3GY5A

A comparative study on the inhibition of bovine beta-trypsin by bis-benzamidines diminazene and pentamidine by x-ray crystallography and itc
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Structural binding evidence of the trypanocidal drugs Berenil and Pentacarinate active principles to a serine protease model.
pubmed doi rcsb
molecule tags Hydrolase
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gy5A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gy5A02
1C1PA 3IG6B 4KTUA 4D7FA 2XC5A 5DG6A 3TLOA 3EA8A 4MQAA 2QGRA 1C4Y2 3BG4C 1A3EH 1G2LA 1EXFA 4XOJA 1GBEA 1V3XA 1C2EA 4XBDA 3OTJE 5DP9A 1EAXA 3RXVA 5EG4A 1IAUA 3MI4A 1EJMA 2FOFA 2ZEBA 1V2OT 2ZU1A 3I78A 4B1TA 2J38A 3V0XA 1C1NA 1V2NT 1SR5C 1GJDB 3TGKE 2FI4E 3RXQA 4DIIH 2ZFPH 3PLBA 2J95A 2ZP0H 4F49A 3LONA 3MO3A 4GAWA 3BTHE 1YGCH 2ZFQH 3GCTF 5TCCA 3ODFA 2HLCA 2F9NA 2FS9A 2ZFSA 3U8TH 2OQUA 4B2BA 4X8UH 1C1TA 1P01A 4I32A 1P9UA 4D9QA 5SGAE 3BEUA 3MU0A 3B9FH 2ILNA 1VITH 1O3KA 5F6MA 1GMHF 1HXFH 4I8JA 3URCA 4ABBA 3O8BA 1PPGE 2FOMB 1ZYOA 2W26A 3UREA 2C3SA 3T29A 1DWBH 1B7XB 3K6YA 1E36B 1NC6A 2GDEH 3HGPA 1XUIA 3DD2H 1RXPA 4ZHMU 2OTVA 4RN6A 1O31A 2DE9A 1HFDA 3QZQA 4A92A 3UPEA 1LPGB 1KXCA 1QY6A 2LNCA 3PMJA 2C93B 1A5HA 3STIA 1EZXC 1YPJH 2JH6D 1BBRK 1Q3XA 4NWLA 1QA7A 3GY3A 1A0LA 4X2XA 1GI8B 3RXCA 1OSSA 4ZROA 3F9HA 1QQUA 1C2IA 2ULLA 1HJAC 3EQ0H 3TK9A 3T28A 3QTVH 1BRAA 1HAVB 1S85A 3S69A 2BLQA 3CS7A 1BIOA 4CREA 1ZOMA 1ELTA 3B8JA 3KL6A 2P8OB 1YPKH 4BTUB 1THSH 2WPJS 5IDKA 3PLKA 2AMDA 2KAIB 5JBAS 1TRNA 1UTQA 5EQRA 2H9EH 1TNKA 4Y10E 1ZSJA 2OC7A 4HGCA 1GVKB 1Z6JH 5F8XA 2BD8A 1V2KT 4CR5A 5ABWA 1YF4A 1L2EA 2ZKSA 1UK3A 4U2WA 3V7TA 1J17T 3ZZ4A 1TNHA 2J94A 2SGAA 1HDTH 4Q7ZA 1EX3A 1SLWB 1ZR0A 1C2DA 2R0KA 1F5KU 1XX9A 5JBCS 4M7GA 2BQWB 3RXEA 1EUFA 2WPKS 7LPRA 2XBWA 9ESTA 3KN2A 3KF2A 1O2RA 2A7HA 4GCHF 4E7NA 1CT2E 2PUXB 3MWIU 5EPYA 3SBKA 3QGNB 3RUOA 2Z94A 1MTSA 3SNDA 1KXFA 3SV8A 1OYQA 1G3CA 1HV7A 1O2NA 2BD5A 1SBWA 1DS2E 4NWKA 3H7TA 4YOGA 4MNXA 1OPHB 4NZQA 4WJG2 3FP7E 1UTJA 1MZDA 5T6FA 5C1UA 3BTWE 1KY9A 1TGBA 5A8YA 2BHGA 3RM0H 1IQHA 1W0YH 1QHRB 5EXNA 1MTNC 2BLVA 1P2NA 4UFFH 1P11E 1BBRE 3UQOA 1RFNA 1AY6H 4WXVA 1FY8E 5GCHF 1ZPZA 2BDGA 1P12E 1GMDG 3A89A 4NGAH 2Z9LA 2AIQA 3RXUA 3VGCB 3LGYA 4LOYH 1EZSC 4K1EA 5C1YA 1ZTLA 8ESTE 3E3TA 2JETB 1OWHA 4INLA 3W95A 4X2YA 1M9UA 1QL8A 4OS6A 1C2HA 1F92A 3OYPA 2ZU2A 2QXIA 1CVWH 1SQAA 3GYLB 2IJOB 3ZZBA 2PGBB 1BTPA 2SNVA 1EAWA 2UUFB 3F9GA 1KXEA 3HK6B 1V6DA 1IQEA 5DPAA 1KXAA 2B5TB 1P10A 1GCTB 1O5DH 4HZHA 1HIAA 1TE0A 2R3UA 3TK6A 2WINI 4A7IB 1GMCG 4ABGA 2ZECA 2ZDKA 1D3TB 1GBBA 2GVFA 5CHAC 1W7GH 2TGTA 3S0NA 1BRUP 2FTLE 1DSTA 3RXOA 1AB9C 3CP7A 2BYAX 1ABIH 3KGPA 1UHBB 4TY6A 1AE8H 1DLEA 5T6DA 4X1NU 3M5MA 4X2WA 1YPGH 1XVOA 3GYMA 1DPOA 1ZRKA 3T2NA 1D3PB 3SV7A 4YZUA 3KQEA 2VWOA 3TJUA 1AZZA 1P03A 2QY0B 1UVOA 1TGCA 3P8GA 3Q76A 1FY5A 1IQNA 1K1OA 4Y0YE 1O3LA 3T26A 2P93A 2BZ6H 5DO4H 4XDEA 4KGAA 4BANB 3D65E 2HNTC 1V2VT 2OXSA 3ELAH 4FUFA 2XBYA 1MTUA 4GHQA 4CHAB 3GY6A 1AN1E 3LC3A 1F2SE 1SGTA 1T8NA 2OC1A 4FXGH 1F0SA 1RD3B 1IQKA 2VIWA 1GJ6A 3GY8A 1QTFA 4FUGA 2HWLB 1PPBH 4ABJA 1O3OA 3MU4A 3UTUH 1QRXA 5C5NA 1AE5A 3GOVB 3F9FA 3SHCH 1G30B 5ESBA 1Z1IA 1AWFH 3GCNA 1HNEE 1GJ9B 3BN9A 2FXRA 2P3FH 1V2UT 3SU5A 5J4QA 1O39A 2ANMH 2M5TA 5K0HA 4ZKNU 1L1GA 1O2TA 2VVVA 2ZA5A 2UWOA 3SGBE 5FPSA 4CBNA 1HAGE 1JXPA 1P3EA 3A8BA 5ESTE 1WTGH 2CMYA 2STAE 3MHWU 1W8BH 4Q7YA 2ZPQA 2CXVA 1TPSA 2FOEA 1WUNH 4NCYA 1UO6A 1HAOH 1EB2A 3P95A 1T8OA 1GJBB 2PFEA 1TPPA 3SQEE 3MU8A 3SW2B 2XW9A 1BHXF 3SORA 3BTQE 4DJZB 1GMDF 3TJVA 3TITA 4JK5A 1UTKA 3TH3H 2RCEA 1G37A 2V0BA 2V3HH 3HKJB 3VB4A 1TYNA 4VGCC 1GGDC 4Z0KA 4BTIB 1A0HB 2WYGA 3LIWA 2FYQA 1EZUC 1ABJH 1HLTH 1YLCA 4AG1A 1S6HA 4DG4A 4OS4A 2BVSH 4IW4E 4BNRA 5FCRA 1HJ8A 1C5PA 1DX5M 2VWMA 2YOLA 4WH8A 3LJJA 2P3TB 3S7KB 3D62A 4DGJA 1HAVA 4NIVA 1GMCF 1BMLA 4KTCA 4GUXA 2FESH 2TBSA 2A2QH 2R3YA 2GCTB 3PM3A 1YPHE 4LZ1H 3A8CA 4KELA 1D6WA 3RXBA 2KAIA 4INHA 3JZ2B 1B5GH 1O2MA 4I7YH 4YLUA 4SGBE 3Q3KA 5HM9A 1GL1A 3E16B 3PB1E 4A1XA 2OQ5A 3A87A 1TBRH 5EXLA 1ZSLA 5HXFA 1AFQC 1DOJA 1S83A 2AGGX 3GCHB 4AZ2B 2ZGXH 1INCA 2P95A 2A4OA 3DFJA 2A5KA 3GCOA 1QQ4A 2LPRA 1UMAH 3WY8A 3GDSA 3HPTB 1JMOH 1K21H 3VPKA 4YT7H 3BV9B 4Q80A 1V2TT 2SGFE 3BIVH 1BRCE 3F1SB 2BDYA 2AGIX 2BX3A 2Z9JA 2BD2A 3SJKA 1J8AA 1W14U 1RIWC 1VR1H 3O8DA 2ZHWH 3VB6A 3MMGA 1V2RT 1FXYA 1K22H 1QJ7B 2W5EA 4ZKOU 3LPRA 3M3VA 1V2JT 5LGOA 4E05H 5EQQA 2VWLA 2Z7FE 2ZIQH 1ZTJA 1SQOA 1GDNA 1VCPA 3BG4B 3UNRA 1CHOF 1MAYA 1QURH 1MAXA 1W0ZU 3GY2A 1BITA 2GT7A 4X1SU 4Y0ZE 4JYVH 1AO5A 1A61H 2FI3E 5BRRE 1GHXH 3ZV9A 1P2KA 4NA9H 3PO1C 4FUDA 1BMNH 1TNIA 1D3DB 3A84A 1P57B 2FPZA 3LGIA 2P94A 1A1RA 3D49H 4WY3A 5A0AE 1ZPBA 1ELVA 4D8NA 2ZDAH 3A86A 2FIRH 1N6YA 2V3OH 1N8OC 3V3MA 3SJOA 3AAVA 1EPTB 1XUHA 3AW0A 3FZZA 2GZ8A 1HJ9A 3S9AA 2FODA 3SJ8A 5E0GA 3U8RH 3VXEH 1GHAG 4ABDA 3PTNA 2ZDMA 4UFDH 1S5SA 3PTBA 5FCKA 4BAHB 5F03A 5EW2H 1TBZH 5DP4A 3HKIB 3UWIA 2WPMS 1GBDA 1ZTKA 4NIXA 1GDUA 4ASHA 2QXHA 1GJ5H 4OGXA 1MKXH 5HM2A 4BXSA 2ZDLA 1GI6A 1D9IA 3MU1A 4MDSA 1TGSZ 1ANEA 3BTFE 1BTYA 4I8GA 3RMLH 1BMAA 4ESTE 1WCZA 2HOBA 2FEQH 1ZMJA 3PROA 4WMFA 2OC8A 1DLKB 2BD4A 2P16A 1IQMA 1G2MA 1OX1A 1VCQA 4JZIA 4MPVA 4IGDA 2Y7ZA 3UNSA 3SOSA 1IQGA 1C1MA 1L4ZA 1HJAB 3A7TA 3EA9A 1E0FD 2BLOA 1SPJA 1TB6H 3NCLA 2PWXA 3LKWA 2FOGA 1ZHMA 1C5TA 3PMHB 1W2KH 1J16A 1GCDA 3QN7A 4X6PA 2HVXA 2BB4A 1ZMNA 3LH1A 2Z9GA 1O2JA 4ZXYH 2GKVE 4FUCA 1JWTA 1SMFE 1IHTH 2JH0D 1P2IA 2OINA 3ZVBA 1MZAA 1AUTC 1DT2A 2C8YB 4ABEA 1TNGA 2ZHDA 4X0WU 5A2MH 7KMEH 2Y5HA 3MO6A 1GHBG 1BB0B 1YM0A 1QFKH 2BDCA 2C8XB 2BD9A 2JKHA 1C5SA 2G5VA 2BTCE 1SFIA 3RXSA 1QL7A 3CS0A 1QJ6B 3FFGA 4KTSA 4WXIA 1EP5A 2ZGHA 2QF3A 1HPGA 1QBNA 1QNJA 1V2LT 3FVFB 5A0CA 3S9BA 1GJAB 3L6PA 5IYTA 2BVXH 4GVUA 1AQ7A 2R0LA 5B6OA 3QZRA 3ZZCA 1IQJA 1K1LA 3B23B 1SGFG 1EZQA 3M5LA 1GI3A 2ZTZA 4ZMAH 3RU4E 1JOUB 3BTDE 3SU3A 1ZRBA 2IPHA 4RSPA 8KME2 2CHAC 4AFQA 1CA0C 1BTXA 4B76A 3RM2H 2ZZUH 4DT7B 3I29A 1P3CA 2CN0H 4FUIA 1FDPA 1RGQA 2F9PA 5FX5A 1FV9A 4CRBA 2K1QA 2TIOA 1PQ8A 1SHHB 2ZTXA 1FJSA 1DUAA 6ESTA 1LQEA 1SLUB 1WV7H 5AF9H 1NY22 1O2PA 1BRBE 1Y3WA 2ZO3H 3S7HB 4Y8YA 1BUIA 5DKMA 4MPXA 1GBLA 1MKXK 1O3FA 3RXHA 3A85A 1AIXH 7GCHG 3F9EA 1ELAA 4NA7A 1PYTC 4O9VA 1FAKH 3MNBA 1SGRE 3U9AH 2VGCB 2F9VA 1ELFA 4OS5A 1TIOA 2NWNA 1DFPA 4RKJB 3U8OH 1UVUH 3O8CA 4TY7A 2FX4A 2XYAA 1TALA 2HNTF 2FDAA 4WH6A 4ZAEA 1QL9A 1W11U 1D3QB 1O3DA 5FPYA 5EGMA 3QLPH 1V2PT 1AUJA 1MCTA 4K1SA 1ANBA 1ELCA 4O03A 4Y79A 1FY1A 4GLYA 4AG2A 1LVBA 2QN5T 3KQDA 3QDZB 1XUFA 3EYDA 2H9HA 1YCPM 1CE5A 1G3BA 1OS8A 2ZFTA 1J14A 3EGKH 2VIPA 1AB9B 4JZDH 5E0HA 1W7XH 1P2JA 3FZDA 1W13U 4O97A 2OBOA 1OP2A 5E0JA 5E8EH 1GDQA 2PTCE 4OGYA 1SC8U 1OP0A 1C5OH 3NZIA 5I46H 2UWLA 1NFWA 3NUMA 1TONA 2BZAA 2HPQH 1HRTH 3GY5A 4NA8A 2Q6DA 5E2OA 1Z8RA 4ZHAA 2OUAA 1KLJH 1WQSA 1GG6C 2PKSC 3U1JB 8GCHG 3LC5A 5C2ZA 1BDAA 4KP0A 5C67A 4U01A 3T25A 3RXFA 2THFB 1OWEA 3BG8A 1FPCH 3A88A 4Y71A 1PQAA 1WYKA 3IITA 4AORA 1XKBC 1GBMA 2QA9E 2ZPRA 2BY5X 1GBIA 1KXDA 1GI0A 1BMMH 1TBQH 1LVYA 1OYTH 3UWJH 1O32A 2AS9A 1EB1H 3UR9A 2EI6A 3BEIB 3A7XA 4X6OA 1UTOA 1O2IA 4NFFA 5JBTA 1C1RA 2GTBA 1G36A 4XSKU 1MMJN 1XXDA 2EEKA 1BTUA 3UQVA 1RTLA 3E91A 1SSXA 1C5QA 2VH6A 1YYY1 3RU4D 3RMMH 1A4WH 2ZGCA 2A0QB 2W3IA 1YBWA 3RLYH 1XUGA 1F0UA 1EPTA 1PPEE 2AH4X 2BXUH 4AFSA 1TRYA 1AD8H 1K1JA 5GPIB 1KTTB 2ZWLH 3MH5A 3A7WA 1O2UA 1C2MA 1CGJE 1TNJA 5FAHA 1C5YB 2G5NA 4X8TH 1LVMA 1C4V2 3A81A 4AX9H 1GHVH 3NK8A 2ZG0H 1P9SA 1FMGA 4B75A 1A46H 2VIVA 2GDDA 3U98H 3ATLA 2ALPA 1TFXA 5A0BA 2ANYA 1IQFA 3VEQB 1LHDH 1U6QA 1NU9A 2AGEX 1NFUA 1CBWB 1Y3XA 1C5UA 2XRCA 2F83A 2O8LA 3K9XB 3MNSA 1Y5UT 2XXLA 1C2LA 1G3DA 1FAXA 4TPIZ 1SGNE 1C5NH 1GGDB 4VGCB 4BAKB 3TK5A 1UVTH 2Y7XA 3GY4A 4X6NA 2GCHG 4WF8A 4JZEH 1GBTA 2BOHB 4H6TA 1MTWA 1VGCC 3MNCA 5GJ4B 3ZVFA 5JDUB 1A7SA 2FX6A 2FP7B 3SQHE 1GHYH 2WV5A 3QWCH 1O3PB 2RG3A 1AHTH 4H4FA 4THNH 2H9TH 1GVZA 1H9IE 1O3BA 2WUBA 2BD7A 2AFQB 3LDXH 2VIOA 3DA9B 2AIPA 1P8VC 2WUCA 3A7YA 3W94A 3ZZAA 4CR9A 3P6ZB 3ZVEA 5GIBA 2ZNKH 3ZVAA 3E8LA 1Z8IB 4U30A 1MQ5A 4HTCH 1UTMA 2F91A 1AFQB 4ABFA 1W3CA 1FIWA 2J2UA 3LGTA 1LVOA 1XUKA 1RJXB 1S82A 3QX5H 2W7SA 1O5BB 3BTEE 5F8ZA 4X8VH 1O3EA 1NESE 4UFGH 4K5ZA 3RXAA 1O2KA 3TH4H 3SI4H 1K2I1 2VJ1A 2SGQE 8GCHF 1Y8TA 4YOJA 3M3SA 1O2HA 4UE7H 3S9CA 4X1RU 2BDAA 2B0FA 1FN6A 1RIWB 2ANWA 1JIMA 1SI5H 1JRSA 1OXGA 1DY9A 1S84A 1PPZA 1IQIA 3KQBA 2PKAB 1LQDB 2GMTC 2ODYB 5L30H 2ZHQH 4Q7XA 4Y76A 5A8ZA 1DWCH 1ZGIA 1ANCA 1NU7B 1RTFB 1EJNA 4ABIA 4CH2B 4AB8A 3ATKA 3OSYA 2ZDVH 2RA3A 1IOEA 5PTPA 1SB1H 1GL0E 1UCYH 3SUEA 5CMXH 1AKSB 3BEFB 4B2AA 6CHAC 5F8TA 1SGYE 3SZNA 1NZQH 3LGUA 1O5FH 3ZZ5A 1OKXA 1TLDA 3LOXA 1FUJA 1SGCA 3FP8E 3RMNH 3SNBA 1ETTH 1LKBA 2VVUA 1P2QA 1Y3VA 4IMQA 4TWYA 2IOTA 3ZVGA 1ETSH 1T7CA 1Y5BT 2H1UA 5I25A 3G01A 4IS5A 2JETC 3BSQA 1O3HA 5TCAA 1F5LA 2A4GA 2PLXA 2ZGJA 2Y6TA 1C2KA 1K28D 1EAUA 2PTNA 2G00A 1SGEE 1WOFA 1SVPA 1A3BH 3D23A 1O34A 3VXFH 2H5DA 4X6MA 4MPWA 5C5OA 3SV6A 1NT1A 2UUYA 1FONA 2D1JA 1F7ZA 2A5IA 5LH8A 1HAPH 3BTGE 2C8ZB 3ATWA 1D6RA 1EOLA 4X2VA 3Q00A 2O8WA 1MTVA 2FS8A 1LPKB 1TA6A 6GCHG 1O37A 1QB1A 1T8LA 1L1NA 4ISIH 5K7RA 2RA0A 1Q2WA 1SOTA 4FU9A 1B0FA 3EA7A 1LHGH 4JYTA 2XBXA 4JZFH 2XCNA 2AYWA 1TMUH 2GCHF 4XBBA 1BZXE 5HMAA 5GDSH 3SU6A 1DVAH 4NSYA 3GICB 1O36A 2GGVB 3KNXA 1DANH 2AMQA 4FUEA 1BHXB 1HAHH 1SGDE 2Y82A 3LT3A 5DK1A 2Z3EA 2AEIH 3SU2A 4BAMB 1A5IA 1KSNA 3QGJA 2ZDNA 1C1OA 2VVCA 1Z71A 2DUCA 3AW1A 3SU1A 3M36A 1WTHD 2VNTA 5JYIA 1FPHH 2D26C 1CHGA 3RXKA 2R9PA 2NU3E 2TRMA 1EOJA 1W10U 2A7CA 5T3HA 3ODDA 1ACBE 1GI4A 3ATIA 4LXBH 2FWWA 1EASA 3ITIA 3N7OA 4XFQA 2CV3A 5H4IB 1ELDE 2GP9B 4Q2KA 1AI8H 2ASUB 1JRTA 4YOIA 3ZZ8A 3MU5A 3QTOH 3P8OA 3U1IB 2ZQ2A 1LKAA 1ESBA 1WU1A 3KQCA 2NU4E 2FMJA 1UCYK 1G9IE 5GWZA 3AVZA 1UTNA 4DOQA 2FZZA 4K8YA 4J2YB 4KKDA 4WVPE 5JPMH 2ZCKP 1V2MT 1SOZA 2ESTE 1CSOE 2FOAA 4NZLA 2OLGA 1QA0A 4K69A 1TPAE 2D8WA 1ELGA 5EXMA 1OWJA 2VH0A 1T8MA 1UTLM 2VU8E 3OU0A 1CT4E 1GBJA 1O3CA 2VWNA 1H4WA 4AOQA 2P59A 1H8DH 1RRKA 3PYHA 1KDQB 1A5GH 2F3CE 4WMEA 3UY9A 2H6MA 2G51A 2CHAB 3MFJA 1CA0B 3GCTG 2B8OH 3GY7A 4B2CA 4DY7B 2Z3DA 5CE1A 1QIXB 2YNBA 2GZ9A 4GSOA 2B9LA 1FN8A 3PMAB 2QIQA 1A2CH 2TGDA 1T4UH 2BD3A 2BM2A 2HALA 3STJA 1FLEE 4CRCA 2SFAA 4I33A 1O35A 2BQ7B 3SNCA 1C5XB 1C1SA 1K9OE 1C1WH 2WYJA 2QYIA 3Q3YA 1F0TA 1GI1A 3AAUA 4FVDA 3SGQE 3P8FA 2HRVA 4GHTA 3L3TA 4A6LA 4ZH8A 3RXTA 1YPLH 2RDLA 1O3MA 2A31A 2ALVA 1P06A 1VJAU 4Y8ZA 3RXPA 1HB0B 1Z8JB 2STBE 1UHBA 2WV4A 1DDJA 2O8MA 1LCYA 4SGAE 2ZCHP 3MH4A 4WMDA 1PPFE 1O33A 2GV6A 1BQYA 1FIZA 3P70B 1K1MA 2Z9IA 2J92A 2BMGB 2OCVB 3C1KA 1C5MD 2WPIS 4I8KA 2ZQ1A 3SHAH 1H9HE 1TX7A 4R8TB 3KEEA 1HIAB 1AZ8A 1L4DA 5HYOA 1DWDH 4ISLA 2SGDE 1G32B 2NU0E 3CENA 1UCYE 3A82A 1BJVA 1TWXB 2ZHEH 3SV9A 3BIUH 1GVLA 3DHKH 2Y81A 2I6SA 1NPMA 1SG8B 3K2UA 3GCHC 1GJ8B 1EQ9A 1TOMH 3RC6A 3UUZA 1GJ4H 2CF8H 3RMOH 3SN8A 1V2QT 1BCUH 3HK3B 3FAOA 3QO6A 1YPHC 3RC4A 2PW8H 2Q6FA 3SNEA 4O3TA 2PUQH 3UOPA 5L2ZH 5C1XA 1QJ1B 1CGIE 4D76A 1FZZA 3EAJA 4B71A 2D2DA 2PKAA 3SU0A 4GCHG 3BTME 3Q3XA 1HUTH 4DW2U 4ABAA 3T5FH 4ISOA 4FVBA 1O5CB 2NU2E 2G52A 1AVXA 1MQ6A 1RS0A 1HAZB 1TMTH 4IN2A 2PV9B 1AGJA 1AKSA 1ZJDA 1KYNA 1O2ZA 3TIUA 4ABHA 2GX4A 4JK6A 1TPOA 2R2MB 4BAQB 4JZ1A 3F68H 1XXFA 3KIDU 2QV1A 1DSUA 1RTKA 2ZU5A 4NIYA 1C5LH 5C3NA 3MH7A 2A32A 4Y8XA 1CT0E 2G55A 3MH6A 1PYTD 2FLBH 2FI5E 1EPTC 1HGTH 1MTNB 4OS1A 5GCHG 1ESTA 3I77A 2GV7A 4ZXXH 2VIQA 1GHZA 3RXDA 1NN6A 2XC0A 3M3TA 1E38B 1BA8B 1C9TA 3M35A 3RP2A 1ESAA 5DP7A 1MCVA 2A5AA 2AMPA 5DJ7A 1NRPH 1SGIB 1GHAF 5FPTA 4ZHLU 3F6UH 2PSXA 3O8RA 4FUHA 1ARBA 1KLTA 3LGVA 1P0SH 1QR3E 2ZFFH 1QCPA 2R2WU 1OWKA 2VB0A 1C5WB 4NG9H 1DXWA 1NM6A 1XMNB 2J34A 4E7RG 1O2OA 2ZU4A 4UDWH 3TU7H 2G81E 4UEHH 4CRGA 2TGAA 3A83A 2Q6GA 1O5GH 5EW1H 5CHAB 2HNTE 1TGTA 3VB3A 2SGEE 5EOKA 4Y11E 2A1DB 1SQTA 1GBAA 1MKWH 3DUXH 1YPMH 3E0PB 1S0RA 3E6PH 1VGCB 1ARCA 3A8AA 8LPRA 4AYVB 1ID5H 1T32A 1Z7KA 1SLVB 1YKTA 3FP6E 1VITG 3P92A 1XUJA 2F9BH 5E2PA 3A7ZA 1TOCB 1N6XA 1N1LA 3TJOA 4B74A 1UTPA 3ZZ3A 1TRMA 3NKKA 5AFYH 1ZZZA 1PPHE 2PGQB 1FI8A 4E06H 2ZPSA 1BT7A 1P04A 1AVWA 2BDIA 2JH5D 1T31A 3TVJB 1AU8A 2WPHS 3E90B 2ZC9H 4CH8B 1BOQA 3ZVDA 2Q1JA 3DFLA 1GHBF 1TX8A 4NSVA 3FANA 1TABE 5FXLA 2ANKH 2BX4A 3P8NA 5HGGA 4A1VA 3JZ1B 1C2FA 2PR3A 1E37B 1NRQH 2BDHA 1HYLA 1LO6A 4HI3A 3GISB 4JYUH 1OWDA 3SUDA 2O8UA 3UR6A 1FNIA 1PFXC 1C5ZB 1ORFA 4MLFB 4BTTB 3TJNA 2FO9A 1KDQA 3RXGA 2GMTB 4YM9A 1H9LB 1THRH 4DIHH 3NPSA 1QRZA 2VIDA 3RXRA 5J4SA 4DURA 2TPIZ 2UWPA 3UFAA 1HXEH 5FBIA 1BJUA 2EA3A 4ISNA 2FYRA 2XNIA 4BXWA 3MYWA 3TGIE 4CBOA 1KLIH 3M5OA 6CHAB 2BOKA 3QUMP 3VFEA 1CO7E 2Y5FA 3RU4T 3R3GB 4Y7AA 4D7GA 1GI2A 1H1BA 1TGNA 1EP6A 5T6GA 1C5RA 1GBFA 4DCDA 5JBBS 1DWEH 1SLXB 2PHBA 2VGCC 3T27A 7GCHF 3H7OA 2I6QA 5AVDA 1F5RA 2H2ZA 3V13A 1XM1A 1MKWK 2FM2A 2QAAA 1DM4B 1ZJKA 2BQ6B 3TPIZ 1GHWH 4MNYA 4PROA 2OBQA 2ZI2H 1EAIA 3C27B 4K3JA 1EATA 1C2GA 3UOUA 1TA2A 1UVPA 1O30A 4FUJA 1LHCH 4I31A 4XBCA 3RXJA 4YT6H 5LPRA 4IMZA 1DICA 2A4QA 1QB6A 2O8TA 1WAYB 4X8SH 3RXIA 3RXLA 3OY5U 1O2XA 2P8OC 2QC2A 5AHGH 2EI8A 1ETRH 4YESB 3VB7A 3SUGA 4QT8C 1WSSH 1UK2A 1SGQE 1QB9A 9LPRA 5L2YH 5LPFA 5C20A 5DGJA 3RLWH 1Z8GA 3MTYA 4I8HA 1O2WA 1CGHA 1XVMA 4O3UA 4I8LA 7ESTE 5EPNA 3A80A 2BXTH 2CGAA 3BTTE 4NFEA 1O2GH 1NS3A 2C4FH 2QXGA 4AYYB 5TJXA 3A8DA 4H6SB 3ZYEA 3R0FA 5EODA 2XWAA 1VITF 3ZZ7A 2EC9H 2ODPA 1C5VA 2GZ7A 3PMBB 2XC4A 1O2SA 5DP5A 1NROH 4JCNA 2Y5GA 1C1UH 3SO3A 1ELEE 4B73A 1AVGH 1IHSH 1QGFA 1J15A 1TX6A 3TGJE 2ZTYA 1GPZA 1GBKA 3H5CB 2BY6X 1VCWA 4YO9A 2FTMA 1PPCE 1PQ5A 3VB5A 5GXPA 4U32A 1CHOG 3K6ZA 1O3JA 3SGAE 1Q31A 3BTKE 3Q77A 1GJCB 3PWBA 1DITH 4IC5A 5BPEA 4AGJA 4UONA 2QXJA 3SNAA 2CJIA 4Z6AH 3ATMA 3URDA 1K1IA 1S0QA 4J1YA 1G3EA 3SJ9A 3P17H 1GJ7B 1AMHA 2ZU3A 1AFEH 2F9UA 1XKAC 3L33A 4F4OC 1EKBB 3EE0B 1L1JA 3ESTA 5LPEA 2WPLS 2Z3CA 3PO1B 5DP6A 3RC5A 1C2JA 1B0EA 1BTHH 1GBHA 1O3NA 3VGCC 1TMBH 2F9OA 1TNLA 2G4TA 1HAYB 3GDVA 4FU8A 1GI7B 1N8OB 4IC6A 1MUEB 2P3UB 2C90B 1Y5AT 4YLQH 3HATH 1BTZA 1KTSB 4FU7A 1AWHB 1TQ7B 1KXBA 1P2MA 1YLDA 1GWAA 3U69H 3ZZ6A 4AN7A 1O3GA 3LU9B 1GBCA 3T62A 1GCTC 2Z9KA 1CBWC 2QF0A 3TNSA 1PJPA 4TWWA 2A2XH 3M7TA 2YNAA 1YCPH 5EQSA 3K65B 2J4IA 4A1TA 4X1QU 2ZFRH 1FY4A 4XE4A 2QCYA 4CRDA 3M37A 4AFUA 3AASA 1ZSKA 3PWCA 1ZLRA 3M61U 4CRFA 1L0ZA 1WBGB 1UJ1A 1T4VH 3M5NA 1O2QA 1W12U 3LJOA 4MTBA 2SGPE 2FOHA 4TPYA 4A5TS 2DE8A 4ISHH 3RXMA 1S6FA 1YC0A 4BAOB 4X1PU 1O3IA 1JIRA 4R0IA 1C9PA 1P2OA 2FOBA 1O5AB 1TAWA 4UD9H 3UIRA 2ZF0H 3DT0H 3SJIA 1V2WT 1HAXB 1P02A 3QK1A 5A09A 1O2LA 1H8IH 1UVSH 1EJAA 1BTWA 4MG3A 1C4U2 4NIWA 3NWUA 3ZZ9A 1ZMLA 4IN1A 2UUKB 1D4PB 3OY6U 2XCFA 3EDXB 4ZKSU 2V6NA 1O2VA 2PSYA 1K1PA 1LPZB 4CHAC 1TQ0B 1FQ3A 1MD8A 3SU4A 3ZYDA 1VJ9U 4LZ4B 4MVNA 3MNXA 5DP8A 2XWBI 1Y3YA 1SL3A 2OC0A 2O9QA 2VINA 1NFXA 2XBVA 1NFYA 1QBOA 3A7VA 1IQLA 1VZQH 1NTPA 4JMYA 2HPPH 3SI3H 1LTOA 2H5CA 2OD3B 2BDBA 5JB8S 1LHEH 1S81A 5ETXA 3ZZDA 4DVAU 1ZHPA 4MNWA 3KHVA 2FOCA 1X7AC 2V35A 4Y7BA 1HBTH 2ZHFH 1LMWB 4AFZA 1C1VH 2Z6BD 3ZV8A 5EU8A 4INKA 3E1XB 1YP9A 2AERH 4BOHA 2A7JA 1DY8A 1F0RA 1KIGH 2W7UA 1DE7H 5AFZH 2FLRH 1V2ST 1UK4A 4TYDA 3ZVCA 3BF6H 2W3KA 1MD7A 4WWYA 1OP8A 4MPUA 1JBUH 2G4UA 2HGTH 1DUEA 4MNVA 2SNWA 2TGPZ 3UNQA 1O3AA 1YCPK 1LDTT 1GMHG 2BY9X 5DP3A 1P09A 1OWIA 1Z1JA 1QBVH 1MBMA 4Y6DA 4H42U 4D9RA 2Y80A 1CQQA 1GI5A 1SGPE 1WQVH 3SUFA 1HAIH 4CRAA 4LK4A 1Y3UA 3PV4A 3KCGH 1SGFA 1ZGVA 3MOCA 1P05A 5G4BA 1O38A 2CF9H 1YPEH 1MU8B 1O0DH 1CU1A 1K1NA 2A4RA 2ODQA 2ZGBH 4ZUHA 3TNTA 3IWMA 1ANDA 2G8TA 6LPRA 1SHYA 1Y59T 4RKOB 3LGWA 1THPB 1NO9H 2B7DH 4YTAA 6GCHF 2GCTC 4OS2A 4K60A 3V12A 1LHFH 3PLPA 5JB9S 1O5EH 3NXPA 3OX7U 2A45B 2BY7X 1NRRH 2GD4B 2GT8A 2IN2A 1ELBA 2NU1E 1DXPA 1GI9B 5FBEA 1J9CH 4OS7A 1MU6B 3SV2H 1NRNH 1PQ7A 3ENSB 3RDZA 2OP9A 1MBQA 5L6NH 5FHTA 2BVRH 3MO9A 4AB9A 4K2YA 1A0JA 1BBRH 1MH0A 1NRSH 5FX6A 1QRWA 1E35B 3E0NB 4HFPB 3LH3A 2BLWA 4FUBA 1Z6EA 1HCGA 3GDUA 1C1QA 1SFQB 3M7UA 1OOKB 3TH2H 2C8WB 1O2YA 2J9NA 3M7QA 1CA8B 4GPGA 3HGNA 2XTTB 2UUJB 2EI7A 4K8BA 4K1TA 4IBLH 2ZCLP 2BY8X 4ZKRU 4UFEH 1E34B 1GG6B 2PKSB 4AGKA 1ZHRA 5A8XA 1FY3A 1ZPCA
chains in the Genus database with same CATH superfamily
1C1PA 3IG6B 4KTUA 4D7FA 2XC5A 5DG6A 3TLOA 3EA8A 3PV2A 2QGRA 1C4Y2 4MQAA 3BG4C 1A3EH 1G2LA 4TSFD 1EXFA 4XOJA 1GBEA 1V3XA 1C2EA 4XBDA 3OTJE 5DP9A 3FN8A 3PV5A 1EAXA 3RXVA 5EG4A 1IAUA 3MI4A 1EJMA 2FOFA 2ZEBA 1V2OT 2ZU1A 3I78A 4B1TA 2J38A 2J98B 1C1NA 3V0XA 1V2NT 1SR5C 1GJDB 3TGKE 2FI4E 2KCAA 3RXQA 4DIIH 2ZFPH 3PLBA 2WPDD 2J95A 2ZP0H 4F49A 3LONA 3MO3A 4GAWA 3BTHE 1YGCH 2ZFQH 3GCTF 5TCCA 3ODFA 2HLCA 2F9NA 3N7EA 2FS9A 2ZFSA 3U8TH 2OQUA 4B2BA 4X8UH 1C1TA 1P01A 2W6JD 1P9UA 4I32A 4D9QA 5SGAE 3BEUA 3MU0A 3B9FH 2ILNA 1VITH 1O3KA 5F6MA 1GMHF 1HXFH 1YLNA 4I8JA 3URCA 4ABBA 3O8BA 1PPGE 2FOMB 1ZYOA 2W26A 3UREA 2C3SA 3T29A 1DWBH 1B7XB 3K6YA 1E36B 1NC6A 2GDEH 3HGPA 1XUIA 3DD2H 1RXPA 4ZHMU 2OTVA 4RN6A 1O31A 2DE9A 1HFDA 2JJ2D 3QZQA 4A92A 3UPEA 1LPGB 1KXCA 1QY6A 2LNCA 3PMJA 2C93B 1A5HA 3STIA 1EZXC 1YPJH 2JH6D 1BBRK 1Q3XA 4NWLA 1QA7A 3GY3A 1A0LA 4X2XA 1GI8B 3RXCA 1OSSA 4ZROA 3F9HA 1QQUA 1C2IA 2ULLA 1HJAC 3EQ0H 3TK9A 3T28A 3QTVH 1UW7A 1BRAA 1HAVB 1S85A 3S69A 2BLQA 3CS7A 1BIOA 4CREA 1ZOMA 1ELTA 3B8JA 3KL6A 2P8OB 1YPKH 4BTUB 1THSH 2WPJS 5IDKA 3PLKA 2AMDA 2KAIB 5JBAS 1TRNA 1UTQA 5EQRA 2H9EH 1TNKA 4Y10E 1ZSJA 2OC7A 4HGCA 1GVKB 1Z6JH 5F8XA 2BD8A 1V2KT 4CR5A 5ABWA 3SYJA 1YF4A 1L2EA 2ZKSA 1UK3A 4U2WA 3V7TA 1J17T 3ZZ4A 1TNHA 2J94A 2SGAA 3WWBA 1HDTH 4Q7ZA 1EX3A 1SLWB 3DSPA 1ZR0A 1C2DA 2R0KA 1F5KU 3OFND 1XX9A 5JBCS 4M7GA 3F0PA 2BQWB 3RXEA 1EUFA 2WPKS 7LPRA 2XBWA 9ESTA 3KN2A 3KF2A 1O2RA 2A7HA 4GCHF 4E7NA 1CT2E 2PUXB 3MWIU 5EPYA 3SBKA 3QGNB 3RUOA 2Z94A 1MTSA 3SNDA 1KXFA 3SV8A 1OYQA 1G3CA 4Q4LA 1HV7A 1O2NA 2BD5A 1SBWA 1DS2E 4NWKA 3H7TA 4YOGA 4MNXA 1OPHB 4NZQA 4WJG2 3FP7E 1UTJA 1MZDA 5T6FA 5C1UA 3BTWE 1KY9A 1TGBA 5A8YA 2BHGA 3RM0H 1H8ED 1IQHA 1W0YH 1QHRB 5EXNA 1MTNC 2BLVA 1P2NA 4UFFH 1P11E 1BBRE 3UQOA 1RFNA 1AY6H 4WXVA 1FY8E 5GCHF 1ZPZA 2BDGA 1P12E 1GMDG 3A89A 4NGAH 2Z9LA 2AIQA 3RXUA 3VGCB 3LGYA 1NBMD 1EZSC 4K1EA 4LOYH 5C1YA 1ZTLA 8ESTE 3E3TA 1S6LA 2JETB 1OWHA 4INLA 3W95A 4X2YA 1M9UA 1QL8A 4OS6A 1C2HA 1F92A 3OYPA 2ZU2A 2QXIA 1CVWH 1SQAA 3GYLB 2IJOB 3ZZBA 2PGBB 1BTPA 2SNVA 2F4LA 1EAWA 2UUFB 3F9GA 1KXEA 3HK6B 1V6DA 4Z1MD 1IQEA 5DPAA 1KXAA 2B5TB 1P10A 1GCTB 1O5DH 3F2FA 4HZHA 1HIAA 1TE0A 2R3UA 4RT0A 3TK6A 2WINI 4A7IB 1GMCG 4ABGA 2ZECA 2ZDKA 1D3TB 1GBBA 2GVFA 5CHAC 1W7GH 2TGTA 3S0NA 1BRUP 2FTLE 1DSTA 3RXOA 1AB9C 3CP7A 2BYAX 1ABIH 3KGPA 1UHBB 4TY6A 1AE8H 1DLEA 5T6DA 4X1NU 3M5MA 4X2WA 1YPGH 1XVOA 3GYMA 1DPOA 1ZRKA 3T2NA 1D3PB 3SV7A 4YZUA 3KQEA 2VWOA 3TJUA 1AZZA 1P03A 2QY0B 1UVOA 1TGCA 3P8GA 3Q76A 1FY5A 1IQNA 1K1OA 4Y0YE 1O3LA 3T26A 2P93A 2BZ6H 5DO4H 4XDEA 4KGAA 4BANB 3D65E 2HNTC 1V2VT 2OXSA 3ELAH 4FUFA 2XBYA 3W1EA 1MTUA 4GHQA 4CHAB 3GY6A 1AN1E 3LC3A 1F2SE 1SGTA 1T8NA 2OC1A 4FXGH 1F0SA 1RD3B 1IQKA 2VIWA 1GJ6A 3GY8A 1QTFA 4FUGA 2HWLB 1PPBH 4ABJA 1O3OA 3MU4A 3UTUH 1QRXA 5C5NA 1AE5A 3GOVB 3F9FA 3SHCH 1G30B 5ESBA 1Z1IA 1AWFH 3GCNA 1HNEE 2J98A 1GJ9B 3BN9A 2FXRA 2P3FH 1V2UT 3SU5A 5J4QA 1O39A 5HIYA 2ANMH 2M5TA 3PRBA 5K0HA 4ZKNU 3KYGA 1L1GA 1O2TA 2VVVA 2ZA5A 2UWOA 3SGBE 5FPSA 4CBNA 1HAGE 1JXPA 1P3EA 5C17A 3A8BA 5ESTE 1WTGH 2CMYA 2STAE 3MHWU 1W8BH 4Q7YA 2ZPQA 2CXVA 1TPSA 2FOEA 1WUNH 4NCYA 1UO6A 1HAOH 1EB2A 3P95A 1T8OA 1GJBB 2PFEA 1TPPA 3SQEE 3MU8A 5C0UA 3SW2B 2XW9A 1BHXF 3SORA 3BTQE 4DJZB 1GMDF 3TJVA 3TITA 4JK5A 1UTKA 3TH3H 2RCEA 1G37A 2V0BA 2V3HH 3HKJB 3VB4A 1TYNA 4VGCC 1GGDC 4Z0KA 4BTIB 1A0HB 2WYGA 3LIWA 2FYQA 1EZUC 1ABJH 1HLTH 1YLCA 4AG1A 1S6HA 4DG4A 4OS4A 2BVSH 4IW4E 4BNRA 5FCRA 1HJ8A 1C5PA 1DX5M 2VWMA 2YOLA 4WH8A 3EE7A 3LJJA 2P3TB 3S7KB 3D62A 2OK5A 4DGJA 1HAVA 4NIVA 1GMCF 1BMLA 4KTCA 4GUXA 2FESH 2TBSA 2WHXA 2A2QH 2R3YA 3OEHD 2GCTB 3PM3A 1YPHE 4LZ1H 3A8CA 4KELA 1D6WA 3RXBA 2KAIA 4INHA 3JZ2B 1B5GH 1O2MA 4I7YH 4YLUA 4SGBE 3Q3KA 5HM9A 1GL1A 3E16B 3PB1E 4A1XA 1YWUA 2OQ5A 3A87A 1TBRH 3F2HA 5EXLA 1ZSLA 2HLDD 5HXFA 1AFQC 1DOJA 1S83A 2AGGX 3GCHB 4AZ2B 2ZGXH 1INCA 2P95A 2A4OA 3DFJA 2A5KA 3GCOA 1QQ4A 2LPRA 1UMAH 2HVYB 3WY8A 3GDSA 3HPTB 1JMOH 1K21H 3VPKA 5HKKD 4YT7H 3BV9B 4Q80A 1V2TT 2SGFE 3BIVH 1BRCE 3F1SB 2BDYA 2AGIX 4YXWD 2BX3A 2Z9JA 2BD2A 3SJKA 1J8AA 1W14U 1RIWC 1VR1H 3O8DA 2ZHWH 3VB6A 3MMGA 1V2RT 1FXYA 1K22H 1QJ7B 2W5EA 4ZKOU 3OEED 3LPRA 4ZCNA 2KCOA 3M3VA 1V2JT 5LGOA 4E05H 5EQQA 2VWLA 2Z7FE 2ZIQH 3F0OA 1ZTJA 1SQOA 1GDNA 1VCPA 3BG4B 4FOUC 3UNRA 1CHOF 1MAYA 1QURH 1MAXA 1W0ZU 3GY2A 1BITA 2GT7A 4X1SU 4Y0ZE 4JYVH 1AO5A 1A61H 2FI3E 5BRRE 2KCPA 2LELA 1GHXH 3ZV9A 2GJGA 1P2KA 1E1RD 4NA9H 3PO1C 4FUDA 1BMNH 1TNIA 1D3DB 3A84A 1P57B 2FPZA 3LGIA 2P94A 1A1RA 3D49H 4WY3A 5A0AE 1ZPBA 1ELVA 4D8NA 2ZDAH 3A86A 2FIRH 1N6YA 2V3OH 1N8OC 3V3MA 3SJOA 3AAVA 1EPTB 1XUHA 3AW0A 3FZZA 2GZ8A 1HJ9A 3S9AA 2FODA 3SJ8A 5E0GA 1VKYA 3U8RH 3VXEH 1GHAG 4ABDA 3PTNA 2ZDMA 4UFDH 1S5SA 3PTBA 5FCKA 4BAHB 5F03A 5EW2H 1TBZH 5DP4A 3HKIB 3UWIA 2WPMS 1GBDA 1ZTKA 4NIXA 1GDUA 4ASHA 2QXHA 1GJ5H 4OGXA 1MKXH 5HM2A 4BXSA 2ZDLA 1GI6A 1D9IA 3MU1A 2WZQA 4MDSA 1TGSZ 1ANEA 3BTFE 1BTYA 4I8GA 3RMLH 1BMAA 4ESTE 1WCZA 2HOBA 2FEQH 1ZMJA 3PROA 4WMFA 2OC8A 1DLKB 2BD4A 2P16A 1IQMA 1G2MA 1OX1A 2RFKC 1VCQA 4JZIA 4MPVA 4IGDA 2Y7ZA 3UNSA 3SOSA 1IQGA 1C1MA 1E1QD 1L4ZA 1HJAB 3A7TA 3EA9A 1E0FD 2BLOA 1SPJA 1TB6H 3NCLA 2PWXA 3LKWA 2FOGA 1ZHMA 1C5TA 3PMHB 1W2KH 1J16A 1GCDA 3QN7A 4X6PA 2HVXA 2BB4A 1ZMNA 3LH1A 2AHME 2Z9GA 1O2JA 4ZXYH 2GKVE 4FUCA 1JWTA 1SMFE 2LP6A 1IHTH 2JH0D 1P2IA 2OINA 3ZVBA 1MZAA 1AUTC 1DT2A 2C8YB 4ACAA 3OTPA 4ABEA 1TNGA 2ZHDA 4X0WU 5A2MH 7KMEH 2Y5HA 3MO6A 1GHBG 1BB0B 1YM0A 1QFKH 2BDCA 2C8XB 2BD9A 2JKHA 1C5SA 2G5VA 2BTCE 1SFIA 3RXSA 1QL7A 3CS0A 1QJ6B 3FFGA 4KTSA 4WXIA 1EP5A 2ZGHA 2QF3A 2JJ1D 1HPGA 1QBNA 1QNJA 1V2LT 3FVFB 5A0CA 3S9BA 1GJAB 3L6PA 2JDID 5IYTA 2BVXH 4OM9A 4GVUA 1AQ7A 2R0LA 5B6OA 3QZRA 3ZZCA 1IQJA 1K1LA 3B23B 1SGFG 5CHBA 1EZQA 3M5LA 3N99A 1GI3A 2ZTZA 4ZMAH 3RU4E 1JOUB 3BTDE 3SU3A 1ZRBA 2IPHA 4ASUD 4RSPA 8KME2 2CHAC 4AFQA 1CA0C 1BTXA 4B76A 3RM2H 2ZZUH 4DT7B 3I29A 1P3CA 2CN0H 4FUIA 1FDPA 1RGQA 2F9PA 5FX5A 1FV9A 4CRBA 2K1QA 5EJZA 2TIOA 1PQ8A 1SHHB 2ZTXA 1FJSA 1COWD 1DUAA 6ESTA 1LQEA 1SLUB 1NBME 1WV7H 2K0QA 5AF9H 1NY22 1YY3A 1O2PA 1BRBE 1Y3WA 2ZO3H 3S7HB 4Y8YA 1BUIA 5DSFA 5DKMA 4MPXA 1GBLA 1MKXK 2L74A 1O3FA 3RXHA 3A85A 1AIXH 7GCHG 3F9EA 1ELAA 4NA7A 1PYTC 4O9VA 1FAKH 3MNBA 1SGRE 3U9AH 2VGCB 2F9VA 1ELFA 4OS5A 1TIOA 2NWNA 1DFPA 4RKJB 3U8OH 1UVUH 3O8CA 4TY7A 2FX4A 2XYAA 1TALA 2HNTF 2FDAA 4WH6A 4ZAEA 1QL9A 1W11U 1D3QB 1O3DA 5FPYA 5EGMA 3QLPH 1V2PT 1AUJA 1MCTA 4K1SA 1ANBA 1ELCA 4O03A 4Y79A 1FY1A 4GLYA 4AG2A 1LVBA 2QN5T 3KQDA 3QDZB 1XUFA 3EYDA 2H9HA 1YCPM 1CE5A 1G3BA 1OS8A 2ZFTA 1J14A 3EGKH 2VIPA 1AB9B 3FOAA 4JZDH 5E0HA 1W7XH 1P2JA 3FZDA 1W13U 4O97A 2OBOA 1OP2A 5E0JA 5E8EH 1GDQA 2PTCE 4OGYA 1SC8U 1W0JD 2KX4A 1OP0A 1C5OH 3NZIA 5I46H 2UWLA 1NFWA 3NUMA 1TONA 2BZAA 2HPQH 1HRTH 3GY5A 4NA8A 1W0KD 2Q6DA 5E2OA 1Z8RA 4ZHAA 2OUAA 1KLJH 1WQSA 1GG6C 2PKSC 3U1JB 8GCHG 3LC5A 2V7QD 3WW7A 4B6EA 5B6LA 1BDAA 5C2ZA 4KP0A 5C67A 4U01A 3T25A 3RXFA 2THFB 1OWEA 3BG8A 1FPCH 3A88A 4Y71A 1PQAA 1WYKA 3IITA 4AORA 3SZEA 1XKBC 1GBMA 2QA9E 2ZPRA 2BY5X 1GBIA 1KXDA 1GI0A 1BMMH 1TBQH 1LVYA 1OYTH 3UWJH 1O32A 2AS9A 1EB1H 3UR9A 2EI6A 3BEIB 3A7XA 4X6OA 1UTOA 1O2IA 4NFFA 5JBTA 1C1RA 2GTBA 1G36A 4XSKU 1MMJN 1XXDA 2EEKA 1BTUA 3UQVA 1RTLA 3E91A 1SSXA 1C5QA 2VH6A 1YYY1 3RU4D 3RMMH 1A4WH 2ZGCA 2A0QB 2W3IA 1YBWA 3RLYH 1XUGA 1F0UA 1EPTA 1PPEE 2AH4X 2BXUH 4AFSA 1TRYA 1AD8H 1K1JA 5GPIB 1KTTB 2ZWLH 3MH5A 3A7WA 1O2UA 1C2MA 1CGJE 1TNJA 5FAHA 1C5YB 2G5NA 4X8TH 1LVMA 1C4V2 3A81A 4AX9H 4F55A 1GHVH 3NK8A 2ZG0H 1P9SA 1FMGA 4B75A 1A46H 2VIVA 2GDDA 3U98H 3ATLA 2L6OA 2ALPA 1TFXA 5A0BA 2ANYA 1IQFA 5T1VA 3VEQB 1LHDH 1U6QA 1NU9A 2AGEX 1NFUA 1CBWB 1Y3XA 1C5UA 2XRCA 2F83A 2O8LA 3K9XB 3MNSA 1Y5UT 2XXLA 1C2LA 1G3DA 1FAXA 2VBCA 1SGNE 1C5NH 1GGDB 4TPIZ 4VGCB 4BAKB 5DN6D 3TK5A 1UVTH 2Y7XA 3GY4A 4X6NA 2GCHG 4WF8A 4JZEH 1GBTA 4M9FA 2BOHB 4H6TA 1MTWA 1VGCC 3MNCA 5GJ4B 5GNDA 3ZVFA 5JDUB 1A7SA 2FX6A 2FP7B 3H09A 1GHYH 2WV5A 3QWCH 3SQHE 2WV9A 1O3PB 2RG3A 1AHTH 4H4FA 4THNH 2H9TH 1GVZA 1H9IE 1O3BA 2WUBA 1KMHB 2K8IA 2BD7A 2AFQB 3LDXH 2VIOA 3DA9B 2AIPA 1P8VC 2WUCA 3A7YA 3W94A 3ZZAA 4CR9A 3P6ZB 3KQ5A 3ZVEA 5GIBA 2ZNKH 3ZVAA 4P02A 3E8LA 1Z8IB 4U30A 1MQ5A 4HTCH 1UTMA 2F91A 1AFQB 4ABFA 1W3CA 1FIWA 2J2UA 3LGTA 1LVOA 1XUKA 1RJXB 1S82A 2F43B 3QX5H 2W7SA 1O5BB 3BTEE 5F8ZA 4X8VH 1O3EA 5CDFE 1NESE 4UFGH 4K5ZA 3RXAA 1O2KA 3TH4H 3SI4H 1K2I1 2VJ1A 2SGQE 8GCHF 1Y8TA 4YOJA 3M3SA 1O2HA 4UE7H 3S9CA 3DCLA 4X1RU 3VG8A 2BDAA 2B0FA 1FN6A 1RIWB 2ANWA 1FX0B 1JIMA 1SI5H 1JRSA 1OXGA 1DY9A 1S84A 1PPZA 1IQIA 3KQBA 2PKAB 1LQDB 2GMTC 2ODYB 2KCYA 5L30H 2ZHQH 4Q7XA 4Y76A 5A8ZA 1DWCH 1ZGIA 1ANCA 1NU7B 1RTFB 1EJNA 4ABIA 4CH2B 4AB8A 3ATKA 3OSYA 2ZDVH 2RA3A 1IOEA 5PTPA 1SB1H 1GL0E 1UCYH 3SUEA 5CMXH 1AKSB 3BEFB 4B2AA 6CHAC 5F8TA 1SGYE 3SZNA 1NZQH 3LGUA 1O5FH 3ZZ5A 1OKXA 1TLDA 3LOXA 1FUJA 1SGCA 3FP8E 3RMNH 3SNBA 1ETTH 1LKBA 2VVUA 1P2QA 1Y3VA 4IMQA 4TWYA 2IOTA 3ZVGA 1ETSH 1T7CA 1Y5BT 2H1UA 3DSGA 3FKSD 5I25A 3G01A 4IS5A 2JETC 2V3MA 3BSQA 1O3HA 5TCAA 1F5LA 2A4GA 2PLXA 2ZGJA 2Y6TA 1C2KA 1K28D 1MABB 1EAUA 2PTNA 2G00A 1SGEE 1WOFA 1SVPA 1A3BH 3DSOA 3D23A 1O34A 3VXFH 2H5DA 4X6MA 4MPWA 5C5OA 3SV6A 1H8HD 1NT1A 2UUYA 1FONA 2D1JA 1F7ZA 2A5IA 5LH8A 1HAPH 3BTGE 2PP6A 2C8ZB 3ATWA 1D6RA 1EOLA 4X2VA 3Q00A 2O8WA 1MTVA 2FS8A 1LPKB 1TA6A 6GCHG 1O37A 1QB1A 1T8LA 1L1NA 4ISIH 5K7RA 2RA0A 1Q2WA 1SOTA 4FU9A 1B0FA 1OHHD 3EA7A 1LHGH 4JYTA 2XBXA 4JZFH 2XCNA 2AYWA 1TMUH 2GCHF 4XBBA 1BZXE 3FO8D 5GDSH 5HMAA 3SU6A 1WDIA 1DVAH 4NSYA 3GICB 1O36A 2GGVB 3KNXA 1DANH 2AMQA 4FUEA 1BHXB 1HAHH 1SGDE 4TT3D 2Y82A 3LT3A 5DK1A 2Z3EA 2AEIH 3SU2A 4BAMB 1A5IA 1SQRA 1KSNA 2YMSC 3QGJA 2ZDNA 1C1OA 2VVCA 1Z71A 2DUCA 3AW1A 3SU1A 3M36A 1WTHD 2VNTA 5JYIA 2XOKD 1FPHH 2D26C 1CHGA 3RXKA 2R9PA 2NU3E 2TRMA 1EOJA 1W10U 2A7CA 5T3HA 3ODDA 1ACBE 1GI4A 3ATIA 4LXBH 2FWWA 1EASA 2CK3D 3ITIA 3N7OA 4XFQA 2CV3A 5C0TA 5H4IB 1ELDE 2GP9B 4Q2KA 1AI8H 2ASUB 1JRTA 4YOIA 3ZZ8A 3MU5A 3QTOH 3P8OA 5HIZA 3U1IB 2ZQ2A 1LKAA 1ESBA 1WU1A 3KQCA 2NU4E 2FMJA 1UCYK 1G9IE 5GWZA 3AVZA 1UTNA 4DOQA 2FZZA 4K8YA 4J2YB 5EJ1A 4KKDA 4WVPE 5JPMH 2ZCKP 1V2MT 1SOZA 2ESTE 1CSOE 2FOAA 4NZLA 2OLGA 1QA0A 4K69A 1TPAE 2D8WA 1ELGA 5EXMA 1OWJA 2M2AA 2VH0A 1T8MA 1UTLM 2VU8E 3OU0A 1CT4E 1GBJA 1O3CA 2VWNA 1H4WA 4AOQA 2P59A 1H8DH 1RRKA 3PYHA 1KDQB 1A5GH 2F3CE 4WMEA 3UY9A 2H6MA 2G51A 2CHAB 3MFJA 1CA0B 3GCTG 2B8OH 3GY7A 4B2CA 4DY7B 2Z3DA 5CE1A 1QIXB 2YNBA 2GZ9A 4GSOA 2B9LA 1FN8A 3PMAB 2QIQA 1A2CH 2TGDA 1T4UH 2BD3A 2BM2A 2HALA 3CNRA 3STJA 1FLEE 4CRCA 2SFAA 4I33A 4ACBA 1O35A 2BQ7B 3SNCA 1C5XB 1C1SA 1K9OE 1C1WH 2WYJA 2QYIA 3Q3YA 1F0TA 1GI1A 3AAUA 4FVDA 3SGQE 3P8FA 2HRVA 4GHTA 3L3TA 4A6LA 4ZH8A 3RXTA 1YPLH 2RDLA 1O3MA 2A31A 2ALVA 1P06A 2KZ4A 1VJAU 4Y8ZA 3RXPA 1HB0B 1Z8JB 2STBE 1UHBA 3N7DA 2WV4A 1DDJA 2O8MA 1LCYA 4SGAE 2ZCHP 3MH4A 4WMDA 1PPFE 1O33A 2GV6A 1BQYA 1FIZA 3P70B 1K1MA 2Z9IA 2J92A 2BMGB 2OCVB 3C1KA 1C5MD 2WPIS 4I8KA 2ZQ1A 3SHAH 1H9HE 1TX7A 4R8TB 3KEEA 1HIAB 1AZ8A 1L4DA 5HYOA 1DWDH 4ISLA 2SGDE 1G32B 2NU0E 3CENA 1UCYE 2QF4A 3A82A 1BJVA 1TWXB 2ZHEH 2EY4C 3SV9A 3BIUH 1GVLA 3DHKH 2Y81A 2I6SA 1NPMA 1SG8B 3K2UA 3GCHC 3ZIAD 1GJ8B 1EQ9A 1TOMH 3RC6A 3UUZA 1GJ4H 2CF8H 3RMOH 3SN8A 1V2QT 1BCUH 3HK3B 3FAOA 3QO6A 1YPHC 3RC4A 2PW8H 2Q6FA 3SNEA 4O3TA 2PUQH 3UOPA 5L2ZH 5C1XA 1QJ1B 1CGIE 4D76A 1FZZA 3EAJA 4B71A 2D2DA 2PKAA 3KYFA 3SU0A 4GCHG 3BTME 3Q3XA 1HUTH 4DW2U 4ABAA 3T5FH 4ISOA 4FVBA 1O5CB 2NU2E 2G52A 1AVXA 1MQ6A 1RS0A 1HAZB 1TMTH 4IN2A 2PV9B 1AGJA 1AKSA 1ZJDA 1KYNA 1O2ZA 3TIUA 4ABHA 2GX4A 4JK6A 1EFRD 1TPOA 2R2MB 4BAQB 4JZ1A 3U28C 3F68H 1XXFA 3KIDU 2QV1A 1DSUA 1RTKA 2ZU5A 4NIYA 1C5LH 5C3NA 3MH7A 2A32A 2IJD1 4Y8XA 1CT0E 2G55A 3MH6A 1PYTD 2FLBH 2FI5E 1EPTC 1HGTH 1MTNB 4OS1A 5GCHG 1ESTA 4HG6A 3I77A 3UAIC 2GV7A 4ZXXH 2VIQA 1GHZA 3RXDA 1NN6A 2XC0A 3M3TA 1E38B 1BA8B 1C9TA 3M35A 3RP2A 1ESAA 5DP7A 1MCVA 2A5AA 2AMPA 5DJ7A 1NRPH 1SGIB 1GHAF 5FPTA 4ZHLU 3F6UH 2PSXA 3O8RA 4FUHA 1ARBA 1KLTA 3LGVA 1P0SH 1QR3E 2ZFFH 1QCPA 2R2WU 1OWKA 2VB0A 1C5WB 4NG9H 1DXWA 1NM6A 1XMNB 3UB0A 2J34A 4E7RG 1O2OA 2ZU4A 4UDWH 3TU7H 2G81E 4UEHH 4CRGA 2TGAA 3A83A 2Q6GA 1O5GH 2QE7D 5EW1H 5CHAB 2HNTE 1TGTA 3VB3A 2SGEE 5EOKA 4Y11E 2A1DB 1SQTA 1GBAA 1MKWH 3DUXH 1YPMH 3E0PB 1BMFD 5KEDA 1S0RA 3E6PH 1VGCB 1ARCA 3A8AA 8LPRA 4AYVB 1ID5H 1T32A 1Z7KA 1SLVB 1YKTA 4AC9A 5KGOA 3FP6E 1VITG 3P92A 1XUJA 2F9BH 2JIZD 5E2PA 1QZ8A 3A7ZA 1TOCB 1N6XA 1N1LA 3TJOA 4B74A 5C94A 4XD7D 1UTPA 4FETA 3ZZ3A 1TRMA 3NKKA 5KECA 5AFYH 1ZZZA 5EJLA 1PPHE 2PGQB 1FI8A 4E06H 2ZPSA 1BT7A 1P04A 1AVWA 2BDIA 2JH5D 4RI0A 1T31A 3TVJB 1AU8A 2WPHS 3E90B 2ZC9H 4CH8B 1BOQA 3ZVDA 2Q1JA 4P00A 3DFLA 1GHBF 1TX8A 4NSVA 5FL7D 3FANA 1TABE 5FXLA 2ANKH 2BX4A 2W6ID 3P8NA 5HGGA 4A1VA 3JZ1B 1C2FA 2PR3A 1E37B 1NRQH 2BDHA 1HYLA 1LO6A 4HI3A 3GISB 4JYUH 1OWDA 3SUDA 3F3BA 4DT4A 2O8UA 3UR6A 1FNIA 1PFXC 1C5ZB 1ORFA 4MLFB 4BTTB 3TJNA 2FO9A 1KDQA 3RXGA 2GMTB 4YM9A 1H9LB 1THRH 4DIHH 3NPSA 1QRZA 2VIDA 3RXRA 3AK5A 5J4SA 4DURA 2TPIZ 2UWPA 3UFAA 2KFWA 1HXEH 5FBIA 1BJUA 2EA3A 4ISNA 2FYRA 2XNIA 4BXWA 3MYWA 3TGIE 4CBOA 1KLIH 3M5OA 6CHAB 2BOKA 2KR7A 3QUMP 3VFEA 1CO7E 2Y5FA 3RU4T 1SKYE 3R3GB 4Y7AA 4D7GA 1GI2A 1H1BA 1TGNA 1EP6A 5T6GA 1C5RA 1GBFA 4DCDA 5JBBS 1DWEH 1SLXB 2PHBA 3NRLA 2VGCC 4Q63A 3T27A 7GCHF 3H7OA 1E79D 2I6QA 5AVDA 1F5RA 2H2ZA 3V13A 1XM1A 2RDEA 1MKWK 2FM2A 2QAAA 1DM4B 1ZJKA 2BQ6B 3TPIZ 1GHWH 4MNYA 4PROA 2OBQA 2ZI2H 1EAIA 3C27B 4K3JA 1EATA 1C2GA 3UOUA 1TA2A 1UVPA 1O30A 4FUJA 1LHCH 4I31A 4XBCA 3RXJA 4YT6H 5LPRA 4IMZA 1DICA 2A4QA 1QB6A 2O8TA 1WAYB 1WXRA 4X8SH 3RXIA 3RXLA 3OY5U 1O2XA 2P8OC 2QC2A 5AHGH 2EI8A 1ETRH 4YESB 3VB7A 3SUGA 4QT8C 1WSSH 1UK2A 1SGQE 1QB9A 9LPRA 5L2YH 5LPFA 5C20A 5DGJA 3RLWH 1Z8GA 3MTYA 4I8HA 1O2WA 1CGHA 4B6FA 1XVMA 4O3UA 4I8LA 7ESTE 5EPNA 3A80A 2BXTH 2CGAA 3BTTE 4NFEA 1O2GH 1NS3A 2C4FH 2QXGA 4AYYB 5TJXA 3A8DA 4H6SB 3ZYEA 3R0FA 5EODA 2XWAA 1VITF 3ZZ7A 2EC9H 2ODPA 2KM0A 1C5VA 2GZ7A 2YMSB 3PMBB 2XC4A 1O2SA 5DP5A 1NROH 4JCNA 2Y5GA 1C1UH 3SO3A 1ELEE 4B73A 1AVGH 1IHSH 1QGFA 1J15A 1TX6A 3TGJE 2ZTYA 1GPZA 1GBKA 3H5CB 2BY6X 1VCWA 4YO9A 2FTMA 1PPCE 1PQ5A 3VB5A 5GXPA 4U32A 1CHOG 3K6ZA 1O3JA 3SGAE 1Q31A 3BTKE 3Q77A 1GJCB 3PWBA 1DITH 4IC5A 5BPEA 4AGJA 4UONA 2QXJA 4I86A 2CJIA 3SNAA 4Z6AH 3ATMA 3URDA 1K1IA 1S0QA 4J1YA 1G3EA 3SJ9A 3P17H 1GJ7B 1AMHA 2ZU3A 1AFEH 2F9UA 1XKAC 3L33A 4F4OC 1EKBB 3EE0B 1L1JA 4F48B 3ESTA 5LPEA 2WPLS 2Z3CA 3PO1B 5DP6A 3RC5A 1C2JA 1B0EA 1BTHH 1GBHA 1O3NA 3VGCC 1TMBH 2F9OA 1TNLA 2G4TA 1HAYB 3GDVA 4FU8A 1GI7B 4XRNA 1N8OB 4IC6A 1MUEB 2P3UB 2C90B 1Y5AT 4YLQH 3HATH 1BTZA 1KTSB 4FU7A 1AWHB 1TQ7B 1KXBA 1P2MA 1YLDA 1GWAA 3U69H 3ZZ6A 4AN7A 1O3GA 2IPQX 3LU9B 1GBCA 3T62A 1GCTC 2Z9KA 1CBWC 2QF0A 3TNSA 1PJPA 4TWWA 2A2XH 3M7TA 2YNAA 1YCPH 5EQSA 3K65B 2J4IA 4A1TA 4X1QU 2ZFRH 1FY4A 4XE4A 2QCYA 4CRDA 3F2GA 3M37A 4AFUA 3OAAD 3AASA 1ZSKA 3PWCA 1ZLRA 3M61U 4CRFA 2YMSD 1L0ZA 1WBGB 1UJ1A 1T4VH 3M5NA 1O2QA 1W12U 3LJOA 4MTBA 2SGPE 2FOHA 4TPYA 4A5TS 2DE8A 4ISHH 5IK2D 3RXMA 1S6FA 1YC0A 4BAOB 4X1PU 1O3IA 1JIRA 4R0IA 1C9PA 1P2OA 2FOBA 1O5AB 1TAWA 4UD9H 3UIRA 2ZF0H 3DT0H 3SJIA 1V2WT 1HAXB 1P02A 3QK1A 1K0HA 5A09A 1O2LA 1H8IH 1UVSH 1EJAA 1BTWA 4MG3A 3PRDA 1C4U2 4NIWA 2J5UA 3NWUA 3ZZ9A 1ZMLA 4IN1A 2UUKB 1D4PB 3OY6U 2XCFA 3EDXB 4ZKSU 2V6NA 1O2VA 2PSYA 1K1PA 1LPZB 4CHAC 1TQ0B 1FQ3A 1MD8A 3SU4A 3ZYDA 1VJ9U 4LZ4B 4MVNA 3MNXA 5DP8A 2XWBI 1Y3YA 1SL3A 2OC0A 2WSSD 2O9QA 2VINA 4RT1A 1NFXA 2XBVA 1NFYA 1QBOA 3A7VA 1IQLA 1VZQH 1NTPA 4JMYA 2HPPH 3SI3H 1LTOA 2H5CA 2OD3B 2BDBA 5JB8S 1LHEH 1S81A 5ETXA 3ZZDA 4DVAU 1ZHPA 4MNWA 3KHVA 2FOCA 5F53A 1X7AC 2V35A 4Y7BA 1HBTH 2ZHFH 1LMWB 2XNDD 4AFZA 1C1VH 2Z6BD 3ZV8A 5EU8A 4INKA 3E1XB 1YP9A 2AERH 4BOHA 2A7JA 1DY8A 1F0RA 1KIGH 2W7UA 1DE7H 5AFZH 2FLRH 1V2ST 1UK4A 4TYDA 3ZVCA 3BF6H 2W3KA 1MD7A 4WWYA 1OP8A 4MPUA 1JBUH 2G4UA 2HGTH 1DUEA 4MNVA 2SNWA 2TGPZ 3UNQA 1O3AA 1YCPK 1LDTT 1GMHG 2BY9X 3OE7D 5DP3A 1P09A 1OWIA 1Z1JA 1QBVH 1MBMA 4Y6DA 4H42U 4D9RA 2Y80A 1CQQA 1GI5A 1SGPE 1WQVH 3SUFA 1HAIH 4CRAA 4LK4A 1Y3UA 3WWFA 3PV4A 3KCGH 1SGFA 1ZGVA 3MOCA 1P05A 3GS9A 5G4BA 1O38A 2CF9H 1YPEH 1MU8B 1O0DH 1CU1A 1K1NA 2A4RA 2ODQA 2ZGBH 4ZUHA 3TNTA 3IWMA 1ANDA 2G8TA 6LPRA 1SHYA 1Y59T 4RKOB 3LGWA 1THPB 1NO9H 2B7DH 4YTAA 6GCHF 2GCTC 4OS2A 4K60A 3V12A 1LHFH 3PLPA 5JB9S 1O5EH 3NXPA 3OX7U 2A45B 2BY7X 1NRRH 2GD4B 2GT8A 2J97A 2IN2A 5EIYA 1ELBA 2NU1E 1DXPA 1GI9B 5FBEA 1J9CH 4OS7A 1MU6B 3SV2H 1NRNH 1PQ7A 3ENSB 3RDZA 2OP9A 1MBQA 5L6NH 5FHTA 2BVRH 3MO9A 4AB9A 4K2YA 1A0JA 1BBRH 3MQKC 1MH0A 1NRSH 5FX6A 1QRWA 1E35B 2EQNA 3E0NB 4HFPB 3LH3A 2BLWA 4FUBA 1Z6EA 1HCGA 3GDUA 1C1QA 1SFQB 3M7UA 1OOKB 3TH2H 2C8WB 1O2YA 2J9NA 3M7QA 1CA8B 2QF5A 4GPGA 3HGNA 2XTTB 2UUJB 2EI7A 4K8BA 4K1TA 4IBLH 2ZCLP 2BY8X 4ZKRU 4UFEH 1E34B 1GG6B 2PKSB 4AGKA 1ZHRA 5A8XA 1FY3A 1ZPCA
chains in the Genus database with same CATH topology
1C1PA 3IG6B 4KTUA 4D7FA 2XC5A 5DG6A 3TLOA 3EA8A 4MQAA 2QGRA 1C4Y2 3BG4C 1A3EH 1G2LA 1EXFA 4XOJA 1GBEA 1V3XA 1C2EA 4XBDA 3OTJE 5DP9A 1EAXA 3RXVA 5EG4A 1IAUA 3MI4A 1EJMA 2FOFA 2ZEBA 1V2OT 2ZU1A 3I78A 4B1TA 2J38A 3V0XA 1C1NA 1V2NT 1SR5C 1GJDB 3TGKE 2FI4E 3RXQA 4DIIH 2ZFPH 3PLBA 2J95A 2ZP0H 4F49A 3LONA 3MO3A 4GAWA 3BTHE 1YGCH 2ZFQH 3GCTF 5TCCA 3ODFA 2HLCA 2F9NA 2FS9A 2ZFSA 3U8TH 2OQUA 4B2BA 4X8UH 1C1TA 1P01A 4I32A 1P9UA 4D9QA 5SGAE 3BEUA 3MU0A 3B9FH 2ILNA 1VITH 1O3KA 5F6MA 1GMHF 1HXFH 4I8JA 3URCA 4ABBA 3O8BA 1PPGE 2FOMB 1ZYOA 2W26A 3UREA 2C3SA 3T29A 1DWBH 1B7XB 3K6YA 1E36B 1NC6A 2GDEH 3HGPA 1XUIA 3DD2H 1RXPA 4ZHMU 2OTVA 4RN6A 1O31A 2DE9A 1HFDA 3QZQA 4A92A 3UPEA 1LPGB 1KXCA 1QY6A 2LNCA 3PMJA 2C93B 1A5HA 3STIA 1EZXC 1YPJH 2JH6D 1BBRK 1Q3XA 4NWLA 1QA7A 3GY3A 1A0LA 4X2XA 1GI8B 3RXCA 1OSSA 4ZROA 3F9HA 1QQUA 1C2IA 2ULLA 1HJAC 3EQ0H 3TK9A 3T28A 3QTVH 1BRAA 1HAVB 1S85A 3S69A 2BLQA 3CS7A 1BIOA 4CREA 1ZOMA 1ELTA 3B8JA 3KL6A 2P8OB 1YPKH 4BTUB 1THSH 2WPJS 5IDKA 3PLKA 2AMDA 2KAIB 5JBAS 1TRNA 1UTQA 5EQRA 2H9EH 1TNKA 4Y10E 1ZSJA 2OC7A 4HGCA 1GVKB 1Z6JH 5F8XA 2BD8A 1V2KT 4CR5A 5ABWA 1YF4A 1L2EA 2ZKSA 1UK3A 4U2WA 3V7TA 1J17T 3ZZ4A 1TNHA 2J94A 2SGAA 1HDTH 4Q7ZA 1EX3A 1SLWB 1ZR0A 1C2DA 2R0KA 1F5KU 1XX9A 5JBCS 4M7GA 2BQWB 3RXEA 1EUFA 2WPKS 7LPRA 2XBWA 9ESTA 3KN2A 3KF2A 1O2RA 2A7HA 4GCHF 4E7NA 1CT2E 2PUXB 3MWIU 5EPYA 3SBKA 3QGNB 3RUOA 2Z94A 1MTSA 3SNDA 1KXFA 3SV8A 1OYQA 1G3CA 1HV7A 1O2NA 2BD5A 1SBWA 1DS2E 4NWKA 3H7TA 4YOGA 4MNXA 1OPHB 4NZQA 4WJG2 3FP7E 1UTJA 1MZDA 5T6FA 5C1UA 3BTWE 1KY9A 1TGBA 5A8YA 2BHGA 3RM0H 1IQHA 1W0YH 1QHRB 5EXNA 1MTNC 2BLVA 1P2NA 4UFFH 1P11E 1BBRE 3UQOA 1RFNA 1AY6H 4WXVA 1FY8E 5GCHF 1ZPZA 2BDGA 1P12E 1GMDG 3A89A 4NGAH 2Z9LA 2AIQA 3RXUA 3VGCB 3LGYA 4LOYH 1EZSC 4K1EA 5C1YA 1ZTLA 8ESTE 3E3TA 2JETB 1OWHA 4INLA 3W95A 4X2YA 1M9UA 1QL8A 4OS6A 1C2HA 1F92A 3OYPA 2ZU2A 2QXIA 1CVWH 1SQAA 3GYLB 2IJOB 3ZZBA 2PGBB 1BTPA 2SNVA 1EAWA 2UUFB 3F9GA 1KXEA 3HK6B 1V6DA 1IQEA 5DPAA 1KXAA 2B5TB 1P10A 1GCTB 1O5DH 4HZHA 1HIAA 1TE0A 2R3UA 3TK6A 2WINI 4A7IB 1GMCG 4ABGA 2ZECA 2ZDKA 1D3TB 1GBBA 2GVFA 5CHAC 1W7GH 2TGTA 3S0NA 1BRUP 2FTLE 1DSTA 3RXOA 1AB9C 3CP7A 2BYAX 1ABIH 3KGPA 1UHBB 4TY6A 1AE8H 1DLEA 5T6DA 4X1NU 3M5MA 4X2WA 1YPGH 1XVOA 3GYMA 1DPOA 1ZRKA 3T2NA 1D3PB 3SV7A 4YZUA 3KQEA 2VWOA 3TJUA 1AZZA 1P03A 2QY0B 1UVOA 1TGCA 3P8GA 3Q76A 1FY5A 1IQNA 1K1OA 4Y0YE 1O3LA 3T26A 2P93A 2BZ6H 5DO4H 4XDEA 4KGAA 4BANB 3D65E 2HNTC 1V2VT 2OXSA 3ELAH 4FUFA 2XBYA 1MTUA 4GHQA 4CHAB 3GY6A 1AN1E 3LC3A 1F2SE 1SGTA 1T8NA 2OC1A 4FXGH 1F0SA 1RD3B 1IQKA 2VIWA 1GJ6A 3GY8A 1QTFA 4FUGA 2HWLB 1PPBH 4ABJA 1O3OA 3MU4A 3UTUH 1QRXA 5C5NA 1AE5A 3GOVB 3F9FA 3SHCH 1G30B 5ESBA 1Z1IA 1AWFH 3GCNA 1HNEE 1GJ9B 3BN9A 2FXRA 2P3FH 1V2UT 3SU5A 5J4QA 1O39A 2ANMH 2M5TA 5K0HA 4ZKNU 1L1GA 1O2TA 2VVVA 2ZA5A 2UWOA 3SGBE 5FPSA 4CBNA 1HAGE 1JXPA 1P3EA 3A8BA 5ESTE 1WTGH 2CMYA 2STAE 3MHWU 1W8BH 4Q7YA 2ZPQA 2CXVA 1TPSA 2FOEA 1WUNH 4NCYA 1UO6A 1HAOH 1EB2A 3P95A 1T8OA 1GJBB 2PFEA 1TPPA 3SQEE 3MU8A 3SW2B 2XW9A 1BHXF 3SORA 3BTQE 4DJZB 1GMDF 3TJVA 3TITA 4JK5A 1UTKA 3TH3H 2RCEA 1G37A 2V0BA 2V3HH 3HKJB 3VB4A 1TYNA 4VGCC 1GGDC 4Z0KA 4BTIB 1A0HB 2WYGA 3LIWA 2FYQA 1EZUC 1ABJH 1HLTH 1YLCA 4AG1A 1S6HA 4DG4A 4OS4A 2BVSH 4IW4E 4BNRA 5FCRA 1HJ8A 1C5PA 1DX5M 2VWMA 2YOLA 4WH8A 3LJJA 2P3TB 3S7KB 3D62A 4DGJA 1HAVA 4NIVA 1GMCF 1BMLA 4KTCA 4GUXA 2FESH 2TBSA 2A2QH 2R3YA 2GCTB 3PM3A 1YPHE 4LZ1H 3A8CA 4KELA 1D6WA 3RXBA 2KAIA 4INHA 3JZ2B 1B5GH 1O2MA 4I7YH 4YLUA 4SGBE 3Q3KA 5HM9A 1GL1A 3E16B 3PB1E 4A1XA 2OQ5A 3A87A 1TBRH 5EXLA 1ZSLA 5HXFA 1AFQC 1DOJA 1S83A 2AGGX 3GCHB 4AZ2B 2ZGXH 1INCA 2P95A 2A4OA 3DFJA 2A5KA 3GCOA 1QQ4A 2LPRA 1UMAH 3WY8A 3GDSA 3HPTB 1JMOH 1K21H 3VPKA 4YT7H 3BV9B 4Q80A 1V2TT 2SGFE 3BIVH 1BRCE 3F1SB 2BDYA 2AGIX 2BX3A 2Z9JA 2BD2A 3SJKA 1J8AA 1W14U 1RIWC 1VR1H 3O8DA 2ZHWH 3VB6A 3MMGA 1V2RT 1FXYA 1K22H 1QJ7B 2W5EA 4ZKOU 3LPRA 3M3VA 1V2JT 5LGOA 4E05H 5EQQA 2VWLA 2Z7FE 2ZIQH 1ZTJA 1SQOA 1GDNA 1VCPA 3BG4B 3UNRA 1CHOF 1MAYA 1QURH 1MAXA 1W0ZU 3GY2A 1BITA 2GT7A 4X1SU 4Y0ZE 4JYVH 1AO5A 1A61H 2FI3E 5BRRE 1GHXH 3ZV9A 1P2KA 4NA9H 3PO1C 4FUDA 1BMNH 1TNIA 1D3DB 3A84A 1P57B 2FPZA 3LGIA 2P94A 1A1RA 3D49H 4WY3A 5A0AE 1ZPBA 1ELVA 4D8NA 2ZDAH 3A86A 2FIRH 1N6YA 2V3OH 1N8OC 3V3MA 3SJOA 3AAVA 1EPTB 1XUHA 3AW0A 3FZZA 2GZ8A 1HJ9A 3S9AA 2FODA 3SJ8A 5E0GA 3U8RH 3VXEH 1GHAG 4ABDA 3PTNA 2ZDMA 4UFDH 1S5SA 3PTBA 5FCKA 4BAHB 5F03A 5EW2H 1TBZH 5DP4A 3HKIB 3UWIA 2WPMS 1GBDA 1ZTKA 4NIXA 1GDUA 4ASHA 2QXHA 1GJ5H 4OGXA 1MKXH 5HM2A 4BXSA 2ZDLA 1GI6A 1D9IA 3MU1A 4MDSA 1TGSZ 1ANEA 3BTFE 1BTYA 4I8GA 3RMLH 1BMAA 4ESTE 1WCZA 2HOBA 2FEQH 1ZMJA 3PROA 4WMFA 2OC8A 1DLKB 2BD4A 2P16A 1IQMA 1G2MA 1OX1A 1VCQA 4JZIA 4MPVA 4IGDA 2Y7ZA 3UNSA 3SOSA 1IQGA 1C1MA 1L4ZA 1HJAB 3A7TA 3EA9A 1E0FD 2BLOA 1SPJA 1TB6H 3NCLA 2PWXA 3LKWA 2FOGA 1ZHMA 1C5TA 3PMHB 1W2KH 1J16A 1GCDA 3QN7A 4X6PA 2HVXA 2BB4A 1ZMNA 3LH1A 2Z9GA 1O2JA 4ZXYH 2GKVE 4FUCA 1JWTA 1SMFE 1IHTH 2JH0D 1P2IA 2OINA 3ZVBA 1MZAA 1AUTC 1DT2A 2C8YB 4ABEA 1TNGA 2ZHDA 4X0WU 5A2MH 7KMEH 2Y5HA 3MO6A 1GHBG 1BB0B 1YM0A 1QFKH 2BDCA 2C8XB 2BD9A 2JKHA 1C5SA 2G5VA 2BTCE 1SFIA 3RXSA 1QL7A 3CS0A 1QJ6B 3FFGA 4KTSA 4WXIA 1EP5A 2ZGHA 2QF3A 1HPGA 1QBNA 1QNJA 1V2LT 3FVFB 5A0CA 3S9BA 1GJAB 3L6PA 5IYTA 2BVXH 4GVUA 1AQ7A 2R0LA 5B6OA 3QZRA 3ZZCA 1IQJA 1K1LA 3B23B 1SGFG 1EZQA 3M5LA 1GI3A 2ZTZA 4ZMAH 3RU4E 1JOUB 3BTDE 3SU3A 1ZRBA 2IPHA 4RSPA 8KME2 2CHAC 4AFQA 1CA0C 1BTXA 4B76A 3RM2H 2ZZUH 4DT7B 3I29A 1P3CA 2CN0H 4FUIA 1FDPA 1RGQA 2F9PA 5FX5A 1FV9A 4CRBA 2K1QA 2TIOA 1PQ8A 1SHHB 2ZTXA 1FJSA 1DUAA 6ESTA 1LQEA 1SLUB 1WV7H 5AF9H 1NY22 1O2PA 1BRBE 1Y3WA 2ZO3H 3S7HB 4Y8YA 1BUIA 5DKMA 4MPXA 1GBLA 1MKXK 1O3FA 3RXHA 3A85A 1AIXH 7GCHG 3F9EA 1ELAA 4NA7A 1PYTC 4O9VA 1FAKH 3MNBA 1SGRE 3U9AH 2VGCB 2F9VA 1ELFA 4OS5A 1TIOA 2NWNA 1DFPA 4RKJB 3U8OH 1UVUH 3O8CA 4TY7A 2FX4A 2XYAA 1TALA 2HNTF 2FDAA 4WH6A 4ZAEA 1QL9A 1W11U 1D3QB 1O3DA 5FPYA 5EGMA 3QLPH 1V2PT 1AUJA 1MCTA 4K1SA 1ANBA 1ELCA 4O03A 4Y79A 1FY1A 4GLYA 4AG2A 1LVBA 2QN5T 3KQDA 3QDZB 1XUFA 3EYDA 2H9HA 1YCPM 1CE5A 1G3BA 1OS8A 2ZFTA 1J14A 3EGKH 2VIPA 1AB9B 4JZDH 5E0HA 1W7XH 1P2JA 3FZDA 1W13U 4O97A 2OBOA 1OP2A 5E0JA 5E8EH 1GDQA 2PTCE 4OGYA 1SC8U 1OP0A 1C5OH 3NZIA 5I46H 2UWLA 1NFWA 3NUMA 1TONA 2BZAA 2HPQH 1HRTH 3GY5A 4NA8A 2Q6DA 5E2OA 1Z8RA 4ZHAA 2OUAA 1KLJH 1WQSA 1GG6C 2PKSC 3U1JB 8GCHG 3LC5A 5C2ZA 1BDAA 4KP0A 5C67A 4U01A 3T25A 3RXFA 2THFB 1OWEA 3BG8A 1FPCH 3A88A 4Y71A 1PQAA 1WYKA 3IITA 4AORA 1XKBC 1GBMA 2QA9E 2ZPRA 2BY5X 1GBIA 1KXDA 1GI0A 1BMMH 1TBQH 1LVYA 1OYTH 3UWJH 1O32A 2AS9A 1EB1H 3UR9A 2EI6A 3BEIB 3A7XA 4X6OA 1UTOA 1O2IA 4NFFA 5JBTA 1C1RA 2GTBA 1G36A 4XSKU 1MMJN 1XXDA 2EEKA 1BTUA 3UQVA 1RTLA 3E91A 1SSXA 1C5QA 2VH6A 1YYY1 3RU4D 3RMMH 1A4WH 2ZGCA 2A0QB 2W3IA 1YBWA 3RLYH 1XUGA 1F0UA 1EPTA 1PPEE 2AH4X 2BXUH 4AFSA 1TRYA 1AD8H 1K1JA 5GPIB 1KTTB 2ZWLH 3MH5A 3A7WA 1O2UA 1C2MA 1CGJE 1TNJA 5FAHA 1C5YB 2G5NA 4X8TH 1LVMA 1C4V2 3A81A 4AX9H 1GHVH 3NK8A 2ZG0H 1P9SA 1FMGA 4B75A 1A46H 2VIVA 2GDDA 3U98H 3ATLA 2ALPA 1TFXA 5A0BA 2ANYA 1IQFA 3VEQB 1LHDH 1U6QA 1NU9A 2AGEX 1NFUA 1CBWB 1Y3XA 1C5UA 2XRCA 2F83A 2O8LA 3K9XB 3MNSA 1Y5UT 2XXLA 1C2LA 1G3DA 1FAXA 4TPIZ 1SGNE 1C5NH 1GGDB 4VGCB 4BAKB 3TK5A 1UVTH 2Y7XA 3GY4A 4X6NA 2GCHG 4WF8A 4JZEH 1GBTA 2BOHB 4H6TA 1MTWA 1VGCC 3MNCA 5GJ4B 3ZVFA 5JDUB 1A7SA 2FX6A 2FP7B 3SQHE 1GHYH 2WV5A 3QWCH 1O3PB 2RG3A 1AHTH 4H4FA 4THNH 2H9TH 1GVZA 1H9IE 1O3BA 2WUBA 2BD7A 2AFQB 3LDXH 2VIOA 3DA9B 2AIPA 1P8VC 2WUCA 3A7YA 3W94A 3ZZAA 4CR9A 3P6ZB 3ZVEA 5GIBA 2ZNKH 3ZVAA 3E8LA 1Z8IB 4U30A 1MQ5A 4HTCH 1UTMA 2F91A 1AFQB 4ABFA 1W3CA 1FIWA 2J2UA 3LGTA 1LVOA 1XUKA 1RJXB 1S82A 3QX5H 2W7SA 1O5BB 3BTEE 5F8ZA 4X8VH 1O3EA 1NESE 4UFGH 4K5ZA 3RXAA 1O2KA 3TH4H 3SI4H 1K2I1 2VJ1A 2SGQE 8GCHF 1Y8TA 4YOJA 3M3SA 1O2HA 4UE7H 3S9CA 4X1RU 2BDAA 2B0FA 1FN6A 1RIWB 2ANWA 1JIMA 1SI5H 1JRSA 1OXGA 1DY9A 1S84A 1PPZA 1IQIA 3KQBA 2PKAB 1LQDB 2GMTC 2ODYB 5L30H 2ZHQH 4Q7XA 4Y76A 5A