2QN5T

Crystal structure and functional study of the bowman-birk inhibitor from rice bran in complex with bovine trypsin
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bowman-Birk type bran trypsin inhibitor
publication title Crystal Structure and Functional Study of the Bowman-Birk Inhibitor from Rice Bran in Complex with Bovine Trypsin
rcsb
molecule tags Hydrolase inhibitor/hydrolase
total genus 46
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2007-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qn5T01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qn5T02
1C5RA 2BDCA 1O2YA 2FOGA 3S7KB 5PTPA 3V12A 1FNIA 1K1IA 2VGCC 3MO6A 5AF9H 4BTUB 3RMLH 1Z1JA 4U2WA 4ASHA 1JXPA 2SNWA 1V3XA 3RXDA 1HV7A 3SV2H 1THRH 6CHAB 2QXHA 1AFEH 2QXIA 4FUIA 3ZZ9A 3O8RA 3BG4C 1H4WA 1ZHPA 1O2LA 1QB9A 1QRWA 4X6MA 1XKAC 1ANBA 3RMOH 1OX1A 2XCFA 3TJUA 5A0AE 1WTGH 2AMPA 9ESTA 2C90B 1O5EH 1QJ1B 4I8KA 3SJ8A 1A61H 1AVXA 2OC7A 2VH6A 3UNSA 1CA0C 3CS0A 5C5NA 1GJDB 1Z6EA 3GCNA 4B2BA 4UEHH 2JETC 3UIRA 2BMGB 4ABGA 1BQYA 3VGCB 2FOEA 1C5OH 1PQ8A 2A4GA 1O5GH 2G00A 2VVUA 2ASUB 4I31A 5A0CA 1A7SA 3LC5A 1CBWB 1CVWH 1T4VH 1AKSA 1QURH 2VWMA 3QLPH 2A32A 2G52A 4D9QA 1SG8B 1GBFA 1THSH 2FXRA 1EJAA 2XXLA 3K6ZA 1NFYA 1P09A 1C1PA 1HAOH 1KXEA 4WMEA 1F7ZA 4OGXA 2ZU3A 1QCPA 3BTQE 1O2JA 1O39A 1ANEA 2PV9B 5EQRA 1PPBH 1AVWA 4U32A 3P6ZB 3LT3A 1S0RA 1ZSKA 4HTCH 4Y8XA 5E0HA 1LHCH 2ANMH 1GDUA 4JZFH 5EXNA 2IOTA 1G3EA 2ZF0H 1P2IA 1QL9A 1HGTH 4IW4E 3M3TA 3MNCA 1BMLA 1FY4A 3U1JB 2HNTF 2YOLA 1DT2A 1T8OA 1GHAG 5JBTA 1WQVH 4H4FA 1TB6H 3OU0A 4CH2B 2A5IA 2G5NA 3A7WA 3SU2A 3PM3A 1GJ5H 2PGBB 5JB9S 2ANYA 2HLCA 4Y7AA 1A3BH 1ESBA 1MUEB 3UOPA 1N8OC 1VCWA 1NRNH 1XUHA 1C5TA 2EEKA 1P2OA 2BDYA 1NESE 1EB1H 3BTME 5GWZA 1C1OA 1DWCH 1ZMLA 2BLOA 1PPZA 4IMZA 1UTMA 3SUEA 3VB5A 1G3CA 2ZHQH 1TMBH 4ZKNU 1DXWA 4WH8A 2WPJS 1MKXK 4BXSA 1GBKA 2CXVA 3LKWA 4F49A 1OWJA 2ZC9H 2ALVA 2TGDA 5FAHA 1QIXB 2OC0A 3M3VA 4NCYA 1V6DA 1M9UA 1IOEA 1GI1A 2XBYA 4ZKOU 3HGNA 2VWNA 1G37A 1UVPA 1FY5A 3SU5A 1MMJN 1GI5A 3PLBA 3A7VA 3MU0A 1Y3XA 2RA0A 3SJKA 3A7TA 5I46H 1DSUA 2DE9A 1ELDE 2R0KA 5DP7A 1IQKA 2ZKSA 1MKXH 1GI8B 2G4TA 1O3KA 3UY9A 3V0XA 2VVVA 1LVYA 2NWNA 3SNCA 3RC5A 2XWAA 3MH5A 1C2LA 3SUDA 2PTCE 2OD3B 3S0NA 3LGYA 1TNJA 1C1SA 1ZLRA 1BMAA 3RXCA 4MPUA 4IBLH 1H8DH 1TMTH 2XC4A 5C1YA 3KQDA 4MQAA 1O34A 2TGTA 1K1OA 3M7TA 1GBMA 6ESTA 4MNVA 4WXVA 5E8EH 4ZHAA 1A4WH 1O2OA 2GTBA 4NSYA 2PUXB 5EPNA 5F8XA 1O2TA 1A46H 2BLWA 1OWIA 5DKMA 3MH7A 2Z3EA 3TLOA 3SU3A 1O2HA 4YZUA 1G2MA 4YOGA 3ZYDA 1RRKA 3BTHE 2VIPA 1W11U 4O3TA 5FHTA 4ZKRU 1L4ZA 2A45B 4HFPB 1KDQB 2ZGXH 4H42U 5L2ZH 3HPTB 1BJUA 1YP9A 5GXPA 1OOKB 4O9VA 3A8DA 2A1DB 4E7NA 5LPEA 2FTLE 1JRSA 4NZLA 4K8BA 3GCHB 1S6FA 1O3FA 2OCVB 1RGQA 5HM9A 3SU0A 5T6GA 5A8XA 4BTIB 1TWXB 1AB9C 1BBRE 1CHOG 1P03A 3G01A 2HALA 3SHAH 4K3JA 2ZFQH 1LHEH 4MPVA 1P9UA 3GY5A 1IQHA 2H9TH 1EQ9A 1AUJA 1YPLH 2PUQH 2K1QA 3ATMA 1SVPA 1NZQH 2ZFFH 3LGTA 4WXIA 3VXEH 2A7HA 3E16B 2CJIA 1HUTH 1SHYA 2B8OH 2PGQB 1SGQE 5GJ4B 4J2YB 1SQOA 2ALPA 1GBTA 3B8JA 3ELAH 3QDZB 5J4QA 3A80A 1VR1H 2BD2A 1AVGH 1QNJA 1GL0E 2XBWA 1TONA 1T8LA 1H8IH 1V2ST 1V2LT 3S9BA 4NIWA 1MBQA 2XBXA 2FESH 1O3NA 1YPKH 2ZU1A 3RXAA 2ODPA 2FP7B 2ZHFH 1GBDA 3M5LA 5DP9A 1G36A 2BXTH 2WPKS 2QV1A 3S9AA 1TA2A 4AN7A 1BTYA 5HMAA 1GI2A 5CHAB 3LGUA 1AIXH 2A31A 1XKBC 1HJAB 3SUGA 3OSYA 2ODYB 1ETTH 2RA3A 5IYTA 2SGQE 1ARBA 2M5TA 3D23A 1P2QA 1O5FH 4MNYA 4NIYA 3QUMP 4YOIA 4XFQA 3NWUA 3QZQA 2H6MA 5LPRA 3UQVA 1OPHB 1F0TA 1YLDA 4JK6A 4FXGH 1IHTH 1QA0A 1A5HA 1C1NA 1XUIA 3PB1E 1QJ7B 4KP0A 1MH0A 2OBOA 2BY5X 1K22H 4Q80A 2ZGJA 1FIZA 2GMTC 4JCNA 5HXFA 1S83A 1DWBH 1FN8A 2RDLA 3A86A 5DG6A 3LPRA 1GMCF 1XUGA 3LONA 3U9AH 3E6PH 3TNTA 1CT0E 2Y6TA 1O2IA 4TPYA 1A0LA 2GZ7A 4VGCB 1DXPA 1OYTH 1BTPA 1C1QA 1Y5UT 4CH8B 4INLA 5LPFA 1D3DB 2P8OB 2XC5A 1GVLA 1AGJA 1TLDA 1AI8H 2ZQ2A 4K60A 3ZZ6A 1MZAA 3BTGE 2FYQA 3KCGH 3PWBA 3STIA 3MYWA 1TNHA 1P06A 4GUXA 3NZIA 4ZXXH 2FOMB 3ZVGA 2SGPE 3GICB 4B71A 1IQEA 2GT7A 3E0NB 1PPCE 1V2KT 3OY5U 2Z3CA 4MVNA 1UJ1A 1G32B 3SNDA 1EX3A 2ZP0H 4OS6A 1THPB 2VIWA 4WH6A 4X1QU 2Y5HA 4ISNA 1WUNH 4TWYA 3EAJA 4Y0ZE 3V3MA 4NSVA 4FUEA 2F9OA 3M37A 3NUMA 1SLWB 1Z71A 1C1UH 1F0RA 2C3SA 5I25A 2SGFE 2GCTB 4CHAB 4BAMB 5EODA 1GHXH 1TBRH 3L3TA 1NPMA 4IN1A 2GCHF 5C3NA 1H1BA 1SBWA 5TCAA 3SNBA 1MTNB 4X2XA 2BZAA 1DM4B 1SGFA 2BQ7B 4Y7BA 3QO6A 2XW9A 1FUJA 1K1MA 5JBAS 2WINI 3M5MA 4R0IA 1BTWA 1HAVA 1O36A 1A3EH 1GI0A 3FZZA 3M3SA 3V7TA 3VB4A 1C5NH 2DE8A 3VXFH 5K7RA 1MCVA 3TH4H 1OP2A 2AEIH 2AIPA 3A81A 3SNAA 1QGFA 1C2KA 5FBEA 1SL3A 2PKAB 3P8OA 5A8ZA 8GCHF 1C4U2 3K6YA 6LPRA 1SLXB 4CR9A 1GMHF 1MQ6A 2O9QA 1GI9B 1YLCA 3SU4A 3UUZA 2BB4A 3RMNH 1TGSZ 1TALA 1FN6A 2Y5FA 2Y5GA 3SJIA 1SR5C 2Q6FA 1IQMA 1SOTA 4QT8C 1CGJE 3LJJA 8GCHG 2ZCLP 1BRAA 4XSKU 3H7OA 3LH1A 1UCYE 1P2NA 2ZEBA 4B73A 1EATA 4OS5A 2AH4X 2YNBA 1GJ7B 2KAIA 1CA8B 4Q7XA 4X8TH 3A88A 1HXEH 2GV6A 4TYDA 1NRSH 4I8GA 2C8WB 1O31A 4X2WA 1EP6A 4AB9A 2P3FH 4ABBA 1DSTA 3H7TA 1FAKH 1DLKB 5F6MA 4UE7H 2OQ5A 2BYAX 3SV7A 3GY3A 3PO1B 1O2NA 5EXMA 1ELFA 3RC4A 3PLPA 1UK3A 2J9NA 4I8JA 1O3CA 3ZZDA 1P12E 2Z9JA 2UWLA 1ZSLA 1NO9H 1OP8A 1OWHA 5FCRA 2WPIS 1KXDA 2TRMA 4NFEA 5AHGH 3SNEA 1QBOA 2J4IA 3VFEA 1GBEA 3FP6E 1O2UA 4ABDA 4AYVB 1KSNA 2R2MB 1CQQA 1H9LB 3UFAA 2WYGA 4THNH 1DLEA 4NA8A 4DIIH 3MNXA 1W10U 1RJXB 1ZRBA 4B2AA 1KLIH 1DS2E 1UHBA 3E8LA 2NU0E 3IWMA 4JZIA 1TX8A 1QFKH 3AASA 4A92A 3KGPA 1A1RA 1E0FD 1P3EA 3ODDA 2ESTE 2ZFRH 1TNIA 1C2GA 2V3OH 4CRGA 3T2NA 1XX9A 1D3TB 2D8WA 3RLWH 1QR3E 2AMQA 3ZVDA 1QHRB 3BG8A 4Z0KA 1ZRKA 1SLVB 1DY8A 1GG6B 4SGBE 2BD9A 4ABIA 4X2VA 4BNRA 1WBGB 2ODQA 2V35A 3BIVH 3D62A 1UVTH 3MH6A 2W7SA 1P2JA 3I29A 1P02A 7GCHF 2UWPA 1YPJH 3DA9B 4DG4A 1IAUA 1XUJA 3S7HB 4Q7YA 2PLXA 1TFXA 1G30B 4KKDA 1W13U 1XVOA 4GCHG 1IQIA 1GPZA 1UK2A 1MD7A 1LTOA 1QJ6B 1ZOMA 4K5ZA 3C27B 7GCHG 1W7XH 4FU9A 1C2FA 4DW2U 1LCYA 4I33A 3UQOA 1GBCA 1QY6A 3SU1A 1AMHA 1Y59T 1GHWH 1XUKA 4MG3A 1ZSJA 1TBQH 1V2VT 2OLGA 1C5QA 3A8AA 3RXBA 2JH5D 3RXLA 3W95A 2VNTA 2GP9B 1O3HA 1V2TT 1ELTA 1SSXA 2VWLA 2SNVA 1Q3XA 3HKIB 2QF0A 4BOHA 3T28A 1O33A 2BD4A 2IN2A 1KY9A 2QF3A 1E36B 1EZUC 3QK1A 3RXRA 2XRCA 5ABWA 2HWLB 3SGQE 1HAYB 2JKHA 1J16A 3TPIZ 3ZVBA 4DCDA 1L4DA 1XUFA 3AW1A 1WCZA 4D76A 3RU4T 5SGAE 3MFJA 1NM6A 4I8LA 1AFQB 3UNQA 1O37A 2BD7A 4NA7A 3SJOA 3OTJE 4AX9H 1LHDH 3KL6A 4Y71A 1GBAA 1O3AA 1HDTH 3KF2A 1GJ8B 1TQ7B 3T25A 4JZDH 3KQBA 1BA8B 2G8TA 3F9GA 3LGVA 3SGBE 5FXLA 2F9UA 1TABE 3NPSA 1EUFA 1BTZA 3TK9A 3K65B 1FPHH 1GHAF 1NC6A 1TOMH 5DP8A 4B74A 2ZGCA 4KTUA 1TX7A 1DUEA 5BPEA 2BVXH 1OYQA 1JWTA 1B0EA 3GOVB 1S0QA 1O2PA 2R9PA 1IHSH 4FU7A 1GMDF 1HAHH 3LC3A 2CGAA 2ZCKP 1N1LA 1UK4A 3U1IB 3M5NA 3N7OA 1XXFA 1FY3A 1YYY1 1C5VA 4X2YA 2PKSC 4K1SA 1GVKB 1GMDG 3T27A 3L33A 3PMBB 1VGCB 2PSXA 3BEUA 2P95A 3MU1A 3ATWA 3U8RH 2VH0A 2CHAC 1DDJA 2ZI2H 1GJ4H 3O8CA 3GY4A 3ITIA 4JZ1A 1ELEE 5L30H 1GGDB 2R3YA 2O8TA 1LPGB 3VEQB 2GVFA 4MTBA 1EOJA 1TPAE 4XBBA 8LPRA 4AG2A 4NG9H 1GWAA 3MO3A 4INKA 3P92A 4IMQA 1P04A 1ZGIA 2LNCA 5DO4H 3Q77A 3K2UA 4XBCA 4MNXA 4ZHLU 1GCDA 2QYIA 3TGKE 5E0JA 4YLQH 2ZHWH 3F9FA 2ZQ1A 4X6PA 1YPMH 1LVBA 3A89A 2GKVE 4KGAA 2XNIA 1C5UA 3UWIA 2W7UA 5ESBA 1YPGH 5AVDA 3P17H 4X8SH 1SGCA 8ESTE 1Z8JB 2BOKA 1Q2WA 2F9BH 1FZZA 5FPYA 1SQTA 3KN2A 3FAOA 1QQUA 4OS1A 1BIOA 2BD5A 5A8YA 4TY6A 3SU6A 4DT7B 2C4FH 4JYVH 1O2VA 1OP0A 2ZIQH 3P8GA 1V2OT 1NFXA 3MMGA 2Y7ZA 2ZU4A 2ZU5A 3A82A 3SQEE 3SV6A 3U69H 1J15A 1BZXE 2ZTZA 2SGEE 3GYMA 5C2ZA 2ZDAH 1LQEA 1C9TA 1SGTA 2J34A 1GBBA 4NZQA 2H9HA 1NN6A 2ILNA 3A84A 1YPHE 1AWHB 1CU1A 1RXPA 1KIGH 2F91A 1TMUH 3SN8A 1O2QA 1GHBF 1IQJA 1ELCA 1BB0B 3A8BA 1K2I1 1WOFA 2FOHA 2P59A 2VB0A 5FCKA 1W3CA 3ZZ7A 1HJ9A 1NY22 3O8DA 1SI5H 1UMAH 1YCPK 1C4Y2 2HNTE 4R8TB 3DFJA 1EOLA 1DX5M 1EPTC 5GCHG 3AAVA 1YBWA 1GHBG 1TGBA 1H9IE 1WV7H 1KLTA 3I78A 1V2WT 2G5VA 5FPTA 1WAYB 4B2CA 3RDZA 2OC1A 3MU5A 3ZVCA 4YT7H 1RIWC 1DE7H 2HPQH 1HIAB 2ZPRA 4OGYA 4ESTE 4DOQA 1YCPH 1CHOF 1FAXA 3SV9A 2J92A 1GBJA 5F8ZA 3AVZA 1O3BA 5FBIA 2BDIA 1Y8TA 1KXBA 3ZZAA 3OY6U 1ZTKA 2JH6D 3RXIA 1PQ7A 1ANDA 6GCHF 2WYJA 2VGCB 3P8NA 1C1VH 4HGCA 1MU6B 1NRQH 1BUIA 1LHGH 5JYIA 2Q1JA 2Y7XA 3LDXH 5ETXA 4A1TA 5A09A 1TA6A 3BG4B 2G51A 2UUKB 4FUGA 2J94A 1GHYH 1F2SE 3UR9A 2I6QA 6GCHG 1PFXC 3B23B 1JRTA 1KXAA 4GAWA 4YO9A 3UNRA 2ANWA 1GI4A 3MNBA 4WF8A 4ZHMU 3SUFA 4BAKB 8KME2 1HAXB 3TH3H 5L6NH 3RC6A 1SGNE 1MTUA 1O3JA 1CA0B 2OXSA 3URCA 4UFDH 1VCQA 3PWCA 1SGDE 4CRBA 4B75A 4BTTB 2FS9A 2JETB 2ZGBH 3MHWU 4A7IB 3BTTE 1O2KA 3GCTG 1K1JA 2ZFSA 4MLFB 2A4QA 1ZPBA 1ELAA 3SI3H 1Z8IB 2BM2A 2PTNA 1NRPH 4YOJA 4K1TA 3ODFA 4FU8A 4AFSA 2BY8X 3NK8A 1VITH 4I32A 3S9CA 3B9FH 1BRBE 4K69A 3TJOA 1CT4E 3QN7A 4AGKA 1OWKA 3GY6A 2B9LA 5EXLA 3SV8A 3JZ2B 4LOYH 2FWWA 1JMOH 1LDTT 1MTWA 1O2MA 3GISB 1KYNA 3LJOA 1Z1IA 4ABFA 2GZ8A 1NTPA 2FLBH 1GCTC 3RXJA 2CN0H 1HYLA 3RXVA 4ZMAH 5E2PA 2QGRA 1AD8H 1D9IA 3PV4A 3SO3A 1U6QA 2H2ZA 4CR5A 1GJAB 4D7FA 4X1SU 2THFB 2G81E 4MNWA 3A7XA 1HFDA 5E0GA 3FVFB 1NFUA 3HGPA 2TPIZ 1ZMNA 4NIVA 3EGKH 3QX5H 2QN5T 3BTFE 1EZQA 1G3BA 1O5DH 1SGPE 2TIOA 3TVJB 1B0FA 1OS8A 3ZZ3A 3R3GB 3T29A 1BHXB 4X1PU 2CV3A 6CHAC 2F9VA 1EP5A 1K1LA 2J2UA 1HAGE 2QIQA 4ABAA 1N8OB 4BAQB 3P8FA 4CRFA 2JH0D 1GBHA 3HK6B 1UTLM 3KHVA 3LIWA 4YT6H 4A5TS 3ZYEA 3ATKA 1DICA 3BSQA 1BBRK 1HAVB 2BOHB 2QY0B 2PSYA 2PWXA 1UVUH 1GJ6A 1UO6A 2FI5E 1A0JA 4NWLA 1AHTH 2QCYA 1V2RT 1Y5AT 1LVMA 3ENSB 5HM2A 4WY3A 2RG3A 3TGJE 1C1MA 1SMFE 3E91A 2ZFTA 2EC9H 3D65E 1NU7B 3PLKA 2Z3DA 3SHCH 1SFIA 4A1VA 1S85A 1T7CA 2ZDMA 4U01A 1KXCA 1FIWA 2VJ1A 3SI4H 1BBRH 2XC0A 2ZU2A 3VGCC 3BV9B 1ZGVA 1PJPA 1C2EA 2ANKH 5K0HA 3PROA 1CBWC 4UDWH 4F4OC 4DVAU 4CBOA 4AFZA 1DANH 1TAWA 1G9IE 1HAZB 2A2QH 2FX6A 4FVBA 1L1NA 1TRYA 3ZVAA 2KAIB 1SGYE 4ABHA 3QGJA 4AZ2B 2C8YB 4Y11E 2C8XB 2TGAA 2V0BA 1AE8H 3RXFA 3TGIE 2SFAA 3LOXA 3ZV8A 2W26A 3DD2H 3M36A 4BAOB 2ULLA 3M7UA 7KMEH 4CBNA 5EGMA 1QTFA 3UWJH 2BDAA 2A2XH 5FX5A 5BRRE 4B76A 1XVMA 5T6DA 5ESTE 3UREA 2WUCA 1FJSA 3UTUH 3EA9A 2OP9A 3M7QA 4JMYA 1LQDB 3P95A 2D2DA 3RXSA 4ISOA 4HZHA 1TIOA 2Z9KA 5JBCS 2GX4A 2AGEX 4RKOB 4CRDA 1A5GH 3TK6A 5DJ7A 5GDSH 2GV7A 2EI8A 3PMAB 2A4RA 1V2PT 2EA3A 2Z9GA 3SBKA 1JBUH 1LMWB 1QRZA 2FM2A 2BLVA 3MOCA 5EU8A 3ZVFA 1YCPM 1EAWA 1BOQA 2TGPZ 1RTLA 3ZZCA 4TY7A 1EZSC 4BANB 1SB1H 5IDKA 1B5GH 4J1YA 3TH2H 4Y8YA 4GVUA 4MPXA 1UHBB 1AB9B 2ZPSA 3RXUA 2AGGX 4X0WU 2OINA 2UUFB 1EPTA 5DGJA 2BDBA 3BN9A 1L1GA 3KNXA 1E38B 1W0ZU 2PKAA 1OKXA 1BTXA 4M7GA 1ACBE 1ZTLA 2BVSH 2B5TB 3UPEA 1TNGA 3NCLA 1ABIH 4FUHA 4WWYA 2IJOB 3HK3B 1T31A 2H5DA 2A4OA 1H9HE 3M5OA 4SGAE 1HBTH 1L1JA 5JPMH 3V13A 2QAAA 1A2CH 1EASA 2FZZA 4ABJA 3FFGA 2V6NA 1AZ8A 3E0PB 1WYKA 1NROH 1HNEE 2WUBA 1QQ4A 1MD8A 2ZTYA 2W3IA 4ZH8A 3A8CA 1GL1A 2H1UA 4CRAA 1C5SA 3TIUA 1GI6A 1BMMH 1P2MA 1O3GA 1C5YB 2FLRH 1EXFA 3DUXH 5EOKA 1B7XB 5CE1A 1O3DA 3TK5A 4JYTA 1PYTD 2AGIX 2P3TB 4GCHF 1QBNA 1QB6A 1CE5A 1K1PA 1DOJA 1OWEA 3SQHE 2R2WU 1LPZB 1RTKA 2BX3A 1J8AA 1SPJA 2GMTB 4AG1A 1MZDA 1LKAA 1JIRA 3MU8A 1ESTA 7LPRA 2BX4A 2WPLS 1GBLA 3U98H 1UCYK 1GDNA 2ZHEH 1QL7A 1SGIB 1AKSB 4I7YH 4GSOA 4ZROA 2ZA5A 4XDEA 1HAPH 1ELVA 1TPSA 3GCHC 2CF9H 3Q3YA 2QC2A 1VCPA 4LZ4B 5F03A 1F0UA 2WV5A 1WU1A 1J17T 1C2DA 1E35B 1LKBA 4WMDA 4ISIH 1Q31A 1BJVA 3LH3A 2AERH 2F3CE 2QXGA 1E34B 2VU8E 1PQ5A 1SFQB 2STBE 3KQEA 1P01A 1QRXA 1C5ZB 1LHFH 1AE5A 2ZGHA 3F9EA 2BXUH 1AZZA 5JBBS 3RXKA 1UCYH 2BVRH 1O2XA 1V2UT 1O5BB 3SORA 2UWOA 1BTHH 4FUCA 2ZPQA 7ESTE 4O97A 1EAXA 5G4BA 1Z8GA 3UOUA 4ISLA 1EZXC 4JZEH 2F9NA 3GCOA 1P9SA 2FI3E 4HI3A 1ORFA 3DHKH 2O8MA 5CMXH 4IS5A 4NA9H 1Z6JH 1TRMA 1VITF 4LZ1H 1HB0B 3MU4A 4NWKA 2TBSA 4DY7B 1YC0A 2AIQA 2CMYA 1DVAH 5T3HA 3SOSA 1GHVH 3E90B 1X7AC 1VITG 2XCNA 3IG6B 4GHQA 4KTCA 1K1NA 4TWWA 5CHAC 3HKJB 4UFGH 1HJAC 3EA7A 1JOUB 5C1XA 2AMDA 1RD3B 3CENA 3ZVEA 2B7DH 4KTSA 1ETSH 3E3TA 1SHHB 3Q3KA 1BMNH 4FVDA 1YPHC 3PTBA 3ZZBA 1UVOA 5C20A 2EI6A 4IN2A 2R0LA 3LU9B 3S69A 2ZG0H 1VJAU 3MI4A 2A7JA 3MH4A 1FY8E 1O2WA 2AS9A 5TJXA 1GBIA 1ID5H 1P8VC 2BHGA 1WTHD 5H4IB 4ABEA 3A7ZA 2HNTC 1FY1A 1LO6A 4Y76A 4X8VH 3EDXB 1HRTH 1HCGA 3T5FH 1F5RA 4OS7A 1O2SA 2FS8A 3ATIA 4FUJA 1BHXF 4NIXA 1O5CB 1G3DA 2QA9E 2XBVA 5HYOA 3RXEA 1HAIH 3AAUA 1LPKB 1YM0A 2Q6DA 4VGCC 5DP4A 3RXGA 3NKKA 5EQQA 1WSSH 1K9OE 2FYRA 4RN6A 1FPCH 3U8TH 2D1JA 4ZKSU 4PROA 2P8OC 1C5XB 2LPRA 1FXYA 1SGFG 3QGNB 4UD9H 3SZNA 1KXFA 4H6SB 1C2MA 1FDPA 4TPIZ 5HGGA 4AORA 3EYDA 2C93B 1S81A 3EE0B 2CF8H 2UUJB 1ELGA 1PQAA 2BQWB 3TU7H 3PYHA 5L2YH 3MNSA 1HJ8A 1O0DH 2FOBA 2AYWA 3RXMA 3CS7A 1W8BH 3ZZ5A 2BDHA 1SLUB 3TITA 4IC6A 1XXDA 3BTEE 1FONA 2GCTC 4BAHB 1O32A 4CHAC 2VVCA 1MCTA 1UTOA 5EQSA 4ISHH 4IGDA 1ESAA 1MTNC 3BF6H 2J38A 2BY9X 1K21H 2O8WA 3VB6A 5GCHF 3KEEA 3KIDU 4H6TA 1GVZA 4XBDA 1IQNA 1EAUA 1EKBB 2OQUA 3E1XB 2BDGA 1EJNA 1YF4A 1P57B 1ZR0A 1P2KA 3M35A 1TPPA 4CREA 3URDA 1Y3UA 1TNKA 2OC8A 2GZ9A 4DURA 1O3MA 1UTPA 3I77A 3K9XB 2R3UA 1V2MT 1D6WA 3RXTA 3WY8A 2ZFPH 1C2IA 1C5WB 3RUOA 2DUCA 2PR3A 2VIQA 4YLUA 1A5IA 2ZHDA 2BY6X 2NU2E 3W94A 5FPSA 5JDUB 2ZDLA 2Y82A 3FP7E 4Y79A 4X6OA 1NFWA 3TJNA 1Y3WA 1GI3A 3VB7A 1ZJKA 5C5OA 4Z6AH 1FV9A 1TBZH 3OX7U 1XMNB 1N6YA 1BTUA 1ETRH 1O38A 2FOAA 2I6SA 3P70B 1RS0A 2BTCE 2GD4B 1O5AB 9LPRA 5B6OA 2H5CA 4WMFA 4A1XA 1O35A 2WPHS 3UR6A 1SQAA 2BY7X 1PPEE 4OS4A 1HLTH 5JB8S 2ZTXA 1UTKA 2XTTB 1C9PA 2VINA 2PHBA 4AFUA 4ZUHA 5DK1A 1MTSA 3PO1C 3ZV9A 3GCTF 5J4SA 2G55A 2FODA 1ZZZA 1MKWK 2VIOA 1PPGE 3ATLA 3O8BA 4X1RU 3SW2B 1C4V2 1ABJH 2BD3A 3JZ1B 1P10A 3PMJA 1KDQA 2P16A 2SGDE 3H5CB 2PFEA 3GDUA 1CO7E 1GDQA 1SOZA 4Q7ZA 4FUFA 1HIAA 3F6UH 2NU3E 1AUTC 3NXPA 1OXGA 3TNSA 2FPZA 4IC5A 5LH8A 3R0FA 2BD8A 1UTQA 1MKWH 3BIUH 4AB8A 3MWIU 5AFZH 1ZHMA 1C1RA 2NU4E 4I8HA 1NU9A 2ZO3H 4O3UA 2HPPH 3PTNA 1C5PA 4YM9A 1O30A 1Y5BT 4NFFA 1G2LA 1MTVA 4LXBH 1AWFH 1AU8A 1F0SA 1ANCA 1V2NT 2EI7A 2GGVB 4X6NA 4AGJA 1EJMA 1VZQH 1ZPZA 2OUAA 2ZCHP 1DWEH 4BXWA 4D7GA 2J95A 1O2GH 1C2JA 4A6LA 1CSOE 1BITA 2HOBA 1NT1A 2AFQB 2FDAA 2WPMS 1T32A 2W3KA 4ZXYH 1F92A 5T6FA 2FO9A 1GG6C 1BRCE 2G4UA 3SGAE 2F9PA 3BTWE 3A7YA 1UTNA 1ARCA 2Q6GA 1W14U 2PKSB 2XYAA 3GY7A 4UONA 3QZRA 4WJG2 4NGAH 1ZYOA 1QA7A 3PMHB 3T26A 4K2YA 3RXOA 3VB3A 2SGAA 1O2ZA 2CHAB 3HATH 1TGCA 2Z9LA 1BRUP 1FLEE 1TRNA 1HXFH 2P3UB 2UUYA 4YTAA 1T8MA 1KTTB 1ZHRA 1PPHE 3ESTA 1C5LH 1V2QT 2H9EH 5E2OA 3T62A 2BZ6H 3QTOH 3RU4D 1MU8B 1GHZA 1HPGA 1UTJA 1DUAA 2VWOA 5A2MH 2A5AA 3IITA 4MPWA 4X1NU 1YKTA 3GY2A 1FQ3A 1W7GH 3AW0A 2BQ6B 2STAE 2C8ZB 4D8NA 1GMCG 1RTFB 1QL8A 3RXHA 1O3EA 4YESB 2YNAA 4UFEH 1EAIA 3BTKE 2ZDKA 3EQ0H 2FOCA 1RFNA 2B0FA 1BDAA 4O03A 1INCA 2ZDVH 3LGIA 2D26C 4XE4A 3QWCH 2NU1E 1BCUH 4WVPE 2FEQH 1FMGA 1ZTJA 1C1TA 1KLJH 1D4PB 1AFQC 1NRRH 3F9HA 1GJ9B 4Y10E 5C67A 1TYNA 1W0YH 3FZDA 1ZPCA 5DP3A 1S6HA 4FUBA 1MQ5A 5EG4A 1TGTA 4DIHH 1J14A 4Y0YE 1WQSA 1KTSB 1GJBB 2Z7FE 2ZECA 5DPAA 1E37B 1O3PB 3VPKA 2VIVA 1L2EA 1CHGA 1S84A 3GDVA 2A5KA 2W5EA 2Y80A 3RM2H 1F5KU 4Y6DA 1DITH 1OWDA 2GCHG 3F1SB 1ZMJA 1T8NA 4U30A 2WV4A 1W2KH 2ZZUH 1T4UH 2A0QB 1EPTB 3CP7A 3OYPA 4GPGA 4GLYA 1O2RA 3A87A 1GI7B 1DY9A 4KELA 1AY6H 1O3IA 5DP6A 3Q3XA 1Y3VA 1V2JT 3GY8A 4AYYB 1VGCC 3EA8A 1AO5A 1C2HA 1IQLA 1QBVH 1RIWB 2ZNKH 5LGOA 2V3HH 1P3CA 1J9CH 4RKJB 4AOQA 1MAYA 4ZAEA 3Q76A 2HRVA 4AFQA 3RU4E 3F68H 1GGDC 1A0HB 3GDSA 4E06H 4K1EA 2FI4E 1CGIE 1GMHG 3DFLA 1BT7A 1SC8U 1ELBA 1TOCB 2XWBI 4INHA 3D49H 1IQFA 1TGNA 1Z7KA 1NS3A 3BEFB 5A0BA 5EW1H 3C1KA 3A85A 4E05H 4RSPA 4Y8ZA 2IPHA 3L6PA 2GDDA 1C5MD 2FX4A 1GJCB 5GIBA 2ZWLH 3MO9A 1F5LA 1N6XA 1VJ9U 4Q2KA 2P93A 4FUDA 4XOJA 1LVOA 4MDSA 3RMMH 1L0ZA 4GHTA 4OS2A 3A83A 4D9RA 1FI8A 3QTVH 2HGTH 1TX6A 1TNLA 5FX6A 1D3QB 3FANA 3MTYA 5AFYH 4LK4A 1SGEE 2FOFA 3RM0H 2OTVA 1TQ0B 1W12U 2OBQA 3TJVA 5TCCA 4UFFH 2A7CA 1CT2E 1P05A 5DP5A 1S82A 3ZZ4A 2GDEH 4DJZB 3Q00A 2RCEA 4K8YA 1D6RA 4CRCA 5EW2H 3BEIB 2F83A 1YPEH 1TPOA 2PW8H 3RXQA 1CGHA 1S5SA 1MBMA 4DGJA 1O3LA 2Y81A 2O8UA 3KQCA 3U8OH 1PPFE 5EPYA 2QXJA 3BTDE 2FMJA 1P11E 1QB1A 1C1WH 1Z8RA 1MAXA 3FP8E 3STJA 2GT8A 5F8TA 1OSSA 1SGRE 3RP2A 1TE0A 3GYLB 3RXPA 2BLQA 1DWDH 1UVSH 3M61U 1DFPA 2Z94A 4JYUH 4X8UH 3RLYH 1YGCH 1AN1E 3SJ9A 1EB2A 1XM1A 5GPIB 1Y3YA 1PYTC 4JK5A 1GCTB 2Z6BD 1D3PB 1K28D 2FIRH 2VIDA 2P94A 4B1TA 1IQGA 3LGWA 1JIMA 4E7RG 1DPOA 2HVXA 1P0SH 2Z9IA 1ZJDA 2FTMA 1O3OA 3DT0H 1AQ7A 5C1UA 2ZDNA 2O8LA 3ZZ8A
chains in the Genus database with same CATH superfamily
1C5RA 2BDCA 1O2YA 2FOGA 3S7KB 5PTPA 3V12A 1FNIA 1K1IA 2VGCC 3MO6A 5AF9H 4BTUB 3RMLH 1Z1JA 4U2WA 4ASHA 1JXPA 2SNWA 1V3XA 3RXDA 1HV7A 3SV2H 1THRH 6CHAB 2QXHA 1AFEH 2QXIA 4FUIA 3ZZ9A 3O8RA 3BG4C 1H4WA 1ZHPA 1O2LA 1QB9A 1QRWA 4X6MA 1XKAC 1ANBA 3RMOH 1OX1A 2XCFA 3TJUA 5A0AE 1WTGH 2AMPA 9ESTA 2C90B 1O5EH 1QJ1B 4I8KA 2LP6A 3H09A 2WPDD 3SJ8A 1A61H 1AVXA 2OC7A 2VH6A 3UNSA 1CA0C 3CS0A 5C5NA 1GJDB 1Z6EA 3GCNA 4B2BA 4UEHH 2JETC 4Q63A 3OFND 3UIRA 2BMGB 4ABGA 1BQYA 3VGCB 2FOEA 1C5OH 1PQ8A 2A4GA 1O5GH 2G00A 2VVUA 2ASUB 4I31A 5A0CA 1A7SA 3LC5A 1CBWB 1CVWH 1T4VH 1AKSA 1QURH 2VWMA 3QLPH 2A32A 2G52A 4D9QA 1SG8B 1GBFA 1THSH 2FXRA 1EJAA 2XXLA 3K6ZA 1NFYA 1P09A 1C1PA 3UAIC 1HAOH 1KXEA 4WMEA 1F7ZA 4OGXA 2ZU3A 1QCPA 3BTQE 1O2JA 1O39A 1ANEA 2PV9B 5EQRA 1PPBH 1AVWA 4U32A 3P6ZB 4I86A 3LT3A 1S0RA 1ZSKA 4HTCH 4Y8XA 5E0HA 1LHCH 2ANMH 1GDUA 4JZFH 5EXNA 2IOTA 1G3EA 2ZF0H 1P2IA 1QL9A 1HGTH 4IW4E 3M3TA 3MNCA 1BMLA 1FY4A 3U1JB 2HNTF 2YOLA 1DT2A 1T8OA 1GHAG 5JBTA 1WQVH 5T1VA 4H4FA 1TB6H 3OU0A 4CH2B 2A5IA 2G5NA 3A7WA 3SU2A 3PM3A 1GJ5H 2PGBB 5JB9S 2ANYA 2HLCA 4Y7AA 1A3BH 1ESBA 1MUEB 3UOPA 1N8OC 1VCWA 1NRNH 1XUHA 1C5TA 2EEKA 1P2OA 2BDYA 1NESE 1EB1H 3BTME 5GWZA 1C1OA 1DWCH 1ZMLA 2BLOA 1PPZA 4IMZA 1UTMA 3SUEA 3VB5A 1G3CA 2ZHQH 1TMBH 4ZKNU 1DXWA 4WH8A 2WPJS 1MKXK 4BXSA 1GBKA 2CXVA 3LKWA 3GS9A 1OWJA 2YMSC 4F49A 2ZC9H 2ALVA 2TGDA 5FAHA 1QIXB 2OC0A 3M3VA 4NCYA 1V6DA 1M9UA 2RFKC 1IOEA 1GI1A 2XBYA 4ZKOU 3HGNA 2VWNA 1G37A 1UVPA 1FY5A 3SU5A 1MMJN 1GI5A 3PLBA 3A7VA 3MU0A 1Y3XA 2IPQX 2RA0A 3SJKA 3A7TA 5I46H 1DSUA 2DE9A 1ELDE 2R0KA 5DP7A 1IQKA 2ZKSA 1MKXH 1GI8B 2G4TA 1O3KA 3UY9A 3V0XA 2VVVA 1LVYA 2NWNA 3SNCA 3RC5A 2XWAA 3MH5A 1C2LA 3SUDA 2PTCE 2OD3B 3S0NA 3LGYA 1TNJA 1C1SA 1ZLRA 1BMAA 3RXCA 4MPUA 4IBLH 1H8DH 1TMTH 2XC4A 5C1YA 3KQDA 4MQAA 1O34A 2TGTA 1K1OA 3M7TA 1GBMA 6ESTA 4MNVA 4WXVA 5E8EH 4ZHAA 1A4WH 1O2OA 2GTBA 4NSYA 2PUXB 5EPNA 5F8XA 3OEED 1O2TA 1A46H 2BLWA 1OWIA 5DKMA 3MH7A 2Z3EA 3TLOA 3SU3A 1O2HA 4YZUA 1G2MA 4YOGA 3ZYDA 1RRKA 3BTHE 2VIPA 1W11U 4O3TA 5FHTA 4ZKRU 1L4ZA 2A45B 4HFPB 3PV2A 1KDQB 2ZGXH 4H42U 5L2ZH 3HPTB 1BJUA 1QZ8A 1YP9A 5GXPA 1OOKB 4O9VA 3A8DA 2A1DB 4E7NA 1SKYE 5LPEA 2FTLE 1JRSA 4NZLA 4K8BA 4FOUC 3GCHB 1S6FA 1O3FA 2OCVB 2QE7D 1RGQA 5HM9A 3SU0A 5T6GA 5A8XA 4BTIB 1TWXB 1AB9C 1BBRE 1CHOG 1P03A 3G01A 2HALA 3SHAH 4K3JA 2ZFQH 1LHEH 4MPVA 1P9UA 3GY5A 1IQHA 2H9TH 1EQ9A 1AUJA 1YPLH 2PUQH 2K1QA 3ATMA 1SVPA 1NZQH 2ZFFH 3LGTA 4WXIA 3VXEH 2J98A 2A7HA 3E16B 2CJIA 1HUTH 1SHYA 2B8OH 2PGQB 1SGQE 5GJ4B 4J2YB 1SQOA 2ALPA 1GBTA 3B8JA 3ELAH 3QDZB 5J4QA 3A80A 1VR1H 2BD2A 4ACBA 1AVGH 1QNJA 1GL0E 2XBWA 1TONA 1T8LA 1H8IH 1V2ST 1V2LT 3S9BA 4NIWA 1MBQA 2XBXA 2FESH 1O3NA 1YPKH 2ZU1A 3RXAA 2ODPA 2FP7B 4XD7D 2ZHFH 1GBDA 3M5LA 5DP9A 1G36A 2BXTH 2WPKS 2QV1A 3S9AA 1TA2A 4AN7A 1BTYA 5HMAA 1GI2A 5CHAB 3LGUA 1AIXH 2A31A 1XKBC 1HJAB 3SUGA 3OSYA 2ODYB 2WV9A 1ETTH 2RA3A 5IYTA 2SGQE 3F2FA 1ARBA 2M5TA 3D23A 1P2QA 1O5FH 4MNYA 4NIYA 3QUMP 4YOIA 4XFQA 3NWUA 3QZQA 2H6MA 5LPRA 3UQVA 1OPHB 1F0TA 1YLDA 4JK6A 4FXGH 1IHTH 1QA0A 1A5HA 1C1NA 1XUIA 3PB1E 1QJ7B 4KP0A 1MH0A 2OBOA 2BY5X 1K22H 4Q80A 2ZGJA 1FIZA 2GMTC 4JCNA 5HXFA 1S83A 1DWBH 1FN8A 2RDEA 2RDLA 3A86A 5DG6A 3LPRA 4OM9A 1GMCF 1XUGA 3LONA 3U9AH 3E6PH 3TNTA 5KEDA 1CT0E 2Y6TA 1O2IA 4TPYA 1A0LA 2GZ7A 4VGCB 2XOKD 3W1EA 1DXPA 1OYTH 1BTPA 2W6ID 1C1QA 1Y5UT 4CH8B 4INLA 2LELA 5LPFA 1D3DB 2P8OB 2XC5A 1GVLA 1AGJA 1TLDA 1AI8H 2ZQ2A 4K60A 3ZZ6A 1MZAA 3BTGE 2FYQA 3KCGH 3PWBA 3STIA 3MYWA 2HVYB 1TNHA 1P06A 4GUXA 3NZIA 4ZXXH 2FOMB 3ZVGA 2SGPE 3GICB 4B71A 1IQEA 2GT7A 1BMFD 3E0NB 1PPCE 1V2KT 4P02A 3OY5U 2Z3CA 4MVNA 1UJ1A 1G32B 3SNDA 1EX3A 2ZP0H 4OS6A 1THPB 2VIWA 4WH6A 4X1QU 2Y5HA 4ISNA 1WUNH 4TWYA 3EAJA 4Y0ZE 3V3MA 2VBCA 4NSVA 4FUEA 2F9OA 3M37A 3NUMA 1SLWB 1WDIA 1C1UH 1F0RA 1Z71A 2C3SA 5I25A 2SGFE 2GCTB 4CHAB 4BAMB 5EODA 1GHXH 1TBRH 3L3TA 1NPMA 4IN1A 2GCHF 5C3NA 1H1BA 1SBWA 5TCAA 3SNBA 1MTNB 4X2XA 2BZAA 1DM4B 1SGFA 2BQ7B 4Y7BA 3QO6A 2XW9A 1FUJA 1K1MA 5JBAS 2WINI 3M5MA 4R0IA 1BTWA 1HAVA 1O36A 1A3EH 1GI0A 3FZZA 3M3SA 3V7TA 3VB4A 1C5NH 2DE8A 3VXFH 5K7RA 1MCVA 3TH4H 1OP2A 2AEIH 2AIPA 3A81A 3SNAA 1QGFA 1C2KA 2KZ4A 5FBEA 1SL3A 2PKAB 3P8OA 5A8ZA 8GCHF 1C4U2 2XNDD 3K6YA 6LPRA 1SLXB 4CR9A 1GMHF 1MQ6A 2O9QA 1GI9B 1YLCA 3SU4A 3UUZA 2BB4A 3RMNH 1TGSZ 1TALA 1FN6A 2Y5FA 2Y5GA 3SJIA 1SR5C 2Q6FA 1IQMA 1SOTA 1EFRD 4QT8C 1CGJE 3LJJA 8GCHG 2ZCLP 3FO8D 1BRAA 4XSKU 3H7OA 3LH1A 1UCYE 1P2NA 2AHME 2ZEBA 4B73A 1EATA 4OS5A 2AH4X 2YNBA 1GJ7B 2KCOA 2KAIA 1CA8B 4Q7XA 4X8TH 3A88A 1HXEH 2GV6A 4F55A 4TYDA 2F43B 3SZEA 1NRSH 4I8GA 2C8WB 1O31A 4X2WA 2JJ1D 1EP6A 4AB9A 2P3FH 4ABBA 1DSTA 3H7TA 1FAKH 1DLKB 5F6MA 4UE7H 2OQ5A 2BYAX 3SV7A 3GY3A 3PO1B 1O2NA 5EXMA 1ELFA 3RC4A 3PLPA 1UK3A 4FETA 2J9NA 4I8JA 1O3CA 3ZZDA 1P12E 2Z9JA 2UWLA 1ZSLA 1NO9H 1OP8A 1OWHA 5FCRA 2WPIS 1KXDA 2TRMA 4NFEA 5AHGH 3SNEA 1QBOA 2J4IA 1SQRA 3VFEA 1GBEA 2PP6A 3FP6E 1O2UA 4ABDA 4AYVB 1KSNA 2R2MB 1CQQA 1H9LB 3UFAA 2WYGA 4THNH 1DLEA 4NA8A 4DIIH 3MNXA 1W10U 5C94A 1RJXB 1ZRBA 2WZQA 4B2AA 1KLIH 1DS2E 1UHBA 5HKKD 3E8LA 2NU0E 3IWMA 4JZIA 1TX8A 1QFKH 3AASA 4A92A 3KGPA 1A1RA 1E0FD 1P3EA 3ODDA 2ESTE 2ZFRH 1TNIA 1C2GA 1E79D 2V3OH 4CRGA 3T2NA 1XX9A 1D3TB 2D8WA 3RLWH 1QR3E 2AMQA 3ZVDA 1QHRB 3BG8A 5EJZA 4Z0KA 1ZRKA 1SLVB 1DY8A 1GG6B 4SGBE 2BD9A 5EJLA 4ABIA 4X2VA 4BNRA 1WBGB 2ODQA 2V35A 3BIVH 3D62A 1UVTH 3MH6A 2W7SA 1P2JA 3I29A 1P02A 1YLNA 7GCHF 2UWPA 1YPJH 3DA9B 4DG4A 1IAUA 1XUJA 3S7HB 4Q7YA 2PLXA 1TFXA 1G30B 4KKDA 1W13U 1XVOA 4GCHG 1IQIA 1GPZA 1UK2A 1MD7A 1LTOA 1QJ6B 1ZOMA 4K5ZA 3C27B 7GCHG 1W7XH 4FU9A 1C2FA 4DW2U 1LCYA 4I33A 3UQOA 1GBCA 1QY6A 3SU1A 1UW7A 1AMHA 1Y59T 1GHWH 1XUKA 4MG3A 1ZSJA 1TBQH 1V2VT 2OLGA 1C5QA 3A8AA 3RXBA 2JH5D 3RXLA 3W95A 2VNTA 2GP9B 1O3HA 1V2TT 1ELTA 1SSXA 2VWLA 2SNVA 1Q3XA 3HKIB 2QF0A 4BOHA 3T28A 1O33A 2BD4A 2IN2A 1KY9A 2QF3A 1E36B 1EZUC 3QK1A 3RXRA 2XRCA 5ABWA 2HWLB 3SGQE 1HAYB 2JKHA 1J16A 3TPIZ 3ZVBA 4DCDA 1L4DA 1XUFA 3AW1A 1WCZA 5HIZA 3RU4T 4D76A 5SGAE 3MFJA 1NM6A 4I8LA 1AFQB 3UNQA 1O37A 2BD7A 4NA7A 3SJOA 3OTJE 4AX9H 1LHDH 3KL6A 4Y71A 1GBAA 1O3AA 1HDTH 3KF2A 1GJ8B 1TQ7B 3T25A 4JZDH 3KQBA 1BA8B 2G8TA 3F9GA 3LGVA 3SGBE 4P00A 5FXLA 2F9UA 1TABE 3NPSA 1EUFA 1BTZA 3TK9A 3K65B 1FPHH 1GHAF 1NC6A 1TOMH 5DP8A 4B74A 2ZGCA 4KTUA 1TX7A 1DUEA 5BPEA 2BVXH 1OYQA 1JWTA 1B0EA 3GOVB 1S0QA 1O2PA 2R9PA 1IHSH 4FU7A 1GMDF 1HAHH 3LC3A 2CGAA 2ZCKP 1N1LA 1UK4A 3F2GA 3U1IB 3M5NA 3N7OA 1XXFA 1FY3A 1YYY1 1C5VA 4X2YA 2PKSC 4K1SA 1GVKB 5DN6D 1GMDG 3T27A 3L33A 3PMBB 1VGCB 2PSXA 3BEUA 2P95A 3MU1A 3ATWA 3U8RH 2VH0A 2CHAC 1DDJA 2ZI2H 1GJ4H 3O8CA 5FL7D 3GY4A 3ITIA 4JZ1A 2V7QD 1ELEE 5L30H 1GGDB 2R3YA 2O8TA 1LPGB 3VEQB 2GVFA 1K0HA 4MTBA 1EOJA 1TPAE 4XBBA 8LPRA 4AG2A 4NG9H 1GWAA 3MO3A 4INKA 3P92A 4IMQA 1P04A 1ZGIA 2LNCA 3UB0A 5DO4H 3Q77A 3K2UA 5HIYA 4XBCA 4MNXA 4ZHLU 1GCDA 2QYIA 3TGKE 5E0JA 4YLQH 2ZHWH 3F9FA 2ZQ1A 4X6PA 1YPMH 3DSPA 1LVBA 3A89A 2GKVE 4KGAA 1W0KD 2XNIA 5C17A 1C5UA 3UWIA 2W7UA 5ESBA 1YPGH 5AVDA 3P17H 4X8SH 2J97A 1SGCA 8ESTE 1Z8JB 2BOKA 1Q2WA 2F9BH 1FZZA 5FPYA 1SQTA 3KN2A 3FAOA 1QQUA 4OS1A 1BIOA 2BD5A 5A8YA 4TY6A 3SU6A 4DT7B 2C4FH 5IK2D 4JYVH 1O2VA 1OP0A 2ZIQH 3P8GA 1V2OT 1NFXA 3MMGA 2Y7ZA 2ZU4A 2ZU5A 3A82A 3SQEE 3SV6A 3U69H 1J15A 1BZXE 2ZTZA 2SGEE 3GYMA 5C2ZA 2ZDAH 1LQEA 1C9TA 3FN8A 1SGTA 2J34A 4B6FA 1GBBA 3OAAD 4NZQA 2H9HA 1NN6A 2ILNA 3A84A 1YPHE 1AWHB 1CU1A 1RXPA 1KIGH 2F91A 1TMUH 3SN8A 1O2QA 1GHBF 1IQJA 1ELCA 1BB0B 3A8BA 1K2I1 1WOFA 2FOHA 2P59A 2VB0A 5FCKA 1W3CA 3ZZ7A 1HJ9A 1NY22 3O8DA 1SI5H 1UMAH 1YCPK 1C4Y2 2HNTE 4R8TB 3DFJA 1EOLA 1DX5M 1EPTC 5GCHG 3AAVA 1YBWA 1GHBG 3CNRA 1TGBA 1H9IE 1WV7H 1KLTA 3I78A 1V2WT 2G5VA 5FPTA 2CK3D 1WAYB 4B2CA 3RDZA 2OC1A 3MU5A 3ZVCA 4YT7H 1RIWC 1DE7H 2HPQH 1HIAB 2ZPRA 4OGYA 4ESTE 4ZCNA 4DOQA 1YCPH 1CHOF 1FAXA 3SV9A 2J92A 1GBJA 5F8ZA 3AVZA 1O3BA 5FBIA 2BDIA 1Y8TA 1KXBA 1VKYA 3OY6U 3ZZAA 1ZTKA 2JH6D 3RXIA 1PQ7A 1ANDA 6GCHF 2WYJA 2VGCB 2KFWA 2J5UA 3P8NA 1C1VH 4HGCA 1MU6B 1NRQH 3SYJA 1BUIA 1LHGH 5JYIA 2Q1JA 2Y7XA 3LDXH 5ETXA 4A1TA 5A09A 1TA6A 3BG4B 2G51A 2UUKB 4FUGA 2J94A 1GHYH 1F2SE 3UR9A 2I6QA 6GCHG 1PFXC 3B23B 1JRTA 1KXAA 4GAWA 4YO9A 3UNRA 2ANWA 1GI4A 3MNBA 4WF8A 4ZHMU 3SUFA 4BAKB 8KME2 1HAXB 3TH3H 5L6NH 3RC6A 1SGNE 1MTUA 1O3JA 1CA0B 2OXSA 3URCA 4UFDH 1VCQA 3PWCA 1SGDE 4CRBA 4B75A 4BTTB 2FS9A 2JETB 4RT1A 2ZGBH 3MHWU 4A7IB 3BTTE 1O2KA 3GCTG 1K1JA 5C0TA 2ZFSA 4MLFB 2A4QA 1ZPBA 1ELAA 3SI3H 1Z8IB 2BM2A 2PTNA 1NRPH 4YOJA 2V3MA 4K1TA 3ODFA 4FU8A 4AFSA 2BY8X 3NK8A 1VITH 4TT3D 4I32A 3S9CA 3B9FH 1BRBE 4K69A 3TJOA 1CT4E 3QN7A 4AGKA 1OWKA 3GY6A 2KM0A 2B9LA 5EXLA 2OK5A 3SV8A 3JZ2B 4LOYH 2FWWA 1JMOH 1LDTT 1MTWA 1O2MA 3GISB 1KYNA 3LJOA 1Z1IA 4ABFA 2GZ8A 1NTPA 2FLBH 4F48B 1GCTC 5KGOA 3RXJA 2CN0H 1HYLA 3RXVA 4ZMAH 5E2PA 2QGRA 1AD8H 1D9IA 3PV4A 3SO3A 1U6QA 2H2ZA 4CR5A 1GJAB 4D7FA 4X1SU 2THFB 2G81E 4MNWA 3A7XA 1HFDA 5E0GA 3FVFB 1NFUA 3HGPA 2TPIZ 1ZMNA 4NIVA 3EGKH 3QX5H 2QN5T 3BTFE 1EZQA 1G3BA 1O5DH 1SGPE 2TIOA 3TVJB 1B0FA 1OS8A 3ZZ3A 2EY4C 3R3GB 3T29A 1BHXB 4X1PU 2CV3A 6CHAC 2F9VA 1EP5A 1K1LA 2J2UA 1HAGE 2QIQA 4ABAA 1N8OB 4BAQB 3P8FA 4CRFA 2JH0D 1GBHA 3HK6B 1UTLM 3KHVA 3LIWA 4YT6H 4A5TS 3ZYEA 3ATKA 1DICA 3BSQA 1BBRK 1HAVB 2BOHB 2QY0B 2PSYA 2PWXA 1UVUH 1GJ6A 1UO6A 2FI5E 1A0JA 4NWLA 1AHTH 2QCYA 2YMSB 1V2RT 1Y5AT 1LVMA 3ENSB 5HM2A 4WY3A 2RG3A 3TGJE 1C1MA 1SMFE 2JIZD 3E91A 2ZFTA 2EC9H 3D65E 1NU7B 3PLKA 2Z3DA 3SHCH 1SFIA 4A1VA 1S85A 1T7CA 1WXRA 2ZDMA 4U01A 1KXCA 1FIWA 2VJ1A 3SI4H 1BBRH 2XC0A 2ZU2A 3VGCC 3BV9B 1ZGVA 3MQKC 1PJPA 3F0PA 1C2EA 2ANKH 5K0HA 3PROA 1CBWC 4UDWH 4F4OC 4DVAU 4CBOA 4AFZA 1DANH 1TAWA 1G9IE 1HAZB 2A2QH 3PRDA 2FX6A 4FVBA 1L1NA 1TRYA 3ZVAA 2KAIB 1SGYE 4ABHA 3QGJA 4AZ2B 2C8YB 4Y11E 2C8XB 2TGAA 2V0BA 1AE8H 3FKSD 5F53A 3RXFA 3TGIE 2SFAA 3LOXA 3ZV8A 2W26A 3DD2H 3M36A 4BAOB 2ULLA 3M7UA 7KMEH 4CBNA 5EGMA 1QTFA 3UWJH 2BDAA 2A2XH 5FX5A 5BRRE 4B76A 1XVMA 5T6DA 5ESTE 3UREA 2WUCA 1FJSA 3UTUH 3EA9A 2OP9A 3M7QA 4JMYA 1LQDB 3P95A 1NBMD 2D2DA 3RXSA 4ISOA 4HZHA 1TIOA 2Z9KA 5JBCS 2GX4A 2AGEX 4RKOB 4CRDA 1A5GH 3TK6A 5DJ7A 5GDSH 2GV7A 2EI8A 3PMAB 3OTPA 2A4RA 1V2PT 2EA3A 2Z9GA 3SBKA 1JBUH 1LMWB 1QRZA 2FM2A 2BLVA 3DSGA 3MOCA 5EU8A 3ZVFA 1YCPM 1EAWA 1BOQA 2TGPZ 1RTLA 3ZZCA 4TY7A 1EZSC 4BANB 1SB1H 5IDKA 1B5GH 4J1YA 3TH2H 4Y8YA 4GVUA 4MPXA 1UHBB 1AB9B 2ZPSA 3RXUA 2AGGX 4X0WU 2OINA 2UUFB 1EPTA 5DGJA 2BDBA 3BN9A 1L1GA 3KNXA 1E38B 1W0ZU 2PKAA 1OKXA 1BTXA 4M7GA 1ACBE 1ZTLA 2BVSH 2B5TB 5C0UA 3UPEA 1TNGA 3NCLA 1ABIH 4FUHA 4WWYA 2IJOB 3HK3B 1T31A 2H5DA 2A4OA 1H9HE 3M5OA 3PV5A 4SGAE 1HBTH 1L1JA 5JPMH 3V13A 2QAAA 1A2CH 1EASA 4ASUD 2FZZA 4ABJA 3FFGA 2V6NA 1AZ8A 3E0PB 3OE7D 3F0OA 3WWBA 1WYKA 1NROH 1HNEE 2WUBA 1QQ4A 1MD8A 2ZTYA 2W3IA 4ZH8A 2K0QA 3A8CA 1GL1A 2H1UA 4CRAA 1C5SA 3TIUA 1GI6A 1BMMH 1P2MA 4RI0A 5CDFE 1O3GA 1C5YB 2FLRH 1EXFA 3DUXH 5EOKA 1B7XB 1NBME 5CE1A 1O3DA 3TK5A 4JYTA 1PYTD 2AGIX 2P3TB 4GCHF 1QBNA 2QF5A 1QB6A 1CE5A 1K1PA 1FX0B 3FOAA 1DOJA 1OWEA 3SQHE 2R2WU 1LPZB 1RTKA 2BX3A 1J8AA 1SPJA 2GMTB 4AG1A 1MZDA 1LKAA 1JIRA 3MU8A 1ESTA 7LPRA 2BX4A 2WPLS 1GBLA 3U98H 1UCYK 1GDNA 2ZHEH 1QL7A 1SGIB 1AKSB 4I7YH 4GSOA 4ZROA 2ZA5A 4XDEA 1HAPH 1ELVA 1TPSA 3GCHC 2CF9H 3Q3YA 2QC2A 1VCPA 4LZ4B 5F03A 1F0UA 2WV5A 1WU1A 1J17T 1C2DA 1E35B 1LKBA 4WMDA 4ISIH 1Q31A 1BJVA 3LH3A 2AERH 3N7EA 2F3CE 2QXGA 3KYGA 1E34B 2VU8E 1PQ5A 1SFQB 2STBE 3KQEA 1P01A 1QRXA 1C5ZB 1LHFH 1AE5A 2ZGHA 3F9EA 2BXUH 1AZZA 5JBBS 2QF4A 3RXKA 1UCYH 3DCLA 2BVRH 1O2XA 1V2UT 1O5BB 3SORA 1E1RD 2UWOA 4HG6A 1BTHH 4FUCA 2ZPQA 7ESTE 3EE7A 4O97A 1EAXA 5G4BA 1Z8GA 3UOUA 4ISLA 1EZXC 4JZEH 2F9NA 3GCOA 1P9SA 5EIYA 2FI3E 4HI3A 1ORFA 3DHKH 2O8MA 5CMXH 4IS5A 4NA9H 1Z6JH 5EJ1A 1TRMA 2GJGA 1VITF 4LZ1H 1HB0B 3WWFA 2JJ2D 3MU4A 4NWKA 2TBSA 4DY7B 1YC0A 2AIQA 2CMYA 1DVAH 5T3HA 3SOSA 1GHVH 3E90B 4DT4A 1X7AC 1VITG 2XCNA 3IG6B 4GHQA 4KTCA 1K1NA 4TWWA 5CHAC 3HKJB 4UFGH 1HJAC 3EA7A 1JOUB 5C1XA 2AMDA 1RD3B 3CENA 3ZVEA 2B7DH 4KTSA 1ETSH 3E3TA 1SHHB 3Q3KA 1BMNH 4FVDA 1YPHC 3PTBA 3ZZBA 1UVOA 5C20A 3F3BA 2EI6A 4IN2A 2WSSD 2R0LA 3LU9B 3S69A 2ZG0H 1VJAU 3MI4A 2A7JA 3MH4A 1FY8E 1O2WA 2AS9A 5TJXA 1GBIA 1ID5H 1P8VC 2BHGA 1WTHD 3OEHD 5H4IB 3A7ZA 4ABEA 2HNTC 1FY1A 4XRNA 1LO6A 4Y76A 4X8VH 3EDXB 1HRTH 1HCGA 3T5FH 1F5RA 4OS7A 1O2SA 2FS8A 3ATIA 4FUJA 1BHXF 4NIXA 1O5CB 1G3DA 2QA9E 1KMHB 2XBVA 5HYOA 3RXEA 1HAIH 3AAUA 1LPKB 1W0JD 1YM0A 2Q6DA 4VGCC 5DP4A 3RXGA 3NKKA 5EQQA 1WSSH 1K9OE 2FYRA 4RN6A 1FPCH 3U8TH 2D1JA 4ZKSU 4PROA 2P8OC 1C5XB 2LPRA 1FXYA 1SGFG 3QGNB 4UD9H 3SZNA 1KXFA 4H6SB 1C2MA 1FDPA 2YMSD 4TPIZ 5HGGA 4AORA 3EYDA 1H8ED 2C93B 1S81A 3EE0B 2CF8H 2UUJB 1ELGA 1PQAA 2BQWB 3TU7H 3PYHA 5L2YH 3MNSA 1HJ8A 1O0DH 2FOBA 2AYWA 2K8IA 3RXMA 3CS7A 1W8BH 3ZZ5A 2BDHA 1SLUB 3TITA 4IC6A 1XXDA 3BTEE 1FONA 2GCTC 4BAHB 1O32A 4CHAC 2VVCA 1MCTA 1UTOA 5EQSA 4ISHH 4IGDA 1ESAA 1MTNC 3BF6H 2J38A 2BY9X 1K21H 2O8WA 3VB6A 5GCHF 3KEEA 3KIDU 4H6TA 5B6LA 1GVZA 4XBDA 1IQNA 1EAUA 1EKBB 2OQUA 3E1XB 2BDGA 1EJNA 1YF4A 1P57B 1ZR0A 1P2KA 3M35A 1TPPA 4CREA 3URDA 5CHBA 1Y3UA 1TNKA 2OC8A 2GZ9A 4DURA 1O3MA 1UTPA 3I77A 3K9XB 2R3UA 1V2MT 1D6WA 3RXTA 3WY8A 2ZFPH 1C2IA 1C5WB 2J98B 3RUOA 2DUCA 2PR3A 2VIQA 4YLUA 1A5IA 2ZHDA 2BY6X 2NU2E 3W94A 5FPSA 5JDUB 2ZDLA 2Y82A 3FP7E 4Y79A 4X6OA 1NFWA 3TJNA 1Y3WA 1GI3A 3VB7A 1ZJKA 5C5OA 4Z6AH 1FV9A 1TBZH 5GNDA 3OX7U 1XMNB 1N6YA 1BTUA 1ETRH 2W6JD 1O38A 2FOAA 2I6SA 3P70B 1RS0A 2BTCE 2GD4B 1O5AB 9LPRA 5B6OA 2H5CA 4WMFA 4A1XA 1O35A 2WPHS 3UR6A 3WW7A 1SQAA 2BY7X 4Q4LA 1PPEE 4OS4A 1HLTH 2F4LA 5JB8S 1E1QD 2ZTXA 1UTKA 2XTTB 1C9PA 2VINA 2PHBA 4AFUA 4ZUHA 5DK1A 1MTSA 3PO1C 3ZV9A 3GCTF 5J4SA 2G55A 2FODA 1ZZZA 4RT0A 1MKWK 2VIOA 1PPGE 3ATLA 3O8BA 4X1RU 3SW2B 1C4V2 1ABJH 2BD3A 3JZ1B 1P10A 3PMJA 1KDQA 2P16A 2SGDE 3H5CB 2PFEA 3GDUA 1CO7E 1GDQA 1SOZA 4Q7ZA 4FUFA 1HIAA 3F6UH 3KYFA 2NU3E 1AUTC 3NXPA 1OXGA 3TNSA 2FPZA 4IC5A 5LH8A 3R0FA 2BD8A 1UTQA 1MKWH 3BIUH 4AB8A 3MWIU 5AFZH 1ZHMA 1C1RA 2NU4E 4I8HA 1NU9A 2ZO3H 4O3UA 2HPPH 2L6OA 4TSFD 3PTNA 1C5PA 4YM9A 1O30A 1Y5BT 4NFFA 1G2LA 1MTVA 4LXBH 1AWFH 1AU8A 1F0SA 1ANCA 1V2NT 2EI7A 2GGVB 4X6NA 4AGJA 1EJMA 1VZQH 4ACAA 1ZPZA 2OUAA 2ZCHP 1DWEH 4BXWA 4D7GA 2J95A 1O2GH 1C2JA 4A6LA 2KR7A 1CSOE 1BITA 2HOBA 1NT1A 2AFQB 2FDAA 2WPMS 1T32A 2W3KA 4ZXYH 1F92A 5T6FA 2FO9A 1GG6C 1BRCE 3F2HA 3N99A 2G4UA 2KX4A 3SGAE 2F9PA 1H8HD 3A7YA 3BTWE 1UTNA 1ARCA 2Q6GA 1W14U 2PKSB 2XYAA 3GY7A 4UONA 3QZRA 4WJG2 4NGAH 1ZYOA 1QA7A 3PMHB 3T26A 4K2YA 3RXOA 3VB3A 2SGAA 3PRBA 3NRLA 1O2ZA 2CHAB 3HATH 1TGCA 2Z9LA 1BRUP 1FLEE 1TRNA 1HXFH 2P3UB 2UUYA 4YTAA 3KQ5A 1T8MA 1KTTB 1ZHRA 1PPHE 3ESTA 1C5LH 1V2QT 2H9EH 5E2OA 3T62A 2BZ6H 3QTOH 3RU4D 2KCPA 1MU8B 1GHZA 1HPGA 1UTJA 1DUAA 2VWOA 5A2MH 2A5AA 3IITA 4MPWA 4X1NU 3AK5A 2KCYA 1YKTA 3GY2A 1FQ3A 1W7GH 1MABB 3AW0A 2BQ6B 2STAE 2C8ZB 4D8NA 1OHHD 1GMCG 1RTFB 1QL8A 3RXHA 1O3EA 4YESB 2YNAA 4UFEH 1EAIA 3BTKE 2ZDKA 3EQ0H 2FOCA 1RFNA 2B0FA 1BDAA 4O03A 1INCA 2ZDVH 3LGIA 2D26C 4XE4A 3QWCH 1S6LA 1BCUH 2NU1E 2FEQH 4WVPE 1FMGA 1ZTJA 1C1TA 1KLJH 1D4PB 1AFQC 1NRRH 4Z1MD 3F9HA 1GJ9B 4Y10E 5C67A 1TYNA 1W0YH 3FZDA 1ZPCA 5DP3A 1S6HA 4FUBA 2EQNA 1MQ5A 5EG4A 1TGTA 3ZIAD 4DIHH 1J14A 4Y0YE 1WQSA 1COWD 1KTSB 1GJBB 2Z7FE 2ZECA 5DPAA 1E37B 1O3PB 4B6EA 3VPKA 2HLDD 2VIVA 1L2EA 1CHGA 1S84A 3GDVA 2A5KA 2W5EA 2Y80A 3RM2H 1F5KU 4Y6DA 1DITH 1OWDA 2GCHG 3F1SB 1ZMJA 1T8NA 4U30A 2WV4A 1W2KH 2ZZUH 1T4UH 2A0QB 1EPTB 3CP7A 3OYPA 4GPGA 4GLYA 1O2RA 3DSOA 3A87A 1GI7B 1DY9A 4KELA 5DSFA 1AY6H 1O3IA 5DP6A 3Q3XA 1Y3VA 1V2JT 3GY8A 4AYYB 1VGCC 3EA8A 1AO5A 1C2HA 1IQLA 1QBVH 1RIWB 2ZNKH 5LGOA 2IJD1 2V3HH 1P3CA 1J9CH 4RKJB 4AOQA 1MAYA 4ZAEA 3Q76A 2HRVA 4AFQA 3RU4E 3F68H 1GGDC 1A0HB 3GDSA 4E06H 4K1EA 2FI4E 1CGIE 1GMHG 3DFLA 1BT7A 1SC8U 1ELBA 1TOCB 2XWBI 4INHA 3D49H 1IQFA 5KECA 1TGNA 1Z7KA 1NS3A 3BEFB 5A0BA 5EW1H 3C1KA 4YXWD 3A85A 4E05H 4RSPA 4Y8ZA 2IPHA 3L6PA 2GDDA 1C5MD 2FX4A 1GJCB 5GIBA 2ZWLH 3MO9A 1F5LA 1N6XA 1VJ9U 4Q2KA 2P93A 4FUDA 4XOJA 1LVOA 4M9FA 4MDSA 3RMMH 1L0ZA 4GHTA 4OS2A 3A83A 3VG8A 4D9RA 1FI8A 3QTVH 2HGTH 1TX6A 1TNLA 5FX6A 1D3QB 3FANA 3MTYA 5AFYH 4LK4A 3N7DA 1SGEE 2FOFA 3RM0H 2OTVA 1TQ0B 1W12U 2OBQA 3TJVA 5TCCA 4UFFH 2A7CA 1CT2E 1P05A 5DP5A 1S82A 3ZZ4A 2GDEH 4DJZB 3Q00A 2RCEA 4K8YA 1D6RA 4CRCA 5EW2H 3BEIB 2F83A 1YPEH 1TPOA 2PW8H 3RXQA 1CGHA 1S5SA 1MBMA 4DGJA 2WHXA 1O3LA 2Y81A 2O8UA 4AC9A 3KQCA 3U8OH 1PPFE 5EPYA 2QXJA 2L74A 3BTDE 2FMJA 1P11E 1QB1A 3U28C 1C1WH 1Z8RA 1MAXA 3FP8E 3STJA 2GT8A 5F8TA 1YWUA 1OSSA 1SGRE 1YY3A 1TE0A 3GYLB 3RP2A 3RXPA 2BLQA 2KCAA 2M2AA 1DWDH 1UVSH 3M61U 1DFPA 2Z94A 4JYUH 4X8UH 3RLYH 1YGCH 1AN1E 3SJ9A 2JDID 1EB2A 1XM1A 5GPIB 1Y3YA 1PYTC 4JK5A 1GCTB 2Z6BD 1D3PB 1K28D 2FIRH 2VIDA 2P94A 4B1TA 1IQGA 3LGWA 1JIMA 4E7RG 1DPOA 2HVXA 1P0SH 2Z9IA 1ZJDA 2FTMA 1O3OA 3DT0H 1AQ7A 5C1UA 2ZDNA 2O8LA 3ZZ8A
chains in the Genus database with same CATH topology
1C5RA 2BDCA 1O2YA 2FOGA 3S7KB 5PTPA 3V12A 1FNIA 1K1IA 2VGCC 3MO6A 5AF9H 4BTUB 3RMLH 1Z1JA 4U2WA 4ASHA 1JXPA 2SNWA 1V3XA 3RXDA 1HV7A 3SV2H 1THRH 6CHAB 2QXHA 1AFEH 2QXIA 4FUIA 3ZZ9A 3O8RA 3BG4C 1H4WA 1ZHPA 1O2LA 1QB9A 1QRWA 4X6MA 1XKAC 1ANBA 3RMOH 1OX1A 2XCFA 3TJUA 5A0AE 1WTGH 2AMPA 9ESTA 2C90B 1O5EH 1QJ1B 4I8KA 3SJ8A 1A61H 1AVXA 2OC7A 2VH6A 3UNSA 1CA0C 3CS0A 5C5NA 1GJDB 1Z6EA 3GCNA 4B2BA 4UEHH 2JETC 3UIRA 2BMGB 4ABGA 1BQYA 3VGCB 2FOEA 1C5OH 1PQ8A 2A4GA 1O5GH 2G00A 2VVUA 2ASUB 4I31A 5A0CA 1A7SA 3LC5A 1CBWB 1CVWH 1T4VH 1AKSA 1QURH 2VWMA 3QLPH 2A32A 2G52A 4D9QA 1SG8B 1GBFA 1THSH 2FXRA 1EJAA 2XXLA 3K6ZA 1NFYA 1P09A 1C1PA 1HAOH 1KXEA 4WMEA 1F7ZA 4OGXA 2ZU3A 1QCPA 3BTQE 1O2JA 1O39A 1ANEA 2PV9B 5EQRA 1PPBH 1AVWA 4U32A 3P6ZB 3LT3A 1S0RA 1ZSKA 4HTCH 4Y8XA 5E0HA 1LHCH 2ANMH 1GDUA 4JZFH 5EXNA 2IOTA 1G3EA 2ZF0H 1P2IA 1QL9A 1HGTH 4IW4E 3M3TA 3MNCA 1BMLA 1FY4A 3U1JB 2HNTF 2YOLA 1DT2A 1T8OA 1GHAG 5JBTA 1WQVH 4H4FA 1TB6H 3OU0A 4CH2B 2A5IA 2G5NA 3A7WA 3SU2A 3PM3A 1GJ5H 2PGBB 5JB9S 2ANYA 2HLCA 4Y7AA 1A3BH 1ESBA 1MUEB 3UOPA 1N8OC 1VCWA 1NRNH 1XUHA 1C5TA 2EEKA 1P2OA 2BDYA 1NESE 1EB1H 3BTME 5GWZA 1C1OA 1DWCH 1ZMLA 2BLOA 1PPZA 4IMZA 1UTMA 3SUEA 3VB5A 1G3CA 2ZHQH 1TMBH 4ZKNU 1DXWA 4WH8A 2WPJS 1MKXK 4BXSA 1GBKA 2CXVA 3LKWA 4F49A 1OWJA 2ZC9H 2ALVA 2TGDA 5FAHA 1QIXB 2OC0A 3M3VA 4NCYA 1V6DA 1M9UA 1IOEA 1GI1A 2XBYA 4ZKOU 3HGNA 2VWNA 1G37A 1UVPA 1FY5A 3SU5A 1MMJN 1GI5A 3PLBA 3A7VA 3MU0A 1Y3XA 2RA0A 3SJKA 3A7TA 5I46H 1DSUA 2DE9A 1ELDE 2R0KA 5DP7A 1IQKA 2ZKSA 1MKXH 1GI8B 2G4TA 1O3KA 3UY9A 3V0XA 2VVVA 1LVYA 2NWNA 3SNCA 3RC5A 2XWAA 3MH5A 1C2LA 3SUDA 2PTCE 2OD3B 3S0NA 3LGYA 1TNJA 1C1SA 1ZLRA 1BMAA 3RXCA 4MPUA 4IBLH 1H8DH 1TMTH 2XC4A 5C1YA 3KQDA 4MQAA 1O34A 2TGTA 1K1OA 3M7TA 1GBMA 6ESTA 4MNVA 4WXVA 5E8EH 4ZHAA 1A4WH 1O2OA 2GTBA 4NSYA 2PUXB 5EPNA 5F8XA 1O2TA 1A46H 2BLWA 1OWIA 5DKMA 3MH7A 2Z3EA 3TLOA 3SU3A 1O2HA 4YZUA 1G2MA 4YOGA 3ZYDA 1RRKA 3BTHE 2VIPA 1W11U 4O3TA 5FHTA 4ZKRU 1L4ZA 2A45B 4HFPB 1KDQB 2ZGXH 4H42U 5L2ZH 3HPTB 1BJUA 1YP9A 5GXPA 1OOKB 4O9VA 3A8DA 2A1DB 4E7NA 5LPEA 2FTLE 1JRSA 4NZLA 4K8BA 3GCHB 1S6FA 1O3FA 2OCVB 1RGQA 5HM9A 3SU0A 5T6GA 5A8XA 4BTIB 1TWXB 1AB9C 1BBRE 1CHOG 1P03A 3G01A 2HALA 3SHAH 4K3JA 2ZFQH 1LHEH 4MPVA 1P9UA 3GY5A 1IQHA 2H9TH 1EQ9A 1AUJA 1YPLH 2PUQH 2K1QA 3ATMA 1SVPA 1NZQH 2ZFFH 3LGTA 4WXIA 3VXEH 2A7HA 3E16B 2CJIA 1HUTH 1SHYA 2B8OH 2PGQB 1SGQE 5GJ4B 4J2YB 1SQOA 2ALPA 1GBTA 3B8JA 3ELAH 3QDZB 5J4QA 3A80A 1VR1H 2BD2A 1AVGH 1QNJA 1GL0E 2XBWA 1TONA 1T8LA 1H8IH 1V2ST 1V2LT 3S9BA 4NIWA 1MBQA 2XBXA 2FESH 1O3NA 1YPKH 2ZU1A 3RXAA 2ODPA 2FP7B 2ZHFH 1GBDA 3M5LA 5DP9A 1G36A 2BXTH 2WPKS 2QV1A 3S9AA 1TA2A 4AN7A 1BTYA 5HMAA 1GI2A 5CHAB 3LGUA 1AIXH 2A31A 1XKBC 1HJAB 3SUGA 3OSYA 2ODYB 1ETTH 2RA3A 5IYTA 2SGQE 1ARBA 2M5TA 3D23A 1P2QA 1O5FH 4MNYA 4NIYA 3QUMP 4YOIA 4XFQA 3NWUA 3QZQA 2H6MA 5LPRA 3UQVA 1OPHB 1F0TA 1YLDA 4JK6A 4FXGH 1IHTH 1QA0A 1A5HA 1C1NA 1XUIA 3PB1E 1QJ7B 4KP0A 1MH0A 2OBOA 2BY5X 1K22H 4Q80A 2ZGJA 1FIZA 2GMTC 4JCNA 5HXFA 1S83A 1DWBH 1FN8A 2RDLA 3A86A 5DG6A 3LPRA 1GMCF 1XUGA 3LONA 3U9AH 3E6PH 3TNTA 1CT0E 2Y6TA 1O2IA 4TPYA 1A0LA 2GZ7A 4VGCB 1DXPA 1OYTH 1BTPA 1C1QA 1Y5UT 4CH8B 4INLA 5LPFA 1D3DB 2P8OB 2XC5A 1GVLA 1AGJA 1TLDA 1AI8H 2ZQ2A 4K60A 3ZZ6A 1MZAA 3BTGE 2FYQA 3KCGH 3PWBA 3STIA 3MYWA 1TNHA 1P06A 4GUXA 3NZIA 4ZXXH 2FOMB 3ZVGA 2SGPE 3GICB 4B71A 1IQEA 2GT7A 3E0NB 1PPCE 1V2KT 3OY5U 2Z3CA 4MVNA 1UJ1A 1G32B 3SNDA 1EX3A 2ZP0H 4OS6A 1THPB 2VIWA 4WH6A 4X1QU 2Y5HA 4ISNA 1WUNH 4TWYA 3EAJA 4Y0ZE 3V3MA 4NSVA 4FUEA 2F9OA 3M37A 3NUMA 1SLWB 1Z71A 1C1UH 1F0RA 2C3SA 5I25A 2SGFE 2GCTB 4CHAB 4BAMB 5EODA 1GHXH 1TBRH 3L3TA 1NPMA 4IN1A 2GCHF 5C3NA 1H1BA 1SBWA 5TCAA 3SNBA 1MTNB 4X2XA 2BZAA 1DM4B 1SGFA 2BQ7B 4Y7BA 3QO6A 2XW9A 1FUJA 1K1MA 5JBAS 2WINI 3M5MA 4R0IA 1BTWA 1HAVA 1O36A 1A3EH 1GI0A 3FZZA 3M3SA 3V7TA 3VB4A 1C5NH 2DE8A 3VXFH 5K7RA 1MCVA 3TH4H 1OP2A 2AEIH 2AIPA 3A81A 3SNAA 1QGFA 1C2KA 5FBEA 1SL3A 2PKAB 3P8OA 5A8ZA 8GCHF 1C4U2 3K6YA 6LPRA 1SLXB 4CR9A 1GMHF 1MQ6A 2O9QA 1GI9B 1YLCA 3SU4A 3UUZA 2BB4A 3RMNH 1TGSZ 1TALA 1FN6A 2Y5FA 2Y5GA 3SJIA 1SR5C 2Q6FA 1IQMA 1SOTA 4QT8C 1CGJE 3LJJA 8GCHG 2ZCLP 1BRAA 4XSKU 3H7OA 3LH1A 1UCYE 1P2NA 2ZEBA 4B73A 1EATA 4OS5A 2AH4X 2YNBA 1GJ7B 2KAIA 1CA8B 4Q7XA 4X8TH 3A88A 1HXEH 2GV6A 4TYDA 1NRSH 4I8GA 2C8WB 1O31A 4X2WA 1EP6A 4AB9A 2P3FH 4ABBA 1DSTA 3H7TA 1FAKH 1DLKB 5F6MA 4UE7H 2OQ5A 2BYAX 3SV7A 3GY3A 3PO1B 1O2NA 5EXMA 1ELFA 3RC4A 3PLPA 1UK3A 2J9NA 4I8JA 1O3CA 3ZZDA 1P12E 2Z9JA 2UWLA 1ZSLA 1NO9H 1OP8A 1OWHA 5FCRA 2WPIS 1KXDA 2TRMA 4NFEA 5AHGH 3SNEA 1QBOA 2J4IA 3VFEA 1GBEA 3FP6E 1O2UA 4ABDA 4AYVB 1KSNA 2R2MB 1CQQA 1H9LB 3UFAA 2WYGA 4THNH 1DLEA 4NA8A 4DIIH 3MNXA 1W10U 1RJXB 1ZRBA 4B2AA 1KLIH 1DS2E 1UHBA 3E8LA 2NU0E 3IWMA 4JZIA 1TX8A 1QFKH 3AASA 4A92A 3KGPA 1A1RA 1E0FD 1P3EA 3ODDA 2ESTE 2ZFRH 1TNIA 1C2GA 2V3OH 4CRGA 3T2NA 1XX9A 1D3TB 2D8WA 3RLWH 1QR3E 2AMQA 3ZVDA 1QHRB 3BG8A 4Z0KA 1ZRKA 1SLVB 1DY8A 1GG6B 4SGBE 2BD9A 4ABIA 4X2VA 4BNRA 1WBGB 2ODQA 2V35A 3BIVH 3D62A 1UVTH 3MH6A 2W7SA 1P2JA 3I29A 1P02A 7GCHF 2UWPA 1YPJH 3DA9B 4DG4A 1IAUA 1XUJA 3S7HB 4Q7YA 2PLXA 1TFXA 1G30B 4KKDA 1W13U 1XVOA 4GCHG 1IQIA 1GPZA 1UK2A 1MD7A 1LTOA 1QJ6B 1ZOMA 4K5ZA 3C27B 7GCHG 1W7XH 4FU9A 1C2FA 4DW2U 1LCYA 4I33A 3UQOA 1GBCA 1QY6A 3SU1A 1AMHA 1Y59T 1GHWH 1XUKA 4MG3A 1ZSJA 1TBQH 1V2VT 2OLGA 1C5QA 3A8AA 3RXBA 2JH5D 3RXLA 3W95A 2VNTA 2GP9B 1O3HA 1V2TT 1ELTA 1SSXA 2VWLA 2SNVA 1Q3XA 3HKIB 2QF0A 4BOHA 3T28A 1O33A 2BD4A 2IN2A 1KY9A 2QF3A 1E36B 1EZUC 3QK1A 3RXRA 2XRCA 5ABWA 2HWLB 3SGQE 1HAYB 2JKHA 1J16A 3TPIZ 3ZVBA 4DCDA 1L4DA 1XUFA 3AW1A 1WCZA 4D76A 3RU4T 5SGAE 3MFJA 1NM6A 4I8LA 1AFQB 3UNQA 1O37A 2BD7A 4NA7A 3SJOA 3OTJE 4AX9H 1LHDH 3KL6A 4Y71A 1GBAA 1O3AA 1HDTH 3KF2A 1GJ8B 1TQ7B 3T25A 4JZDH 3KQBA 1BA8B 2G8TA 3F9GA 3LGVA 3SGBE 5FXLA 2F9UA 1TABE 3NPSA 1EUFA 1BTZA 3TK9A 3K65B 1FPHH 1GHAF 1NC6A 1TOMH 5DP8A 4B74A 2ZGCA 4KTUA 1TX7A 1DUEA 5BPEA 2BVXH 1OYQA 1JWTA 1B0EA 3GOVB 1S0QA 1O2PA 2R9PA 1IHSH 4FU7A 1GMDF 1HAHH 3LC3A 2CGAA 2ZCKP 1N1LA 1UK4A 3U1IB 3M5NA 3N7OA 1XXFA 1FY3A 1YYY1 1C5VA 4X2YA 2PKSC 4K1SA 1GVKB 1GMDG 3T27A 3L33A 3PMBB 1VGCB 2PSXA 3BEUA 2P95A 3MU1A 3ATWA 3U8RH 2VH0A 2CHAC 1DDJA 2ZI2H 1GJ4H 3O8CA 3GY4A 3ITIA 4JZ1A 1ELEE 5L30H 1GGDB 2R3YA 2O8TA 1LPGB 3VEQB 2GVFA 4MTBA 1EOJA 1TPAE 4XBBA 8LPRA 4AG2A 4NG9H 1GWAA 3MO3A 4INKA 3P92A 4IMQA 1P04A 1ZGIA 2LNCA 5DO4H 3Q77A 3K2UA 4XBCA 4MNXA 4ZHLU 1GCDA 2QYIA 3TGKE 5E0JA 4YLQH 2ZHWH 3F9FA 2ZQ1A 4X6PA 1YPMH 1LVBA 3A89A 2GKVE 4KGAA 2XNIA 1C5UA 3UWIA 2W7UA 5ESBA 1YPGH 5AVDA 3P17H 4X8SH 1SGCA 8ESTE 1Z8JB 2BOKA 1Q2WA 2F9BH 1FZZA 5FPYA 1SQTA 3KN2A 3FAOA 1QQUA 4OS1A 1BIOA 2BD5A 5A8YA 4TY6A 3SU6A 4DT7B 2C4FH 4JYVH 1O2VA 1OP0A 2ZIQH 3P8GA 1V2OT 1NFXA 3MMGA 2Y7ZA 2ZU4A 2ZU5A 3A82A 3SQEE 3SV6A 3U69H 1J15A 1BZXE 2ZTZA 2SGEE 3GYMA 5C2ZA 2ZDAH 1LQEA 1C9TA 1SGTA 2J34A 1GBBA 4NZQA 2H9HA 1NN6A 2ILNA 3A84A 1YPHE 1AWHB 1CU1A 1RXPA 1KIGH 2F91A 1TMUH 3SN8A 1O2QA 1GHBF 1IQJA 1ELCA 1BB0B 3A8BA 1K2I1 1WOFA 2FOHA 2P59A 2VB0A 5FCKA 1W3CA 3ZZ7A 1HJ9A 1NY22 3O8DA 1SI5H 1UMAH 1YCPK 1C4Y2 2HNTE 4R8TB 3DFJA 1EOLA 1DX5M 1EPTC 5GCHG 3AAVA 1YBWA 1GHBG 1TGBA 1H9IE 1WV7H 1KLTA 3I78A 1V2WT 2G5VA 5FPTA 1WAYB 4B2CA 3RDZA 2OC1A 3MU5A 3ZVCA 4YT7H 1RIWC 1DE7H 2HPQH 1HIAB 2ZPRA 4OGYA 4ESTE 4DOQA 1YCPH 1CHOF 1FAXA 3SV9A 2J92A 1GBJA 5F8ZA 3AVZA 1O3BA 5FBIA 2BDIA 1Y8TA 1KXBA 3ZZAA 3OY6U 1ZTKA 2JH6D 3RXIA 1PQ7A 1ANDA 6GCHF 2WYJA 2VGCB 3P8NA 1C1VH 4HGCA 1MU6B 1NRQH 1BUIA 1LHGH 5JYIA 2Q1JA 2Y7XA 3LDXH 5ETXA 4A1TA 5A09A 1TA6A 3BG4B 2G51A 2UUKB 4FUGA 2J94A 1GHYH 1F2SE 3UR9A 2I6QA 6GCHG 1PFXC 3B23B 1JRTA 1KXAA 4GAWA 4YO9A 3UNRA 2ANWA 1GI4A 3MNBA 4WF8A 4ZHMU 3SUFA 4BAKB 8KME2 1HAXB 3TH3H 5L6NH 3RC6A 1SGNE 1MTUA 1O3JA 1CA0B 2OXSA 3URCA 4UFDH 1VCQA 3PWCA 1SGDE 4CRBA 4B75A 4BTTB 2FS9A 2JETB 2ZGBH 3MHWU 4A7IB 3BTTE 1O2KA 3GCTG 1K1JA 2ZFSA 4MLFB 2A4QA 1ZPBA 1ELAA 3SI3H 1Z8IB 2BM2A 2PTNA 1NRPH 4YOJA 4K1TA 3ODFA 4FU8A 4AFSA 2BY8X 3NK8A