1SGNE

Asn 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
185
structure length
185
Chain Sequence
b'ISGGDAIYSSTGRCSLGFNVRSGSTYYFLTAGHCTDGATTWWANSARTTVLGTTSGSSFPNNDYGIVRYTNTTIPKDGTVGGQDITSAANATVGMAVTRRGSTTGTHSGSVTALNATVNYGGGDVVYGMIRTNVCAEPGDSGGPLYSGTRAIGLTSGGSGNCSSGGTTFFQPVTEALSAYGVSVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptogrisin B
publication title Recruitment of a Buried K+ Ion to Stabilize the Negative Charge of Ionized P1 in the Hydrophobic Pocket: Crystal Structures of Glu18, Gln18, Asp18 and Asn18 Variants of Turkey Ovomucoid Inhibitor Third Domain Complexed with Streptomyces griseus Protease B at Various pHs
rcsb
source organism Meleagris gallopavo
molecule tags Hydrolase/hydrolase inhibitor
total genus 48
structure length 185
sequence length 185
ec nomenclature ec 3.4.21.81: Streptogrisin B.
pdb deposition date 1999-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sgnE02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sgnE01
3SV6A 1O2XA 3VB3A 4ZAEA 4YO9A 3K6ZA 3BV9B 1TE0A 1EAUA 4ABHA 4X6MA 4ABJA 1Q31A 2W3KA 3PMBB 1O2HA 1VITH 4KTSA 4Q7XA 1MAYA 5T3HA 2YNBA 9LPRA 1UTOA 2OD3B 4YOJA 4AG2A 2B9LA 2QXIA 1TA6A 3DT0H 5EGMA 1O3DA 3Q3XA 4BAKB 1UVSH 3D23A 4ABIA 1MCTA 1IOEA 1FPHH 2A5KA 3GCOA 1SC8U 4RN6A 4Q7YA 2UWPA 3FANA 3VFEA 1DANH 3DA9B 2FLRH 1UTNA 3PLBA 2OXSA 5FPYA 3V0XA 2VGCC 4VGCC 2O8LA 1BBRK 1Z1IA 1YF4A 1HFDA 1O2WA 4ZKNU 4AFSA 7LPRA 1SB1H 1HXEH 3OU0A 4M7GA 3KL6A 3RMNH 1UVUH 1YPKH 1MU8B 1O2VA 2FYQA 2G00A 2BLWA 2AMQA 1BITA 2ZU3A 3CS0A 3M7TA 4TY6A 1C5UA 3UUZA 2CXVA 4MQAA 4B73A 2XYAA 1Y3XA 2THFB 1UJ1A 1P2KA 4X6NA 1TRMA 4I32A 2G4TA 1LHEH 2A31A 2A1DB 1AE8H 2Z9GA 4JZ1A 1SLUB 1O3LA 4X2VA 2A7JA 2W5EA 4ZH8A 5BPEA 5ABWA 3LGYA 5GXPA 4DIHH 4ABFA 1SHHB 2Y81A 5K0HA 2BDHA 2TBSA 1ZPCA 1CHOG 3HGNA 3RXQA 4LXBH 4NSYA 2OBQA 8LPRA 3LT3A 1WTGH 3VXFH 3FZDA 3MYWA 5DJ7A 2NU2E 3E8LA 1TA2A 1DM4B 1PPEE 4FUJA 1O2PA 1V6DA 2G8TA 3A7ZA 1BHXF 1C2EA 3BTME 3FAOA 3TH2H 1NROH 2J9NA 4Z0KA 3SJIA 3QZQA 1TFXA 1TX8A 4NIXA 4Y8YA 1V2PT 1HIAB 1GI3A 3MNXA 2ZHEH 2SFAA 2FOBA 3P70B 1AFQC 4MVNA 1TMUH 3BEFB 4I31A 1AD8H 1BTZA 1J14A 5GJ4B 3HPTB 1LPZB 3TJNA 2Z3CA 3S7HB 1BBRH 2VIDA 2ZPRA 4YT6H 3K65B 1RFNA 4LZ1H 2B8OH 3RMLH 1GBFA 1Y5UT 3NCLA 5A0AE 5FPSA 1EB1H 4X8UH 1ANCA 1IQIA 1FIZA 2ZFFH 1FQ3A 4SGAE 4AGKA 2ZDLA 1RTKA 3ZVFA 1EPTA 1KXCA 2WPJS 5LPRA 4BAOB 2GT7A 1EXFA 4WF8A 2A32A 2BM2A 2GDDA 1FJSA 2XBXA 1C1QA 1GVZA 4FUCA 1C5XB 1BRUP 2DE8A 1NESE 3T28A 1NFXA 1O5FH 1FPCH 4RSPA 1PJPA 2FOHA 3RXRA 1CA8B 3SU2A 1HAVA 3M61U 5EXMA 3SW2B 3UQOA 1VITF 3M5LA 4K69A 2XBWA 4WH6A 4X6OA 4NFFA 5A8ZA 1EPTC 1C5RA 2BOKA 2ZU4A 3ZZ8A 2A2XH 3TU7H 4BXSA 5CHAC 1D3QB 1S6HA 2ASUB 2C8XB 1W12U 3SQEE 1CE5A 5DP4A 1SGDE 5C1YA 1XUKA 1TAWA 4UFDH 1MTVA 2C8ZB 3BTHE 4Z6AH 2JKHA 1JIRA 2BYAX 2PHBA 2Y7ZA 5AFZH 3MI4A 1MTSA 1Y59T 1B0FA 3LGWA 3ZZAA 1AGJA 4HTCH 3L6PA 1FDPA 3KEEA 2QC2A 3A81A 2J2UA 4MLFB 2HWLB 1MAXA 5JBCS 1GJAB 1BBRE 2W7SA 3E0NB 1HDTH 1OS8A 1XVMA 1T7CA 3E1XB 3NZIA 1C2HA 3DUXH 1BMAA 1J9CH 1SGPE 2PR3A 2H5DA 2CV3A 5DP7A 1K1IA 1OX1A 5HXFA 1LVMA 1TX7A 3PMAB 1S82A 1C4Y2 1WCZA 3O8RA 4CRDA 1ELBA 4KTCA 3LPRA 1FY4A 4XE4A 5F8ZA 1GCTB 4J1YA 1GBCA 2A7HA 5F6MA 1O35A 1TPPA 1NTPA 4INKA 1MH0A 3B23B 3U8OH 4TWYA 1P09A 1AKSA 4X8VH 4MTBA 4A92A 1ZMLA 1BTYA 3R3GB 1UMAH 1BB0B 5AF9H 5L2YH 1K1JA 4XFQA 4YZUA 2H1UA 5HMAA 1UTLM 3RXHA 2SNWA 1C2MA 2G5VA 1SFIA 1J15A 1Y3UA 1QRZA 4DJZB 1KDQA 4CBNA 1HV7A 1MBMA 4Y10E 1QURH 3FVFB 1YPJH 4AFZA 3T2NA 4K1EA 4U30A 4OGYA 1GJ6A 4NA8A 2QGRA 1V2RT 1AE5A 2G52A 1UCYK 1Y3VA 1Y5AT 3BG8A 3LH3A 2ZA5A 3JZ2B 1ZOMA 3A8CA 2ZU1A 3RXEA 2Z9JA 1NFYA 1AY6H 1B0EA 2OC0A 2R2MB 1W0ZU 1GJ9B 4Q2KA 5E2PA 4ZKOU 2FI5E 2OC7A 3QN7A 5C1XA 1P2NA 4WH8A 1WTHD 1ZGVA 1C2IA 1ZLRA 3GCHB 3SZNA 5C67A 1ELGA 2FWWA 1QJ1B 1FI8A 3DHKH 4ZKSU 1QGFA 2BXUH 3LH1A 1C1WH 1FY3A 2VIVA 3HKIB 5EG4A 1L1GA 2D2DA 1AIXH 4J2YB 5DK1A 1BTWA 1XKAC 4K3JA 3RXUA 2NU1E 1TNGA 1ZPBA 2CF9H 2BLQA 1THRH 1SQTA 1TLDA 1DWBH 2H9EH 3BF6H 4UD9H 3URDA 2WUCA 4NIVA 3NUMA 4CR9A 4HI3A 3TGIE 3ATMA 3HK6B 1AWHB 4BTIB 1IHSH 1O2RA 1C4U2 2XRCA 1C1RA 4A1VA 4TWWA 1TGCA 1O2QA 1GL0E 5DG6A 1WQSA 1GHAG 1EASA 2P94A 2EC9H 2F9VA 2GMTC 1LMWB 1GPZA 3SO3A 2ZDKA 3MOCA 4YTAA 2Y6TA 1G3CA 3HK3B 2Q6GA 1SPJA 4E7NA 3S9BA 4JYTA 5LPFA 5LH8A 4GHTA 3A83A 1TGTA 4U2WA 1UCYH 1PPBH 1XUFA 2DE9A 2QIQA 5FBEA 3AASA 3S0NA 2CF8H 1HPGA 3SUDA 1C5MD 1ZR0A 1GMHF 1SGFA 1D3DB 2ZPSA 1HB0B 4ASHA 5I46H 5K7RA 4FUDA 1VGCC 3ZZBA 1O3IA 3ODDA 1SG8B 4OGXA 2XCFA 1LHFH 4U32A 2ANWA 1PPGE 3SU0A 3KCGH 2ZGXH 2Y5HA 3S7KB 4BTUB 3IWMA 3VEQB 1VCQA 3QX5H 2FOGA 1SGYE 1D6WA 4GSOA 2PWXA 4NIWA 3VB5A 1JWTA 4FUIA 2QF0A 4NG9H 1GJ5H 3TLOA 1WUNH 5FXLA 1RIWB 1GI9B 2PUXB 3CS7A 4BXWA 1ZGIA 5EQQA 2WYJA 4B1TA 3PV4A 4ISHH 1QB9A 1TMBH 2P8OB 3PTNA 1ELTA 3BEUA 2CHAC 1TABE 2OLGA 1EUFA 2TGTA 1CT4E 4D76A 1F0TA 1EP6A 1CA0B 2GV7A 3A86A 1SFQB 4NA7A 2ANKH 1O2ZA 1LVOA 1NRPH 3A7XA 1KYNA 2NU3E 1GVKB 1YLCA 1XUGA 5JDUB 1CBWC 5FCKA 1MBQA 1O3HA 4X1SU 1LQEA 3LGVA 1P02A 1SQAA 3S69A 2D1JA 1UCYE 2GZ7A 3SJ8A 5JBTA 3UNQA 3P17H 3PLKA 4FU8A 1Y3YA 1V2UT 4TPIZ 2BTCE 3RU4D 4PROA 4ZXXH 1DS2E 5GCHG 3A89A 1QIXB 1ZYOA 1EJMA 2QN5T 5DGJA 1IQHA 2UWOA 1QR3E 1GBAA 2GV6A 2H9TH 1GBMA 1INCA 3A7TA 1Z7KA 1NFUA 4CBOA 4Y6DA 1SLXB 5EXNA 3TK5A 2ZFRH 1XKBC 1FY8E 3BIVH 4YOGA 1MQ6A 2VGCB 4VGCB 1DDJA 3MNSA 1F5RA 2P59A 1GBKA 1HAOH 1AI8H 1C5PA 1WU1A 1SOTA 1QA7A 1GHWH 2V0BA 2AGGX 1A5HA 3U8RH 5DO4H 1HAHH 3ZZ4A 2QF3A 2VB0A 5GWZA 4NWLA 2ZCKP 3SU6A 8GCHG 1T32A 2R0KA 3ENSB 1KLIH 3M3VA 1AZ8A 4UONA 3MU1A 5ESBA 1K28D 2ZHFH 4B2BA 1C2GA 2PKAA 1N8OC 4ABAA 3NWUA 1FAKH 1BQYA 1MZAA 1EB2A 2D26C 2HLCA 1MCVA 4IN2A 2CN0H 3D49H 1RXPA 3RXMA 1C9PA 1GI0A 2VH6A 4Y0ZE 2BD3A 4D9RA 1GMCF 2BB4A 4UE7H 1WV7H 3RXDA 1GGDC 4CHAC 2QAAA 1UO6A 4JMYA 1NRRH 2BDAA 1A7SA 4D9QA 2BDYA 1LKBA 2F9UA 3D65E 4D7FA 1BA8B 3F6UH 4H6SB 1GI7B 1LVYA 4B71A 1YP9A 2BY8X 1AHTH 3QZRA 3SV7A 1F7ZA 4ISIH 3SUGA 4MNYA 1CGIE 4OS6A 1GBEA 3TH4H 2Y5FA 1B7XB 1E35B 1FNIA 3RXJA 3RXPA 3T62A 1TONA 2FXRA 3EE0B 2G4UA 4AFQA 1AB9C 1AUTC 4ZHLU 1NPMA 1GCDA 5EOKA 1SGQE 1UVOA 1QRXA 3QTVH 3UWJH 1O3OA 4XBCA 1O3CA 2VVUA 1ZMNA 1XVOA 3PB1E 3EA9A 2QV1A 3H5CB 2ZDNA 1KY9A 2UUKB 4CRGA 3UOPA 3ZVEA 5E0JA 1TGSZ 1BTPA 1O3PB 1ZJDA 1P2OA 1P12E 1V2KT 5JYIA 2WPLS 3ZV9A 3SNDA 1BZXE 3PO1C 1C2FA 5F8XA 2H9HA 1TGNA 1Q2WA 2QXJA 1F2SE 4Q80A 2ZECA 2GD4B 5T6FA 2Z3DA 3MNBA 4GCHF 1W13U 2WYGA 1O5CB 1E34B 3M3TA 4IGDA 4AB9A 5AVDA 3E3TA 1CGJE 2XBYA 4FUHA 1YBWA 2RG3A 1DWEH 3MH4A 1AUJA 3LONA 5C2ZA 1LCYA 1O36A 2ESTE 1TALA 1V2LT 1GJ7B 2I6SA 2GVFA 4E7RG 1OWJA 4GLYA 1YPLH 3GCNA 3Q76A 2HOBA 3TJUA 1NY22 1SMFE 3M7UA 3QLPH 1LHCH 7GCHF 2EA3A 3E0PB 2PGQB 4DGJA 2NWNA 4UFFH 1EATA 3OTJE 1DSUA 1H9HE 3M7QA 1C1SA 5CMXH 1O5EH 1DPOA 2RA3A 1GBJA 5CHAB 5E0HA 4I33A 1CGHA 1VJ9U 3GOVB 1P2QA 3PMHB 3RU4T 3ZVCA 1ACBE 2EI7A 5A09A 1H8IH 4OS4A 1BMMH 1G36A 3SGAE 3N7OA 3DFJA 3Q3YA 1H8DH 2BY6X 4K8YA 3SU5A 8ESTE 1C2DA 1GHBG 2PGBB 1TBQH 1HAVB 2SGEE 2FIRH 3SHAH 1B5GH 2QXHA 1E0FD 3S9CA 2JETC 4UDWH 1ETTH 1L4DA 4WWYA 1OWKA 3A84A 3F9HA 3BG4C 3ZYEA 2AMPA 4BTTB 5FX6A 1O3GA 4AOQA 5SGAE 3VXEH 1BIOA 5PTPA 5DPAA 3KQBA 3M37A 3EA7A 1ELVA 5JB8S 2GT8A 4ESTE 2XBVA 3A80A 3C1KA 1HGTH 1K1PA 1KIGH 4H42U 2J94A 4MNWA 1MTWA 1GJCB 1IQJA 3K6YA 1FV9A 4HZHA 4AYVB 3T25A 3TNTA 1O3AA 4KTUA 2FX4A 1AWFH 1UHBA 2C8WB 2WUBA 1W7GH 4CRFA 2BDGA 4DURA 2ZCHP 3A87A 1O0DH 1C4V2 2PV9B 2VVCA 3Q3KA 2TGPZ 3RM0H 4ZKRU 1EZQA 2F83A 5GPIB 5DP9A 4B75A 1HUTH 1GMDG 3VGCC 2ZDVH 4YT7H 2GCHG 1NFWA 1QBNA 4LOYH 2FLBH 1P04A 1Z6EA 2A4GA 1OP2A 2BDIA 4AB8A 4E06H 2P95A 1WSSH 1QL7A 1P8VC 3RP2A 1XX9A 1BTUA 3SJ9A 1AKSB 1O30A 3FFGA 1W8BH 3P95A 2BXTH 2F9OA 4X1QU 1GBLA 2BQ6B 1GG6C 3SNCA 1JMOH 3EAJA 1KTSB 1MKXK 3SUFA 1ESTA 3MFJA 3NPSA 4IMQA 2W3IA 3LIWA 3GY5A 2UWLA 1KDQB 3KF2A 1XM1A 3BTGE 3BTFE 1ID5H 4DIIH 1RD3B 4A7IB 1SGCA 4JZDH 1GJ8B 1O2UA 1S81A 3A7YA 1GWAA 1NS3A 5C1UA 2XXLA 1Z8GA 4FXGH 1JIMA 1ZHRA 2ZHQH 4XBDA 1S6FA 2BQ7B 1J8AA 1CQQA 5HM9A 1O3JA 2STAE 4UEHH 1DSTA 4UFGH 2FM2A 4WMFA 2OP9A 3SU3A 2PKSC 2V35A 5L2ZH 1PQ8A 2ZKSA 1DE7H 2BVXH 3I78A 1BDAA 4IBLH 1BHXB 2PTNA 5J4SA 1ZTKA 1L1NA 4YLUA 1O2GH 1P57B 2OC1A 3SJOA 1HAGE 4B76A 1A46H 1MZDA 1VCWA 2XNIA 1O32A 2FS9A 2OBOA 3ZZ6A 5L6NH 3AW0A 4B2AA 5A8XA 1O2LA 1TQ0B 3SGQE 1O2KA 2ZTXA 3A8DA 2F9NA 1WOFA 1C5LH 1MTNC 1A3BH 1CVWH 3HKJB 4FU7A 4FUFA 5C5NA 2QCYA 3RXIA 4Y8XA 1EX3A 3GY3A 3MMGA 1GBHA 3GCTF 1UK2A 4YESB 5H4IB 3VPKA 3TVJB 1W7XH 1A2CH 5BRRE 1O2NA 3U8TH 1A3EH 5ETXA 1H9LB 1AQ7A 1MKXH 1G32B 2ZGBH 1MU6B 2SGAA 1LDTT 2ZGHA 2ZTYA 1P2MA 3OSYA 3SU4A 1IQMA 1VGCB 4FVDA 1QL9A 1PYTD 2O8MA 1OOKB 3SNBA 2AFQB 1KLJH 1NN6A 3ZVDA 2FZZA 2ODYB 4K60A 3RXLA 4BAQB 1T8MA 1HCGA 1S0QA 2BY7X 4NZLA 2VIPA 4D7GA 4I8GA 4ZXYH 1GI2A 2VIWA 4AORA 2IN2A 5B6OA 1O3FA 1W0YH 2F3CE 1BOQA 2WPMS 1V2OT 2R3UA 2BLVA 5F8TA 4JZEH 1BTXA 3GY2A 1LTOA 2O8WA 3TJOA 3A7VA 1PPCE 2TIOA 1BUIA 1THPB 4K1TA 3LGUA 4HGCA 1CT2E 1OSSA 4BAHB 4D8NA 2ANYA 3E91A 1HAZB 1HXFH 1EZUC 2AH4X 3QDZB 1ARCA 5DP5A 2AGIX 2CHAB 1YPGH 3M36A 3C27B 3SJKA 3FZZA 2OC8A 3P8NA 2HVXA 2Y7XA 1EOJA 1LO6A 1EP5A 1TMTH 5J4QA 2J92A 3RDZA 1M9UA 1HAIH 1FXYA 4AX9H 2WPIS 1JXPA 1LPKB 1OKXA 2ZGJA 1CBWB 1ZJKA 2V3OH 3SUEA 4JYVH 2XTTB 3BTEE 2AS9A 1ETRH 3D62A 2Z94A 1QNJA 2A4OA 3L33A 1DXWA 1HJAB 1BCUH 1ZPZA 3PWBA 2ZU5A 4JCNA 4O9VA 1P9UA 2QYIA 3H7OA 3RXCA 1GBIA 4RKJB 4BANB 5HYOA 5HGGA 1EAXA 4H6TA 3CP7A 4WY3A 3T27A 4IN1A 3EQ0H 4KP0A 1GI4A 4DY7B 3LC3A 1NM6A 1HAXB 3GY8A 4DOQA 1DY9A 1K1OA 1LVBA 1JOUB 1OYQA 3SN8A 3KN2A 1NRSH 1DITH 1GJ4H 3TGJE 1TGBA 2BD5A 1TBZH 3BIUH 4GPGA 4H4FA 3UWIA 1ANBA 1T8OA 2V3HH 4JYUH 2A0QB 4FUBA 3NK8A 1J16A 2VH0A 3F1SB 1FAXA 1T8NA 1TNJA 1PFXC 1BRCE 3RLWH 4ABGA 2ZF0H 5EODA 5JBBS 4X1NU 3PTBA 1MD8A 3E90B 2GGVB 4O03A 3RXFA 1N8OB 3MU4A 1GHYH 1TNIA 2IJOB 6GCHF 2AGEX 2ZNKH 4XDEA 1RRKA 3UNSA 2XWBI 4I8HA 1CT0E 2FODA 1GGDB 4CHAB 3KGPA 3URCA 2OINA 2Q6DA 1HLTH 4IC5A 1CSOE 2P93A 1V2TT 6ESTA 1FZZA 1IQGA 1YC0A 3QGJA 2PKAB 1Z1JA 1C5OH 1HNEE 3PLPA 1W14U 3ZZDA 5E0GA 5TJXA 2IPHA 1S0RA 4X2WA 1XUIA 4INHA 3RC5A 2XWAA 1TBRH 4U01A 1SSXA 4I8JA 1AB9B 3M5MA 1GI6A 1KTTB 3MO9A 1P11E 3QGNB 3V3MA 1Z8IB 1RJXB 2G51A 4XBBA 1SBWA 2ZFQH 1F0SA 1DXPA 2HRVA 5FCRA 1V2MT 5EPYA 1UK3A 1S85A 3A88A 3MNCA 3RXAA 1C1PA 2J34A 3KQCA 1ETSH 1KXEA 3PO1B 1QB1A 1NU7B 4MPVA 1QQUA 1C9TA 5C3NA 2ZTZA 2Z3EA 1UK4A 2FI3E 1QL8A 5C5OA 4ABDA 3O8BA 3VB7A 3KQDA 1O3NA 1Y3WA 1P03A 3QWCH 3ODFA 1YCPK 4TPYA 2SNVA 3MU5A 4HFPB 3TJVA 4Y7BA 3O8CA 3EGKH 5T6DA 1O31A 2ZI2H 1GHAF 2QY0B 5T6GA 3VB6A 3RXOA 2QXGA 1HJ9A 3RXVA 2ZZUH 3M5OA 4CRAA 1FMGA 7GCHG 2TGDA 1O2SA 3TPIZ 2OUAA 3GY6A 1JBUH 3SGBE 2XW9A 1FN6A 3BEIB 1SGNE 2BD8A 1BMLA 1UTPA 1SLVB 1C1VH 1ZSKA 1A0HB 1SGTA 3KIDU 5CE1A 1KLTA 4INLA 5LPEA 2P3UB 3SI3H 3KNXA 1AVGH 2RA0A 1HBTH 1F5KU 1SI5H 2CGAA 3BN9A 1O2IA 1XXDA 4GVUA 3SNAA 3SV8A 1VCPA 1D3PB 3OX7U 1VJAU 2R9PA 2ZO3H 2BD7A 3ZYDA 1EJAA 3ZVBA 1T8LA 4DCDA 1P3CA 3V12A 4CRBA 2ZPQA 4R8TB 3ZZ7A 1OXGA 3NKKA 1GHVH 3M35A 4MG3A 1K1LA 2JETB 4XSKU 2PSYA 1QJ7B 1P10A 1C5YB 3MU8A 4MPUA 1QHRB 2J4IA 6CHAC 3ZVGA 1MD7A 1RIWC 4CH2B 2BD4A 2ODPA 1MKWK 2HGTH 1D3TB 3BG4B 5FPTA 4I8KA 1O2TA 1UTJA 1YPHC 2VIQA 1T31A 4AGJA 2XC4A 1YPMH 1ORFA 1TB6H 3FP7E 1O2JA 2FO9A 5L30H 4Y8ZA 3ZV8A 1C1MA 2C93B 2Z9LA 2KAIA 1AFQB 1CA0C 4A6LA 1AO5A 2FDAA 4BOHA 3TITA 2WV5A 5LGOA 1AVWA 1OWEA 1YCPH 4WXIA 5HM2A 3K2UA 5E2OA 2C3SA 1L0ZA 5EQRA 1K1NA 1TNKA 2JH0D 3HATH 1L1JA 2BOHB 2SGQE 1BRBE 4O3TA 1ELEE 1RGQA 2NU0E 3U1IB 4B2CA 2OCVB 1G3DA 5GIBA 1SVPA 1D9IA 4NIYA 1SOZA 3ATKA 2C8YB 1K22H 5E8EH 1MMJN 1SQOA 1YM0A 2WINI 1DLKB 4AZ2B 4CH8B 5F03A 3U9AH 4UFEH 1FY1A 1A1RA 1T4UH 4Q7ZA 3VGCB 1P3EA 3BTTE 1LHGH 1GDQA 1ZZZA 1DUAA 2GZ8A 2R3YA 3SORA 2A4QA 1W3CA 2V6NA 2WV4A 4FUEA 5C20A 2C4FH 1UHBB 4K5ZA 4GAWA 5GCHF 1NRQH 1ANEA 1VITG 2O8TA 1JRTA 1GHZA 2AEIH 4LK4A 4E05H 2FOEA 2CMYA 4OS7A 3BTWE 1QFKH 1E36B 1GG6B 4K1SA 1SGFG 4RKOB 1EPTB 2ZEBA 2FOFA 1TPOA 3Q77A 2BDCA 1DVAH 4I8LA 2HNTE 1C1TA 4JK6A 1MKWH 1ARBA 2ZFSA 2BQWB 2BZ6H 1O2OA 2JH6D 5DKMA 4AG1A 1H4WA 2BD2A 2VWOA 4X6PA 1PPZA 3R0FA 1FLEE 1O3BA 3P8FA 3ITIA 2G55A 2BY9X 3BTQE 8GCHF 2ODQA 1EKBB 1A4WH 1GDUA 1LKAA 1QRWA 1YGCH 2PKSB 3AAVA 1O2MA 1C5VA 1TQ7B 1V2NT 1MTUA 1BT7A 4ZHAA 2R2WU 1G9IE 1TIOA 2EI6A 1HRTH 1P2JA 3LKWA 2GDEH 1UVTH 2PFEA 1G2LA 1DFPA 1ELCA 3GDSA 4X0WU 3RC6A 1Q3XA 1N6XA 3UNRA 3RMOH 3I29A 1AU8A 3GCTG 1MTNB 3ZVAA 2P16A 4B74A 5JB9S 1TRYA 4FVBA 1WAYB 1G30B 2HNTF 2GCTC 2ZFPH 1ZTLA 1XXFA 4NFEA 2OQ5A 1EJNA 9ESTA 4IMZA 1QY6A 3MHWU 5FAHA 1G2MA 1IHTH 1ELFA 4O3UA 3U1JB 1ZTJA 1PQAA 3SNEA 1TX6A 5DP3A 1GBBA 3B8JA 4KKDA 3RXGA 2SGPE 3MH5A 5A0BA 2AERH 2FP7B 5A2MH 2AIQA 3DD2H 2FI4E 1TOMH 2GX4A 4GHQA 2Z9KA 1YLDA 2ALVA 1UTKA 2A5IA 3T29A 2F9BH 3ELAH 3PM3A 3A8BA 4TYDA 1OPHB 2ZP0H 3MO3A 2WPHS 2P3TB 1FIWA 1V2ST 3TK9A 3AW1A 1FUJA 1E37B 1GBDA 3M5NA 2IOTA 2PW8H 1TPAE 2PSXA 2XC5A 1E38B 2A2QH 4K2YA 4X1RU 3RM2H 1JRSA 2FESH 3QK1A 2M5TA 2Z6BD 3AAUA 4KGAA 1SHYA 2ALPA 2Y5GA 1GJBB 4X2YA 1BJUA 2O9QA 1PQ5A 2AMDA 2TGAA 4Y76A 3MU0A 2FPZA 5FHTA 1S83A 3V13A 5IDKA 1YYY1 2FX6A 1D4PB 1FY5A 4JZIA 3SI4H 2ZWLH 1OWDA 1OWHA 4MDSA 1F0RA 3A7WA 2LPRA 4Y79A 1P0SH 1HIAA 1O5AB 1A0JA 2TPIZ 2ZCLP 5I25A 1SGRE 1DT2A 2F91A 4DT7B 1ZHPA 5JPMH 1DWDH 1NO9H 3IG6B 1GHBF 2VNTA 1C1OA 3F9GA 2K1QA 1ZHMA 2FOAA 1V2VT 5A8YA 3TNSA 2GMTB 1SGEE 1CHOF 4WJG2 5EPNA 1FONA 2YNAA 1C5ZB 3UY9A 1WBGB 4DVAU 3W94A 3MTYA 1HYLA 1OP8A 1J17T 4ISLA 1KXDA 1H9IE 1PPHE 1C5TA 3GISB 5FX5A 2BLOA 4QT8C 2H6MA 3TH3H 1XUHA 2OQUA 1UTMA 1GMHG 3PWCA 2A4RA 3GDUA 1W11U 1DICA 1EOLA 2B0FA 2ZU2A 2FOMB 3ZZ5A 2YOLA 1A5IA 1QA0A 3P8GA 4F4OC 1EZSC 3STIA 1V2WT 3QUMP 5A0CA 2D8WA 1YPHE 2ZIQH 1C2JA 2HPQH 1GDNA 1MUEB 2VJ1A 4I7YH 2GP9B 4X2XA 4X8SH 1DOJA 1V2JT 1IQLA 1EQ9A 1F5LA 1GI5A 4R0IA 1IQEA 4IC6A 1P06A 2H5CA 3ATLA 6LPRA 4NZQA 2P3FH 1NZQH 2BX4A 2OTVA 3I77A 2RCEA 2Y80A 3RU4E 1EAIA 6GCHG 4WXVA 2W7UA 1Z6JH 4GUXA 2PLXA 2TRMA 3EYDA 1O34A 1GMDF 2GTBA 2FTLE 4ZUHA 3MH7A 2GCHF 3GY4A 1Z8JB 3P8OA 1G3BA 1L4ZA 4A5TS 3WY8A 2PTCE 1DX5M 8KME2 2DUCA 5EXLA 1RTFB 4AN7A 3FP8E 1DWCH 1NU9A 3SU1A 3ZZ9A 1BJVA 3STJA 2VU8E 1C2LA 1K9OE 3A85A 1SLWB 3IITA 1TRNA 2Y82A 4MPWA 1TNLA 5EW2H 1AZZA 3LJOA 1XMNB 4SGBE 5FBIA 1HJ8A 4O97A 2PUQH 2GZ9A 3BSQA 1ZRBA 2ZDMA 3L3TA 3SOSA 4X8TH 4CREA 1Y8TA 1IAUA 2BVSH 2G5NA 1EZXC 3RXBA 3TK6A 3BTDE 2BX3A 3OYPA 3RXSA 2BZAA 3UR9A 1CHGA 3AVZA 1GJDB 1NC6A 1CO7E 2I6QA 3F68H 1P9SA 5EU8A 2EEKA 2Q1JA 4NCYA 3OY6U 2UUFB 2BD9A 2FTMA 1K21H 3T5FH 4THNH 1C5WB 1C5NH 1AFEH 3SBKA 1QBOA 4WMDA 1UTQA 3ESTA 2HNTC 3UIRA 2Q6FA 1T4VH 3GICB 1A61H 1ZMJA 3UPEA 4ABBA 1O3MA 4A1XA 1OP0A 2C90B 3Q00A 1ZSJA 1HAYB 2VWLA 4IS5A 3SQHE 4TY7A 1GHXH 2HALA 3O8DA 5GDSH 2BY5X 4DW2U 3LU9B 1GCTC 2SGFE 1SL3A 4KELA 1DUEA 1WQVH 1KXAA 4ZMAH 3RUOA 1QBVH 5TCAA 1KXBA 1W10U 5G4BA 2J95A 4Y0YE 3NXPA 1PPFE 3K9XB 4DG4A 1PYTC 5AFYH 4Y7AA 4NSVA 1MQ5A 2VWMA 1W2KH 3S9AA 2R0LA 3V7TA 1THSH 2ZDAH 1QQ4A 5JBAS 4YM9A 1K1MA 3P6ZB 2BHGA 4NWKA 4ISOA 1L2EA 1GL1A 4Y11E 3GY7A 1K2I1 3P92A 1P01A 3UQVA 4NGAH 2A5AA 3SV9A 2VINA 1O2YA 3SV2H 3UTUH 5DP6A 1ANDA 1RTLA 1TPSA 1GMCG 1UVPA 1XUJA 3LDXH 4AYYB 2WPKS 3UREA 3LC5A 1EAWA 3T26A 2UUJB 1P2IA 3U98H 2ILNA 2FEQH 4JK5A 1H1BA 1OYTH 2VVVA 4XOJA 4OS5A 1BRAA 1ESAA 4X1PU 5ESTE 4YOIA 2RDLA 6CHAB 7ESTE 1S84A 3PMJA 4WMEA 2BMGB 2ZHDA 4OS2A 3RC4A 2Z9IA 3LJJA 4FU9A 1SR5C 1KXFA 1YPEH 3ATWA 3LGIA 3KHVA 4ISNA 2FMJA 1VZQH 3GCHC 7KMEH 2H2ZA 1GVLA 1PQ7A 3OY5U 3SHCH 1C1NA 1RS0A 3UFAA 2XC0A 4WVPE 1DY8A 3E6PH 1OWIA 4F49A 5DP8A 2FOCA 1C2KA 1SGIB 2HPPH 4FUGA 3GYLB 1TOCB 4BAMB 2SGDE 1A5GH 1LPGB 4ABEA 2ZFTA 1Y5BT 4GCHG 3BTKE 3QTOH 4OS1A 4NA9H 1Z71A 1YCPM 2STBE 4MNXA 2ZG0H 2Z7FE 3W95A 1HJAC 3EA8A 2B5TB 1O5DH 1LHDH 1O37A 1TYNA 2KAIB 1NRNH 1LQDB 1O5GH 1U6QA 1ELDE 3RLYH 3QO6A 4AFUA 3E16B 3MO6A 3FP6E 2FS8A 3H7TA 3ZZCA 1O38A 3CENA 1BMNH 3PROA 1ZRKA 1A0LA 2BDBA 1ZSLA 2EI8A 3ZZ3A 1WYKA 1O39A 1QJ6B 2AIPA 1V2QT 1ELAA 4CR5A 2VWNA 3HGPA 3PYHA 1C5SA 2W26A 2F9PA 1O33A 2G81E 3MWIU 3GYMA 1IQFA 2ZHWH 4A1TA 3TGKE 2J38A 3GDVA 4BNRA 2ZQ1A 3G01A 3VB4A 5AHGH 4MNVA 5TCCA 3B9FH 1KSNA 4LZ4B 1O3EA 2CJIA 1D6RA 4CRCA 2JH5D 3M3SA 1ABJH 1CU1A 2ZC9H 2ZGCA 4Y71A 2ULLA 5IYTA 3A8AA 3JZ1B 1C1UH 1V3XA 4JZFH 1O3KA 2BVRH 1AMHA 1IQKA 1IQNA 1P05A 3RMMH 1QCPA 1N1LA 2B7DH 3KQEA 1GI1A 2QA9E 1NT1A 3LOXA 1QB6A 5EQSA 2A7CA 3A82A 1BTHH 1N6YA 2LNCA 1G37A 1TNHA 2P8OC 1AN1E 4ZROA 4IW4E 1AVXA 1DLEA 3TIUA 4MPXA 3UOUA 1F0UA 3EDXB 5EW1H 1GBTA 2AYWA 4ZHMU 1GI8B 2UUYA 3UR6A 1G3EA 2GKVE 2ANMH 1YKTA 2O8UA 2ZQ2A 1VR1H 1X7AC 2A45B 3F9FA 1QTFA 2GCTB 3LGTA 3RXKA 1HAPH 1ABIH 2VIOA 1TWXB 4YLQH 1S5SA 2XCNA 3MH6A 4K8BA 3U69H 1ESBA 3F9EA 1FN8A 2FYRA 3RXTA 2NU4E 1C5QA 1O5BB 3ATIA 1Z8RA 3DFLA 1F92A
chains in the Genus database with same CATH superfamily
3SV6A 1O2XA 3VB3A 4ZAEA 4YO9A 3K6ZA 4TT3D 3BV9B 1TE0A 1EAUA 4ABHA 4X6MA 4ABJA 1Q31A 2W3KA 3PMBB 1O2HA 1VITH 4KTSA 4Q7XA 1MAYA 5T3HA 2YNBA 9LPRA 3WWFA 1UTOA 2OD3B 4YOJA 4AG2A 2B9LA 2QXIA 1BMFD 1TA6A 3DT0H 5EGMA 1O3DA 3Q3XA 4BAKB 1UVSH 3D23A 4ABIA 1MCTA 1IOEA 1FPHH 2A5KA 3GCOA 1SC8U 4RN6A 4Q7YA 2UWPA 3FANA 3VFEA 1DANH 3DA9B 2FLRH 1UTNA 3PLBA 2OXSA 5FPYA 3V0XA 2VGCC 4VGCC 2O8LA 1BBRK 1Z1IA 1YF4A 1HFDA 1O2WA 4ZKNU 4AFSA 7LPRA 1SB1H 1HXEH 3OU0A 4M7GA 3KL6A 3RMNH 1UVUH 1YPKH 2GJGA 3F3BA 1MU8B 1O2VA 2FYQA 2G00A 5DSFA 2BLWA 2AMQA 1BITA 5EJ1A 2ZU3A 3CS0A 3M7TA 4TY6A 3DSPA 1C5UA 3UUZA 2CXVA 2HLDD 4MQAA 4B73A 2XYAA 1Y3XA 2THFB 1UJ1A 1P2KA 4X6NA 1TRMA 4B6EA 4I32A 2G4TA 1LHEH 2A31A 2A1DB 5F53A 1AE8H 2Z9GA 4JZ1A 1SLUB 1O3LA 4X2VA 2A7JA 2W5EA 4ZH8A 5BPEA 5ABWA 3LGYA 5GXPA 4DIHH 4ABFA 1SHHB 5C0UA 2Y81A 5K0HA 2BDHA 3FOAA 2TBSA 1ZPCA 3KYGA 1CHOG 3HGNA 3RXQA 4LXBH 4NSYA 2OBQA 8LPRA 3LT3A 1WTGH 3VXFH 3FZDA 3MYWA 5DJ7A 2NU2E 3E8LA 3F2GA 1TA2A 1DM4B 1PPEE 2YMSC 4FUJA 1O2PA 1V6DA 2G8TA 3A7ZA 1BHXF 1C2EA 3BTME 3FAOA 3TH2H 1NROH 2J9NA 4Z0KA 3SJIA 3QZQA 1TFXA 1TX8A 3OAAD 4NIXA 1V2PT 4Y8YA 1HIAB 2KCPA 1GI3A 3MNXA 2ZHEH 5CDFE 2SFAA 2FOBA 3P70B 1AFQC 4MVNA 1TMUH 3BEFB 4I31A 1AD8H 1BTZA 1J14A 2HVYB 5GJ4B 3HPTB 1LPZB 3TJNA 2Z3CA 3S7HB 1BBRH 2VIDA 2ZPRA 4YT6H 3K65B 1RFNA 4LZ1H 2B8OH 3RMLH 1W0KD 1GBFA 1Y5UT 3NCLA 5A0AE 5FPSA 1EB1H 4X8UH 1ANCA 1IQIA 1FIZA 2ZFFH 1FQ3A 4SGAE 4AGKA 2ZDLA 1RTKA 3ZVFA 1EPTA 1KXCA 2WPJS 5LPRA 4BAOB 2GT7A 1EXFA 4WF8A 2A32A 2BM2A 2GDDA 4FOUC 1FJSA 2XBXA 1C1QA 1GVZA 4FUCA 1C5XB 1BRUP 2DE8A 1NESE 3T28A 1NFXA 1O5FH 1FPCH 4RSPA 1PJPA 2FOHA 3RXRA 1CA8B 3SU2A 1HAVA 3M61U 5EXMA 3SW2B 3UQOA 1VITF 3M5LA 4K69A 2XBWA 4WH6A 4X6OA 4NFFA 5A8ZA 1EPTC 1C5RA 2BOKA 2ZU4A 3ZZ8A 2A2XH 3TU7H 4BXSA 5CHAC 1D3QB 1S6HA 2ASUB 2C8XB 1W12U 3SQEE 1CE5A 4YXWD 5DP4A 2KX4A 1SGDE 5C1YA 1XUKA 1TAWA 4UFDH 1MTVA 2C8ZB 3BTHE 4Z6AH 2JKHA 3H09A 1JIRA 2BYAX 2PHBA 2Y7ZA 5AFZH 3MI4A 1MTSA 1Y59T 1B0FA 3LGWA 3ZZAA 1AGJA 4HTCH 3L6PA 1FDPA 3KEEA 2QC2A 3A81A 2J2UA 4MLFB 2HWLB 1MAXA 5JBCS 1GJAB 1BBRE 2W7SA 3E0NB 1HDTH 1OS8A 1XVMA 1T7CA 3E1XB 3NZIA 1C2HA 5KEDA 3DUXH 1BMAA 1J9CH 1SGPE 2PR3A 2H5DA 2CV3A 5DP7A 1K1IA 1OX1A 5HXFA 1LVMA 1TX7A 3PMAB 1S82A 1C4Y2 1WCZA 3O8RA 4CRDA 1ELBA 4KTCA 3LPRA 1FY4A 4XE4A 5F8ZA 1GCTB 4J1YA 1GBCA 2A7HA 5F6MA 1O35A 1TPPA 1NTPA 4INKA 1MH0A 3B23B 3U8OH 4TWYA 1P09A 1AKSA 4X8VH 4MTBA 4A92A 1ZMLA 1BTYA 3R3GB 4ZCNA 1UMAH 1BB0B 5AF9H 5L2YH 1K1JA 4XFQA 1FX0B 4YZUA 2H1UA 5HMAA 2WPDD 1UTLM 3RXHA 2SNWA 1C2MA 2G5VA 1SFIA 1J15A 1Y3UA 1QRZA 4DJZB 1KDQA 4CBNA 1HV7A 1MBMA 4Y10E 1QURH 3FVFB 1YPJH 4AFZA 3T2NA 5CHBA 4K1EA 4U30A 4OGYA 1GJ6A 1OHHD 4NA8A 2QGRA 1V2RT 1AE5A 2G52A 1UCYK 1Y3VA 1Y5AT 3BG8A 2F4LA 3LH3A 2ZA5A 3JZ2B 1ZOMA 3A8CA 2ZU1A 3RXEA 2Z9JA 1NFYA 1AY6H 1B0EA 2OC0A 2R2MB 1W0ZU 1GJ9B 4Q2KA 5E2PA 4ZKOU 2FI5E 2OC7A 3QN7A 5C1XA 1P2NA 4WH8A 1WTHD 1ZGVA 1C2IA 1ZLRA 3GCHB 3SZNA 5C67A 1ELGA 2FWWA 1QJ1B 1FI8A 3DHKH 4ZKSU 1QGFA 2BXUH 3LH1A 1C1WH 1FY3A 2VIVA 3HKIB 5EG4A 1L1GA 2D2DA 1AIXH 4J2YB 5DK1A 1BTWA 1XKAC 4K3JA 3RXUA 1TNGA 1ZPBA 2NU1E 2CF9H 2BLQA 1THRH 1SQTA 1TLDA 1DWBH 2H9EH 3BF6H 4UD9H 3URDA 2WUCA 4NIVA 3NUMA 4CR9A 4HI3A 3TGIE 2WHXA 3ATMA 3HK6B 1AWHB 4BTIB 1IHSH 1O2RA 1C4U2 2XRCA 1C1RA 4A1VA 4TWWA 1TGCA 1O2QA 1GL0E 5DG6A 1WQSA 1GHAG 1EASA 2EC9H 2P94A 2F9VA 2GMTC 1LMWB 1GPZA 3SO3A 2ZDKA 3MOCA 4YTAA 2Y6TA 1G3CA 3HK3B 2Q6GA 1SPJA 4E7NA 3S9BA 4JYTA 5LPFA 5LH8A 4GHTA 3A83A 4Q63A 1TGTA 4U2WA 1UCYH 1PPBH 1XUFA 2DE9A 2QIQA 5FBEA 3AASA 4TSFD 3S0NA 2CF8H 1HPGA 1UW7A 3SUDA 1NBMD 1C5MD 1ZR0A 1GMHF 1SGFA 1D3DB 2ZPSA 1HB0B 4ASHA 5I46H 5K7RA 4FUDA 1VGCC 3ZZBA 1O3IA 3ODDA 1SG8B 4OGXA 2XCFA 1LHFH 4U32A 2ANWA 1PPGE 3SU0A 3KCGH 2ZGXH 2JJ1D 2Y5HA 3S7KB 4BTUB 3IWMA 3VEQB 1VCQA 3QX5H 2FOGA 1SGYE 1D6WA 4GSOA 2PWXA 4NIWA 3VB5A 1JWTA 4FUIA 2QF0A 4NG9H 1GJ5H 3TLOA 1WUNH 5FXLA 1RIWB 1GI9B 2PUXB 3CS7A 4BXWA 1ZGIA 3OFND 5EQQA 2WYJA 4B1TA 3PV4A 4ISHH 1QB9A 1TMBH 2P8OB 3PTNA 1ELTA 3BEUA 2CHAC 1TABE 2OLGA 1EUFA 2TGTA 3SZEA 1CT4E 4D76A 1F0TA 1EP6A 1CA0B 2GV7A 3A86A 1SFQB 4NA7A 2ANKH 1O2ZA 1LVOA 1NRPH 3A7XA 1KYNA 2NU3E 2K0QA 1GVKB 1YLCA 1XUGA 5JDUB 1CBWC 5FCKA 1MBQA 1O3HA 4X1SU 1LQEA 3LGVA 1P02A 1SQAA 2J97A 3S69A 2D1JA 1UCYE 2GZ7A 3SJ8A 5JBTA 3UNQA 3DCLA 3P17H 3PLKA 4FU8A 1Y3YA 1V2UT 4TPIZ 2BTCE 3RU4D 5FL7D 4PROA 4ZXXH 1DS2E 5GCHG 3A89A 1QIXB 1ZYOA 1EJMA 2QN5T 5DGJA 1IQHA 2UWOA 1QR3E 1GBAA 4F55A 2GV6A 2H9TH 1GBMA 1INCA 3A7TA 1Z7KA 1NFUA 4CBOA 4Y6DA 1SLXB 5EXNA 4DT4A 3TK5A 2ZFRH 1XKBC 1FY8E 3N7DA 3BIVH 4YOGA 1MQ6A 2VBCA 2VGCB 4VGCB 1DDJA 3MNSA 1F5RA 2P59A 1GBKA 1HAOH 1AI8H 1C5PA 1WU1A 1SOTA 1QA7A 1GHWH 2V0BA 2AGGX 1A5HA 3U8RH 5DO4H 1HAHH 3ZZ4A 2QF3A 2VB0A 5GWZA 4NWLA 2ZCKP 3SU6A 8GCHG 1T32A 2R0KA 3ENSB 1KLIH 3M3VA 1AZ8A 4UONA 3MU1A 5ESBA 1K28D 2ZHFH 4B2BA 1C2GA 2PKAA 1N8OC 4ABAA 3NWUA 5C94A 1FAKH 1BQYA 1MZAA 1EB2A 2D26C 2HLCA 1MCVA 4IN2A 2CN0H 3D49H 1RXPA 3RXMA 4RI0A 1C9PA 1GI0A 2VH6A 4Y0ZE 2BD3A 4RT0A 4D9RA 1GMCF 2BB4A 4UE7H 1WV7H 3RXDA 2V3MA 1GGDC 2K8IA 4P00A 4CHAC 2QAAA 1UO6A 4JMYA 1NRRH 2BDAA 1A7SA 4D9QA 2BDYA 1LKBA 1SKYE 2F9UA 3D65E 4D7FA 1BA8B 3F6UH 4H6SB 1GI7B 1LVYA 4B71A 1YP9A 2BY8X 1AHTH 3QZRA 2YMSB 3SV7A 1F7ZA 4ISIH 3SUGA 4MNYA 1CGIE 4OS6A 1GBEA 5HKKD 3TH4H 2Y5FA 1B7XB 1E35B 1FNIA 3RXJA 3RXPA 3T62A 1TONA 2FXRA 3EE0B 2G4UA 4AFQA 5C17A 1AB9C 1AUTC 2JJ2D 4ZHLU 1NPMA 1GCDA 5EOKA 1SGQE 1UVOA 1QRXA 3QTVH 3UWJH 1O3OA 4XBCA 1O3CA 2VVUA 1ZMNA 1XVOA 3PB1E 3EA9A 2QV1A 3H5CB 2ZDNA 1KY9A 2UUKB 4CRGA 3UOPA 3ZVEA 5E0JA 1TGSZ 1BTPA 1O3PB 2V7QD 1ZJDA 1P2OA 1P12E 1V2KT 5JYIA 2WPLS 3ZV9A 3SNDA 1BZXE 3PO1C 1C2FA 5F8XA 2H9HA 1TGNA 2M2AA 1Q2WA 2QXJA 1F2SE 4Q80A 2ZECA 2GD4B 5T6FA 2Z3DA 2F43B 3MNBA 4GCHF 1W13U 2WYGA 1O5CB 1E34B 3M3TA 4IGDA 4AB9A 5AVDA 3E3TA 1CGJE 2XBYA 4FUHA 1YBWA 2RG3A 3F2HA 1DWEH 3MH4A 1AUJA 3LONA 5C2ZA 1LCYA 1O36A 2ESTE 1TALA 1V2LT 1GJ7B 3FKSD 2I6SA 2GVFA 4E7RG 1OWJA 4GLYA 3UB0A 1YPLH 3GCNA 3Q76A 2HOBA 3TJUA 1NY22 1SMFE 3M7UA 3QLPH 1LHCH 7GCHF 2EA3A 3E0PB 2PGQB 4DGJA 2NWNA 4UFFH 1EATA 3OTJE 1DSUA 1H9HE 3M7QA 1C1SA 5CMXH 1O5EH 1DPOA 2RA3A 1GBJA 5CHAB 5E0HA 4I33A 1CGHA 1VJ9U 3GOVB 1P2QA 3PMHB 3RU4T 3ZVCA 1ACBE 2EI7A 5A09A 1H8IH 4OS4A 1BMMH 1G36A 4Z1MD 3SGAE 3N7OA 3DFJA 3Q3YA 1H8DH 2BY6X 4K8YA 3SU5A 8ESTE 1C2DA 1GHBG 2PGBB 1TBQH 1HAVB 2SGEE 2FIRH 1MABB 3SHAH 1B5GH 2QXHA 1E0FD 3S9CA 2JETC 4UDWH 1ETTH 1L4DA 4WWYA 1OWKA 3A84A 3F9HA 3BG4C 3ZYEA 2AMPA 4BTTB 5FX6A 1O3GA 4AOQA 5SGAE 3VXEH 1BIOA 5PTPA 5DPAA 3KQBA 3M37A 3EA7A 1ELVA 5JB8S 2GT8A 4ESTE 2XBVA 3A80A 3C1KA 1HGTH 1K1PA 1KIGH 4H42U 2J94A 4MNWA 1MTWA 1GJCB 1YLNA 5T1VA 1E1RD 1IQJA 3K6YA 1FV9A 4HZHA 4AYVB 3T25A 3TNTA 1O3AA 4KTUA 2FX4A 1AWFH 1UHBA 2C8WB 4B6FA 2WUBA 1W7GH 4CRFA 2BDGA 4DURA 2ZCHP 3A87A 1O0DH 1C4V2 2PV9B 2VVCA 3Q3KA 2TGPZ 3RM0H 4ZKRU 1EZQA 2F83A 5GPIB 2IJD1 5DP9A 4B75A 1HUTH 1GMDG 3VGCC 2ZDVH 4YT7H 2GCHG 1NFWA 1QBNA 4LOYH 2FLBH 1P04A 1Z6EA 2A4GA 1OP2A 2BDIA 4AB8A 4E06H 2P95A 1WSSH 1QL7A 2QE7D 1P8VC 3RP2A 1XX9A 1BTUA 3SJ9A 1AKSB 1O30A 3FFGA 1W8BH 3P95A 2BXTH 1COWD 2KFWA 2F9OA 4X1QU 1GBLA 2BQ6B 1GG6C 3SNCA 1JMOH 3EAJA 1KTSB 1MKXK 3SUFA 1ESTA 3MFJA 3NPSA 4IMQA 2W3IA 3LIWA 3GY5A 2UWLA 1KDQB 3KF2A 1XM1A 3BTGE 3BTFE 3WWBA 1ID5H 4DIIH 1RD3B 4A7IB 1SGCA 4JZDH 3WW7A 1GJ8B 1O2UA 1S81A 3A7YA 1GWAA 1NS3A 5C1UA 2XXLA 1Z8GA 3N7EA 4FXGH 1JIMA 1ZHRA 2ZHQH 4XBDA 1S6FA 2BQ7B 1J8AA 1CQQA 5HM9A 1O3JA 2STAE 4UEHH 1DSTA 4UFGH 2FM2A 4WMFA 2OP9A 3NRLA 3SU3A 2PKSC 2V35A 5L2ZH 1PQ8A 2ZKSA 1DE7H 2BVXH 3I78A 1BDAA 4IBLH 1BHXB 2PTNA 5J4SA 1ZTKA 1L1NA 4YLUA 1O2GH 1P57B 2OC1A 1W0JD 1HAGE 3SJOA 4B76A 1A46H 1MZDA 1VCWA 2XNIA 1O32A 2FS9A 2OBOA 3ZZ6A 5L6NH 3AW0A 3ZIAD 4B2AA 5A8XA 1O2LA 1TQ0B 3SGQE 4Q4LA 1O2KA 3UAIC 2ZTXA 3A8DA 2F9NA 1WOFA 1C5LH 1MTNC 1A3BH 1CVWH 3HKJB 4FU7A 4FUFA 5C5NA 2KCYA 2QCYA 3RXIA 4Y8XA 1EX3A 3GY3A 3MMGA 1GBHA 3GCTF 1UK2A 4YESB 1WXRA 5H4IB 3VPKA 3TVJB 3KQ5A 1E79D 1YY3A 1W7XH 1A2CH 5BRRE 1O2NA 3U8TH 1A3EH 5ETXA 1H9LB 1AQ7A 1MKXH 1G32B 2ZGBH 1MU6B 2SGAA 1LDTT 2ZGHA 2ZTYA 1P2MA 3OSYA 3SU4A 1IQMA 1VGCB 3OEHD 4FVDA 1QL9A 1PYTD 2O8MA 1OOKB 3SNBA 2AFQB 1KLJH 1NN6A 3ZVDA 2FZZA 2ODYB 4K60A 3RXLA 4BAQB 1T8MA 1HCGA 1S0QA 2BY7X 4NZLA 2JDID 2VIPA 4D7GA 4I8GA 4ZXYH 1GI2A 2VIWA 4AORA 2IN2A 5B6OA 1O3FA 1W0YH 2F3CE 1BOQA 2WPMS 1V2OT 2R3UA 2BLVA 5F8TA 4JZEH 1BTXA 3GY2A 1LTOA 2O8WA 3KYFA 3A7VA 3TJOA 1PPCE 2TIOA 1BUIA 1THPB 4K1TA 3LGUA 4HGCA 1CT2E 1OSSA 4BAHB 4D8NA 2ANYA 3E91A 1HAZB 1K0HA 1HXFH 1EZUC 2AH4X 3QDZB 1ARCA 5DP5A 2AGIX 2CHAB 1YPGH 2KM0A 3M36A 3C27B 3SJKA 3FZZA 2OC8A 3P8NA 2HVXA 2Y7XA 1EOJA 1LO6A 1EP5A 1TMTH 5J4QA 2J92A 3RDZA 1M9UA 1HAIH 1FXYA 4AX9H 2WPIS 1JXPA 1LPKB 1OKXA 3OEED 2ZGJA 1CBWB 1ZJKA 2V3OH 3SUEA 4JYVH 2XTTB 3BTEE 2AS9A 1ETRH 3D62A 2Z94A 1QNJA 2A4OA 2L74A 3L33A 1DXWA 1HJAB 1BCUH 1ZPZA 3PWBA 2ZU5A 4JCNA 4O9VA 2EQNA 1P9UA 2QYIA 3H7OA 3RXCA 1GBIA 4RKJB 4BANB 5HYOA 5HGGA 2J98A 1EAXA 4H6TA 3CP7A 4WY3A 3T27A 4IN1A 3EQ0H 4KP0A 1GI4A 4DY7B 3LC3A 1NM6A 1HAXB 3GY8A 4DOQA 1DY9A 1K1OA 1LVBA 1JOUB 1OYQA 3SN8A 3KN2A 1NRSH 1DITH 3F0PA 2WSSD 1GJ4H 3TGJE 1TGBA 2BD5A 1TBZH 3BIUH 4GPGA 4H4FA 3UWIA 1ANBA 1T8OA 2V3HH 4JYUH 2A0QB 4FUBA 3NK8A 1J16A 2VH0A 4ACBA 3F1SB 1FAXA 1T8NA 1TNJA 1PFXC 2W6JD 1BRCE 3RLWH 4ABGA 2ZF0H 5EODA 5JBBS 4X1NU 3PTBA 1MD8A 4HG6A 3E90B 2GGVB 4O03A 5KGOA 3FN8A 3RXFA 1N8OB 3MU4A 1GHYH 5B6LA 1TNIA 2IJOB 6GCHF 2AGEX 2ZNKH 4XDEA 1RRKA 3UNSA 2XWBI 4I8HA 1CT0E 2FODA 1GGDB 4CHAB 3KGPA 3URCA 2OINA 2Q6DA 1HLTH 4IC5A 1CSOE 2P93A 1V2TT 6ESTA 1FZZA 3OTPA 1IQGA 1YC0A 3QGJA 1Z1JA 2PKAB 1C5OH 1HNEE 3PLPA 1W14U 3ZZDA 5E0GA 5TJXA 2IPHA 1S0RA 4X2WA 1XUIA 4INHA 3RC5A 2LP6A 2XWAA 1TBRH 4U01A 1SSXA 3DSGA 1AB9B 3M5MA 4FETA 4I8JA 1GI6A 1KTTB 3MO9A 1P11E 3QGNB 3V3MA 1Z8IB 1RJXB 2G51A 4XBBA 1SBWA 2ZFQH 1F0SA 1DXPA 2HRVA 5FCRA 1V2MT 5EPYA 4AC9A 5EIYA 2QF5A 1UK3A 1S85A 3A88A 3MNCA 3RXAA 1C1PA 2J34A 3KQCA 1ETSH 1KXEA 3PO1B 1QB1A 1NU7B 4MPVA 1QQUA 1C9TA 4F48B 5C3NA 2ZTZA 2Z3EA 1UK4A 2FI3E 1QL8A 5C5OA 4ABDA 3O8BA 3VB7A 3KQDA 1O3NA 1Y3WA 1P03A 3QWCH 3ODFA 1YCPK 4TPYA 2SNVA 3MU5A 4HFPB 3TJVA 4Y7BA 3O8CA 3EGKH 5T6DA 1O31A 2ZI2H 1GHAF 2QY0B 5T6GA 3VB6A 1EFRD 5HIYA 2QXGA 3RXOA 1HJ9A 2J5UA 5EJLA 3RXVA 5IK2D 2ZZUH 3M5OA 4M9FA 4CRAA 1FMGA 7GCHG 2TGDA 1O2SA 3TPIZ 2OUAA 3GY6A 1JBUH 3SGBE 2XW9A 1FN6A 3BEIB 1SGNE 2BD8A 1BMLA 1UTPA 1SLVB 1C1VH 1ZSKA 1A0HB 1SGTA 3KIDU 2QF4A 3W1EA 5CE1A 1KLTA 4INLA 5LPEA 2P3UB 3SI3H 3KNXA 1AVGH 2RA0A 1HBTH 1F5KU 1SI5H 2CGAA 2RDEA 3BN9A 1O2IA 1XXDA 4GVUA 3SNAA 3SV8A 1VCPA 1D3PB 3OX7U 1VJAU 2R9PA 2ZO3H 2BD7A 3ZYDA 1EJAA 3ZVBA 1T8LA 4DCDA 1P3CA 3V12A 4CRBA 2ZPQA 4R8TB 3ZZ7A 1OXGA 3NKKA 1GHVH 3M35A 4MG3A 1K1LA 2JETB 4XSKU 2PSYA 1H8HD 1QJ7B 1P10A 1C5YB 3MU8A 4MPUA 1QHRB 2J4IA 6CHAC 3ZVGA 1MD7A 1RIWC 4CH2B 2BD4A 2ODPA 1MKWK 2HGTH 1D3TB 3BG4B 5FPTA 4I8KA 1O2TA 1UTJA 1YPHC 2VIQA 1T31A 4AGJA 2XC4A 1YPMH 1ORFA 1TB6H 2KR7A 3FP7E 1O2JA 2FO9A 5L30H 4Y8ZA 3ZV8A 1C1MA 2C93B 2Z9LA 2KAIA 1AFQB 1CA0C 4A6LA 1AO5A 2FDAA 4BOHA 3TITA 2WV5A 5LGOA 1AVWA 1OWEA 1YCPH 4WXIA 5HM2A 3K2UA 5E2OA 2C3SA 1L0ZA 2YMSD 5EQRA 1K1NA 1TNKA 2JH0D 3HATH 1L1JA 2BOHB 5HIZA 2SGQE 1BRBE 4O3TA 1ELEE 1RGQA 2NU0E 3U1IB 4B2CA 2OCVB 1G3DA 5GIBA 1SVPA 1D9IA 4NIYA 1SOZA 1H8ED 3ATKA 2C8YB 1K22H 5E8EH 1MMJN 1SQOA 1YM0A 2WINI 1DLKB 4AZ2B 4CH8B 5F03A 3U9AH 4UFEH 1FY1A 1A1RA 1T4UH 1QZ8A 4Q7ZA 3VGCB 1P3EA 3BTTE 1LHGH 1GDQA 1ZZZA 1DUAA 2GZ8A 2R3YA 3SORA 2A4QA 1W3CA 2V6NA 2WV4A 4FUEA 5C20A 2C4FH 1UHBB 4K5ZA 4GAWA 5GCHF 3FO8D 1NRQH 1ANEA 1VITG 2O8TA 2OK5A 1JRTA 1GHZA 3SYJA 3VG8A 2AEIH 4LK4A 4E05H 2FOEA 2CMYA 4OS7A 3BTWE 1QFKH 1E36B 1GG6B 4K1SA 1SGFG 4RKOB 1EPTB 2ZEBA 2FOFA 1TPOA 3Q77A 2BDCA 3CNRA 1DVAH 1E1QD 4I8LA 2HNTE 1C1TA 4JK6A 1MKWH 1ARBA 2ZFSA 2BQWB 2BZ6H 1S6LA 1O2OA 2JH6D 2W6ID 5DKMA 4AG1A 1H4WA 2BD2A 2VWOA 4X6PA 1PPZA 3R0FA 1FLEE 1O3BA 3P8FA 3ITIA 2G55A 2BY9X 3BTQE 8GCHF 2ODQA 1EKBB 1A4WH 1GDUA 1LKAA 1QRWA 1YGCH 2PKSB 3AAVA 1O2MA 1C5VA 1TQ7B 1V2NT 1MTUA 1BT7A 4ZHAA 2R2WU 1G9IE 1TIOA 5GNDA 2EI6A 1HRTH 1P2JA 3LKWA 2GDEH 1UVTH 2PFEA 1G2LA 1DFPA 1ELCA 3GDSA 4X0WU 3RC6A 1Q3XA 1N6XA 3UNRA 3RMOH 3I29A 1AU8A 2CK3D 3GCTG 1MTNB 3ZVAA 2P16A 4B74A 5JB9S 1TRYA 4XD7D 4FVBA 1WAYB 1G30B 2IPQX 5C0TA 2HNTF 2GCTC 2ZFPH 1ZTLA 1XXFA 4NFEA 2OQ5A 1EJNA 9ESTA 4IMZA 1QY6A 3MHWU 5FAHA 1G2MA 1IHTH 1ELFA 4O3UA 3U1JB 1ZTJA 1PQAA 3SNEA 1TX6A 4RT1A 5DP3A 1GBBA 3B8JA 4KKDA 3RXGA 2SGPE 3MH5A 2AHME 5A0BA 2AERH 2FP7B 5A2MH 2AIQA 3DD2H 2FI4E 1TOMH 2GX4A 2WZQA 4GHQA 2Z9KA 2KCOA 1YLDA 2ALVA 1UTKA 2A5IA 4P02A 3T29A 2F9BH 3ELAH 3PM3A 3A8BA 4TYDA 3U28C 1OPHB 2ZP0H 3MO3A 2WPHS 2P3TB 1FIWA 1V2ST 3TK9A 3AW1A 1SQRA 1FUJA 2WV9A 1E37B 1GBDA 3M5NA 2IOTA 2PW8H 1TPAE 2PSXA 2XC5A 1E38B 2A2QH 4K2YA 4X1RU 3RM2H 1JRSA 2FESH 3QK1A 2M5TA 2Z6BD 3AAUA 4KGAA 2KZ4A 1SHYA 2ALPA 2Y5GA 1GJBB 3AK5A 4X2YA 1BJUA 2O9QA 1NBME 1PQ5A 2AMDA 2TGAA 4Y76A 3MU0A 2FPZA 3GS9A 5FHTA 1S83A 3V13A 5IDKA 1YYY1 2FX6A 1D4PB 1FY5A 4JZIA 3SI4H 2ZWLH 1OWDA 3DSOA 1OWHA 4MDSA 1F0RA 3A7WA 2LPRA 4Y79A 1P0SH 1HIAA 1O5AB 1A0JA 2TPIZ 2ZCLP 5I25A 1SGRE 1DT2A 2F91A 4DT7B 1ZHPA 5JPMH 1DWDH 1NO9H 3IG6B 1GHBF 2VNTA 1C1OA 3F9GA 2K1QA 1ZHMA 2FOAA 1V2VT 5A8YA 3TNSA 2GMTB 1SGEE 2XOKD 1CHOF 4WJG2 5EPNA 1FONA 2YNAA 1C5ZB 3UY9A 1WBGB 4DVAU 3W94A 3MTYA 1HYLA 1OP8A 1J17T 4ISLA 1KXDA 1H9IE 1PPHE 1C5TA 3GISB 5FX5A 2BLOA 4QT8C 2H6MA 3TH3H 1XUHA 2OQUA 1UTMA 1GMHG 3PWCA 2A4RA 3GDUA 1W11U 1DICA 1EOLA 2B0FA 2ZU2A 2FOMB 3ZZ5A 2YOLA 1A5IA 1QA0A 3P8GA 4F4OC 1EZSC 3STIA 1V2WT 3QUMP 5A0CA 2D8WA 1YPHE 2ZIQH 1C2JA 2HPQH 1GDNA 1MUEB 2VJ1A 5EJZA 4I7YH 2J98B 2GP9B 4X2XA 4X8SH 1DOJA 1V2JT 1IQLA 3PRDA 1EQ9A 1F5LA 1GI5A 4R0IA 1IQEA 4IC6A 1P06A 2H5CA 3ATLA 6LPRA 4NZQA 2P3FH 1NZQH 2BX4A 2OTVA 3I77A 2RCEA 2Y80A 3RU4E 1EAIA 6GCHG 4WXVA 2W7UA 1Z6JH 4GUXA 2PLXA 2TRMA 3PV5A 3EYDA 1O34A 1GMDF 2GTBA 2PP6A 2FTLE 4ZUHA 3MH7A 2GCHF 3GY4A 1Z8JB 3P8OA 1G3BA 1L4ZA 4A5TS 3WY8A 2PTCE 1DX5M 8KME2 2DUCA 5EXLA 1RTFB 4AN7A 3FP8E 1DWCH 1NU9A 3SU1A 3ZZ9A 1BJVA 3MQKC 3STJA 2VU8E 1C2LA 1K9OE 3A85A 1SLWB 3IITA 1TRNA 2Y82A 4MPWA 4ACAA 1TNLA 5EW2H 1AZZA 3LJOA 1XMNB 4SGBE 5FBIA 1HJ8A 4O97A 2PUQH 2GZ9A 3BSQA 1ZRBA 2ZDMA 3L3TA 3SOSA 4X8TH 4CREA 1Y8TA 1IAUA 3F0OA 2BVSH 2G5NA 1EZXC 3RXBA 3TK6A 3BTDE 2BX3A 3OYPA 3RXSA 2BZAA 3UR9A 2EY4C 1CHGA 3AVZA 1GJDB 1NC6A 1CO7E 2I6QA 3F68H 1P9SA 5EU8A 2EEKA 2Q1JA 4NCYA 3OY6U 2UUFB 2BD9A 2FTMA 1K21H 3T5FH 4THNH 1C5WB 4XRNA 1C5NH 1AFEH 3SBKA 1QBOA 4WMDA 1UTQA 3ESTA 2HNTC 3UIRA 2Q6FA 1T4VH 3GICB 1A61H 1ZMJA 3UPEA 4ABBA 1O3MA 4A1XA 1OP0A 2C90B 3Q00A 2RFKC 1ZSJA 1HAYB 2VWLA 4IS5A 3SQHE 4TY7A 1GHXH 2HALA 3O8DA 5GDSH 2BY5X 4DW2U 3LU9B 1GCTC 2SGFE 1SL3A 4KELA 1DUEA 1WQVH 1KXAA 4ZMAH 3RUOA 1QBVH 5TCAA 1KXBA 1W10U 5G4BA 2J95A 4Y0YE 3NXPA 1PPFE 3K9XB 4DG4A 1PYTC 5AFYH 4Y7AA 4NSVA 1MQ5A 2VWMA 1W2KH 3S9AA 2R0LA 3V7TA 1THSH 2ZDAH 1QQ4A 5JBAS 4YM9A 1K1MA 5KECA 3P6ZB 2BHGA 4NWKA 4ISOA 1L2EA 1GL1A 4Y11E 3GY7A 1KMHB 1K2I1 1WDIA 1P01A 3P92A 3UQVA 4NGAH 2A5AA 3SV9A 2VINA 1O2YA 3SV2H 3UTUH 5DP6A 1ANDA 1RTLA 1TPSA 1GMCG 1UVPA 1XUJA 3LDXH 4AYYB 2WPKS 3UREA 3LC5A 1EAWA 3T26A 2UUJB 1P2IA 3U98H 2ILNA 2FEQH 4JK5A 1H1BA 1OYTH 2VVVA 4XOJA 4OS5A 1BRAA 1ESAA 4X1PU 5ESTE 4YOIA 2RDLA 2L6OA 6CHAB 7ESTE 1S84A 3PMJA 4WMEA 2BMGB 2ZHDA 4OS2A 3RC4A 2Z9IA 3LJJA 4FU9A 1SR5C 1KXFA 1YPEH 3ATWA 3LGIA 3KHVA 4ISNA 2FMJA 1VZQH 3GCHC 7KMEH 2H2ZA 1GVLA 1PQ7A 3OY5U 3SHCH 1C1NA 1RS0A 3UFAA 2XC0A 4WVPE 1DY8A 3E6PH 1OWIA 4F49A 5DP8A 2FOCA 1C2KA 1SGIB 2HPPH 4FUGA 3GYLB 1TOCB 4BAMB 2SGDE 1A5GH 1LPGB 3F2FA 4ABEA 2ZFTA 1Y5BT 4GCHG 3BTKE 3QTOH 4OS1A 4NA9H 1Z71A 3PRBA 1YCPM 2STBE 4MNXA 2ZG0H 2Z7FE 3OE7D 3W95A 1HJAC 3EA8A 2B5TB 1O5DH 1LHDH 1O37A 1TYNA 2KAIB 1NRNH 1LQDB 1O5GH 1U6QA 1ELDE 3RLYH 3QO6A 4AFUA 3E16B 3MO6A 3FP6E 2FS8A 3H7TA 3ZZCA 1O38A 3CENA 1BMNH 3PROA 1ZRKA 1A0LA 2BDBA 1ZSLA 2EI8A 3ZZ3A 1WYKA 1O39A 4ASUD 1QJ6B 2AIPA 1V2QT 1ELAA 4CR5A 2VWNA 3HGPA 3PYHA 1C5SA 2W26A 2F9PA 2XNDD 1O33A 2G81E 3MWIU 3GYMA 1IQFA 2ZHWH 4A1TA 3TGKE 2J38A 3GDVA 4BNRA 2ZQ1A 3G01A 2JIZD 2LELA 3VB4A 5AHGH 4MNVA 5TCCA 3B9FH 1KSNA 4LZ4B 1O3EA 2CJIA 1D6RA 4CRCA 2JH5D 3M3SA 1ABJH 1CU1A 2ZC9H 2ZGCA 4Y71A 4OM9A 2ULLA 5IYTA 3A8AA 3JZ1B 1C1UH 1V3XA 4JZFH 1O3KA 2BVRH 1AMHA 1IQKA 1IQNA 1P05A 3RMMH 1QCPA 1N1LA 2B7DH 3KQEA 1GI1A 2QA9E 2KCAA 1NT1A 3PV2A 3LOXA 1QB6A 5EQSA 2A7CA 3A82A 1BTHH 1N6YA 2LNCA 1G37A 1TNHA 2P8OC 1AN1E 4ZROA 4I86A 4IW4E 1AVXA 1DLEA 3TIUA 4MPXA 3UOUA 1F0UA 3EDXB 5EW1H 1GBTA 2AYWA 4ZHMU 1GI8B 2UUYA 3UR6A 1G3EA 2GKVE 2ANMH 1YWUA 1YKTA 1VKYA 2O8UA 2ZQ2A 1VR1H 1X7AC 2A45B 3F9FA 1QTFA 2GCTB 3LGTA 5DN6D 3RXKA 1HAPH 1ABIH 2VIOA 3EE7A 1TWXB 4YLQH 1S5SA 2XCNA 3MH6A 4K8BA 3U69H 1ESBA 3F9EA 3N99A 1FN8A 2FYRA 3RXTA 2NU4E 1C5QA 1O5BB 3ATIA 1Z8RA 3DFLA 1F92A
chains in the Genus database with same CATH topology
3SV6A 1O2XA 3VB3A 4ZAEA 4YO9A 3K6ZA 3BV9B 1TE0A 1EAUA 4ABHA 4X6MA 4ABJA 1Q31A 2W3KA 3PMBB 1O2HA 1VITH 4KTSA 4Q7XA 1MAYA 5T3HA 2YNBA 9LPRA 1UTOA 2OD3B 4YOJA 4AG2A 2B9LA 2QXIA 1TA6A 3DT0H 5EGMA 1O3DA 3Q3XA 4BAKB 1UVSH 3D23A 4ABIA 1MCTA 1IOEA 1FPHH 2A5KA 3GCOA 1SC8U 4RN6A 4Q7YA 2UWPA 3FANA 3VFEA 1DANH 3DA9B 2FLRH 1UTNA 3PLBA 2OXSA 5FPYA 3V0XA 2VGCC 4VGCC 2O8LA 1BBRK 1Z1IA 1YF4A 1HFDA 1O2WA 4ZKNU 4AFSA 7LPRA 1SB1H 1HXEH 3OU0A 4M7GA 3KL6A 3RMNH 1UVUH 1YPKH 1MU8B 1O2VA 2FYQA 2G00A 2BLWA 2AMQA 1BITA 2ZU3A 3CS0A 3M7TA 4TY6A 1C5UA 3UUZA 2CXVA 4MQAA 4B73A 2XYAA 1Y3XA 2THFB 1UJ1A 1P2KA 4X6NA 1TRMA 4I32A 2G4TA 1LHEH 2A31A 2A1DB 1AE8H 2Z9GA 4JZ1A 1SLUB 1O3LA 4X2VA 2A7JA 2W5EA 4ZH8A 5BPEA 5ABWA 3LGYA 5GXPA 4DIHH 4ABFA 1SHHB 2Y81A 5K0HA 2BDHA 2TBSA 1ZPCA 1CHOG 3HGNA 3RXQA 4LXBH 4NSYA 2OBQA 8LPRA 3LT3A 1WTGH 3VXFH 3FZDA 3MYWA 5DJ7A 2NU2E 3E8LA 1TA2A 1DM4B 1PPEE 4FUJA 1O2PA 1V6DA 2G8TA 3A7ZA 1BHXF 1C2EA 3BTME 3FAOA 3TH2H 1NROH 2J9NA 4Z0KA 3SJIA 3QZQA 1TFXA 1TX8A 4NIXA 4Y8YA 1V2PT 1HIAB 1GI3A 3MNXA 2ZHEH 2SFAA 2FOBA 3P70B 1AFQC 4MVNA 1TMUH 3BEFB 4I31A 1AD8H 1BTZA 1J14A 5GJ4B 3HPTB 1LPZB 3TJNA 2Z3CA 3S7HB 1BBRH 2VIDA 2ZPRA 4YT6H 3K65B 1RFNA 4LZ1H 2B8OH 3RMLH 1GBFA 1Y5UT 3NCLA 5A0AE 5FPSA 1EB1H 4X8UH 1ANCA 1IQIA 1FIZA 2ZFFH 1FQ3A 4SGAE 4AGKA 2ZDLA 1RTKA 3ZVFA 1EPTA 1KXCA 2WPJS 5LPRA 4BAOB 2GT7A 1EXFA 4WF8A 2A32A 2BM2A 2GDDA 1FJSA 2XBXA 1C1QA 1GVZA 4FUCA 1C5XB 1BRUP 2DE8A 1NESE 3T28A 1NFXA 1O5FH 1FPCH 4RSPA 1PJPA 2FOHA 3RXRA 1CA8B 3SU2A 1HAVA 3M61U 5EXMA 3SW2B 3UQOA 1VITF 3M5LA 4K69A 2XBWA 4WH6A 4X6OA 4NFFA 5A8ZA 1EPTC 1C5RA 2BOKA 2ZU4A 3ZZ8A 2A2XH 3TU7H 4BXSA 5CHAC 1D3QB 1S6HA 2ASUB 2C8XB 1W12U 3SQEE 1CE5A 5DP4A 1SGDE 5C1YA 1XUKA 1TAWA 4UFDH 1MTVA 2C8ZB 3BTHE 4Z6AH 2JKHA 1JIRA 2BYAX 2PHBA 2Y7ZA 5AFZH 3MI4A 1MTSA 1Y59T 1B0FA 3LGWA 3ZZAA 1AGJA 4HTCH 3L6PA 1FDPA 3KEEA 2QC2A 3A81A 2J2UA 4MLFB 2HWLB 1MAXA 5JBCS 1GJAB 1BBRE 2W7SA 3E0NB 1HDTH 1OS8A 1XVMA 1T7CA 3E1XB 3NZIA 1C2HA 3DUXH 1BMAA 1J9CH 1SGPE 2PR3A 2H5DA 2CV3A 5DP7A 1K1IA 1OX1A 5HXFA 1LVMA 1TX7A 3PMAB 1S82A 1C4Y2 1WCZA 3O8RA 4CRDA 1ELBA 4KTCA 3LPRA 1FY4A 4XE4A 5F8ZA 1GCTB 4J1YA 1GBCA 2A7HA 5F6MA 1O35A 1TPPA 1NTPA 4INKA 1MH0A 3B23B 3U8OH 4TWYA 1P09A 1AKSA 4X8VH 4MTBA 4A92A 1ZMLA 1BTYA 3R3GB 1UMAH 1BB0B 5AF9H 5L2YH 1K1JA 4XFQA 4YZUA 2H1UA 5HMAA 1UTLM 3RXHA 2SNWA 1C2MA 2G5VA 1SFIA 1J15A 1Y3UA 1QRZA 4DJZB 1KDQA 4CBNA 1HV7A 1MBMA 4Y10E 1QURH 3FVFB 1YPJH 4AFZA 3T2NA 4K1EA 4U30A 4OGYA 1GJ6A 4NA8A 2QGRA 1V2RT 1AE5A 2G52A 1UCYK 1Y3VA 1Y5AT 3BG8A 3LH3A 2ZA5A 3JZ2B 1ZOMA 3A8CA 2ZU1A 3RXEA 2Z9JA 1NFYA 1AY6H 1B0EA 2OC0A 2R2MB 1W0ZU 1GJ9B 4Q2KA 5E2PA 4ZKOU 2FI5E 2OC7A 3QN7A 5C1XA 1P2NA 4WH8A 1WTHD 1ZGVA 1C2IA 1ZLRA 3GCHB 3SZNA 5C67A 1ELGA 2FWWA 1QJ1B 1FI8A 3DHKH 4ZKSU 1QGFA 2BXUH 3LH1A 1C1WH 1FY3A 2VIVA 3HKIB 5EG4A 1L1GA 2D2DA 1AIXH 4J2YB 5DK1A 1BTWA 1XKAC 4K3JA 3RXUA 2NU1E 1TNGA 1ZPBA 2CF9H 2BLQA 1THRH 1SQTA 1TLDA 1DWBH 2H9EH 3BF6H 4UD9H 3URDA 2WUCA 4NIVA 3NUMA 4CR9A 4HI3A 3TGIE 3ATMA 3HK6B 1AWHB 4BTIB 1IHSH 1O2RA 1C4U2 2XRCA 1C1RA 4A1VA 4TWWA 1TGCA 1O2QA 1GL0E 5DG6A 1WQSA 1GHAG 1EASA 2P94A 2EC9H 2F9VA 2GMTC 1LMWB 1GPZA 3SO3A 2ZDKA 3MOCA 4YTAA 2Y6TA 1G3CA 3HK3B 2Q6GA 1SPJA 4E7NA 3S9BA 4JYTA 5LPFA 5LH8A 4GHTA 3A83A 1TGTA 4U2WA 1UCYH 1PPBH 1XUFA 2DE9A 2QIQA 5FBEA 3AASA 3S0NA 2CF8H 1HPGA 3SUDA 1C5MD 1ZR0A 1GMHF 1SGFA 1D3DB 2ZPSA 1HB0B 4ASHA 5I46H 5K7RA 4FUDA 1VGCC 3ZZBA 1O3IA 3ODDA 1SG8B 4OGXA 2XCFA 1LHFH 4U32A 2ANWA 1PPGE 3SU0A 3KCGH 2ZGXH 2Y5HA 3S7KB 4BTUB 3IWMA 3VEQB 1VCQA 3QX5H 2FOGA 1SGYE 1D6WA 4GSOA 2PWXA 4NIWA 3VB5A 1JWTA 4FUIA 2QF0A 4NG9H 1GJ5H 3TLOA 1WUNH 5FXLA 1RIWB 1GI9B 2PUXB 3CS7A 4BXWA 1ZGIA 5EQQA 2WYJA 4B1TA 3PV4A 4ISHH 1QB9A 1TMBH 2P8OB 3PTNA 1ELTA 3BEUA 2CHAC 1TABE 2OLGA 1EUFA 2TGTA 1CT4E 4D76A 1F0TA 1EP6A 1CA0B 2GV7A 3A86A 1SFQB 4NA7A 2ANKH 1O2ZA 1LVOA 1NRPH 3A7XA 1KYNA 2NU3E 1GVKB 1YLCA 1XUGA 5JDUB 1CBWC 5FCKA 1MBQA 1O3HA 4X1SU 1LQEA 3LGVA 1P02A 1SQAA 3S69A 2D1JA 1UCYE 2GZ7A 3SJ8A 5JBTA 3UNQA 3P17H 3PLKA 4FU8A 1Y3YA 1V2UT 4TPIZ 2BTCE 3RU4D 4PROA 4ZXXH 1DS2E 5GCHG 3A89A 1QIXB 1ZYOA 1EJMA 2QN5T 5DGJA 1IQHA 2UWOA 1QR3E 1GBAA 2GV6A 2H9TH 1GBMA 1INCA 3A7TA 1Z7KA 1NFUA 4CBOA 4Y6DA 1SLXB 5EXNA 3TK5A 2ZFRH 1XKBC 1FY8E 3BIVH 4YOGA 1MQ6A 2VGCB 4VGCB 1DDJA 3MNSA 1F5RA 2P59A 1GBKA 1HAOH 1AI8H 1C5PA 1WU1A 1SOTA 1QA7A 1GHWH 2V0BA 2AGGX 1A5HA 3U8RH 5DO4H 1HAHH 3ZZ4A 2QF3A 2VB0A 5GWZA 4NWLA 2ZCKP 3SU6A 8GCHG 1T32A 2R0KA 3ENSB 1KLIH 3M3VA 1AZ8A 4UONA 3MU1A 5ESBA 1K28D 2ZHFH 4B2BA 1C2GA 2PKAA 1N8OC 4ABAA 3NWUA 1FAKH 1BQYA 1MZAA 1EB2A 2D26C 2HLCA 1MCVA 4IN2A 2CN0H 3D49H 1RXPA 3RXMA 1C9PA 1GI0A 2VH6A 4Y0ZE 2BD3A 4D9RA 1GMCF 2BB4A 4UE7H 1WV7H 3RXDA 1GGDC 4CHAC 2QAAA 1UO6A 4JMYA 1NRRH 2BDAA 1A7SA 4D9QA 2BDYA 1LKBA 2F9UA 3D65E 4D7FA 1BA8B 3F6UH 4H6SB 1GI7B 1LVYA 4B71A 1YP9A 2BY8X 1AHTH 3QZRA 3SV7A 1F7ZA 4ISIH 3SUGA 4MNYA 1CGIE 4OS6A 1GBEA 3TH4H 2Y5FA 1B7XB 1E35B 1FNIA 3RXJA 3RXPA 3T62A 1TONA 2FXRA 3EE0B 2G4UA 4AFQA 1AB9C 1AUTC 4ZHLU 1NPMA 1GCDA 5EOKA 1SGQE 1UVOA 1QRXA 3QTVH 3UWJH 1O3OA 4XBCA 1O3CA 2VVUA 1ZMNA 1XVOA 3PB1E 3EA9A 2QV1A 3H5CB 2ZDNA 1KY9A 2UUKB 4CRGA 3UOPA 3ZVEA 5E0JA 1TGSZ 1BTPA 1O3PB 1ZJDA 1P2OA 1P12E 1V2KT 5JYIA 2WPLS 3ZV9A 3SNDA 1BZXE 3PO1C 1C2FA 5F8XA 2H9HA 1TGNA 1Q2WA 2QXJA 1F2SE 4Q80A 2ZECA 2GD4B 5T6FA 2Z3DA 3MNBA 4GCHF 1W13U 2WYGA 1O5CB 1E34B 3M3TA 4IGDA 4AB9A 5AVDA 3E3TA 1CGJE 2XBYA 4FUHA 1YBWA 2RG3A 1DWEH 3MH4A 1AUJA 3LONA 5C2ZA 1LCYA 1O36A 2ESTE 1TALA 1V2LT 1GJ7B 2I6SA 2GVFA 4E7RG 1OWJA 4GLYA 1YPLH 3GCNA 3Q76A 2HOBA 3TJUA 1NY22 1SMFE 3M7UA 3QLPH 1LHCH 7GCHF 2EA3A 3E0PB 2PGQB 4DGJA 2NWNA 4UFFH 1EATA 3OTJE 1DSUA 1H9HE 3M7QA 1C1SA 5CMXH 1O5EH 1DPOA 2RA3A 1GBJA 5CHAB 5E0HA 4I33A 1CGHA 1VJ9U 3GOVB 1P2QA 3PMHB 3RU4T 3ZVCA 1ACBE 2EI7A 5A09A 1H8IH 4OS4A 1BMMH 1G36A 3SGAE 3N7OA 3DFJA 3Q3YA 1H8DH 2BY6X 4K8YA 3SU5A 8ESTE 1C2DA 1GHBG 2PGBB 1TBQH 1HAVB 2SGEE 2FIRH 3SHAH 1B5GH 2QXHA 1E0FD 3S9CA 2JETC 4UDWH 1ETTH 1L4DA 4WWYA 1OWKA 3A84A 3F9HA 3BG4C 3ZYEA 2AMPA 4BTTB 5FX6A 1O3GA 4AOQA 5SGAE 3VXEH 1BIOA 5PTPA 5DPAA 3KQBA 3M37A 3EA7A 1ELVA 5JB8S 2GT8A 4ESTE 2XBVA 3A80A 3C1KA 1HGTH 1K1PA 1KIGH 4H42U 2J94A 4MNWA 1MTWA 1GJCB 1IQJA 3K6YA 1FV9A 4HZHA 4AYVB 3T25A 3TNTA 1O3AA 4KTUA 2FX4A 1AWFH 1UHBA 2C8WB 2WUBA 1W7GH 4CRFA 2BDGA 4DURA 2ZCHP 3A87A 1O0DH 1C4V2 2PV9B 2VVCA 3Q3KA 2TGPZ 3RM0H 4ZKRU 1EZQA 2F83A 5GPIB 5DP9A 4B75A 1HUTH 1GMDG 3VGCC 2ZDVH 4YT7H 2GCHG 1NFWA 1QBNA 4LOYH 2FLBH 1P04A 1Z6EA 2A4GA 1OP2A 2BDIA 4AB8A 4E06H 2P95A 1WSSH 1QL7A 1P8VC 3RP2A 1XX9A 1BTUA 3SJ9A 1AKSB 1O30A 3FFGA 1W8BH 3P95A 2BXTH 2F9OA 4X1QU 1GBLA 2BQ6B 1GG6C 3SNCA 1JMOH 3EAJA 1KTSB 1MKXK 3SUFA 1ESTA 3MFJA 3NPSA 4IMQA 2W3IA 3LIWA 3GY5A 2UWLA 1KDQB 3KF2A 1XM1A 3BTGE 3BTFE 1ID5H 4DIIH 1RD3B 4A7IB 1SGCA 4JZDH 1GJ8B 1O2UA 1S81A 3A7YA 1GWAA 1NS3A 5C1UA 2XXLA 1Z8GA 4FXGH 1JIMA 1ZHRA 2ZHQH 4XBDA 1S6FA 2BQ7B 1J8AA 1CQQA 5HM9A 1O3JA 2STAE 4UEHH 1DSTA 4UFGH 2FM2A 4WMFA 2OP9A 3SU3A 2PKSC 2V35A 5L2ZH 1PQ8A 2ZKSA 1DE7H 2BVXH 3I78A 1BDAA 4IBLH 1BHXB 2PTNA 5J4SA 1ZTKA 1L1NA 4YLUA 1O2GH 1P57B 2OC1A 3SJOA 1HAGE 4B76A 1A46H 1MZDA 1VCWA 2XNIA 1O32A 2FS9A 2OBOA 3ZZ6A 5L6NH 3AW0A 4B2AA 5A8XA 1O2LA 1TQ0B 3SGQE 1O2KA 2ZTXA 3A8DA 2F9NA 1WOFA 1C5LH 1MTNC 1A3BH 1CVWH 3HKJB 4FU7A 4FUFA 5C5NA 2QCYA 3RXIA 4Y8XA 1EX3A 3GY3A 3MMGA 1GBHA 3GCTF 1UK2A 4YESB 5H4IB 3VPKA 3TVJB 1W7XH 1A2CH 5BRRE 1O2NA 3U8TH 1A3EH 5ETXA 1H9LB 1AQ7A 1MKXH 1G32B 2ZGBH 1MU6B 2SGAA 1LDTT 2ZGHA 2ZTYA 1P2MA 3OSYA 3SU4A 1IQMA 1VGCB 4FVDA 1QL9A 1PYTD 2O8MA 1OOKB 3SNBA 2AFQB 1KLJH 1NN6A 3ZVDA 2FZZA 2ODYB 4K60A 3RXLA 4BAQB 1T8MA 1HCGA 1S0QA 2BY7X 4NZLA 2VIPA 4D7GA 4I8GA 4ZXYH 1GI2A 2VIWA 4AORA 2IN2A 5B6OA 1O3FA 1W0YH 2F3CE 1BOQA 2WPMS 1V2OT 2R3UA 2BLVA 5F8TA 4JZEH 1BTXA 3GY2A 1LTOA 2O8WA 3TJOA 3A7VA 1PPCE 2TIOA 1BUIA 1THPB 4K1TA 3LGUA 4HGCA 1CT2E 1OSSA 4BAHB 4D8NA 2ANYA 3E91A 1HAZB 1HXFH 1EZUC 2AH4X 3QDZB 1ARCA 5DP5A 2AGIX 2CHAB 1YPGH