1SGNE

Asn 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
185
structure length
185
Chain Sequence
ISGGDAIYSSTGRCSLGFNVRSGSTYYFLTAGHCTDGATTWWANSARTTVLGTTSGSSFPNNDYGIVRYTNTTIPKDGTVGGQDITSAANATVGMAVTRRGSTTGTHSGSVTALNATVNYGGGDVVYGMIRTNVCAEPGDSGGPLYSGTRAIGLTSGGSGNCSSGGTTFFQPVTEALSAYGVSVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptogrisin B
publication title Recruitment of a Buried K+ Ion to Stabilize the Negative Charge of Ionized P1 in the Hydrophobic Pocket: Crystal Structures of Glu18, Gln18, Asp18 and Asn18 Variants of Turkey Ovomucoid Inhibitor Third Domain Complexed with Streptomyces griseus Protease B at Various pHs
rcsb
source organism Meleagris gallopavo
molecule tags Hydrolase/hydrolase inhibitor
total genus 48
structure length 185
sequence length 185
ec nomenclature ec 3.4.21.81: Streptogrisin B.
pdb deposition date 1999-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sgnE02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sgnE01
1IQMA 1TA6A 3TH3H 1WTGH 1FIZA 1A5HA 4CH2B 5IYTA 1ETSH 5FPYA 1FQ3A 4Q80A 1KY9A 3UUZA 5JPMH 2GT7A 1LHCH 2AEIH 3A89A 2P93A 2ZC9H 1YCPM 1QB1A 6CHAC 1W7XH 1UTOA 2FP7B 1GI2A 2B8OH 4B71A 3PB1E 4FU9A 1PQ8A 1SB1H 3KIDU 1P2MA 4AFZA 1LVMA 3HGPA 4NZLA 3E0PB 1XKAC 3BIVH 3MNXA 4ISIH 4D7GA 1O2HA 2QC2A 1AO5A 2AFQB 1BJUA 2PUXB 3SJ9A 5JB8S 1O2TA 3LC3A 2ZDMA 1AY6H 5FHTA 2P95A 1VITG 3ATKA 1A61H 4D9RA 2B7DH 2QCYA 2UUKB 4AOQA 1HAVA 1P12E 5FXLA 2ZECA 2ZPRA 3KN2A 5GDSH 4J1YA 4WY3A 2ZQ2A 1CGIE 4OGYA 4JMYA 1C1VH 2WPJS 5GWZA 3UNRA 4ZMAH 1O3GA 3STIA 3BTGE 1DS2E 1CHOG 4NA9H 4NG9H 4K1SA 1H1BA 1C1QA 1AFQB 3GCOA 3ATWA 3MO6A 1O3CA 1VITF 3E16B 4DT7B 4BXWA 1RTKA 4CBOA 1P03A 3SI4H 4ZXYH 3RXOA 2WPMS 4IMZA 1UTKA 1QIXB 2W5EA 1ZOMA 3ZVFA 2BMGB 1C1RA 3SV9A 1DX5M 3TU7H 2XBXA 1ANEA 3LC5A 1CHOF 2QIQA 1JRSA 9ESTA 1C5UA 1A5GH 2VH6A 4F4OC 1C5ZB 2F9VA 1DY9A 1CSOE 2Z7FE 1IOEA 3LH1A 1DWDH 5JBAS 1O2XA 1QTFA 1Z8JB 3GDUA 4FUFA 1BOQA 1HAVB 1AUTC 3PLKA 2QF0A 5CHAC 2ANYA 1RXPA 2GT8A 1LMWB 2Z3EA 4ZUHA 1RTFB 5E2PA 2FOEA 1GHXH 1C5TA 3FZZA 2W3KA 1Z6EA 4RSPA 4H42U 4WJG2 2BQ6B 2BVXH 1MTNB 2C4FH 1NT1A 1L1GA 4O03A 1KXDA 2FS8A 1YLCA 6GCHG 1T8OA 1AZZA 5B6OA 2ZQ1A 2CN0H 4BNRA 2A4RA 4CRFA 2VINA 2ZCKP 1TBQH 3MO3A 1K22H 2HNTE 1O2MA 1J8AA 1YPJH 3ZZ4A 1AB9C 1QBOA 2QV1A 1AQ7A 3L3TA 5EW1H 2RG3A 1BUIA 1YPHC 2UWOA 1K1PA 1B5GH 4A5TS 1MKXK 1FDPA 1T32A 1CHGA 1QJ1B 2H6MA 1S84A 1ABIH 2P59A 1K1MA 4X8UH 2D1JA 5DP4A 2PTNA 1P3EA 3M35A 4BTUB 1FNIA 1TGCA 3MNBA 1DVAH 6GCHF 1EAXA 1ETTH 3QDZB 4DIIH 3Q00A 4K3JA 4YLQH 1PYTD 2FOHA 1K28D 2JH0D 2XCNA 4LXBH 3VB4A 1F0TA 3RMOH 4SGBE 2A2XH 3FP7E 2A4OA 1ANDA 1OYQA 1YPEH 1QR3E 2J4IA 3GCHB 2GZ7A 4D7FA 1V2ST 2FPZA 1KSNA 3S7HB 2R3UA 5DP5A 3NK8A 5ESBA 5L2YH 3QN7A 3BF6H 1DICA 2FS9A 2OP9A 1MCTA 3EDXB 2A45B 1G32B 3TPIZ 1QL9A 1C5NH 2AERH 2O9QA 1TNIA 2F9BH 1TOCB 3ESTA 8LPRA 1AIXH 1FY4A 2ANKH 4DY7B 1TABE 3EQ0H 1CBWC 1T4VH 1KTSB 1YC0A 4H6SB 5FBIA 2DUCA 3B9FH 4KTSA 4ZXXH 2Q6GA 3H7OA 3FP6E 3SU5A 2VWMA 2ZP0H 2STAE 3PV4A 2WV5A 5ESTE 2QN5T 2ZU2A 1EAIA 1QQ4A 2OLGA 2WYGA 2VVCA 2A31A 2XC5A 1LCYA 3U69H 2YNAA 1Z1JA 4BOHA 4GPGA 4MTBA 3SUEA 1KDQA 2HPPH 4HFPB 2KAIA 4IN1A 3ZZ7A 4I33A 2G00A 2OBOA 4YESB 3GCNA 4U2WA 3GICB 1Y3XA 4HTCH 4NWKA 1HAXB 1A2CH 2F9UA 1EJMA 1DXPA 1GVKB 4A1VA 3UQOA 5EXNA 5TCAA 4UFFH 4GHTA 1MTWA 3SU4A 1HJ8A 5GCHG 1BHXF 4ESTE 1C1SA 1LVBA 1K2I1 4NA8A 2Z9JA 2ZHEH 2C3SA 3RXMA 1UJ1A 1A5IA 2BDYA 2G51A 1ELBA 4A6LA 2JETC 2JH5D 2CV3A 4U30A 3LPRA 3BTDE 2NU1E 1FY5A 1T7CA 1QNJA 4WH8A 1AGJA 2AMQA 2CGAA 3MH5A 4AB9A 1XUKA 2ZGJA 1HXFH 1UTNA 2ZPQA 4AB8A 2ZHWH 1W0ZU 1TBRH 1NO9H 1ELEE 1KDQB 1T8MA 1G30B 5GCHF 2KAIB 3LGYA 1ORFA 3MH6A 1SGRE 2V6NA 5A0BA 1G2LA 4X6NA 1BBRK 3MNCA 4UDWH 4K2YA 2QXHA 3TNSA 3O8CA 5AHGH 1BBRE 2PKSC 4ZROA 2ZFTA 2BD7A 2WUBA 3A85A 1UVSH 1N6YA 1V2QT 4OGXA 2PGQB 3SZNA 2QXJA 2P8OC 2Z9LA 3R0FA 1CA8B 3S69A 5JYIA 1NFWA 4Y0ZE 1SPJA 2ZIQH 2ALPA 3V0XA 5A0AE 2CHAC 2BDGA 3MH4A 2OCVB 1O2JA 2XBWA 3GISB 4CHAB 5E0GA 1XXFA 5E2OA 1LQDB 4H4FA 5TJXA 4I8KA 1GMHG 4R0IA 1BT7A 4TPYA 1OP8A 4B73A 1GHWH 1CA0B 2Y5FA 3VFEA 1O3AA 2EI6A 1ZPCA 1GL1A 1BJVA 1UTPA 2OBQA 1GMCG 3W95A 4X1QU 4NIXA 1C4V2 4K5ZA 1U6QA 3VXEH 5LPRA 3UIRA 4BAOB 1GMDG 2ZDKA 4OS2A 3U8RH 2BDIA 1K1LA 1YCPH 1A3EH 3U1IB 1Y5BT 1C5LH 1T8NA 1PPFE 1GMHF 2K1QA 1WTHD 1EJNA 3SNCA 5DK1A 2OC7A 2H9HA 3GOVB 4X2WA 4ZHAA 1UTMA 1FY8E 2P3TB 1LPZB 2P94A 1GMCF 1O2SA 4I7YH 2VWOA 5DP6A 2AMDA 1WOFA 3HGNA 3I77A 4Y6DA 1BTYA 5DP3A 1GMDF 8ESTE 1S83A 4HGCA 4KKDA 1UTJA 1W3CA 3A7TA 1SGPE 2BD9A 2W7UA 2BY6X 2PSXA 1J16A 3RMLH 1NM6A 4WMEA 1F2SE 2FTLE 4ABBA 2B0FA 1AD8H 3I29A 1WYKA 2BY7X 1W14U 2G5NA 1SL3A 2ZU3A 1DSUA 2HNTF 1K21H 4MVNA 5HYOA 3T2NA 4E06H 1YPLH 2SGEE 3L33A 4CBNA 3V12A 2FI5E 1Y5AT 2Z3CA 1QL8A 3QZQA 3VPKA 1V2VT 2ZZUH 2GZ9A 1AI8H 4UFGH 3E6PH 3ZVAA 1BRBE 2C8XB 1IQJA 1SQAA 2C90B 1GCDA 5CE1A 1MAXA 1O3FA 1ACBE 5FPTA 1OPHB 4Y79A 2WPLS 2R0LA 1ZTJA 5HMAA 2M5TA 3WY8A 1S5SA 4JYVH 1SBWA 4X6PA 2BLVA 3K6ZA 1WQVH 2SNWA 1SGFA 3A8AA 4K69A 5EGMA 3A80A 2DE9A 2FDAA 4FUHA 2GVFA 3P8NA 2V0BA 5EXLA 1ELCA 2XWAA 1YF4A 1EUFA 1O3MA 5DPAA 3SJ8A 3RXSA 1DFPA 2H5DA 2FOMB 1T8LA 2OQ5A 1EZSC 2TGAA 1BMAA 3QUMP 4NA7A 4Q7ZA 1F92A 1GPZA 2Y81A 1TQ0B 3AW0A 2QGRA 2BX3A 2F9PA 3KF2A 4TY6A 1GBTA 2W26A 4X1PU 2WPIS 4XBDA 2PHBA 4BTIB 5EG4A 2A0QB 6LPRA 1VJ9U 5DKMA 3EE0B 3TGIE 2J2UA 2GCTB 1TB6H 1GJ8B 1AWFH 1H8IH 2ZF0H 5T6FA 3BG4C 4XBCA 4ISOA 1ELGA 4MPXA 1P2IA 1NFYA 1GGDB 1N8OB 4ISLA 1KXFA 2ZI2H 1OWIA 2BQWB 3KQBA 3MU4A 1PPBH 2F9NA 3SV2H 1ZR0A 3ZZ5A 2G4TA 3S9AA 1NN6A 1P02A 3AAUA 3TVJB 1OWKA 3RXPA 3LJJA 2AGGX 5I25A 3E1XB 3DT0H 4Y0YE 5EPNA 1LVYA 4CREA 1GBJA 1GI5A 1ZTKA 2XC0A 1DUEA 5FX6A 2UWPA 1O5AB 2GMTC 2A5KA 2G4UA 1AWHB 1MTUA 5F6MA 1DWEH 1JWTA 3LU9B 7GCHG 5IDKA 1F5KU 1YKTA 3T27A 3EAJA 5ETXA 3C27B 1SC8U 1DDJA 1Y59T 1T4UH 2Y82A 1K1NA 2BLQA 3MFJA 3P92A 3O8RA 1WQSA 1UCYK 1HXEH 1V2NT 5BRRE 1O30A 2PV9B 1ANCA 1UCYE 2HLCA 4ABGA 1VCQA 1UVTH 2Q6DA 1TPPA 1BMMH 3F1SB 3U8TH 1O36A 1CT2E 2ZG0H 1YPKH 1H9LB 1K1JA 3TK6A 7GCHF 1DXWA 4CRCA 2OQUA 1JMOH 2NU4E 3SGAE 3UFAA 1C1WH 3SI3H 5FX5A 2HVXA 2BOKA 3H7TA 1S0RA 1N1LA 1BTZA 2D26C 1FY1A 3BTWE 5GPIB 4ABJA 3M5NA 3P95A 1ESAA 1TAWA 2XNIA 1XXDA 1ESTA 4Y8ZA 1S0QA 3ZZ8A 1NS3A 1CGHA 1HJ9A 4E7NA 3SQEE 1P2OA 4CRGA 1RJXB 2FODA 1ZRKA 4YO9A 3SGBE 4ABDA 1F0RA 1GI4A 3PYHA 2Z9GA 1IQNA 5L2ZH 1O2QA 2ZCHP 2QAAA 1C2JA 1ANBA 2ZTYA 1OYTH 3A8BA 1YBWA 1XUIA 2A5AA 2GX4A 1D6RA 1O5DH 1D6WA 1RIWB 2SGPE 5F8ZA 2FOAA 2ODPA 1OP0A 4UE7H 1PPEE 1P57B 1UO6A 1SFQB 2BD5A 5HM2A 1FN8A 2B9LA 4WVPE 4ZKSU 1PPZA 4I8HA 1GI1A 1PQAA 2C8ZB 1C2LA 1ELTA 1Q2WA 3A86A 3PROA 3DA9B 1P0SH 2F3CE 3TJOA 5DP7A 7KMEH 3NPSA 2HRVA 4YT7H 1O5FH 1ELVA 1V2RT 1OKXA 4UFDH 3CS0A 1GJBB 2VVVA 1YPMH 1SGCA 3SHAH 1C1TA 3URDA 3VB7A 1TNHA 3MU5A 3BV9B 2BXUH 2FX6A 1SMFE 4O3TA 5H4IB 1TMBH 3TGJE 1EP6A 5HXFA 1Q3XA 1A1RA 2FI3E 4MDSA 4AFQA 4YLUA 3TJUA 1YM0A 3ZZ6A 1BITA 1H4WA 2V3HH 1A0LA 2WPHS 1HAPH 2FO9A 1F0SA 2A4QA 1KLJH 2R3YA 4UONA 1LQEA 2FESH 4XE4A 2FLRH 4DVAU 3M61U 4CH8B 1BTWA 3V13A 2LPRA 1OWDA 1TFXA 2WV4A 3MNSA 3OX7U 4FVDA 2EI7A 4K8YA 3RLWH 9LPRA 1MKWH 1BB0B 3T28A 1LPGB 1ZGIA 2ZNKH 3EA9A 4AORA 4TYDA 4WXIA 4B2BA 4YOJA 2XBYA 1Y8TA 2ZPSA 4BAQB 2BM2A 1W11U 1RGQA 2UWLA 1GBIA 2ZTZA 4OS1A 2P3FH 4A7IB 1V2KT 5ABWA 4Y76A 1EX3A 1O3OA 1PJPA 1P01A 3ODFA 1K1IA 4TWYA 1FUJA 3UR6A 1AMHA 1D3DB 4IBLH 1AUJA 2ZEBA 1EPTA 1G37A 2PKAA 1TX6A 1A3BH 1VCWA 1TNGA 4WH6A 3RXKA 3ZV9A 3BTTE 1HIAA 5G4BA 3PO1B 2AGEX 3VGCB 1O3LA 1VGCB 3QTVH 4Y7AA 2FOFA 1O35A 2GKVE 2QY0B 1VJAU 3P70B 1EXFA 3LDXH 3SV7A 1EOLA 3NZIA 1GJAB 5E8EH 1MQ6A 1EZXC 4FVBA 4IS5A 2VGCC 4H6TA 2ZO3H 2Y7ZA 4LK4A 4I8JA 4JZFH 5T3HA 2FIRH 1SOZA 1O38A 1ZMLA 3U9AH 1C2HA 3LH3A 1H9HE 4ISHH 4ZHMU 3BTEE 2Y7XA 3GY2A 1ZSKA 4ZH8A 1GJ9B 3A82A 4AZ2B 5SGAE 3ZZAA 1BTPA 3DFLA 1C5YB 3ATIA 1GHZA 3RXBA 1E35B 4Q2KA 3TGKE 1P8VC 3E8LA 3FAOA 2AIQA 3ITIA 2VIQA 1EPTB 1ZGVA 2OC8A 2PKAB 1O2WA 1K1OA 2PR3A 4FXGH 2ESTE 2ZDVH 4FU7A 1C5PA 3ZVBA 1XUGA 1HIAB 3P17H 1O3BA 3LKWA 1Q31A 1TA2A 4FUGA 2HNTC 1BTHH 1TONA 6CHAB 1TMTH 3LGWA 4ZHLU 1C2GA 4KP0A 4YOIA 1L4DA 2ZA5A 1O3EA 1ARBA 3MMGA 1D3PB 1EZUC 1O3HA 1MZDA 2QA9E 3UWIA 2BY9X 1AU8A 2NWNA 4FUIA 5LGOA 4AX9H 2R2WU 1TALA 2H2ZA 4K8BA 3EA8A 2OTVA 1S82A 1E36B 1GI9B 8GCHG 2PUQH 5AFYH 2Z9KA 1CGJE 1DT2A 1HYLA 2TRMA 2VVUA 2C8YB 3TLOA 1TGSZ 3PM3A 1O2UA 3SNEA 2BD2A 4JYUH 3SUFA 3BTME 1TE0A 3PMBB 4FUDA 1B7XB 1C2EA 2RCEA 1FN6A 1ZHPA 2NU0E 3B23B 4Y8XA 2Z6BD 1A4WH 1EB2A 1TPAE 4X1RU 4AN7A 3UOPA 5A8YA 4B1TA 3RXDA 3PMAB 1HRTH 5DGJA 1XUHA 4OS4A 3A88A 8GCHF 1V6DA 4BAKB 3P8GA 5L6NH 1FAKH 4I32A 5T6DA 3ZVDA 3SNAA 4K1EA 1C4U2 2A4GA 1QRXA 7ESTE 1GBAA 3VB6A 4A1XA 1AKSA 3PMHB 3MWIU 4GHQA 4JK6A 2PGBB 2A7CA 3S9BA 5EPYA 2FYQA 1SSXA 1HJAC 1RRKA 5DP8A 4INLA 3AW1A 1ZSJA 2F91A 1C5RA 3A8CA 3BG8A 2VWNA 1GBEA 1HFDA 2BD3A 3FVFB 1Z8IB 5F03A 5CHAB 4GAWA 1EATA 5JBCS 4Z6AH 1Z1IA 4VGCC 2ILNA 1ZSLA 1TRMA 3RU4T 2OC0A 1O2LA 1TOMH 2V3OH 5EXMA 1TGBA 2ASUB 1IQGA 4O97A 2VIPA 1SQTA 1ARCA 2QXGA 3BTKE 1JRTA 3DFJA 2VIOA 5C1UA 3ZVGA 1GI6A 2BOHB 3RMNH 1VZQH 1FIWA 1EP5A 1G9IE 1C1PA 3RXJA 1SI5H 3O8DA 3RXCA 1PPHE 1UVUH 4YTAA 1GHAG 2FLBH 3GYMA 3RXEA 1AB9B 1C4Y2 1G3DA 3DUXH 3STJA 5HM9A 3P8FA 2I6QA 4BAMB 3RXHA 1GCTC 3Q77A 1CT4E 1AKSB 1GBDA 1TWXB 4MPUA 2J92A 3MU1A 5C5NA 4MLFB 2ANWA 1BRUP 1YCPK 3BIUH 1NRSH 4ABEA 6ESTA 2BD8A 2IPHA 2PFEA 4X0WU 1BRAA 2XCFA 1C1UH 4JZEH 3A7WA 5JB9S 3F9HA 1G3CA 1GHAF 1WBGB 1QBVH 1QRZA 2HOBA 1EASA 1JBUH 1V2JT 3Q3KA 1S6HA 3AVZA 5EQSA 2XW9A 1SOTA 5EQRA 2FEQH 4NWLA 3ZVEA 1OP2A 3EGKH 4CR5A 1VITH 1TNKA 3SNBA 1HPGA 5K0HA 3HK3B 2BTCE 1Y3VA 2GTBA 3A8DA 3LGIA 3TK5A 3QLPH 5A2MH 1EB1H 2V35A 4Q7YA 3P6ZB 2SGAA 3F6UH 4XDEA 3ZZ3A 2TIOA 1DLKB 5A0CA 1AVWA 3GY5A 3HKJB 1CBWB 1FLEE 4CRAA 4NIYA 4TWWA 5F8XA 3S9CA 1D4PB 4YM9A 3AAVA 4Y8YA 5JBTA 1O3NA 1PYTC 4ABFA 1QB6A 1F7ZA 4JZ1A 5FPSA 2O8LA 1BCUH 3GYLB 2W7SA 3IG6B 3HK6B 4D8NA 3PWBA 3TITA 4DIHH 1KXBA 4X1NU 4Y71A 2ZFSA 5JDUB 1QFKH 2BDCA 1NY22 1NESE 1P3CA 5GJ4B 1GHYH 2TGPZ 1IQHA 4Z0KA 3KQCA 1O3IA 1O5BB 3EA7A 3TJVA 3GDSA 2H1UA 1AFQC 1RFNA 4R8TB 1O3PB 2OC1A 1J9CH 1O2RA 2OINA 4A1TA 5DP9A 3M3VA 3K65B 1SGFG 1W8BH 2DE8A 2AH4X 1SGDE 1DPOA 1SGNE 1XVOA 1VR1H 3P8OA 1THPB 2J38A 3RXAA 3M3SA 3KGPA 2XXLA 4GVUA 2A32A 1EJAA 3OY5U 1Y3YA 3CP7A 3QGJA 1NRQH 2LNCA 2P16A 1FONA 1YGCH 1KXEA 4DGJA 2JETB 3R3GB 4XSKU 1TPOA 4KTCA 2FXRA 4PROA 3H5CB 4WWYA 2BX4A 1V2OT 1KTTB 3SO3A 4IC5A 1DWBH 1O3KA 1S85A 4RKOB 2NU3E 1LHFH 1MQ5A 3U8OH 4QT8C 8KME2 1NZQH 1HGTH 3A81A 4JZDH 3UQVA 5TCCA 3Q3XA 1MTNC 1GBBA 2A5IA 1INCA 1ABJH 3QTOH 4FUBA 3Q3YA 2PKSB 1O33A 2VJ1A 1ELDE 2ULLA 1QB9A 4HZHA 1S6FA 1GL0E 1E38B 1O31A 1PFXC 2P8OB 2WYJA 4SGAE 1A0HB 1ELAA 3SV6A 1EAUA 3BSQA 3F9GA 1GI3A 3DD2H 5C20A 1FAXA 1OX1A 5LPFA 2CHAB 2R9PA 3G01A 1HAYB 3KL6A 3KQEA 4X2XA 3RXLA 3T25A 4AFSA 1O3DA 3AASA 1MBMA 2BDHA 2SFAA 2BVSH 2ZHFH 1WUNH 1O2ZA 1XMNB 1V2UT 3VGCC 1O0DH 2TPIZ 3K6YA 1LHGH 3RDZA 1UVOA 1FI8A 3OYPA 3SU1A 4LZ1H 1X7AC 5EODA 1HV7A 2FX4A 1TQ7B 1THRH 2O8MA 3CENA 2ODYB 1SLVB 2FOCA 1HAZB 1JIMA 1GVLA 3GCHC 1O2IA 1IHSH 3E3TA 1GG6B 3GY3A 4O9VA 1P06A 1GBCA 4IGDA 1MU6B 4X8TH 3SJKA 2BB4A 1DE7H 3UPEA 1TX8A 1Z8RA 2SNVA 1F5LA 4U01A 1W13U 4GUXA 1HCGA 2XTTB 5DO4H 1L1JA 4NCYA 3UWJH 1TIOA 1P2JA 4IC6A 1AHTH 1O34A 3NKKA 3W94A 1KXCA 4AG1A 1W2KH 4FU8A 3V7TA 3ZZBA 1DITH 3TK9A 1LKAA 2W3IA 1NC6A 3SGQE 3ZVCA 1O39A 3PTBA 3RXTA 1XVMA 3TJNA 3MH7A 3UOUA 1KIGH 4AFUA 4Y10E 4X6OA 4NFEA 1C2DA 3GCTG 3RP2A 2P3UB 3M3TA 3A87A 2XBVA 1C1OA 1C2KA 1DSTA 3PTNA 5LH8A 4GSOA 1SGQE 2ZKSA 4D9QA 4MPWA 2HWLB 4K60A 4MQAA 4D76A 1QY6A 1XX9A 1JIRA 4X1SU 2GV6A 4ZAEA 5J4QA 2Y6TA 3VEQB 4B2CA 4GCHG 1ZRBA 1TGTA 3A7YA 1OWEA 2RA0A 2YNBA 2CF9H 4JYTA 2TBSA 1QJ6B 1ID5H 2G55A 5C67A 2GD4B 1HAIH 3DHKH 5J4SA 4JZIA 1YPHE 1MTVA 4XFQA 3FFGA 1MUEB 3GCTF 4B2AA 2A7JA 2JKHA 3D65E 2ZGBH 3M5LA 1EOJA 4AGJA 1SFIA 1W10U 3O8BA 2XRCA 1EAWA 2VNTA 4YZUA 1D3TB 3BN9A 3IITA 1O2PA 5L30H 1NROH 3VB5A 4NIVA 1IAUA 1ZPBA 1SG8B 4GCHF 3UNQA 2IJOB 1LO6A 2HGTH 3K9XB 4AYVB 3OSYA 4KELA 4CR9A 1CU1A 4OS5A 2AMPA 2OXSA 3UR9A 4B76A 1GHVH 1UK4A 2O8UA 2XC4A 4WMDA 3VXFH 4NZQA 2FWWA 1YLDA 2WINI 3SJIA 1L2EA 2ZDAH 1C5WB 1PQ5A 3K2UA 1MZAA 1E0FD 1ZPZA 2BZ6H 2TGTA 3UNSA 1L4ZA 1QURH 3MI4A 1IHTH 3GY8A 2Z3DA 4K1TA 1G3EA 4OS7A 4AGKA 2ZHQH 2XYAA 3D49H 5EOKA 2EEKA 2Y80A 1LTOA 2BDAA 1S81A 2EC9H 4CRBA 5PTPA 2F9OA 1MKWK 1TRNA 1UK3A 3BG4B 3SU2A 2ZTXA 1KYNA 1MMJN 2ANMH 1GBHA 3PLPA 4TPIZ 4CHAC 1A0JA 1QRWA 2O8TA 4DOQA 1BZXE 1UTQA 2VIDA 4YT6H 5F8TA 1HAOH 1OWJA 1PPGE 2ZU1A 1GWAA 4KTUA 4X2VA 2BXTH 1ZYOA 1C2IA 4F49A 1TLDA 3T26A 2ZDNA 1CA0C 1FZZA 3M5MA 3SORA 4BTTB 2F83A 1PPCE 1MKXH 1Y3UA 1C5VA 1AZ8A 3LGVA 3VB3A 3HPTB 4DJZB 3U98H 2GMTB 2OUAA 1SHYA 1O2KA 5EQQA 3MYWA 3FZDA 5I46H 1O2YA 1P04A 2VIVA 4B74A 1NPMA 1UTLM 1K9OE 2I6SA 2G81E 3A83A 3LIWA 5C1XA 4JCNA 1T31A 1FJSA 1WCZA 3SUDA 1BMNH 2ZU5A 2BLOA 1UHBA 1AVGH 5GXPA 1FY3A 4O3UA 4ZKNU 4A92A 1LKBA 1TRYA 4M7GA 2FMJA 2GDEH 4E7RG 1IQFA 1V2MT 1C2MA 2STBE 3QGNB 1ZLRA 3F9EA 1WU1A 4ZKOU 5FCKA 1E37B 1MBQA 2HALA 4OS6A 3ZYEA 3E90B 1QHRB 3A7XA 3SUGA 2GV7A 4RKJB 2Q6FA 2NU2E 2O8WA 3CS7A 1W7GH 3A84A 1HBTH 1RD3B 3RXIA 2AS9A 3OTJE 3QZRA 4BXSA 1O2VA 1BTUA 2G52A 4IN2A 1Z8GA 1FV9A 1MAYA 1NFUA 3M7TA 4I31A 2ZGCA 3UTUH 3M7QA 1YYY1 1OWHA 3NWUA 4DW2U 3RC4A 1GVZA 1BTXA 3KQDA 3M36A 1NU9A 2Y5GA 1IQEA 1Z7KA 3S0NA 3SU6A 5E0JA 3OU0A 1V3XA 3I78A 1UHBB 4XBBA 2FOBA 1GJ7B 3FANA 2PTCE 1A46H 2ZGHA 3BTQE 3ENSB 3L6PA 3U1JB 2J95A 2J9NA 1SQOA 1GHBG 1DANH 4AG2A 1D9IA 1ETRH 5HGGA 3M37A 1SR5C 3ZYDA 3URCA 2IN2A 4TY7A 5E0HA 1SGIB 1MTSA 4INKA 3ZZCA 1BRCE 4Y11E 1C1MA 3RXUA 2PSYA 1OOKB 3HATH 2FOGA 1LPKB 2HPQH 2BQ7B 1IQLA 1V2LT 1P09A 3C1KA 1GHBF 5AF9H 3RXGA 4X8SH 2FM2A 2R2MB 1THSH 1W0YH 1Y5UT 4MPVA 1BHXB 3JZ1B 2CXVA 4DG4A 1F5RA 1ZMJA 3FP8E 1SHHB 2H9TH 1SLXB 4MNWA 1DOJA 2ZFRH 4LZ4B 2BYAX 2UUFB 2ODQA 2GCTC 3Q76A 3LJOA 3ODDA 2YOLA 5AFZH 3ZV8A 1BIOA 5EU8A 1P10A 1BBRH 3NXPA 1G2MA 1HUTH 1ZHRA 1GGDC 1N8OC 3SHCH 2BY5X 1P9SA 3KHVA 2BHGA 2OD3B 3RMMH 4AYYB 2J94A 1ELFA 3E91A 1V2PT 1SGTA 4FUEA 1C1NA 4FUCA 3LGTA 1LVOA 4WMFA 2QF3A 2Q1JA 2RDLA 1Y3WA 4NFFA 1GJCB 2PW8H 3RU4D 5FBEA 3RXVA 1OS8A 2FYRA 1TPSA 2ZCLP 5BPEA 2C93B 4BAHB 4B75A 3NCLA 3SBKA 2IOTA 4UEHH 3PLBA 1JXPA 1HAHH 3F68H 2H5CA 5C3NA 1EQ9A 2WUCA 1GI0A 4Y7BA 3SQHE 5T6GA 1YP9A 1XM1A 1EZQA 2BLWA 3SOSA 1L0ZA 1L1NA 3T62A 4THNH 1M9UA 5CMXH 1P2KA 1O2OA 2VU8E 1QBNA 4MNXA 1MD7A 3MU0A 1GBLA 3PMJA 4XOJA 4ASHA 1O5CB 5FAHA 5EW2H 2G8TA 1LHEH 3GY7A 1NRPH 1O2NA 1HLTH 1P11E 2QYIA 1UK2A 3IWMA 1ZHMA 4ZKRU 1B0EA 1GG6C 1C5XB 4INHA 4DCDA 3LGUA 2H9EH 2VGCB 3MO9A 1J15A 1QA7A 4IMQA 4ABIA 1FPCH 2A7HA 2AYWA 3S7KB 2SGDE 3RXQA 1NRNH 1ZJKA 1XKBC 2BD4A 3UREA 1BMLA 4WXVA 2AGIX 1QQUA 4KGAA 5DG6A 1MU8B 2FI4E 3PWCA 3JZ2B 1O3JA 3A7ZA 1Z71A 1DUAA 2A2QH 5LPEA 2WPKS 3SW2B 1O2GH 3UY9A 4MG3A 3NUMA 2ZFFH 4UD9H 2VWLA 3M5OA 1ZJDA 1LDTT 5A8ZA 2UUJB 1Z6JH 1HB0B 1AE8H 1V2TT 2G5VA 1TNLA 1NTPA 2CJIA 1J14A 4FUJA 2ZFPH 2FZZA 1J17T 2FTMA 1B0FA 3LT3A 4CRDA 1G36A 1DLEA 2VIWA 1HDTH 4BANB 3MU8A 2BZAA 1FXYA 3TH2H 1DY8A 1AE5A 1P2NA 1E34B 3EYDA 1RIWC 1OSSA 3BTHE 2BY8X 7LPRA 1RS0A 1TBZH 2CMYA 1G3BA 2Z94A 1RTLA 1GJ5H 1QA0A 1SGEE 1KLTA 2VB0A 3T5FH 1UVPA 4GLYA 3TNTA 2GDDA 1FPHH 1W12U 1TNJA 4X2YA 4J2YB 5C2ZA 1KXAA 5GIBA 1WSSH 3RM2H 1CE5A 1P9UA 4I8GA 1GJDB 2THFB 4E05H 1GDNA 1SLUB 3ELAH 3TIUA 1TMUH 1GBMA 3MHWU 3RC5A 1H9IE 3N7OA 1IQKA 1ZTLA 1NU7B 1HNEE 1MH0A 1GDQA 3QX5H 1QCPA 1ESBA 1AFEH 1O37A 1BA8B 3BEFB 1GBFA 1AN1E 3ZZ9A 4LOYH 3SU3A 2QXIA 2RA3A 2ZDLA 2XWBI 1C9PA 1FMGA 2ZWLH 1XUFA 4MNVA 4ABAA 1SGYE 2D2DA 2GP9B 3RU4E 3MTYA 4HI3A 2ALVA 3GY6A 2ZHDA 3T29A 4X8VH 1HAGE 2JH6D 1LHDH 2SGQE 1QL7A 1D3QB 1MCVA 2C8WB 4ABHA 3RXFA 1ZMNA 2ZGXH 2PWXA 4NGAH 1HJAB 1OXGA 1DM4B 2GGVB 2ZFQH 3RUOA 4UFEH 1AVXA 1A7SA 1N6XA 4JK5A 1C2FA 3SV8A 1TGNA 1P2QA 2A1DB 4VGCB 3TH4H 5DJ7A 1O5GH 3RXRA 1V2WT 1TYNA 2UUYA 3KEEA 3ZZDA 3BTFE 3ATMA 1DWCH 4MNYA 4I8LA 4ISNA 1GI7B 1C5OH 3BEUA 1PQ7A 2TGDA 3OY6U 3F9FA 3LOXA 2VH0A 1GJ6A 5FCRA 1YPGH 1BQYA 2J34A 4YOGA 1CQQA 2GCHG 1GBKA 1TX7A 2D8WA 3D62A 2ZU4A 2B5TB 2EI8A 3LONA 1SVPA 3PO1C 1H8DH 1VGCC 2BDBA 4NSYA 1O5EH 5JBBS 2BVRH 1QJ7B 3RC6A 1JOUB 4WF8A 3SJOA 5AVDA 5C5OA 1GCTB 3MOCA 3SU0A 3BEIB 1NRRH 1WV7H 5K7RA 4Q7XA 3A7VA 1EKBB 3SNDA 1MD8A 2Z9IA 3GDVA 1VCPA 3E0NB 3HKIB 3QO6A 4DURA 2R0KA 1O32A 1UCYH 4NSVA 2GZ8A 2GCHF 1NFXA 1UMAH 1KLIH 3RM0H 4IW4E 3M7UA 2EA3A 2AIPA 3KNXA 5C1YA 5A09A 3ATLA 1GI8B 4RN6A 5A8XA 1QGFA 1F0UA 1GJ4H 1C5SA 3QWCH 3GY4A 3KCGH 1CVWH 3RLYH 1SLWB 4U32A 3SN8A 1BDAA 3QK1A 1WAYB 3D23A 4X6MA 2Y5HA 1XUJA 1C5MD 3V3MA 1C5QA 1ZZZA 1C9TA 2PLXA 1P05A 1IQIA 1EPTC 1GDUA 4NIWA 2CF8H 2SGFE 1CO7E 3B8JA 1CT0E
chains in the Genus database with same CATH superfamily
1IQMA 1TA6A 3TH3H 1WTGH 1FIZA 1A5HA 4CH2B 5IYTA 1ETSH 5FPYA 1FQ3A 4Q80A 1KY9A 3UUZA 5JPMH 2GT7A 1LHCH 2AEIH 3A89A 2P93A 2ZC9H 1YCPM 1QB1A 6CHAC 1W7XH 1UTOA 2FP7B 1GI2A 2B8OH 4B71A 3PB1E 4FU9A 1PQ8A 1SB1H 3KIDU 1P2MA 4AFZA 1LVMA 3HGPA 4NZLA 3E0PB 1XKAC 3BIVH 3MNXA 4ISIH 4D7GA 1O2HA 2QC2A 1AO5A 2AFQB 1BJUA 2PUXB 3SJ9A 5JB8S 1O2TA 3LC3A 2ZDMA 1AY6H 5FHTA 2P95A 1VITG 3ATKA 1A61H 4D9RA 2GJGA 2B7DH 2QCYA 2UUKB 4AOQA 1HAVA 1P12E 5FXLA 2ZECA 2ZPRA 3KN2A 5GDSH 4J1YA 4WY3A 2ZQ2A 1CGIE 4OGYA 4JMYA 1C1VH 2WPJS 5GWZA 3UNRA 4ZMAH 1O3GA 3STIA 3BTGE 5DN6D 1DS2E 1CHOG 4NA9H 4NG9H 4K1SA 1H1BA 1C1QA 1NBME 1AFQB 3GCOA 3ATWA 3MO6A 1O3CA 1VITF 3E16B 4DT7B 4BXWA 1RTKA 4CBOA 1P03A 3SI4H 4ZXYH 3RXOA 2WPMS 3SYJA 4IMZA 1UTKA 1QIXB 2W5EA 2WHXA 5T1VA 1ZOMA 3ZVFA 2BMGB 1C1RA 3SV9A 1DX5M 3TU7H 2XBXA 1ANEA 3LC5A 1CHOF 2QIQA 3VG8A 1JRSA 9ESTA 1C5UA 1A5GH 2VH6A 4F4OC 1C5ZB 2F9VA 1DY9A 1CSOE 2Z7FE 1IOEA 3LH1A 1DWDH 5JBAS 1O2XA 1QTFA 1Z8JB 3GDUA 4FUFA 1BOQA 1HAVB 1AUTC 3PLKA 2QF0A 5CHAC 2ANYA 1RXPA 2GT8A 1LMWB 2Z3EA 4ZUHA 1RTFB 5E2PA 2FOEA 1GHXH 3F2HA 1C5TA 3FZZA 2W3KA 1Z6EA 4RSPA 4H42U 4WJG2 2BQ6B 2BVXH 1MTNB 2C4FH 1NT1A 1L1GA 4O03A 1KXDA 2FS8A 1YLCA 6GCHG 1T8OA 1AZZA 5B6OA 2ZQ1A 2CN0H 4BNRA 2A4RA 4CRFA 2VINA 2ZCKP 5B6LA 1TBQH 3MO3A 1K22H 2HNTE 1O2MA 4YXWD 1J8AA 1YPJH 3ZZ4A 1AB9C 1QBOA 2QV1A 1AQ7A 3L3TA 5EW1H 2RG3A 1BUIA 1YPHC 2UWOA 4OM9A 1K1PA 1B5GH 4A5TS 1MKXK 1FDPA 1T32A 1CHGA 1QJ1B 2H6MA 2JJ2D 1S84A 1ABIH 2P59A 1K1MA 4X8UH 2D1JA 5DP4A 2PTNA 1P3EA 3M35A 4BTUB 1FNIA 1TGCA 3MNBA 1DVAH 6GCHF 1EAXA 1ETTH 3QDZB 4DIIH 3Q00A 4FETA 1OHHD 4K3JA 4YLQH 5KGOA 1PYTD 2FOHA 1K28D 2JH0D 2XCNA 4LXBH 3VB4A 1F0TA 3RMOH 4SGBE 3OFND 2A2XH 3FP7E 5C17A 2A4OA 1ANDA 1OYQA 1YPEH 1QR3E 2J4IA 3GCHB 2GZ7A 4D7FA 1V2ST 2FPZA 1KSNA 3S7HB 2R3UA 5DP5A 3NK8A 5ESBA 5L2YH 1YLNA 3BF6H 1DICA 2FS9A 3QN7A 2OP9A 1MCTA 3EDXB 2A45B 1G32B 3TPIZ 1QL9A 1C5NH 2AERH 1SKYE 2O9QA 1TNIA 2F9BH 1TOCB 3ESTA 2J5UA 1AIXH 8LPRA 1FY4A 2ANKH 4DY7B 1TABE 3EQ0H 1CBWC 1T4VH 1KTSB 1YC0A 4H6SB 5FBIA 2DUCA 1W0KD 3B9FH 4KTSA 4ZXXH 2Q6GA 3H7OA 3FP6E 3SU5A 2VWMA 2ZP0H 2STAE 3PV4A 2WV5A 5ESTE 2QN5T 2ZU2A 1EAIA 1QQ4A 2OLGA 2WYGA 2VVCA 2A31A 2XC5A 1LCYA 3U69H 2YNAA 1Z1JA 4BOHA 4GPGA 4MTBA 3SUEA 1KDQA 2HPPH 4HFPB 2KAIA 4IN1A 3ZZ7A 4I33A 2G00A 2OBOA 4YESB 3GCNA 4U2WA 3GICB 1Y3XA 4HTCH 4NWKA 1HAXB 1A2CH 2F9UA 1EJMA 1DXPA 1GVKB 4A1VA 3UQOA 5EXNA 5TCAA 4UFFH 4GHTA 2KCOA 1MTWA 3SU4A 1HJ8A 5GCHG 1BHXF 4ESTE 1C1SA 1LVBA 1K2I1 4NA8A 4XRNA 2Z9JA 2ZHEH 2C3SA 3RXMA 1UJ1A 1A5IA 2BDYA 2G51A 1ELBA 4A6LA 2JETC 2JH5D 2CV3A 4U30A 3LPRA 5F53A 3BTDE 2NU1E 1FY5A 1T7CA 1QNJA 4WH8A 1AGJA 2AMQA 2CGAA 3MH5A 4AB9A 1XUKA 2ZGJA 1HXFH 1UTNA 2ZPQA 4AB8A 4DT4A 2ZHWH 1W0ZU 1TBRH 1NO9H 1ELEE 1KDQB 1T8MA 1G30B 5GCHF 2KAIB 3LGYA 1ORFA 3MH6A 1SGRE 2V6NA 5A0BA 1G2LA 4X6NA 3AK5A 1BBRK 3MNCA 4UDWH 4K2YA 2QXHA 3TNSA 3O8CA 5AHGH 1BBRE 2PKSC 4ZROA 2ZFTA 2BD7A 2WUBA 3A85A 1UVSH 1N6YA 1V2QT 4OGXA 2PGQB 3SZNA 2QXJA 2P8OC 2Z9LA 3R0FA 1CA8B 3S69A 5JYIA 1NFWA 4Y0ZE 4FOUC 1SPJA 2ZIQH 2ALPA 3V0XA 5A0AE 2CHAC 2BDGA 3MH4A 2OCVB 1O2JA 2XBWA 3GISB 4CHAB 5E0GA 1XXFA 5E2OA 1LQDB 4H4FA 5TJXA 4I8KA 1GMHG 4R0IA 1BT7A 3PRDA 3PV2A 4TPYA 1OP8A 4B73A 1GHWH 1CA0B 2Y5FA 2KFWA 3VFEA 4ACBA 1O3AA 2EI6A 1ZPCA 1GL1A 1BJVA 1UTPA 2OBQA 1GMCG 3W95A 4X1QU 4NIXA 1C4V2 4K5ZA 1U6QA 3VXEH 5LPRA 3UIRA 4BAOB 1GMDG 2ZDKA 4OS2A 3U8RH 2BDIA 1K1LA 1YCPH 1A3EH 3U1IB 1Y5BT 1C5LH 1T8NA 1PPFE 1GMHF 2K1QA 1WTHD 1EJNA 3SNCA 5DK1A 2OC7A 2H9HA 3GOVB 4X2WA 4ZHAA 1UTMA 1FY8E 2P3TB 1LPZB 2P94A 1GMCF 1O2SA 4I7YH 2VWOA 5DP6A 2AMDA 1WOFA 3HGNA 3I77A 4Y6DA 1BTYA 5DP3A 1GMDF 2IJD1 8ESTE 1S83A 4HGCA 4KKDA 1UTJA 2J98A 1W3CA 3A7TA 1EFRD 1SGPE 2BD9A 2W7UA 2BY6X 2PSXA 1J16A 3U28C 3RMLH 1NM6A 4WMEA 1F2SE 2FTLE 4ABBA 2B0FA 1AD8H 3I29A 1WYKA 2BY7X 1W14U 2G5NA 4I86A 1SL3A 5KEDA 2ZU3A 1DSUA 2HNTF 1K21H 4MVNA 3UB0A 5HYOA 3T2NA 4E06H 1YPLH 2SGEE 3L33A 4CBNA 3V12A 2FI5E 1Y5AT 2Z3CA 1QL8A 3QZQA 3VPKA 1V2VT 2ZZUH 2GZ9A 1AI8H 4UFGH 3E6PH 3ZVAA 1BRBE 2C8XB 1IQJA 1SQAA 2C90B 1GCDA 5CE1A 1MAXA 1O3FA 1ACBE 5FPTA 1OPHB 4Y79A 1S6LA 2WPLS 2R0LA 1ZTJA 5HMAA 2M5TA 3WY8A 1S5SA 4JYVH 1SBWA 4X6PA 2BLVA 3K6ZA 1WQVH 2SNWA 1SGFA 2YMSB 3A8AA 4K69A 5EGMA 4Q63A 3A80A 2DE9A 2FDAA 4FUHA 2GVFA 3P8NA 2IPQX 2V0BA 5EXLA 1ELCA 2XWAA 1YF4A 1EUFA 5DSFA 1O3MA 5DPAA 3SJ8A 3RXSA 1DFPA 2H5DA 2FOMB 1T8LA 2OQ5A 1EZSC 2TGAA 1BMAA 3QUMP 4NA7A 4Q7ZA 1F92A 1GPZA 2Y81A 1TQ0B 3AW0A 2QGRA 2BX3A 2F9PA 3KF2A 1E79D 4TY6A 1GBTA 2W26A 4X1PU 2WPIS 4XBDA 2PHBA 4BTIB 5EG4A 2A0QB 6LPRA 1VJ9U 5DKMA 3EE0B 3TGIE 2J2UA 2GCTB 1TB6H 1GJ8B 1AWFH 1H8IH 2ZF0H 5T6FA 3BG4C 4XBCA 4ISOA 1ELGA 4MPXA 4F48B 1P2IA 2QF5A 1NFYA 1GGDB 1N8OB 4ISLA 1KXFA 2ZI2H 1OWIA 2BQWB 3KQBA 3MU4A 1PPBH 2F9NA 3SV2H 1ZR0A 3ZZ5A 2G4TA 3S9AA 1NN6A 1P02A 3AAUA 3TVJB 1OWKA 3RXPA 2XOKD 2KR7A 3LJJA 2AGGX 5I25A 3E1XB 3DT0H 5EJLA 4Y0YE 5EPNA 1LVYA 4CREA 1GBJA 1GI5A 1ZTKA 2XC0A 1DUEA 5FX6A 2UWPA 1O5AB 2GMTC 2A5KA 2G4UA 1AWHB 1MTUA 5F6MA 1DWEH 1JWTA 3LU9B 4Q4LA 7GCHG 5IDKA 1F5KU 1YKTA 4P00A 3T27A 3EAJA 5ETXA 1E1QD 3C27B 1SC8U 1DDJA 1Y59T 1T4UH 2Y82A 1K1NA 2BLQA 3MFJA 3P92A 3O8RA 1WQSA 1UCYK 2JJ1D 1HXEH 1V2NT 5BRRE 1O30A 2LP6A 2PV9B 1ANCA 1UCYE 2HLCA 4ABGA 1VCQA 1UVTH 2Q6DA 1TPPA 1BMMH 3F1SB 3U8TH 1O36A 1CT2E 2ZG0H 1YPKH 1H9LB 1K1JA 3TK6A 7GCHF 1DXWA 5CDFE 4CRCA 2OQUA 1JMOH 2NU4E 3SGAE 3F2GA 3UFAA 1C1WH 3SI3H 5FX5A 2HVXA 2BOKA 3H7TA 1S0RA 1N1LA 1BTZA 2D26C 4ZCNA 1FY1A 3BTWE 5GPIB 5HKKD 4ABJA 3M5NA 3P95A 1ESAA 1TAWA 2XNIA 1XXDA 1ESTA 4Y8ZA 1S0QA 3ZZ8A 1NS3A 4RI0A 1CGHA 1HJ9A 4E7NA 3SQEE 1P2OA 4CRGA 1RJXB 2FODA 1ZRKA 4YO9A 3SGBE 4ABDA 1F0RA 1GI4A 3PYHA 2Z9GA 1IQNA 5L2ZH 1O2QA 3F0PA 2ZCHP 2QAAA 1C2JA 1ANBA 2ZTYA 1OYTH 2W6ID 3A8BA 1YBWA 1XUIA 2A5AA 2GX4A 1D6RA 1O5DH 1D6WA 1RIWB 2SGPE 5F8ZA 3EE7A 2FOAA 2ODPA 1OP0A 4UE7H 1PPEE 1P57B 1UO6A 1WXRA 1SFQB 2BD5A 5HM2A 1FN8A 2B9LA 4WVPE 4ZKSU 1PPZA 4I8HA 1GI1A 1PQAA 2C8ZB 1C2LA 1ELTA 1Q2WA 3A86A 3PROA 3DA9B 1P0SH 2F3CE 3TJOA 5DP7A 7KMEH 3NPSA 2HRVA 4YT7H 1O5FH 1ELVA 1V2RT 1OKXA 4UFDH 3CS0A 1GJBB 2VVVA 1YPMH 1SGCA 3SHAH 1C1TA 3URDA 3VB7A 1TNHA 3MU5A 3BV9B 2BXUH 2FX6A 1SMFE 4O3TA 5H4IB 1TMBH 3FKSD 3TGJE 1EP6A 5HXFA 1Q3XA 1A1RA 2FI3E 4MDSA 4AFQA 4YLUA 3TJUA 1YM0A 3ZZ6A 1BITA 1H4WA 2V3HH 1A0LA 4B6FA 2HLDD 2WPHS 1HAPH 2FO9A 1F0SA 2A4QA 1KLJH 2R3YA 4UONA 1LQEA 2FESH 4XE4A 2FLRH 4DVAU 3M61U 4CH8B 1BTWA 3V13A 2LPRA 1OWDA 1TFXA 2WV4A 3MNSA 3OX7U 4FVDA 2EI7A 4K8YA 3RLWH 9LPRA 1MKWH 1BB0B 3T28A 1LPGB 1ZGIA 2ZNKH 3EA9A 4AORA 4TYDA 4WXIA 4B2BA 4YOJA 2XBYA 1Y8TA 2ZPSA 4BAQB 2BM2A 1W11U 1RGQA 2UWLA 1GBIA 2ZTZA 4OS1A 2P3FH 4A7IB 1V2KT 3UAIC 5ABWA 3H09A 4Y76A 1EX3A 1O3OA 1PJPA 4XD7D 1P01A 5FL7D 3ODFA 1K1IA 4TWYA 1FUJA 3UR6A 1AMHA 1D3DB 4IBLH 4RT0A 1AUJA 3WWFA 2ZEBA 1EPTA 1G37A 2PKAA 1TX6A 1A3BH 1VCWA 1TNGA 4WH6A 3RXKA 2WSSD 3OAAD 3ZV9A 3BTTE 1HIAA 5G4BA 3PO1B 2AGEX 3VGCB 1O3LA 1VGCB 3QTVH 4Y7AA 2FOFA 1O35A 2GKVE 2QY0B 1VJAU 3P70B 1EXFA 3LDXH 3SV7A 1EOLA 3NZIA 1GJAB 5E8EH 1MQ6A 1EZXC 4FVBA 4IS5A 2VGCC 4H6TA 2K0QA 2ZO3H 2Y7ZA 4LK4A 4I8JA 4JZFH 5T3HA 3W1EA 2FIRH 1SOZA 1O38A 1ZMLA 3U9AH 1C2HA 3LH3A 1H9HE 4ISHH 4ZHMU 3BTEE 2Y7XA 3GY2A 1ZSKA 4ZH8A 1GJ9B 3A82A 4AZ2B 5SGAE 3ZZAA 1BTPA 3DFLA 1C5YB 3ATIA 1GHZA 3RXBA 1E35B 4Q2KA 3TGKE 1P8VC 3E8LA 3FAOA 2AIQA 3ITIA 2WPDD 2VIQA 1EPTB 1ZGVA 2OC8A 2PKAB 1O2WA 1K1OA 2PR3A 4FXGH 2ESTE 2ZDVH 4FU7A 1C5PA 3ZVBA 1XUGA 1HIAB 2WZQA 3P17H 1O3BA 3LKWA 1Q31A 1TA2A 4FUGA 2HNTC 1BTHH 1TONA 6CHAB 1TMTH 3LGWA 4ZHLU 5C0UA 1C2GA 4KP0A 4YOIA 1L4DA 2ZA5A 1O3EA 1ARBA 3MMGA 1D3PB 1EZUC 1O3HA 1MZDA 2QA9E 3UWIA 3CNRA 2BY9X 1AU8A 2NWNA 4FUIA 5LGOA 4AX9H 2R2WU 1TALA 2H2ZA 4K8BA 3EA8A 2OTVA 1S82A 1E36B 1GI9B 8GCHG 2PUQH 5AFYH 2Z9KA 1CGJE 1DT2A 1HYLA 2TRMA 4ACAA 2VVUA 2C8YB 3TLOA 1TGSZ 3PM3A 1O2UA 3SNEA 2BD2A 3OEED 4JYUH 3SUFA 3BTME 1TE0A 3PMBB 4FUDA 1B7XB 1C2EA 2RCEA 1FN6A 1ZHPA 2NU0E 3B23B 4Y8XA 1YY3A 2Z6BD 1A4WH 1EB2A 1TPAE 4X1RU 4AN7A 3UOPA 5A8YA 4B1TA 3RXDA 3PMAB 1HRTH 5DGJA 1XUHA 4OS4A 3A88A 8GCHF 1V6DA 4BAKB 3P8GA 5L6NH 1FAKH 4I32A 5T6DA 3ZVDA 1FX0B 3SNAA 4K1EA 1C4U2 2A4GA 1QRXA 7ESTE 1GBAA 3VB6A 4RT1A 4A1XA 1AKSA 3PMHB 3MWIU 4GHQA 4JK6A 2PGBB 2A7CA 3S9BA 5EPYA 2FYQA 1SSXA 1HJAC 1RRKA 5DP8A 4INLA 3AW1A 1ZSJA 2F91A 1C5RA 3A8CA 3BG8A 2VWNA 1GBEA 1HFDA 2BD3A 3FVFB 1Z8IB 5F03A 5CHAB 4GAWA 1EATA 5JBCS 4Z6AH 1Z1IA 4VGCC 2ILNA 1ZSLA 1TRMA 3RU4T 2OC0A 1O2LA 1TOMH 2V3OH 5EXMA 1TGBA 2ASUB 1IQGA 4O97A 2VIPA 1SQTA 3OTPA 1ARCA 2QXGA 2L74A 3BTKE 1JRTA 3DFJA 2VIOA 5C1UA 3ZVGA 1GI6A 2BOHB 3RMNH 1VZQH 1FIWA 1EP5A 1G9IE 1C1PA 3RXJA 1SI5H 3O8DA 3RXCA 1PPHE 1UVUH 4YTAA 1GHAG 2FLBH 3GYMA 3RXEA 4P02A 1AB9B 1C4Y2 1G3DA 3DUXH 3STJA 5HM9A 3P8FA 5KECA 2I6QA 4BAMB 3RXHA 1GCTC 3Q77A 1CT4E 1AKSB 1GBDA 1TWXB 5HIZA 4MPUA 2J92A 3MU1A 5C5NA 4MLFB 2ANWA 1BRUP 1YCPK 3BIUH 1NRSH 4ABEA 6ESTA 2BD8A 2IPHA 2PFEA 4X0WU 1BRAA 2XCFA 1C1UH 4JZEH 3A7WA 5JB9S 3F9HA 1G3CA 1GHAF 1WBGB 1QBVH 1QRZA 2HOBA 1EASA 1K0HA 1JBUH 1V2JT 3Q3KA 4TT3D 1S6HA 3AVZA 5EQSA 2K8IA 2XW9A 3F0OA 1SOTA 5EQRA 2FEQH 4NWLA 3ZVEA 1OP2A 3EGKH 4CR5A 1VITH 2QE7D 1TNKA 3PRBA 3SNBA 1HPGA 5K0HA 3MQKC 3HK3B 2BTCE 1Y3VA 2GTBA 2YMSC 3A8DA 3LGIA 3TK5A 3QLPH 5A2MH 1EB1H 2V35A 4Q7YA 3P6ZB 2SGAA 3F6UH 4XDEA 4M9FA 3ZZ3A 2TIOA 1DLKB 5A0CA 1AVWA 3GY5A 3HKJB 1CBWB 1FLEE 4CRAA 4NIYA 4TWWA 2W6JD 5F8XA 3S9CA 1D4PB 4YM9A 3AAVA 4Y8YA 5JBTA 1O3NA 1PYTC 2KZ4A 4ABFA 1QB6A 1F7ZA 4JZ1A 5FPSA 2O8LA 1BCUH 3GYLB 2W7SA 3IG6B 3HK6B 4D8NA 3PWBA 3TITA 4DIHH 1KXBA 4AC9A 4X1NU 4Y71A 2ZFSA 5JDUB 1QFKH 1H8ED 2BDCA 1NY22 1NESE 1P3CA 5GJ4B 1GHYH 2TGPZ 1IQHA 4Z0KA 3KQCA 1O3IA 2J98B 1O5BB 1W0JD 3EA7A 3TJVA 3SZEA 3GDSA 2H1UA 1AFQC 1RFNA 4R8TB 1O3PB 2OC1A 1J9CH 1O2RA 2OINA 4A1TA 5DP9A 3M3VA 1MABB 3K65B 1SGFG 1W8BH 2DE8A 2AH4X 1SGDE 1DPOA 1SGNE 1XVOA 1VR1H 3P8OA 1THPB 2J38A 3RXAA 1SQRA 3M3SA 3KGPA 1KMHB 2XXLA 4GVUA 2A32A 1EJAA 3OY5U 1VKYA 1Y3YA 3CP7A 3QGJA 1NRQH 2LNCA 2P16A 1FONA 1YGCH 1KXEA 4DGJA 2JETB 3R3GB 4XSKU 2PP6A 1TPOA 4KTCA 2FXRA 4PROA 3H5CB 4WWYA 2BX4A 1V2OT 1KTTB 3SO3A 4IC5A 5IK2D 1DWBH 5EJZA 1O3KA 2JIZD 1S85A 4RKOB 2NU3E 1LHFH 1MQ5A 3U8OH 4QT8C 8KME2 1NZQH 1HGTH 3A81A 4JZDH 1NBMD 3UQVA 5TCCA 3Q3XA 1MTNC 1GBBA 2A5IA 1INCA 1ABJH 3QTOH 4FUBA 3Q3YA 2PKSB 1O33A 2VJ1A 1ELDE 2ULLA 1QB9A 4HZHA 1S6FA 3DSPA 1GL0E 1E38B 1O31A 1PFXC 2P8OB 2WYJA 4SGAE 1A0HB 1ELAA 3SV6A 1EAUA 3BSQA 3F9GA 1GI3A 3DD2H 5C20A 1FAXA 1OX1A 5LPFA 2CHAB 2R9PA 3G01A 1HAYB 3KL6A 3KQEA 4X2XA 3RXLA 3T25A 4AFSA 1O3DA 2QF4A 3AASA 1MBMA 2BDHA 2SFAA 2BVSH 2ZHFH 1WUNH 1O2ZA 1XMNB 1V2UT 3VGCC 1O0DH 2TPIZ 3K6YA 1LHGH 3RDZA 1UVOA 1FI8A 3OYPA 3N7EA 3SU1A 4LZ1H 1X7AC 5EODA 1HV7A 2FX4A 1TQ7B 1THRH 2O8MA 3CENA 2ODYB 1SLVB 2FOCA 1HAZB 1JIMA 1BMFD 1GVLA 3GCHC 1O2IA 2KCYA 1IHSH 3E3TA 2V7QD 1GG6B 3GY3A 4O9VA 2JDID 1P06A 1GBCA 4IGDA 1MU6B 4X8TH 3FO8D 2BB4A 1DE7H 3SJKA 3UPEA 1TX8A 1Z8RA 2SNVA 1F5LA 4U01A 1W13U 4GUXA 1HCGA 2XTTB 2RFKC 5DO4H 1L1JA 4NCYA 3UWJH 1TIOA 1P2JA 1WDIA 4IC6A 1AHTH 1O34A 3NKKA 3W94A 1KXCA 4AG1A 1W2KH 4FU8A 3V7TA 3ZZBA 1DITH 3TK9A 1LKAA 2CK3D 2W3IA 1NC6A 3SGQE 3ZVCA 1O39A 3PTBA 3RXTA 1XVMA 3TJNA 3MH7A 3UOUA 1KIGH 4AFUA 4Y10E 4X6OA 4NFEA 1C2DA 3GCTG 3RP2A 2P3UB 3M3TA 3A87A 2XBVA 1YWUA 5EIYA 1C1OA 1C2KA 1DSTA 3PTNA 5LH8A 4GSOA 1SGQE 2ZKSA 4D9QA 4MPWA 2HWLB 4K60A 4MQAA 4D76A 1QY6A 1XX9A 1JIRA 4X1SU 2GV6A 4ZAEA 5J4QA 2Y6TA 3VEQB 4B2CA 4GCHG 1ZRBA 1TGTA 3A7YA 1OWEA 2AHME 2RA0A 2CF9H 2YNBA 4JYTA 2TBSA 1QJ6B 1ID5H 2G55A 5C67A 2GD4B 2V3MA 1HAIH 3DHKH 5J4SA 4JZIA 1YPHE 1MTVA 4XFQA 3FFGA 1MUEB 3GCTF 2L6OA 4B2AA 2A7JA 2JKHA 3D65E 2ZGBH 3M5LA 1EOJA 4AGJA 1SFIA 1W10U 3O8BA 2XRCA 1EAWA 2VNTA 4TSFD 4YZUA 1D3TB 3BN9A 3IITA 1O2PA 5L30H 1NROH 3VB5A 4NIVA 1IAUA 1ZPBA 1SG8B 4GCHF 3UNQA 2IJOB 1LO6A 2HGTH 3K9XB 4AYVB 3OSYA 4KELA 4B6EA 4CR9A 1CU1A 4OS5A 2AMPA 2OXSA 3UR9A 4B76A 1GHVH 1UK4A 2O8UA 2XC4A 4WMDA 3VXFH 4NZQA 2FWWA 1YLDA 2WINI 3SJIA 1L2EA 2ZDAH 1C5WB 1PQ5A 3K2UA 1MZAA 1E0FD 1ZPZA 2BZ6H 2TGTA 3UNSA 1L4ZA 1QURH 3MI4A 1IHTH 3GY8A 2Z3DA 4K1TA 1G3EA 4OS7A 4AGKA 2ZHQH 2XYAA 3D49H 5EOKA 2EEKA 2Y80A 1LTOA 2BDAA 1S81A 2EC9H 5C94A 4CRBA 5PTPA 2F9OA 1MKWK 1TRNA 1UK3A 3BG4B 3SU2A 2ZTXA 1KYNA 1MMJN 2ANMH 1GBHA 3PLPA 4TPIZ 4CHAC 1A0JA 1QRWA 2O8TA 4DOQA 1BZXE 1UTQA 2VIDA 4YT6H 5F8TA 1HAOH 1OWJA 1PPGE 2ZU1A 1GWAA 2J97A 4KTUA 4X2VA 5CHBA 2BXTH 1ZYOA 1C2IA 4F49A 1TLDA 3T26A 2ZDNA 1CA0C 2YMSD 1FZZA 3M5MA 3SORA 4HG6A 4BTTB 2F83A 1PPCE 1MKXH 1Y3UA 1C5VA 1AZ8A 3LGVA 3VB3A 3HPTB 4DJZB 1H8HD 3U98H 2GMTB 2OUAA 1SHYA 1O2KA 5EQQA 3MYWA 3FZDA 5I46H 1O2YA 1P04A 2VIVA 4B74A 1NPMA 1UTLM 1K9OE 2I6SA 2G81E 3A83A 3LIWA 5C1XA 4JCNA 1T31A 1FJSA 1WCZA 3SUDA 1BMNH 2ZU5A 3KQ5A 2BLOA 1UHBA 1AVGH 5GXPA 1FY3A 2F43B 4O3UA 4ZKNU 4A92A 1LKBA 1TRYA 4M7GA 2FMJA 2GDEH 4E7RG 1IQFA 2HVYB 1V2MT 1C2MA 2STBE 3QGNB 1ZLRA 3F9EA 1WU1A 4ZKOU 5FCKA 1E37B 1MBQA 2HALA 4OS6A 3ZYEA 3E90B 5GNDA 1QHRB 3A7XA 3SUGA 2GV7A 4RKJB 2Q6FA 2NU2E 2O8WA 3CS7A 1W7GH 3A84A 1HBTH 1RD3B 3RXIA 2AS9A 3OTJE 1E1RD 3QZRA 4BXSA 1O2VA 1BTUA 2G52A 4IN2A 1Z8GA 1FV9A 1MAYA 1NFUA 3M7TA 4I31A 3WWBA 2ZGCA 3UTUH 3M7QA 1YYY1 1OWHA 3NWUA 4DW2U 3RC4A 1GVZA 1BTXA 3KQDA 3M36A 1NU9A 2Y5GA 1IQEA 1Z7KA 3S0NA 3SU6A 5E0JA 3OU0A 1V3XA 3I78A 1UHBB 4XBBA 2FOBA 5HIYA 1GJ7B 3FANA 2PTCE 3ZIAD 1A46H 2ZGHA 3BTQE 3ENSB 3L6PA 2VBCA 3U1JB 2J95A 2J9NA 1SQOA 1GHBG 1DANH 3F3BA 4AG2A 1QZ8A 1D9IA 1ETRH 5HGGA 3M37A 1SR5C 3ZYDA 3URCA 2IN2A 4TY7A 5E0HA 1SGIB 1MTSA 4INKA 3ZZCA 1BRCE 4Y11E 1C1MA 3RXUA 2PSYA 1OOKB 3HATH 2FOGA 1LPKB 2HPQH 2BQ7B 3PV5A 1IQLA 1V2LT 1P09A 3C1KA 1GHBF 2KCAA 5AF9H 3RXGA 4X8SH 2FM2A 2R2MB 1THSH 1W0YH 1Y5UT 4MPVA 2EY4C 1BHXB 3JZ1B 2CXVA 4DG4A 1F5RA 1ZMJA 3FP8E 1SHHB 2H9TH 1SLXB 4MNWA 1DOJA 5C0TA 2ZFRH 4LZ4B 2OK5A 2BYAX 2UUFB 2ODQA 2GCTC 3Q76A 3LJOA 3ODDA 3FN8A 2YOLA 5AFZH 3ZV8A 1BIOA 5EU8A 1P10A 1BBRH 3NXPA 1G2MA 1HUTH 1ZHRA 1GGDC 1N8OC 3SHCH 2BY5X 1P9SA 3KHVA 2BHGA 2OD3B 3RMMH 3OEHD 2J94A 4AYYB 1ELFA 3E91A 1V2PT 1SGTA 4FUEA 1C1NA 4FUCA 3WW7A 3LGTA 1LVOA 4WMFA 2QF3A 2Q1JA 2RDLA 1Y3WA 4NFFA 1GJCB 2PW8H 3RU4D 5FBEA 3RXVA 2EQNA 1OS8A 2XNDD 2FYRA 1TPSA 2ZCLP 5BPEA 2C93B 4BAHB 4B75A 3NCLA 3SBKA 2IOTA 4UEHH 3PLBA 1UW7A 1JXPA 1HAHH 3F68H 2H5CA 2KX4A 5C3NA 1EQ9A 2WUCA 1GI0A 4Y7BA 3SQHE 5T6GA 1YP9A 1XM1A 2M2AA 1EZQA 2BLWA 3SOSA 1L0ZA 1L1NA 3KYFA 3T62A 4THNH 1M9UA 5CMXH 1P2KA 1O2OA 2VU8E 1QBNA 4MNXA 1MD7A 3MU0A 1GBLA 3PMJA 4XOJA 4ASHA 1O5CB 5FAHA 5EW2H 2G8TA 1LHEH 3GY7A 1NRPH 1O2NA 1HLTH 1P11E 2QYIA 1UK2A 3IWMA 1ZHMA 4ZKRU 1B0EA 1GG6C 1C5XB 4INHA 4DCDA 3LGUA 2H9EH 2VGCB 3MO9A 1J15A 1QA7A 4IMQA 4ABIA 1FPCH 2A7HA 2AYWA 3S7KB 2SGDE 3RXQA 3F2FA 1NRNH 1ZJKA 1XKBC 2BD4A 3UREA 1BMLA 4WXVA 2AGIX 1QQUA 4KGAA 5DG6A 1MU8B 2FI4E 3PWCA 3JZ2B 1O3JA 3A7ZA 1Z71A 1DUAA 2A2QH 5LPEA 2WPKS 2KM0A 3SW2B 1O2GH 3UY9A 4MG3A 3NUMA 2ZFFH 4UD9H 2VWLA 3M5OA 1ZJDA 1LDTT 5EJ1A 5A8ZA 2UUJB 3GS9A 1Z6JH 1HB0B 1AE8H 1V2TT 2G5VA 1TNLA 1NTPA 2CJIA 1J14A 4FUJA 3N99A 2ZFPH 2FZZA 1J17T 2FTMA 1B0FA 3DSOA 3LT3A 4CRDA 1G36A 1DLEA 2VIWA 1HDTH 4BANB 3MU8A 2BZAA 1FXYA 3TH2H 1DY8A 2LELA 1AE5A 1P2NA 1E34B 3EYDA 1RIWC 1OSSA 3BTHE 2BY8X 7LPRA 1RS0A 1TBZH 2CMYA 2F4LA 1G3BA 2Z94A 1RTLA 1GJ5H 1QA0A 1SGEE 1KLTA 2VB0A 3T5FH 1UVPA 2KCPA 4GLYA 3TNTA 2GDDA 1FPHH 1W12U 1TNJA 4X2YA 4J2YB 3OE7D 5C2ZA 1KXAA 5GIBA 3FOAA 1WSSH 3RM2H 1CE5A 1P9UA 4I8GA 1GJDB 2THFB 4E05H 1GDNA 1SLUB 3ELAH 3TIUA 1TMUH 1GBMA 3MHWU 3RC5A 1H9IE 3N7OA 1IQKA 1ZTLA 1NU7B 1HNEE 1MH0A 1GDQA 3QX5H 1QCPA 1ESBA 1AFEH 1O37A 1BA8B 3BEFB 1GBFA 1AN1E 3ZZ9A 4LOYH 3SU3A 2QXIA 2RA3A 2ZDLA 2XWBI 1C9PA 1FMGA 2ZWLH 1XUFA 4MNVA 4ABAA 1SGYE 2D2DA 2GP9B 3RU4E 3MTYA 4HI3A 2ALVA 3GY6A 2ZHDA 3T29A 4X8VH 1HAGE 2JH6D 3DCLA 1LHDH 2SGQE 1QL7A 1D3QB 1MCVA 2C8WB 4ABHA 3RXFA 1ZMNA 2ZGXH 2PWXA 4NGAH 1HJAB 1OXGA 1DM4B 2GGVB 2ZFQH 3RUOA 4UFEH 1AVXA 1A7SA 1N6XA 4JK5A 1C2FA 3SV8A 1TGNA 1P2QA 2A1DB 4VGCB 4F55A 3TH4H 5DJ7A 1O5GH 3RXRA 1V2WT 1TYNA 2UUYA 3KEEA 3ZZDA 3BTFE 1COWD 3ATMA 1DWCH 4MNYA 3DSGA 4I8LA 4ISNA 1GI7B 1C5OH 3BEUA 1PQ7A 2TGDA 3OY6U 3F9FA 3LOXA 2VH0A 1GJ6A 5FCRA 1YPGH 1BQYA 2J34A 4YOGA 1CQQA 2GCHG 3N7DA 1GBKA 1TX7A 2D8WA 3D62A 2ZU4A 2B5TB 2EI8A 3LONA 1SVPA 3PO1C 1H8DH 1VGCC 2BDBA 2RDEA 1O5EH 4NSYA 5JBBS 2BVRH 1QJ7B 3RC6A 1JOUB 4WF8A 3SJOA 5AVDA 5C5OA 1GCTB 3MOCA 3SU0A 3BEIB 1NRRH 1WV7H 5K7RA 4Q7XA 3A7VA 1EKBB 3SNDA 1MD8A 2Z9IA 3GDVA 1VCPA 3E0NB 3HKIB 3QO6A 4DURA 4Z1MD 2R0KA 1O32A 1UCYH 4NSVA 2GZ8A 2GCHF 1NFXA 1UMAH 1KLIH 3RM0H 2WV9A 4IW4E 3M7UA 2EA3A 2AIPA 3KNXA 5C1YA 5A09A 3ATLA 1GI8B 4RN6A 5A8XA 1QGFA 3NRLA 1F0UA 1GJ4H 1C5SA 3QWCH 3GY4A 3KCGH 1CVWH 3RLYH 1SLWB 4U32A 3SN8A 1BDAA 3QK1A 1WAYB 3D23A 4X6MA 2Y5HA 1XUJA 1C5MD 3V3MA 1C5QA 1ZZZA 1C9TA 2PLXA 1P05A 3KYGA 1IQIA 4ASUD 1EPTC 1GDUA 4NIWA 2CF8H 2SGFE 1CO7E 3B8JA 1CT0E
chains in the Genus database with same CATH topology
1IQMA 1TA6A 3TH3H 1WTGH 1FIZA 1A5HA 4CH2B 5IYTA 1ETSH 5FPYA 1FQ3A 4Q80A 1KY9A 3UUZA 5JPMH 2GT7A 1LHCH 2AEIH 3A89A 2P93A 2ZC9H 1YCPM 1QB1A 6CHAC 1W7XH 1UTOA 2FP7B 1GI2A 2B8OH 4B71A 3PB1E 4FU9A 1PQ8A 1SB1H 3KIDU 1P2MA 4AFZA 1LVMA 3HGPA 4NZLA 3E0PB 1XKAC 3BIVH 3MNXA 4ISIH 4D7GA 1O2HA 2QC2A 1AO5A 2AFQB 1BJUA 2PUXB 3SJ9A 5JB8S 1O2TA 3LC3A 2ZDMA 1AY6H 5FHTA 2P95A 1VITG 3ATKA 1A61H 4D9RA 2B7DH 2QCYA 2UUKB 4AOQA 1HAVA 1P12E 5FXLA 2ZECA 2ZPRA 3KN2A 5GDSH 4J1YA 4WY3A 2ZQ2A 1CGIE 4OGYA 4JMYA 1C1VH 2WPJS 5GWZA 3UNRA 4ZMAH 1O3GA 3STIA 3BTGE 1DS2E 1CHOG 4NA9H 4NG9H 4K1SA 1H1BA 1C1QA 1AFQB 3GCOA 3ATWA 3MO6A 1O3CA 1VITF 3E16B 4DT7B 4BXWA 1RTKA 4CBOA 1P03A 3SI4H 4ZXYH 3RXOA 2WPMS 4IMZA 1UTKA 1QIXB 2W5EA 1ZOMA 3ZVFA 2BMGB 1C1RA 3SV9A 1DX5M 3TU7H 2XBXA 1ANEA 3LC5A 1CHOF 2QIQA 1JRSA 9ESTA 1C5UA 1A5GH 2VH6A 4F4OC 1C5ZB 2F9VA 1DY9A 1CSOE 2Z7FE 1IOEA 3LH1A 1DWDH 5JBAS 1O2XA 1QTFA 1Z8JB 3GDUA 4FUFA 1BOQA 1HAVB 1AUTC 3PLKA 2QF0A 5CHAC 2ANYA 1RXPA 2GT8A 1LMWB 2Z3EA 4ZUHA 1RTFB 5E2PA 2FOEA 1GHXH 1C5TA 3FZZA 2W3KA 1Z6EA 4RSPA 4H42U 4WJG2 2BQ6B 2BVXH 1MTNB 2C4FH 1NT1A 1L1GA 4O03A 1KXDA 2FS8A 1YLCA 6GCHG 1T8OA 1AZZA 5B6OA 2ZQ1A 2CN0H 4BNRA 2A4RA 4CRFA 2VINA 2ZCKP 1TBQH 3MO3A 1K22H 2HNTE 1O2MA 1J8AA 1YPJH 3ZZ4A 1AB9C 1QBOA 2QV1A 1AQ7A 3L3TA 5EW1H 2RG3A 1BUIA 1YPHC 2UWOA 1K1PA 1B5GH 4A5TS 1MKXK 1FDPA 1T32A 1CHGA 1QJ1B 2H6MA 1S84A 1ABIH 2P59A 1K1MA 4X8UH 2D1JA 5DP4A 2PTNA 1P3EA 3M35A 4BTUB 1FNIA 1TGCA 3MNBA 1DVAH 6GCHF 1EAXA 1ETTH 3QDZB 4DIIH 3Q00A 4K3JA 4YLQH 1PYTD 2FOHA 1K28D 2JH0D 2XCNA 4LXBH 3VB4A 1F0TA 3RMOH 4SGBE 2A2XH 3FP7E 2A4OA 1ANDA 1OYQA 1YPEH 1QR3E 2J4IA 3GCHB 2GZ7A 4D7FA 1V2ST 2FPZA 1KSNA 3S7HB 2R3UA 5DP5A 3NK8A 5ESBA 5L2YH 3QN7A 3BF6H 1DICA 2FS9A 2OP9A 1MCTA 3EDXB 2A45B 1G32B 3TPIZ 1QL9A 1C5NH 2AERH 2O9QA 1TNIA 2F9BH 1TOCB 3ESTA 8LPRA 1AIXH 1FY4A 2ANKH 4DY7B 1TABE 3EQ0H 1CBWC 1T4VH 1KTSB 1YC0A 4H6SB 5FBIA 2DUCA 3B9FH 4KTSA 4ZXXH 2Q6GA 3H7OA 3FP6E 3SU5A 2VWMA 2ZP0H 2STAE 3PV4A 2WV5A 5ESTE 2QN5T 2ZU2A 1EAIA 1QQ4A 2OLGA 2WYGA 2VVCA 2A31A 2XC5A 1LCYA 3U69H 2YNAA 1Z1JA 4BOHA 4GPGA 4MTBA 3SUEA 1KDQA 2HPPH 4HFPB 2KAIA 4IN1A 3ZZ7A 4I33A 2G00A 2OBOA 4YESB 3GCNA 4U2WA 3GICB 1Y3XA 4HTCH 4NWKA 1HAXB 1A2CH 2F9UA 1EJMA 1DXPA 1GVKB 4A1VA 3UQOA 5EXNA 5TCAA 4UFFH 4GHTA 1MTWA 3SU4A 1HJ8A 5GCHG 1BHXF 4ESTE 1C1SA 1LVBA 1K2I1 4NA8A 2Z9JA 2ZHEH 2C3SA 3RXMA 1UJ1A 1A5IA 2BDYA 2G51A 1ELBA 4A6LA 2JETC 2JH5D 2CV3A 4U30A 3LPRA 3BTDE 2NU1E 1FY5A 1T7CA 1QNJA 4WH8A 1AGJA 2AMQA 2CGAA 3MH5A 4AB9A 1XUKA 2ZGJA 1HXFH 1UTNA 2ZPQA 4AB8A 2ZHWH 1W0ZU 1TBRH 1NO9H 1ELEE 1KDQB 1T8MA 1G30B 5GCHF 2KAIB 3LGYA 1ORFA 3MH6A 1SGRE 2V6NA 5A0BA 1G2LA 4X6NA 1BBRK 3MNCA 4UDWH 4K2YA 2QXHA 3TNSA 3O8CA 5AHGH 1BBRE 2PKSC 4ZROA 2ZFTA 2BD7A 2WUBA 3A85A 1UVSH 1N6YA 1V2QT 4OGXA 2PGQB 3SZNA 2QXJA 2P8OC 2Z9LA 3R0FA 1CA8B 3S69A 5JYIA 1NFWA 4Y0ZE 1SPJA 2ZIQH 2ALPA 3V0XA 5A0AE 2CHAC 2BDGA 3MH4A 2OCVB 1O2JA 2XBWA 3GISB 4CHAB 5E0GA 1XXFA 5E2OA 1LQDB 4H4FA 5TJXA 4I8KA 1GMHG 4R0IA 1BT7A 4TPYA 1OP8A 4B73A 1GHWH 1CA0B 2Y5FA 3VFEA 1O3AA 2EI6A 1ZPCA 1GL1A 1BJVA 1UTPA 2OBQA 1GMCG 3W95A 4X1QU 4NIXA 1C4V2 4K5ZA 1U6QA 3VXEH 5LPRA 3UIRA 4BAOB 1GMDG 2ZDKA 4OS2A 3U8RH 2BDIA 1K1LA 1YCPH 1A3EH 3U1IB 1Y5BT 1C5LH 1T8NA 1PPFE 1GMHF 2K1QA 1WTHD 1EJNA 3SNCA 5DK1A 2OC7A 2H9HA 3GOVB 4X2WA 4ZHAA 1UTMA 1FY8E 2P3TB 1LPZB 2P94A 1GMCF 1O2SA 4I7YH 2VWOA 5DP6A 2AMDA 1WOFA 3HGNA 3I77A 4Y6DA 1BTYA 5DP3A 1GMDF 8ESTE 1S83A 4HGCA 4KKDA 1UTJA 1W3CA 3A7TA 1SGPE 2BD9A 2W7UA 2BY6X 2PSXA 1J16A 3RMLH 1NM6A 4WMEA 1F2SE 2FTLE 4ABBA 2B0FA 1AD8H 3I29A 1WYKA 2BY7X 1W14U 2G5NA 1SL3A 2ZU3A 1DSUA 2HNTF 1K21H 4MVNA 5HYOA 3T2NA 4E06H 1YPLH 2SGEE 3L33A 4CBNA 3V12A 2FI5E 1Y5AT 2Z3CA 1QL8A 3QZQA 3VPKA 1V2VT 2ZZUH 2GZ9A 1AI8H 4UFGH 3E6PH 3ZVAA 1BRBE 2C8XB 1IQJA 1SQAA 2C90B 1GCDA 5CE1A 1MAXA 1O3FA 1ACBE 5FPTA 1OPHB 4Y79A 2WPLS 2R0LA 1ZTJA 5HMAA 2M5TA 3WY8A 1S5SA 4JYVH 1SBWA 4X6PA 2BLVA 3K6ZA 1WQVH 2SNWA 1SGFA 3A8AA 4K69A 5EGMA 3A80A 2DE9A 2FDAA 4FUHA 2GVFA 3P8NA 2V0BA 5EXLA 1ELCA 2XWAA 1YF4A 1EUFA 1O3MA 5DPAA 3SJ8A 3RXSA 1DFPA 2H5DA 2FOMB 1T8LA 2OQ5A 1EZSC 2TGAA 1BMAA 3QUMP 4NA7A 4Q7ZA 1F92A 1GPZA 2Y81A 1TQ0B 3AW0A 2QGRA 2BX3A 2F9PA 3KF2A 4TY6A 1GBTA 2W26A 4X1PU 2WPIS 4XBDA 2PHBA 4BTIB 5EG4A 2A0QB 6LPRA 1VJ9U 5DKMA 3EE0B 3TGIE 2J2UA 2GCTB 1TB6H 1GJ8B 1AWFH 1H8IH 2ZF0H 5T6FA 3BG4C 4XBCA 4ISOA 1ELGA 4MPXA 1P2IA 1NFYA 1GGDB 1N8OB 4ISLA 1KXFA 2ZI2H 1OWIA 2BQWB 3KQBA 3MU4A 1PPBH 2F9NA 3SV2H 1ZR0A 3ZZ5A 2G4TA 3S9AA 1NN6A 1P02A 3AAUA 3TVJB 1OWKA 3RXPA 3LJJA 2AGGX 5I25A 3E1XB 3DT0H 4Y0YE 5EPNA 1LVYA 4CREA 1GBJA 1GI5A 1ZTKA 2XC0A 1DUEA 5FX6A 2UWPA 1O5AB 2GMTC 2A5KA 2G4UA 1AWHB 1MTUA 5F6MA 1DWEH 1JWTA 3LU9B 7GCHG 5IDKA 1F5KU 1YKTA 3T27A 3EAJA 5ETXA 3C27B 1SC8U 1DDJA 1Y59T 1T4UH 2Y82A 1K1NA 2BLQA 3MFJA 3P92A 3O8RA 1WQSA 1UCYK 1HXEH 1V2NT 5BRRE 1O30A 2PV9B 1ANCA 1UCYE 2HLCA 4ABGA 1VCQA 1UVTH 2Q6DA 1TPPA 1BMMH 3F1SB 3U8TH 1O36A 1CT2E 2ZG0H 1YPKH 1H9LB 1K1JA 3TK6A 7GCHF 1DXWA 4CRCA 2OQUA 1JMOH 2NU4E 3SGAE 3UFAA 1C1WH 3SI3H 5FX5A 2HVXA 2BOKA 3H7TA 1S0RA 1N1LA 1BTZA 2D26C 1FY1A 3BTWE 5GPIB 4ABJA 3M5NA 3P95A 1ESAA 1TAWA 2XNIA 1XXDA 1ESTA 4Y8ZA 1S0QA 3ZZ8A 1NS3A 1CGHA 1HJ9A 4E7NA 3SQEE 1P2OA 4CRGA 1RJXB 2FODA 1ZRKA 4YO9A 3SGBE 4ABDA 1F0RA 1GI4A 3PYHA 2Z9GA 1IQNA 5L2ZH 1O2QA 2ZCHP 2QAAA 1C2JA 1ANBA 2ZTYA 1OYTH 3A8BA 1YBWA 1XUIA 2A5AA 2GX4A 1D6RA 1O5DH 1D6WA 1RIWB 2SGPE 5F8ZA 2FOAA 2ODPA 1OP0A 4UE7H 1PPEE 1P57B 1UO6A 1SFQB 2BD5A 5HM2A 1FN8A 2B9LA 4WVPE 4ZKSU 1PPZA 4I8HA 1GI1A 1PQAA 2C8ZB 1C2LA 1ELTA 1Q2WA 3A86A 3PROA 3DA9B 1P0SH 2F3CE 3TJOA 5DP7A 7KMEH 3NPSA 2HRVA 4YT7H 1O5FH 1ELVA 1V2RT 1OKXA 4UFDH 3CS0A 1GJBB 2VVVA 1YPMH 1SGCA 3SHAH 1C1TA 3URDA 3VB7A 1TNHA 3MU5A 3BV9B 2BXUH 2FX6A 1SMFE 4O3TA 5H4IB 1TMBH 3TGJE 1EP6A 5HXFA 1Q3XA 1A1RA 2FI3E 4MDSA 4AFQA 4YLUA 3TJUA 1YM0A 3ZZ6A 1BITA 1H4WA 2V3HH 1A0LA 2WPHS 1HAPH 2FO9A 1F0SA 2A4QA 1KLJH 2R3YA 4UONA 1LQEA 2FESH 4XE4A 2FLRH 4DVAU 3M61U 4CH8B 1BTWA 3V13A 2LPRA 1OWDA 1TFXA 2WV4A 3MNSA 3OX7U 4FVDA 2EI7A 4K8YA 3RLWH 9LPRA 1MKWH 1BB0B 3T28A 1LPGB 1ZGIA 2ZNKH 3EA9A 4AORA 4TYDA 4WXIA 4B2BA 4YOJA 2XBYA 1Y8TA 2ZPSA 4BAQB 2BM2A 1W11U 1RGQA 2UWLA 1GBIA 2ZTZA 4OS1A 2P3FH 4A7IB 1V2KT 5ABWA 4Y76A 1EX3A 1O3OA 1PJPA 1P01A 3ODFA 1K1IA 4TWYA 1FUJA 3UR6A 1AMHA 1D3DB 4IBLH 1AUJA 2ZEBA 1EPTA 1G37A 2PKAA 1TX6A 1A3BH 1VCWA 1TNGA 4WH6A 3RXKA 3ZV9A 3BTTE 1HIAA 5G4BA 3PO1B 2AGEX 3VGCB 1O3LA 1VGCB 3QTVH 4Y7AA 2FOFA 1O35A 2GKVE 2QY0B 1VJAU 3P70B 1EXFA 3LDXH 3SV7A 1EOLA 3NZIA 1GJAB 5E8EH 1MQ6A 1EZXC 4FVBA 4IS5A 2VGCC 4H6TA 2ZO3H 2Y7ZA 4LK4A 4I8JA 4JZFH 5T3HA 2FIRH 1SOZA 1O38A 1ZMLA 3U9AH 1C2HA 3LH3A 1H9HE 4ISHH 4ZHMU 3BTEE 2Y7XA 3GY2A 1ZSKA 4ZH8A 1GJ9B 3A82A 4AZ2B 5SGAE 3ZZAA 1BTPA 3DFLA 1C5YB 3ATIA 1GHZA 3RXBA 1E35B 4Q2KA 3TGKE 1P8VC 3E8LA 3FAOA 2AIQA 3ITIA 2VIQA 1EPTB 1ZGVA 2OC8A 2PKAB 1O2WA 1K1OA 2PR3A 4FXGH 2ESTE 2ZDVH 4FU7A 1C5PA 3ZVBA 1XUGA 1HIAB 3P17H 1O3BA 3LKWA 1Q31A 1TA2A 4FUGA 2HNTC 1BTHH 1TONA 6CHAB 1TMTH 3LGWA 4ZHLU 1C2GA 4KP0A 4YOIA 1L4DA 2ZA5A 1O3EA 1ARBA 3MMGA 1D3PB 1EZUC 1O3HA 1MZDA 2QA9E 3UWIA 2BY9X 1AU8A 2NWNA 4FUIA 5LGOA 4AX9H 2R2WU 1TALA 2H2ZA 4K8BA 3EA8A 2OTVA 1S82A 1E36B 1GI9B 8GCHG 2PUQH 5AFYH 2Z9KA 1CGJE 1DT2A 1HYLA 2TRMA 2VVUA 2C8YB 3TLOA 1TGSZ 3PM3A 1O2UA 3SNEA 2BD2A 4JYUH 3SUFA 3BTME 1TE0A 3PMBB 4FUDA 1B7XB 1C2EA 2RCEA 1FN6A 1ZHPA 2NU0E 3B23B 4Y8XA 2Z6BD 1A4WH 1EB2A 1TPAE 4X1RU 4AN7A 3UOPA 5A8YA 4B1TA 3RXDA 3PMAB 1HRTH 5DGJA 1XUHA 4OS4A 3A88A 8GCHF 1V6DA 4BAKB 3P8GA 5L6NH 1FAKH 4I32A 5T6DA 3ZVDA 3SNAA 4K1EA 1C4U2 2A4GA 1QRXA 7ESTE 1GBAA 3VB6A 4A1XA 1AKSA 3PMHB 3MWIU 4GHQA 4JK6A 2PGBB 2A7CA 3S9BA 5EPYA 2FYQA 1SSXA 1HJAC 1RRKA 5DP8A 4INLA 3AW1A 1ZSJA 2F91A 1C5RA 3A8CA 3BG8A 2VWNA 1GBEA 1HFDA 2BD3A 3FVFB 1Z8IB 5F03A 5CHAB 4GAWA 1EATA 5JBCS 4Z6AH 1Z1IA 4VGCC 2ILNA 1ZSLA 1TRMA 3RU4T 2OC0A 1O2LA 1TOMH 2V3OH 5EXMA 1TGBA 2ASUB 1IQGA 4O97A 2VIPA 1SQTA 1ARCA 2QXGA 3BTKE 1JRTA 3DFJA