2QN5T

Crystal structure and functional study of the bowman-birk inhibitor from rice bran in complex with bovine trypsin
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and Functional Study of the Bowman-Birk Inhibitor from Rice Bran in Complex with Bovine Trypsin
rcsb
molecule tags Hydrolase inhibitor/hydrolase
molecule keywords Bowman-Birk type bran trypsin inhibitor
total genus 46
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2007-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qn5T01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qn5T02
2KAIA 1TGBA 4NWLA 3MH6A 1HYLA 3K2UA 4DY7B 1O3KA 4Q2KA 1O2JA 2A4RA 4AYYB 8ESTE 1ESTA 1DX5M 2EI6A 1C2LA 5EOKA 1JXPA 1CA0B 2AGEX 1NFYA 1VR1H 1PFXC 1UMAH 1WBGB 3I77A 2BD7A 4JZ1A 4A7IB 1O3EA 4X2XA 3RXTA 3KN2A 4FUBA 5F6MA 4K2YA 2W7UA 4O3UA 1GHXH 2ZTYA 1AKSB 2Y5FA 3ZZAA 1O33A 4THNH 1P05A 2BDGA 3KQCA 4MNWA 1GJDB 5E2OA 6GCHF 1EB1H 1FN8A 1BJVA 4CRCA 1GVZA 4Y71A 1TBZH 5GCHF 3UOPA 2JKHA 5FCRA 2XBXA 2IPHA 1ZYOA 1C4V2 1UTOA 1YM0A 2D2DA 3OX7U 1VCWA 1O3FA 1YPMH 3B23B 4CH2B 1AVXA 1S81A 1C5PA 4CREA 4X2YA 2STBE 1O3PB 2UUFB 4BNRA 3ZVFA 4ZMAH 4E06H 2J4IA 2W3IA 2IN2A 1NN6A 3AVZA 3EQ0H 1NM6A 3RM2H 3RXQA 2GVFA 3F9EA 1RS0A 1C1RA 2PKAB 2F9NA 1EJMA 1VJ9U 4IMQA 5EU8A 3RXFA 1TGSZ 1GDUA 2BLQA 1P04A 1FLEE 1WYKA 7LPRA 4CBNA 3T25A 2VVUA 3QGJA 3A81A 2ILNA 4NFEA 3RXGA 1M9UA 1YP9A 4FUGA 2JETC 5DP6A 1ZRBA 3RXRA 1T8LA 3P6ZB 1NRNH 4NA8A 1MKXK 1AWHB 1NESE 3SV8A 1YPJH 2G5VA 3OYPA 4YTAA 2AGIX 2Q6FA 4LZ1H 3RLYH 2AMPA 3BTWE 1F2SE 3NWUA 1LVMA 5T6FA 1GMHF 1LTOA 1BTHH 5EQRA 5EW1H 2Y6TA 1OP2A 2PKAA 2QF0A 3CS7A 1NFXA 3RXDA 4HGCA 3SBKA 1C2KA 4JK5A 4WH6A 1C1PA 3ZYEA 4ZHLU 4FUFA 1TNIA 1HIAB 2BDCA 2ZFFH 3FAOA 1XUJA 3BN9A 1LHGH 3HKIB 3K9XB 2VIPA 1WOFA 2VWLA 3E90B 3LGIA 1CT4E 2A2XH 1MZAA 2F9VA 4Y8ZA 1AUTC 1D9IA 3DUXH 5FXLA 3EYDA 5DGJA 1GG6B 1EJAA 3RXAA 1P2MA 1GI6A 2QIQA 1S5SA 3U98H 5FCKA 2ESTE 1O2WA 1UVPA 1E34B 2Z9JA 4E7RG 1VCQA 3Q00A 4R0IA 1PPBH 2WPHS 2Y5GA 3RP2A 5SGAE 3A80A 1NFWA 3P17H 1DLKB 1DT2A 1SGIB 1QHRB 1BTXA 4OS7A 3A85A 1OPHB 1SLWB 1S83A 1J9CH 2Z9LA 3LH3A 1RGQA 3QO6A 3PMBB 1MMJN 1SGYE 1BHXF 1A0JA 1E36B 3LGUA 1C5LH 2BVXH 3PMAB 1CT2E 2TGAA 3A82A 5T6DA 2J34A 3DFJA 1V6DA 4MNXA 1HUTH 1IQGA 2CV3A 1GJ7B 1G3CA 1ZMNA 2ZTXA 4O9VA 3GCTG 4K8BA 4BANB 2ZZUH 5H4IB 4OGYA 1RTLA 1DPOA 2YOLA 2WYGA 4JYUH 1Y3WA 4NWKA 3TJOA 3BIUH 3SV7A 3O8BA 5EG4A 3T2NA 4SGAE 1K1JA 4JYVH 1H9LB 1O32A 2BX3A 2NU1E 4JK6A 3Q3YA 1YLDA 1MAXA 2P94A 4KKDA 1WCZA 1K28D 2BY6X 1MKXH 3GY6A 1G3BA 3V0XA 1ZGVA 1E0FD 2BHGA 1DWBH 4LXBH 3QTOH 3VB4A 5CHAB 3BTME 1ZRKA 1C1SA 3BEIB 3SN8A 4WXVA 5HM2A 4JZFH 2VIVA 3ZZ6A 1Q3XA 2GCHF 1OWDA 2YNBA 3V7TA 4DIHH 1JIRA 2ZIQH 6CHAC 1MAYA 1DDJA 2DE8A 1CBWB 4DIIH 1Y3YA 1THRH 3HPTB 2B0FA 3GY8A 1F0SA 2PSYA 2WYJA 1F7ZA 1B0EA 3HKJB 1P2KA 3P8OA 4BXWA 3QDZB 3E1XB 1TWXB 2ZDVH 2BQ6B 2EI7A 5PTPA 2AS9A 4A1TA 1FQ3A 4MLFB 4NG9H 4UFDH 2OBOA 1GBKA 3SU5A 2IJOB 1N8OB 7ESTE 3LGWA 4I8KA 4FUDA 1TQ0B 1HIAA 1HJ8A 1NROH 1RIWC 2ZU1A 3EA7A 1O5DH 3UUZA 1Z8RA 3IWMA 1PPFE 3VB7A 2BY9X 2PKSC 4YLQH 3S0NA 4O97A 2W7SA 1UVTH 1QURH 2H9EH 1EPTA 3SUFA 1FAXA 1O2KA 5DP3A 1TPOA 3SORA 7GCHG 1MBMA 3BG8A 1FY5A 3PV4A 1KDQA 4CHAB 1ANCA 4UE7H 2SGFE 2AYWA 1UJ1A 3BEFB 2ZU5A 2C8XB 1HAXB 1GI0A 2WUBA 2ZCKP 2AH4X 1CGHA 3SQHE 3PLBA 3FP6E 1C1OA 4MVNA 1V2JT 4A92A 3GDUA 3M7QA 1THPB 1LO6A 1O2OA 2BX4A 4Q80A 3SW2B 3U69H 6GCHG 2QXJA 3F9HA 5J4SA 1WTGH 2WPIS 2C4FH 4NIXA 3SU0A 1EXFA 1FZZA 1ANBA 1HJAB 2AMQA 2BDAA 2PTNA 2OD3B 1UTMA 4AZ2B 3MU1A 2PW8H 2FOBA 1F5KU 1KXAA 2BOKA 2GT8A 3GCHC 2V3OH 4B2BA 3A84A 3ESTA 1K1PA 3F9GA 1X7AC 1ZR0A 1HGTH 2Z9IA 2VH0A 4LZ4B 2PUQH 3KQEA 1GJ4H 1NT1A 4Z0KA 1INCA 3IITA 4NIVA 3TVJB 3M35A 5TCCA 3SU4A 1NY22 2G5NA 2G4UA 1QTFA 3Q76A 5A8YA 2HALA 5ESTE 1QA0A 1TOCB 3CENA 3TH2H 1V2RT 2FS9A 2NU0E 1S6HA 2R3YA 1MTUA 3SGQE 2FI5E 2F3CE 3M5MA 2QC2A 3EGKH 1XUGA 4X1RU 3TH3H 8KME2 1EATA 1KIGH 1T8MA 5HMAA 1OKXA 1KY9A 4WY3A 1C9PA 1O2TA 1S0QA 1DVAH 2XBYA 1JMOH 1QL9A 5DP8A 2HPPH 2JETB 4X1QU 3V12A 3FANA 4O03A 1ZGIA 4E7NA 1O3NA 1A2CH 3CP7A 2AIQA 2EC9H 1SB1H 4ABHA 4KELA 1XX9A 5F03A 3RU4T 2SGAA 1SR5C 1FI8A 1AUJA 1GI9B 1DLEA 1P09A 1SMFE 2FODA 2XW9A 2B8OH 3ZZCA 6ESTA 1O2QA 3SJ8A 3B9FH 3ZVGA 1VGCB 2G8TA 2CF9H 4ZXYH 2EEKA 4BTIB 2ALPA 2HPQH 1V2QT 3A7XA 1GMDF 2H5DA 3TGKE 3UQVA 1GJBB 3KHVA 1TX6A 2VB0A 3EA9A 1EKBB 3MNCA 4ZXXH 1D3QB 4AB8A 3QUMP 1O5CB 1IHTH 1JIMA 4MDSA 4AGKA 1J8AA 4INLA 2C8ZB 1DANH 1P9SA 3FP8E 3PLKA 1PPGE 3GY7A 1BZXE 2F9OA 3H7TA 2B5TB 1AE5A 1O37A 1SGRE 1TFXA 5DP5A 1C5XB 5G4BA 3I78A 2H5CA 3CS0A 2V0BA 5DK1A 1O34A 1O2HA 1ZMLA 3E91A 5EPNA 3SQEE 1TABE 4F4OC 1GJ6A 1TAWA 3T26A 2ZDKA 1TX8A 4GHTA 4WMFA 5LPEA 1DICA 2XCNA 4GUXA 3VB3A 1C4Y2 2VVVA 1K1OA 1SFIA 2FYQA 2ZGJA 1PPZA 1D4PB 5AF9H 1V2TT 4JZDH 2ODYB 1L4ZA 1YKTA 4DT7B 2PTCE 1O2LA 1YLCA 2M5TA 1AWFH 5GWZA 1EAUA 1YC0A 4OS4A 2ZC9H 3M3SA 1ELBA 1QRWA 1GJ8B 3A7ZA 1FMGA 4VGCB 1A4WH 1MD7A 1GDNA 2D1JA 2VIWA 3S9AA 3U8RH 1YGCH 3NK8A 3RLWH 1PPCE 5A0AE 4WWYA 1W7GH 2VIQA 1LVBA 3D23A 3ZV9A 5CMXH 5L2YH 1ELCA 5E0HA 2FESH 2VNTA 3LKWA 4H4FA 3AW1A 4X6OA 2FOCA 1SGEE 4K1TA 3STJA 1HBTH 1FY1A 3A7WA 4Q7YA 2OTVA 2ZFTA 2PV9B 1AVWA 4YM9A 5GIBA 4ZUHA 1J16A 1OSSA 3QX5H 3VB5A 1NTPA 3RUOA 5EW2H 1A0LA 2CF8H 4GCHG 4MQAA 1C2DA 2ZTZA 2BVRH 3UFAA 2ANMH 4HZHA 5F8XA 2F9PA 1RIWB 1TNKA 2JH5D 1KXCA 3ODFA 1C2MA 4D7FA 3SV6A 2SGDE 1O2ZA 5C5OA 2QCYA 1EPTB 1P8VC 4MPWA 1QNJA 1TQ7B 3O8RA 1P3EA 2BZ6H 3GISB 2FM2A 1SGCA 3KNXA 1IHSH 2OQUA 1EZXC 1OWIA 1OYTH 1MQ6A 1DOJA 1O3AA 2G51A 5LH8A 2FWWA 4CRGA 1CA0C 1C5SA 3PO1B 2BMGB 2GDEH 3LGVA 1BJUA 2P3UB 3KEEA 3UWJH 1T8NA 3P8FA 3P8GA 2A4OA 3RU4D 1GBTA 1ELFA 1GCTC 1CT0E 1AE8H 4J2YB 4AOQA 2Q1JA 1ZTLA 4ASHA 9ESTA 1EJNA 1O5AB 1GHBG 3TH4H 2VGCC 5FBIA 4Z6AH 1FUJA 1LQEA 4TWWA 1D3TB 1VITF 1AFQC 1KLTA 2HWLB 1GL0E 3MO9A 1EUFA 1C9TA 1SHHB 1LCYA 2FOEA 4D8NA 2J38A 3OU0A 4ZKNU 4WJG2 3RMMH 2H9TH 1EAXA 3MFJA 2P8OC 1TPSA 2ZDNA 2FEQH 2O8MA 1L1JA 1S6FA 2Z7FE 3JZ1B 1UHBB 2FI3E 3BTHE 1KXFA 4DG4A 3SJIA 2Z6BD 3GY4A 3TLOA 1MKWK 4WMEA 2O8UA 1LMWB 1IQJA 5C1XA 1OYQA 3GY2A 4XFQA 2ZGBH 2GP9B 1O3IA 1ZPZA 2FOFA 1GL1A 2AMDA 3GDVA 1NFUA 4AFQA 1J14A 1V2KT 2ULLA 2P59A 1T8OA 4NGAH 2BD8A 4OS6A 1YCPM 1MTNC 1QY6A 1A3BH 2GX4A 3OTJE 1D6RA 1QA7A 1A5HA 1O3DA 2ZHEH 2IOTA 3MOCA 4FVBA 3SO3A 1L4DA 1O38A 1IQNA 3PWBA 4IC6A 1TA2A 1GBEA 1AFQB 3RXHA 3MI4A 2BLWA 2TPIZ 1P57B 1QQUA 3HK6B 1SSXA 2GCTB 1UVUH 1DXPA 4BAQB 1OS8A 4Y79A 2QGRA 3TJUA 5C20A 1WV7H 1YPKH 3SU2A 1O35A 4UD9H 3ZZDA 1SVPA 1HXEH 3FZDA 1XUKA 2OQ5A 3MH7A 3VXFH 1C5OH 1P01A 1BCUH 1RXPA 3SOSA 3RXLA 2UWLA 2GV6A 2RA0A 2WPKS 4Y7AA 4CR9A 1HV7A 4FU9A 1HAHH 3SNDA 2XXLA 2A7HA 2BQ7B 2OLGA 4FVDA 1AIXH 3ZVDA 2C8YB 4B74A 1FAKH 1JBUH 2PWXA 1GPZA 2VGCB 1AGJA 1QBOA 2FXRA 2ZA5A 1SGFG 1GCTB 3RC6A 1ARCA 2NU2E 4U01A 2V3HH 1HAGE 1OP8A 3FFGA 5DO4H 1F0RA 1SGDE 8GCHG 3A8DA 1XMNB 1C5UA 3ZYDA 1Z1JA 2A7CA 4CRDA 1V2UT 3QN7A 3LC3A 1W8BH 6LPRA 1AVGH 3GY3A 2O8LA 4K60A 4ESTE 2BYAX 1N6YA 1EOLA 3UNRA 2CJIA 3PROA 5EQQA 1BTUA 1C5ZB 1LKAA 1Z71A 1MBQA 2ZGHA 3MTYA 4X1PU 3E0PB 1KSNA 1FV9A 1LPKB 2R0KA 4DVAU 5FAHA 1PYTC 1GI2A 4A5TS 1S85A 1BT7A 4AB9A 1HDTH 4X6MA 1LPGB 3E0NB 5TJXA 3ZZ8A 2QV1A 3LGYA 1G37A 4ZHAA 1D6WA 1Z7KA 3PO1C 1A3EH 1RRKA 1A0HB 4XSKU 4SGBE 1O3LA 1TOMH 1Y59T 4I8JA 2PGBB 1GMHG 2Z9KA 1S0RA 2RCEA 1W3CA 3L33A 4DJZB 1ORFA 1XVOA 2AFQB 3QGNB 4HTCH 4GPGA 2KAIB 4XOJA 3BG4C 1HAOH 4IN2A 3NXPA 1BOQA 5LGOA 1HAVA 2PHBA 2XBWA 3MU4A 2ZWLH 1XKAC 2Z3DA 1BB0B 4WVPE 1O36A 1HB0B 1H1BA 3U1JB 1ETRH 4CBOA 4RKOB 4K69A 3UIRA 3D65E 2XCFA 3LJJA 2XNIA 4KP0A 2FZZA 3DHKH 1LHEH 2GT7A 3AW0A 3A7TA 4ABEA 3VGCC 1NS3A 4UFEH 1DXWA 4NSVA 1LDTT 1OWEA 1SGTA 4INKA 1UTPA 3UWIA 3R0FA 1N1LA 4H6SB 3TK6A 1D3PB 4JZEH 1E37B 4MNVA 1O5BB 1DFPA 1L1NA 3TK9A 1O2UA 2ZDAH 3I29A 3SV9A 3MU5A 3ELAH 4UFGH 4X2VA 1O2NA 2J2UA 1O2VA 2OINA 3DT0H 5ETXA 1GHVH 5EXMA 5FHTA 1FN6A 2A4GA 1YPGH 2ZI2H 1EASA 1G2MA 5JPMH 3DFLA 1Y3XA 1OWJA 2FTLE 5JYIA 5A8ZA 3GYMA 2BQWB 1U6QA 4TY7A 5I25A 3ATLA 1ABJH 2A31A 1VZQH 3MYWA 2VWOA 2NU4E 1C2GA 1QJ1B 2FOHA 2XTTB 3UOUA 4D9QA 3RC5A 2XYAA 1FY4A 5JBAS 3BTEE 4D9RA 4K3JA 3GICB 2Y5HA 3V13A 1NRRH 3M5NA 3MMGA 3RXJA 4AFZA 3SNCA 3RXUA 3S9CA 4D7GA 1P2NA 1Y8TA 3NKKA 1O3MA 1IAUA 1GI7B 3RXBA 3M37A 1WAYB 3W95A 2BY5X 5E0GA 2ALVA 2GZ8A 3A7YA 4MPUA 1UCYH 2SGEE 5HXFA 1P10A 4UFFH 1GJ5H 3GYLB 1BBRK 2J9NA 3P70B 3LJOA 5A2MH 4OS1A 5F8TA 2OUAA 3SNEA 2OBQA 2ZEBA 4F49A 1PPHE 3IG6B 3OY6U 1FPHH 2EI8A 2OC0A 2BLVA 1ABIH 4GAWA 3LH1A 2Z9GA 4X8UH 5C3NA 4B75A 4BAKB 2A32A 1P06A 3C1KA 3TJNA 5IYTA 3SJKA 3URDA 3RXOA 1HJAC 1C2FA 4D76A 3U9AH 2WV4A 4ZHMU 1GBIA 1FJSA 4A6LA 1GI3A 1UK3A 1V2LT 2D26C 1TA6A 3TITA 3A8CA 4TPIZ 4XBCA 1KDQB 1GHBF 5BPEA 2FI4E 1BTPA 4YZUA 1O3OA 5JBBS 2DE9A 4Y7BA 3SHCH 4LK4A 1XUFA 4K5ZA 1ZPCA 2ZP0H 1SQAA 2P8OB 1HXFH 1SBWA 3RXIA 3URCA 3A83A 4ABBA 2Q6DA 1MCVA 2PKSB 1PQ8A 4AGJA 3NPSA 1O5GH 1AMHA 1TGTA 3BTGE 1OXGA 4BXSA 4TWYA 1C1MA 4DOQA 3L3TA 2ZO3H 1C1VH 6CHAB 2GD4B 3NUMA 3TJVA 3VB6A 4AFSA 5C67A 1P11E 1MTWA 1BTZA 2K1QA 1AQ7A 3SUEA 3QZRA 1GBJA 4TPYA 3EA8A 1O5FH 3VFEA 3SZNA 1GI1A 5C5NA 1C1UH 1EP5A 3MWIU 4X1SU 3OSYA 3PYHA 3MU0A 3UQOA 2BY8X 2SGQE 3VEQB 2A4QA 2ZPQA 3HK3B 2RG3A 1BQYA 1NO9H 2ZNKH 3S7HB 1PQ7A 3AASA 3QWCH 2QY0B 1AY6H 1FIWA 4ABAA 3DD2H 1IOEA 9LPRA 1KLJH 3LC5A 5L2ZH 3U8TH 1KLIH 4ZH8A 1BHXB 2ZPSA 2ANYA 5JBCS 4KTSA 4Y76A 2ZPRA 1TBRH 1O0DH 1C1NA 3MHWU 4NZQA 3SJ9A 1SLUB 4I33A 2UUYA 3T62A 1O3JA 1O2RA 2Y80A 1VGCC 3BIVH 4ISNA 3SNAA 1Z6JH 2Z94A 2GMTB 1W11U 5LPFA 1P3CA 2TGTA 4Q7ZA 1FONA 1HCGA 4JYTA 1V2NT 4UEHH 1C1WH 4K8YA 5J4QA 1SOTA 3GOVB 2A5KA 3G01A 1SOZA 3RXVA 2GV7A 1KTSB 1NC6A 1OWHA 2D8WA 4ZKSU 4YOJA 2BVSH 1AO5A 3B8JA 4DCDA 4NIYA 4IMZA 1TPPA 3LIWA 4NA9H 3P92A 3P95A 2VVCA 2CGAA 1GHYH 1TGCA 4Y6DA 2FDAA 1O2SA 1LPZB 8GCHF 1SI5H 2O8TA 4WMDA 3M3VA 1P2QA 1OWKA 3ZVBA 5JB9S 1P12E 3MNBA 1K21H 3U8OH 4DURA 4AG1A 3F9FA 1PPEE 1G3EA 2BXTH 2C90B 1O3BA 2ZFQH 2OCVB 2A1DB 2NU3E 4ABIA 4IGDA 1CVWH 1TALA 4H6TA 3ATKA 4IBLH 1AI8H 1JOUB 4B2CA 1GJAB 1LQDB 1ZPBA 1O3CA 4XDEA 5EXNA 3FZZA 1UTQA 2UWOA 1SQTA 1O2PA 1NPMA 5ESBA 1JWTA 1Z8GA 1GGDC 4KTUA 1A5IA 2FS8A 1ZSJA 2C8WB 2FX4A 1RD3B 2G55A 4YO9A 2BD9A 1TRMA 3F6UH 5AVDA 1PJPA 2W5EA 1AU8A 1A1RA 3RC4A 1WQVH 5FPYA 1O2XA 5L6NH 4HFPB 2BDYA 1MQ5A 1TIOA 2XBVA 1C2IA 1W0ZU 2ZG0H 1ZLRA 2XC0A 2A7JA 3KCGH 5EODA 1MU6B 2QA9E 4B73A 1TNHA 2WPJS 3E8LA 5T6GA 1CHOG 4INHA 1LVOA 1TYNA 2CN0H 3W94A 1AB9B 5HGGA 2ZCHP 1QB6A 1CSOE 1H4WA 5GCHG 2VIOA 2SGPE 1DSUA 3PB1E 3ZZ3A 1BUIA 4HI3A 4A1XA 1UHBA 2BD4A 1YBWA 3GCOA 1WUNH 5TCAA 3RXCA 1UTKA 2AIPA 3MU8A 4AYVB 4CRBA 3MO6A 4A1VA 2V35A 5AFZH 3VXEH 1QJ6B 2O9QA 1ID5H 1P02A 1G32B 3QLPH 2ODQA 1C5YB 1GG6C 1YPLH 5L30H 4Y10E 1AB9C 3ZZ7A 2WUCA 1EX3A 3Q77A 1SFQB 2R0LA 1JRSA 1QB9A 4FUHA 2YNAA 2WPLS 4QT8C 1OOKB 1ZJKA 1C5NH 1N6XA 1GBCA 2G00A 2VH6A 2ZFSA 1FIZA 1BRAA 2BM2A 3TGIE 2LPRA 1P2OA 4MG3A 3SI3H 1TBQH 2ZDLA 2A2QH 1AN1E 2CHAB 2O8WA 3GCHB 4CRAA 3M5OA 1O39A 2ZQ2A 7GCHF 1ARBA 4LOYH 1XUHA 3QK1A 5DP7A 3N7OA 4RKJB 2AEIH 1C5MD 1DITH 1DY8A 5DJ7A 1GHWH 1F0UA 3ATMA 2W3KA 1C2JA 1WU1A 3TNTA 5E8EH 1HJ9A 4B1TA 1P2IA 1SQOA 1FNIA 3ATWA 3MH5A 4B76A 4X1NU 4BAMB 4NFFA 1N8OC 2QF3A 1T31A 3V3MA 1UK4A 2PSXA 1YCPK 4FU7A 1K1IA 2XC4A 1H9HE 1ANDA 2PR3A 1CHGA 2PUXB 2R2MB 3M36A 2FYRA 1OX1A 3HATH 2P3TB 1GJCB 4OGXA 1AZ8A 2BZAA 2JH0D 1GGDB 1D3DB 3UY9A 2A45B 5EQSA 3RXSA 4GCHF 2ZKSA 3LPRA 3TNSA 1C4U2 1ESAA 1T4VH 1EQ9A 1QL7A 2FLRH 2ZECA 2CXVA 1Y5UT 2BDBA 1RTKA 1T4UH 1BBRE 1SGPE 3ZZ5A 5HYOA 1QBVH 1DY9A 3ENSB 1Y3UA 3BV9B 4CRFA 4OS2A 4I31A 2PFEA 2BD5A 3O8CA 2VJ1A 3BSQA 3RMOH 1SPJA 1IQFA 3UNQA 2QN5T 1GMCG 1VCPA 3KF2A 3ITIA 1CA8B 2BD3A 3A7VA 3RMLH 1KTTB 1AFEH 1DUEA 1QR3E 1V2WT 2GGVB 1FXYA 1HPGA 2HNTF 4RSPA 4KTCA 2FOAA 4ABDA 1EZUC 1LKBA 1OP0A 1C5QA 4KGAA 3E16B 5A0BA 3MNXA 3S7KB 1YPHE 4GVUA 2HNTE 4XBBA 2BB4A 3LONA 3E6PH 1QFKH 1IQEA 3ZVEA 3UR9A 4J1YA 3SGBE 1W10U 1CO7E 1PQAA 1TMBH 5DKMA 2FPZA 1SGNE 2H2ZA 4Q7XA 1W13U 3BF6H 2NWNA 4YESB 1LVYA 1YPHC 4Y0YE 5GDSH 3O8DA 2F9UA 3F68H 3SNBA 3LDXH 3OY5U 2G81E 3RXKA 3SU6A 5K0HA 2HLCA 3M7TA 1NZQH 2ZU3A 1GMCF 1O3HA 1YCPH 1RTFB 2OC7A 3T29A 1MUEB 4CH8B 2C93B 3UREA 2ASUB 5DP9A 3RXPA 3SUGA 5A8XA 4U32A 1ELEE 3UPEA 4IS5A 2ZQ1A 1TRYA 1ZTKA 2DUCA 1RFNA 1DS2E 1DWCH 3Q3XA 2CHAC 1SLXB 2TBSA 5C1YA 4ISIH 3SV2H 2QXGA 4XE4A 4TY6A 1O2MA 1L1GA 1IQIA 1C5TA 1K1MA 3MH4A 3PMJA 3RU4E 2BY7X 1V2VT 4X0WU 1ANEA 1K1NA 2PGQB 1HAVB 4ISLA 2FIRH 3EE0B 1K1LA 4ZKOU 5ABWA 1SGFA 1W12U 4BOHA 4DGJA 2FO9A 1AKSA 2UUKB 2C3SA 1J15A 1GHAF 1XXDA 2UWPA 4R8TB 4I8GA 1NRSH 4NA7A 2A5IA 1FPCH 3RXMA 2ZU4A 1QRXA 2ZHQH 3GCTF 1ZHPA 3K65B 1ELVA 2XRCA 1ZHRA 4IN1A 4Y8YA 2RA3A 1TNJA 3ZVAA 4YOIA 1GHZA 2SNWA 2G4TA 2GKVE 1EZQA 1WSSH 3VPKA 2GZ9A 1ZSLA 4PROA 1GBMA 2Y82A 2TRMA 4NZLA 4I8HA 3UNSA 4YT7H 3AAVA 4YOGA 1ELTA 2F91A 3KGPA 3QZQA 2P3FH 3KIDU 2LNCA 4RN6A 5K7RA 5FPTA 5GPIB 3SI4H 5DPAA 1EOJA 4AN7A 2AERH 1BIOA 1QJ7B 2Q6GA 5I46H 1SC8U 3RMNH 1GI5A 2F83A 1J17T 2R9PA 3R3GB 3RDZA 1BTYA 1S82A 2J94A 2A0QB 1QL8A 1DM4B 5GJ4B 1GVLA 4M7GA 4H42U 3BTKE 3HGPA 1CU1A 1V2OT 1B0FA 1THSH 1EAWA 1HRTH 3PLPA 2CMYA 3TK5A 4X6NA 2J95A 1QBNA 2ODPA 5FPSA 4IC5A 4ABJA 4Y8XA 2WPMS 4WXIA 1VITG 3T27A 1HAYB 2RDLA 4WH8A 1Q2WA 1MKWH 3S9BA 3ZZ4A 3BTFE 3TGJE 2G52A 1TMTH 2HNTC 3PWCA 1BA8B 1P0SH 2P16A 1A5GH 4FUIA 2SNVA 1Z6EA 3BTQE 2UUJB 1F92A 1BMNH 1QGFA 2HRVA 1W7XH 1O31A 1B7XB 2OC1A 2V6NA 1GI8B 1O2YA 1A46H 1MH0A 4X2WA 4BTUB 2QXIA 1HAPH 2QYIA 2J92A 2GDDA 2BDIA 1GCDA 2ZFPH 1H8IH 1ZJDA 3ZVCA 4FXGH 3D49H 5EGMA 1TX7A 4UDWH 5HM9A 1O5EH 1BRCE 1LHDH 1W2KH 1V2PT 3RM0H 1UVSH 2BDHA 4ZROA 1AHTH 2FMJA 3M7UA 1PYTD 4AORA 1TRNA 3AAUA 2R3UA 1F5LA 2ZGCA 1EZSC 1GVKB 4OS5A 1C1TA 5DP4A 3ZZBA 2H6MA 1UTLM 2FOGA 5A0CA 3QTVH 1T7CA 3HGNA 1BRUP 4FUEA 4K1EA 4MPVA 4Y11E 2A5AA 3Q3KA 1TMUH 2VWMA 1ETSH 4JMYA 1ZZZA 4ISHH 2R2WU 1ZOMA 1C5RA 1LHCH 3MNSA 3PTBA 4AX9H 4WF8A 3A89A 3A87A 5FX6A 1P03A 4VGCC 1DSTA 1TONA 3DA9B 4TYDA 4I7YH 1XKBC 2BTCE 4I32A 4X6PA 4I8LA 1GBHA 1Y5AT 1HNEE 1XVMA 1TNGA 2GTBA 1E38B 1HAZB 2P93A 1S84A 5EPYA 4MTBA 3A8BA 4IW4E 4ABGA 5LPRA 3KL6A 2FLBH 1G9IE 1ESBA 1H8DH 1IQLA 1HLTH 2ZHFH 2ZU2A 1BMAA 1BBRH 2W26A 2BD2A 1ZMJA 2THFB 5FBEA 3UTUH 5AFYH 1MTVA 4FU8A 3WY8A 2Z3CA 1C2HA 3TPIZ 1UTNA 1BTWA 4CHAC 1WQSA 2OXSA 4NSYA 3PM3A 1CHOF 1Y3VA 1MTSA 5DG6A 4BAOB 1MCTA 4YT6H 3SUDA 4MNYA 1A61H 4ISOA 3U1IB 1UVOA 1XXFA 2HOBA 1TGNA 2BXUH 3JZ2B 4X8VH 2BLOA 4DW2U 1KXBA 5B6OA 3PMHB 1CQQA 1GMDG 1MD8A 3L6PA 1L2EA 1BDAA 2ZCLP 3F1SB 3LU9B 4X8SH 3KQBA 1TLDA 4GLYA 3SU3A 3K6ZA 1C5WB 2P95A 1NRPH 1G2LA 1F5RA 5EXLA 2GZ7A 1GWAA 1WTHD 1GBDA 1V3XA 1K2I1 5E0JA 4ZAEA 1ETTH 1RJXB 1V2ST 2EA3A 2ZF0H 2OC8A 1CGIE 1UCYE 1GHAG 3M5LA 1CBWC 5JDUB 1ZSKA 2I6QA 3GCNA 5T3HA 3LT3A 3A86A 1G3DA 1JRTA 4ZKRU 1T32A 1Z8JB 4GHQA 1ZTJA 5E2PA 3LOXA 5CHAC 5IDKA 2HGTH 1KXDA 1P2JA 1IQHA 1SL3A 2FTMA 2QAAA 1NU9A 2GMTC 5FX5A 1YPEH 1PQ5A 1W14U 2STAE 3M3TA 1O30A 3UR6A 1AZZA 1Z1IA 5GXPA 1FY3A 4CR5A 1O2GH 4XBDA 2Y7ZA 4FUCA 2ANWA 1MTNB 3EDXB 4B2AA 3MO3A 5JB8S 4MPXA 2TGPZ 1EPTC 3ZZ9A 1GJ9B 4O3TA 2FX6A 2ZHDA 1SLVB 2GCHG 1XM1A 3S69A 1FY8E 1C1QA 1SGQE 1QB1A 2PLXA 1ELGA 3SJOA 3EAJA 2H1UA 2AGGX 4GSOA 2VWNA 3E3TA 1ELDE 2FOMB 1TE0A 4ABFA 2BOHB 1MZDA 2WV5A 1Q31A 4AG2A 1K9OE 2HVXA 1G30B 4X8TH 1GBFA 2Z3EA 3TU7H 1C2EA 1SHYA 3STIA 1IQKA 4UONA 2OP9A 1Y5BT 2B9LA 2XWAA 4JCNA 1TPAE 2TIOA 4K1SA 5JBTA 4E05H 1BMMH 1MU8B 3ZV8A 1UO6A 1W0YH 3GY5A 3M61U 1TB6H 2GCTC 2H9HA 1KYNA 2VINA 2TGDA 2QXHA 5AHGH 3SGAE 1AD8H 1VJAU 2ZGXH 3H5CB 3RXEA 3NCLA 1UTJA 1NU7B 4BTTB 1GBBA 1QCPA 1EAIA 3BTDE 1EB2A 3TIUA 1V2MT 1O2IA 3K6YA 3A88A 1O3GA 1CGJE 1BMLA 1CE5A 5CE1A 3ATIA 1ZHMA 4B71A 1A7SA 1NRQH 1ELAA 4Y0ZE 1BRBE 1UK2A 1HFDA 1Z8IB 2ZHWH 4U2WA 1F0TA 1FDPA 1ACBE 3T28A 1P9UA 1QRZA 1TNLA 4NIWA 4FUJA 3LGTA 1K22H 3BG4B 3SHAH 3GDSA 3ODDA 2JH6D 3NZIA 1XUIA 1QQ4A 3T5FH 2XC5A 7KMEH 2ANKH 5C2ZA 4NCYA 4YLUA 3P8NA 4BAHB 1BITA 8LPRA 2VU8E 3BEUA 3FVFB 1E35B 1H9IE 1GI4A 2FP7B 1DWDH 4U30A 1GBAA 2VIDA 1G36A 2ZFRH 1DUAA 3H7OA 3PTNA 1DE7H 1LHFH 1B5GH 1HAIH 1QIXB 2SFAA 1KXEA 1YYY1 3KQDA 2Y81A 5C1UA 1GDQA 3SU1A 1YF4A 3VGCB 2XWBI 3A8AA 2I6SA 3C27B 2F9BH 1GBLA 2B7DH 1C5VA 4AFUA 1DWEH 2Y7XA 5A09A 3FP7E 5BRRE 1VITH 1SG8B 2ZDMA 1UCYK 3BTTE 4JZIA 5F8ZA 2WINI 1EP6A 1IQMA 1L0ZA 3D62A
chains in the Genus database with same CATH superfamily
2KAIA 1TGBA 4NWLA 3MH6A 1HYLA 3K2UA 4M9FA 4DY7B 1O3KA 4Q2KA 5GNDA 1O2JA 2A4RA 4AYYB 8ESTE 1ESTA 1DX5M 2EI6A 1C2LA 5EOKA 1JXPA 1CA0B 2AGEX 1NFYA 1VR1H 1PFXC 1UMAH 1WBGB 3I77A 2BD7A 4JZ1A 3NRLA 4A7IB 1O3EA 4X2XA 3RXTA 3KN2A 2K8IA 4FUBA 5F6MA 4K2YA 2W7UA 4O3UA 1GHXH 2ZTYA 1AKSB 2Y5FA 3ZZAA 1O33A 4THNH 1P05A 2BDGA 3KQCA 4MNWA 1GJDB 5E2OA 6GCHF 1EB1H 1FN8A 1BJVA 4CRCA 1GVZA 4Y71A 1TBZH 5GCHF 3UOPA 2JKHA 5FCRA 2XBXA 2IPHA 1ZYOA 1C4V2 1UTOA 1YM0A 2D2DA 3OX7U 1VCWA 1O3FA 1YPMH 3B23B 4CH2B 1AVXA 1S81A 1C5PA 4CREA 4X2YA 3AK5A 2STBE 1O3PB 2UUFB 4BNRA 3ZVFA 4ZMAH 4E06H 2J4IA 2W3IA 2IN2A 1NN6A 3AVZA 3EQ0H 1NM6A 3RM2H 3RXQA 2GVFA 3F9EA 1RS0A 1C1RA 2PKAB 2F9NA 1EJMA 1VJ9U 4IMQA 5EU8A 3RXFA 1COWD 1GDUA 1TGSZ 2BLQA 1P04A 1FLEE 1WYKA 7LPRA 4CBNA 3T25A 3PRDA 2VVUA 3QGJA 3A81A 2ILNA 4NFEA 3RXGA 1M9UA 1YP9A 4FUGA 2JETC 5DP6A 1ZRBA 3RXRA 1T8LA 3P6ZB 1NRNH 4NA8A 1MKXK 5KECA 1AWHB 1NESE 3SV8A 1YPJH 5KGOA 2G5VA 3OYPA 4YTAA 2AGIX 2Q6FA 4LZ1H 3RLYH 2AMPA 3BTWE 1F2SE 4XD7D 3F0OA 1LVMA 3NWUA 5T6FA 1GMHF 1LTOA 1BTHH 5EQRA 5EW1H 2Y6TA 1OP2A 2PKAA 2QF0A 3CS7A 1NFXA 3RXDA 4HGCA 3SBKA 1C2KA 4JK5A 4WH6A 1C1PA 3ZYEA 4ZHLU 4FUFA 3FOAA 1TNIA 1HIAB 2BDCA 2ZFFH 3FAOA 1XUJA 3BN9A 1LHGH 3HKIB 3K9XB 2VIPA 1WOFA 2VWLA 3E90B 3LGIA 1CT4E 2A2XH 1MZAA 2F9VA 4Y8ZA 1AUTC 1D9IA 3DUXH 5FXLA 3EYDA 5DGJA 1GG6B 1EJAA 1K0HA 3RXAA 1P2MA 1GI6A 2QIQA 1S5SA 3U98H 5FCKA 3ZIAD 2ESTE 1O2WA 1UVPA 1E34B 2Z9JA 4E7RG 1VCQA 3Q00A 4R0IA 1PPBH 2WPHS 2Y5GA 3RP2A 5SGAE 3A80A 1NFWA 3P17H 1DLKB 1DT2A 1SGIB 1QHRB 5IK2D 1BTXA 4OS7A 3A85A 1OPHB 1SLWB 1S83A 1J9CH 2Z9LA 3LH3A 1RGQA 3QO6A 3PMBB 1MMJN 1SGYE 1BHXF 1A0JA 1E36B 3LGUA 1C5LH 2BVXH 3PMAB 1CT2E 2TGAA 3A82A 5T6DA 2J34A 2OK5A 3DFJA 1V6DA 4MNXA 1HUTH 1IQGA 2CV3A 1GJ7B 1G3CA 1ZMNA 2ZTXA 4O9VA 3GCTG 2YMSD 4K8BA 4BANB 2ZZUH 5H4IB 4OGYA 1RTLA 1DPOA 2YOLA 2WYGA 4JYUH 1Y3WA 2KFWA 4NWKA 3TJOA 3BIUH 3SV7A 3O8BA 5EG4A 3T2NA 4SGAE 1K1JA 4JYVH 1H9LB 1O32A 2BX3A 2NU1E 4JK6A 3Q3YA 1YLDA 1MAXA 2P94A 4KKDA 1WCZA 1K28D 2BY6X 1MKXH 3GY6A 1G3BA 3V0XA 1ZGVA 2VBCA 1E0FD 2BHGA 1DWBH 4LXBH 3QTOH 3VB4A 5CHAB 3BTME 1ZRKA 1C1SA 3BEIB 3SN8A 4WXVA 5HM2A 4JZFH 2VIVA 3ZZ6A 1Q3XA 2GCHF 1OWDA 2YNBA 3V7TA 4DIHH 1JIRA 2ZIQH 6CHAC 1MAYA 1DDJA 2DE8A 1CBWB 4DIIH 1Y3YA 1THRH 3HPTB 2B0FA 3GY8A 1F0SA 2PSYA 2WYJA 1F7ZA 1B0EA 3HKJB 1P2KA 3P8OA 4BXWA 3QDZB 3E1XB 1TWXB 2KCPA 2BQ6B 2EI7A 2ZDVH 5PTPA 2AS9A 4A1TA 1FQ3A 4MLFB 4NG9H 4UFDH 2OBOA 1GBKA 4XRNA 3SU5A 2IJOB 1N8OB 7ESTE 3LGWA 4I8KA 4FUDA 1TQ0B 1HIAA 1HJ8A 1NROH 1RIWC 2ZU1A 4OM9A 3EA7A 1O5DH 3UUZA 1Z8RA 3IWMA 1PPFE 3VB7A 2BY9X 2PKSC 4YLQH 3S0NA 3WW7A 4O97A 2W7SA 1UVTH 1QURH 2H9EH 1EPTA 3SUFA 1FAXA 1O2KA 5DP3A 1TPOA 3DSGA 3SORA 7GCHG 1MBMA 3BG8A 1FY5A 3PV4A 1KDQA 4CHAB 1ANCA 4UE7H 2SGFE 2AYWA 1UJ1A 3BEFB 2ZU5A 2C8XB 1HAXB 1GI0A 2WUBA 2ZCKP 1NBMD 2AH4X 1CGHA 3SQHE 3PLBA 3FP6E 1C1OA 4MVNA 1V2JT 4A92A 3GDUA 3M7QA 1THPB 1LO6A 1O2OA 2BX4A 3F0PA 4Q80A 3SW2B 3U69H 6GCHG 2QXJA 3F9HA 5J4SA 1WTGH 5EIYA 2WPIS 2C4FH 4NIXA 3SU0A 1EXFA 1FZZA 1ANBA 1HJAB 2AMQA 2BDAA 2PTNA 2OD3B 1UTMA 4AZ2B 3MU1A 2PW8H 2FOBA 1F5KU 1KXAA 2BOKA 2GT8A 3GCHC 2V3OH 4B2BA 3A84A 3ESTA 1K1PA 3F9GA 1X7AC 1ZR0A 1HGTH 2Z9IA 2VH0A 4LZ4B 2PUQH 3KQEA 1GJ4H 1NT1A 4Z0KA 1INCA 3IITA 4NIVA 3TVJB 3M35A 5TCCA 3SU4A 1NY22 2G5NA 2G4UA 1QTFA 3Q76A 5A8YA 2HALA 5ESTE 1QA0A 1TOCB 3CENA 3TH2H 1V2RT 2FS9A 2NU0E 4ACAA 4RT0A 1S6HA 2R3YA 1MTUA 4TSFD 3SGQE 2FI5E 2F3CE 3M5MA 2QC2A 3EGKH 1XUGA 4X1RU 3TH3H 8KME2 1EATA 1KIGH 2WPDD 3PRBA 1T8MA 5HMAA 1OKXA 1KY9A 4WY3A 1C9PA 1O2TA 1S0QA 1DVAH 2XBYA 1JMOH 1QL9A 5DP8A 2HPPH 2JETB 4X1QU 3V12A 3FANA 4O03A 5EJLA 1ZGIA 4E7NA 1O3NA 1A2CH 3CP7A 2AIQA 2EC9H 1SB1H 4ABHA 4KELA 1XX9A 5F03A 3RU4T 2SGAA 1SR5C 1FI8A 1AUJA 1GI9B 1DLEA 3W1EA 1P09A 1SMFE 2FODA 2XW9A 2B8OH 3ZZCA 6ESTA 1O2QA 3SJ8A 3B9FH 3ZVGA 1VGCB 2HVYB 2G8TA 2CF9H 4ZXYH 2EEKA 4BTIB 2ALPA 2HPQH 1V2QT 3A7XA 1GMDF 2H5DA 3TGKE 3UQVA 1GJBB 5EJZA 3KHVA 5C0TA 1TX6A 2VB0A 3EA9A 4F55A 1EKBB 3MNCA 4ZXXH 3F2GA 4Q4LA 1D3QB 4AB8A 3QUMP 1O5CB 1IHTH 1JIMA 4MDSA 4AGKA 1J8AA 4INLA 2C8ZB 1DANH 1P9SA 3FP8E 3PLKA 1PPGE 3GY7A 4F48B 1BZXE 2F9OA 3H7TA 2B5TB 1AE5A 1O37A 1SGRE 1TFXA 5DP5A 1C5XB 5G4BA 3I78A 2H5CA 3CS0A 2V0BA 5DK1A 1O34A 1O2HA 1ZMLA 3E91A 5EPNA 3SQEE 1TABE 4F4OC 1GJ6A 1TAWA 3T26A 2ZDKA 1TX8A 4GHTA 4WMFA 5LPEA 1DICA 2XCNA 4GUXA 3VB3A 1C4Y2 2VVVA 1K1OA 1SFIA 2FYQA 2ZGJA 1PPZA 1D4PB 5AF9H 1V2TT 4JZDH 2ODYB 1L4ZA 1YKTA 2KCOA 3N99A 4DT7B 2PTCE 1O2LA 1YLCA 2M5TA 1AWFH 5GWZA 1EAUA 1YC0A 4OS4A 2ZC9H 3M3SA 1ELBA 1QRWA 1GJ8B 3A7ZA 1FMGA 4VGCB 1A4WH 1MD7A 1GDNA 2D1JA 2VIWA 3S9AA 3U8RH 1YGCH 3NK8A 3RLWH 1PPCE 3EE7A 5A0AE 4WWYA 1W7GH 2VIQA 1LVBA 3D23A 3ZV9A 5CMXH 5L2YH 1ELCA 5E0HA 2FESH 2VNTA 3LKWA 4H4FA 3AW1A 4X6OA 2FOCA 1SGEE 4K1TA 3STJA 1HBTH 1FY1A 5C0UA 3A7WA 2W6JD 4Q7YA 2OTVA 2ZFTA 2PV9B 1AVWA 4YM9A 5GIBA 4ZUHA 1J16A 1OSSA 3QX5H 3VB5A 1NTPA 3RUOA 5EJ1A 5EW2H 2AHME 1A0LA 2CF8H 4GCHG 4MQAA 1C2DA 2ZTZA 4I86A 2BVRH 3UFAA 2ANMH 4HZHA 5F8XA 2F9PA 1RIWB 3UAIC 1TNKA 2JH5D 1KXCA 3ODFA 1C2MA 4D7FA 3SV6A 2SGDE 1O2ZA 5C5OA 2QCYA 1EPTB 1P8VC 4MPWA 1QNJA 1TQ7B 3O8RA 1P3EA 2BZ6H 3GISB 2FM2A 1SGCA 3KNXA 3KQ5A 1IHSH 2OQUA 1EZXC 1OWIA 1OYTH 1MQ6A 1DOJA 1O3AA 2G51A 5LH8A 2FWWA 3OFND 4CRGA 1CA0C 1C5SA 4P02A 3PO1B 2BMGB 2GDEH 3LGVA 1BJUA 2P3UB 3KEEA 3UWJH 1T8NA 3P8FA 3P8GA 2A4OA 3RU4D 1GBTA 1ELFA 2PP6A 1GCTC 1CT0E 1AE8H 4J2YB 4AOQA 2Q1JA 1ZTLA 4ASHA 9ESTA 1EJNA 1O5AB 1GHBG 3TH4H 1H8ED 2VGCC 5FBIA 4ACBA 4Z6AH 1FUJA 1LQEA 4TWWA 1D3TB 1VITF 1AFQC 4Q63A 1KLTA 2HWLB 1GL0E 3MO9A 1EUFA 3DCLA 1C9TA 1SHHB 1LCYA 2FOEA 4D8NA 2J38A 3OU0A 4ZKNU 4WJG2 3RMMH 2H9TH 1EAXA 3MFJA 3MQKC 2P8OC 1TPSA 2ZDNA 2FEQH 2O8MA 1UW7A 1L1JA 1S6FA 2Z7FE 3JZ1B 4Z1MD 2W6ID 1UHBB 2FI3E 3BTHE 1KXFA 4DG4A 3SJIA 2Z6BD 3GY4A 3TLOA 1MKWK 4WMEA 2O8UA 1LMWB 1IQJA 5C1XA 1OYQA 3GY2A 4XFQA 2ZGBH 2GP9B 1O3IA 1ZPZA 2FOFA 2YMSC 1GL1A 3FKSD 2AMDA 3GDVA 1NFUA 4AFQA 1J14A 1V2KT 2ULLA 2P59A 1T8OA 4NGAH 2BD8A 4OS6A 1YCPM 1MTNC 1QY6A 1A3BH 2GX4A 3OTJE 1D6RA 1QA7A 5C17A 2RFKC 1A5HA 1O3DA 2ZHEH 2IOTA 3MOCA 4FVBA 3SO3A 1L4DA 1O38A 1IQNA 3PWBA 4IC6A 1TA2A 2V7QD 1GBEA 1AFQB 3RXHA 3MI4A 2BLWA 2TPIZ 1P57B 1QQUA 3HK6B 1SSXA 2GCTB 1UVUH 1DXPA 4BAQB 1OS8A 4Y79A 1KMHB 2QGRA 3TJUA 5C20A 1WV7H 1YPKH 3SU2A 1O35A 4UD9H 3ZZDA 1SVPA 1HXEH 3FZDA 1XUKA 2OQ5A 3MH7A 5HIZA 3VXFH 1C5OH 1P01A 1BCUH 1RXPA 3SOSA 3RXLA 2UWLA 2KCAA 2GV6A 2RA0A 2WPKS 4Y7AA 4CR9A 1HV7A 4FU9A 1HAHH 3SNDA 2XXLA 2A7HA 2BQ7B 2OLGA 3DSOA 4FVDA 1AIXH 3ZVDA 2C8YB 4B74A 1FAKH 1JBUH 2PWXA 1GPZA 2VGCB 1AGJA 1QBOA 2FXRA 2ZA5A 1SGFG 5T1VA 1GCTB 3RC6A 1ARCA 2NU2E 4U01A 2V3HH 1HAGE 4FETA 1OP8A 3FFGA 5DO4H 1F0RA 1SGDE 8GCHG 3A8DA 1XMNB 1C5UA 3ZYDA 1Z1JA 2A7CA 4CRDA 1V2UT 3QN7A 3LC3A 1W8BH 6LPRA 1AVGH 3GY3A 2O8LA 3DSPA 4K60A 4ESTE 2WV9A 2BYAX 1N6YA 1EOLA 3UNRA 2CJIA 3PROA 5EQQA 1BTUA 1C5ZB 1LKAA 1Z71A 1MBQA 2ZGHA 3MTYA 4X1PU 3E0PB 1KSNA 1FV9A 1LPKB 2R0KA 4DVAU 5FAHA 1PYTC 1GI2A 4A5TS 1S85A 2KR7A 1BT7A 1WDIA 4AB9A 1HDTH 4X6MA 1LPGB 5F53A 3E0NB 5TJXA 3ZZ8A 2QV1A 3LGYA 1G37A 4ZHAA 1D6WA 1Z7KA 3PO1C 1A3EH 1RRKA 1A0HB 4XSKU 4SGBE 1O3LA 1TOMH 1Y59T 4I8JA 2PGBB 1GMHG 2Z9KA 1S0RA 2RCEA 1W3CA 3L33A 4DJZB 1ORFA 1XVOA 2AFQB 3QGNB 4HTCH 3CNRA 4GPGA 2KAIB 3OEHD 4XOJA 3BG4C 1HAOH 4IN2A 1FX0B 3NXPA 2JJ1D 1BOQA 5LGOA 1HAVA 2PHBA 2XBWA 3MU4A 2ZWLH 1XKAC 2Z3DA 1BB0B 4WVPE 1O36A 1VKYA 1HB0B 1H1BA 3U1JB 1ETRH 4CBOA 4RKOB 4K69A 3UIRA 3D65E 2XCFA 3LJJA 2XNIA 4KP0A 2FZZA 3DHKH 1LHEH 2JDID 2GT7A 3AW0A 3A7TA 1YWUA 4ABEA 3VGCC 1NS3A 4UFEH 1DXWA 4NSVA 1LDTT 1OWEA 1SGTA 4INKA 1UTPA 3UWIA 3R0FA 1N1LA 4H6SB 3TK6A 1D3PB 4JZEH 1E37B 5HKKD 4MNVA 1O5BB 1DFPA 1L1NA 3TK9A 1O2UA 2ZDAH 3I29A 3SV9A 3MU5A 3ELAH 4UFGH 4X2VA 1O2NA 1E1RD 2J2UA 1O2VA 2OINA 3DT0H 5ETXA 1GHVH 3UB0A 5EXMA 2JIZD 5FHTA 1FN6A 2A4GA 1YPGH 2ZI2H 1EASA 1G2MA 5JPMH 3DFLA 1Y3XA 1OWJA 2FTLE 5JYIA 5A8ZA 3GYMA 2BQWB 1U6QA 4TY7A 5I25A 3ATLA 1ABJH 2A31A 1VZQH 3MYWA 2VWOA 2NU4E 1C2GA 1QJ1B 1MABB 2FOHA 2XTTB 3UOUA 4D9QA 3RC5A 2XYAA 1FY4A 5JBAS 3BTEE 4D9RA 4K3JA 3GICB 2Y5HA 3V13A 1NRRH 3M5NA 3MMGA 3RXJA 4AFZA 3SNCA 3RXUA 3S9CA 2V3MA 2J97A 4D7GA 1P2NA 2QF4A 1Y8TA 3NKKA 1O3MA 1IAUA 1GI7B 3RXBA 3M37A 1WAYB 3W95A 2BY5X 5E0GA 2ALVA 2XNDD 2GZ8A 3A7YA 4MPUA 1UCYH 2SGEE 5HXFA 1P10A 4UFFH 1GJ5H 3GYLB 1BBRK 2J9NA 3P70B 3LJOA 5A2MH 4OS1A 5F8TA 2OUAA 3SNEA 2OBQA 2ZEBA 4F49A 1PPHE 3IG6B 3OY6U 1FPHH 3KYFA 2EI8A 2OC0A 2BLVA 1ABIH 4GAWA 3LH1A 2Z9GA 4X8UH 5C3NA 4B75A 4BAKB 2A32A 1P06A 3C1KA 3TJNA 5IYTA 3SJKA 3URDA 3RXOA 1HJAC 1C2FA 4D76A 3U9AH 2WV4A 4ZHMU 1GBIA 1FJSA 4A6LA 1GI3A 1UK3A 1V2LT 2D26C 1TA6A 3TITA 3A8CA 4TPIZ 4XBCA 1KDQB 1GHBF 5BPEA 2FI4E 1BTPA 4YZUA 4B6EA 1O3OA 5JBBS 2DE9A 4Y7BA 3SHCH 4LK4A 1XUFA 4K5ZA 1ZPCA 2ZP0H 1SQAA 2P8OB 1HXFH 1SBWA 3RXIA 3URCA 3A83A 4ABBA 2Q6DA 1MCVA 2PKSB 1PQ8A 4AGJA 3NPSA 1O5GH 4RT1A 1AMHA 1TGTA 3BTGE 1OXGA 4BXSA 4TWYA 1C1MA 4DOQA 3L3TA 2L6OA 2ZO3H 1C1VH 4HG6A 6CHAB 2GD4B 3NUMA 3TJVA 3VB6A 4AFSA 5C67A 1P11E 1MTWA 1BTZA 2K1QA 1AQ7A 3SUEA 3QZRA 1GBJA 4TPYA 3EA8A 1O5FH 3VFEA 3SZNA 1GI1A 5C5NA 1C1UH 1EP5A 3MWIU 4X1SU 3OSYA 3PYHA 3MU0A 3UQOA 2BY8X 2SGQE 3VEQB 2A4QA 2ZPQA 3N7DA 3HK3B 2RG3A 1BQYA 1NO9H 2ZNKH 3S7HB 1PQ7A 3AASA 3QWCH 2QY0B 1AY6H 1FIWA 4ABAA 3DD2H 5DN6D 1IOEA 9LPRA 1KLJH 3LC5A 5L2ZH 3U8TH 1KLIH 4ZH8A 1BHXB 2ZPSA 2ANYA 5JBCS 4KTSA 4Y76A 2ZPRA 1TBRH 1O0DH 1C1NA 3MHWU 4NZQA 3SJ9A 1SLUB 4I33A 2UUYA 3T62A 1O3JA 1O2RA 2Y80A 1VGCC 3BIVH 4ISNA 3SNAA 1Z6JH 2Z94A 2GMTB 1W11U 5LPFA 1P3CA 2TGTA 4Q7ZA 1FONA 1HCGA 4JYTA 1V2NT 4UEHH 1C1WH 4K8YA 5J4QA 1SOTA 3N7EA 3GOVB 2A5KA 3G01A 1SOZA 3RXVA 2GV7A 1KTSB 1NC6A 1OWHA 2D8WA 4ZKSU 4YOJA 2BVSH 1AO5A 3B8JA 4DCDA 4NIYA 4IMZA 1TPPA 3LIWA 4NA9H 3P92A 3P95A 2VVCA 1NBME 4B6FA 2CGAA 1H8HD 1GHYH 4FOUC 1TGCA 4Y6DA 2FDAA 1O2SA 1LPZB 8GCHF 1SI5H 2O8TA 4WMDA 3M3VA 1P2QA 1OWKA 3ZVBA 5JB9S 1P12E 3MNBA 1K21H 3U8OH 4DURA 4AG1A 3F9FA 1PPEE 1G3EA 2BXTH 2C90B 1O3BA 2ZFQH 2OCVB 2A1DB 2NU3E 4ABIA 4IGDA 1CVWH 1TALA 4H6TA 5DSFA 3ATKA 4IBLH 1AI8H 1JOUB 4B2CA 1GJAB 1LQDB 1ZPBA 3PV2A 1O3CA 4XDEA 5EXNA 3FZZA 1UTQA 2UWOA 1SQTA 1O2PA 1NPMA 5ESBA 1JWTA 1Z8GA 1GGDC 4KTUA 1A5IA 3OEED 2FS8A 1ZSJA 2C8WB 2FX4A 1RD3B 2G55A 4YO9A 2BD9A 1TRMA 3F6UH 5AVDA 1PJPA 2W5EA 1AU8A 1A1RA 3RC4A 1WQVH 5FPYA 1O2XA 5L6NH 4HFPB 2BDYA 1MQ5A 1TIOA 2XBVA 1C2IA 1W0ZU 2ZG0H 1ZLRA 2XC0A 2A7JA 3KCGH 5EODA 1MU6B 2QA9E 4B73A 1TNHA 2WPJS 3E8LA 5T6GA 1CHOG 4INHA 1LVOA 2K0QA 1TYNA 2CN0H 3W94A 1AB9B 5HGGA 2ZCHP 5C94A 1QB6A 1CSOE 1H4WA 5GCHG 2VIOA 2SGPE 1DSUA 3PB1E 3ZZ3A 1BUIA 4HI3A 4A1XA 1UHBA 2BD4A 2IJD1 1YBWA 3GCOA 1WUNH 5TCAA 3RXCA 1UTKA 2AIPA 3MU8A 1WXRA 1YLNA 4AYVB 4CRBA 3MO6A 4A1VA 2V35A 5AFZH 1E1QD 3VXEH 1QJ6B 2O9QA 1ID5H 1P02A 1G32B 3QLPH 2ODQA 1C5YB 1GG6C 1YPLH 2LP6A 5L30H 4Y10E 1AB9C 3ZZ7A 2WUCA 1EX3A 3Q77A 1SFQB 2R0LA 1JRSA 1QB9A 4FUHA 2YNAA 2WPLS 4QT8C 1OOKB 1ZJKA 1C5NH 1N6XA 1GBCA 2G00A 2VH6A 2ZFSA 1FIZA 1BRAA 2BM2A 3TGIE 2LPRA 2WZQA 2IPQX 1P2OA 4MG3A 3SI3H 1TBQH 2ZDLA 2A2QH 1AN1E 2CHAB 2O8WA 3GCHB 4CRAA 3M5OA 1O39A 2ZQ2A 7GCHF 3PV5A 1ARBA 4LOYH 1XUHA 3QK1A 5DP7A 3N7OA 4RKJB 2AEIH 1C5MD 1DITH 1DY8A 5DJ7A 1GHWH 1F0UA 3ATMA 1BMFD 2W3KA 1C2JA 1WU1A 3TNTA 5E8EH 1HJ9A 4B1TA 1P2IA 1SQOA 1FNIA 3ATWA 3MH5A 3OAAD 4B76A 4X1NU 4BAMB 4NFFA 1N8OC 2QF3A 1T31A 3V3MA 1UK4A 2PSXA 1YCPK 2KX4A 4FU7A 1K1IA 2XC4A 1H9HE 1ANDA 2PR3A 1CHGA 2PUXB 2R2MB 3M36A 2FYRA 1OX1A 3HATH 2P3TB 1GJCB 4OGXA 1AZ8A 2BZAA 2JH0D 1GGDB 1D3DB 3UY9A 2A45B 5EQSA 3RXSA 4GCHF 2ZKSA 2F4LA 3LPRA 3TNSA 1C4U2 1ESAA 1T4VH 2KZ4A 1EQ9A 1QL7A 2FLRH 2ZECA 2CK3D 2CXVA 2J5UA 1Y5UT 2BDBA 4AC9A 1RTKA 1T4UH 1BBRE 1SGPE 3ZZ5A 5HYOA 1QBVH 1DY9A 3ENSB 1Y3UA 3BV9B 4CRFA 4OS2A 4I31A 2PFEA 2BD5A 3O8CA 2VJ1A 3BSQA 3RMOH 1SPJA 1IQFA 3UNQA 2QN5T 1GMCG 1VCPA 3WWBA 3KF2A 3ITIA 1CA8B 2BD3A 3A7VA 3RMLH 1KTTB 1AFEH 1DUEA 1QR3E 1V2WT 2GGVB 1FXYA 1QZ8A 1HPGA 2HNTF 4RSPA 4KTCA 2QE7D 5B6LA 2FOAA 4ABDA 1EZUC 1LKBA 1OP0A 1W0KD 1C5QA 3KYGA 3E16B 4KGAA 5A0BA 3MNXA 3S7KB 1YPHE 4GVUA 2HNTE 4XBBA 2BB4A 3LONA 3E6PH 1QFKH 1IQEA 3ZVEA 3UR9A 4J1YA 3SGBE 1W10U 1CO7E 1PQAA 1TMBH 5DKMA 2FPZA 1SGNE 2H2ZA 4Q7XA 1W13U 3BF6H 2NWNA 4YESB 1W0JD 1LVYA 1YPHC 4Y0YE 5GDSH 3O8DA 2F9UA 3F68H 2J98B 3SNBA 3LDXH 3OY5U 2G81E 3RXKA 3SU6A 5K0HA 2HLCA 3M7TA 1NZQH 2ZU3A 1GMCF 1O3HA 1YCPH 1RTFB 2OC7A 3T29A 1MUEB 4CH8B 2C93B 3UREA 2ASUB 3WWFA 3RXPA 3SUGA 5A8XA 5DP9A 4U32A 1ELEE 3UPEA 4IS5A 2ZQ1A 1TRYA 1ZTKA 2DUCA 1RFNA 1DS2E 1DWCH 3Q3XA 2CHAC 1SLXB 2TBSA 3F2HA 5C1YA 3GS9A 4ISIH 3SV2H 2QXGA 2QF5A 4XE4A 4TY6A 3OE7D 1O2MA 1L1GA 1IQIA 1C5TA 1K1MA 3MH4A 3PMJA 3RU4E 2BY7X 1V2VT 4X0WU 1ANEA 1K1NA 2PGQB 1HAVB 4ISLA 2FIRH 3EE0B 1K1LA 4ZKOU 5ABWA 1SGFA 1W12U 4BOHA 4DGJA 2FO9A 2JJ2D 1AKSA 2UUKB 2C3SA 1J15A 1GHAF 1XXDA 2UWPA 4R8TB 4I8GA 1NRSH 4NA7A 2A5IA 1FPCH 3RXMA 2ZU4A 1QRXA 2ZHQH 3GCTF 1ZHPA 3K65B 1ELVA 2XRCA 1ZHRA 4IN1A 4Y8YA 2RA3A 1TNJA 3ZVAA 4YOIA 1GHZA 2SNWA 2G4TA 1EFRD 2GKVE 1EZQA 1WSSH 3VPKA 2GZ9A 1ZSLA 4PROA 1GBMA 2Y82A 2TRMA 4NZLA 3F3BA 4I8HA 3UNSA 2WSSD 4RI0A 4YT7H 3AAVA 4YOGA 1ELTA 2J98A 2F91A 3KGPA 3QZQA 2P3FH 3KIDU 2LNCA 4RN6A 5K7RA 5FPTA 5GPIB 3SI4H 5DPAA 1EOJA 2EQNA 4AN7A 2AERH 1BIOA 1QJ7B 2L74A 2Q6GA 5I46H 1SC8U 3RMNH 1GI5A 5FL7D 5KEDA 2F83A 1J17T 2R9PA 3R3GB 3RDZA 1BTYA 1S82A 2J94A 2A0QB 1QL8A 1DM4B 5GJ4B 1GVLA 4M7GA 3H09A 1SQRA 4H42U 1S6LA 3BTKE 3HGPA 1CU1A 1V2OT 1B0FA 2WHXA 1THSH 1EAWA 1HRTH 3PLPA 2CMYA 3TK5A 4X6NA 2J95A 1QBNA 2ODPA 5FPSA 4IC5A 4ABJA 4Y8XA 2WPMS 4WXIA 1VITG 3T27A 1HAYB 2RDLA 4YXWD 4WH8A 1Q2WA 1MKWH 3S9BA 3ZZ4A 3BTFE 3TGJE 2G52A 1TMTH 2HNTC 3PWCA 1BA8B 1P0SH 2P16A 1A5GH 4FUIA 2SNVA 1Z6EA 3BTQE 2UUJB 1F92A 1BMNH 1QGFA 2HRVA 1W7XH 1O31A 1B7XB 2OC1A 2V6NA 1GI8B 1O2YA 3FN8A 1A46H 1MH0A 4X2WA 4BTUB 2QXIA 1HAPH 2QYIA 2J92A 2GDDA 2BDIA 1GCDA 2ZFPH 1H8IH 1ZJDA 3ZVCA 4FXGH 3U28C 3D49H 5EGMA 1TX7A 4UDWH 5HM9A 1O5EH 1BRCE 1LHDH 1W2KH 1V2PT 3RM0H 1UVSH 2BDHA 4ZROA 1AHTH 2FMJA 3M7UA 1PYTD 3F2FA 4AORA 1TRNA 4P00A 3AAUA 2R3UA 1F5LA 2ZGCA 1EZSC 1GVKB 4OS5A 1C1TA 5DP4A 3ZZBA 2H6MA 1UTLM 2FOGA 5A0CA 3QTVH 1T7CA 3HGNA 1BRUP 4FUEA 4K1EA 4MPVA 4Y11E 2A5AA 3Q3KA 1TMUH 2VWMA 1SKYE 1ETSH 4JMYA 1ZZZA 3VG8A 4ISHH 2R2WU 1ZOMA 1C5RA 1LHCH 2EY4C 3MNSA 3PTBA 4AX9H 4WF8A 3A89A 3A87A 5FX6A 1OHHD 1P03A 4VGCC 1DSTA 1TONA 3DA9B 4TYDA 4I7YH 1XKBC 2BTCE 4I32A 4X6PA 4I8LA 1GBHA 1Y5AT 1HNEE 1XVMA 1TNGA 2GTBA 5HIYA 1E38B 1HAZB 2P93A 1S84A 5EPYA 4TT3D 4MTBA 3A8BA 4IW4E 4ABGA 5LPRA 3KL6A 2FLBH 1G9IE 1ESBA 1H8DH 1IQLA 1HLTH 2ZHFH 2ZU2A 1BMAA 1BBRH 2W26A 2BD2A 1ZMJA 2THFB 5FBEA 3UTUH 5AFYH 1MTVA 4FU8A 3WY8A 2Z3CA 4ASUD 1C2HA 3TPIZ 1UTNA 1BTWA 4CHAC 1WQSA 2OXSA 4NSYA 3PM3A 1CHOF 1Y3VA 1MTSA 2YMSB 5DG6A 1MCTA 4BAOB 4YT6H 5CDFE 2GJGA 3SUDA 4MNYA 1A61H 4ISOA 3U1IB 1UVOA 1XXFA 2HOBA 1TGNA 2BXUH 3JZ2B 4X8VH 2BLOA 4DW2U 1KXBA 5B6OA 3PMHB 1CQQA 1GMDG 1MD8A 3L6PA 1L2EA 1BDAA 2ZCLP 3F1SB 3LU9B 4X8SH 3KQBA 1TLDA 4GLYA 3SU3A 3K6ZA 1C5WB 2P95A 3SYJA 2HLDD 1NRPH 1G2LA 1F5RA 5EXLA 2GZ7A 1GWAA 1WTHD 1GBDA 1V3XA 1K2I1 5E0JA 4ZAEA 1ETTH 1RJXB 1V2ST 2EA3A 2ZF0H 2OC8A 1CGIE 3FO8D 1UCYE 1GHAG 3M5LA 1CBWC 5JDUB 1ZSKA 3OTPA 2I6QA 3GCNA 5T3HA 3LT3A 3A86A 1G3DA 1JRTA 1YY3A 4ZKRU 1T32A 1Z8JB 4GHQA 1ZTJA 5E2PA 3LOXA 5CHAC 5IDKA 2HGTH 1KXDA 1P2JA 1IQHA 1SL3A 2FTMA 2QAAA 1NU9A 2GMTC 5FX5A 1YPEH 1PQ5A 1W14U 2STAE 3M3TA 1O30A 3UR6A 1AZZA 1Z1IA 5GXPA 1FY3A 4CR5A 1O2GH 2KCYA 4XBDA 2Y7ZA 4FUCA 2ANWA 1MTNB 3EDXB 4B2AA 3MO3A 5JB8S 4MPXA 2TGPZ 1EPTC 3ZZ9A 1GJ9B 4O3TA 2FX6A 2ZHDA 1SLVB 2GCHG 1XM1A 3S69A 1FY8E 1C1QA 1SGQE 1QB1A 2PLXA 1ELGA 3SJOA 3EAJA 2H1UA 2AGGX 4GSOA 2VWNA 3E3TA 1ELDE 2FOMB 4DT4A 1TE0A 4ABFA 2BOHB 1MZDA 2WV5A 1Q31A 4AG2A 1K9OE 2HVXA 1G30B 4X8TH 1GBFA 2Z3EA 3TU7H 1C2EA 1SHYA 3STIA 1IQKA 4UONA 2OP9A 1Y5BT 2B9LA 2XWAA 4JCNA 1TPAE 2XOKD 2TIOA 4K1SA 5JBTA 4E05H 1BMMH 1MU8B 3ZV8A 1UO6A 1W0YH 3GY5A 3M61U 1TB6H 2GCTC 2H9HA 1KYNA 2TGDA 2VINA 2QXHA 5AHGH 3SGAE 1AD8H 1VJAU 2ZGXH 3H5CB 3RXEA 3NCLA 1UTJA 1NU7B 2RDEA 4BTTB 1GBBA 1QCPA 1EAIA 2F43B 3BTDE 1EB2A 2LELA 1V2MT 3TIUA 1O2IA 3K6YA 3A88A 1O3GA 5CHBA 1CGJE 1BMLA 1CE5A 5CE1A 3ATIA 1ZHMA 4B71A 1A7SA 1NRQH 1ELAA 4Y0ZE 3SZEA 1BRBE 1UK2A 2KM0A 1HFDA 1Z8IB 2ZHWH 4U2WA 1F0TA 1FDPA 1ACBE 3T28A 1P9UA 1QRZA 1TNLA 4NIWA 4FUJA 3LGTA 1K22H 3BG4B 3SHAH 3GDSA 3ODDA 2JH6D 3NZIA 1XUIA 1QQ4A 3T5FH 2XC5A 7KMEH 2ANKH 5C2ZA 4NCYA 4YLUA 3P8NA 4BAHB 1BITA 8LPRA 2VU8E 3BEUA 4ZCNA 3FVFB 1E35B 1H9IE 1GI4A 2FP7B 1DWDH 4U30A 1GBAA 2VIDA 1G36A 2ZFRH 1DUAA 3H7OA 2M2AA 3PTNA 1DE7H 1LHFH 1B5GH 1HAIH 1QIXB 2SFAA 1KXEA 1YYY1 3KQDA 2Y81A 5C1UA 1GDQA 3SU1A 1YF4A 3VGCB 2XWBI 3A8AA 2I6SA 3C27B 2F9BH 1GBLA 2B7DH 1C5VA 4AFUA 1DWEH 2Y7XA 5A09A 3FP7E 5BRRE 1VITH 1E79D 1SG8B 2ZDMA 1UCYK 3BTTE 4JZIA 5F8ZA 2WINI 1EP6A 1IQMA 1L0ZA 3D62A
chains in the Genus database with same CATH topology
2KAIA 1TGBA 4NWLA 3MH6A 1HYLA 3K2UA 4DY7B 1O3KA 4Q2KA 1O2JA 2A4RA 4AYYB 8ESTE 1ESTA 1DX5M 2EI6A 1C2LA 5EOKA 1JXPA 1CA0B 2AGEX 1NFYA 1VR1H 1PFXC 1UMAH 1WBGB 3I77A 2BD7A 4JZ1A 4A7IB 1O3EA 4X2XA 3RXTA 3KN2A 4FUBA 5F6MA 4K2YA 2W7UA 4O3UA 1GHXH 2ZTYA 1AKSB 2Y5FA 3ZZAA 1O33A 4THNH 1P05A 2BDGA 3KQCA 4MNWA 1GJDB 5E2OA 6GCHF 1EB1H 1FN8A 1BJVA 4CRCA 1GVZA 4Y71A 1TBZH 5GCHF 3UOPA 2JKHA 5FCRA 2XBXA 2IPHA 1ZYOA 1C4V2 1UTOA 1YM0A 2D2DA 3OX7U 1VCWA 1O3FA 1YPMH 3B23B 4CH2B 1AVXA 1S81A 1C5PA 4CREA 4X2YA 2STBE 1O3PB 2UUFB 4BNRA 3ZVFA 4ZMAH 4E06H 2J4IA 2W3IA 2IN2A 1NN6A 3AVZA 3EQ0H 1NM6A 3RM2H 3RXQA 2GVFA 3F9EA 1RS0A 1C1RA 2PKAB 2F9NA 1EJMA 1VJ9U 4IMQA 5EU8A 3RXFA 1TGSZ 1GDUA 2BLQA 1P04A 1FLEE 1WYKA 7LPRA 4CBNA 3T25A 2VVUA 3QGJA 3A81A 2ILNA 4NFEA 3RXGA 1M9UA 1YP9A 4FUGA 2JETC 5DP6A 1ZRBA 3RXRA 1T8LA 3P6ZB 1NRNH 4NA8A 1MKXK 1AWHB 1NESE 3SV8A 1YPJH 2G5VA 3OYPA 4YTAA 2AGIX 2Q6FA 4LZ1H 3RLYH 2AMPA 3BTWE 1F2SE 3NWUA 1LVMA 5T6FA 1GMHF 1LTOA 1BTHH 5EQRA 5EW1H 2Y6TA 1OP2A 2PKAA 2QF0A 3CS7A 1NFXA 3RXDA 4HGCA 3SBKA 1C2KA 4JK5A 4WH6A 1C1PA 3ZYEA 4ZHLU 4FUFA 1TNIA 1HIAB 2BDCA 2ZFFH 3FAOA 1XUJA 3BN9A 1LHGH 3HKIB 3K9XB 2VIPA 1WOFA 2VWLA 3E90B 3LGIA 1CT4E 2A2XH 1MZAA 2F9VA 4Y8ZA 1AUTC 1D9IA 3DUXH 5FXLA 3EYDA 5DGJA 1GG6B 1EJAA 3RXAA 1P2MA 1GI6A 2QIQA 1S5SA 3U98H 5FCKA 2ESTE 1O2WA 1UVPA 1E34B 2Z9JA 4E7RG 1VCQA 3Q00A 4R0IA 1PPBH 2WPHS 2Y5GA 3RP2A 5SGAE 3A80A 1NFWA 3P17H 1DLKB 1DT2A 1SGIB 1QHRB 1BTXA 4OS7A 3A85A 1OPHB 1SLWB 1S83A 1J9CH 2Z9LA 3LH3A 1RGQA 3QO6A 3PMBB 1MMJN 1SGYE 1BHXF 1A0JA 1E36B 3LGUA 1C5LH 2BVXH 3PMAB 1CT2E 2TGAA 3A82A 5T6DA 2J34A 3DFJA 1V6DA 4MNXA 1HUTH 1IQGA 2CV3A 1GJ7B 1G3CA 1ZMNA 2ZTXA 4O9VA 3GCTG 4K8BA 4BANB 2ZZUH 5H4IB 4OGYA 1RTLA 1DPOA 2YOLA 2WYGA 4JYUH 1Y3WA 4NWKA 3TJOA 3BIUH 3SV7A 3O8BA 5EG4A 3T2NA 4SGAE 1K1JA 4JYVH 1H9LB 1O32A 2BX3A 2NU1E 4JK6A 3Q3YA 1YLDA 1MAXA 2P94A 4KKDA 1WCZA 1K28D 2BY6X 1MKXH 3GY6A 1G3BA 3V0XA 1ZGVA 1E0FD 2BHGA 1DWBH 4LXBH 3QTOH 3VB4A 5CHAB 3BTME 1ZRKA 1C1SA 3BEIB 3SN8A 4WXVA 5HM2A 4JZFH 2VIVA 3ZZ6A 1Q3XA 2GCHF 1OWDA 2YNBA 3V7TA 4DIHH 1JIRA 2ZIQH 6CHAC 1MAYA 1DDJA 2DE8A 1CBWB 4DIIH 1Y3YA 1THRH 3HPTB 2B0FA 3GY8A 1F0SA 2PSYA 2WYJA 1F7ZA 1B0EA 3HKJB 1P2KA 3P8OA 4BXWA 3QDZB 3E1XB 1TWXB 2ZDVH 2BQ6B 2EI7A 5PTPA 2AS9A 4A1TA 1FQ3A 4MLFB 4NG9H 4UFDH 2OBOA 1GBKA 3SU5A 2IJOB 1N8OB 7ESTE 3LGWA 4I8KA 4FUDA 1TQ0B 1HIAA 1HJ8A 1NROH 1RIWC 2ZU1A 3EA7A 1O5DH 3UUZA 1Z8RA 3IWMA 1PPFE 3VB7A 2BY9X 2PKSC 4YLQH 3S0NA 4O97A 2W7SA 1UVTH 1QURH 2H9EH 1EPTA 3SUFA 1FAXA 1O2KA 5DP3A 1TPOA 3SORA 7GCHG 1MBMA 3BG8A 1FY5A 3PV4A 1KDQA 4CHAB 1ANCA 4UE7H 2SGFE 2AYWA 1UJ1A 3BEFB 2ZU5A 2C8XB 1HAXB 1GI0A 2WUBA 2ZCKP 2AH4X 1CGHA 3SQHE 3PLBA 3FP6E 1C1OA 4MVNA 1V2JT 4A92A 3GDUA 3M7QA 1THPB 1LO6A 1O2OA 2BX4A 4Q80A 3SW2B 3U69H 6GCHG 2QXJA 3F9HA 5J4SA 1WTGH 2WPIS 2C4FH 4NIXA 3SU0A 1EXFA 1FZZA 1ANBA 1HJAB 2AMQA 2BDAA 2PTNA 2OD3B 1UTMA 4AZ2B 3MU1A 2PW8H 2FOBA 1F5KU 1KXAA 2BOKA 2GT8A 3GCHC 2V3OH 4B2BA 3A84A 3ESTA 1K1PA 3F9GA 1X7AC 1ZR0A 1HGTH 2Z9IA 2VH0A 4LZ4B 2PUQH 3KQEA 1GJ4H 1NT1A 4Z0KA 1INCA 3IITA 4NIVA 3TVJB 3M35A 5TCCA 3SU4A 1NY22 2G5NA 2G4UA 1QTFA 3Q76A 5A8YA 2HALA 5ESTE 1QA0A 1TOCB 3CENA 3TH2H 1V2RT 2FS9A 2NU0E 1S6HA 2R3YA 1MTUA 3SGQE 2FI5E 2F3CE 3M5MA 2QC2A 3EGKH 1XUGA 4X1RU 3TH3H 8KME2 1EATA 1KIGH 1T8MA 5HMAA 1OKXA 1KY9A 4WY3A 1C9PA 1O2TA 1S0QA 1DVAH 2XBYA 1JMOH 1QL9A 5DP8A 2HPPH 2JETB 4X1QU 3V12A 3FANA 4O03A 1ZGIA 4E7NA 1O3NA 1A2CH 3CP7A 2AIQA 2EC9H 1SB1H 4ABHA 4KELA 1XX9A 5F03A 3RU4T 2SGAA 1SR5C 1FI8A 1AUJA 1GI9B 1DLEA 1P09A 1SMFE 2FODA 2XW9A 2B8OH 3ZZCA 6ESTA 1O2QA 3SJ8A 3B9FH 3ZVGA 1VGCB 2G8TA 2CF9H 4ZXYH 2EEKA 4BTIB 2ALPA 2HPQH 1V2QT 3A7XA 1GMDF 2H5DA 3TGKE 3UQVA 1GJBB 3KHVA 1TX6A 2VB0A 3EA9A 1EKBB 3MNCA 4ZXXH 1D3QB 4AB8A 3QUMP 1O5CB 1IHTH 1JIMA 4MDSA 4AGKA 1J8AA 4INLA 2C8ZB 1DANH 1P9SA 3FP8E 3PLKA 1PPGE 3GY7A 1BZXE 2F9OA 3H7TA 2B5TB 1AE5A 1O37A 1SGRE 1TFXA 5DP5A 1C5XB 5G4BA 3I78A 2H5CA 3CS0A 2V0BA 5DK1A 1O34A 1O2HA 1ZMLA 3E91A 5EPNA 3SQEE 1TABE 4F4OC 1GJ6A 1TAWA 3T26A 2ZDKA 1TX8A 4GHTA 4WMFA 5LPEA 1DICA 2XCNA 4GUXA 3VB3A 1C4Y2 2VVVA 1K1OA 1SFIA 2FYQA 2ZGJA 1PPZA 1D4PB 5AF9H 1V2TT 4JZDH 2ODYB 1L4ZA 1YKTA 4DT7B 2PTCE 1O2LA 1YLCA 2M5TA 1AWFH 5GWZA 1EAUA 1YC0A 4OS4A 2ZC9H 3M3SA 1ELBA 1QRWA 1GJ8B 3A7ZA 1FMGA 4VGCB 1A4WH 1MD7A 1GDNA 2D1JA 2VIWA 3S9AA 3U8RH 1YGCH 3NK8A 3RLWH 1PPCE 5A0AE 4WWYA 1W7GH 2VIQA 1LVBA 3D23A 3ZV9A 5CMXH 5L2YH 1ELCA 5E0HA 2FESH 2VNTA 3LKWA 4H4FA 3AW1A 4X6OA 2FOCA 1SGEE 4K1TA 3STJA 1HBTH 1FY1A 3A7WA 4Q7YA 2OTVA 2ZFTA 2PV9B 1AVWA 4YM9A 5GIBA 4ZUHA 1J16A 1OSSA 3QX5H 3VB5A 1NTPA 3RUOA 5EW2H 1A0LA 2CF8H 4GCHG 4MQAA 1C2DA 2ZTZA 2BVRH 3UFAA 2ANMH 4HZHA 5F8XA 2F9PA 1RIWB 1TNKA 2JH5D 1KXCA 3ODFA 1C2MA 4D7FA 3SV6A 2SGDE 1O2ZA 5C5OA 2QCYA 1EPTB 1P8VC 4MPWA 1QNJA 1TQ7B 3O8RA 1P3EA 2BZ6H 3GISB 2FM2A 1SGCA 3KNXA 1IHSH 2OQUA 1EZXC 1OWIA 1OYTH 1MQ6A 1DOJA 1O3AA 2G51A 5LH8A 2FWWA 4CRGA 1CA0C 1C5SA 3PO1B 2BMGB 2GDEH 3LGVA 1BJUA 2P3UB 3KEEA 3UWJH 1T8NA 3P8FA 3P8GA 2A4OA 3RU4D 1GBTA 1ELFA 1GCTC 1CT0E 1AE8H 4J2YB 4AOQA 2Q1JA 1ZTLA 4ASHA 9ESTA 1EJNA 1O5AB 1GHBG 3TH4H 2VGCC 5FBIA 4Z6AH 1FUJA 1LQEA 4TWWA 1D3TB 1VITF 1AFQC 1KLTA 2HWLB 1GL0E 3MO9A 1EUFA 1C9TA 1SHHB 1LCYA 2FOEA 4D8NA 2J38A 3OU0A 4ZKNU 4WJG2 3RMMH 2H9TH 1EAXA 3MFJA 2P8OC 1TPSA 2ZDNA 2FEQH 2O8MA 1L1JA 1S6FA 2Z7FE 3JZ1B 1UHBB 2FI3E 3BTHE 1KXFA 4DG4A 3SJIA 2Z6BD 3GY4A 3TLOA 1MKWK 4WMEA 2O8UA 1LMWB 1IQJA 5C1XA 1OYQA 3GY2A 4XFQA 2ZGBH 2GP9B 1O3IA 1ZPZA 2FOFA 1GL1A 2AMDA 3GDVA 1NFUA 4AFQA 1J14A 1V2KT 2ULLA 2P59A 1T8OA 4NGAH 2BD8A 4OS6A 1YCPM 1MTNC 1QY6A 1A3BH 2GX4A 3OTJE 1D6RA 1QA7A 1A5HA 1O3DA 2ZHEH 2IOTA 3MOCA 4FVBA 3SO3A 1L4DA 1O38A 1IQNA 3PWBA 4IC6A 1TA2A 1GBEA 1AFQB 3RXHA 3MI4A 2BLWA 2TPIZ 1P57B 1QQUA 3HK6B 1SSXA 2GCTB 1UVUH 1DXPA 4BAQB 1OS8A 4Y79A 2QGRA 3TJUA 5C20A 1WV7H 1YPKH 3SU2A 1O35A 4UD9H 3ZZDA 1SVPA 1HXEH 3FZDA 1XUKA 2OQ5A 3MH7A 3VXFH 1C5OH 1P01A 1BCUH 1RXPA 3SOSA 3RXLA 2UWLA 2GV6A 2RA0A 2WPKS 4Y7AA 4CR9A 1HV7A 4FU9A 1HAHH 3SNDA 2XXLA 2A7HA 2BQ7B 2OLGA 4FVDA 1AIXH 3ZVDA 2C8YB 4B74A 1FAKH 1JBUH 2PWXA 1GPZA 2VGCB 1AGJA 1QBOA 2FXRA 2ZA5A 1SGFG 1GCTB 3RC6A 1ARCA 2NU2E 4U01A 2V3HH 1HAGE 1OP8A 3FFGA 5DO4H 1F0RA 1SGDE 8GCHG 3A8DA 1XMNB 1C5UA 3ZYDA 1Z1JA 2A7CA 4CRDA 1V2UT 3QN7A 3LC3A 1W8BH 6LPRA 1AVGH 3GY3A 2O8LA 4K60A 4ESTE 2BYAX 1N6YA 1EOLA 3UNRA 2CJIA 3PROA 5EQQA 1BTUA 1C5ZB 1LKAA 1Z71A 1MBQA 2ZGHA 3MTYA 4X1PU 3E0PB 1KSNA 1FV9A 1LPKB 2R0KA 4DVAU 5FAHA 1PYTC 1GI2A 4A5TS 1S85A 1BT7A 4AB9A 1HDTH 4X6MA 1LPGB 3E0NB 5TJXA 3ZZ8A 2QV1A 3LGYA 1G37A 4ZHAA 1D6WA 1Z7KA 3PO1C 1A3EH 1RRKA 1A0HB 4XSKU 4SGBE 1O3LA 1TOMH 1Y59T 4I8JA 2PGBB 1GMHG 2Z9KA 1S0RA 2RCEA 1W3CA 3L33A 4DJZB 1ORFA 1XVOA 2AFQB 3QGNB 4HTCH 4GPGA 2KAIB 4XOJA 3BG4C 1HAOH 4IN2A 3NXPA 1BOQA 5LGOA 1HAVA 2PHBA 2XBWA 3MU4A 2ZWLH 1XKAC 2Z3DA 1BB0B 4WVPE 1O36A 1HB0B 1H1BA 3U1JB 1ETRH 4CBOA 4RKOB 4K69A 3UIRA 3D65E 2XCFA 3LJJA 2XNIA 4KP0A 2FZZA 3DHKH 1LHEH 2GT7A 3AW0A 3A7TA 4ABEA 3VGCC 1NS3A 4UFEH 1DXWA 4NSVA 1LDTT 1OWEA 1SGTA 4INKA 1UTPA 3UWIA 3R0FA 1N1LA 4H6SB 3TK6A 1D3PB 4JZEH 1E37B 4MNVA 1O5BB 1DFPA 1L1NA 3TK9A 1O2UA 2ZDAH 3I29A 3SV9A 3MU5A 3ELAH 4UFGH 4X2VA 1O2NA 2J2UA 1O2VA 2OINA 3DT0H 5ETXA 1GHVH 5EXMA 5FHTA 1FN6A 2A4GA 1YPGH 2ZI2H 1EASA 1G2MA 5JPMH 3DFLA 1Y3XA 1OWJA 2FTLE 5JYIA 5A8ZA 3GYMA 2BQWB 1U6QA 4TY7A 5I25A 3ATLA 1ABJH 2A31A 1VZQH 3MYWA 2VWOA 2NU4E 1C2GA 1QJ1B 2FOHA 2XTTB 3UOUA 4D9QA 3RC5A 2XYAA 1FY4A 5JBAS 3BTEE 4D9RA 4K3JA 3GICB 2Y5HA 3V13A 1NRRH 3M5NA 3MMGA 3RXJA 4AFZA 3SNCA 3RXUA 3S9CA 4D7GA 1P2NA 1Y8TA 3NKKA 1O3MA 1IAUA 1GI7B 3RXBA 3M37A 1WAYB 3W95A 2BY5X 5E0GA 2ALVA 2GZ8A 3A7YA 4MPUA 1UCYH 2SGEE 5HXFA 1P10A 4UFFH 1GJ5H 3GYLB 1BBRK 2J9NA 3P70B 3LJOA 5A2MH 4OS1A 5F8TA 2OUAA 3SNEA 2OBQA 2ZEBA 4F49A 1PPHE 3IG6B 3OY6U 1FPHH 2EI8A 2OC0A 2BLVA 1ABIH 4GAWA 3LH1A 2Z9GA 4X8UH 5C3NA 4B75A 4BAKB 2A32A 1P06A 3C1KA 3TJNA 5IYTA 3SJKA 3URDA 3RXOA 1HJAC 1C2FA 4D76A 3U9AH 2WV4A 4ZHMU 1GBIA 1FJSA