 3S69A 1AZ8A 2XCFA 3MI4A 2GDDA 2HPQH 1O2YA 5L6NH 1AD8H 2AIPA 2VIOA 1BTPA 3Q3YA 1AWHB 1GDUA 1O2OA 2UUFB 1DS2E 1KXEA 2V3OH 4Q7XA 2P8OB 1IQNA 1YBWA 1E37B 1L1JA 4MNWA 1H9IE 4LK4A 2KAIB 3VFEA 1UTPA 2UWLA 2ZG0H 1AY6H 1MTUA 1LMWB 3KL6A 2FOAA 1O5DH 1ZOMA 2QXJA 4I32A 1UTQA 1O5FH 1LVYA 3TJVA 1FQ3A 3KQDA 2NU0E 2AEIH 2Y81A 4H42U 1EZQA 4AX9H 1EJNA 2UWPA 2ZU3A 4CRDA 1HFDA 2ZFFH 3TK6A 1UMAH 1GJBB 2GMTB 1GI6A 4YTAA 2F9NA 2A1DB 3SUDA 2Y6TA 1JMOH 2ALVA 5DP9A 4TWWA 1ETTH 2WPLS 1XKAC 4Y8ZA 2XBYA 4JZ1A 5K7RA 1CA8B 2VWMA 2F91A 1GJ9B 2TGPZ 1GI9B 1H9LB 1QJ1B 1T32A 7GCHF 1THSH 3VB5A 3ZVDA 4O3TA 1UK4A 3KNXA 1HIAB 1IQJA 2D8WA 2P8OC 2ZA5A 3CENA 4GHQA 3BIUH 3K9XB 1V2PT 5T3HA 4YOJA 1H8DH 1KXFA 2EC9H 1SGQE 5L30H 1BBRE 2BY9X 1Y59T 1PPBH 1IHSH 7LPRA 1TPOA 3SU2A 1DY8A 4DW2U 1SVPA 1BTZA 2UUJB 4DIHH 1SSXA 2FX6A 5IYTA 4RSPA 1K1MA 1YPKH 2Y7ZA 1BJVA 2R2WU 5E2OA 4ZROA 1C4U2 1O33A 3TH3H 1UTJA 4X2WA 2CV3A 4MTBA 2ODPA 2ZEBA 5EXLA 1CGIE 1YKTA 2OD3B 3F9HA 3LC3A 1O2ZA 4AOQA 3B23B 4NFEA 1SGTA 4NSVA 1HUTH 1AE5A 3A8BA 2QN5T 3EA8A 4X2YA 1SGPE 3EA9A 5DG6A 4INLA 2PFEA 1O2XA 2GT7A 1O2UA 1HAOH 1FONA 1O3DA 4A7IB 1T8NA 4X6OA 1SI5H 3BTME 3LU9B 4NZQA 2SGFE 3ZZAA 1XVMA 2R9PA 1NTPA 1V2ST 2BD5A 1KTSB 3E8LA 1EAIA 5CHAB 2FI5E 1LHEH 2VWLA 2HPPH 3JZ2B 1CT4E 1T8MA 1NZQH 2ZKSA 4BTTB 1K1IA 5IDKA 4A1VA 2LNCA 4WF8A 1MTVA 3KQCA 2CJIA 2A2QH 4IGDA 1N8OB 2FOFA 3BTHE 1TPPA 2VGCB 1M9UA 1UK2A 2AIQA 4YOGA 4K60A 4IC5A 2PKAA 2HOBA 1D6WA 5E0HA 1T8OA 1KSNA 1C5VA 1P2QA 4K8BA 3PO1C 1C2HA 2QYIA 3KHVA 1HDTH 3M5LA 1AVXA 3QZRA 2VWNA 1BZXE 3MHWU 8ESTE 4X8UH 2F9VA 4BXSA 3UOUA 1O2HA 1FUJA 1GMCF 3GCOA 2Y82A 2XCNA 3D62A 2R3UA 1OP0A 1ETRH 4SGBE 3OY6U 5GDSH 3U8OH 3QLPH 1ELEE 1UO6A 1SFIA 3MO3A 3ATLA 3I29A 4AFSA 3QGJA 5EGMA 1QQUA 1XUGA 4CRFA 1C2IA 5TJXA 4KGAA 4DG4A 3UY9A 3G01A 1HXEH 1HLTH 5CHAC 2A4GA 3MO6A 3PYHA 3NCLA 1NRNH 2OLGA 1YPHC 1O2JA 1EPTC 3VXFH 1XUKA 1YM0A 3AAUA 4ZHMU 3RXHA 2BDHA 1LCYA 1GJDB 1BTHH 3BG4B 1TA6A 1ETSH 1FMGA 1N8OC 4XBBA 3SU6A 1CGJE 4ABGA 2VGCC 4YM9A 2C90B 4LZ1H 3MU8A 2QXIA 3TPIZ 4ESTE 3ATIA 4ABAA 1HAXB 2W7SA 1O36A 1HB0B 2H1UA 1DLKB 1GHWH 3ZVEA 1GBJA 3A86A 2FDAA 2VIVA 4HFPB 4TY6A 4Y11E 1FY3A 1HV7A 2R2MB 3Q77A 3DUXH 3BEFB 5TCAA 2PGQB 5FHTA 5EG4A 1E36B 1P2MA 1S81A 1W3CA 2FS8A 2GZ7A 2FZZA 3E91A 3ZVCA 1VZQH 2JH0D 1QFKH 2ZNKH 1MZAA 2BD9A 1BHXF 1RGQA 2BY7X 2PR3A 4CR9A 1C1MA 3RXEA 2ZU4A 1BMNH 3OX7U 3PMJA 4KTCA 4NIWA 3TNTA 3SU3A 5L2YH 2QAAA 4WH6A 1CHGA 1QBNA 3DD2H 1C1OA 4ABJA 2R0LA 4AG2A 1SGIB 1H4WA 4JYVH 4I31A 3ZZ9A 3NXPA 3U9AH 2KAIA 4ZHAA 1KDQB 1V2RT 4UFGH 1O2TA 3HK6B 3S9AA 4AFUA 1TNGA 1FPHH 3LOXA 1C1TA 3BG4C 4R8TB 5CMXH 1ANBA 5AVDA 1SC8U 2K1QA 1ZRBA 1MKXH 1K1OA 1HJ8A 4WXIA 3A84A 2Z3EA 1KXBA 2P3FH 3F68H 1WU1A 1YLCA 3LJOA 1C1QA 1E0FD 4BAOB 3FP6E 1UVSH 1FN8A 2H5DA 3MNXA 3SJ9A 3A8CA 1W0ZU 1C5LH 1TBZH 1BRAA 1W13U 4CH2B 1TPAE 1C5XB 1J14A 1FXYA 1W2KH 1QRWA 1GDQA 1NFXA 1TA2A 2ZGJA 1OXGA 2SGDE 4Y79A 1T8LA 1Z1IA 3NK8A 3R0FA 5DGJA 1F5LA 5JDUB 2BDIA 1A0HB 1GPZA 2ZTYA 3OU0A 1C4Y2 4MPUA 3M61U 1Y5UT 1Z6EA 1EZUC 1C2MA 2BM2A 2FEQH 2OC8A 1TNKA 1SQTA 4BNRA 3DHKH 1XX9A 3ZVFA 2WPKS 1UCYK 9LPRA 5J4QA 3PWBA 2ZDNA 2FXRA 4NIVA 4MPVA 1O3GA 4YESB 1PQ5A 4X1PU 1AUTC 2R3YA 4NIXA 1C5MD 2BDBA 5PTPA 2ZU1A 1S84A 3SNDA 1HCGA 1ESTA 4Y10E 3BTEE 2HNTC 1F2SE 1FZZA 2VIDA 2IOTA 2FS9A 1RIWB 1GBEA 1O3AA 4MPXA 4WH8A 5JB8S 2RA0A 1OWKA 4X8VH 1H8IH 2HRVA 1EKBB 1WQSA 1TNLA 2NU4E 1IQLA 1DDJA 4RKJB 1WSSH 4AFZA 8GCHF 1QL8A 1PQ7A 1O2KA 4CBNA 5FCRA 1FAKH 4WMEA 1NN6A 1WQVH 2BQWB 3ENSB 1TX8A 1KYNA 1UK3A 1BOQA 5EXNA 1FAXA 1BRUP 1BTUA 2ZP0H 3TH2H 3FANA 4X1QU 4K1EA 1E35B 1TNIA 1EPTA 3RXIA 1GHAG 1Z8IB 1GBAA 1AFEH 5AF9H 3NPSA 1CU1A 4JYUH 5CE1A 1TGNA 1GBHA 1GBLA 3GCTF 3LGYA 2BD2A 2BLVA 2D1JA 4ASHA 5A8XA 4U01A 3TGKE 5FX5A 4K8YA 3ZZ8A 5DPAA 1UTMA 3S9BA 1GVKB 4GCHF 4E06H 5B6OA 1AB9B 1ZSLA 2PSXA 1OKXA 2F9BH 1QHRB 5F6MA 3KQEA 1GCTB 3F9GA 2CHAB 4RKOB 3M3SA 4F49A 1A7SA 4X8TH 3RM0H 1G36A 2G4UA 1GHBF 1LHFH 4UDWH 2A4RA 2SGPE 4HGCA 2OINA 8LPRA 3ZYDA 4TPYA 3TGIE 1TAWA 2QXGA 4JMYA 4D7GA 1YP9A 5LPEA 1O38A 1OYQA 2FX4A 3SHCH 3P8NA 1VITG 1ZHMA 4GVUA 2ALPA 1OWJA 1AO5A 3PV4A 3QDZB 2GVFA 1LHGH 2GX4A 3PLBA 3M5OA 1ELVA 1NPMA 3T25A 3SBKA 2W26A 3E0NB 3RXMA 3MWIU 1FDPA 1EOJA 2BLWA 1TIOA 1GI1A 1GBMA 2FOMB 1TQ7B 2BD8A 3SOSA 2AH4X 1JBUH 1AU8A 1XUIA