2R0KA

Protease domain of hgfa with inhibitor fab58
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
239
structure length
239
Chain Sequence
IIGGSSSLPGSHPWLAAIYIGDSFCAGSLVHTCWVVSAAHCFSHSPPRDSVSVVLGQHFFNRTTDVTQTFGIEKYIPYTLYSVFNPSDHDLVLIRLKKKGDRCATRSQFVQPICLPEPGSTFPAGHKCQIAGWGHLDENVSGYSSSLREALVPLVADHKCSSPEVYGADISPNMLCAGYFDCKSDACQGDSGGPLACEKNGVAYLYGIISWGDGCGRLHKPGVYTRVANYVDWINDRIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase, immune system
molecule keywords Hepatocyte growth factor activator
publication title Structural insight into distinct mechanisms of protease inhibition by antibodies.
pubmed doi rcsb
source organism Homo sapiens
total genus 50
structure length 239
sequence length 239
ec nomenclature ec 3.4.21.-:
pdb deposition date 2007-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2r0kA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2r0kA01
1NC6A 4MTBA 4ABEA 3Q3YA 3SJ8A 2ZGXH 5ESTE 7ESTE 1MTVA 1XM1A 3PMAB 3MNBA 1BDAA 2AMQA 2O8MA 4I31A 2ZU4A 1F0TA 5J4SA 2R0LA 4Y8XA 1PYTC 1ELVA 3G01A 2ZA5A 1BBRK 3T25A 4AFQA 4H6TA 4LOYH 1XUIA 2R3UA 4BAQB 3ATIA 2F83A 3RXGA 2GGVB 3SU4A 2O8TA 2AFQB 4MPWA 4YOGA 1CQQA 1KXAA 1Y3YA 1O3CA 2BD3A 4CRFA 3B9FH 2VNTA 2Z7FE 2BD9A 3PLPA 2ASUB 2C8YB 3RXUA 3RMLH 4J1YA 1D3QB 1OKXA 1PPZA 1L1JA 3FP6E 2VIDA 1ZRBA 1XUFA 4NG9H 3BV9B 2BQ7B 1GJ7B 3TJOA 3UR9A 1S0QA 3SUEA 3SJKA 1C2IA 1O3NA 1V2UT 1D3TB 1XMNB 1NU7B 5A0BA 4PROA 3ZYEA 1UVTH 1O33A 1SGCA 1DLKB 1E36B 6GCHG 3KCGH 2STBE 3A7WA 1UHBA 5AF9H 1BHXF 1C5NH 1GJ5H 3VPKA 3SJOA 3P8FA 1QBVH 1VITF 1C5RA 3F9HA 2FESH 1HIAB 2H9EH 2BVXH 2A5KA 2GZ9A 4K69A 3UNSA 2ZNKH 1GBLA 8LPRA 1JXPA 2BLWA 1DOJA 3TNTA 2F9NA 2A7JA 4ZAEA 1FN6A 1A0HB 4LK4A 3D65E 3D23A 3TLOA 1O3AA 1FAKH 1NM6A 2ZCHP 3LH1A 2Z3DA 1V2QT 1AB9C 1O3JA 3DUXH 2F9UA 2FP7B 1MKWH 4CRBA 2OINA 1FY8E 3T26A 4BNRA 4AOQA 1FY3A 3KF2A 2O9QA 1EZSC 1YCPH 1Y59T 3K6YA 1TBQH 1O35A 1F0UA 2FYRA 2FIRH 4KGAA 1E34B 1DX5M 1BRAA 2WINI 2XBWA 1H8IH 1FPCH 1DWCH 1CGJE 3L3TA 1K1PA 7GCHF 1FQ3A 4X6OA 1SI5H 4CR9A 2ZEBA 7KMEH 5EQQA 1ZPZA 4DVAU 1FY1A 1NY22 2FLRH 2DE8A 1D6RA 1SGNE 1GBHA 1QBOA 2ZU2A 2EC9H 1MAYA 2PLXA 5PTPA 1YGCH 3KQEA 1SLVB 2ZU3A 4Y71A 2TBSA 2ZDAH 4FXGH 5LPFA 1SG8B 2BYAX 1P12E 1UTKA 1F7ZA 3GY3A 4JCNA 3D49H 1GCDA 2WV4A 1A46H 1PPFE 3A8AA 1Y5UT 1LKBA 1TPOA 4JYUH 1EZUC 3EGKH 3LGUA 3TGIE 2XRCA 3P8OA 1GMHG 1MKXH 3M36A 1QA7A 1P9UA 1UMAH 1HAPH 2FS9A 2P3FH 4TPIZ 2H5CA 2QIQA 2OC1A 2P8OB 4K3JA 4O03A 1SGFG 1AB9B 1N6XA 3P70B 4BTUB 3PLBA 1G3CA 1FZZA 2SGFE 4X0WU 4CRGA 3LJJA 4YOJA 4BAOB 3ODFA 4I8HA 3LH3A 1D9IA 4YO9A 1TE0A 2HNTF 2PV9B 1N6YA 2BDGA 1F0RA 3M35A 5LPRA 4MNVA 3RXQA 4FUJA 3RXOA 4X1QU 1O2NA 1SGEE 1WUNH 2TGPZ 1NFWA 3LONA 5L2YH 1AGJA 1GBKA 1C1NA 1LPZB 1P04A 2VIQA 1V2TT 2ZI2H 1DT2A 1ZGIA 1EX3A 2YOLA 3PROA 4OS2A 2VJ1A 3V7TA 1EAUA 4YESB 1TGBA 2GKVE 3GY7A 1HGTH 1LVYA 1VCPA 2KAIA 2XYAA 3UWJH 4X2WA 1Z6EA 2BTCE 2FI3E 4H6SB 2THFB 2ZQ2A 1MTWA 4ZKSU 5CMXH 1P3EA 4UONA 1QHRB 1AN1E 3BIUH 3BF6H 3RXAA 3VB3A 1TX8A 1INCA 2QA9E 3M5MA 4RKOB 3DT0H 3RUOA 3K9XB 3B8JA 1ZJDA 1MZDA 2EI7A 2GZ8A 1CSOE 2Z9LA 5DP7A 1UK2A 1EAIA 2CN0H 2PW8H 2QAAA 4Y7BA 1A7SA 2QXJA 4I7YH 1Y5AT 3C27B 2C8WB 1HBTH 1J8AA 3SGAE 3NXPA 1QA0A 7LPRA 1CHOG 1OP2A 1HXEH 2ZDNA 2AGEX 1AMHA 1SQTA 1W0ZU 3IG6B 3S9CA 2A4GA 2BB4A 3K2UA 3U69H 2WUBA 1EZQA 1ANCA 2XXLA 3ZVCA 4Z6AH 4RN6A 4Y6DA 1T8OA 2BD4A 4K8YA 1KTSB 3RXKA 1OWHA 1O5CB 1O2VA 1HAZB 2QV1A 5C1YA 3BTFE 4A1TA 1GI4A 3Q76A 2ODQA 1DVAH 5DP6A 1SQAA 2BXTH 4Y8ZA 2BOKA 2LPRA 2PR3A 5E2OA 1ELFA 4A6LA 3MWIU 2FZZA 3ZVEA 3V13A 1G2MA 2PKSC 1YLCA 3DA9B 3KL6A 2OP9A 2F9VA 5CE1A 2ZC9H 3SZNA 5C67A 2ZDVH 4FVBA 2ZFRH 1AIXH 1RTFB 2LNCA 4U01A 2Q6FA 1BITA 1EUFA 3TITA 1GHAG 5HGGA 4K5ZA 1N1LA 3KHVA 5I46H 4D7FA 3L6PA 1MQ6A 2J9NA 1BIOA 4AN7A 4DY7B 2GD4B 2BX4A 2BXUH 1YPGH 4CRAA 3UY9A 2ZQ1A 5DGJA 1C5QA 1JRTA 1O2SA 2P59A 4XBBA 1O30A 4AGKA 4MNYA 2WPIS 1A5HA 1Q2WA 1MD8A 2FX6A 5GCHF 4F4OC 2ZZUH 4X6NA 1DY9A 2R2WU 4NA8A 1C1MA 5ETXA 5B6OA 1V2KT 2WPKS 1ETTH 1HYLA 2VIOA 1EP6A 3AAUA 4AGJA 5JDUB 1WQSA 3M3VA 3EDXB 2JH6D 2ZHDA 1BTWA 5DP3A 1BTYA 4ISIH 2FMJA 1C4U2 1D6WA 1V2PT 1Z8RA 3RU4D 4INHA 1DITH 3A7VA 2XC4A 3TK9A 1YF4A 3U1JB 2FOMB 1MBQA 4UFFH 1LHCH 2G4TA 4GUXA 1JIMA 1G36A 1G3EA 1GWAA 3QWCH 3SI4H 2PKSB 1O3OA 3I78A 3ZV8A 5HM9A 3HPTB 3URDA 2BDHA 2BY5X 4A1VA 2QY0B 1CBWC 3GISB 2DUCA 2VIPA 3T28A 1ANBA 2P93A 1C2HA 1OS8A 3JZ1B 1CGHA 2F3CE 3M5NA 4I8JA 1K21H 4AZ2B 5E0GA 2BQ6B 4GVUA 1BBRE 2A5IA 2IN2A 1C5ZB 3BG4C 3RXCA 4B2BA 1GVKB 2SGQE 4KTUA 2C90B 2BMGB 3T5FH 4B2AA 1P3CA 1IQLA 2OC7A 4B75A 3R3GB 2GCHF 1RFNA 1MMJN 1G3DA 1DS2E 2Q6GA 4Y0YE 2FTMA 1HRTH 1TRYA 5IYTA 1TPAE 4IMQA 3U1IB 2FXRA 1ZLRA 4BAHB 3NZIA 1GI1A 3NWUA 1FNIA 5GWZA 1UK4A 2HALA 1MD7A 1DM4B 5ESBA 1U6QA 2FEQH 2XWAA 2O8LA 3HGPA 3OX7U 5T6GA 3VB4A 3BTKE 2ZWLH 1KY9A 2BM2A 1TPPA 1KYNA 4IS5A 4E7RG 4GPGA 3QN7A 1TB6H 4X2YA 2HPPH 1W13U 1YP9A 1DY8A 1GMDG 4A1XA 2K1QA 3GCTF 3RMNH 1ETRH 4Y7AA 4CRCA 1EXFA 2ZPRA 2G5NA 2WPLS 1Z8IB 1SOZA 1LPKB 3E90B 1O37A 1MTNC 3PLKA 3ZZCA 3HK3B 4XSKU 4K1EA 1VCQA 3MNSA 1SFQB 1T31A 4IGDA 1GHBF 4OS5A 2OQ5A 3F9EA 3A8CA 4X1PU 4AB9A 3LJOA 1CBWB 3SO3A 3B23B 1F2SE 2R0KA 1Q31A 1FY4A 2JKHA 1ESBA 2ZP0H 2ALPA 1XUKA 2FS8A 3M7TA 3BG4B 3HKIB 3SNCA 1C9TA 1JOUB 2Z9IA 3KEEA 2OXSA 4B1TA 4U32A 2YNBA 1SB1H 3H7OA 1TGCA 1DUEA 1O2WA 3UOUA 1YPKH 1MQ5A 1IQJA 1UCYE 5AVDA 4DCDA 4NSYA 1Z8GA 2QGRA 1DLEA 1O2XA 5T6FA 1A0LA 1C1VH 1DXWA 1PQ8A 1YYY1 1DSUA 3P17H 1HAHH 4UEHH 4GCHG 1AI8H 3BTWE 1C5SA 3N7OA 2DE9A 1YCPM 1Z71A 3S0NA 3M3SA 4NIXA 2I6QA 2ZHWH 1NO9H 4I8KA 1LHEH 1EZXC 3ZVGA 4DIHH 2SGEE 2VVCA 4ISLA 1GBCA 1ELBA 3PWCA 1TOMH 5EOKA 5DJ7A 1FONA 1GG6C 2Z9GA 2WPMS 1H9IE 4X8VH 2OD3B 1CT2E 1G3BA 1AZZA 4XOJA 1NT1A 3PWBA 3T29A 1GMDF 1BTUA 1YKTA 1KIGH 1MTNB 1IOEA 2G8TA 3SJIA 2C3SA 1PQ5A 2ZFPH 3ZZ7A 1P11E 3GY5A 1J14A 2YNAA 1O2HA 2FWWA 1C5MD 1DUAA 4NWKA 2Z6BD 1RIWC 3BTEE 4D7GA 3RMOH 1TIOA 4ABAA 3U8RH 1C1OA 2G55A 2ZFQH 1GI3A 3BTTE 4ESTE 1B0EA 4CRDA 4ZHAA 4ZUHA 2FODA 4MPXA 1NU9A 1BMAA 1V6DA 3FFGA 4MG3A 5I25A 4FU8A 2C4FH 3M5LA 4KTSA 2FLBH 4OS6A 5GDSH 3MHWU 1SGFA 1GJBB 1LVOA 3GOVB 1UTNA 1TNHA 1KXFA 5EPNA 5AHGH 1Z6JH 1O38A 2WPJS 1NFUA 1GGDB 3RLYH 1BRCE 1ZMJA 1ZSJA 4JZEH 4WH6A 1V2LT 4BAKB 3QLPH 2PTCE 2ZHEH 1ZPBA 1W0YH 5JB9S 1MCVA 1BTHH 3SV7A 4HFPB 1QY6A 2J92A 1IQMA 3GY6A 1V2MT 3K6ZA 2GV6A 1THSH 2GT7A 1FXYA 4DOQA 3LC3A 1PPCE 2WPHS 1GJ9B 1GBFA 3ZVFA 2CF9H 1P57B 4OS1A 4ZKRU 1GG6B 2VVVA 1C2JA 5G4BA 5GPIB 1C1WH 3T62A 1QJ6B 3MNXA 4FUHA 3E3TA 1QQUA 1BRUP 3BTHE 1TX6A 3RXIA 4WF8A 1S81A 2V3OH 5JBAS 5T3HA 2FOGA 1JMOH 1BT7A 1XVMA 1LCYA 1NRNH 3A86A 1GJ4H 5C1UA 1RIWB 1GMCF 1ZMNA 2VINA 1QL9A 1H4WA 1ESAA 1P05A 1L4DA 1P03A 3QUMP 1EJNA 1VCWA 5HMAA 4NIVA 3GICB 1HJ8A 3AW0A 3BEUA 3E8LA 1UCYH 2FI5E 1LO6A 4NWLA 1TLDA 3PV4A 2GDDA 2OTVA 3QX5H 1RD3B 1SMFE 3E6PH 1UK3A 1LKAA 3ZZ5A 4O97A 3SOSA 2Q1JA 3LIWA 1MCTA 2ANWA 3TVJB 3F6UH 1GL1A 1QIXB 3ELAH 5EW1H 2W7SA 3F68H 3SU1A 1QQ4A 4YZUA 2HVXA 2P95A 3MH7A 3PTBA 3ZZ6A 1T8MA 1HAVB 1O2MA 1IQIA 1SSXA 1O5AB 4IN1A 1SGYE 1NN6A 3UQOA 2AEIH 1AY6H 4NZQA 4YT7H 1M9UA 3VB7A 4XFQA 1HLTH 3A81A 2PTNA 1CA8B 1THRH 2A7HA 2H1UA 4MPUA 1C1TA 3F9GA 3QTVH 3ATLA 2VIVA 1FJSA 2VIWA 3QZQA 3UFAA 3RXEA 1MBMA 4CH8B 4X1SU 1KXCA 3GY2A 5DK1A 1ZOMA 1TRMA 3HGNA 2FOFA 2NU2E 4NFFA 1AE5A 1C5UA 4TYDA 3SHCH 3STIA 1SGRE 1AQ7A 4WXIA 2NU4E 2I6SA 1RTLA 1BMNH 3VXEH 4ABJA 1MUEB 1Z7KA 1KDQA 5ABWA 4KP0A 3MYWA 1CHGA 1TBRH 2O8WA 3BTGE 1T8LA 2A4RA 4QT8C 1O3MA 4ABFA 1K1IA 1O5BB 2G52A 3MMGA 2P16A 4Y8YA 4ISNA 2NU0E 2QCYA 1W12U 1SFIA 3ZV9A 2J34A 3RP2A 1ZSKA 2GZ7A 4Y79A 1C1RA 1FIWA 2AIQA 2AMPA 3KN2A 2UUJB 3IWMA 6GCHF 1KLJH 1XXDA 4X2XA 1O5EH 1MKWK 1S84A 2IJOB 1OWIA 2FOEA 1WCZA 2CGAA 1H1BA 2HPQH 2XNIA 3RXPA 5EGMA 3NCLA 3UIRA 1LTOA 1O31A 1GBBA 4MVNA 4D8NA 4JK5A 1ETSH 1YCPK 4WXVA 1GHYH 4Q80A 1Z8JB 2WYJA 4LZ1H 1QRZA 1SOTA 4Y76A 1JBUH 3SGQE 2ZECA 1YPEH 5F8ZA 4D9QA 1E0FD 3M61U 3PMJA 4E06H 3GY4A 1A3EH 4O3TA 1QBNA 4BAMB 2HNTE 2XCNA 1GDNA 2AMDA 5A0AE 3A83A 6CHAC 4IMZA 3A7XA 1JIRA 2VU8E 3LGTA 2D8WA 1H8DH 4NA9H 1O32A 3Q77A 3SNAA 5DP9A 3FP8E 1TNIA 1WAYB 5GJ4B 1ARCA 1AKSA 1LHFH 2FPZA 2GMTC 1ZHPA 3LT3A 4IC6A 2A2XH 2F9OA 1ZZZA 4R0IA 1C1UH 1W14U 3TJVA 5FPYA 1VZQH 2ZU1A 4BTIB 1MKXK 1F5LA 6LPRA 2VWLA 2P94A 4RKJB 4I8LA 4Y0ZE 3QDZB 3SNBA 1SLUB 2CHAC 5A8ZA 1V2VT 4ASHA 3VEQB 2JH5D 2P3TB 1Y3VA 5DO4H 2J94A 1IHSH 2UWLA 1O3PB 2HNTC 2UUYA 1O34A 1QB9A 2BDBA 3D62A 1W7GH 2FM2A 1F5KU 1EB2A 4IBLH 1EATA 1GMHF 3A7ZA 1A0JA 1O5GH 1GVLA 3RMMH 1HIAA 1VJ9U 3FZDA 2B7DH 1W2KH 3CS0A 1O3HA 3SV6A 4AFUA 4TY7A 1O2JA 1P2OA 5L2ZH 1QL8A 4FUEA 4RSPA 3BIVH 5LGOA 1SGTA 1W10U 4CREA 4SGBE 1FAXA 1P2IA 1TGTA 2B5TB 1SGPE 3DFLA 3AASA 1FPHH 1TMUH 1SGIB 1CO7E 1E37B 1P01A 5FCKA 1GVZA 3H7TA 2ODPA 3I77A 2HLCA 4UDWH 2C8ZB 3ZZBA 5FBIA 3NPSA 1TX7A 3RC6A 5TJXA 3RXFA 3V3MA 3LGVA 1DFPA 2AH4X 3F9FA 3TH3H 2GMTB 2XBYA 5A8XA 1NTPA 4OS7A 1BCUH 1KXDA 1QJ1B 1V2NT 2V3HH 5FX6A 1AWHB 1P8VC 4TWWA 3O8CA 1MU8B 2ZG0H 1HJAC 1OYTH 1Y8TA 2BDIA 1QTFA 2CHAB 2O8UA 3S7HB 4DIIH 2FOBA 3Q00A 1GBIA 2J95A 3BSQA 4O3UA 3BTQE 1T32A 4NCYA 1O2PA 4U30A 1GBJA 1XKAC 1CE5A 1E38B 3OSYA 3ENSB 1TWXB 3SHAH 1SLWB 1GBDA 3SORA 2B9LA 2ANMH 2B8OH 4VGCC 3TGKE 4AX9H 4UFDH 2BDYA 5F6MA 1IQKA 3P8NA 2AIPA 1RTKA 4WMDA 3A84A 5C5NA 1G32B 1KTTB 5E0JA 5FPTA 1ANDA 2FOAA 2UUKB 3DFJA 1BRBE 1CHOF 4JZDH 3SU3A 5L6NH 1SQOA 5EPYA 3UNRA 1TMBH 3GYLB 1GHWH 2NU3E 5DG6A 1DSTA 4NFEA 2UWOA 1MAXA 3QGNB 1D3DB 3LOXA 4CBOA 4MLFB 2Y82A 2FOHA 3SNDA 4A5TS 1ESTA 3V0XA 1A5IA 3ZZ3A 4AG2A 2ZIQH 5CHAC 4IN2A 1O5FH 1DWDH 1IQEA 1TNLA 1UVOA 3MI4A 3OY6U 5A0CA 5A09A 1EJAA 2EEKA 1GHVH 1L4ZA 2Y7XA 3SQEE 1AVGH 1DDJA 4OGYA 1CT4E 2JETC 3M7UA 2ZHFH 1P10A 1OWKA 4GSOA 4ZXYH 1PJPA 4NIWA 1ZHMA 2BVRH 1LHDH 1HJAB 3O8BA 1Y3XA 3PMHB 1O2KA 4LZ4B 2A0QB 3BN9A 3O8DA 1TAWA 3AVZA 2ZGHA 3RXSA 4I8GA 3HATH 3SN8A 4MPVA 1XVOA 3GDSA 4HGCA 1GHAF 4WJG2 2BZAA 1Y3WA 4DURA 9LPRA 4UE7H 4ABGA 4IW4E 1ANEA 1ZR0A 2H2ZA 1UVSH 4VGCB 4X6PA 1P2MA 1PPEE 1UTMA 2Z9KA 2NWNA 4CH2B 1HNEE 1EAXA 1CVWH 1T7CA 2PKAA 2ZDKA 4XBDA 1CA0C 5GIBA 3ZZAA 2A45B 1C1SA 3OYPA 1RS0A 3UUZA 1PQ7A 1SL3A 1YLDA 2ZF0H 2Y7ZA 3S69A 1IQFA 1TGNA 2QXIA 4YLQH 3RXTA 1CT0E 1C2DA 2PHBA 2BY9X 2SFAA 1TNJA 1XUGA 2ZDMA 1IQNA 1O2OA 1GDQA 5CHAB 1QNJA 1S0RA 2H9TH 2GTBA 3ATWA 1AFEH 3TJNA 1P09A 4B74A 1AE8H 1AUTC 3RC4A 3FVFB 1HXFH 2VGCC 4ZHMU 1L2EA 2SGAA 1D3PB 1C1PA 4MNWA 1G2LA 2G51A 2JETB 1WSSH 2OBOA 1BJVA 1QFKH 3M5OA 3RXDA 3BEFB 3SV9A 1GBEA 2W3KA 1EQ9A 1LHGH 2F9PA 2CJIA 1UHBB 4FUBA 2SGDE 1VGCC 1GBTA 5C1XA 1GI7B 3EYDA 2FX4A 1O2TA 1XX9A 2FYQA 4INLA 8GCHG 1P2JA 1RGQA 2CMYA 3SV2H 1LQEA 4Q7XA 2XTTB 1C2KA 4HTCH 1P9SA 3FP7E 5JYIA 2ZPQA 1K28D 3A89A 5K0HA 1S82A 2WYGA 5JB8S 4FUCA 2OLGA 3F1SB 5T6DA 5EW2H 3P92A 3ATMA 4O9VA 1CA0B 1DANH 1SGDE 3ZZ4A 1O2YA 4JZIA 1GI6A 5FBEA 1TA6A 5FXLA 2ZFSA 1BOQA 3OU0A 2GDEH 4A7IB 1DXPA 2AGIX 2W5EA 5BPEA 5EXMA 3E1XB 5TCCA 1S5SA 1C2MA 3CS7A 4INKA 2ZGJA 2GV7A 2XBVA 1GCTC 3S7KB 4XE4A 1O0DH 2C93B 2FI4E 1BBRH 1GJ8B 1EOLA 4TPYA 1KDQB 4WY3A 5FPSA 1HCGA 3TU7H 3RXHA 2J2UA 2VGCB 1K2I1 2ZU5A 1EP5A 2RA0A 1P2KA 4AORA 2UUFB 3GCHC 1P2QA 1Z1IA 3UR6A 1LPGB 3A80A 2P3UB 1AHTH 1BZXE 1VGCB 1TRNA 1OPHB 3GYMA 2PSXA 4ZH8A 2QC2A 4UD9H 4E7NA 2D2DA 1C5LH 4B73A 3LKWA 5IDKA 2TGDA 3Q3KA 4FUIA 1TFXA 1VITG 3ESTA 2VH0A 1AU8A 2ZGBH 1VJAU 3SUDA 4YM9A 1N8OC 3TK6A 1GHXH 1P0SH 5DP4A 1EPTA 1V2WT 2BZ6H 4Y11E 3RXRA 1TPSA 4BOHA 1V2OT 3TK5A 2A31A 3SUGA 4NZLA 1BA8B 1IHTH 3RXMA 1C5OH 2AYWA 4ISOA 3A87A 1GI8B 4X2VA 4GCHF 3A7YA 1O5DH 1TA2A 3TJUA 1RXPA 5C20A 1IQHA 2BLOA 1DE7H 3MH6A 1O3IA 1PFXC 3MFJA 4WWYA 1PPBH 1KLIH 1GCTB 1ZPCA 5F8TA 1G37A 3MO9A 7GCHG 2A4OA 2BHGA 2TRMA 3SW2B 1AKSB 1EJMA 2ANYA 3ZZ9A 1SR5C 1DPOA 1ARBA 1TONA 5C2ZA 3A8BA 1ZTJA 2KAIB 1NZQH 3GCHB 1NFXA 1W11U 4TWYA 1O3GA 4X8SH 3LGWA 3MU8A 4KELA 2PGQB 4Y10E 1F0SA 1S6HA 3GDVA 3RC5A 2Z94A 2WV5A 3KQCA 1MTSA 2SGPE 2ZGCA 4TY6A 2Q6DA 1QRWA 3AW1A 2D1JA 4OGXA 4H42U 1ZTLA 3MH5A 3U98H 3ZVBA 3KQDA 1UO6A 4FUGA 2H6MA 1F5RA 4HI3A 2XC5A 1SHHB 2J4IA 4FU7A 1N8OB 4DGJA 5L30H 1YPJH 3SNEA 2QXGA 2SNWA 1HDTH 2ZO3H 4NA7A 4DW2U 2OQUA 5AFYH 1TNKA 1DWEH 1T4VH 3E16B 4ABIA 1SGQE 2ULLA 4BANB 3VFEA 4X8TH 2ZCKP 2BDCA 3SU2A 1HAYB 5DKMA 1EB1H 2BX3A 1C2FA 1ACBE 3S9BA 1YC0A 1WBGB 5EQSA 2P8OC 2Z9JA 1OYQA 3KNXA 3TIUA 2HWLB 2AGGX 3STJA 1CGIE 2Y5FA 1H9LB 1AZ8A 1AFQC 1GHZA 1FIZA 5DP8A 1C2LA 3EA7A 3ZZ8A 4ISHH 2ZTYA 1NRPH 1UCYK 2A4QA 5HYOA 3UQVA 3PTNA 3PMBB 3P6ZB 2ODYB 5F8XA 3EA9A 4K8BA 2ILNA 5C5OA 1K1JA 3MNCA 1EOJA 1CU1A 3GDUA 1K1NA 5JBCS 1ID5H 1FY5A 3QK1A 5C3NA 3VB6A 3ZVDA 4ZXXH 3K65B 1O39A 4CR5A 1GI2A 3RXLA 1C5TA 1C4Y2 3TNSA 1HUTH 2BY8X 1ELCA 4WMEA 1Y3UA 3U8TH 1GBMA 1QB1A 1UTJA 2A32A 3T2NA 1B0FA 1WYKA 4I33A 4XBCA 3MU1A 3A8DA 4DJZB 3HKJB 1RJXB 1MU6B 1SC8U 2Y5GA 1SPJA 1ZTKA 4X1RU 2XWBI 1G30B 2W26A 2HRVA 1O2IA 1W8BH 3UOPA 3QTOH 4OS4A 1Q3XA 3TPIZ 1BTZA 3GCNA 1UTOA 1BJUA 3I29A 1G9IE 2R2MB 1ELAA 3VXFH 4CHAC 1B5GH 1Y5BT 3LGYA 1NFYA 4GAWA 3ZVAA 1OP0A 1UTQA 2QF3A 2Z3EA 4J2YB 1AFQB 1L1GA 1K1OA 1Z1JA 3KIDU 3PYHA 1O2RA 1BHXB 1WU1A 3QZRA 4K1SA 1OWEA 4M7GA 3PO1C 5F03A 1ZRKA 4AFZA 1AD8H 2OUAA 2VH6A 3E0NB 1AO5A 1C5XB 3SBKA 3A82A 2J38A 2BQWB 1FI8A 1VITH 2ZFFH 1OWJA 3OTJE 4H4FA 4I32A 1THPB 2Y81A 2PWXA 1JWTA 4E05H 3C1KA 3VGCC 2FO9A 4D76A 4DG4A 4B2CA 5HM2A 4ZMAH 4LXBH 3LU9B 4ZKOU 1XXFA 2XC0A 2STAE 5LPEA 3SQHE 2ZFTA 3MO3A 3OY5U 2R9PA 1QGFA 5E0HA 1UTLM 2BD5A 2HGTH 3IITA 3SU0A 3EA8A 2GCTC 1ELTA 4YLUA 4U2WA 1BMMH 4KKDA 3MH4A 1FN8A 1QCPA 2G4UA 3BG8A 1S85A 4UFEH 3RXBA 5E8EH 1GI0A 2EI6A 3PB1E 2QF0A 1WOFA 1HAOH 5DP5A 1YM0A 3Q3XA 3ATKA 1AWFH 1SHYA 3SJ9A 1OX1A 5GCHG 2PKAB 4FU9A 3TGJE 1C5VA 3QO6A 1HAVA 1MH0A 3UPEA 1WV7H 1OWDA 1GDUA 1F92A 9ESTA 3A88A 3BTDE 1QB6A 4CHAB 4THNH 5JPMH 4JYVH 1J17T 2EA3A 6CHAB 5K7RA 2BLVA 5FX5A 1AVXA 2IOTA 1ORFA 4AYVB 4FVDA 1BB0B 1ZHRA 1MZAA 2EI8A 3SU6A 3NUMA 4WVPE 2Y80A 3PO1B 1GL0E 5BRRE 2H5DA 4JZ1A 4JMYA 4ABBA 2ZTXA 1O36A 2C8XB 2VWOA 1O3FA 2TPIZ 3VGCB 2QN5T 1D4PB 2RG3A 1ZSLA 2UWPA 3A85A 4JZFH 4X6MA 2W3IA 1C2EA 2AS9A 2VWMA 1SVPA 1O2LA 1GI5A 1L0ZA 2GP9B 3W95A 1A1RA 1BUIA 1FV9A 1L1NA 1TQ7B 3MTYA 1V2JT 5DPAA 1WTHD 1BTPA 2F91A 3NK8A 2GCTB 1ABIH 1O3KA 2A1DB 4KTCA 5LH8A 2PFEA 1NROH 2GCHG 1HAXB 2ESTE 3FANA 1KSNA 2Y6TA 1ZMLA 1EPTC 2NU1E 3M37A 2QYIA 2ZCLP 2SNVA 1BMLA 3E91A 2CXVA 4YOIA 3U9AH 2BY7X 3EE0B 2RCEA 3ZZDA 1HV7A 5SGAE 2WUCA 1LVBA 4GHQA 2BD2A 4FUDA 3T27A 1J15A 4CBNA 2D26C 4AFSA 1UVUH 1ABJH 3A7TA 4FUFA 3MU4A 2V6NA 1O3LA 1PQAA 1EAWA 2PGBB 5A2MH 2Z3CA 1AUJA 2OCVB 1P02A 1ELGA 1LMWB 2GVFA 3SU5A 4YT6H 3SI3H 1UTPA 2W7UA 1NRRH 4BXSA 1KLTA 2FTLE 3GCTG 1UJ1A 4F49A 4MQAA 3UWIA 2XCFA 5EQRA 3LC5A 4XDEA 4BXWA 1S83A 3R0FA 2A2QH 5AFZH 3BEIB 2CF8H 1TGSZ 2OC0A 3ODDA 2XW9A 2ZTZA 3GCOA 1NPMA 2TGAA 2H9HA 1E35B 1FLEE 1TBZH 1SBWA 1GJ6A 3SUFA 1GHBG 3TH4H 4NGAH 1VR1H 3AAVA 1A2CH 1GI9B 2VB0A 1P2NA 3MU0A 2BD7A 2B0FA 2AERH 1NRQH 1PYTD 3EAJA 1TOCB 1KXBA 5FCRA 1C1QA 1YPHE 4R8TB 4ZHLU 3SV8A 1X7AC 3U8OH 3M3TA 1RRKA 1TQ0B 5FHTA 2TIOA 1GJDB 3MU5A 3LPRA 1V2ST 2RDLA 4Q7ZA 2ZKSA 3WY8A 1LVMA 1IAUA 4K2YA 1O3DA 4K1TA 1TYNA 2F9BH 1EPTB 2JH0D 1K1MA 1ZYOA 1A4WH 2A5AA 1OXGA 1K22H 4AYYB 5JBBS 1HB0B 1HFDA 3BTME 1TMTH 4ABHA 1BQYA 5EXNA 1O2ZA 4MNXA 3SGBE 1PPGE 2G00A 2V0BA 1T8NA 1O2UA 5E2PA 4X1NU 1S6FA 3LDXH 4WMFA 3EQ0H 3GY8A 3UNQA 3NKKA 1HAIH 1OSSA 1HPGA 1UVPA 1O2QA 3RDZA 1H9HE 5EODA 1P06A 1WTGH 1YPHC 4GHTA 1A3BH 4IC5A 1TALA 4D9RA 3FZZA 3DD2H 2G5VA 5A8YA 3CENA 1QR3E 4SGAE 1EKBB 3JZ2B 1YPMH 2ALVA 1GPZA 1A5GH 5EG4A 3MO6A 2BOHB 1K1LA 1TNGA 2ZHQH 5EU8A 4HZHA 1C2GA 1NRSH 4YTAA 1QJ7B 3ZYDA 1XUHA 2OBQA 5HXFA 1DWBH 5TCAA 5GXPA 1NESE 3RXVA 1EASA 4GLYA 1HAGE 3KGPA 3PM3A 4Z0KA 3RXJA 2G81E 1ELDE 1XKBC 3DHKH 1NS3A 4AG1A 1MTUA 1FUJA 2IPHA 2V35A 3M7QA 1GJAB 3UREA 4BTTB 2OC8A 1TABE 1OP8A 4DT7B 3V12A 1B7XB 3MOCA 2BDAA 3RM2H 2QXHA 4X8UH 3VB5A 1V2RT 4B71A 1LDTT 4JK6A 1C5YB 4NIYA 2BD8A 4Q7YA 3RU4T 3W94A 1W7XH 5FAHA 2HOBA 2R3YA 4Q2KA 1O3EA 4WH8A 8ESTE 2BVSH 3TH2H 2ZDLA 1C4V2 4MDSA 4ABDA 2VVUA 1ZJKA 3P8GA 1GGDC 1C5PA 3KQBA 3P95A 4AB8A 1YBWA 1IQGA 1BTXA 3CP7A 1O2GH 1QL7A 4JYTA 2Y5HA 2PUQH 4K60A 1KXEA 3S9AA 1AVWA 3L33A 2GX4A 5JBTA 1C9PA 1W3CA 3RU4E 2FDAA 2PUXB 2RA3A 4A92A 4ZROA 2A7CA 2ANKH 3UTUH 1V3XA 1PPHE 4UFGH 1QRXA 3FAOA 1JRSA 1GBAA 5H4IB 1GJCB 3RM0H 3URCA 2BY6X 1QURH 1J16A 4B76A 1GMCG 2BLQA 1ZGVA 3O8RA 2FOCA 2VWNA 1A61H 4NSVA 2TGTA 1T4UH 1J9CH 1ELEE 2XBXA 6ESTA 2GT8A 3QGJA 1HJ9A 1K9OE 3LGIA 1SLXB 2CV3A 3RLWH 1FDPA 4ZKNU 3ITIA 1YPLH 3H5CB 1XUJA 1DICA 2M5TA 3E0PB 3HK6B 1WQVH 1C5WB 1O3BA 2PSYA 5EXLA 8GCHF 1LQDB 2ZPSA 1FMGA 5J4QA 1OOKB 8KME2
chains in the Genus database with same CATH superfamily
1NC6A 4MTBA 4ABEA 3Q3YA 3SJ8A 2ZGXH 5ESTE 7ESTE 1MTVA 1XM1A 3PMAB 3MNBA 1BDAA 2AMQA 2O8MA 4I31A 2ZU4A 1F0TA 5J4SA 2R0LA 1E1RD 4Y8XA 1PYTC 1ELVA 3G01A 3U28C 2ZA5A 1BBRK 3T25A 4AFQA 4P00A 4H6TA 4LOYH 1XUIA 2R3UA 4BAQB 3ATIA 2F83A 3RXGA 2GGVB 3KYGA 3SU4A 2O8TA 2AFQB 4MPWA 4YOGA 1CQQA 1KXAA 1Y3YA 1O3CA 2BD3A 4CRFA 3B9FH 2VNTA 2Z7FE 2BD9A 3PLPA 2ASUB 2C8YB 3RXUA 3RMLH 4J1YA 1D3QB 1OKXA 1PPZA 2KR7A 1L1JA 3FP6E 2VIDA 1ZRBA 1XUFA 4NG9H 3BV9B 2BQ7B 1GJ7B 3TJOA 3UR9A 1S0QA 3SUEA 3SJKA 1C2IA 1O3NA 2JJ2D 5GNDA 1V2UT 1D3TB 1XMNB 1NU7B 3FO8D 2HLDD 5A0BA 4PROA 3ZYEA 1UVTH 1O33A 1SGCA 1DLKB 1E36B 3OEHD 6GCHG 3KCGH 2STBE 3A7WA 1UHBA 5AF9H 1BHXF 1C5NH 1GJ5H 3VPKA 3SJOA 3P8FA 1QBVH 1VITF 1C5RA 3F9HA 2FESH 1HIAB 2H9EH 2BVXH 2A5KA 2GZ9A 4K69A 3UNSA 2ZNKH 1GBLA 8LPRA 1JXPA 1QZ8A 2BLWA 1DOJA 3KYFA 3TNTA 2F9NA 2A7JA 4ZAEA 1FN6A 1A0HB 4LK4A 3D65E 3D23A 3TLOA 1O3AA 1FAKH 1NM6A 2ZCHP 3LH1A 3SZEA 2JDID 2Z3DA 1V2QT 4B6FA 1AB9C 1O3JA 3DUXH 2F9UA 2FP7B 1MKWH 4CRBA 2OINA 1FY8E 3T26A 4BNRA 4AOQA 1FY3A 3KF2A 2O9QA 1EZSC 1YCPH 1Y59T 3K6YA 1TBQH 1O35A 2J98A 1F0UA 2FYRA 2FIRH 4KGAA 1E34B 1DX5M 1BRAA 2WINI 2XBWA 1H8IH 1FPCH 1DWCH 1CGJE 3L3TA 1K1PA 7GCHF 1FQ3A 4X6OA 1SI5H 4CR9A 2ZEBA 7KMEH 5EQQA 1ZPZA 4DVAU 1FY1A 1NY22 2FLRH 2DE8A 1D6RA 1SGNE 1GBHA 1QBOA 2ZU2A 2EC9H 1MAYA 2PLXA 5PTPA 1YGCH 3KQEA 4B6EA 1SLVB 5C17A 2ZU3A 4Y71A 1EFRD 2TBSA 2ZDAH 4FXGH 5LPFA 1SG8B 2BYAX 5EJLA 1P12E 1UTKA 1F7ZA 3GY3A 4JCNA 3D49H 1GCDA 2WV4A 1A46H 1PPFE 3A8AA 1Y5UT 1LKBA 1TPOA 4JYUH 1EZUC 3EGKH 3LGUA 3TGIE 2XRCA 3P8OA 1GMHG 1MKXH 3M36A 3PV5A 1QA7A 1SKYE 1P9UA 1UMAH 5KECA 1HAPH 2FS9A 2P3FH 4TPIZ 2H5CA 2QIQA 2OC1A 2P8OB 4K3JA 4O03A 1SGFG 1AB9B 1N6XA 3P70B 4BTUB 2XNDD 3PLBA 1G3CA 1FZZA 2SGFE 4X0WU 4CRGA 3LJJA 4YOJA 4BAOB 3ODFA 4I8HA 3LH3A 1D9IA 4YO9A 1TE0A 2HNTF 2PV9B 1N6YA 2BDGA 1F0RA 3M35A 5LPRA 4MNVA 3RXQA 1NBMD 4FUJA 3RXOA 4X1QU 1O2NA 1SGEE 1WUNH 2TGPZ 1NFWA 3LONA 5L2YH 1AGJA 1GBKA 5HIYA 1C1NA 1LPZB 1P04A 2VIQA 1V2TT 2IPQX 2ZI2H 5CDFE 1DT2A 1ZGIA 1EX3A 2YOLA 3PROA 4OS2A 2VJ1A 3V7TA 1EAUA 4YESB 1WXRA 4RT0A 1TGBA 2GKVE 3GY7A 3DCLA 1HGTH 1LVYA 1VCPA 2KAIA 2XYAA 3UWJH 4X2WA 1Z6EA 2BTCE 2FI3E 4H6SB 2THFB 2ZQ2A 1MTWA 4ZKSU 5CMXH 1P3EA 4UONA 1QHRB 1AN1E 3BIUH 3BF6H 3RXAA 3VB3A 1TX8A 1INCA 2QA9E 3M5MA 4RKOB 3DT0H 3RUOA 3K9XB 3B8JA 1ZJDA 1MZDA 2EI7A 2GZ8A 1CSOE 2Z9LA 5DP7A 1UK2A 1EAIA 2CN0H 2PW8H 2QAAA 4Y7BA 1A7SA 2QXJA 4I7YH 1Y5AT 3C27B 2C8WB 1HBTH 1J8AA 3SGAE 3NXPA 1QA0A 7LPRA 1CHOG 1OP2A 1HXEH 2ZDNA 2K0QA 2AGEX 1AMHA 1SQTA 1W0ZU 3IG6B 3S9CA 2A4GA 2BB4A 3K2UA 3U69H 2WUBA 1EZQA 1ANCA 2XXLA 3ZVCA 4Z6AH 4RN6A 4Y6DA 1T8OA 2BD4A 4K8YA 1KTSB 3RXKA 1OWHA 1O5CB 1O2VA 1HAZB 2QV1A 5C1YA 3BTFE 4A1TA 1GI4A 3Q76A 2ODQA 1DVAH 5DP6A 1SQAA 2BXTH 4Y8ZA 4I86A 2BOKA 2LPRA 2PR3A 5E2OA 1ELFA 4A6LA 3MWIU 2FZZA 3ZVEA 3V13A 1G2MA 2PKSC 1YLCA 3DA9B 3KL6A 2OP9A 2F9VA 5CE1A 2ZC9H 3SZNA 5C67A 2YMSD 2ZDVH 4FVBA 2ZFRH 1AIXH 1RTFB 2LNCA 4U01A 2Q6FA 1BITA 1EUFA 3TITA 1GHAG 5HGGA 4K5ZA 1N1LA 3KHVA 5I46H 4D7FA 3L6PA 1MQ6A 2J9NA 1BIOA 4AN7A 4DY7B 2GD4B 2BX4A 2BXUH 1YPGH 4CRAA 3UY9A 2ZQ1A 5DGJA 1C5QA 1JRTA 1O2SA 2P59A 4XBBA 1O30A 4AGKA 4MNYA 2WPIS 1A5HA 1Q2WA 1MD8A 2FX6A 5GCHF 4F4OC 2ZZUH 4X6NA 1DY9A 2R2WU 3N7EA 4NA8A 1C1MA 5ETXA 5B6OA 1V2KT 2WPKS 1ETTH 1HYLA 2VIOA 1EP6A 3AAUA 4AGJA 5JDUB 1WQSA 3M3VA 3EDXB 2JH6D 2ZHDA 1BTWA 3FOAA 5DP3A 1BTYA 4ISIH 2FMJA 1C4U2 1D6WA 1V2PT 1Z8RA 3RU4D 4INHA 1DITH 3A7VA 2XC4A 3TK9A 1YF4A 3U1JB 2FOMB 1MBQA 4UFFH 1LHCH 2G4TA 4GUXA 1JIMA 1G36A 2LELA 1G3EA 1GWAA 3QWCH 3SI4H 2PKSB 1O3OA 3I78A 3ZV8A 5HM9A 3HPTB 3URDA 2BDHA 2BY5X 4A1VA 2QY0B 1CBWC 3N99A 3GISB 2DUCA 2VIPA 1W0JD 3T28A 1ANBA 2P93A 1C2HA 1OS8A 3JZ1B 1CGHA 2F3CE 3M5NA 4I8JA 1K21H 4AZ2B 5E0GA 1KMHB 2BQ6B 4GVUA 1BBRE 2A5IA 1BMFD 2IN2A 1C5ZB 3BG4C 3RXCA 4B2BA 1GVKB 2SGQE 4KTUA 2C90B 2BMGB 3T5FH 4B2AA 1P3CA 1IQLA 2OC7A 4B75A 3R3GB 2GCHF 1RFNA 3OTPA 1MMJN 1G3DA 1DS2E 2Q6GA 4Y0YE 2FTMA 1HRTH 1TRYA 5IYTA 1TPAE 4IMQA 3U1IB 2FXRA 1ZLRA 4BAHB 3NZIA 1GI1A 3NWUA 1FNIA 5GWZA 1UK4A 2HALA 1MD7A 1DM4B 5ESBA 1U6QA 2FEQH 2XWAA 2O8LA 3HGPA 3OX7U 5T6GA 3VB4A 3BTKE 2ZWLH 1KY9A 2BM2A 1TPPA 4HG6A 1KYNA 4IS5A 4E7RG 4GPGA 3QN7A 1TB6H 4X2YA 2HPPH 1W13U 1YP9A 1DY8A 1GMDG 4A1XA 2K1QA 2LP6A 3GCTF 3RMNH 1ETRH 4Y7AA 4CRCA 1EXFA 2WSSD 2ZPRA 2G5NA 2WPLS 1Z8IB 1SOZA 1LPKB 3E90B 1O37A 1MTNC 3PLKA 3ZZCA 3HK3B 4XSKU 4K1EA 1VCQA 3MNSA 1SFQB 5CHBA 1T31A 4IGDA 1GHBF 4OS5A 2OQ5A 3F9EA 3A8CA 3DSGA 4X1PU 4AB9A 3LJOA 1CBWB 3SO3A 3B23B 1F2SE 2R0KA 1Q31A 1FY4A 2JKHA 1ESBA 2ZP0H 2ALPA 1XUKA 3OAAD 2FS8A 3M7TA 3BG4B 3HKIB 3SNCA 1C9TA 1JOUB 2Z9IA 3KEEA 2OXSA 4B1TA 4U32A 2YNBA 1SB1H 3H7OA 1TGCA 1DUEA 1O2WA 3UOUA 3MQKC 1YPKH 1MQ5A 1IQJA 1UCYE 5AVDA 4DCDA 4NSYA 1Z8GA 2QGRA 1DLEA 1O2XA 5T6FA 1A0LA 1C1VH 2YMSC 1DXWA 1PQ8A 1YYY1 1DSUA 3P17H 1HAHH 2RFKC 3PV2A 4UEHH 4GCHG 1AI8H 3BTWE 1C5SA 3N7OA 2DE9A 1YCPM 1Z71A 1K0HA 3S0NA 3M3SA 4NIXA 2I6QA 2ZHWH 1NO9H 4I8KA 1LHEH 1EZXC 3ZVGA 4DIHH 2SGEE 2VVCA 4ISLA 1GBCA 1ELBA 3PWCA 1TOMH 5EOKA 3FKSD 5DJ7A 1FONA 1GG6C 2Z9GA 2WPMS 1H9IE 2J98B 4X8VH 2OD3B 1CT2E 1G3BA 1AZZA 4XOJA 1NT1A 3ZIAD 3PWBA 3T29A 1GMDF 1BTUA 4AC9A 1YKTA 2JIZD 1KIGH 2WZQA 1MTNB 1IOEA 2G8TA 3SJIA 2C3SA 1PQ5A 2ZFPH 3ZZ7A 1P11E 3GY5A 1J14A 2YNAA 1O2HA 2FWWA 1C5MD 1DUAA 4NWKA 2Z6BD 1RIWC 3BTEE 4D7GA 3RMOH 1TIOA 4ABAA 3U8RH 1C1OA 2G55A 2ZFQH 1GI3A 3BTTE 4ESTE 1B0EA 4CRDA 4ZHAA 4ZUHA 1OHHD 2WV9A 2FODA 1W0KD 4MPXA 1NU9A 1BMAA 1V6DA 3FFGA 4MG3A 5I25A 4FU8A 2C4FH 4ACAA 3M5LA 4KTSA 2FLBH 4OS6A 5GDSH 3MHWU 1SGFA 1GJBB 1LVOA 3GOVB 1UTNA 1TNHA 1KXFA 2M2AA 5EPNA 5AHGH 1Z6JH 1O38A 2WPJS 1NFUA 3F0PA 1GGDB 3RLYH 1BRCE 1ZMJA 1ZSJA 4JZEH 4WH6A 1V2LT 5HKKD 4BAKB 3QLPH 2PTCE 2ZHEH 1ZPBA 1W0YH 2YMSB 5JB9S 1MCVA 1BTHH 3SV7A 4HFPB 1QY6A 2J92A 1IQMA 3GY6A 1V2MT 3K6ZA 2GV6A 1THSH 2GT7A 1FXYA 4DOQA 3LC3A 1PPCE 2WPHS 1GJ9B 1GBFA 3ZVFA 2CF9H 1P57B 4OS1A 4ZKRU 1GG6B 2VVVA 1C2JA 5G4BA 5GPIB 1C1WH 3T62A 1QJ6B 3MNXA 4FUHA 3E3TA 4ZCNA 1QQUA 1BRUP 3BTHE 1TX6A 3RXIA 4WF8A 1SQRA 1S81A 2V3OH 5JBAS 5T3HA 2FOGA 1JMOH 1BT7A 1XVMA 5FL7D 1LCYA 1NRNH 3A86A 1GJ4H 5C1UA 1RIWB 1GMCF 1ZMNA 2VINA 1QL9A 1H4WA 1ESAA 1P05A 1L4DA 1P03A 3QUMP 1EJNA 1VCWA 5HMAA 4NIVA 3GICB 1HJ8A 3AW0A 3BEUA 3E8LA 1UCYH 2FI5E 1LO6A 4NWLA 1TLDA 3PV4A 2GDDA 2OTVA 3F2HA 3QX5H 1RD3B 1SMFE 4XD7D 3H09A 3E6PH 1UK3A 1LKAA 3ZZ5A 4O97A 3SOSA 2Q1JA 3LIWA 1MCTA 2ANWA 3TVJB 3F6UH 1GL1A 1QIXB 3ELAH 5EW1H 2W7SA 2KFWA 3F68H 3SU1A 1QQ4A 4YZUA 2HVXA 2P95A 3MH7A 3PTBA 3ZZ6A 5B6LA 1T8MA 1HAVB 1O2MA 1IQIA 1SSXA 1O5AB 4IN1A 1SGYE 4RI0A 1NN6A 3UQOA 2AEIH 1AY6H 4NZQA 4YT7H 1M9UA 3VB7A 4XFQA 1HLTH 3A81A 2PTNA 1CA8B 2L74A 1THRH 2A7HA 2H1UA 4MPUA 1C1TA 3F9GA 3QTVH 3ATLA 2HVYB 2VIVA 1FJSA 2VIWA 3QZQA 3UFAA 3RXEA 1MBMA 4CH8B 4X1SU 1KXCA 4Z1MD 3GY2A 5DK1A 1ZOMA 1TRMA 2EQNA 3HGNA 2FOFA 2NU2E 4NFFA 1AE5A 1C5UA 4TYDA 3SHCH 3STIA 1SGRE 1AQ7A 4Q63A 4WXIA 2NU4E 2I6SA 1RTLA 1BMNH 3VXEH 4ABJA 1MUEB 1Z7KA 1KDQA 5ABWA 4KP0A 3MYWA 2OK5A 1CHGA 1TBRH 2O8WA 3BTGE 2QE7D 1T8LA 2A4RA 4QT8C 1O3MA 4ABFA 1K1IA 1O5BB 2G52A 3MMGA 2P16A 4Y8YA 4ISNA 2NU0E 2QCYA 1W12U 1SFIA 3ZV9A 2J34A 3RP2A 1ZSKA 2GZ7A 4Y79A 1C1RA 1FIWA 2AIQA 2AMPA 3KN2A 3OE7D 2UUJB 3IWMA 4YXWD 6GCHF 1KLJH 1XXDA 4X2XA 1O5EH 1MKWK 1S84A 2IJOB 1OWIA 2FOEA 1WCZA 2CGAA 1H1BA 2HPQH 2XNIA 3RXPA 5EGMA 3NCLA 4ASUD 5EJ1A 3UIRA 1LTOA 1O31A 1GBBA 4MVNA 4D8NA 4JK5A 1ETSH 1FX0B 1YCPK 5F53A 4WXVA 1GHYH 4Q80A 1Z8JB 2WYJA 4LZ1H 1QRZA 2CK3D 1SOTA 4Y76A 1JBUH 3SGQE 2ZECA 4M9FA 1YPEH 5F8ZA 4D9QA 1E0FD 3M61U 3PMJA 4E06H 3GY4A 1A3EH 4O3TA 1QBNA 4BAMB 2HNTE 2XCNA 1GDNA 3F2FA 2AMDA 5A0AE 3A83A 3F2GA 4IMZA 6CHAC 3A7XA 1JIRA 2VU8E 3LGTA 2D8WA 1H8DH 4NA9H 1O32A 3Q77A 3SNAA 5DP9A 3FP8E 1TNIA 1WAYB 1YY3A 5GJ4B 1ARCA 1AKSA 1LHFH 2FPZA 2GMTC 1ZHPA 3LT3A 4IC6A 2A2XH 2F9OA 1ZZZA 4R0IA 1C1UH 1W14U 3TJVA 5FPYA 1VZQH 2ZU1A 4BTIB 1MKXK 1F5LA 6LPRA 2VWLA 2P94A 2QF5A 4RKJB 4FETA 4I8LA 4Y0ZE 3QDZB 3SNBA 1SLUB 4FOUC 2CHAC 5A8ZA 1V2VT 4ASHA 3VEQB 2JH5D 2P3TB 1Y3VA 5DO4H 2J94A 1IHSH 2UWLA 1O3PB 2HNTC 2UUYA 1O34A 1QB9A 2BDBA 3D62A 1W7GH 2FM2A 4DT4A 1F5KU 1EB2A 4IBLH 1EATA 1GMHF 3A7ZA 1A0JA 1O5GH 1GVLA 3RMMH 1HIAA 1VJ9U 3FZDA 2B7DH 1W2KH 3CS0A 1O3HA 3WW7A 3SV6A 4AFUA 2VBCA 4TY7A 1O2JA 1P2OA 5L2ZH 1QL8A 4FUEA 4RSPA 3BIVH 3VG8A 1SGTA 1W10U 4CREA 5LGOA 4SGBE 1FAXA 1P2IA 1TGTA 2B5TB 1SGPE 3DFLA 3AASA 1FPHH 1TMUH 1SGIB 1CO7E 1E37B 1P01A 5FCKA 1GVZA 3H7TA 2ODPA 3I77A 2HLCA 4UDWH 2C8ZB 3ZZBA 1S6LA 5FBIA 3NPSA 1TX7A 3RC6A 5TJXA 3RXFA 3V3MA 3LGVA 1DFPA 2AH4X 3F9FA 3TH3H 2GMTB 2XBYA 5A8XA 1NTPA 4OS7A 1BCUH 1KXDA 1QJ1B 1V2NT 2V3HH 5FX6A 1AWHB 1P8VC 4TWWA 3O8CA 2KCAA 1MU8B 2ZG0H 1HJAC 1OYTH 1Y8TA 2BDIA 3F3BA 1QTFA 2CHAB 2O8UA 3S7HB 4DIIH 2FOBA 3Q00A 1GBIA 2J95A 3BSQA 4O3UA 3BTQE 1T32A 4NCYA 1O2PA 4U30A 1GBJA 1XKAC 1CE5A 4P02A 1E38B 3OSYA 3ENSB 1TWXB 3SHAH 1SLWB 1GBDA 3SORA 2B9LA 2ANMH 2B8OH 4VGCC 3TGKE 4AX9H 1E1QD 2BDYA 4UFDH 5F6MA 1IQKA 3P8NA 2AIPA 1RTKA 4WMDA 3A84A 5C5NA 1G32B 1KTTB 5E0JA 5FPTA 1ANDA 2FOAA 2RDEA 2UUKB 3DFJA 1BRBE 1CHOF 4JZDH 3SU3A 5L6NH 1SQOA 5EPYA 3UNRA 1TMBH 3GYLB 1GHWH 2WHXA 2NU3E 4ACBA 5DG6A 1DSTA 4NFEA 2UWOA 1MAXA 3QGNB 1D3DB 3LOXA 4CBOA 4MLFB 2Y82A 2FOHA 3SNDA 4A5TS 1ESTA 3V0XA 1A5IA 3ZZ3A 4AG2A 2ZIQH 5CHAC 4IN2A 1O5FH 1DWDH 1IQEA 1TNLA 1UVOA 3MI4A 3OY6U 5A0CA 5A09A 1EJAA 2EEKA 1GHVH 1L4ZA 2Y7XA 3SQEE 1AVGH 1DDJA 4OGYA 1CT4E 2JETC 3M7UA 2ZHFH 1P10A 1OWKA 4GSOA 4ZXYH 1PJPA 4NIWA 1ZHMA 2BVRH 1LHDH 1HJAB 1VKYA 3O8BA 1Y3XA 3PMHB 1O2KA 4LZ4B 2A0QB 3BN9A 3O8DA 1TAWA 3AVZA 2ZGHA 3RXSA 4I8GA 3HATH 3SN8A 4MPVA 1XVOA 3GDSA 5C0TA 4HGCA 1GHAF 4WJG2 2BZAA 2XOKD 1E79D 1Y3WA 4DURA 9LPRA 4UE7H 4ABGA 4IW4E 1ANEA 1ZR0A 2H2ZA 1UVSH 4VGCB 4X6PA 1P2MA 1PPEE 1UTMA 2Z9KA 2NWNA 4CH2B 1HNEE 1EAXA 1CVWH 1T7CA 2PKAA 2ZDKA 4XBDA 1CA0C 5GIBA 3ZZAA 2A45B 1C1SA 3OYPA 1RS0A 3UUZA 1PQ7A 5C94A 1SL3A 1YLDA 2ZF0H 2Y7ZA 3S69A 1IQFA 1TGNA 2QXIA 4YLQH 3RXTA 1CT0E 1C2DA 2PHBA 2BY9X 2SFAA 1TNJA 1XUGA 3PRBA 2ZDMA 1IQNA 1O2OA 1GDQA 5CHAB 5T1VA 1QNJA 1S0RA 2H9TH 2GTBA 3ATWA 1AFEH 3TJNA 1P09A 4B74A 1AE8H 1AUTC 3RC4A 3FVFB 1HXFH 2VGCC 4ZHMU 1L2EA 2SGAA 1D3PB 1C1PA 4MNWA 1MABB 1G2LA 2G51A 2JETB 1WSSH 2OBOA 1BJVA 1QFKH 3M5OA 3RXDA 3BEFB 3SV9A 1GBEA 2W3KA 1EQ9A 1LHGH 2F9PA 2CJIA 1UHBB 4FUBA 2SGDE 1VGCC 1GBTA 5C1XA 1GI7B 3EYDA 2FX4A 1O2TA 1XX9A 2FYQA 4INLA 8GCHG 1P2JA 1RGQA 2CMYA 3SV2H 1LQEA 4Q7XA 2XTTB 1C2KA 4HTCH 1P9SA 3FP7E 5JYIA 2ZPQA 1K28D 3A89A 5K0HA 1S82A 2WYGA 5JB8S 4FUCA 2OLGA 3F1SB 5T6DA 5EW2H 3P92A 3ATMA 4O9VA 1CA0B 1DANH 1SGDE 3ZZ4A 1O2YA 3F0OA 4JZIA 1GI6A 5FBEA 5KEDA 1TA6A 5FXLA 2ZFSA 1BOQA 3OU0A 2GDEH 4A7IB 1DXPA 2AGIX 2W5EA 5BPEA 5EXMA 3E1XB 5TCCA 1S5SA 1C2MA 3CS7A 4INKA 2ZGJA 2J97A 2JJ1D 2GV7A 2KCPA 2XBVA 1GCTC 3S7KB 4XE4A 1O0DH 2C93B 2FI4E 1BBRH 1GJ8B 1EOLA 4TPYA 1KDQB 4WY3A 5FPSA 1HCGA 3OFND 3TU7H 3RXHA 2J2UA 2VGCB 1K2I1 2ZU5A 1EP5A 2RA0A 2J5UA 1P2KA 4AORA 2UUFB 3GCHC 1P2QA 1Z1IA 3UR6A 1LPGB 3A80A 2P3UB 1AHTH 1BZXE 1VGCB 1TRNA 1OPHB 3GYMA 2PSXA 4ZH8A 2QC2A 4RT1A 4UD9H 4E7NA 2D2DA 1C5LH 4B73A 3LKWA 5IDKA 2TGDA 3Q3KA 4FUIA 1TFXA 1VITG 3ESTA 2VH0A 1AU8A 2ZGBH 5DSFA 1VJAU 3SUDA 4YM9A 1N8OC 3TK6A 1GHXH 1P0SH 5DP4A 2WPDD 3N7DA 1EPTA 1V2WT 2BZ6H 2K8IA 4Y11E 1TPSA 3RXRA 5HIZA 4BOHA 1V2OT 3TK5A 2A31A 3SUGA 4NZLA 1BA8B 1IHTH 3RXMA 1C5OH 2AYWA 4ISOA 3A87A 1GI8B 4X2VA 4GCHF 3A7YA 1O5DH 1TA2A 3TJUA 1RXPA 5C20A 1IQHA 2BLOA 1DE7H 3AK5A 3MH6A 1COWD 1O3IA 1PFXC 2V3MA 3MFJA 4WWYA 1PPBH 1KLIH 1GCTB 1ZPCA 5F8TA 1G37A 3MO9A 5EJZA 7GCHG 2A4OA 2BHGA 2TRMA 3SW2B 1AKSB 1EJMA 2ANYA 3ZZ9A 1SR5C 1DPOA 1ARBA 1TONA 5C2ZA 3A8BA 1ZTJA 2KAIB 1NZQH 3GCHB 1NFXA 1W11U 4TWYA 1O3GA 4X8SH 2PP6A 3LGWA 3MU8A 4KELA 3WWBA 1UW7A 2PGQB 1F0SA 1S6HA 3GDVA 4Y10E 2Z94A 2WV5A 3KQCA 3RC5A 1MTSA 2SGPE 2ZGCA 4TY6A 2Q6DA 1QRWA 3AW1A 2D1JA 4OGXA 4H42U 1ZTLA 3MH5A 3U98H 3ZVBA 3KQDA 1UO6A 4FUGA 2H6MA 1F5RA 4HI3A 2XC5A 1SHHB 2J4IA 4FU7A 1N8OB 4DGJA 5L30H 1YPJH 3SNEA 2QXGA 2SNWA 2F43B 1HDTH 2ZO3H 3DSOA 4NA7A 2OQUA 4DW2U 5AFYH 1TNKA 1DWEH 1T4VH 1WDIA 3E16B 4ABIA 1SGQE 2ULLA 4BANB 2KZ4A 4X8TH 3VFEA 2ZCKP 2BDCA 3SU2A 1H8HD 1HAYB 5DKMA 3UAIC 1EB1H 2BX3A 1C2FA 1ACBE 3S9BA 1YC0A 1WBGB 5EQSA 2P8OC 2Z9JA 2V7QD 1OYQA 3KNXA 3TIUA 2HWLB 2AGGX 3STJA 1CGIE 2Y5FA 1H9LB 1AZ8A 1AFQC 3UB0A 1GHZA 1FIZA 5DP8A 1C2LA 3EA7A 3ZZ8A 4ISHH 2ZTYA 1NRPH 1UCYK 2A4QA 5HYOA 4TT3D 3UQVA 3PTNA 3PMBB 3P6ZB 2ODYB 5F8XA 3EA9A 4K8BA 3PRDA 2ILNA 5C5OA 1K1JA 3MNCA 1EOJA 1CU1A 3GDUA 1K1NA 4XRNA 5JBCS 1ID5H 1FY5A 3QK1A 5C3NA 3VB6A 3ZVDA 4ZXXH 3K65B 1O39A 4CR5A 1GI2A 3RXLA 1C5TA 1C4Y2 3TNSA 1HUTH 2BY8X 1ELCA 4WMEA 1Y3UA 3U8TH 1GBMA 1QB1A 1UTJA 2A32A 3T2NA 1B0FA 1WYKA 4I33A 4XBCA 3MU1A 3A8DA 5EIYA 4DJZB 3HKJB 1RJXB 3NRLA 1MU6B 1SC8U 2Y5GA 3CNRA 1SPJA 1ZTKA 4X1RU 2XWBI 1G30B 2W26A 2HRVA 1O2IA 1W8BH 3UOPA 3QTOH 4OS4A 1Q3XA 3TPIZ 1BTZA 3GCNA 1UTOA 1BJUA 3I29A 1G9IE 2R2MB 1ELAA 3VXFH 4CHAC 1B5GH 1Y5BT 3LGYA 1NFYA 4GAWA 3ZVAA 1OP0A 1UTQA 2QF3A 2Z3EA 4J2YB 1AFQB 1L1GA 1K1OA 1Z1JA 3KIDU 3PYHA 1O2RA 1BHXB 1WU1A 3QZRA 4K1SA 1OWEA 4M7GA 3PO1C 5F03A 1ZRKA 4AFZA 4F48B 1AD8H 2OUAA 2VH6A 3E0NB 1AO5A 1C5XB 3SBKA 3A82A 2J38A 2BQWB 1FI8A 1VITH 2ZFFH 1OWJA 3OTJE 4H4FA 4I32A 1THPB 2Y81A 2PWXA 1JWTA 4E05H 3C1KA 3VGCC 2FO9A 4D76A 4DG4A 4B2CA 5HM2A 4ZMAH 4LXBH 3LU9B 4ZKOU 1XXFA 2XC0A 2STAE 5LPEA 3SQHE 2ZFTA 3MO3A 3OY5U 2R9PA 4OM9A 1QGFA 5E0HA 1UTLM 2BD5A 2HGTH 3IITA 3SU0A 3EA8A 2GCTC 1ELTA 4YLUA 2KM0A 4U2WA 1BMMH 4KKDA 3MH4A 1FN8A 1QCPA 2G4UA 3BG8A 1S85A 4UFEH 3RXBA 5E8EH 1GI0A 2EI6A 3PB1E 2QF0A 1WOFA 1HAOH 5DP5A 1YM0A 3Q3XA 3ATKA 1AWFH 1SHYA 3SJ9A 1OX1A 5GCHG 2PKAB 4FU9A 3TGJE 1C5VA 3QO6A 1HAVA 1MH0A 3UPEA 1WV7H 1OWDA 3SYJA 1GDUA 1F92A 9ESTA 3A88A 3BTDE 1QB6A 4CHAB 4THNH 5JPMH 4JYVH 1J17T 4TSFD 2EA3A 6CHAB 5K7RA 2BLVA 5FX5A 1AVXA 2IOTA 1ORFA 4AYVB 4FVDA 2W6JD 1BB0B 1ZHRA 1MZAA 2EI8A 3SU6A 3NUMA 4WVPE 2Y80A 3PO1B 1GL0E 5BRRE 2H5DA 4JZ1A 4JMYA 4ABBA 2GJGA 2ZTXA 1O36A 2C8XB 2VWOA 1O3FA 2TPIZ 2KX4A 3VGCB 2QN5T 2IJD1 1D4PB 2RG3A 1ZSLA 2UWPA 3A85A 4JZFH 4X6MA 2W3IA 1C2EA 2AS9A 2VWMA 1SVPA 1O2LA 1GI5A 1L0ZA 2GP9B 3W95A 3FN8A 1A1RA 1BUIA 1FV9A 1L1NA 1TQ7B 3MTYA 1V2JT 5DPAA 1WTHD 1BTPA 2F91A 3NK8A 2QF4A 2GCTB 1ABIH 1O3KA 2A1DB 4KTCA 5LH8A 2PFEA 1NROH 2GCHG 1HAXB 2ESTE 3FANA 1KSNA 2Y6TA 4Q4LA 1ZMLA 1EPTC 2NU1E 3M37A 2QYIA 2ZCLP 2SNVA 1BMLA 3E91A 2CXVA 4YOIA 3U9AH 2BY7X 3EE0B 2RCEA 3ZZDA 1HV7A 5SGAE 2WUCA 2L6OA 1LVBA 4GHQA 2BD2A 4FUDA 3T27A 1J15A 4CBNA 2D26C 4AFSA 1UVUH 1ABJH 3A7TA 4FUFA 3MU4A 2V6NA 1O3LA 1PQAA 1EAWA 2PGBB 5A2MH 2Z3CA 1AUJA 2OCVB 1NBME 1P02A 1ELGA 1LMWB 2GVFA 3SU5A 4YT6H 3SI3H 1UTPA 2W7UA 1NRRH 4BXSA 1KLTA 2FTLE 3GCTG 1UJ1A 4F49A 4MQAA 3UWIA 2XCFA 5EQRA 3LC5A 4XDEA 4BXWA 1S83A 3R0FA 2A2QH 5AFZH 3BEIB 2CF8H 1TGSZ 2OC0A 3ODDA 2XW9A 2ZTZA 3GCOA 1NPMA 2TGAA 2H9HA 1E35B 1FLEE 3KQ5A 1TBZH 1SBWA 1GJ6A 3SUFA 1GHBG 3TH4H 4NGAH 1VR1H 2F4LA 3AAVA 1A2CH 1GI9B 2VB0A 3OEED 1P2NA 2AHME 3MU0A 2BD7A 5C0UA 2B0FA 2AERH 1NRQH 1PYTD 3EAJA 1TOCB 1KXBA 5FCRA 1C1QA 1YPHE 4R8TB 4ZHLU 3SV8A 1X7AC 3U8OH 3M3TA 1RRKA 1TQ0B 5FHTA 2TIOA 1GJDB 3MU5A 3LPRA 1V2ST 2RDLA 4Q7ZA 2ZKSA 3WY8A 1LVMA 1IAUA 4K2YA 1O3DA 4K1TA 1TYNA 2F9BH 1EPTB 2JH0D 1K1MA 1ZYOA 1A4WH 2A5AA 1OXGA 1K22H 4AYYB 5JBBS 1HB0B 1HFDA 3BTME 1TMTH 4ABHA 1BQYA 5EXNA 1O2ZA 4MNXA 3SGBE 1PPGE 2G00A 2V0BA 1T8NA 1O2UA 4F55A 5E2PA 4X1NU 1S6FA 3LDXH 4WMFA 3EQ0H 3GY8A 3UNQA 3NKKA 1HAIH 1OSSA 1HPGA 1UVPA 1O2QA 3RDZA 1H9HE 5EODA 1P06A 1WTGH 2W6ID 1YPHC 4GHTA 1A3BH 4IC5A 1TALA 4D9RA 3FZZA 3DD2H 2G5VA 5A8YA 3CENA 1QR3E 4SGAE 1EKBB 3JZ2B 1YPMH 3GS9A 2ALVA 1GPZA 1A5GH 5EG4A 3MO6A 2BOHB 1K1LA 5KGOA 1TNGA 2ZHQH 5EU8A 4HZHA 1C2GA 1NRSH 4YTAA 1QJ7B 3ZYDA 1XUHA 2OBQA 5HXFA 1DWBH 5TCAA 5GXPA 1NESE 3RXVA 1EASA 4GLYA 3WWFA 1HAGE 3KGPA 3PM3A 4Z0KA 3RXJA 2G81E 1ELDE 1XKBC 3DHKH 3W1EA 1NS3A 4AG1A 1MTUA 1FUJA 2IPHA 2V35A 3M7QA 1GJAB 3UREA 4BTTB 2OC8A 1TABE 1OP8A 4DT7B 3V12A 1B7XB 3MOCA 2BDAA 3RM2H 2QXHA 2EY4C 4X8UH 3VB5A 1V2RT 4B71A 1LDTT 4JK6A 1C5YB 4NIYA 2BD8A 4Q7YA 3RU4T 3W94A 1W7XH 5FAHA 2HOBA 2R3YA 4Q2KA 1O3EA 4WH8A 8ESTE 3EE7A 2BVSH 3TH2H 2ZDLA 1C4V2 4MDSA 4ABDA 2VVUA 1ZJKA 3P8GA 1GGDC 1C5PA 3KQBA 3P95A 4AB8A 1YBWA 1IQGA 1BTXA 3CP7A 1O2GH 1QL7A 4JYTA 2Y5HA 2PUQH 4K60A 1KXEA 3S9AA 1AVWA 3L33A 2GX4A 5JBTA 1C9PA 1W3CA 3RU4E 2FDAA 2PUXB 1H8ED 2KCYA 2RA3A 4A92A 4ZROA 2A7CA 2ANKH 3UTUH 1V3XA 1PPHE 4UFGH 1QRXA 3FAOA 1JRSA 1GBAA 5H4IB 1GJCB 3RM0H 3URCA 2BY6X 1QURH 1J16A 1YLNA 4B76A 1GMCG 2BLQA 1ZGVA 3O8RA 2FOCA 2VWNA 1A61H 4NSVA 2TGTA 1T4UH 1J9CH 1ELEE 2XBXA 6ESTA 2GT8A 3QGJA 1HJ9A 1K9OE 3LGIA 1SLXB 2CV3A 3RLWH 1FDPA 4ZKNU 5IK2D 3ITIA 1YPLH 3H5CB 1XUJA 1DICA 2M5TA 3E0PB 3HK6B 1WQVH 1YWUA 3DSPA 1C5WB 1O3BA 2KCOA 2PSYA 5EXLA 8GCHF 1LQDB 5DN6D 2ZPSA 1FMGA 5J4QA 1OOKB 8KME2
chains in the Genus database with same CATH topology
1NC6A 4MTBA 4ABEA 3Q3YA 3SJ8A 2ZGXH 5ESTE 7ESTE 1MTVA 1XM1A 3PMAB 3MNBA 1BDAA 2AMQA 2O8MA 4I31A 2ZU4A 1F0TA 5J4SA 2R0LA 4Y8XA 1PYTC 1ELVA 3G01A 2ZA5A 1BBRK 3T25A 4AFQA 4H6TA 4LOYH 1XUIA 2R3UA 4BAQB 3ATIA 2F83A 3RXGA 2GGVB 3SU4A 2O8TA 2AFQB 4MPWA 4YOGA 1CQQA 1KXAA 1Y3YA 1O3CA 2BD3A 4CRFA 3B9FH 2VNTA 2Z7FE 2BD9A 3PLPA 2ASUB 2C8YB 3RXUA 3RMLH 4J1YA 1D3QB 1OKXA 1PPZA 1L1JA 3FP6E 2VIDA 1ZRBA 1XUFA 4NG9H 3BV9B 2BQ7B 1GJ7B 3TJOA 3UR9A 1S0QA 3SUEA 3SJKA 1C2IA 1O3NA 1V2UT 1D3TB 1XMNB 1NU7B 5A0BA 4PROA 3ZYEA 1UVTH 1O33A 1SGCA 1DLKB 1E36B 6GCHG 3KCGH 2STBE 3A7WA 1UHBA 5AF9H 1BHXF 1C5NH 1GJ5H 3VPKA 3SJOA 3P8FA 1QBVH 1VITF 1C5RA 3F9HA 2FESH 1HIAB 2H9EH 2BVXH 2A5KA 2GZ9A 4K69A 3UNSA 2ZNKH 1GBLA 8LPRA 1JXPA 2BLWA 1DOJA 3TNTA 2F9NA 2A7JA 4ZAEA 1FN6A 1A0HB 4LK4A 3D65E 3D23A 3TLOA 1O3AA 1FAKH 1NM6A 2ZCHP 3LH1A 2Z3DA 1V2QT 1AB9C 1O3JA 3DUXH 2F9UA 2FP7B 1MKWH 4CRBA 2OINA 1FY8E 3T26A 4BNRA 4AOQA 1FY3A 3KF2A 2O9QA 1EZSC 1YCPH 1Y59T 3K6YA 1TBQH 1O35A 1F0UA 2FYRA 2FIRH 4KGAA 1E34B 1DX5M 1BRAA 2WINI 2XBWA 1H8IH 1FPCH 1DWCH 1CGJE 3L3TA 1K1PA 7GCHF 1FQ3A 4X6OA 1SI5H 4CR9A 2ZEBA 7KMEH 5EQQA 1ZPZA 4DVAU 1FY1A 1NY22 2FLRH 2DE8A 1D6RA 1SGNE 1GBHA 1QBOA 2ZU2A 2EC9H 1MAYA 2PLXA 5PTPA 1YGCH 3KQEA 1SLVB 2ZU3A 4Y71A 2TBSA 2ZDAH 4FXGH 5LPFA 1SG8B 2BYAX 1P12E 1UTKA 1F7ZA 3GY3A 4JCNA 3D49H 1GCDA 2WV4A 1A46H 1PPFE 3A8AA 1Y5UT 1LKBA 1TPOA 4JYUH 1EZUC 3EGKH 3LGUA 3TGIE 2XRCA 3P8OA 1GMHG 1MKXH 3M36A 1QA7A 1P9UA 1UMAH 1HAPH 2FS9A 2P3FH 4TPIZ 2H5CA 2QIQA 2OC1A 2P8OB 4K3JA 4O03A 1SGFG 1AB9B 1N6XA 3P70B 4BTUB 3PLBA 1G3CA 1FZZA 2SGFE 4X0WU 4CRGA 3LJJA 4YOJA 4BAOB 3ODFA 4I8HA 3LH3A 1D9IA 4YO9A 1TE0A 2HNTF 2PV9B 1N6YA 2BDGA 1F0RA 3M35A 5LPRA 4MNVA 3RXQA 4FUJA 3RXOA 4X1QU 1O2NA 1SGEE 1WUNH 2TGPZ 1NFWA 3LONA 5L2YH 1AGJA 1GBKA 1C1NA 1LPZB 1P04A 2VIQA 1V2TT 2ZI2H 1DT2A 1ZGIA 1EX3A 2YOLA 3PROA 4OS2A 2VJ1A 3V7TA 1EAUA 4YESB 1TGBA 2GKVE 3GY7A 1HGTH 1LVYA 1VCPA 2KAIA 2XYAA 3UWJH 4X2WA 1Z6EA 2BTCE 2FI3E 4H6SB 2THFB 2ZQ2A 1MTWA 4ZKSU 5CMXH 1P3EA 4UONA 1QHRB 1AN1E 3BIUH 3BF6H 3RXAA 3VB3A 1TX8A 1INCA 2QA9E 3M5MA 4RKOB 3DT0H 3RUOA 3K9XB 3B8JA 1ZJDA 1MZDA 2EI7A 2GZ8A 1CSOE 2Z9LA 5DP7A 1UK2A 1EAIA 2CN0H 2PW8H 2QAAA 4Y7BA 1A7SA 2QXJA 4I7YH 1Y5AT 3C27B 2C8WB 1HBTH 1J8AA 3SGAE 3NXPA 1QA0A 7LPRA 1CHOG 1OP2A 1HXEH 2ZDNA 2AGEX 1AMHA 1SQTA 1W0ZU 3IG6B 3S9CA 2A4GA 2BB4A 3K2UA 3U69H 2WUBA 1EZQA 1ANCA 2XXLA 3ZVCA 4Z6AH 4RN6A 4Y6DA 1T8OA 2BD4A 4K8YA 1KTSB 3RXKA 1OWHA 1O5CB 1O2VA 1HAZB 2QV1A 5C1YA 3BTFE 4A1TA 1GI4A 3Q76A 2ODQA 1DVAH 5DP6A 1SQAA 2BXTH 4Y8ZA 2BOKA 2LPRA 2PR3A 5E2OA 1ELFA 4A6LA 3MWIU 2FZZA 3ZVEA 3V13A 1G2MA 2PKSC 1YLCA 3DA9B 3KL6A 2OP9A 2F9VA 5CE1A 2ZC9H 3SZNA 5C67A 2ZDVH 4FVBA 2ZFRH 1AIXH 1RTFB 2LNCA 4U01A 2Q6FA 1BITA 1EUFA 3TITA 1GHAG 5HGGA 4K5ZA 1N1LA 3KHVA 5I46H 4D7FA 3L6PA 1MQ6A 2J9NA 1BIOA 4AN7A 4DY7B 2GD4B 2BX4A 2BXUH 1YPGH 4CRAA 3UY9A 2ZQ1A 5DGJA 1C5QA 1JRTA 1O2SA 2P59A 4XBBA 1O30A 4AGKA 4MNYA 2WPIS 1A5HA 1Q2WA 1MD8A 2FX6A 5GCHF 4F4OC 2ZZUH 4X6NA 1DY9A 2R2WU 4NA8A 1C1MA 5ETXA 5B6OA 1V2KT 2WPKS 1ETTH 1HYLA 2VIOA 1EP6A 3AAUA 4AGJA 5JDUB 1WQSA 3M3VA 3EDXB 2JH6D 2ZHDA 1BTWA 5DP3A 1BTYA 4ISIH 2FMJA 1C4U2 1D6WA 1V2PT 1Z8RA 3RU4D 4INHA 1DITH 3A7VA 2XC4A 3TK9A 1YF4A 3U1JB 2FOMB 1MBQA 4UFFH 1LHCH 2G4TA 4GUXA 1JIMA 1G36A 1G3EA 1GWAA 3QWCH 3SI4H 2PKSB 1O3OA 3I78A 3ZV8A 5HM9A 3HPTB 3URDA 2BDHA 2BY5X 4A1VA 2QY0B 1CBWC 3GISB 2DUCA 2VIPA 3T28A 1ANBA 2P93A 1C2HA 1OS8A 3JZ1B 1CGHA 2F3CE 3M5NA 4I8JA 1K21H 4AZ2B 5E0GA 2BQ6B 4GVUA 1BBRE 2A5IA 2IN2A 1C5ZB 3BG4C 3RXCA 4B2BA 1GVKB 2SGQE 4KTUA 2C90B 2BMGB 3T5FH 4B2AA 1P3CA 1IQLA 2OC7A 4B75A 3R3GB 2GCHF 1RFNA 1MMJN 1G3DA 1DS2E 2Q6GA 4Y0YE 2FTMA 1HRTH 1TRYA 5IYTA 1TPAE 4IMQA 3U1IB 2FXRA 1ZLRA 4BAHB 3NZIA 1GI1A 3NWUA 1FNIA 5GWZA 1UK4A 2HALA 1MD7A 1DM4B 5ESBA 1U6QA 2FEQH 2XWAA 2O8LA 3HGPA 3OX7U 5T6GA 3VB4A 3BTKE 2ZWLH 1KY9A 2BM2A 1TPPA 1KYNA 4IS5A 4E7RG 4GPGA 3QN7A 1TB6H 4X2YA 2HPPH 1W13U 1YP9A 1DY8A 1GMDG 4A1XA 2K1QA 3GCTF 3RMNH 1ETRH 4Y7AA 4CRCA 1EXFA 2ZPRA 2G5NA 2WPLS 1Z8IB 1SOZA 1LPKB 3E90B 1O37A 1MTNC 3PLKA 3ZZCA 3HK3B 4XSKU 4K1EA 1VCQA 3MNSA 1SFQB 1T31A 4IGDA 1GHBF 4OS5A 2OQ5A 3F9EA 3A8CA 4X1PU 4AB9A 3LJOA 1CBWB 3SO3A 3B23B 1F2SE 2R0KA 1Q31A 1FY4A 2JKHA 1ESBA 2ZP0H 2ALPA 1XUKA 2FS8A 3M7TA 3BG4B 3HKIB 3SNCA 1C9TA 1JOUB 2Z9IA 3KEEA 2OXSA 4B1TA 4U32A 2YNBA 1SB1H 3H7OA 1TGCA 1DUEA 1O2WA 3UOUA 1YPKH 1MQ5A 1IQJA 1UCYE 5AVDA 4DCDA 4NSYA 1Z8GA 2QGRA 1DLEA 1O2XA 5T6FA 1A0LA 1C1VH 1DXWA 1PQ8A 1YYY1 1DSUA 3P17H 1HAHH 4UEHH 4GCHG 1AI8H 3BTWE 1C5SA 3N7OA 2DE9A 1YCPM 1Z71A 3S0NA 3M3SA 4NIXA 2I6QA 2ZHWH 1NO9H 4I8KA 1LHEH 1EZXC 3ZVGA 4DIHH 2SGEE 2VVCA 4ISLA 1GBCA 1ELBA 3PWCA 1TOMH 5EOKA 5DJ7A 1FONA 1GG6C 2Z9GA 2WPMS 1H9IE 4X8VH 2OD3B 1CT2E 1G3BA 1AZZA 4XOJA 1NT1A 3PWBA 3T29A 1GMDF 1BTUA 1YKTA 1KIGH 1MTNB 1IOEA 2G8TA 3SJIA 2C3SA 1PQ5A 2ZFPH 3ZZ7A 1P11E 3GY5A 1J14A 2YNAA 1O2HA 2FWWA 1C5MD 1DUAA 4NWKA 2Z6BD 1RIWC 3BTEE 4D7GA 3RMOH 1TIOA 4ABAA 3U8RH 1C1OA 2G55A 2ZFQH 1GI3A 3BTTE 4ESTE 1B0EA 4CRDA 4ZHAA 4ZUHA 2FODA 4MPXA 1NU9A 1BMAA 1V6DA 3FFGA 4MG3A 5I25A 4FU8A 2C4FH 3M5LA 4KTSA 2FLBH 4OS6A 5GDSH 3MHWU 1SGFA 1GJBB 1LVOA 3GOVB 1UTNA 1TNHA 1KXFA 5EPNA 5AHGH 1Z6JH 1O38A 2WPJS 1NFUA 1GGDB 3RLYH 1BRCE 1ZMJA 1ZSJA 4JZEH 4WH6A 1V2LT 4BAKB 3QLPH 2PTCE 2ZHEH 1ZPBA 1W0YH 5JB9S 1MCVA 1BTHH 3SV7A 4HFPB 1QY6A 2J92A 1IQMA 3GY6A 1V2MT 3K6ZA 2GV6A 1THSH 2GT7A 1FXYA 4DOQA 3LC3A 1PPCE 2WPHS 1GJ9B 1GBFA 3ZVFA 2CF9H 1P57B 4OS1A 4ZKRU 1GG6B 2VVVA 1C2JA 5G4BA 5GPIB 1C1WH 3T62A 1QJ6B 3MNXA 4FUHA 3E3TA 1QQUA 1BRUP 3BTHE 1TX6A 3RXIA 4WF8A 1S81A 2V3OH 5JBAS 5T3HA 2FOGA 1JMOH 1BT7A 1XVMA 1LCYA 1NRNH 3A86A 1GJ4H 5C1UA 1RIWB 1GMCF 1ZMNA 2VINA 1QL9A 1H4WA 1ESAA 1P05A 1L4DA 1P03A 3QUMP 1EJNA 1VCWA 5HMAA 4NIVA 3GICB 1HJ8A 3AW0A 3BEUA 3E8LA 1UCYH 2FI5E 1LO6A 4NWLA 1TLDA 3PV4A 2GDDA 2OTVA 3QX5H 1RD3B 1SMFE 3E6PH 1UK3A 1LKAA 3ZZ5A 4O97A 3SOSA 2Q1JA 3LIWA 1MCTA 2ANWA 3TVJB 3F6UH 1GL1A 1QIXB 3ELAH 5EW1H 2W7SA 3F68H 3SU1A 1QQ4A 4YZUA 2HVXA 2P95A 3MH7A 3PTBA 3ZZ6A 1T8MA 1HAVB 1O2MA 1IQIA 1SSXA 1O5AB 4IN1A 1SGYE 1NN6A 3UQOA 2AEIH 1AY6H 4NZQA 4YT7H 1M9UA 3VB7A 4XFQA 1HLTH 3A81A 2PTNA 1CA8B 1THRH 2A7HA 2H1UA 4MPUA 1C1TA 3F9GA 3QTVH 3ATLA 2VIVA 1FJSA 2VIWA 3QZQA 3UFAA 3RXEA 1MBMA 4CH8B 4X1SU 1KXCA 3GY2A 5DK1A 1ZOMA 1TRMA 3HGNA 2FOFA 2NU2E 4NFFA 1AE5A 1C5UA 4TYDA 3SHCH 3STIA 1SGRE 1AQ7A 4WXIA 2NU4E 2I6SA 1RTLA 1BMNH 3VXEH 4ABJA 1MUEB 1Z7KA 1KDQA 5ABWA 4KP0A 3MYWA 1CHGA 1TBRH 2O8WA 3BTGE 1T8LA 2A4RA 4QT8C 1O3MA 4ABFA 1K1IA 1O5BB 2G52A 3MMGA 2P16A 4Y8YA 4ISNA 2NU0E 2QCYA 1W12U 1SFIA 3ZV9A 2J34A 3RP2A 1ZSKA 2GZ7A 4Y79A 1C1RA 1FIWA 2AIQA 2AMPA 3KN2A 2UUJB 3IWMA 6GCHF 1KLJH 1XXDA 4X2XA 1O5EH 1MKWK 1S84A 2IJOB 1OWIA 2FOEA 1WCZA 2CGAA 1H1BA 2HPQH 2XNIA 3RXPA 5EGMA 3NCLA 3UIRA 1LTOA 1O31A 1GBBA 4MVNA 4D8NA 4JK5A 1ETSH 1YCPK 4WXVA 1GHYH 4Q80A 1Z8JB 2WYJA 4LZ1H 1QRZA 1SOTA 4Y76A 1JBUH 3SGQE 2ZECA 1YPEH 5F8ZA 4D9QA 1E0FD 3M61U 3PMJA 4E06H 3GY4A 1A3EH 4O3TA 1QBNA 4BAMB 2HNTE 2XCNA 1GDNA 2AMDA 5A0AE 3A83A 6CHAC 4IMZA 3A7XA 1JIRA 2VU8E 3LGTA 2D8WA 1H8DH 4NA9H 1O32A 3Q77A 3SNAA 5DP9A 3FP8E 1TNIA 1WAYB 5GJ4B 1ARCA 1AKSA 1LHFH 2FPZA 2GMTC 1ZHPA 3LT3A 4IC6A 2A2XH 2F9OA 1ZZZA 4R0IA 1C1UH 1W14U 3TJVA 5FPYA 1VZQH 2ZU1A 4BTIB 1MKXK 1F5LA 6LPRA 2VWLA 2P94A 4RKJB 4I8LA 4Y0ZE 3QDZB 3SNBA 1SLUB 2CHAC 5A8ZA 1V2VT 4ASHA 3VEQB 2JH5D 2P3TB 1Y3VA 5DO4H 2J94A 1IHSH 2UWLA 1O3PB 2HNTC 2UUYA 1O34A 1QB9A 2BDBA 3D62A 1W7GH 2FM2A 1F5KU 1EB2A 4IBLH 1EATA 1GMHF 3A7ZA 1A0JA 1O5GH 1GVLA 3RMMH 1HIAA 1VJ9U 3FZDA 2B7DH 1W2KH 3CS0A 1O3HA 3SV6A 4AFUA 4TY7A 1O2JA 1P2OA 5L2ZH 1QL8A 4FUEA 4RSPA 3BIVH 5LGOA 1SGTA 1W10U 4CREA 4SGBE 1FAXA 1P2IA 1TGTA 2B5TB 1SGPE 3DFLA 3AASA 1FPHH 1TMUH 1SGIB 1CO7E 1E37B 1P01A 5FCKA 1GVZA 3H7TA 2ODPA 3I77A 2HLCA 4UDWH 2C8ZB 3ZZBA 5FBIA 3NPSA 1TX7A 3RC6A 5TJXA 3RXFA 3V3MA 3LGVA 1DFPA 2AH4X 3F9FA 3TH3H 2GMTB 2XBYA 5A8XA 1NTPA 4OS7A 1BCUH 1KXDA 1QJ1B 1V2NT