1SGNE

Asn 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
185
structure length
185
Chain Sequence
ISGGDAIYSSTGRCSLGFNVRSGSTYYFLTAGHCTDGATTWWANSARTTVLGTTSGSSFPNNDYGIVRYTNTTIPKDGTVGGQDITSAANATVGMAVTRRGSTTGTHSGSVTALNATVNYGGGDVVYGMIRTNVCAEPGDSGGPLYSGTRAIGLTSGGSGNCSSGGTTFFQPVTEALSAYGVSVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Streptogrisin B
publication title Recruitment of a Buried K+ Ion to Stabilize the Negative Charge of Ionized P1 in the Hydrophobic Pocket: Crystal Structures of Glu18, Gln18, Asp18 and Asn18 Variants of Turkey Ovomucoid Inhibitor Third Domain Complexed with Streptomyces griseus Protease B at Various pHs
rcsb
source organism Meleagris gallopavo
total genus 48
structure length 185
sequence length 185
ec nomenclature ec 3.4.21.81: Streptogrisin B.
pdb deposition date 1999-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sgnE02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sgnE01
5F8TA 2AIPA 2BLQA 1BTWA 1ELCA 3NXPA 1GMCG 1O2GH 3B8JA 2Q6DA 2WPMS 1T4VH 3TNTA 1UTNA 1O5EH 2ZHQH 2VIQA 1BJVA 1G3BA 4MNWA 5F03A 2ANYA 4BAQB 2FIRH 1DOJA 1GHWH 1NRRH 2C3SA 1UK4A 3PMHB 3T26A 2RA3A 1SGFA 3MWIU 4AG1A 4K2YA 4B2AA 2WPJS 4BAHB 1A61H 1TPSA 3VB5A 4WMEA 1BMAA 2BD8A 3NCLA 4I8KA 1MTUA 2Z9GA 2PUQH 1BITA 3EGKH 4YM9A 1EP6A 3GDVA 2OQ5A 3ITIA 1ZGIA 2FZZA 2GDDA 3P70B 1A4WH 3LONA 3VFEA 2BD3A 2ZFSA 1Y8TA 1IOEA 3A8BA 1ZTLA 1UK2A 3HKJB 2V6NA 1NESE 3DA9B 3RXLA 1AHTH 2OLGA 2BDHA 1XKBC 1XUFA 1GMDF 1S81A 1TAWA 2GZ9A 4ZKRU 1GJ4H 1HBTH 2BY9X 6LPRA 4GSOA 2BY5X 1OPHB 1EAIA 2XC4A 1YPGH 3A7WA 3I78A 4CHAC 1CT2E 1O2XA 4K3JA 3MO9A 1F0TA 1O2MA 3IITA 1TGBA 3SOSA 2ZDAH 1DWDH 2BY6X 2FS8A 2Y5GA 2XBWA 3RXVA 3WY8A 4TPYA 1DSUA 1P9SA 2W26A 1RTLA 4K1TA 3SJ8A 5A0AE 1AY6H 1SGIB 3MNSA 3RXDA 1T8MA 1F0UA 3E1XB 5JB9S 2PUXB 4DIHH 4MNVA 2BB4A 9LPRA 1YM0A 4JYVH 3GY2A 2FESH 1ZTJA 1VCPA 1T32A 1EPTB 4H6TA 1V2UT 5C1XA 4A1VA 3BN9A 1QQUA 1TOMH 2J92A 4AGJA 2FS9A 1DE7H 2XBXA 2XCNA 4CRFA 5L6NH 4Y71A 1ZPCA 2Z3EA 1DSTA 4NWLA 1C5PA 1BRCE 1MKWK 5FPSA 4B75A 4ZKNU 3GISB 4K8YA 2Y82A 2ODYB 5CHAB 2GZ7A 2ZDNA 3NUMA 3JZ2B 1P3CA 3H7OA 2OINA 2D8WA 1NM6A 3SQHE 1Z8GA 3EYDA 1QURH 1GCDA 3GCTF 1TX6A 4GCHG 1OWKA 1GWAA 3SUDA 3PMAB 1FAKH 4BAMB 4HGCA 2B5TB 2TGAA 2QIQA 2Y5HA 2B0FA 5TCCA 4AG2A 3E90B 2VWLA 4HTCH 3TNSA 3ZVBA 1UMAH 4UFFH 1C2HA 1ZRKA 5DGJA 1TMBH 1Y5UT 4RN6A 1EJAA 4X2YA 1DITH 3A8AA 1HXFH 1AKSB 2XNIA 2F9VA 5A2MH 2ZQ2A 2ZDVH 5CMXH 3A8DA 1S0QA 1G32B 3TITA 1C2MA 1DPOA 1GBBA 1T31A 1GHAF 3BIVH 1HIAA 1XUGA 2UWOA 2QF0A 1VCQA 2ZU3A 1DY8A 1AVXA 1J17T 2Y80A 5AF9H 1NZQH 5E2PA 1XM1A 1YPHC 3F1SB 4ZHAA 2F83A 1T8OA 1BMMH 1GGDC 2XCFA 1SFQB 1ESBA 2ALVA 3QUMP 2DE9A 1P2MA 3SBKA 3UOUA 4CR9A 4OS5A 2ZECA 3T5FH 3GDUA 3FANA 1TONA 1YPJH 3LOXA 5JDUB 3T27A 1SGPE 3Q76A 1AMHA 1PPGE 1O3FA 3H7TA 5A0BA 3A86A 2AFQB 1GJ5H 4ISNA 3SQEE 1TPPA 4LZ1H 2BXUH 3VGCB 2XYAA 3KCGH 4ABJA 1J9CH 1TGTA 4AGKA 1CGJE 2R0KA 1HXEH 4KTCA 2WPLS 1O2TA 1DXWA 3M3TA 1D3QB 1CO7E 5AFYH 1Y3WA 1JOUB 2XBYA 1IHTH 2ZHEH 1GHVH 2QY0B 4DG4A 1ETRH 1O3KA 3RLYH 8GCHF 5JB8S 3NPSA 3GYLB 1N1LA 1D6RA 1EP5A 3VB4A 1GBEA 1C2GA 4NSYA 1JBUH 1G30B 2BDCA 4WJG2 4D9RA 4DGJA 1FN6A 1O2IA 4X6PA 2BDGA 2W3IA 4KGAA 2BX4A 4ISHH 1NPMA 1GBAA 1O2VA 1W0YH 4ZHLU 2GGVB 2GCTB 4A92A 4GHTA 4FVDA 1Z1JA 1SC8U 1BMNH 1OXGA 1RRKA 2FOCA 3PYHA 1THSH 1CHOG 4DW2U 3LDXH 5DP5A 3HK3B 5JBTA 4E06H 2VWMA 3PLKA 1HV7A 3FP7E 1C2IA 4FUDA 4A1TA 2BQ7B 1LTOA 1TBRH 4XSKU 2CF9H 5FBEA 3RXSA 2H5CA 3LH3A 1FN8A 1K2I1 1LDTT 1OP8A 4IMZA 5FPYA 1C2LA 1OWEA 2VH6A 2QF3A 1FIWA 4AFSA 4CHAB 2C8XB 4ABDA 1CA0C 1H9IE 2HRVA 3GCOA 2BLVA 1AE8H 1JIRA 1P10A 2W7SA 1UK3A 2VIOA 3UNRA 1TLDA 3LGWA 4GHQA 1NRNH 2WPHS 1HDTH 4YLQH 4NA9H 3SNCA 4AFZA 1Q2WA 2ZA5A 1TPOA 1RS0A 3S9CA 2HLCA 1ABIH 4SGBE 2ZG0H 5K7RA 1O3DA 1RGQA 2XBVA 3D62A 1GI7B 1TNHA 4CH2B 1O3AA 1IQNA 3SJIA 3TU7H 1SFIA 2GCHF 1V2LT 4X6NA 1O2YA 1CQQA 4NCYA 1QBOA 3SU6A 1PJPA 1O33A 3HGNA 2FLRH 1TGCA 4Y8ZA 1O3NA 3ESTA 1AGJA 2ANMH 4LK4A 1YBWA 2H9EH 8LPRA 1AVGH 3O8RA 3E8LA 1TNGA 1MZAA 1F0RA 3TGIE 1C5QA 1C1RA 1PPCE 2BLOA 3ZYDA 4E05H 2QXHA 5HYOA 2AMPA 2G81E 1LVOA 3AAVA 4H6SB 3U1IB 2ZWLH 1P2OA 1AFEH 3SV2H 4JZFH 2RG3A 1P11E 4YT6H 2ZDLA 5ABWA 1PPFE 1D9IA 7KMEH 3P6ZB 1SLWB 2QAAA 4MLFB 1F92A 2FM2A 2STAE 7ESTE 1XUKA 1O2OA 4JMYA 1O2QA 2ZP0H 1Z8IB 1SLUB 1W7GH 5ESTE 1W10U 1BJUA 2ILNA 3BEFB 1JRSA 2G4UA 2WYJA 1O0DH 3M7TA 3S9AA 4AOQA 4I7YH 1TB6H 1GJDB 1C1MA 3PB1E 4X1SU 1O30A 1HAIH 3LKWA 2PKSC 3IG6B 2FLBH 5LPFA 1G3EA 2QXJA 2C4FH 4ZHMU 5A09A 1TQ7B 2AMDA 2YNAA 4ABAA 3A84A 1GGDB 1O3CA 1PPZA 3MH6A 4K5ZA 1MCTA 2JH5D 3OSYA 2ZPRA 5E2OA 3GY6A 2CHAC 2GZ8A 1PYTD 3SV8A 4X2WA 1SBWA 5FHTA 4XBDA 3RMOH 1CVWH 3MFJA 2GP9B 1IAUA 2QA9E 1VGCC 3UNQA 1O5BB 1C5LH 3P95A 1UTQA 1P2KA 3RXAA 2B9LA 2ZFQH 1J14A 2Z94A 3ZZ8A 2GV7A 1K1OA 2CXVA 4O03A 4MVNA 3RP2A 3MO3A 1OX1A 1SI5H 5AFZH 2ZTYA 3N7OA 2G55A 5HGGA 2ZHDA 1ZMJA 5J4QA 4D8NA 1FY3A 4Q7YA 1TX7A 3F9HA 1GJAB 4B71A 1BUIA 1C2DA 1BHXB 2OTVA 2J34A 1P02A 5DP4A 1KLIH 1GJ7B 2IPHA 4YOIA 3RXFA 1TX8A 3CS0A 4FUGA 5FAHA 4A6LA 1L1NA 2Q6FA 4X6OA 1THRH 2ZEBA 4ZMAH 1ANDA 1H8IH 2F9BH 2SGQE 3Q3KA 2RA0A 1MAYA 7GCHF 1C5SA 4CRDA 3P8GA 1J15A 3I29A 1Y3UA 1SGCA 3F68H 5ETXA 1KXEA 3M5OA 2AERH 1C2KA 3AASA 4Y0ZE 3GCHC 4XBCA 1IQGA 1O3LA 4R0IA 1C5RA 4UD9H 1O2JA 1LHEH 1MU6B 2FX4A 2P8OC 1CA0B 1WQSA 1A5HA 2P59A 2ZC9H 3T2NA 2A45B 2F9UA 3MI4A 4CBOA 2HPQH 4GVUA 2Y7ZA 2GTBA 5C1YA 2BD7A 2VWNA 5JBCS 3ZZCA 5CHAC 4GAWA 2O8LA 3BTWE 4YZUA 4JZ1A 1DFPA 1DUAA 1BZXE 1JXPA 3RMMH 3RU4E 4UFEH 1P2JA 1U6QA 2B8OH 5A8ZA 1C5OH 1P3EA 3T29A 4X1PU 1GMHF 1GBKA 2W7UA 1TPAE 2SNWA 1QQ4A 3M3SA 3URDA 2F91A 2F9PA 1S6FA 5DG6A 1SPJA 1NC6A 5FXLA 1C1OA 1D3TB 4Y10E 3RXBA 3UR9A 1D4PB 5A8YA 1XXFA 3UUZA 1C4V2 3SU0A 1BHXF 4ZUHA 2XWBI 1GL0E 1V2VT 1SR5C 4ABHA 2WYGA 5F8ZA 4Q7XA 2ZO3H 1ARBA 3SU5A 1SSXA 1O3MA 3TK9A 1P2QA 1JWTA 1GI8B 4FXGH 1MD8A 3GY7A 2Y6TA 3LPRA 4O3UA 1LHGH 1PFXC 3RXEA 1HNEE 5E0GA 5C5OA 1Y59T 1FIZA 2PFEA 3RMNH 1SGYE 2Z9LA 2VB0A 4Z0KA 2ZPQA 1BTUA 1O5AB 1ETTH 1QIXB 3UIRA 1ELAA 1F5RA 1GMCF 2GVFA 5PTPA 1ACBE 2FPZA 2FEQH 1SLVB 1DWBH 1G3DA 2OQUA 2SGEE 3F6UH 3ZZ4A 4INHA 4ABGA 1MTNC 3BTTE 1O39A 2PKSB 1BMLA 1XKAC 1EB1H 3M3VA 3A85A 1CSOE 4UFDH 2BOKA 7LPRA 1IQFA 1FY1A 5AHGH 4JYTA 5GWZA 3RXGA 1SOTA 1CA8B 2O8WA 3L6PA 1W3CA 4AYVB 4KELA 1YCPH 2GCTC 4DOQA 2CHAB 1TMTH 4I8JA 4AB8A 1P09A 4NIWA 1GI2A 1QRWA 2ZU2A 1GDNA 2G52A 1MH0A 4WWYA 1ESTA 2BD4A 1VGCB 3MNXA 1LVYA 2ZDMA 4DIIH 1EZQA 3EDXB 3MMGA 3P8NA 4Y8XA 4KTSA 2IN2A 2VIPA 3M5LA 2G4TA 4IN2A 1FXYA 3ZZ6A 1UTJA 1QB1A 3LGIA 1AZZA 2ZGJA 2UUYA 4WVPE 1GBJA 4IW4E 2QXIA 3O8DA 3OY6U 1HAHH 2WINI 1VJAU 3K6YA 2OC1A 3ATIA 5JBAS 3P17H 4WXVA 5BRRE 3CENA 3A7YA 3UWIA 3GYMA 4CRCA 2A5KA 3KQCA 1ELFA 4AX9H 3L33A 2FXRA 3KQBA 1K1JA 2QXGA 1DS2E 1KXFA 1Z8RA 1J8AA 3TGJE 4DT7B 8KME2 5FCKA 1BTYA 3QLPH 1GHYH 3ZZ9A 2BDYA 1KTSB 2WV5A 3TJUA 1K9OE 3B23B 3E0NB 3Q77A 1FV9A 4HFPB 3UWJH 2BM2A 3A89A 1UTOA 1GVKB 4D7GA 1O3GA 3GCHB 5EQSA 4PROA 3ZVAA 4H4FA 1C5ZB 2BZAA 2YOLA 3KEEA 4NIVA 4OGXA 1K1IA 3UREA 2P8OB 1HAPH 4X1QU 2R0LA 1IQEA 3ODDA 2A1DB 1ELGA 1IHSH 1QL7A 2KAIB 1EKBB 2UWLA 2GV6A 4MPWA 1NRPH 2PTCE 4IN1A 4K1SA 4DCDA 3ZVDA 3FZZA 1PPHE 5IDKA 2OD3B 1T8NA 3ATKA 1D6WA 4ASHA 2HNTC 4GCHF 5F6MA 1AUTC 4BANB 4AORA 1QA0A 1TBZH 3FAOA 1P2NA 5FBIA 3ZZ7A 2R9PA 1AB9C 1S82A 4WY3A 1K21H 1ZPBA 4FUEA 4AB9A 3UQVA 1Z6EA 3LU9B 3BTME 3FP6E 1LPGB 3K9XB 1NFXA 1LKBA 2ZZUH 5GDSH 3TK5A 2FODA 1O35A 1MKXH 3DD2H 3MU8A 5LPEA 8ESTE 1MKWH 1GDQA 3PMBB 4A7IB 1HAZB 1UVUH 2VWOA 1CE5A 1O2HA 1A3EH 1V2PT 3SU4A 2ZHWH 1TQ0B 2A2XH 4MNXA 4JZDH 2PSYA 2H9TH 2ESTE 1E38B 1NY22 2ZFPH 2G8TA 4WH8A 2P94A 1ZYOA 3QTOH 2F3CE 5I46H 2THFB 3A87A 1ELDE 1S83A 2BD2A 3VB3A 1HB0B 3BTQE 1EATA 4WF8A 5GCHG 3IWMA 4KTUA 2VH0A 5FX6A 2VNTA 3V0XA 3KGPA 1W2KH 1QGFA 1ZPZA 1C5VA 1A0HB 1RTFB 3RDZA 5EQQA 1ARCA 1THPB 1O37A 1BRAA 3DFJA 2PGBB 3ZV8A 4BNRA 1B0FA 2ZI2H 2H9HA 3RXPA 1O5FH 1UVOA 1WTHD 2HOBA 3SI4H 1EZUC 3KQDA 1MTNB 4X8UH 3SUGA 2ZGHA 2Z9IA 2W5EA 3BTEE 1HCGA 2ZKSA 2V3HH 1KDQB 5L30H 1O5DH 4NGAH 1O3JA 4NSVA 1V2NT 1XX9A 4JK5A 1CHOF 1ZHPA 4ESTE 3D23A 4JCNA 3OX7U 3STIA 4NZLA 2AGEX 1JIMA 2W3KA 1GCTC 1C5TA 4UDWH 2QC2A 1HJ8A 3V3MA 1AO5A 1NRSH 2Y81A 1UHBB 4X1NU 4TYDA 2K1QA 3UR6A 2TIOA 1ZZZA 2XC5A 2PV9B 2F9OA 2SGDE 4CRAA 3BV9B 1PPBH 4Y7BA 1SHHB 1PQ8A 2V0BA 3RXKA 4TWWA 2ZTZA 4K1EA 4VGCC 1MBMA 5TCAA 1TGSZ 4Y7AA 1NS3A 1G36A 3EE0B 3A7TA 2BXTH 2VGCC 1GVZA 1MTSA 1NROH 3UPEA 4X2VA 2TGDA 2J38A 3KNXA 4UE7H 4NA7A 1K1LA 2JKHA 3ZVEA 3AW1A 3TH3H 1KXCA 3VXFH 1XVOA 4XBBA 1DLKB 2ZFFH 1NT1A 1AI8H 3MH4A 4YLUA 1B0EA 4RSPA 1A2CH 2O9QA 1KXDA 4TWYA 3LIWA 3UFAA 2ZCLP 2Z3DA 2P93A 5ESBA 3LJOA 1SQOA 1L1GA 1PQAA 3RXJA 3VXEH 5LPRA 2A32A 1L1JA 2XRCA 1AUJA 4Y79A 2FYRA 2OP9A 2BDAA 1CGHA 1NO9H 1E34B 2PW8H 4THNH 1UJ1A 1ZJDA 3MU5A 1H9HE 1GJ8B 3BTGE 1HGTH 1FQ3A 2TPIZ 4NIXA 3PTNA 1O3EA 4Y6DA 1N8OC 1XUHA 4NG9H 3SGBE 5DP8A 1B7XB 1O2RA 4I8HA 1MUEB 2A7CA 2AGGX 4F49A 3W95A 2GT8A 1V2TT 2G51A 3F9FA 1EASA 1O5CB 2ZHFH 3DUXH 2J9NA 3BTDE 2EI6A 3SO3A 1HUTH 3MO6A 2KAIA 1AB9B 3ATLA 2XC0A 5C1UA 1DX5M 3BSQA 3HGPA 5EXNA 3PLPA 3SNEA 2BOHB 3ZVGA 1TRNA 4FUIA 3UQOA 1CU1A 3V13A 3P8OA 2WUCA 3TGKE 2O8TA 1DT2A 4ZKSU 1DDJA 1UTMA 3ZVCA 2EI7A 3BIUH 2A7HA 2FDAA 3MYWA 2JH0D 1ANBA 2FOFA 2AMQA 2Z9KA 4BTIB 1C1PA 4Q2KA 1V3XA 3SU1A 3DFLA 1C1WH 1NFWA 1YCPM 1BA8B 1GBTA 1QB9A 1K1MA 2RCEA 4BAOB 1YPKH 1KLJH 2OC0A 1CT0E 3K2UA 2BQ6B 3TH4H 1EB2A 5E0JA 1FY8E 1DY9A 1G9IE 4ISLA 3GY4A 4I8LA 1NRQH 2BDBA 2UWPA 4J2YB 1E37B 1ZSJA 1OP2A 5JYIA 1KYNA 2EA3A 1C9PA 3Q3XA 4AFUA 1GI1A 3ATWA 2ZNKH 1N6XA 1GI5A 1GHBG 2ZGXH 1TNIA 2H6MA 2Y5FA 1QA7A 3TPIZ 1EOJA 1VITF 3QTVH 1QTFA 3SZNA 1IQJA 3RXHA 1WCZA 4O9VA 3A80A 4IGDA 4IS5A 4MNYA 3SU2A 3V7TA 1VZQH 3S0NA 1A1RA 2CMYA 1G3CA 3T25A 3ZVFA 1LQEA 2HALA 3C27B 1BB0B 5EPYA 2XWAA 4ZKOU 2STBE 2PSXA 1O2LA 1SGDE 3MH5A 3M35A 2J2UA 4D7FA 3SGQE 2QGRA 1KTTB 4ABFA 4NFEA 3SV6A 3GDSA 3UNSA 2HNTF 1UCYH 3GY3A 3ZZ3A 2F9NA 3DHKH 3BEIB 1G2LA 4X8VH 4H42U 1LQDB 2O8UA 2GDEH 4ZXYH 2NU1E 5GJ4B 2ASUB 3SW2B 4K8BA 3TJNA 2R2WU 1YKTA 2R3UA 3LGVA 3KHVA 1GI4A 4FU8A 4IMQA 1GJ6A 1HYLA 4M7GA 1P04A 1PQ7A 1DWCH 1GCTB 3SV7A 1FMGA 1KDQA 2C93B 2Q1JA 3QDZB 4BTUB 2FP7B 3M37A 3MNBA 4MDSA 4B73A 1ZJKA 2P3TB 1W0ZU 2A0QB 1J16A 2UUKB 2CJIA 1IQHA 2UUJB 2BD9A 3KL6A 4TY7A 3EAJA 4ZXXH 3PLBA 1A46H 2OC7A 4OS7A 1SG8B 3HK6B 1K28D 1K22H 6GCHG 2O8MA 1Y5AT 1EXFA 4VGCB 4YTAA 1GJCB 1OSSA 1YPLH 1BQYA 1SVPA 1UHBA 2SGFE 1NU7B 1SGFG 1A0LA 3PV4A 1Z71A 5T6GA 2ZF0H 1P05A 1ZLRA 2VGCB 1UTPA 4A1XA 1E35B 1D3PB 2VJ1A 5DJ7A 1P12E 3UY9A 1ZHRA 3A83A 5J4SA 1AN1E 2H5DA 3AVZA 1BRUP 2CF8H 1DVAH 1P03A 3GOVB 4J1YA 1C4Y2 1V2OT 2TGPZ 4INKA 5SGAE 4A5TS 2SFAA 1EJMA 3P92A 3UOPA 1NFUA 3SHCH 5TJXA 3M5MA 1O32A 1OWJA 1UCYE 1ANCA 1TWXB 4CREA 3RXUA 1SB1H 2ZU1A 1UVTH 1TBQH 1DM4B 1GDUA 4CRBA 2QV1A 3PWCA 2G5NA 3RXTA 2G00A 1RTKA 1WUNH 1FAXA 1L2EA 1C5NH 1LHFH 1O2UA 1O3BA 1Y3YA 4NA8A 5JBBS 1KXBA 1GI6A 3F9EA 4I32A 1HFDA 1QBNA 3NWUA 1N8OB 1GI0A 1LPKB 1TNJA 4BAKB 1XMNB 1JMOH 1P57B 4Y8YA 3RM2H 1AD8H 1SGRE 1TYNA 2BHGA 2PTNA 3ZZ5A 1ID5H 1BBRH 1DICA 1ZHMA 4ZAEA 1KLTA 4FU9A 4YO9A 2ZTXA 1H1BA 2BVSH 4UONA 2BYAX 3SUEA 5L2YH 3FZDA 1P01A 1TOCB 1BIOA 2A4GA 1DWEH 1S5SA 1S6HA 4MTBA 1O2WA 4CRGA 1X7AC 3SJKA 1BT7A 2DUCA 5T6DA 3KF2A 1DLEA 3K6ZA 1AE5A 2ZCHP 1OS8A 2AIQA 4KP0A 2P3FH 4AFQA 1D3DB 4OGYA 1TRYA 5GPIB 2WV4A 1FPHH 1HAYB 1CT4E 1GG6C 2SGPE 1YCPK 1V2QT 2ZPSA 2BY7X 2P16A 2Y7XA 1HAGE 2IJOB 5FPTA 1ETSH 2FO9A 5GIBA 1DXPA 1W14U 1HJAC 1EAWA 1A5IA 1P8VC 1V2RT 1W7XH 3GCNA 4Y11E 1F7ZA 5EGMA 4ZH8A 3RC5A 2B7DH 5EXMA 1QRXA 1W12U 1LCYA 2OCVB 1GPZA 1KXAA 5DP7A 4OS2A 3BG8A 3CP7A 3LC5A 4JZIA 4K69A 4RKOB 2A5IA 2XXLA 2SGAA 1TA2A 1YC0A 1TMUH 3U9AH 1EUFA 1QY6A 5I25A 1LVBA 1HPGA 1Y3XA 1QJ6B 4ISOA 2M5TA 4Q7ZA 1ZSLA 3Q3YA 1C5YB 1EAUA 2NU2E 5EG4A 1AIXH 3LJJA 2FOEA 1K1NA 2AS9A 1WQVH 3SNDA 1JRTA 3MU1A 1W8BH 1BBRE 1FJSA 1NN6A 4IC5A 3TJVA 1OWDA 1OWIA 2HVXA 3H5CB 3OTJE 4I8GA 1MMJN 1FLEE 4WH6A 1RFNA 2Z7FE 1SLXB 3RM0H 1QRZA 2FOGA 1ABJH 3S7HB 1ELVA 2P3UB 4HZHA 2ALPA 1GBMA 2OBQA 1QJ7B 1BTZA 3S7KB 3SUFA 3NZIA 1AZ8A 4E7NA 4WXIA 1SMFE 1S84A 3SJ9A 1GMDG 3U69H 1ESAA 2A4QA 4U2WA 4ABEA 3K65B 2QYIA 3GY5A 3ZZDA 1F2SE 3ZZAA 1KSNA 2QCYA 4TY6A 1ANEA 2WPKS 3QO6A 4HI3A 5CE1A 5A0CA 4CH8B 1Q31A 3EQ0H 2TBSA 1O36A 4B1TA 1H8DH 1AFQC 2J4IA 2OXSA 1OOKB 4ZROA 3MOCA 1SGEE 4LXBH 1EZSC 3A81A 4JK6A 1F5LA 4NIYA 2NU0E 2BVRH 1GVLA 4UEHH 2AEIH 1C5XB 4YESB 3BEUA 3Q00A 3A88A 4X2XA 1V6DA 4MQAA 2ULLA 1MAXA 1XUIA 2ODQA 1QFKH 2ZGBH 2FI4E 2OC8A 2TRMA 3RXMA 4U01A 3SV9A 3BTFE 3QN7A 1E36B 2VVUA 3QGJA 1TE0A 1ZGVA 1OP0A 5FX5A 1C5MD 1MKXK 1W13U 1A0JA 4WMFA 1HAOH 1VITH 2P95A 1LHCH 4F4OC 3KN2A 2D26C 3TH2H 1WYKA 1BCUH 1YGCH 2PLXA 1KY9A 3E0PB 3SI3H 1QB6A 2UUFB 4OS4A 3D65E 1V2ST 1EX3A 2D1JA 3SORA 1YLDA 3GCTG 1P0SH 1HAXB 3S9BA 4YT7H 5EXLA 1IQMA 1T8LA 4CR5A 3U98H 3FVFB 2BMGB 3RC4A 2ZU4A 2BD5A 1V2KT 2FTLE 2Q6GA 1S0RA 1C2JA 4INLA 1FPCH 1YPEH 2AYWA 1UO6A 3RXRA 4DY7B 4U30A 1IQKA 1GBFA 1SL3A 4UFGH 1YF4A 2CN0H 3MH7A 3RMLH 3M7QA 5EODA 3SU3A 2BX3A 1LO6A 3T28A 3TK6A 3HATH 3G01A 5GCHF 1RXPA 3FP8E 4XDEA 1AWHB 2GMTC 1L4DA 2I6SA 3SJOA 3TJOA 1EAXA 2C8ZB 1TABE 1GHAG 4FUJA 5HM2A 3U8RH 1ELBA 3LT3A 3BG4C 2A31A 1GBHA 2ZCKP 3RXCA 4JZEH 1PPEE 5JPMH 1QHRB 3MHWU 3VPKA 2BLWA 4GLYA 3GICB 2ODPA 3QX5H 1SOZA 3PO1C 5EPNA 3W94A 1LHDH 3GY8A 2FI5E 4FUCA 4MPVA 1AQ7A 2QN5T 3ENSB 1GG6B 5DK1A 1ELTA 1MU8B 3ELAH 2BY8X 1MD7A 4AYYB 1HAVB 3NK8A 1WAYB 3QK1A 1A5GH 1HJAB 5DP9A 2G5VA 3OY5U 3M5NA 1MCVA 4GUXA 1UVPA 3KIDU 1VCWA 4OS1A 3V12A 1O3IA 1IQIA 3RLWH 1EZXC 1V2WT 1FZZA 3MU0A 4IBLH 2FOAA 1BTPA 5H4IB 1G37A 2JETC 1SGQE 2PKAB 4BOHA 2FMJA 8GCHG 3DT0H 1F0SA 3KQEA 3CS7A 3MTYA 3PM3A 3EA7A 2PGQB 5EU8A 1RIWC 2HNTE 1UTLM 3EA9A 2FOMB 3AAUA 1QCPA 1QJ1B 2SNVA 1QBVH 1LVMA 2EI8A 4DVAU 1AVWA 4BXSA 1C5WB 3MNCA 4K60A 3M7UA 5E0HA 4BXWA 1WBGB 4DURA 3T62A 4X8TH 4JYUH 2EEKA 1MBQA 1NFYA 3OU0A 4FVBA 1GJ9B 2VIVA 2ZIQH 4E7RG 4KKDA 2GX4A 2FWWA 2ZDKA 4X0WU 2PWXA 1HRTH 1ZSKA 1SGTA 2Z9JA 1AWFH 4ABBA 1EOLA 1MZDA 2ANKH 1ZRBA 1O38A 1EJNA 3SGAE 3PROA 3VEQB 6CHAC 3A8CA 2ZFTA 1TALA 5T6FA 1YPHE 1PQ5A 2V35A 3RXQA 1V2JT 1GBCA 1L4ZA 1TRMA 2HWLB 1GBDA 3RUOA 1AFQB 1Z7KA 1O34A 3M36A 1SHYA 4O3TA 2VIDA 4QT8C 3U8OH 2VU8E 1O2KA 1C2EA 3SN8A 1QL8A 1ELEE 4Y0YE 4Q80A 1HLTH 2CGAA 1T7CA 3TIUA 4AZ2B 3QZRA 3P8FA 2BDIA 1MTVA 2GCHG 3RU4T 2OBOA 2HGTH 1MQ6A 5BPEA 5EOKA 4MPUA 3ZZBA 1E0FD 3HKIB 5FCRA 1C2FA 1O2ZA 5IYTA 3VB7A 1C4U2 3VB6A 1LKAA 4AN7A 1FUJA 4XFQA 3RU4D 2LNCA 1NTPA 2A5AA 4B74A 4FUHA 1FY4A 3ODFA 1EPTA 4MG3A 4TPIZ 2A7JA 3C1KA 1OYQA 4I33A 4ABIA 2DE8A 3RXIA 1GHZA 3SNBA 1C1UH 2H2ZA 1TIOA 1CBWC 3UTUH 1ZTKA 2R3YA 4B76A 4XE4A 1O5GH 1TNLA 2BQWB 1WV7H 2FTMA 3U1JB 5DP6A 3OYPA 1TGNA 1YLCA 2WPIS 2CV3A 1M9UA 1Z6JH 5C2ZA 3M61U 1C1SA 2Z3CA 4X1RU 1C1TA 1ZMLA 2ZU5A 2ZGCA 1L0ZA 3A82A 3F9GA 3LGUA 5F8XA 2BVXH 1OYTH 1LPZB 3MU4A 2A4OA 4IC6A 2FX6A 5C5NA 1GI9B 3BF6H 1Z1IA 3O8BA 3SHAH 2C8YB 1GI3A 2V3OH 1WU1A 1GHBF 1ZOMA 2GMTB 5L2ZH 4I31A 2EC9H 3A7ZA 1QNJA 2GT7A 3BG4B 1OWHA 1GBLA 1ZR0A 1H9LB 1RJXB 3A7VA 3PMJA 4X6MA 3E16B 2OUAA 6ESTA 3O8CA 3BTHE 1O3HA 1AKSA 2C8WB 3I77A 4BTTB 1INCA 2YNBA 1HJ9A 4NZQA 2BZ6H 3PO1B 3R0FA 4FU7A 4R8TB 4YOJA 1UCYK 1F5KU 1ZMNA 1C9TA 1A7SA 1LMWB 5LH8A 3PWBA 1T4UH 3PTBA 1VJ9U 1Y5BT 3QGNB 2VINA 3HPTB 4MPXA 2JH6D 1FONA 1O3OA 5DP3A 4B2CA 2A4RA 4FUBA 1VITG 2IOTA 3E6PH 1Y3VA 2J95A 1C1NA 1MQ5A 1OKXA 2RDLA 1O2NA 1KIGH 1AU8A 2JETB 2A2QH 3A7XA 1CGIE 3RXOA 3SNAA 1FDPA 1HAVA 2NU3E 5C3NA 1A3BH 5LGOA 1GL1A 1BRBE 1QR3E 4NFFA 1RIWB 3BTKE 1WSSH 3NKKA 4B2BA 5A8XA 3QWCH 3LH1A 2VVVA 2GKVE 3ATMA 2PKAA 3URCA 4CBNA 1Q3XA 4WMDA 2NU4E 1MTWA 3E91A 1GJBB 6GCHF 5DKMA 1W11U 1WTGH 1XUJA 4GPGA 5EQRA 7GCHG 3QZQA 1G2MA 1NU9A 1P9UA 1SGNE 1PYTC 2AH4X 5AVDA 1IQLA 3U8TH 1BDAA 4OS6A 1FY5A 1XVMA 2J94A 1EPTC 1O3PB 2PHBA 5HXFA 1YYY1 1S85A 1YP9A 2HPPH 2PR3A 2ZFRH 1TFXA 4LZ4B 5E8EH 1EQ9A 1C1QA 1FNIA 4D9QA 2FOHA 6CHAB 9ESTA 3FFGA 1O2PA 3S69A 3JZ1B 5GXPA 5C67A 3TLOA 4U32A 1B5GH 4Z6AH 4FUFA 2XTTB 1CHGA 2R2MB 1C5UA 3ZV9A 2D2DA 2Z6BD 1XXDA 1UVSH 1O2SA 3STJA 1FI8A 5T3HA 1ORFA 2TGTA 3LC3A 2LPRA 4SGAE 1TA6A 2VVCA 1BTHH 5HMAA 1BTXA 3LGTA 1C1VH 1BBRK 1K1PA 4D76A 2C90B 1DUEA 4LOYH 1HIAB 2XW9A 4O97A 5EW2H 1SQAA 1YPMH 3AW0A 5EW1H 5DO4H 4XOJA 2NWNA 4X8SH 1P06A 2ZQ1A 4YOGA 2GD4B 1GMHG 4NWKA 1DANH 2ANWA 3L3TA 1N6YA 2FI3E 1BOQA 1Z8JB 5HM9A 3E3TA 3D49H 5K0HA 1GHXH 2FOBA 3ZYEA 3LGYA 1P2IA 5C20A 4ISIH 3RC6A 5B6OA 1GBIA 1UTKA 4Y76A 4RKJB 1WOFA 1VR1H 2WUBA 5G4BA 2FYQA 1CBWB 1RD3B 2BTCE 1QL9A 2VIWA 2AGIX 1TNKA 3EA8A 3R3GB 1H4WA 1SQTA 5DPAA 3TVJB 3VGCC 2H1UA 4DJZB 1V2MT 2I6QA 1O31A 3B9FH
chains in the Genus database with same CATH superfamily
1E1QD 5F8TA 2AIPA 3NRLA 2BLQA 1BTWA 1ELCA 3NXPA 1GMCG 1O2GH 3B8JA 2Q6DA 2WPMS 1T4VH 3TNTA 1UTNA 1O5EH 2ZHQH 2VIQA 1BJVA 1G3BA 4MNWA 5F03A 5IK2D 2ANYA 4BAQB 2FIRH 1DOJA 1GHWH 1NRRH 2C3SA 1UK4A 3PMHB 3T26A 2RA3A 1SGFA 3MWIU 4AG1A 4ACAA 4K2YA 4B2AA 2WPJS 4BAHB 1A61H 1TPSA 3VB5A 4WMEA 1YLNA 1BMAA 2BD8A 3NCLA 4I8KA 1MTUA 2Z9GA 2PUQH 1BITA 3EGKH 4YM9A 1EP6A 3GDVA 2OQ5A 3ITIA 1ZGIA 2FZZA 2GDDA 3P70B 1A4WH 3LONA 3VFEA 2BD3A 2ZFSA 1Y8TA 1IOEA 3A8BA 1ZTLA 1UK2A 3HKJB 2V6NA 1NESE 3DA9B 3RXLA 1AHTH 2OLGA 2BDHA 1XKBC 1XUFA 1GMDF 1S81A 1TAWA 2GZ9A 4ZKRU 1GJ4H 1HBTH 2BY9X 6LPRA 4GSOA 2BY5X 1OPHB 1EAIA 2XC4A 1YPGH 3A7WA 3I78A 1NBMD 4CHAC 3DCLA 1CT2E 1O2XA 4K3JA 3MO9A 1F0TA 1O2MA 3IITA 1TGBA 3SOSA 2ZDAH 1DWDH 2J98B 2BY6X 2FS8A 2Y5GA 2XBWA 3RXVA 3WY8A 4TPYA 1DSUA 1P9SA 2W26A 1RTLA 4K1TA 3SJ8A 5DN6D 5A0AE 1AY6H 1SGIB 3MNSA 3RXDA 1T8MA 1F0UA 3E1XB 5JB9S 2PUXB 4DIHH 4MNVA 2BB4A 9LPRA 2WHXA 1YM0A 4JYVH 3GY2A 2FESH 1ZTJA 1VCPA 1T32A 1EPTB 4H6TA 1V2UT 5C1XA 4A1VA 3BN9A 1QQUA 1TOMH 2J92A 4AGJA 2FS9A 1DE7H 2XBXA 2XCNA 4CRFA 5L6NH 4Y71A 3PRDA 1ZPCA 2Z3EA 1DSTA 4NWLA 1C5PA 1BRCE 1MKWK 5FPSA 4B75A 4ZKNU 4F55A 3GISB 4K8YA 2Y82A 2ODYB 5CHAB 2GZ7A 2ZDNA 3NUMA 3JZ2B 1P3CA 3H7OA 2OINA 2D8WA 1NM6A 3SQHE 1Z8GA 3F2FA 3EYDA 1QURH 1GCDA 2W6JD 3GCTF 1TX6A 4GCHG 2GJGA 1OWKA 1GWAA 3SUDA 3PMAB 1FAKH 4BAMB 4HGCA 2B5TB 2TGAA 2QIQA 2Y5HA 2B0FA 5TCCA 5CDFE 4AG2A 3E90B 2VWLA 4HTCH 3TNSA 3ZVBA 1UMAH 4UFFH 1C2HA 1ZRKA 5DGJA 1TMBH 1Y5UT 4RN6A 1EJAA 4X2YA 1DITH 3A8AA 1HXFH 1AKSB 2XNIA 3PV2A 2F9VA 5A2MH 2ZQ2A 2ZDVH 5CMXH 3A8DA 2J97A 1S0QA 1G32B 3TITA 1C2MA 1DPOA 1GBBA 1T31A 1GHAF 3BIVH 1HIAA 5FL7D 1XUGA 2UWOA 2QF0A 1VCQA 2CK3D 2ZU3A 1DY8A 1AVXA 1J17T 2Y80A 5AF9H 1NZQH 5E2PA 1XM1A 1YPHC 5GNDA 3F1SB 4ZHAA 2F83A 1T8OA 1BMMH 1GGDC 2KCPA 2XCFA 1SFQB 1ESBA 2ALVA 3QUMP 2DE9A 1P2MA 3SBKA 3UOUA 4CR9A 1QZ8A 4OS5A 2ZECA 3T5FH 3GDUA 3FANA 1TONA 1YPJH 3LOXA 5JDUB 3T27A 1SGPE 3Q76A 1AMHA 1PPGE 1O3FA 3H7TA 5A0BA 3A86A 2AFQB 1GJ5H 4ISNA 3SQEE 1TPPA 4LZ1H 2BXUH 3VGCB 2XYAA 3KCGH 4ABJA 1J9CH 1TGTA 4AGKA 1CGJE 2R0KA 1HXEH 4KTCA 2WPLS 1O2TA 1DXWA 3M3TA 1D3QB 1CO7E 5F53A 5AFYH 1Y3WA 1JOUB 2XBYA 3KQ5A 1IHTH 2ZHEH 4ASUD 1GHVH 2QY0B 4DG4A 1ETRH 1O3KA 3RLYH 8GCHF 5JB8S 3NPSA 3GYLB 1N1LA 3OFND 1D6RA 1EP5A 3VB4A 1GBEA 1C2GA 4NSYA 3WWFA 1JBUH 1G30B 2BDCA 4WJG2 4D9RA 4DGJA 1FN6A 3DSGA 1O2IA 4X6PA 3OEHD 2BDGA 2W3IA 4KGAA 2BX4A 4ISHH 1NPMA 1GBAA 1O2VA 1W0YH 4ZHLU 2GGVB 2GCTB 4A92A 4GHTA 4FVDA 1Z1JA 1SC8U 1BMNH 1OXGA 1RRKA 2FOCA 3PYHA 1THSH 1CHOG 4DW2U 3LDXH 5DP5A 3HK3B 5JBTA 4E06H 2VWMA 3PLKA 1HV7A 3FP7E 1C2IA 4FUDA 4A1TA 2BQ7B 1LTOA 1TBRH 4XSKU 2CF9H 5FBEA 3RXSA 2H5CA 3LH3A 1FN8A 1K2I1 1LDTT 1OP8A 4IMZA 5FPYA 4RT1A 1C2LA 1OWEA 2VH6A 2QF3A 1FIWA 4AFSA 4CHAB 2C8XB 4ABDA 1CA0C 1H9IE 2HRVA 3GCOA 2BLVA 1AE8H 1JIRA 1P10A 2W7SA 1UK3A 2VIOA 3UNRA 1TLDA 3LGWA 4GHQA 1NRNH 2WPHS 1HDTH 4YLQH 4NA9H 3SNCA 4AFZA 1Q2WA 2ZA5A 1TPOA 1RS0A 4B6EA 3S9CA 2HLCA 3F2HA 1ABIH 4SGBE 2ZG0H 5K7RA 1O3DA 1RGQA 2XBVA 3D62A 1GI7B 1TNHA 4CH2B 1O3AA 1IQNA 3SJIA 3TU7H 2J98A 2F4LA 1SFIA 2GCHF 1KMHB 1V2LT 4X6NA 1O2YA 1CQQA 4NCYA 1QBOA 3SU6A 1PJPA 1O33A 3HGNA 2FLRH 1TGCA 4Y8ZA 1O3NA 3ESTA 1AGJA 2ANMH 4LK4A 1YBWA 3PV5A 3F2GA 2H9EH 8LPRA 1AVGH 3O8RA 3E8LA 1TNGA 1MZAA 1F0RA 3TGIE 1C5QA 1C1RA 1PPCE 2BLOA 3ZYDA 4E05H 2QXHA 5HYOA 2AMPA 2G81E 4XD7D 1LVOA 3AAVA 4H6SB 3U1IB 2ZWLH 1P2OA 1AFEH 3SV2H 4JZFH 2RG3A 1P11E 4YT6H 2ZDLA 5ABWA 1PPFE 1D9IA 7KMEH 3P6ZB 1SLWB 2QAAA 4MLFB 1F92A 2FM2A 2STAE 7ESTE 1XUKA 1O2OA 3KYFA 1O2QA 4JMYA 2ZP0H 1Z8IB 1SLUB 1W7GH 5ESTE 1WXRA 1W10U 1BJUA 2L6OA 2ILNA 3BEFB 1JRSA 2G4UA 2WYJA 1O0DH 3M7TA 3S9AA 4AOQA 4I7YH 1TB6H 1GJDB 2WZQA 1C1MA 3PB1E 4X1SU 1O30A 1HAIH 3LKWA 2PKSC 3IG6B 2FLBH 5LPFA 1G3EA 2QXJA 2C4FH 3F0PA 4ZHMU 5A09A 1TQ7B 2AMDA 2YNAA 4ABAA 3A84A 1GGDB 1O3CA 1PPZA 3MH6A 4K5ZA 1MCTA 2JH5D 3OSYA 2ZPRA 5E2OA 1H8HD 3GY6A 2CHAC 2GZ8A 1PYTD 3UB0A 3SV8A 4X2WA 1SBWA 5CHBA 5FHTA 4XBDA 3RMOH 1CVWH 3MFJA 2GP9B 3N7EA 1IAUA 2QA9E 1VGCC 3UNQA 1O5BB 1C5LH 3P95A 4YXWD 1UTQA 1P2KA 3RXAA 2B9LA 2ZFQH 1J14A 2Z94A 3ZZ8A 2GV7A 1K1OA 2CXVA 4O03A 4MVNA 3RP2A 3FKSD 3MO3A 1OX1A 2JIZD 1SI5H 3OEED 5AFZH 2ZTYA 3N7OA 2G55A 5HGGA 2ZHDA 1ZMJA 5J4QA 4D8NA 1FY3A 4Q7YA 1TX7A 3F9HA 1GJAB 4B71A 1BUIA 1C2DA 1BHXB 2KR7A 2OTVA 2J34A 1P02A 5DP4A 1KLIH 1GJ7B 2IPHA 4YOIA 3RXFA 1TX8A 2XNDD 3CS0A 4FUGA 5FAHA 4A6LA 1L1NA 2Q6FA 2QF4A 4X6OA 1THRH 2ZEBA 4ZMAH 1ANDA 1H8IH 2F9BH 2SGQE 3Q3KA 2RA0A 1MAYA 7GCHF 1C5SA 4CRDA 3P8GA 1J15A 3I29A 4FOUC 1Y3UA 1SGCA 3F68H 5ETXA 1KXEA 3M5OA 2AERH 2WPDD 1C2KA 3AASA 4Y0ZE 3GCHC 4XBCA 1IQGA 1O3LA 4R0IA 1C5RA 4UD9H 1O2JA 1LHEH 1MU6B 2FX4A 2P8OC 1CA0B 1WQSA 1A5HA 2P59A 2ZC9H 3T2NA 2A45B 2F9UA 3MI4A 4CBOA 2HPQH 2YMSD 4GVUA 2Y7ZA 2GTBA 5C1YA 2BD7A 2VWNA 5JBCS 3ZZCA 5CHAC 4GAWA 2O8LA 3BTWE 4YZUA 4JZ1A 1DFPA 1DUAA 1BZXE 1JXPA 3RMMH 3RU4E 4UFEH 1P2JA 1U6QA 2B8OH 5A8ZA 1C5OH 1P3EA 3T29A 4X1PU 1GMHF 1GBKA 2W7UA 1TPAE 2SNWA 1QQ4A 3M3SA 5EJZA 2F91A 3URDA 2F9PA 1S6FA 5DG6A 1SPJA 1NC6A 5FXLA 1C1OA 1D3TB 4Y10E 3RXBA 3UR9A 1E1RD 1D4PB 5A8YA 1XXFA 3UUZA 1C4V2 3SU0A 1BHXF 4ZUHA 4B6FA 2XWBI 1GL0E 2KCYA 1V2VT 1SR5C 4ABHA 2WYGA 5F8ZA 4Q7XA 2ZO3H 1ARBA 3SU5A 1SSXA 1O3MA 3TK9A 1P2QA 2YMSC 1JWTA 1GI8B 1YWUA 4FXGH 1MD8A 3GY7A 2Y6TA 3LPRA 4O3UA 1LHGH 1PFXC 3RXEA 1HNEE 5E0GA 5C5OA 1Y59T 1FIZA 2PFEA 3RMNH 1SGYE 2Z9LA 2VB0A 4Z0KA 2ZPQA 1BTUA 1O5AB 1ETTH 1QIXB 3UIRA 1ELAA 1F5RA 1GMCF 2GVFA 5PTPA 1ACBE 2FPZA 2FEQH 1SLVB 1DWBH 1G3DA 2OQUA 2SGEE 3F6UH 3ZZ4A 4INHA 4ABGA 1MTNC 3BTTE 1O39A 2PKSB 1BMLA 1XKAC 1EB1H 3M3VA 3A85A 1CSOE 4UFDH 2BOKA 7LPRA 1IQFA 1FY1A 5AHGH 4JYTA 5GWZA 3RXGA 1SOTA 1CA8B 2O8WA 3L6PA 1W3CA 4AYVB 2KCAA 1YCPH 4KELA 2GCTC 4DOQA 5B6LA 2CHAB 1TMTH 4I8JA 4AB8A 1P09A 4NIWA 1GI2A 1QRWA 3WWBA 2ZU2A 1GDNA 2G52A 3FOAA 1MH0A 4WWYA 1ESTA 2BD4A 1VGCB 3MNXA 1LVYA 2AHME 2ZDMA 4DIIH 1EZQA 3EDXB 5EJLA 3MMGA 3P8NA 4Y8XA 4KTSA 2IN2A 2VIPA 3M5LA 2G4TA 4IN2A 1FXYA 3ZZ6A 1UTJA 1QB1A 3LGIA 1AZZA 2ZGJA 2UUYA 4WVPE 1GBJA 4IW4E 2QXIA 3O8DA 3OY6U 1HAHH 2WINI 1VJAU 3K6YA 2OC1A 3ATIA 5JBAS 3P17H 4WXVA 5BRRE 3CENA 4DT4A 5C0TA 3A7YA 3UWIA 3GYMA 2EY4C 4CRCA 2A5KA 3KQCA 1ELFA 4AX9H 3L33A 2FXRA 3KQBA 1K1JA 2QXGA 1DS2E 1KXFA 1Z8RA 1J8AA 3TGJE 4DT7B 8KME2 5FCKA 1BTYA 3QLPH 1GHYH 3ZZ9A 2BDYA 1KTSB 2WV5A 3TJUA 5KGOA 1K9OE 3B23B 3E0NB 3Q77A 1FV9A 4HFPB 3UWJH 2BM2A 3A89A 1UTOA 1GVKB 4D7GA 1O3GA 3GCHB 5EQSA 4I86A 4PROA 3ZVAA 4H4FA 1C5ZB 2BZAA 2YOLA 3KEEA 4NIVA 4OGXA 1K1IA 3UREA 2P8OB 3WW7A 1HAPH 4X1QU 2R0LA 1IQEA 3EE7A 3ODDA 2A1DB 1ELGA 1IHSH 1QL7A 2KAIB 1EKBB 2UWLA 2GV6A 4MPWA 1NRPH 2PTCE 4IN1A 2KZ4A 4K1SA 4DCDA 3ZVDA 3FZZA 2V7QD 1PPHE 5IDKA 2OD3B 5T1VA 3GS9A 1T8NA 3ATKA 1D6WA 4ASHA 2HNTC 2VBCA 4GCHF 5F6MA 4FETA 1AUTC 4BANB 4AORA 1QA0A 1TBZH 3FAOA 1P2NA 5FBIA 3ZZ7A 2R9PA 1AB9C 1S82A 4WY3A 1K21H 1ZPBA 4FUEA 4AB9A 3UQVA 2JJ1D 1Z6EA 3LU9B 3BTME 3FP6E 1LPGB 3K9XB 1NFXA 1LKBA 2ZZUH 5GDSH 1OHHD 3TK5A 2FODA 1O35A 1MKXH 3DD2H 3MU8A 5LPEA 8ESTE 1MKWH 1GDQA 3PMBB 4A7IB 1HAZB 1UVUH 2VWOA 1CE5A 1O2HA 1A3EH 1V2PT 3SU4A 2ZHWH 1TQ0B 2A2XH 4MNXA 4JZDH 2PSYA 2H9TH 2ESTE 1E38B 1NY22 2ZFPH 2EQNA 2G8TA 4WH8A 2P94A 1ZYOA 3QTOH 2F3CE 5I46H 2YMSB 2THFB 3A87A 1ELDE 1S83A 5EJ1A 2BD2A 3VB3A 1HB0B 3BTQE 1EATA 4WF8A 5GCHG 3IWMA 4KTUA 2VH0A 5FX6A 2VNTA 3V0XA 3KGPA 1W2KH 1QGFA 1ZPZA 1C5VA 1A0HB 1RTFB 3RDZA 5EQQA 1ARCA 1THPB 1O37A 1BRAA 3DFJA 2PGBB 3ZV8A 4BNRA 1B0FA 2ZI2H 2H9HA 3RXPA 1O5FH 1UVOA 1WTHD 2HOBA 3SI4H 1EZUC 3KQDA 1MTNB 4X8UH 3SUGA 2KFWA 2ZGHA 2Z9IA 2W5EA 3BTEE 1HCGA 2ZKSA 2V3MA 2V3HH 1KDQB 5L30H 1O5DH 4NGAH 1O3JA 4NSVA 2W6ID 1V2NT 1XX9A 4JK5A 1CHOF 1ZHPA 1YY3A 4ESTE 3D23A 4Q4LA 4JCNA 3OX7U 3STIA 1NBME 4NZLA 2AGEX 1JIMA 2W3KA 1GCTC 1C5TA 4UDWH 2QC2A 1HJ8A 3V3MA 1AO5A 1NRSH 2Y81A 1UHBB 4X1NU 4TYDA 2K1QA 3UR6A 2TIOA 1ZZZA 2XC5A 2PV9B 2F9OA 2SGDE 4CRAA 3BV9B 1PPBH 4Y7BA 1SHHB 1PQ8A 2V0BA 3RXKA 4TWWA 3DSPA 2ZTZA 4K1EA 3N99A 4VGCC 1MBMA 5TCAA 1TGSZ 4Y7AA 1NS3A 3H09A 3U28C 1G36A 3EE0B 3A7TA 2BXTH 2JDID 2VGCC 3UAIC 1GVZA 1MTSA 1NROH 3UPEA 4X2VA 2TGDA 2J38A 3KNXA 4UE7H 4NA7A 1K1LA 2JKHA 3ZVEA 3AW1A 3TH3H 1KXCA 3VXFH 1XVOA 4XBBA 1DLKB 2ZFFH 1NT1A 1S6LA 1AI8H 3MH4A 4YLUA 1B0EA 4RSPA 1A2CH 2O9QA 2J5UA 1KXDA 4TWYA 3LIWA 3UFAA 2ZCLP 2Z3DA 2P93A 5ESBA 3LJOA 1SQOA 1L1GA 1PQAA 3RXJA 3VXEH 5LPRA 2A32A 1L1JA 2XRCA 1AUJA 4Y79A 2FYRA 2OP9A 2BDAA 1CGHA 2M2AA 1NO9H 1W0JD 1E34B 3SZEA 2PW8H 4THNH 1UJ1A 1ZJDA 3MU5A 1H9HE 1GJ8B 3BTGE 1HGTH 1FQ3A 2TPIZ 4NIXA 3PTNA 1O3EA 4Y6DA 1N8OC 1XUHA 4NG9H 2RDEA 3SGBE 5DP8A 1B7XB 1O2RA 4I8HA 1EFRD 1MUEB 2A7CA 2AGGX 4F49A 3W95A 2GT8A 1V2TT 2G51A 3F9FA 1EASA 1O5CB 2ZHFH 3DUXH 2J9NA 3BTDE 2EI6A 3SO3A 1HUTH 3MO6A 2KAIA 1AB9B 3ATLA 2XC0A 5C1UA 1DX5M 3BSQA 3HGPA 5EXNA 3PLPA 3SNEA 2BOHB 3ZVGA 1TRNA 4FUIA 3UQOA 5C0UA 1CU1A 3V13A 3P8OA 2WUCA 3TGKE 2O8TA 1DT2A 4ZKSU 1DDJA 1UTMA 3ZVCA 2EI7A 3BIUH 2A7HA 2FDAA 3MYWA 2JH0D 1ANBA 2FOFA 2AMQA 2Z9KA 4BTIB 1C1PA 4Q2KA 1V3XA 3SU1A 3DFLA 1C1WH 1NFWA 1YCPM 1BA8B 1GBTA 1QB9A 1K1MA 2RCEA 4BAOB 1YPKH 1KLJH 2OC0A 1CT0E 3K2UA 4TSFD 2BQ6B 3TH4H 1EB2A 5E0JA 1FY8E 1DY9A 1G9IE 4ISLA 3GY4A 4I8LA 4Q63A 1NRQH 2BDBA 2UWPA 4TT3D 4J2YB 1E37B 1ZSJA 1OP2A 5JYIA 1KYNA 2EA3A 3OE7D 1C9PA 3Q3XA 4AFUA 1GI1A 3ATWA 2ZNKH 1N6XA 1GI5A 1GHBG 2ZGXH 1TNIA 2H6MA 2Y5FA 1QA7A 3TPIZ 1EOJA 1VITF 4ZCNA 3QTVH 1QTFA 3SZNA 1IQJA 3RXHA 1WCZA 4O9VA 3A80A 4IGDA 4IS5A 4MNYA 3SU2A 3V7TA 1VZQH 3S0NA 1A1RA 2CMYA 1G3CA 3T25A 3ZVFA 1LQEA 2HALA 3C27B 3PRBA 1BB0B 5EPYA 2XWAA 4ZKOU 2STBE 2PSXA 1O2LA 1SGDE 3MH5A 3M35A 2J2UA 4D7FA 3SGQE 2QGRA 1KTTB 4ABFA 4NFEA 2JJ2D 3SV6A 3GDSA 3UNSA 2HNTF 1UCYH 3GY3A 3ZZ3A 2F9NA 3DHKH 3BEIB 1G2LA 4X8VH 4H42U 1LQDB 2O8UA 2GDEH 4ZXYH 2NU1E 5GJ4B 5C94A 2ASUB 3SW2B 4K8BA 5HIYA 3TJNA 2R2WU 1YKTA 2R3UA 3LGVA 3KHVA 1GI4A 4FU8A 4IMQA 1GJ6A 1HYLA 4M7GA 1P04A 1PQ7A 1DWCH 1GCTB 3SV7A 1FMGA 1KDQA 2C93B 4RT0A 2K0QA 2Q1JA 3QDZB 4BTUB 2FP7B 3M37A 3MNBA 4MDSA 4B73A 1ZJKA 2P3TB 1W0ZU 2A0QB 1J16A 2UUKB 4P00A 2CJIA 1IQHA 2UUJB 2BD9A 3KL6A 4TY7A 3EAJA 3OTPA 4ZXXH 3PLBA 1A46H 2OC7A 4OS7A 4RI0A 1SG8B 3HK6B 1K28D 1K22H 6GCHG 2O8MA 1Y5AT 1EXFA 4VGCB 4YTAA 1GJCB 1OSSA 1YPLH 1BQYA 1SVPA 1UHBA 2SGFE 2KM0A 1NU7B 1SGFG 1A0LA 3PV4A 1Z71A 5T6GA 2ZF0H 1P05A 1ZLRA 2VGCB 1UTPA 4A1XA 1E35B 1D3PB 2VJ1A 5DJ7A 1P12E 3UY9A 1ZHRA 3A83A 5J4SA 1AN1E 2H5DA 3AVZA 1BRUP 2CF8H 1DVAH 1P03A 3GOVB 4J1YA 1C4Y2 1V2OT 2TGPZ 4INKA 5SGAE 4A5TS 2SFAA 1EJMA 3P92A 3UOPA 1NFUA 3SHCH 4ACBA 5TJXA 3M5MA 1O32A 1OWJA 1UCYE 1ANCA 1TWXB 4CREA 3RXUA 1SB1H 3VG8A 2ZU1A 1UVTH 1TBQH 1DM4B 1GDUA 4CRBA 2QV1A 3PWCA 2G5NA 3RXTA 2G00A 1RTKA 1WUNH 1FAXA 1L2EA 1C5NH 1LHFH 1O2UA 1O3BA 1Y3YA 4NA8A 5JBBS 1KXBA 1GI6A 3F9EA 4I32A 1HFDA 1QBNA 3NWUA 1N8OB 1GI0A 1LPKB 1TNJA 4BAKB 1XMNB 1JMOH 1P57B 4Y8YA 3RM2H 1AD8H 1SGRE 1TYNA 2BHGA 2PTNA 3ZZ5A 1ID5H 1BBRH 1DICA 1ZHMA 4ZAEA 1KLTA 4FU9A 4YO9A 2ZTXA 1H1BA 2BVSH 4UONA 2BYAX 3SUEA 5L2YH 3FZDA 1P01A 1TOCB 1BIOA 2A4GA 1DWEH 1S5SA 3OAAD 1S6HA 4MTBA 1O2WA 4CRGA 1X7AC 5KEDA 3SJKA 1BT7A 2DUCA 5T6DA 3KF2A 1DLEA 3K6ZA 1AE5A 2ZCHP 1OS8A 2AIQA 4KP0A 2P3FH 4AFQA 1D3DB 2WSSD 4OGYA 1TRYA 5GPIB 2WV4A 1FPHH 1HAYB 1CT4E 1GG6C 2SGPE 1YCPK 1V2QT 2ZPSA 2BY7X 2P16A 2Y7XA 1HAGE 2IJOB 5FPTA 1ETSH 2FO9A 5GIBA 1DXPA 1W14U 1HJAC 1EAWA 1A5IA 1P8VC 1V2RT 1W7XH 3GCNA 4Y11E 1F7ZA 5EGMA 4ZH8A 3RC5A 2B7DH 5EXMA 1QRXA 1W12U 1LCYA 2OCVB 1GPZA 1KXAA 5DP7A 4OS2A 3BG8A 3CP7A 3LC5A 4JZIA 4K69A 4RKOB 2A5IA 2XXLA 2SGAA 1TA2A 1YC0A 2QE7D 1TMUH 3U9AH 1EUFA 1QY6A 5I25A 1LVBA 1HPGA 1Y3XA 1QJ6B 4ISOA 2M5TA 4Q7ZA 1ZSLA 3Q3YA 1C5YB 1EAUA 2NU2E 5EG4A 1AIXH 3LJJA 2FOEA 1K1NA 2AS9A 1WQVH 3SNDA 1JRTA 3MU1A 1W8BH 1BBRE 1FJSA 1NN6A 4IC5A 3TJVA 1OWDA 1OWIA 3KYGA 2HVXA 3H5CB 3OTJE 4I8GA 1MMJN 1FLEE 4WH6A 1RFNA 2Z7FE 1SLXB 3RM0H 1QRZA 2FOGA 1ABJH 3S7HB 1ELVA 2P3UB 4HZHA 2ALPA 1GBMA 2OBQA 3F3BA 1QJ7B 1BTZA 3S7KB 3SUFA 3NZIA 1AZ8A 4E7NA 4WXIA 1SMFE 2KX4A 1S84A 3SJ9A 1GMDG 3U69H 1ESAA 2A4QA 4U2WA 4ABEA 3K65B 2QYIA 3GY5A 3ZZDA 1F2SE 3ZZAA 1KSNA 2QCYA 4TY6A 1ANEA 2WPKS 3QO6A 4HI3A 5CE1A 5A0CA 4CH8B 1Q31A 3EQ0H 2TBSA 1O36A 2PP6A 4B1TA 1H8DH 1AFQC 2J4IA 2OXSA 1OOKB 4ZROA 3MOCA 1SGEE 4LXBH 1EZSC 3A81A 4JK6A 1F5LA 4NIYA 2NU0E 2BVRH 1GVLA 4UEHH 2AEIH 1C5XB 4YESB 3BEUA 3Q00A 3A88A 4X2XA 1V6DA 4MQAA 2ULLA 1MAXA 1XUIA 2ODQA 1QFKH 2ZGBH 2FI4E 2OC8A 2TRMA 3RXMA 4U01A 3SV9A 3BTFE 3QN7A 1E36B 2VVUA 3QGJA 1TE0A 1ZGVA 1OP0A 5FX5A 1C5MD 1MKXK 1W13U 1A0JA 4WMFA 1HAOH 1VITH 2P95A 1LHCH 4F4OC 3KN2A 2D26C 3TH2H 1WYKA 1BCUH 1YGCH 2PLXA 1KY9A 3E0PB 3SI3H 1QB6A 2UUFB 4OS4A 3D65E 1V2ST 1EX3A 2D1JA 3SORA 1YLDA 3GCTG 1P0SH 1HAXB 3S9BA 4YT7H 5EXLA 1IQMA 1T8LA 3DSOA 4CR5A 3U98H 3FVFB 2BMGB 3RC4A 2ZU4A 2BD5A 1V2KT 2FTLE 2Q6GA 1S0RA 1C2JA 4INLA 5HKKD 1FPCH 1YPEH 2AYWA 1UO6A 1MABB 3RXRA 4DY7B 4U30A 1IQKA 1GBFA 1SL3A 4UFGH 1YF4A 2CN0H 1VKYA 3MH7A 3RMLH 3M7QA 5EODA 3SU3A 3MQKC 5DSFA 2BX3A 1LO6A 3T28A 3TK6A 3HATH 1FX0B 3G01A 5GCHF 1RXPA 3FP8E 4XDEA 1AWHB 2GMTC 1L4DA 2I6SA 3SJOA 3TJOA 1EAXA 2C8ZB 1TABE 1GHAG 4FUJA 5HM2A 3U8RH 1ELBA 3LT3A 3BG4C 2A31A 1GBHA 2ZCKP 3RXCA 4JZEH 1PPEE 5JPMH 1QHRB 3MHWU 3VPKA 2BLWA 4GLYA 3GICB 2ODPA 3QX5H 1SOZA 3PO1C 5EPNA 3W94A 1LHDH 3GY8A 2FI5E 4FUCA 4MPVA 1AQ7A 2QN5T 3ENSB 1GG6B 5DK1A 1ELTA 1MU8B 3ELAH 2BY8X 1W0KD 1MD7A 4M9FA 4AYYB 1HAVB 3NK8A 1WAYB 3QK1A 1A5GH 1HJAB 5DP9A 2G5VA 3OY5U 3M5NA 1MCVA 4GUXA 1UVPA 3KIDU 1VCWA 4OS1A 3V12A 1O3IA 1IQIA 3RLWH 1EZXC 1V2WT 1FZZA 3MU0A 4IBLH 2FOAA 1BTPA 5H4IB 1G37A 2JETC 1SGQE 2PKAB 4BOHA 2FMJA 8GCHG 3DT0H 1F0SA 3KQEA 3CS7A 3MTYA 3PM3A 3EA7A 2LELA 2PGQB 5EU8A 1RIWC 2HNTE 1UTLM 3EA9A 3SYJA 2FOMB 3AAUA 1QCPA 1QJ1B 2SNVA 1QBVH 1LVMA 2EI8A 4DVAU 1AVWA 4BXSA 1C5WB 3MNCA 4K60A 3M7UA 5E0HA 4BXWA 1WBGB 4DURA 3T62A 4X8TH 4JYUH 2EEKA 1MBQA 1NFYA 3OU0A 4FVBA 1GJ9B 2VIVA 2ZIQH 4E7RG 4KKDA 2GX4A 2FWWA 2ZDKA 4X0WU 2PWXA 1HRTH 1ZSKA 1SGTA 2Z9JA 1AWFH 4ABBA 1EOLA 1MZDA 2ANKH 1ZRBA 1O38A 1EJNA 3SGAE 3PROA 3VEQB 6CHAC 3A8CA 2ZFTA 1TALA 5T6FA 1YPHE 2L74A 1PQ5A 2V35A 3RXQA 1V2JT 1GBCA 1L4ZA 1TRMA 2HWLB 1GBDA 3RUOA 4OM9A 1AFQB 1Z7KA 1O34A 3M36A 1SHYA 4O3TA 1H8ED 2VIDA 4QT8C 3U8OH 2VU8E 1O2KA 1C2EA 3SN8A 1QL8A 1ELEE 4Y0YE 4Q80A 1HLTH 2CGAA 1T7CA 3TIUA 1SQRA 4AZ2B 3QZRA 3P8FA 2BDIA 3W1EA 1MTVA 2GCHG 3RU4T 2OBOA 2HGTH 1MQ6A 5BPEA 1WDIA 5EOKA 4MPUA 3ZZBA 1E0FD 3HKIB 5FCRA 1C2FA 1O2ZA 5IYTA 3VB7A 1C4U2 3VB6A 1LKAA 4AN7A 1FUJA 4XFQA 3RU4D 2LNCA 1NTPA 2A5AA 4B74A 4FUHA 1FY4A 3ODFA 1EPTA 4MG3A 4TPIZ 2A7JA 3C1KA 1OYQA 4I33A 4ABIA 2DE8A 3RXIA 1GHZA 3SNBA 5KECA 1C1UH 2H2ZA 1TIOA 3FN8A 1CBWC 3UTUH 1ZTKA 2R3YA 4B76A 4XE4A 1O5GH 1TNLA 2BQWB 1WV7H 2LP6A 2FTMA 3U1JB 5DP6A 3OYPA 1TGNA 1YLCA 2WPIS 2CV3A 1M9UA 1Z6JH 5C2ZA 3AK5A 3M61U 1C1SA 2Z3CA 4X1RU 1C1TA 1ZMLA 2ZU5A 2ZGCA 1L0ZA 3A82A 3F9GA 3LGUA 5F8XA 1UW7A 1OYTH 1LPZB 2BVXH 2WV9A 3MU4A 2A4OA 4IC6A 1COWD 2FX6A 5C5NA 1GI9B 3BF6H 1Z1IA 3O8BA 3SHAH 2C8YB 1GI3A 2V3OH 1WU1A 1GHBF 1ZOMA 2GMTB 5L2ZH 4I31A 2EC9H 3A7ZA 1QNJA 2GT7A 3BG4B 1OWHA 1GBLA 1ZR0A 1H9LB 1RJXB 3A7VA 3PMJA 4X6MA 3E16B 2OUAA 6ESTA 3O8CA 3BTHE 1O3HA 1AKSA 2C8WB 3I77A 4BTTB 1INCA 2YNBA 1HJ9A 4NZQA 2BZ6H 3PO1B 3R0FA 4FU7A 1E79D 4R8TB 4YOJA 1UCYK 1F5KU 1ZMNA 1C9TA 4P02A 1A7SA 1LMWB 5LH8A 3PWBA 1T4UH 3PTBA 4F48B 1VJ9U 1Y5BT 3QGNB 2VINA 3HPTB 4MPXA 2JH6D 1FONA 1O3OA 5DP3A 4B2CA 2A4RA 4FUBA 1K0HA 1VITG 2IOTA 3E6PH 1Y3VA 2J95A 1C1NA 1MQ5A 1OKXA 2RDLA 1O2NA 4XRNA 1KIGH 1AU8A 2JETB 2A2QH 3A7XA 1CGIE 3RXOA 3SNAA 1FDPA 1HAVA 2NU3E 5C3NA 1A3BH 5LGOA 1GL1A 1BRBE 1QR3E 4NFFA 1RIWB 3BTKE 1WSSH 3NKKA 4B2BA 2IPQX 5A8XA 3QWCH 3LH1A 2OK5A 2VVVA 2GKVE 3ATMA 2PKAA 3URCA 4CBNA 1Q3XA 4WMDA 2KCOA 2NU4E 1MTWA 3E91A 1GJBB 2XOKD 5DKMA 6GCHF 1W11U 1WTGH 1XUJA 4GPGA 5EQRA 7GCHG 3QZQA 1G2MA 1NU9A 1P9UA 1SGNE 1PYTC 2AH4X 5AVDA 3FO8D 4HG6A 2QF5A 1IQLA 3U8TH 1BDAA 4OS6A 1FY5A 1XVMA 2J94A 1EPTC 1O3PB 2PHBA 5EIYA 5HXFA 3ZIAD 1YYY1 3N7DA 1S85A 1YP9A 2HPPH 2PR3A 2ZFRH 1TFXA 4LZ4B 5E8EH 1EQ9A 1C1QA 1FNIA 4D9QA 2FOHA 6CHAB 9ESTA 3FFGA 1O2PA 3S69A 3JZ1B 1BMFD 5GXPA 5C67A 1SKYE 3TLOA 4U32A 1B5GH 4Z6AH 4FUFA 2XTTB 4Z1MD 1CHGA 2R2MB 1C5UA 3ZV9A 2D2DA 2Z6BD 1XXDA 1UVSH 1O2SA 3STJA 1FI8A 5T3HA 1ORFA 2TGTA 3LC3A 2LPRA 4SGAE 1TA6A 2VVCA 1BTHH 5HMAA 1BTXA 3LGTA 1C1VH 1BBRK 1K1PA 4D76A 2C90B 1DUEA 2RFKC 2HLDD 4LOYH 1HIAB 2XW9A 4O97A 4AC9A 1SQAA 1YPMH 5EW2H 3AW0A 5EW1H 5DO4H 4XOJA 2NWNA 2IJD1 4X8SH 1P06A 2ZQ1A 5HIZA 4YOGA 2GD4B 1GMHG 4NWKA 1DANH 2ANWA 3L3TA 1N6YA 2FI3E 1BOQA 1Z8JB 5HM9A 3E3TA 3D49H 5K0HA 1GHXH 2FOBA 3ZYEA 3LGYA 1P2IA 5C20A 4ISIH 3RC6A 5B6OA 1GBIA 1UTKA 3F0OA 4Y76A 4RKJB 2HVYB 1WOFA 1VR1H 2WUBA 5G4BA 2FYQA 1CBWB 1RD3B 2BTCE 1QL9A 2VIWA 2AGIX 2K8IA 1TNKA 3EA8A 3R3GB 2F43B 1H4WA 1SQTA 5DPAA 3TVJB 3VGCC 2H1UA 4DJZB 3CNRA 1V2MT 2I6QA 5C17A 1O31A 3B9FH
chains in the Genus database with same CATH topology
5F8TA 2AIPA 2BLQA 1BTWA 1ELCA 3NXPA 1GMCG 1O2GH 3B8JA 2Q6DA 2WPMS 1T4VH 3TNTA 1UTNA 1O5EH 2ZHQH 2VIQA 1BJVA 1G3BA 4MNWA 5F03A 2ANYA 4BAQB 2FIRH 1DOJA 1GHWH 1NRRH 2C3SA 1UK4A 3PMHB 3T26A 2RA3A 1SGFA 3MWIU 4AG1A 4K2YA 4B2AA 2WPJS 4BAHB 1A61H 1TPSA 3VB5A 4WMEA 1BMAA 2BD8A 3NCLA 4I8KA 1MTUA 2Z9GA 2PUQH 1BITA 3EGKH 4YM9A 1EP6A 3GDVA 2OQ5A 3ITIA 1ZGIA 2FZZA 2GDDA 3P70B 1A4WH 3LONA 3VFEA 2BD3A 2ZFSA 1Y8TA 1IOEA 3A8BA 1ZTLA 1UK2A 3HKJB 2V6NA 1NESE 3DA9B 3RXLA 1AHTH 2OLGA 2BDHA 1XKBC 1XUFA 1GMDF 1S81A 1TAWA 2GZ9A 4ZKRU 1GJ4H 1HBTH 2BY9X 6LPRA 4GSOA 2BY5X 1OPHB 1EAIA 2XC4A 1YPGH 3A7WA 3I78A 4CHAC 1CT2E 1O2XA 4K3JA 3MO9A 1F0TA 1O2MA 3IITA 1TGBA 3SOSA 2ZDAH 1DWDH 2BY6X 2FS8A 2Y5GA 2XBWA 3RXVA 3WY8A 4TPYA 1DSUA 1P9SA 2W26A 1RTLA 4K1TA 3SJ8A 5A0AE 1AY6H 1SGIB 3MNSA 3RXDA 1T8MA 1F0UA 3E1XB 5JB9S 2PUXB 4DIHH 4MNVA 2BB4A 9LPRA 1YM0A 4JYVH 3GY2A 2FESH 1ZTJA 1VCPA 1T32A 1EPTB 4H6TA 1V2UT 5C1XA 4A1VA 3BN9A 1QQUA 1TOMH 2J92A 4AGJA 2FS9A 1DE7H 2XBXA 2XCNA 4CRFA 5L6NH 4Y71A 1ZPCA 2Z3EA 1DSTA 4NWLA 1C5PA 1BRCE 1MKWK 5FPSA 4B75A 4ZKNU 3GISB 4K8YA 2Y82A 2ODYB 5CHAB 2GZ7A 2ZDNA 3NUMA 3JZ2B 1P3CA 3H7OA 2OINA 2D8WA 1NM6A 3SQHE 1Z8GA 3EYDA 1QURH 1GCDA 3GCTF 1TX6A 4GCHG 1OWKA 1GWAA 3SUDA 3PMAB 1FAKH 4BAMB 4HGCA 2B5TB 2TGAA 2QIQA 2Y5HA 2B0FA 5TCCA 4AG2A 3E90B 2VWLA 4HTCH 3TNSA 3ZVBA 1UMAH 4UFFH 1C2HA 1ZRKA 5DGJA 1TMBH 1Y5UT 4RN6A 1EJAA 4X2YA 1DITH 3A8AA 1HXFH 1AKSB 2XNIA 2F9VA 5A2MH 2ZQ2A 2ZDVH 5CMXH 3A8DA 1S0QA 1G32B 3TITA 1C2MA 1DPOA 1GBBA 1T31A 1GHAF 3BIVH 1HIAA 1XUGA 2UWOA 2QF0A 1VCQA 2ZU3A 1DY8A 1AVXA 1J17T 2Y80A 5AF9H 1NZQH 5E2PA 1XM1A 1YPHC 3F1SB 4ZHAA 2F83A 1T8OA 1BMMH 1GGDC 2XCFA 1SFQB 1ESBA 2ALVA 3QUMP 2DE9A 1P2MA 3SBKA 3UOUA 4CR9A 4OS5A 2ZECA 3T5FH 3GDUA 3FANA 1TONA 1YPJH 3LOXA 5JDUB 3T27A 1SGPE 3Q76A 1AMHA 1PPGE 1O3FA 3H7TA 5A0BA 3A86A 2AFQB 1GJ5H 4ISNA 3SQEE 1TPPA 4LZ1H 2BXUH 3VGCB 2XYAA 3KCGH 4ABJA 1J9CH 1TGTA 4AGKA 1CGJE 2R0KA 1HXEH 4KTCA 2WPLS 1O2TA 1DXWA 3M3TA 1D3QB 1CO7E 5AFYH 1Y3WA 1JOUB 2XBYA 1IHTH 2ZHEH 1GHVH 2QY0B 4DG4A 1ETRH 1O3KA 3RLYH 8GCHF 5JB8S 3NPSA 3GYLB 1N1LA 1D6RA 1EP5A 3VB4A 1GBEA 1C2GA 4NSYA 1JBUH 1G30B 2BDCA 4WJG2 4D9RA 4DGJA 1FN6A 1O2IA 4X6PA 2BDGA 2W3IA 4KGAA 2BX4A 4ISHH 1NPMA 1GBAA 1O2VA 1W0YH 4ZHLU 2GGVB 2GCTB 4A92A 4GHTA 4FVDA 1Z1JA 1SC8U 1BMNH 1OXGA 1RRKA 2FOCA 3PYHA 1THSH 1CHOG 4DW2U 3LDXH 5DP5A 3HK3B 5JBTA 4E06H 2VWMA 3PLKA 1HV7A 3FP7E 1C2IA 4FUDA 4A1TA 2BQ7B 1LTOA 1TBRH 4XSKU 2CF9H 5FBEA 3RXSA 2H5CA 3LH3A 1FN8A 1K2I1 1LDTT 1OP8A 4IMZA 5FPYA 1C2LA 1OWEA 2VH6A 2QF3A 1FIWA 4AFSA 4CHAB 2C8XB 4ABDA 1CA0C 1H9IE 2HRVA 3GCOA 2BLVA 1AE8H 1JIRA 1P10A 2W7SA 1UK3A 2VIOA 3UNRA 1TLDA 3LGWA 4GHQA 1NRNH 2WPHS 1HDTH 4YLQH 4NA9H 3SNCA 4AFZA 1Q2WA 2ZA5A 1TPOA 1RS0A 3S9CA 2HLCA 1ABIH 4SGBE 2ZG0H 5K7RA 1O3DA 1RGQA 2XBVA 3D62A 1GI7B 1TNHA 4CH2B 1O3AA 1IQNA 3SJIA 3TU7H 1SFIA 2GCHF 1V2LT 4X6NA 1O2YA 1CQQA 4NCYA 1QBOA 3SU6A 1PJPA 1O33A 3HGNA 2FLRH 1TGCA 4Y8ZA 1O3NA 3ESTA 1AGJA 2ANMH 4LK4A 1YBWA 2H9EH 8LPRA 1AVGH 3O8RA 3E8LA 1TNGA 1MZAA 1F0RA 3TGIE 1C5QA 1C1RA 1PPCE 2BLOA 3ZYDA 4E05H 2QXHA 5HYOA 2AMPA 2G81E 1LVOA 3AAVA 4H6SB 3U1IB 2ZWLH 1P2OA 1AFEH 3SV2H 4JZFH 2RG3A 1P11E 4YT6H 2ZDLA 5ABWA 1PPFE 1D9IA 7KMEH 3P6ZB 1SLWB 2QAAA 4MLFB 1F92A 2FM2A 2STAE 7ESTE 1XUKA 1O2OA 4JMYA 1O2QA 2ZP0H 1Z8IB 1SLUB 1W7GH 5ESTE 1W10U 1BJUA 2ILNA 3BEFB 1JRSA 2G4UA 2WYJA 1O0DH 3M7TA 3S9AA 4AOQA 4I7YH 1TB6H 1GJDB 1C1MA 3PB1E 4X1SU 1O30A 1HAIH 3LKWA 2PKSC 3IG6B 2FLBH 5LPFA 1G3EA 2QXJA 2C4FH 4ZHMU 5A09A 1TQ7B 2AMDA 2YNAA 4ABAA 3A84A 1GGDB 1O3CA 1PPZA 3MH6A 4K5ZA 1MCTA 2JH5D 3OSYA 2ZPRA 5E2OA 3GY6A 2CHAC 2GZ8A 1PYTD 3SV8A 4X2WA 1SBWA 5FHTA 4XBDA 3RMOH 1CVWH 3MFJA 2GP9B 1IAUA 2QA9E 1VGCC 3UNQA 1O5BB 1C5LH 3P95A 1UTQA 1P2KA 3RXAA 2B9LA 2ZFQH 1J14A 2Z94A 3ZZ8A 2GV7A 1K1OA 2CXVA 4O03A 4MVNA 3RP2A 3MO3A 1OX1A 1SI5H 5AFZH 2ZTYA 3N7OA 2G55A 5HGGA 2ZHDA 1ZMJA 5J4QA 4D8NA 1FY3A 4Q7YA 1TX7A 3F9HA 1GJAB 4B71A 1BUIA 1C2DA 1BHXB 2OTVA 2J34A 1P02A 5DP4A 1KLIH 1GJ7B 2IPHA 4YOIA 3RXFA 1TX8A 3CS0A 4FUGA 5FAHA 4A6LA 1L1NA 2Q6FA 4X6OA 1THRH 2ZEBA 4ZMAH 1ANDA 1H8IH 2F9BH 2SGQE 3Q3KA 2RA0A 1MAYA 7GCHF 1C5SA 4CRDA 3P8GA 1J15A 3I29A 1Y3UA 1SGCA 3F68H 5ETXA 1KXEA 3M5OA 2AERH 1C2KA 3AASA 4Y0ZE 3GCHC 4XBCA 1IQGA 1O3LA 4R0IA 1C5RA 4UD9H 1O2JA 1LHEH 1MU6B 2FX4A 2P8OC 1CA0B 1WQSA 1A5HA 2P59A 2ZC9H 3T2NA 2A45B 2F9UA 3MI4A 4CBOA 2HPQH 4GVUA 2Y7ZA 2GTBA 5C1YA 2BD7A 2VWNA 5JBCS 3ZZCA 5CHAC 4GAWA 2O8LA 3BTWE 4YZUA 4JZ1A 1DFPA 1DUAA 1BZXE 1JXPA 3RMMH 3RU4E 4UFEH 1P2JA 1U6QA 2B8OH 5A8ZA 1C5OH 1P3EA 3T29A 4X1PU 1GMHF 1GBKA 2W7UA 1TPAE 2SNWA 1QQ4A 3M3SA 3URDA 2F91A 2F9PA 1S6FA 5DG6A 1SPJA 1NC6A 5FXLA 1C1OA 1D3TB 4Y10E 3RXBA 3UR9A 1D4PB 5A8YA 1XXFA 3UUZA 1C4V2 3SU0A 1BHXF 4ZUHA 2XWBI 1GL0E 1V2VT 1SR5C 4ABHA 2WYGA 5F8ZA 4Q7XA 2ZO3H 1ARBA 3SU5A 1SSXA 1O3MA 3TK9A 1P2QA 1JWTA 1GI8B 4FXGH 1MD8A 3GY7A 2Y6TA 3LPRA 4O3UA 1LHGH 1PFXC 3RXEA 1HNEE 5E0GA 5C5OA 1Y59T 1FIZA 2PFEA 3RMNH 1SGYE 2Z9LA 2VB0A 4Z0KA 2ZPQA 1BTUA 1O5AB 1ETTH 1QIXB 3UIRA 1ELAA 1F5RA 1GMCF 2GVFA 5PTPA 1ACBE 2FPZA 2FEQH 1SLVB 1DWBH 1G3DA 2OQUA 2SGEE 3F6UH 3ZZ4A 4INHA 4ABGA 1MTNC 3BTTE 1O39A 2PKSB 1BMLA 1XKAC 1EB1H 3M3VA 3A85A 1CSOE 4UFDH 2BOKA 7LPRA 1IQFA 1FY1A 5AHGH 4JYTA 5GWZA 3RXGA 1SOTA 1CA8B 2O8WA 3L6PA 1W3CA 4AYVB 4KELA 1YCPH 2GCTC 4DOQA 2CHAB 1TMTH 4I8JA 4AB8A 1P09A 4NIWA 1GI2A 1QRWA 2ZU2A 1GDNA 2G52A 1MH0A 4WWYA 1ESTA 2BD4A 1VGCB 3MNXA 1LVYA 2ZDMA 4DIIH 1EZQA 3EDXB 3MMGA 3P8NA 4Y8XA 4KTSA 2IN2A 2VIPA 3M5LA 2G4TA 4IN2A 1FXYA 3ZZ6A 1UTJA 1QB1A 3LGIA 1AZZA 2ZGJA 2UUYA 4WVPE 1GBJA 4IW4E 2QXIA 3O8DA 3OY6U 1HAHH 2WINI 1VJAU 3K6YA 2OC1A 3ATIA 5JBAS 3P17H 4WXVA 5BRRE 3CENA 3A7YA 3UWIA 3GYMA 4CRCA 2A5KA 3KQCA 1ELFA 4AX9H 3L33A 2FXRA 3KQBA 1K1JA 2QXGA 1DS2E 1KXFA 1Z8RA 1J8AA 3TGJE 4DT7B 8KME2 5FCKA 1BTYA 3QLPH 1GHYH 3ZZ9A 2BDYA 1KTSB 2WV5A 3TJUA 1K9OE 3B23B 3E0NB 3Q77A 1FV9A 4HFPB 3UWJH 2BM2A 3A89A 1UTOA 1GVKB 4D7GA 1O3GA 3GCHB 5EQSA 4PROA 3ZVAA 4H4FA 1C5ZB 2BZAA 2YOLA 3KEEA 4NIVA 4OGXA 1K1IA 3UREA 2P8OB 1HAPH 4X1QU 2R0LA 1IQEA 3ODDA 2A1DB 1ELGA 1IHSH 1QL7A 2KAIB 1EKBB 2UWLA 2GV6A 4MPWA 1NRPH 2PTCE 4IN1A 4K1SA 4DCDA 3ZVDA 3FZZA 1PPHE 5IDKA 2OD3B 1T8NA 3ATKA 1D6WA 4ASHA 2HNTC 4GCHF 5F6MA 1AUTC 4BANB 4AORA 1QA0A 1TBZH 3FAOA 1P2NA 5FBIA 3ZZ7A 2R9PA 1AB9C 1S82A 4WY3A 1K21H 1ZPBA 4FUEA 4AB9A 3UQVA 1Z6EA 3LU9B 3BTME 3FP6E 1LPGB 3K9XB 1NFXA 1LKBA 2ZZUH 5GDSH 3TK5A 2FODA 1O35A 1MKXH 3DD2H 3MU8A 5LPEA 8ESTE 1MKWH 1GDQA 3PMBB 4A7IB 1HAZB 1UVUH 2VWOA 1CE5A 1O2HA 1A3EH 1V2PT 3SU4A 2ZHWH 1TQ0B 2A2XH 4MNXA 4JZDH 2PSYA 2H9TH 2ESTE 1E38B 1NY22 2ZFPH 2G8TA 4WH8A 2P94A 1ZYOA 3QTOH 2F3CE 5I46H 2THFB 3A87A 1ELDE 1S83A 2BD2A 3VB3A 1HB0B 3BTQE 1EATA 4WF8A 5GCHG 3IWMA 4KTUA 2VH0A 5FX6A 2VNTA 3V0XA 3KGPA 1W2KH 1QGFA 1ZPZA 1C5VA 1A0HB 1RTFB 3RDZA 5EQQA 1ARCA 1THPB 1O37A 1BRAA 3DFJA 2PGBB 3ZV8A 4BNRA 1B0FA 2ZI2H 2H9HA 3RXPA 1O5FH 1UVOA 1WTHD 2HOBA 3SI4H 1EZUC 3KQDA 1MTNB 4X8UH 3SUGA 2ZGHA 2Z9IA 2W5EA 3BTEE 1HCGA 2ZKSA 2V3HH 1KDQB 5L30H 1O5DH 4NGAH 1O3JA 4NSVA 1V2NT 1XX9A 4JK5A 1CHOF 1ZHPA 4ESTE 3D23A 4JCNA 3OX7U 3STIA 4NZLA 2AGEX 1JIMA 2W3KA 1GCTC 1C5TA 4UDWH 2QC2A 1HJ8A 3V3MA 1AO5A 1NRSH 2Y81A 1UHBB 4X1NU 4TYDA 2K1QA 3UR6A 2TIOA 1ZZZA 2XC5A 2PV9B 2F9OA 2SGDE 4CRAA 3BV9B 1PPBH 4Y7BA 1SHHB 1PQ8A 2V0BA 3RXKA 4TWWA 2ZTZA 4K1EA 4VGCC 1MBMA 5TCAA 1TGSZ 4Y7AA 1NS3A 1G36A 3EE0B 3A7TA 2BXTH 2VGCC 1GVZA 1MTSA 1NROH 3UPEA 4X2VA 2TGDA 2J38A 3KNXA 4UE7H 4NA7A 1K1LA 2JKHA 3ZVEA 3AW1A 3TH3H 1KXCA 3VXFH 1XVOA 4XBBA 1DLKB 2ZFFH 1NT1A 1AI8H 3MH4A 4YLUA 1B0EA 4RSPA 1A2CH 2O9QA 1KXDA 4TWYA 3LIWA 3UFAA 2ZCLP 2Z3DA 2P93A 5ESBA 3LJOA 1SQOA 1L1GA 1PQAA 3RXJA 3VXEH 5LPRA 2A32A 1L1JA 2XRCA 1AUJA 4Y79A 2FYRA 2OP9A 2BDAA 1CGHA 1NO9H 1E34B 2PW8H 4THNH 1UJ1A 1ZJDA 3MU5A 1H9HE 1GJ8B 3BTGE 1HGTH 1FQ3A 2TPIZ 4NIXA 3PTNA 1O3EA 4Y6DA 1N8OC 1XUHA 4NG9H 3SGBE 5DP8A 1B7XB 1O2RA 4I8HA 1MUEB 2A7CA 2AGGX 4F49A 3W95A 2GT8A 1V2TT 2G51A 3F9FA 1EASA