1SGNE

Asn 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
185
structure length
185
Chain Sequence
ISGGDAIYSSTGRCSLGFNVRSGSTYYFLTAGHCTDGATTWWANSARTTVLGTTSGSSFPNNDYGIVRYTNTTIPKDGTVGGQDITSAANATVGMAVTRRGSTTGTHSGSVTALNATVNYGGGDVVYGMIRTNVCAEPGDSGGPLYSGTRAIGLTSGGSGNCSSGGTTFFQPVTEALSAYGVSVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recruitment of a Buried K+ Ion to Stabilize the Negative Charge of Ionized P1 in the Hydrophobic Pocket: Crystal Structures of Glu18, Gln18, Asp18 and Asn18 Variants of Turkey Ovomucoid Inhibitor Third Domain Complexed with Streptomyces griseus Protease B at Various pHs
rcsb
source organism Meleagris gallopavo
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Streptogrisin B
total genus 48
structure length 185
sequence length 185
ec nomenclature ec 3.4.21.81: Streptogrisin B.
pdb deposition date 1999-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sgnE02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sgnE01
3TH4H 1P09A 1ZGIA 4YLQH 3LC3A 3NZIA 3S69A 1ELGA 1S6FA 1BUIA 1QL7A 3EA9A 4UE7H 2ZP0H 1V2RT 3HPTB 5EXNA 1A46H 4DIHH 1O35A 1SGQE 4TPYA 1J14A 2P8OC 5EQRA 1EJAA 1G2LA 4U30A 5FBIA 1N8OB 1KXAA 1OPHB 2XNIA 2DE8A 1YCPH 1DX5M 1BCUH 3C27B 3VB3A 1UTQA 3SJKA 1LVOA 1C1PA 2YNBA 1MTSA 1QB1A 1SI5H 2QXGA 4WH6A 3ZYDA 2FM2A 3TNTA 4AORA 1IQIA 5A8YA 2GZ8A 3LH1A 4J1YA 1DWEH 5DP4A 4A92A 2Z3EA 5A2MH 1ZHRA 5EW2H 4K8YA 1HIAB 1Z8GA 4LZ1H 3QZRA 1ACBE 5HM9A 1BTPA 3SO3A 2HGTH 2P95A 4JYUH 4WY3A 3KGPA 3K9XB 2ZEBA 2BXTH 3E91A 1HAXB 2AMQA 1WCZA 2ZKSA 1C2DA 3PLPA 3P70B 2O8WA 4MTBA 2P59A 1YCPM 2ANMH 1QNJA 3BEUA 1GCTC 1Q2WA 2GDDA 2XBXA 1YLDA 3A7ZA 3AW1A 4ZH8A 3L33A 1C1OA 1P11E 4I8LA 2BVXH 1EB2A 5EW1H 1TGTA 1P2KA 1OP2A 1SOTA 4MVNA 1OYTH 5GDSH 2Z9GA 3TITA 1WAYB 5DPAA 1H9IE 1OP8A 4I33A 3ATKA 1TRYA 2BQ7B 4ABGA 3QUMP 1GPZA 1C2HA 4A6LA 1EQ9A 1HAHH 1GHXH 1NFYA 4GPGA 2J38A 1SB1H 4X6PA 5A0CA 4DT7B 4AX9H 4DVAU 1AKSA 3RXMA 1S6HA 4YESB 3RXUA 1C1NA 4AFQA 4ZKOU 4FU9A 3MTYA 2ZPRA 2ZECA 1RD3B 1SVPA 2SGQE 3SJIA 3SV6A 5E2OA 1KXDA 3E16B 3KIDU 5TCCA 5FAHA 1TYNA 1CVWH 3MNCA 2FP7B 1L1NA 3MHWU 4CRFA 6ESTA 2G8TA 2R2MB 3M36A 1B5GH 1DUAA 4LXBH 1HAGE 2Y5FA 3T29A 1HAOH 3M7TA 3FP6E 1LMWB 5DKMA 2ZGJA 3GCHB 3FFGA 3Q3YA 4KTCA 4THNH 3CS7A 4I32A 1UVSH 2VIDA 1DT2A 2Z3DA 7LPRA 3LJOA 1ETRH 3BF6H 4NIWA 3SV7A 1EATA 5HMAA 3TVJB 3V12A 2GCHG 4K1SA 4NFEA 3QO6A 5T6FA 3LDXH 1UHBA 4Q80A 4CR9A 1F5LA 1GG6B 1W8BH 4MPXA 1GHAG 1EAWA 1BBRK 1HV7A 3QN7A 3MO9A 2XRCA 2Z9LA 1J17T 3TU7H 1UTJA 3GY4A 3PO1B 5DGJA 2VIPA 1HJAC 1DDJA 2J94A 1MBMA 2ZC9H 2ZFRH 3UTUH 3ZZ4A 2ZA5A 1CT4E 1CA0C 3T25A 1JIRA 2RA0A 4X1QU 3KQCA 2FI4E 4DGJA 2VGCB 1SQOA 4AB8A 1FQ3A 1MD7A 1YPEH 3KL6A 2HRVA 3RU4E 1UVPA 2VIVA 1ZTKA 1H9HE 3VXEH 2FYRA 4X1RU 1QFKH 4HTCH 4ESTE 4NSVA 3KN2A 1LHCH 3M5NA 1IQHA 4XOJA 1LVMA 4BAMB 4YT6H 4BANB 1O34A 3I29A 4Y76A 4O9VA 1JBUH 2NWNA 2HLCA 2FYQA 1TPPA 1HUTH 2PFEA 2PKAA 5HXFA 4Z0KA 2A7JA 2C8XB 1ZSKA 4GUXA 2GZ9A 1DE7H 2NU1E 4FXGH 3GOVB 1INCA 4YOJA 4ISOA 3M7QA 2UWPA 4YOGA 1BHXF 3RXOA 4Y79A 3VB7A 1NM6A 2PTCE 2BZAA 2C8ZB 1DWCH 4BNRA 1ESBA 5JBCS 2A4GA 2Z9IA 5JDUB 1FI8A 1AB9C 1T4UH 1W14U 2A0QB 1V2ST 1XKAC 2Y7ZA 3BTME 4I8HA 5HGGA 5LPRA 3GICB 2G4TA 1CT0E 3O8DA 1QIXB 2D1JA 2ZQ2A 3TK6A 3F1SB 2VWNA 2LNCA 1F0RA 1V2UT 1N6XA 2SNWA 2WPLS 5DP6A 3GCOA 3EGKH 1BMAA 1E36B 2FTMA 1BJUA 1S0QA 3L3TA 1GJ7B 2LPRA 1KYNA 1C1VH 1WU1A 2XW9A 2WYJA 3MWIU 5L2ZH 2VNTA 1MU6B 1HNEE 3RXGA 4U2WA 1OWHA 1YPHE 3NPSA 1E35B 4JMYA 2FMJA 3SGBE 3UUZA 1QJ1B 1AY6H 2VWLA 3LKWA 4OGXA 1P2OA 3DHKH 3RC6A 1BTZA 1NU7B 1GJ8B 2PKAB 4MPVA 4Z6AH 1SGFA 1UVUH 3E0PB 1QJ7B 4XBBA 3SNEA 1HPGA 4YM9A 1MCTA 3SNCA 1KIGH 2IPHA 5FPYA 2D26C 4JZFH 3SUGA 1S84A 1AVGH 1WYKA 2WV5A 1O3JA 1ELEE 1VCPA 2M5TA 3EQ0H 4D9RA 1OX1A 1C2GA 1YC0A 2OLGA 4MPUA 1MUEB 1O3KA 1YP9A 1GJ9B 2ZG0H 2QA9E 1NROH 1P05A 3ZZDA 2ZFSA 4JCNA 2F9NA 2HNTC 1ZR0A 3F9EA 1IQJA 1EAUA 4ABJA 2ZFQH 3H5CB 1C2KA 2NU4E 2O8TA 1GI9B 4WH8A 2ZNKH 1DFPA 1XUGA 1O36A 4ABIA 1SMFE 1TPSA 3SOSA 4OS2A 2XC5A 2Q6DA 3A86A 1O2XA 2PUQH 3HKIB 1PFXC 1PQ5A 1NS3A 2FWWA 3RMMH 3K2UA 4NIXA 3A8BA 5ESTE 3BSQA 4A1TA 5GCHG 3GDVA 2ZFTA 2H2ZA 2ZCKP 1EPTA 2GVFA 2R0LA 1ZJKA 1OXGA 5EXMA 1ETTH 2ZI2H 1DS2E 1CQQA 1RIWC 3GY5A 3SV2H 1TWXB 1GI2A 5K0HA 1TGSZ 2UWLA 1LHDH 1EKBB 1BB0B 5EXLA 2V3OH 3NKKA 1QR3E 1DXPA 1GHVH 2QC2A 3R0FA 2JH0D 2A32A 5G4BA 4X8UH 3A7WA 1O32A 2NU2E 3U1JB 5E0HA 2C93B 1DANH 2CXVA 1AFEH 1CHOF 1K1JA 1JRTA 3RXSA 5GIBA 4QT8C 1F7ZA 1QTFA 1BJVA 1GBEA 3TH3H 7GCHG 1UMAH 1C5TA 3AAVA 3BG4C 3DUXH 1IQKA 1GJ4H 4F4OC 4RSPA 3S0NA 2ZDAH 1GJDB 2VGCC 1AD8H 4FUIA 3SW2B 2JETB 2BLOA 2OXSA 3FP7E 4MLFB 1EPTC 5DP9A 5ETXA 2QY0B 3TNSA 1P9SA 1FAKH 3ENSB 3PO1C 4Y0ZE 4Y71A 2V3HH 4NFFA 3VB5A 2BDCA 4U01A 3GY2A 3RXFA 3EA7A 1QRWA 3LGVA 1UO6A 4X1SU 1O5DH 1F0TA 2PKSB 3CS0A 1O3MA 2BDIA 1NFWA 3BTEE 4Y6DA 1GL0E 3BTFE 2TGAA 1TNIA 1V3XA 2I6QA 2GMTB 3RXEA 2FS9A 2BB4A 4X8VH 3O8CA 3ELAH 4FUBA 1ESAA 4Y10E 1TGCA 3UNRA 2FZZA 2BOKA 3KHVA 5FPSA 1G2MA 1O2GH 3A80A 2GDEH 2ZFPH 3Q00A 2W7SA 1CBWC 2ZHQH 3PV4A 4Q7YA 2AIQA 3RXHA 2ZU2A 5JB8S 1MTNC 1UTOA 3P6ZB 2CF9H 4O3UA 1O3CA 3GY3A 2SNVA 4JK6A 2AH4X 1UTPA 3MNBA 1LO6A 2GT7A 2QIQA 1C5UA 3ATIA 1J15A 3ZZ3A 3NXPA 1QGFA 5DP8A 1F0SA 1K1LA 3DD2H 1EX3A 3OU0A 5AHGH 2GZ7A 2XTTB 1RJXB 2G52A 2G00A 1YBWA 4TYDA 2BM2A 4M7GA 4ZAEA 1KTSB 1GWAA 2QYIA 1UTMA 3URDA 1SFIA 5C67A 1TALA 4Q7ZA 4UFDH 3OX7U 3KQBA 2QV1A 3GYLB 4SGBE 1GMHG 3UNQA 2D2DA 2FOBA 2VVVA 1H9LB 3TGJE 4KTUA 4ISLA 5F6MA 2QCYA 4MPWA 1AZ8A 1K21H 4ASHA 8GCHF 2XBYA 1KDQA 1P3EA 4JZ1A 1WQSA 3SJOA 4WJG2 3P8NA 3BEIB 3SNDA 1GJAB 2QXHA 2VH6A 4OS6A 1G3BA 5FX6A 1UTLM 5H4IB 1XUIA 1AGJA 1NZQH 1TPOA 1C5LH 3UPEA 3EDXB 2HNTE 1Y3UA 2CF8H 3LPRA 3QX5H 1BT7A 3LGUA 1FPCH 1LQDB 2A1DB 1ZTLA 5EPNA 1IQGA 1QB9A 1O2IA 5EPYA 4AYYB 2CJIA 1IOEA 1ORFA 1SGPE 1FIWA 3MH5A 3M35A 2BZ6H 1MKXK 5CHAB 4BOHA 1X7AC 3CENA 1O2OA 3VXFH 5EODA 2SGFE 1D9IA 1MTVA 3V3MA 1P01A 1LVBA 1BITA 2HVXA 1L0ZA 4OS1A 1GVKB 3ZVCA 5A8XA 1JOUB 3ITIA 1PPFE 2GX4A 4UFGH 3V13A 1QA7A 2GTBA 2VWOA 4IGDA 1BTUA 1TFXA 3T62A 1PQAA 3RU4T 2ANWA 1BBRH 1O2LA 1P2IA 4A7IB 3HK3B 2BD3A 1V2WT 2FEQH 1GBMA 1C1TA 4BXWA 1GJ5H 4ABHA 3UREA 4K8BA 1MKXH 2BXUH 2G81E 3RM2H 5FCKA 4NCYA 1O2WA 1ABJH 4UONA 1C1UH 3ZZ7A 1DUEA 1Q31A 3O8BA 1O3LA 2ZPSA 1T8LA 2OP9A 1C1QA 1GHBF 1GGDC 1F92A 4BXSA 1O2RA 1CGIE 4ABEA 1O2ZA 3RM0H 1T31A 4X6NA 5EU8A 1ZRKA 1BRAA 5JBAS 2BD4A 1YPKH 3ZVFA 4O03A 4H4FA 3KNXA 2H5CA 2TGTA 1GI0A 1UJ1A 1Z8IB 2VWMA 1B7XB 1EJMA 3FVFB 1HAVA 5EG4A 5AFYH 2C8YB 2GCTB 1AVWA 3SUEA 1O5EH 5L2YH 5E2PA 4Y0YE 5CHAC 1O3NA 3FZDA 4NA8A 1WTGH 4OGYA 3AVZA 2A5KA 2P94A 1EUFA 1PPHE 1ZGVA 1FY1A 3SUDA 4CRDA 2EEKA 1AE5A 2HPPH 2R0KA 3K65B 2ULLA 2FIRH 1GHAF 2F91A 2EI6A 1DOJA 3BN9A 3F6UH 3BIUH 2EI7A 1LPGB 1OP0A 8ESTE 4D7FA 1S83A 3SU3A 1P2JA 2ZF0H 1O3OA 1NY22 1V2TT 3PTNA 2BD9A 1AIXH 3LGIA 4BTTB 1ZHPA 1DLKB 1O39A 4GAWA 4XFQA 5ABWA 3RXQA 5FCRA 2BX3A 1GG6C 3RC5A 2A4QA 2C4FH 5AF9H 2NU0E 1WBGB 3F9FA 5CMXH 2G4UA 5K7RA 5C5NA 1O2NA 2QXIA 1G3EA 4YO9A 1NTPA 3L6PA 1P10A 1GDNA 2ZQ1A 1K22H 2ZTXA 1GMDG 1FY8E 5GJ4B 3PWBA 3STJA 5J4SA 4CH8B 4IW4E 2XC4A 2ZZUH 4KP0A 4AGKA 2GKVE 5I25A 1Z71A 2A5AA 2BVRH 3PMJA 2SGDE 1EZUC 3BTQE 2PGQB 1C2IA 4FUGA 1YF4A 1SGNE 5HM2A 3LU9B 3SHAH 2FO9A 4RKJB 4CRGA 1O2JA 1QBNA 1F5RA 2F9BH 4I7YH 2FDAA 3PMAB 3ZVBA 4B2BA 1A5HA 3EAJA 3D62A 2VINA 4YT7H 1P02A 1ZJDA 1O3AA 1C5XB 4K3JA 4B1TA 1NRQH 3SUFA 1GBLA 2HWLB 1TGNA 4ZHAA 4KELA 2AFQB 1A0JA 5T6DA 1EOJA 3A7TA 1MU8B 1C2MA 1PPZA 4GLYA 1EP6A 1SLXB 1TIOA 3P92A 3LGTA 1BMLA 1LDTT 4XDEA 1P06A 4NA7A 2PKSC 2QAAA 4U32A 3RXIA 2GV6A 3ZZ6A 1QBOA 2BHGA 3EYDA 2VVUA 2P3UB 1QURH 1EP5A 3UR9A 1MAYA 3NCLA 1Y3YA 2F3CE 2PW8H 3M7UA 2IN2A 2A7CA 1A2CH 2AEIH 3QK1A 4YOIA 2Q6GA 2JETC 1G9IE 1C1MA 1O2YA 2EA3A 3IITA 1CE5A 4UEHH 2O8UA 4Q2KA 1G3CA 1GI7B 4IBLH 2G5VA 3OY5U 6GCHF 1HDTH 2A2QH 3RXRA 2ILNA 1PQ8A 4I8KA 5FXLA 5AFZH 4NG9H 2C3SA 1GHYH 1IQMA 1O3FA 3U1IB 1KSNA 1XUKA 1SHYA 1MAXA 2Y6TA 3A85A 1S0RA 3PMBB 2AGIX 3MH6A 3F68H 1XXFA 4J2YB 4A5TS 1P2MA 2P8OB 2STAE 2WINI 1KTTB 3PLKA 1WOFA 3BEFB 1TNGA 1MD8A 2K1QA 2O8MA 1YPJH 1AI8H 4WXVA 3BTDE 3SJ9A 3FP8E 5L6NH 4OS7A 2FODA 2UWOA 3SHCH 4HFPB 2Y82A 3RLWH 2THFB 1O5GH 1Z6EA 3MFJA 5C1UA 4ISNA 3GISB 2J4IA 1GDUA 2OC7A 2D8WA 1TA2A 1WUNH 1FLEE 1AHTH 1TNHA 2BQ6B 1JIMA 2XCNA 2F83A 1MTWA 2ANYA 1AZZA 2IOTA 1BDAA 1F5KU 2TIOA 2BD5A 2A7HA 4VGCB 1Q3XA 3SNAA 1TQ7B 2ZHFH 3UQVA 3ATMA 3D23A 3RXCA 4ZROA 1FY4A 3H7OA 1UTKA 2BD7A 2ZIQH 2FOGA 5DP7A 1SQAA 3SGAE 3OYPA 2FOAA 1O3IA 1ZMJA 2QF0A 5B6OA 1THSH 1PPGE 2TGPZ 1FNIA 4NWLA 5BRRE 1U6QA 3SBKA 3S7HB 1UCYE 1NFXA 5F03A 1O37A 1OYQA 1XUFA 1VITH 3URCA 1P8VC 3VPKA 1HAVB 4Y8ZA 4CRBA 3PM3A 1NRNH 3A84A 2C8WB 3QWCH 2ZDKA 1W2KH 1DLEA 3B23B 4BAQB 2WPIS 3W94A 4WVPE 2QGRA 4Y8YA 1EZSC 1TOMH 1BTHH 1RTKA 1BBRE 1Z7KA 4NZQA 2ESTE 1JMOH 1UVTH 1K1NA 2J9NA 4ISHH 1NPMA 1QRZA 1C1SA 2ZDVH 1Y3VA 2UUFB 4SGAE 1BRCE 1UK3A 1OS8A 3ZZAA 2OBQA 1KLTA 1XX9A 3ZZ8A 2OQUA 2ZPQA 5GCHF 2HOBA 1TMBH 4LOYH 1G32B 4I8GA 2H9TH 4H6TA 1ANBA 3RMNH 1YKTA 1C5YB 1GDQA 1P2NA 2H9HA 1BMNH 1F0UA 4DIIH 1AWFH 1BZXE 1VCWA 3PLBA 4IMQA 4BTUB 4X8SH 2PTNA 1HJ9A 3ODFA 3M61U 2XXLA 1RTFB 4NIYA 1BQYA 2UUJB 1GMHF 2ZFFH 3LJJA 1GBAA 2SFAA 3QGJA 1W13U 4Y7AA 1RTLA 2SGPE 1JRSA 3UQOA 2BLQA 1EAIA 3UOUA 1D3TB 2ZGBH 3A87A 3NK8A 3Q77A 1C4Y2 2QN5T 3RXVA 3I77A 1UK2A 5DP5A 3P8GA 1KXFA 3BIVH 1THRH 3BTKE 3MU0A 4X0WU 3E1XB 1GMDF 2CV3A 3MYWA 4E7RG 5FHTA 3ZZCA 1T4VH 3VGCC 1UTNA 2VIOA 2O8LA 2VIWA 3SI4H 5C1XA 2OBOA 1ZYOA 1MQ5A 4NSYA 1TPAE 2FI5E 3LONA 4X2XA 1EB1H 4XBDA 1FPHH 4NGAH 1C2EA 1ESTA 1GHZA 3QZQA 5DO4H 5EGMA 2WYGA 1XKBC 1TX7A 1CT2E 1RS0A 2W3KA 1OWJA 1L4DA 3A8AA 3TJVA 1QBVH 4WMDA 5A8ZA 2FTLE 2BDGA 3S9AA 5C5OA 1YPLH 2RG3A 4TPIZ 5JBTA 2XBWA 4ABAA 2STBE 3HKJB 4IN1A 1GVLA 4DOQA 1TAWA 2GCTC 1EOLA 4ZMAH 4DJZB 4AGJA 3LIWA 1C5RA 3LOXA 4WXIA 5A0BA 1MZDA 4HZHA 1CSOE 3P8FA 1C5NH 1BHXB 1C9TA 3ATLA 4DCDA 1GGDB 1DY9A 1IHSH 2V35A 2FX6A 2W7UA 1O3EA 1LQEA 4ISIH 1AUJA 1OSSA 4CBNA 3UWJH 1KXEA 5LPFA 1GBKA 4B73A 1AB9B 2XCFA 3RXTA 3S9CA 1K9OE 2ZDLA 3AASA 1ETSH 1BRUP 2JH6D 4X2VA 3T28A 3E6PH 4K1TA 3KQEA 1ZSLA 3PYHA 1AE8H 1SLVB 2BQWB 3ODDA 1D3PB 2FS8A 1C5ZB 2P16A 3RXBA 2ZTZA 2VVCA 5GPIB 2BY9X 1J16A 1ABIH 2J95A 6LPRA 4DY7B 3BTWE 1CGJE 1PYTD 1C5WB 4H42U 4KGAA 1CA8B 2C90B 3BG8A 2PWXA 3MNXA 1P3CA 1W7GH 1Y5UT 2PSXA 2XWBI 1DSUA 1ELFA 4D7GA 3B9FH 3UWIA 1J9CH 2ZU3A 1O2MA 3ZZ9A 1NFUA 1O3BA 1DXWA 1TBRH 2B9LA 5F8XA 3B8JA 1W0YH 1QJ6B 4RN6A 2A5IA 3ATWA 4BTIB 1PQ7A 3LC5A 1YGCH 2ZHEH 3DA9B 1GHBG 3T2NA 3MO3A 3VFEA 3PTBA 3NUMA 3SORA 4ABBA 1MKWK 1A61H 1YPMH 3QLPH 5IDKA 1HJAB 1E37B 5T6GA 1HCGA 3ZV8A 1MQ6A 1GHWH 3A8DA 2ZWLH 3G01A 2GGVB 2F9PA 2PV9B 3H7TA 5F8ZA 3UY9A 3RMOH 1GJ6A 5DJ7A 4HI3A 5EOKA 3UR6A 7KMEH 1C2FA 1V2QT 3ZV9A 1V2VT 2H1UA 1C5MD 3DFJA 4F49A 2W3IA 1TNJA 4CHAB 2PUXB 3O8RA 1UCYH 2KAIB 2RCEA 1FIZA 2JKHA 1N8OC 1HAZB 2BY7X 2VB0A 3TK9A 3GDUA 3T27A 5JYIA 2R2WU 1C5SA 1W10U 1SC8U 3ESTA 3D65E 4X2YA 1RXPA 2WPJS 2OQ5A 1MTUA 3F9GA 5DP3A 3RXKA 9ESTA 1O38A 4X1PU 3GY8A 3GYMA 5C1YA 4MQAA 1DITH 2PLXA 1YYY1 2FI3E 1EASA 1HIAA 3AW0A 4ZHLU 2F9VA 1B0FA 3M3VA 3ZZ5A 1AVXA 2FOMB 4CRAA 1PYTC 2BY8X 1GI3A 4GCHF 1VITF 1V2NT 2R3UA 1BOQA 2GT8A 5I46H 4K1EA 1SGCA 4IS5A 2XWAA 3QTOH 1FY5A 1UCYK 2OC8A 2PGBB 2Z9JA 1Z8JB 2BLVA 4WWYA 1O2VA 3ZZBA 1QA0A 1LHEH 3RXAA 1BTXA 3GDSA 1O2TA 2FOEA 1AQ7A 1C5OH 2Z9KA 3IWMA 3RLYH 1P0SH 4DURA 1GJBB 2CGAA 2WV4A 2FOHA 2ZU4A 2HALA 1EXFA 2KAIA 1C2LA 4JK5A 1MBQA 1T8MA 3LGWA 1RGQA 1BIOA 1C5PA 1CHOG 1MMJN 1MH0A 2J2UA 9LPRA 2AERH 2F9OA 1C4U2 1SG8B 4X8TH 1G37A 4H6SB 1GI8B 4IMZA 3MU8A 3ZVGA 8LPRA 3BG4B 1G36A 1LTOA 3MU4A 3SN8A 2GP9B 5A0AE 2VJ1A 2YOLA 3HGPA 3E3TA 3GCTF 1LVYA 2H9EH 1O2HA 4UDWH 2ZHDA 4OS4A 4MDSA 4AB9A 4D9QA 4D76A 2OC1A 2A31A 1HFDA 2TGDA 4INLA 3RC4A 1TRNA 1GBCA 2BMGB 2FLBH 1TNLA 2ZU1A 1FUJA 3PWCA 1O5AB 4BAHB 1N1LA 2GD4B 4UFFH 4E06H 5DK1A 3T5FH 2V0BA 1P57B 2G51A 4JZDH 2PSYA 1RIWB 1Z6JH 1GJCB 4GHQA 1WSSH 2BY6X 1TQ0B 1PJPA 4XBCA 1T7CA 2I6SA 1DM4B 1ZPBA 4CH2B 3A7YA 2BDBA 1O2UA 1TONA 1YPGH 4K69A 2ASUB 1T8OA 2B0FA 1T8NA 1TGBA 1O31A 1ANCA 2ZGXH 1GVZA 1LKBA 1WV7H 4B71A 5EQQA 1CHGA 3VB4A 4AZ2B 3SI3H 1ANDA 4K60A 2ZGHA 1KXCA 3TJUA 1NU9A 2BD8A 1TRMA 3F9HA 2SGAA 5J4QA 2FOFA 3JZ2B 4ZKRU 1QB6A 1PPEE 3BTGE 3KF2A 4WMEA 5LH8A 1OOKB 1SR5C 1P03A 1ZHMA 1ZOMA 2Y5GA 2W26A 4K5ZA 1QCPA 1ARBA 1XXDA 1FMGA 2YNAA 3W95A 4B76A 4DW2U 4KKDA 2DE9A 6GCHG 3SV8A 1IQFA 4YTAA 5E0JA 1FN8A 1ELCA 3ZYEA 1FV9A 3MMGA 2A4RA 4E7NA 1ZTJA 2AMDA 4YZUA 3UNSA 4IN2A 1GBTA 3OTJE 4AFUA 4CRCA 2QF3A 1TA6A 1LPKB 1ANEA 1H8IH 4Y11E 1D6RA 1QQUA 1SPJA 1EZQA 1SGEE 4UFEH 3HGNA 2Y5HA 2BTCE 3K6YA 3PROA 1FDPA 1O2KA 2P3FH 3E90B 3FAOA 1H1BA 3TGKE 4Y7BA 4X2WA 1ELAA 1Z1JA 2WUBA 4ABFA 5A09A 4R0IA 3A89A 1JWTA 5C20A 1L1JA 4O97A 1DWBH 3QGNB 4CREA 1ZLRA 2B8OH 2ZGCA 4GVUA 4FUEA 1K1PA 1W7XH 3ZVEA 1QHRB 2OD3B 1HAIH 1SLWB 2ZDMA 3MNSA 3I78A 1NRPH 1GBHA 2EI8A 3U8RH 1HLTH 4BAOB 1LHGH 1SBWA 1D6WA 3OSYA 4IC5A 4K2YA 5BPEA 2VIQA 2BDYA 4JYVH 2Q6FA 3A88A 2HNTF 3PMHB 4TY7A 3DT0H 3N7OA 3U8OH 1HGTH 4R8TB 5JPMH 1S85A 2CMYA 1H8DH 1MCVA 2OC0A 4B74A 1G3DA 1TX8A 2NU3E 1A4WH 1MKWH 1MZAA 4ABDA 5GXPA 4LK4A 1AFQC 1QL8A 2ZHWH 7ESTE 1IQLA 1D3QB 2ANKH 3FANA 1W11U 3MH4A 4INHA 4OS5A 4X1NU 1A3EH 3P8OA 1ID5H 1C2JA 3U69H 3RXLA 2CHAB 8GCHG 2OTVA 2DUCA 3RU4D 1KLJH 1W12U 1DY8A 2OUAA 3A81A 3R3GB 1CGHA 2A45B 2RDLA 4TWYA 1TX6A 1VJ9U 6CHAB 1DSTA 4FU8A 1W3CA 4HGCA 1K2I1 1TMTH 3E8LA 2P93A 4ZHMU 1PPCE 3A83A 3RP2A 1H4WA 1CA0B 1O2SA 1TBQH 1SFQB 1FXYA 3GY6A 4AG2A 2HPQH 1XMNB 4WF8A 3SNBA 3V0XA 1SGTA 1E38B 5SGAE 1PPBH 3NWUA 4I8JA 1L4ZA 3DFLA 1O3PB 4Y8XA 1HRTH 4E05H 3TJNA 3EE0B 2WPHS 1GL1A 1NRSH 1EPTB 1ELTA 1LKAA 3AAUA 4ZKNU 3SU2A 2GCHF 3RXPA 1ELBA 2AMPA 5AVDA 1BA8B 3RXDA 1D3DB 3S9BA 1C1RA 3M3SA 3FZZA 2WUCA 4I31A 1V2JT 3M5MA 1BTYA 1A1RA 1J8AA 3M5LA 2AGGX 3HK6B 1XVOA 5C2ZA 1WQVH 1TB6H 1C1WH 4FUDA 2H6MA 4IC6A 5CE1A 2ZCHP 3EA8A 4AFZA 3GCHC 1MTNB 4FVDA 2EC9H 1CBWB 2B5TB 1HB0B 3TLOA 3K6ZA 3M37A 1HXFH 4XE4A 1P2QA 4CR5A 2FPZA 4A1VA 3U9AH 1SQTA 4CHAC 3ZVAA 2GMTC 1AN1E 2B7DH 5L30H 4JYTA 1XUJA 1GMCG 1LCYA 1TMUH 1DVAH 1EZXC 4Q7XA 1IQNA 1QRXA 4FU7A 1SOZA 1A7SA 1NESE 3A7VA 4JZEH 1T32A 3LGYA 1TLDA 4NWKA 1A3BH 3QDZB 2AS9A 2Q1JA 1S5SA 3PB1E 1UK4A 2PR3A 2AYWA 1OWEA 3SU6A 1GI6A 2BDHA 5DG6A 1KLIH 1ZSJA 2VU8E 3RXJA 3UFAA 1UVOA 3RUOA 1GCDA 1N6YA 1O30A 1QY6A 3MO6A 1O5BB 2QXJA 5E0GA 1ZPCA 2ZDNA 4ZUHA 1SGYE 1OWKA 1SGIB 3ZVDA 3BV9B 1C4V2 1P12E 2IJOB 2GV7A 2XYAA 2BX4A 3U8TH 4B2CA 1XVMA 3KQDA 3IG6B 1E0FD 3MU5A 1OKXA 4PROA 2WPMS 4MNVA 4VGCC 4AYVB 3P95A 1XUHA 2OCVB 4LZ4B 2Z7FE 3TJOA 1FY3A 4NZLA 4FUFA 4DG4A 2OINA 1FAXA 1FN6A 1BRBE 2TPIZ 2Y7XA 1YM0A 1GI5A 4GHTA 4AN7A 3SU5A 4FVBA 1ZRBA 3Q3XA 1XM1A 1AUTC 3SQEE 1Y5AT 3KEEA 3P17H 3KCGH 3TH2H 1Y8TA 1C9PA 5FX5A 3SZNA 1O5CB 1FONA 1RFNA 3GCNA 1V2LT 3HATH 4MNXA 1VZQH 3RDZA 1B0EA 1A5IA 1ZZZA 3WY8A 3BTTE 2R3YA 4GSOA 1IHTH 2BDAA 1K1OA 2G55A 1NC6A 3SV9A 1O3GA 3UOPA 2WPKS 1ZMLA 5T3HA 2ALVA 2TBSA 2ZCLP 1HJ8A 1S82A 2XBVA 3VB6A 4YLUA 5FBEA 5LPEA 4D8NA 4AFSA 3LT3A 1TE0A 4ZXXH 3GY7A 3TK5A 4TY6A 1THPB 4XSKU 1Y5BT 1KXBA 1HAPH 1SLUB 3D49H 5IYTA 1K1MA 1KDQB 2ZTYA 4CBOA 4MNWA 1SHHB 3A82A 1HXEH 1D4PB 2BOHB 1NN6A 1SL3A 1C5VA 1V2OT 2Y81A 1VCQA 1SGRE 1BMMH 1V2MT 4BAKB 1O0DH 1VGCC 1TBZH 2BLWA 3SU0A 1Z8RA 5JB9S 1GBFA 1G30B 2ODQA 3U98H 6CHAC 1Y3WA 2F9UA 1EJNA 2UUKB 2FESH 1ARCA 4FUCA 1AU8A 1HBTH 3STIA 2CHAC 5GWZA 1VITG 1ELVA 1CO7E 2Y80A 1NRRH 3SGQE 5EQSA 1BTWA 2Z94A 3Q76A 2BVSH 4NA9H 5LGOA 3VGCB 3VEQB 1AKSB 5E8EH 3SU4A 1FZZA 3OY6U 1IAUA 4UD9H 1AFQB 1AWHB 5PTPA 1SSXA 2R9PA 4JZIA 1CU1A 3A8CA 1KY9A 2ZU5A 1P9UA 1NO9H 2PHBA 1GBJA 3MOCA 1F2SE 3E0NB 1O2QA 2SGEE 2ZO3H 2RA3A 2FOCA 1Z1IA 2BYAX 2J34A 3SQHE 1P04A 1S81A 2Z6BD 1EAXA 8KME2 2A4OA 1HAYB 3UIRA 1IQEA 1Y3XA 1ZMNA 3MI4A 4B75A 4RKOB 5HYOA 1V2PT 2G5NA 4AOQA 4MG3A 1UHBB 3M3TA 1K28D 1L1GA 3TIUA 3TPIZ 3Q3KA 5JBBS 4FUHA 1VR1H 5TCAA 1GMCF 5TJXA 4GCHG 4ZKSU 3LH3A 1L2EA 4FUJA 1GBBA 4AG1A 1JXPA 1OWIA 5F8TA 1LPZB 2UUYA 3A7XA 3C1KA 2CN0H 1E34B 1DPOA 1YLCA 3CP7A 4INKA 1HYLA 1YPHC 4MNYA 2JH5D 3T26A 3SU1A 1A0LA 2FLRH 1GBDA 1TOCB 5C3NA 1SGDE 2VH0A 2TRMA 5FPTA 1K1IA 2H5DA 2V6NA 2ODYB 4B2AA 2Z3CA 1AMHA 1SGFG 5ESBA 1VJAU 2FXRA 1AO5A 1OWDA 4X6OA 2O9QA 2ALPA 1NT1A 2BY5X 2AIPA 3BTHE 1DWDH 3S7KB 2XC0A 2AGEX 7GCHF 3MH7A 1QQ4A 3MU1A 1C5QA 3M5OA 1M9UA 1Y59T 1O3HA 4X6MA 1O5FH 1DICA 1WTHD 1GI4A 1V6DA 1V2KT 3SJ8A 1A5GH 1LHFH 4A1XA 4O3TA 4KTSA 1FJSA 1VGCB 2ODPA 2P3TB 4ZXYH 1ZPZA 3V7TA 2A2XH 3GCTG 1W0ZU 4WMFA 1GCTB 1YCPK 1O2PA 1ELDE 2FX4A 3JZ1B 1A0HB 1O3DA 1GBIA 1O33A 1TABE 1QL9A 1GI1A 2W5EA 3RMLH 4NIVA 2J92A 2BD2A 4TWWA 3TGIE 3QTVH 1TNKA 1RRKA
chains in the Genus database with same CATH superfamily
3TH4H 1P09A 1ZGIA 3KYFA 4YLQH 3LC3A 3NZIA 3S69A 1ELGA 1S6FA 1BUIA 1QL7A 3EA9A 4UE7H 2ZP0H 1V2RT 3HPTB 1BMFD 5EXNA 1A46H 4DIHH 1O35A 1SGQE 4TPYA 1J14A 2P8OC 5EQRA 1EJAA 1G2LA 4U30A 5FBIA 1N8OB 1KXAA 1OPHB 2XNIA 2DE8A 1YCPH 1DX5M 1BCUH 3C27B 3VB3A 1UTQA 3SJKA 1LVOA 1C1PA 2YNBA 1MTSA 1QB1A 1SI5H 2QXGA 4WH6A 3ZYDA 2FM2A 3TNTA 4AORA 1IQIA 5A8YA 2GZ8A 3LH1A 4J1YA 1DWEH 5DP4A 4A92A 2Z3EA 3PV2A 5A2MH 1ZHRA 5EW2H 4K8YA 1HIAB 1Z8GA 4LZ1H 3QZRA 1ACBE 5HM9A 1BTPA 3SO3A 2HGTH 2P95A 4JYUH 4WY3A 3KGPA 3K9XB 5KGOA 2ZEBA 2BXTH 3E91A 1HAXB 2AMQA 4XRNA 3WWFA 1WCZA 2ZKSA 1C2DA 3PLPA 3P70B 2O8WA 4MTBA 2P59A 1YCPM 2ANMH 1QNJA 3BEUA 1GCTC 1Q2WA 2GDDA 2XBXA 1YLDA 3A7ZA 3AW1A 4ZH8A 3L33A 1C1OA 1P11E 4I8LA 2BVXH 1EB2A 5EW1H 1TGTA 1P2KA 1OP2A 1SOTA 4MVNA 1OYTH 5GDSH 2Z9GA 3TITA 1WAYB 5DPAA 1H9IE 1OP8A 4I33A 3ATKA 1TRYA 2BQ7B 4ABGA 3QUMP 1GPZA 1C2HA 4A6LA 1EQ9A 1HAHH 1GHXH 1NFYA 4GPGA 2J38A 1SB1H 4X6PA 5A0CA 4DT7B 4AX9H 4DVAU 1AKSA 3RXMA 1S6HA 4YESB 3RXUA 1C1NA 4AFQA 4ZKOU 4FU9A 3MTYA 1K0HA 2ZPRA 2ZECA 1RD3B 1SVPA 2SGQE 3SJIA 3SV6A 5E2OA 3DSPA 1KXDA 3E16B 3KIDU 5TCCA 5FAHA 3PV5A 1TYNA 1CVWH 3MNCA 2FP7B 1L1NA 3MHWU 4CRFA 6ESTA 2G8TA 2R2MB 3M36A 1B5GH 1DUAA 4LXBH 1HAGE 2Y5FA 3T29A 3NRLA 1HAOH 3M7TA 3FP6E 1LMWB 5DKMA 2ZGJA 3GCHB 3FFGA 3Q3YA 4KTCA 4THNH 3CS7A 4I32A 1UVSH 2VIDA 1DT2A 2Z3DA 7LPRA 3LJOA 1ETRH 3BF6H 4NIWA 3SV7A 1EATA 5HMAA 3TVJB 3V12A 2GCHG 4K1SA 4NFEA 3QO6A 5T6FA 3F3BA 4P00A 3LDXH 1UHBA 4Q80A 4CR9A 1F5LA 1GG6B 1W8BH 4MPXA 1GHAG 1EAWA 1BBRK 1HV7A 3QN7A 3MO9A 2XRCA 2Z9LA 1J17T 3TU7H 1E1RD 3FOAA 1E1QD 1UTJA 3GY4A 3PO1B 5DGJA 2VIPA 1HJAC 1DDJA 2J94A 1MBMA 2ZC9H 2ZFRH 3UTUH 2KCAA 3ZZ4A 2ZA5A 1CT4E 1CA0C 3T25A 1JIRA 2RA0A 4X1QU 3KQCA 2FI4E 4DGJA 2VGCB 1SQOA 4AB8A 1FQ3A 1MD7A 2QF5A 1YPEH 3KL6A 2HRVA 3RU4E 1UVPA 1ZTKA 2VIVA 1H9HE 3VXEH 2FYRA 4X1RU 1QFKH 4HTCH 4ESTE 4NSVA 3KN2A 1LHCH 5EIYA 3M5NA 1IQHA 1S6LA 4XOJA 1LVMA 4BAMB 4YT6H 4BANB 1O34A 2HVYB 3I29A 4FOUC 4Y76A 4O9VA 1JBUH 2NWNA 2HLCA 2FYQA 1TPPA 1HUTH 2PFEA 2PKAA 5HXFA 4Z0KA 2A7JA 2C8XB 1ZSKA 4GUXA 2GZ9A 1DE7H 2NU1E 4FXGH 3GOVB 1INCA 4YOJA 2K8IA 4ISOA 3M7QA 2UWPA 4YOGA 1BHXF 3KYGA 3RXOA 4Y79A 3VB7A 1NM6A 2PTCE 2BZAA 2C8ZB 1DWCH 4BNRA 1ESBA 5JBCS 2A4GA 2Z9IA 5JDUB 1FI8A 1AB9C 1T4UH 1W14U 2A0QB 1V2ST 1XKAC 2Y7ZA 3BTME 4I8HA 5HGGA 5LPRA 3GICB 2G4TA 1CT0E 3O8DA 1QIXB 2D1JA 4HG6A 2ZQ2A 3TK6A 3F1SB 2VWNA 2IJD1 2AHME 2LNCA 1F0RA 1V2UT 1N6XA 2SNWA 2WPLS 5DP6A 3GCOA 3EGKH 1BMAA 1E36B 2FTMA 1BJUA 3VG8A 1S0QA 3L3TA 1GJ7B 2LPRA 1KYNA 2L6OA 1C1VH 1WU1A 2GJGA 2XW9A 2WYJA 3MWIU 5L2ZH 2VNTA 1MU6B 1HNEE 3RXGA 4U2WA 1OWHA 2F43B 1YPHE 3NPSA 1E35B 4JMYA 5DN6D 2FMJA 3SGBE 3UUZA 1QJ1B 1AY6H 2VWLA 3LKWA 4OGXA 1P2OA 3DHKH 3RC6A 1BTZA 1NU7B 1GJ8B 2PKAB 4MPVA 4Z6AH 1SGFA 5HKKD 1UVUH 3E0PB 1QJ7B 4XBBA 3SNEA 1HPGA 4YM9A 1MCTA 3SNCA 1KIGH 2IPHA 5FPYA 2D26C 4JZFH 3SUGA 1S84A 5CHBA 1AVGH 1WYKA 2WV5A 1O3JA 1ELEE 1VCPA 2M5TA 3EQ0H 4D9RA 1OX1A 1C2GA 1YC0A 3UAIC 2OLGA 4MPUA 1MUEB 1O3KA 1YP9A 1GJ9B 3AK5A 2ZG0H 2QA9E 1NROH 1P05A 3ZZDA 2ZFSA 4JCNA 4B6EA 2F9NA 2HNTC 1ZR0A 3F9EA 1IQJA 1EAUA 4ABJA 2ZFQH 3H5CB 1C2KA 2NU4E 2O8TA 1GI9B 4WH8A 2ZNKH 2K0QA 1DFPA 1XUGA 1O36A 4ABIA 1SMFE 1TPSA 3SOSA 4OS2A 2XC5A 2Q6DA 3A86A 1O2XA 2PUQH 3HKIB 1PFXC 1PQ5A 1NS3A 2FWWA 3RMMH 3K2UA 4NIXA 3CNRA 3A8BA 5ESTE 3BSQA 4A1TA 5GCHG 3GDVA 2ZFTA 2H2ZA 2ZCKP 1EPTA 2GVFA 2R0LA 1ZJKA 1OXGA 3F0OA 5EXMA 1ETTH 2ZI2H 1DS2E 1CQQA 1RIWC 3GY5A 3SV2H 1TWXB 1GI2A 2WV9A 5K0HA 1TGSZ 2UWLA 1LHDH 1EKBB 1BB0B 5EXLA 2V3OH 3NKKA 1QR3E 1DXPA 1GHVH 2QC2A 3R0FA 2JH0D 2A32A 5G4BA 4X8UH 3A7WA 1O32A 2NU2E 3U1JB 5E0HA 2V3MA 2C93B 1DANH 2CXVA 1AFEH 1CHOF 1K1JA 1JRTA 3RXSA 5GIBA 4QT8C 1F7ZA 2CK3D 1QTFA 1BJVA 1GBEA 3TH3H 7GCHG 1UMAH 1C5TA 3AAVA 3BG4C 3DUXH 1IQKA 1GJ4H 4F4OC 4RSPA 3S0NA 2ZDAH 1GJDB 2VGCC 1AD8H 4FUIA 3SW2B 2JETB 2BLOA 2OXSA 3FP7E 4MLFB 1EPTC 5DP9A 5ETXA 2QY0B 3TNSA 3N99A 1P9SA 1FAKH 3ENSB 3PO1C 4Y0ZE 4Y71A 2V3HH 1E79D 4NFFA 4F48B 3VB5A 2BDCA 4U01A 3GY2A 3RXFA 3EA7A 1QRWA 3LGVA 1UO6A 4X1SU 1O5DH 1F0TA 2PKSB 3CS0A 1O3MA 2BDIA 1NFWA 3BTEE 4Y6DA 1GL0E 3BTFE 2TGAA 1TNIA 1V3XA 2I6QA 4OM9A 2GMTB 1H8ED 3RXEA 2FS9A 2BB4A 4X8VH 3O8CA 3ELAH 4FUBA 1ESAA 4Y10E 1TGCA 3UNRA 2FZZA 2BOKA 3KHVA 5FPSA 1G2MA 1O2GH 3A80A 2GDEH 2ZFPH 3Q00A 2W7SA 1CBWC 2ZHQH 3PV4A 4Q7YA 2AIQA 3RXHA 2ZU2A 5JB8S 1MTNC 1UTOA 3P6ZB 2CF9H 4O3UA 1O3CA 3GY3A 2SNVA 4JK6A 2AH4X 1UTPA 3MNBA 1LO6A 2GT7A 2QIQA 1C5UA 3ATIA 1J15A 3ZZ3A 3NXPA 1QGFA 5DP8A 1F0SA 1K1LA 3DD2H 1EX3A 3OU0A 5AHGH 2GZ7A 2XTTB 1RJXB 2G52A 2G00A 1YBWA 4TYDA 2BM2A 4M7GA 4ZAEA 1KTSB 1GWAA 2QYIA 1UTMA 3URDA 1SFIA 5C67A 1TALA 4Q7ZA 4UFDH 3OX7U 3KQBA 2QV1A 3GYLB 4SGBE 1GMHG 3UNQA 2D2DA 2FOBA 2VVVA 1H9LB 3TGJE 4KTUA 4ISLA 5F6MA 2QCYA 4MPWA 1AZ8A 4FETA 1K21H 4ASHA 8GCHF 2XBYA 1KDQA 1P3EA 4JZ1A 1WQSA 3SJOA 4WJG2 3P8NA 3BEIB 3SNDA 1GJAB 2QXHA 2VH6A 4OS6A 1G3BA 5FX6A 1UTLM 3F2FA 1XUIA 5H4IB 1AGJA 1NZQH 1TPOA 1C5LH 3UPEA 3EDXB 2HNTE 1Y3UA 2CF8H 3LPRA 3QX5H 1H8HD 1BT7A 3LGUA 1FPCH 1LQDB 2A1DB 3UB0A 1ZTLA 3DSGA 5EPNA 1IQGA 1QB9A 1O2IA 5EPYA 4AYYB 2CJIA 2W6ID 1IOEA 1ORFA 1SGPE 4XD7D 1FIWA 3MH5A 3M35A 2BZ6H 1MKXK 5CHAB 4BOHA 1X7AC 3CENA 1O2OA 3VXFH 5EODA 2SGFE 1D9IA 1MTVA 3V3MA 1P01A 2KFWA 1LVBA 1BITA 2HVXA 1L0ZA 4OS1A 1GVKB 3ZVCA 5A8XA 1JOUB 3ITIA 1PPFE 2GX4A 4UFGH 3V13A 1QA7A 5F53A 2GTBA 2KCPA 2VWOA 4IGDA 1BTUA 1TFXA 3T62A 1PQAA 3RU4T 2ANWA 1BBRH 1O2LA 1P2IA 4A7IB 3HK3B 2BD3A 1V2WT 2FEQH 1GBMA 1C1TA 4BXWA 2J5UA 1GJ5H 4ABHA 1SQRA 3UREA 4K8BA 1MKXH 2BXUH 2G81E 3RM2H 5FCKA 4NCYA 1O2WA 1ABJH 4UONA 1C1UH 3ZZ7A 1DUEA 1Q31A 3O8BA 1O3LA 2ZPSA 1T8LA 2OP9A 1C1QA 1GHBF 1GGDC 3OEHD 1F92A 4BXSA 1O2RA 1CGIE 4ABEA 1O2ZA 3RM0H 1T31A 4X6NA 5EU8A 1ZRKA 1BRAA 5JBAS 2BD4A 1YPKH 3ZVFA 4O03A 4H4FA 3KNXA 2H5CA 2TGTA 3F0PA 1GI0A 1UJ1A 1Z8IB 2VWMA 1B7XB 1EJMA 3FVFB 1HAVA 5EG4A 5AFYH 2C8YB 2GCTB 1AVWA 3SUEA 1O5EH 2J98A 5L2YH 5E2PA 4Y0YE 5CHAC 1O3NA 3FZDA 4NA8A 1WTGH 4OGYA 2WHXA 3AVZA 2A5KA 2P94A 1EUFA 1PPHE 1ZGVA 1FY1A 3SUDA 4CRDA 2EEKA 1AE5A 2HPPH 2R0KA 3K65B 2ULLA 2FIRH 1GHAF 2F91A 2EI6A 1DOJA 3BN9A 3F6UH 3BIUH 2EI7A 1LPGB 1OP0A 8ESTE 4D7FA 1S83A 3SU3A 1P2JA 2ZF0H 2KCYA 1O3OA 1NY22 1V2TT 3PTNA 2BD9A 1AIXH 3LGIA 4BTTB 1ZHPA 1DLKB 1O39A 4GAWA 4XFQA 5ABWA 3RXQA 4Q4LA 5FCRA 2BX3A 1GG6C 3RC5A 2A4QA 2C4FH 2PP6A 5AF9H 2NU0E 1WBGB 3F9FA 5CMXH 2G4UA 5K7RA 5C5NA 2YMSD 1O2NA 2QXIA 1G3EA 4YO9A 1NTPA 3L6PA 1P10A 1GDNA 2ZQ1A 1K22H 2ZTXA 1GMDG 1FY8E 5GJ4B 3PWBA 3STJA 2W6JD 5J4SA 4CH8B 4IW4E 2XC4A 2ZZUH 4KP0A 4AGKA 2GKVE 4I86A 2QE7D 5I25A 1Z71A 2A5AA 2BVRH 3PMJA 2SGDE 1EZUC 3BTQE 1YLNA 2PGQB 1C2IA 4FUGA 1W0JD 1YF4A 1SGNE 5HM2A 3LU9B 3SHAH 2FO9A 4RKJB 4CRGA 1O2JA 3PRBA 1QBNA 1F5RA 2F9BH 3F2HA 4I7YH 2FDAA 3PMAB 3ZVBA 4B2BA 1A5HA 3EAJA 3D62A 2VINA 4YT7H 1P02A 1ZJDA 1COWD 1O3AA 5HIYA 1C5XB 4K3JA 4B1TA 1NRQH 3SUFA 1GBLA 2HWLB 1TGNA 4ZHAA 4KELA 2AFQB 1A0JA 5T6DA 1EOJA 3A7TA 1MU8B 1C2MA 1PPZA 4GLYA 1EP6A 1SLXB 1TIOA 3P92A 3LGTA 1BMLA 1LDTT 4XDEA 1P06A 4NA7A 2PKSC 2QAAA 4U32A 3RXIA 2GV6A 3ZZ6A 1QBOA 2BHGA 3EYDA 2VVUA 2P3UB 1QURH 2EQNA 1EP5A 3UR9A 1MAYA 3NCLA 1Y3YA 2F3CE 2PW8H 3M7UA 2IN2A 2A7CA 1A2CH 2AEIH 3QK1A 4YOIA 2Q6GA 2JETC 1G9IE 1C1MA 1O2YA 2EA3A 3IITA 1CE5A 4UEHH 2O8UA 4Q2KA 1G3CA 1GI7B 4IBLH 2JDID 2G5VA 2HLDD 3OY5U 6GCHF 1HDTH 2A2QH 3RXRA 2ILNA 1PQ8A 4I8KA 5FXLA 5AFZH 4RI0A 4NG9H 2C3SA 1GHYH 1IQMA 1O3FA 3U1IB 2WSSD 1KSNA 1XUKA 1SHYA 1MAXA 2Y6TA 3A85A 1S0RA 3PMBB 2AGIX 3MH6A 1EFRD 3F68H 1XXFA 4J2YB 4Q63A 5DSFA 4A5TS 3MQKC 1P2MA 2P8OB 2STAE 2WINI 1KTTB 3PLKA 1WOFA 3BEFB 1TNGA 1MD8A 2K1QA 2O8MA 1YPJH 1AI8H 4WXVA 3BTDE 3SJ9A 3FP8E 5L6NH 4OS7A 2FODA 2UWOA 3SHCH 4HFPB 2Y82A 3RLWH 2THFB 1O5GH 1Z6EA 3MFJA 5C1UA 4ISNA 3GISB 2J4IA 1GDUA 2OC7A 2D8WA 1TA2A 1WDIA 1WUNH 1FLEE 1AHTH 1TNHA 2BQ6B 1JIMA 2XCNA 2F83A 1MTWA 2ANYA 1AZZA 2IOTA 1BDAA 1F5KU 2TIOA 2KR7A 2BD5A 2KCOA 2A7HA 4VGCB 1Q3XA 3W1EA 3SNAA 1TQ7B 4ZCNA 2ZHFH 3UQVA 3ATMA 3D23A 3RXCA 4ZROA 1OHHD 1FY4A 3H7OA 1UTKA 2BD7A 2ZIQH 2FOGA 5DP7A 1SQAA 3SGAE 3OYPA 2FOAA 1O3IA 1YY3A 1ZMJA 2QF0A 5B6OA 1THSH 1PPGE 2TGPZ 1FNIA 4NWLA 5BRRE 1U6QA 3SBKA 3S7HB 1UCYE 1NFXA 5F03A 1O37A 1OYQA 1XUFA 1VITH 3URCA 1P8VC 3VPKA 1HAVB 4Y8ZA 4CRBA 3PM3A 1NRNH 3A84A 2C8WB 3QWCH 2ZDKA 1W2KH 1DLEA 2J98B 3B23B 4BAQB 2WPIS 3W94A 4WVPE 4ACBA 2QGRA 4Y8YA 1EZSC 5GNDA 1TOMH 1BTHH 1RTKA 1BBRE 1Z7KA 4NZQA 2ESTE 1JMOH 4TT3D 1UVTH 1K1NA 2J9NA 4ISHH 1NPMA 1QRZA 1C1SA 2ZDVH 1Y3VA 2UUFB 4SGAE 1BRCE 1UK3A 1OS8A 3ZZAA 2KX4A 2OBQA 1KLTA 1XX9A 3ZZ8A 2OQUA 2ZPQA 5GCHF 2HOBA 1TMBH 4LOYH 1G32B 4I8GA 2H9TH 4H6TA 1ANBA 3RMNH 1YKTA 1SKYE 1C5YB 1GDQA 1P2NA 2H9HA 1BMNH 1F0UA 4DIIH 1AWFH 1BZXE 1VCWA 3PLBA 4IMQA 3DCLA 4BTUB 4X8SH 2PTNA 1HJ9A 3ODFA 3M61U 2XXLA 1RTFB 4NIYA 1BQYA 2UUJB 1GMHF 2ZFFH 3LJJA 1GBAA 2SFAA 3QGJA 1W13U 4Y7AA 1RTLA 2SGPE 2JIZD 1JRSA 3UQOA 2BLQA 1EAIA 1WXRA 3UOUA 1D3TB 2ZGBH 3A87A 3NK8A 3Q77A 1C4Y2 2QN5T 3RXVA 3I77A 1UK2A 5DP5A 3P8GA 1KXFA 3BIVH 1THRH 3BTKE 3MU0A 4TSFD 4X0WU 3E1XB 1GMDF 2CV3A 3MYWA 4E7RG 5FHTA 3ZZCA 1T4VH 3VGCC 1UTNA 2VIOA 2O8LA 2VIWA 3SI4H 5C1XA 2OBOA 1ZYOA 1MQ5A 4NSYA 1TPAE 2FI5E 3LONA 4X2XA 1EB1H 4XBDA 1FPHH 4NGAH 1C2EA 1ESTA 1GHZA 3QZQA 5DO4H 5EGMA 2WYGA 1XKBC 1TX7A 1CT2E 3WWBA 1RS0A 2W3KA 1OWJA 1L4DA 3A8AA 3TJVA 1QBVH 4WMDA 2LP6A 5A8ZA 2FTLE 4P02A 2BDGA 3S9AA 5C5OA 1YPLH 2RG3A 4TPIZ 5JBTA 2JJ1D 1YWUA 2XBWA 4ABAA 2STBE 3HKJB 4IN1A 1GVLA 4DOQA 1TAWA 2GCTC 1EOLA 4ZMAH 4DJZB 4AGJA 3LIWA 1C5RA 3LOXA 4WXIA 5A0BA 1MZDA 2J97A 4HZHA 1CSOE 3P8FA 3FO8D 1C5NH 1BHXB 1C9TA 3ATLA 4DCDA 1GGDB 1DY9A 1IHSH 2V35A 2FX6A 2W7UA 1O3EA 1LQEA 2QF4A 4ISIH 1AUJA 1OSSA 4CBNA 3UWJH 1KXEA 5LPFA 1GBKA 4B73A 1AB9B 2XCFA 3RXTA 3S9CA 1K9OE 2ZDLA 3AASA 1ETSH 1BRUP 2JH6D 4X2VA 3T28A 3E6PH 4K1TA 3KQEA 1ZSLA 3PYHA 1AE8H 1SLVB 2BQWB 3ODDA 1QZ8A 1D3PB 2FS8A 1C5ZB 2P16A 3RXBA 2ZTZA 2VVCA 5GPIB 2BY9X 1J16A 1ABIH 2J95A 6LPRA 4DY7B 3BTWE 1CGJE 1PYTD 1C5WB 4H42U 4KGAA 1CA8B 2C90B 3BG8A 2PWXA 3MNXA 1P3CA 1W7GH 1Y5UT 2PSXA 2XWBI 1DSUA 1ELFA 4D7GA 3B9FH 3UWIA 4B6FA 1NBME 1J9CH 2ZU3A 1O2MA 4ACAA 3ZZ9A 1NFUA 1O3BA 5FL7D 1DXWA 1TBRH 2B9LA 5F8XA 3B8JA 1W0YH 1QJ6B 4RN6A 2A5IA 3OFND 3ATWA 4BTIB 1PQ7A 3LC5A 1YGCH 2ZHEH 3DA9B 1GHBG 3T2NA 5C0TA 5CDFE 3MO3A 3VFEA 3PTBA 3NUMA 3SORA 4ABBA 1MKWK 1A61H 1YPMH 3QLPH 5IDKA 5T1VA 1HJAB 1E37B 5T6GA 1HCGA 3ZV8A 1MQ6A 1GHWH 3A8DA 2ZWLH 3G01A 2GGVB 2F9PA 2PV9B 3H7TA 5F8ZA 3UY9A 3RMOH 1GJ6A 5DJ7A 4HI3A 5EOKA 3UR6A 7KMEH 1C2FA 1V2QT 3ZV9A 1V2VT 2H1UA 1C5MD 4AC9A 3DFJA 4F49A 2W3IA 1TNJA 4CHAB 2PUXB 3O8RA 1UCYH 2KAIB 2RCEA 1FIZA 2JKHA 1N8OC 1HAZB 2BY7X 2VB0A 3TK9A 3GDUA 3T27A 5JYIA 2R2WU 1C5SA 1W10U 1SC8U 3ESTA 3D65E 4X2YA 1RXPA 2WPJS 2OQ5A 1MTUA 3F9GA 5DP3A 3RXKA 9ESTA 1O38A 4X1PU 3GY8A 3GYMA 5C1YA 2YMSB 4MQAA 1DITH 2PLXA 1YYY1 2FI3E 1EASA 1HIAA 3AW0A 4ZHLU 2F9VA 1B0FA 3M3VA 3ZZ5A 1AVXA 2FOMB 4CRAA 1PYTC 2BY8X 1GI3A 4GCHF 1VITF 1V2NT 2R3UA 3SZEA 1BOQA 2GT8A 5I46H 4K1EA 1SGCA 4IS5A 2XWAA 3QTOH 1FY5A 1UCYK 2OC8A 2PGBB 2Z9JA 1Z8JB 2BLVA 4WWYA 1O2VA 3ZZBA 1QA0A 1LHEH 3RXAA 1BTXA 3GDSA 1O2TA 2FOEA 1AQ7A 1C5OH 2Z9KA 3IWMA 3RLYH 1P0SH 3WW7A 4DURA 2RFKC 1GJBB 2CGAA 2WV4A 2FOHA 2ZU4A 2HALA 4RT1A 1EXFA 2KAIA 1C2LA 4JK5A 1MBQA 1T8MA 3LGWA 1RGQA 1BIOA 1C5PA 1CHOG 1MMJN 1MH0A 2J2UA 3GS9A 9LPRA 2AERH 2F9OA 3N7DA 4M9FA 1C4U2 1SG8B 2YMSC 4X8TH 1G37A 4H6SB 1GI8B 4IMZA 3MU8A 3ZVGA 8LPRA 3BG4B 1G36A 1LTOA 3MU4A 3SN8A 2GP9B 5A0AE 2VJ1A 2YOLA 3HGPA 3E3TA 3GCTF 1LVYA 2H9EH 1O2HA 4UDWH 2ZHDA 4OS4A 4MDSA 4AB9A 4D9QA 4D76A 2OC1A 2A31A 1HFDA 2TGDA 4INLA 3RC4A 1TRNA 1GBCA 2BMGB 2FLBH 1TNLA 2ZU1A 1FUJA 3PWCA 1O5AB 4BAHB 1N1LA 2GD4B 4UFFH 4E06H 5DK1A 4DT4A 3T5FH 2V0BA 1P57B 2G51A 4JZDH 2PSYA 1RIWB 1Z6JH 1GJCB 4GHQA 1WSSH 2BY6X 1TQ0B 1PJPA 4XBCA 1T7CA 2I6SA 1DM4B 1ZPBA 4CH2B 3A7YA 2BDBA 1O2UA 1TONA 1YPGH 4K69A 2ASUB 1T8OA 2B0FA 5C0UA 2OK5A 1T8NA 1TGBA 1O31A 1ANCA 2ZGXH 1GVZA 1LKBA 1WV7H 4B71A 5EQQA 1CHGA 3VB4A 4AZ2B 3SI3H 1ANDA 4K60A 2ZGHA 1KXCA 3TJUA 1NU9A 2BD8A 1TRMA 3F9HA 2SGAA 5J4QA 2FOFA 3JZ2B 4ZKRU 1QB6A 1PPEE 3BTGE 3KF2A 4WMEA 5LH8A 1OOKB 5B6LA 1SR5C 1P03A 1ZHMA 1ZOMA 2Y5GA 2W26A 4K5ZA 1QCPA 1ARBA 1XXDA 1FMGA 2YNAA 3W95A 4B76A 4DW2U 4KKDA 2DE9A 6GCHG 3SV8A 1IQFA 4YTAA 3OAAD 5E0JA 1FN8A 1NBMD 1ELCA 3ZYEA 1KMHB 1FV9A 3MMGA 2A4RA 4E7NA 1ZTJA 2AMDA 4YZUA 3UNSA 4IN2A 1GBTA 3OTJE 4AFUA 4CRCA 2QF3A 1TA6A 1LPKB 1ANEA 1H8IH 4Y11E 1D6RA 1QQUA 1SPJA 1EZQA 1SGEE 4UFEH 3HGNA 2Y5HA 2BTCE 3K6YA 3PROA 1FDPA 1O2KA 2P3FH 2EY4C 3E90B 3FAOA 1H1BA 3TGKE 4Y7BA 4X2WA 1ELAA 1Z1JA 2JJ2D 2WUBA 4ABFA 5A09A 4R0IA 3A89A 1JWTA 5C20A 3U28C 1L1JA 4O97A 1DWBH 3OEED 3QGNB 4CREA 1ZLRA 2B8OH 2ZGCA 4GVUA 4FUEA 1K1PA 1W7XH 3ZVEA 1QHRB 2OD3B 1HAIH 1SLWB 2ZDMA 3MNSA 3I78A 1NRPH 1GBHA 2EI8A 3U8RH 1HLTH 4BAOB 1LHGH 1SBWA 1D6WA 3OSYA 4IC5A 4K2YA 5BPEA 2VIQA 2BDYA 4JYVH 2Q6FA 2XOKD 3A88A 2HNTF 3PMHB 4TY7A 3DT0H 3N7OA 3U8OH 2WZQA 3FN8A 1HGTH 3PRDA 2VBCA 4R8TB 5JPMH 1S85A 2CMYA 1H8DH 1MCVA 2OC0A 4B74A 1G3DA 1TX8A 2NU3E 1A4WH 1MKWH 1MZAA 4ABDA 5GXPA 4LK4A 1AFQC 1QL8A 2ZHWH 7ESTE 1IQLA 1D3QB 2ANKH 3FANA 1W11U 3MH4A 4INHA 2F4LA 4OS5A 4RT0A 4X1NU 1A3EH 3P8OA 1ID5H 1C2JA 3U69H 3RXLA 2CHAB 8GCHG 2OTVA 2DUCA 3RU4D 1KLJH 1W12U 1DY8A 2OUAA 3A81A 3R3GB 1CGHA 2A45B 2RDLA 4TWYA 1TX6A 1VJ9U 6CHAB 1DSTA 4FU8A 1W3CA 4HGCA 1MABB 1K2I1 1TMTH 3E8LA 2P93A 4ZHMU 1PPCE 3A83A 3ZIAD 3RP2A 1H4WA 1CA0B 1O2SA 1TBQH 1SFQB 2M2AA 1FXYA 3GY6A 4AG2A 2HPQH 1XMNB 4WF8A 3SNBA 3V0XA 1SGTA 1E38B 5SGAE 1PPBH 3NWUA 4I8JA 1L4ZA 3DFLA 1O3PB 4Y8XA 1HRTH 4E05H 3TJNA 3EE0B 2WPHS 1FX0B 1GL1A 1NRSH 1EPTB 1ELTA 1LKAA 3AAUA 4ZKNU 3SU2A 2GCHF 3RXPA 1ELBA 2AMPA 5AVDA 1BA8B 3RXDA 1D3DB 3S9BA 1C1RA 3M3SA 3FZZA 2WUCA 4I31A 1V2JT 3M5MA 5EJ1A 1BTYA 1A1RA 3FKSD 1J8AA 3M5LA 2AGGX 3HK6B 1XVOA 5C2ZA 1WQVH 1TB6H 1C1WH 4FUDA 2H6MA 4IC6A 5CE1A 2ZCHP 3EA8A 4AFZA 3GCHC 1MTNB 4FVDA 2EC9H 1CBWB 2B5TB 1HB0B 3TLOA 2L74A 3K6ZA 5KEDA 3M37A 1HXFH 4XE4A 1P2QA 4CR5A 2FPZA 4A1VA 3U9AH 1SQTA 4CHAC 3ZVAA 2GMTC 1AN1E 2B7DH 5L30H 4JYTA 1XUJA 1GMCG 1LCYA 1TMUH 1DVAH 1EZXC 4Q7XA 1IQNA 1QRXA 4FU7A 1SOZA 1A7SA 1NESE 3A7VA 4JZEH 1T32A 3LGYA 1TLDA 4NWKA 1A3BH 3QDZB 1W0KD 2AS9A 3KQ5A 2Q1JA 1S5SA 3PB1E 1UK4A 2PR3A 2AYWA 1OWEA 3SU6A 1GI6A 2BDHA 5DG6A 1KLIH 1ZSJA 2VU8E 3RXJA 3UFAA 1UVOA 3RUOA 1GCDA 1N6YA 1O30A 1QY6A 3MO6A 1O5BB 2QXJA 5E0GA 1ZPCA 2ZDNA 4ZUHA 1SGYE 1OWKA 1SGIB 3ZVDA 3BV9B 1C4V2 1P12E 2IJOB 2GV7A 2XYAA 2BX4A 2XNDD 3U8TH 4B2CA 1XVMA 3KQDA 3IG6B 1E0FD 3MU5A 3OTPA 1OKXA 4PROA 2WPMS 4MNVA 5C17A 4VGCC 4AYVB 3P95A 1XUHA 2OCVB 4LZ4B 2Z7FE 3TJOA 1FY3A 4NZLA 4FUFA 4DG4A 2OINA 1FAXA 1FN6A 1BRBE 2TPIZ 5IK2D 2Y7XA 1YM0A 1GI5A 4GHTA 4AN7A 2IPQX 3SU5A 3OE7D 4FVBA 1ZRBA 3Q3XA 1XM1A 1AUTC 3SQEE 1Y5AT 3KEEA 3P17H 3KCGH 5EJLA 3TH2H 1Y8TA 1C9PA 5FX5A 3SZNA 1O5CB 1FONA 1RFNA 2KM0A 1V2LT 3GCNA 3HATH 4MNXA 1VZQH 3RDZA 1B0EA 1A5IA 1ZZZA 3WY8A 2WPDD 3BTTE 2R3YA 4GSOA 1IHTH 2BDAA 1K1OA 2G55A 1NC6A 3SV9A 1O3GA 3UOPA 2WPKS 1ZMLA 5T3HA 2ALVA 2TBSA 2ZCLP 1HJ8A 1S82A 2XBVA 3VB6A 4YLUA 5FBEA 5LPEA 4D8NA 4AFSA 3LT3A 1TE0A 4ZXXH 3GY7A 3TK5A 4TY6A 1THPB 4XSKU 1Y5BT 1KXBA 1HAPH 1SLUB 3D49H 5IYTA 1K1MA 1KDQB 2ZTYA 4CBOA 4MNWA 1SHHB 3A82A 3H09A 1HXEH 1D4PB 2BOHB 1NN6A 1SL3A 1C5VA 1V2OT 2Y81A 1VCQA 4F55A 1SGRE 3F2GA 1BMMH 1V2MT 4BAKB 2LELA 1O0DH 1VGCC 1TBZH 2BLWA 3SU0A 1Z8RA 5JB9S 1GBFA 1G30B 2ODQA 3U98H 6CHAC 2F9UA 1Y3WA 4ASUD 1EJNA 2UUKB 2FESH 1ARCA 4FUCA 1AU8A 1HBTH 3STIA 2CHAC 5GWZA 1VITG 1ELVA 1CO7E 2Y80A 1NRRH 3SGQE 5EQSA 1BTWA 2Z94A 3Q76A 2BVSH 4NA9H 5LGOA 3VGCB 3VEQB 1AKSB 5E8EH 3SU4A 1FZZA 3OY6U 4YXWD 1IAUA 4UD9H 1AFQB 1AWHB 5PTPA 1SSXA 2R9PA 4JZIA 1CU1A 3A8CA 1KY9A 2ZU5A 1P9UA 1NO9H 2PHBA 1GBJA 3MOCA 1F2SE 3E0NB 1O2QA 2SGEE 2ZO3H 2RA3A 2FOCA 1Z1IA 2BYAX 2J34A 3SQHE 1P04A 1S81A 2Z6BD 1EAXA 8KME2 2A4OA 1HAYB 5EJZA 3UIRA 1IQEA 1Y3XA 3SYJA 1ZMNA 3MI4A 4B75A 4RKOB 5HYOA 1V2PT 2G5NA 4AOQA 4MG3A 1UHBB 3M3TA 1K28D 1L1GA 3TIUA 3TPIZ 3Q3KA 5JBBS 4FUHA 1VR1H 5TCAA 1GMCF 5TJXA 5C94A 4GCHG 4ZKSU 3LH3A 1L2EA 4FUJA 1GBBA 4AG1A 2RDEA 1JXPA 1OWIA 5F8TA 1LPZB 2UUYA 3A7XA 3C1KA 2CN0H 1E34B 1DPOA 1YLCA 3CP7A 4INKA 1HYLA 1YPHC 4MNYA 2JH5D 3EE7A 3T26A 3SU1A 1A0LA 2FLRH 1GBDA 1VKYA 1TOCB 5C3NA 1SGDE 2VH0A 2TRMA 5FPTA 1K1IA 2H5DA 2V6NA 2ODYB 4B2AA 2Z3CA 1AMHA 1UW7A 1SGFG 5ESBA 1VJAU 2FXRA 1AO5A 1OWDA 2KZ4A 4X6OA 5HIZA 2O9QA 4Z1MD 2ALPA 1NT1A 2BY5X 2AIPA 3BTHE 1DWDH 3S7KB 2XC0A 2AGEX 7GCHF 3MH7A 1QQ4A 3MU1A 1C5QA 3M5OA 1M9UA 1Y59T 1O3HA 4X6MA 1O5FH 1DICA 1WTHD 1GI4A 1V6DA 5KECA 1V2KT 3SJ8A 1A5GH 1LHFH 4A1XA 4O3TA 4KTSA 1FJSA 1VGCB 2ODPA 2P3TB 4ZXYH 1ZPZA 3V7TA 2A2XH 3GCTG 2V7QD 1W0ZU 4WMFA 1GCTB 1YCPK 1O2PA 1ELDE 2FX4A 3JZ1B 1A0HB 1O3DA 1GBIA 1O33A 1TABE 1QL9A 1GI1A 2W5EA 3N7EA 3RMLH 4NIVA 2J92A 3DSOA 2BD2A 4TWWA 3TGIE 3QTVH 1TNKA 1RRKA
chains in the Genus database with same CATH topology
3TH4H 1P09A 1ZGIA 4YLQH 3LC3A 3NZIA 3S69A 1ELGA 1S6FA 1BUIA 1QL7A 3EA9A 4UE7H 2ZP0H 1V2RT 3HPTB 5EXNA 1A46H 4DIHH 1O35A 1SGQE 4TPYA 1J14A 2P8OC 5EQRA 1EJAA 1G2LA 4U30A 5FBIA 1N8OB 1KXAA 1OPHB 2XNIA 2DE8A 1YCPH 1DX5M 1BCUH 3C27B 3VB3A 1UTQA 3SJKA 1LVOA 1C1PA 2YNBA 1MTSA 1QB1A 1SI5H 2QXGA 4WH6A 3ZYDA 2FM2A 3TNTA 4AORA 1IQIA 5A8YA 2GZ8A 3LH1A 4J1YA 1DWEH 5DP4A 4A92A 2Z3EA 5A2MH 1ZHRA 5EW2H 4K8YA 1HIAB 1Z8GA 4LZ1H 3QZRA 1ACBE 5HM9A 1BTPA 3SO3A 2HGTH 2P95A 4JYUH 4WY3A 3KGPA 3K9XB 2ZEBA 2BXTH 3E91A 1HAXB 2AMQA 1WCZA 2ZKSA 1C2DA 3PLPA 3P70B 2O8WA 4MTBA 2P59A 1YCPM 2ANMH 1QNJA 3BEUA 1GCTC 1Q2WA 2GDDA 2XBXA 1YLDA 3A7ZA 3AW1A 4ZH8A 3L33A 1C1OA 1P11E 4I8LA 2BVXH 1EB2A 5EW1H 1TGTA 1P2KA 1OP2A 1SOTA 4MVNA 1OYTH 5GDSH 2Z9GA 3TITA 1WAYB 5DPAA 1H9IE 1OP8A 4I33A 3ATKA 1TRYA 2BQ7B 4ABGA 3QUMP 1GPZA 1C2HA 4A6LA 1EQ9A 1HAHH 1GHXH 1NFYA 4GPGA 2J38A 1SB1H 4X6PA 5A0CA 4DT7B 4AX9H 4DVAU 1AKSA 3RXMA 1S6HA 4YESB 3RXUA 1C1NA 4AFQA 4ZKOU 4FU9A 3MTYA 2ZPRA 2ZECA 1RD3B 1SVPA 2SGQE 3SJIA 3SV6A 5E2OA 1KXDA 3E16B 3KIDU 5TCCA 5FAHA 1TYNA 1CVWH 3MNCA 2FP7B 1L1NA 3MHWU 4CRFA 6ESTA 2G8TA 2R2MB 3M36A 1B5GH 1DUAA 4LXBH 1HAGE 2Y5FA 3T29A 1HAOH 3M7TA 3FP6E 1LMWB 5DKMA 2ZGJA 3GCHB 3FFGA 3Q3YA 4KTCA 4THNH 3CS7A 4I32A 1UVSH 2VIDA 1DT2A 2Z3DA 7LPRA 3LJOA 1ETRH 3BF6H 4NIWA 3SV7A 1EATA 5HMAA 3TVJB 3V12A 2GCHG 4K1SA 4NFEA 3QO6A 5T6FA 3LDXH 1UHBA 4Q80A 4CR9A 1F5LA 1GG6B 1W8BH 4MPXA 1GHAG 1EAWA 1BBRK 1HV7A 3QN7A 3MO9A 2XRCA 2Z9LA 1J17T 3TU7H 1UTJA 3GY4A 3PO1B 5DGJA 2VIPA 1HJAC 1DDJA 2J94A 1MBMA 2ZC9H 2ZFRH 3UTUH 3ZZ4A 2ZA5A 1CT4E 1CA0C 3T25A 1JIRA 2RA0A 4X1QU 3KQCA 2FI4E 4DGJA 2VGCB 1SQOA 4AB8A 1FQ3A 1MD7A 1YPEH 3KL6A 2HRVA 3RU4E 1UVPA 2VIVA 1ZTKA 1H9HE 3VXEH 2FYRA 4X1RU 1QFKH 4HTCH 4ESTE 4NSVA 3KN2A 1LHCH 3M5NA 1IQHA 4XOJA 1LVMA 4BAMB 4YT6H 4BANB 1O34A 3I29A 4Y76A 4O9VA 1JBUH 2NWNA 2HLCA 2FYQA 1TPPA 1HUTH 2PFEA 2PKAA 5HXFA 4Z0KA 2A7JA 2C8XB 1ZSKA 4GUXA 2GZ9A 1DE7H 2NU1E 4FXGH 3GOVB 1INCA 4YOJA 4ISOA 3M7QA 2UWPA 4YOGA 1BHXF 3RXOA 4Y79A 3VB7A 1NM6A 2PTCE 2BZAA 2C8ZB 1DWCH 4BNRA 1ESBA 5JBCS 2A4GA 2Z9IA 5JDUB 1FI8A 1AB9C 1T4UH 1W14U 2A0QB 1V2ST 1XKAC 2Y7ZA 3BTME 4I8HA 5HGGA 5LPRA 3GICB 2G4TA 1CT0E 3O8DA 1QIXB 2D1JA 2ZQ2A 3TK6A 3F1SB 2VWNA 2LNCA 1F0RA 1V2UT 1N6XA 2SNWA 2WPLS 5DP6A 3GCOA 3EGKH 1BMAA 1E36B 2FTMA 1BJUA 1S0QA 3L3TA 1GJ7B 2LPRA 1KYNA 1C1VH 1WU1A 2XW9A 2WYJA 3MWIU 5L2ZH 2VNTA 1MU6B 1HNEE 3RXGA 4U2WA 1OWHA 1YPHE 3NPSA 1E35B 4JMYA 2FMJA 3SGBE 3UUZA 1QJ1B 1AY6H 2VWLA 3LKWA 4OGXA 1P2OA 3DHKH 3RC6A 1BTZA 1NU7B 1GJ8B 2PKAB 4MPVA 4Z6AH 1SGFA 1UVUH 3E0PB 1QJ7B 4XBBA 3SNEA 1HPGA 4YM9A 1MCTA 3SNCA 1KIGH 2IPHA 5FPYA 2D26C 4JZFH 3SUGA 1S84A 1AVGH 1WYKA 2WV5A 1O3JA 1ELEE 1VCPA 2M5TA 3EQ0H 4D9RA 1OX1A 1C2GA 1YC0A 2OLGA 4MPUA 1MUEB 1O3KA 1YP9A 1GJ9B 2ZG0H 2QA9E 1NROH 1P05A 3ZZDA 2ZFSA 4JCNA 2F9NA 2HNTC 1ZR0A 3F9EA 1IQJA 1EAUA 4ABJA 2ZFQH 3H5CB 1C2KA 2NU4E 2O8TA 1GI9B 4WH8A 2ZNKH 1DFPA 1XUGA 1O36A 4ABIA 1SMFE 1TPSA 3SOSA 4OS2A 2XC5A 2Q6DA 3A86A 1O2XA 2PUQH 3HKIB 1PFXC 1PQ5A 1NS3A 2FWWA 3RMMH 3K2UA 4NIXA 3A8BA 5ESTE 3BSQA 4A1TA 5GCHG 3GDVA 2ZFTA 2H2ZA 2ZCKP 1EPTA 2GVFA 2R0LA 1ZJKA 1OXGA 5EXMA 1ETTH 2ZI2H 1DS2E 1CQQA 1RIWC 3GY5A 3SV2H 1TWXB 1GI2A 5K0HA 1TGSZ 2UWLA 1LHDH 1EKBB 1BB0B 5EXLA 2V3OH 3NKKA 1QR3E 1DXPA 1GHVH 2QC2A 3R0FA 2JH0D 2A32A 5G4BA 4X8UH 3A7WA 1O32A 2NU2E 3U1JB 5E0HA 2C93B 1DANH 2CXVA 1AFEH 1CHOF 1K1JA 1JRTA 3RXSA 5GIBA 4QT8C 1F7ZA 1QTFA 1BJVA 1GBEA 3TH3H 7GCHG 1UMAH 1C5TA 3AAVA 3BG4C 3DUXH 1IQKA 1GJ4H 4F4OC 4RSPA 3S0NA 2ZDAH 1GJDB 2VGCC 1AD8H 4FUIA 3SW2B 2JETB 2BLOA 2OXSA 3FP7E 4MLFB 1EPTC 5DP9A 5ETXA 2QY0B 3TNSA 1P9SA 1FAKH 3ENSB 3PO1C 4Y0ZE 4Y71A 2V3HH 4NFFA 3VB5A 2BDCA 4U01A 3GY2A 3RXFA 3EA7A 1QRWA 3LGVA 1UO6A 4X1SU 1O5DH 1F0TA 2PKSB 3CS0A 1O3MA 2BDIA 1NFWA 3BTEE 4Y6DA 1GL0E 3BTFE 2TGAA 1TNIA 1V3XA 2I6QA 2GMTB 3RXEA 2FS9A 2BB4A 4X8VH 3O8CA 3ELAH 4FUBA 1ESAA 4Y10E 1TGCA 3UNRA 2FZZA 2BOKA 3KHVA 5FPSA 1G2MA 1O2GH 3A80A 2GDEH 2ZFPH 3Q00A 2W7SA 1CBWC 2ZHQH 3PV4A 4Q7YA 2AIQA 3RXHA 2ZU2A 5JB8S 1MTNC 1UTOA 3P6ZB 2CF9H 4O3UA 1O3CA 3GY3A 2SNVA 4JK6A 2AH4X 1UTPA 3MNBA 1LO6A 2GT7A 2QIQA 1C5UA 3ATIA 1J15A 3ZZ3A 3NXPA 1QGFA 5DP8A 1F0SA 1K1LA 3DD2H 1EX3A 3OU0A 5AHGH 2GZ7A 2XTTB 1RJXB 2G52A 2G00A 1YBWA 4TYDA 2BM2A 4M7GA 4ZAEA 1KTSB 1GWAA 2QYIA 1UTMA 3URDA 1SFIA 5C67A 1TALA 4Q7ZA 4UFDH 3OX7U 3KQBA 2QV1A 3GYLB 4SGBE 1GMHG 3UNQA 2D2DA 2FOBA 2VVVA 1H9LB 3TGJE 4KTUA 4ISLA 5F6MA 2QCYA 4MPWA 1AZ8A 1K21H 4ASHA 8GCHF 2XBYA 1KDQA 1P3EA 4JZ1A 1WQSA 3SJOA 4WJG2 3P8NA 3BEIB 3SNDA 1GJAB 2QXHA 2VH6A 4OS6A 1G3BA 5FX6A 1UTLM 5H4IB 1XUIA 1AGJA 1NZQH 1TPOA 1C5LH 3UPEA 3EDXB 2HNTE 1Y3UA 2CF8H 3LPRA 3QX5H 1BT7A 3LGUA 1FPCH 1LQDB 2A1DB 1ZTLA 5EPNA 1IQGA 1QB9A 1O2IA 5EPYA 4AYYB 2CJIA 1IOEA 1ORFA 1SGPE 1FIWA 3MH5A 3M35A 2BZ6H 1MKXK 5CHAB 4BOHA 1X7AC 3CENA 1O2OA 3VXFH 5EODA 2SGFE 1D9IA 1MTVA 3V3MA 1P01A 1LVBA 1BITA 2HVXA 1L0ZA 4OS1A 1GVKB 3ZVCA 5A8XA 1JOUB 3ITIA 1PPFE 2GX4A 4UFGH 3V13A 1QA7A 2GTBA 2VWOA 4IGDA 1BTUA 1TFXA 3T62A 1PQAA 3RU4T 2ANWA 1BBRH 1O2LA 1P2IA 4A7IB 3HK3B 2BD3A 1V2WT 2FEQH 1GBMA 1C1TA 4BXWA 1GJ5H 4ABHA 3UREA 4K8BA 1MKXH 2BXUH 2G81E 3RM2H 5FCKA 4NCYA 1O2WA 1ABJH 4UONA 1C1UH 3ZZ7A 1DUEA 1Q31A 3O8BA 1O3LA 2ZPSA 1T8LA 2OP9A 1C1QA 1GHBF 1GGDC 1F92A 4BXSA 1O2RA 1CGIE 4ABEA 1O2ZA 3RM0H 1T31A 4X6NA 5EU8A 1ZRKA 1BRAA 5JBAS 2BD4A 1YPKH 3ZVFA 4O03A 4H4FA 3KNXA 2H5CA 2TGTA 1GI0A 1UJ1A 1Z8IB 2VWMA 1B7XB 1EJMA 3FVFB 1HAVA 5EG4A 5AFYH 2C8YB 2GCTB 1AVWA 3SUEA 1O5EH 5L2YH 5E2PA 4Y0YE 5CHAC 1O3NA 3FZDA 4NA8A 1WTGH 4OGYA 3AVZA 2A5KA 2P94A 1EUFA 1PPHE 1ZGVA 1FY1A 3SUDA 4CRDA 2EEKA 1AE5A 2HPPH 2R0KA 3K65B 2ULLA 2FIRH 1GHAF 2F91A 2EI6A 1DOJA 3BN9A 3F6UH 3BIUH 2EI7A 1LPGB 1OP0A 8ESTE 4D7FA 1S83A 3SU3A 1P2JA 2ZF0H 1O3OA 1NY22 1V2TT 3PTNA 2BD9A 1AIXH 3LGIA 4BTTB 1ZHPA 1DLKB 1O39A 4GAWA 4XFQA 5ABWA 3RXQA 5FCRA 2BX3A 1GG6C 3RC5A 2A4QA 2C4FH 5AF9H 2NU0E 1WBGB 3F9FA 5CMXH 2G4UA 5K7RA 5C5NA 1O2NA 2QXIA 1G3EA 4YO9A 1NTPA 3L6PA 1P10A 1GDNA 2ZQ1A 1K22H 2ZTXA 1GMDG 1FY8E 5GJ4B 3PWBA 3STJA 5J4SA 4CH8B 4IW4E 2XC4A 2ZZUH 4KP0A 4AGKA 2GKVE 5I25A 1Z71A 2A5AA 2BVRH 3PMJA 2SGDE 1EZUC 3BTQE 2PGQB 1C2IA 4FUGA 1YF4A 1SGNE 5HM2A 3LU9B 3SHAH 2FO9A 4RKJB 4CRGA 1O2JA 1QBNA 1F5RA 2F9BH 4I7YH 2FDAA 3PMAB 3ZVBA 4B2BA 1A5HA 3EAJA 3D62A 2VINA 4YT7H 1P02A 1ZJDA 1O3AA 1C5XB 4K3JA 4B1TA 1NRQH 3SUFA 1GBLA 2HWLB 1TGNA 4ZHAA 4KELA 2AFQB 1A0JA 5T6DA 1EOJA 3A7TA 1MU8B 1C2MA 1PPZA 4GLYA 1EP6A 1SLXB 1TIOA 3P92A 3LGTA 1BMLA 1LDTT 4XDEA 1P06A 4NA7A 2PKSC 2QAAA 4U32A 3RXIA 2GV6A 3ZZ6A 1QBOA 2BHGA 3EYDA 2VVUA 2P3UB 1QURH 1EP5A 3UR9A 1MAYA 3NCLA 1Y3YA 2F3CE 2PW8H 3M7UA 2IN2A 2A7CA 1A2CH 2AEIH 3QK1A 4YOIA 2Q6GA 2JETC 1G9IE 1C1MA 1O2YA 2EA3A 3IITA 1CE5A 4UEHH 2O8UA 4Q2KA 1G3CA 1GI7B 4IBLH 2G5VA 3OY5U 6GCHF 1HDTH 2A2QH 3RXRA 2ILNA 1PQ8A 4I8KA 5FXLA 5AFZH 4NG9H 2C3SA 1GHYH 1IQMA 1O3FA 3U1IB 1KSNA 1XUKA 1SHYA 1MAXA 2Y6TA 3A85A 1S0RA 3PMBB 2AGIX 3MH6A 3F68H 1XXFA 4J2YB 4A5TS 1P2MA 2P8OB 2STAE 2WINI 1KTTB 3PLKA 1WOFA 3BEFB 1TNGA 1MD8A 2K1QA 2O8MA 1YPJH 1AI8H 4WXVA 3BTDE 3SJ9A 3FP8E 5L6NH 4OS7A 2FODA 2UWOA 3SHCH 4HFPB 2Y82A 3RLWH 2THFB 1O5GH 1Z6EA 3MFJA 5C1UA 4ISNA 3GISB 2J4IA 1GDUA 2OC7A 2D8WA 1TA2A 1WUNH 1FLEE 1AHTH 1TNHA 2BQ6B 1JIMA 2XCNA 2F83A 1MTWA 2ANYA 1AZZA 2IOTA 1BDAA 1F5KU 2TIOA 2BD5A 2A7HA 4VGCB 1Q3XA 3SNAA 1TQ7B 2ZHFH 3UQVA 3ATMA 3D23A 3RXCA 4ZROA 1FY4A 3H7OA 1UTKA 2BD7A 2ZIQH 2FOGA 5DP7A 1SQAA 3SGAE 3OYPA 2FOAA 1O3IA 1ZMJA 2QF0A 5B6OA 1THSH 1PPGE 2TGPZ 1FNIA 4NWLA 5BRRE 1U6QA 3SBKA 3S7HB 1UCYE 1NFXA 5F03A 1O37A 1OYQA 1XUFA 1VITH 3URCA 1P8VC 3VPKA 1HAVB 4Y8ZA 4CRBA 3PM3A 1NRNH 3A84A 2C8WB 3QWCH 2ZDKA 1W2KH 1DLEA 3B23B 4BAQB 2WPIS 3W94A 4WVPE 2QGRA 4Y8YA 1EZSC 1TOMH 1BTHH 1RTKA 1BBRE 1Z7KA 4NZQA 2ESTE 1JMOH 1UVTH 1K1NA 2J9NA 4ISHH 1NPMA 1QRZA 1C1SA 2ZDVH 1Y3VA 2UUFB 4SGAE 1BRCE 1UK3A 1OS8A 3ZZAA 2OBQA 1KLTA 1XX9A 3ZZ8A 2OQUA 2ZPQA 5GCHF 2HOBA 1TMBH 4LOYH 1G32B 4I8GA 2H9TH 4H6TA 1ANBA