4ASHA

Crystal structure of the ns6 protease from murine norovirus 1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
184
structure length
177
Chain Sequence
SAPVSIWSRVVQFGTGWGFWVSGHVFITAKHVAPPKGTEIFGRKPGDFTVTSSGDFLKYYFTSAVRPDIPAMVLENGCQEGVVASVLVKRASGEMLALAVRMGSQAAIKIGSAVVHGQTGMLLTDLGTIPGDAGCPYVYKKGNTWVVIGVHVAATRSGNTVIAATHGEPTLEALEFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords NS6 PROTEASE
publication title Structure of a Murine Norovirus Ns6 Protease-Product Complex Revealed by Adventitious Crystallisation.
pubmed doi rcsb
source organism Murine norovirus 1
total genus 35
structure length 177
sequence length 184
chains with identical sequence B
ec nomenclature ec 3.4.22.66: Calicivirin.
pdb deposition date 2012-05-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ashA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ashA01
1B7XB 2F9UA 1ANDA 1RFNA 3P8OA 1A0LA 4NWKA 5FCRA 2FIRH 2V3HH 5GDSH 4I7YH 3SV9A 3T27A 1LPKB 4CH8B 1BA8B 4ISLA 1P2IA 3IG6B 4YT7H 2A0QB 4O3TA 2GZ7A 2VGCB 4TYDA 1UK2A 3B9FH 1SOZA 2QXGA 3ZZAA 1UTLM 1NRSH 4INHA 2GDDA 1GDNA 1WV7H 3GICB 1A61H 3GCOA 4ABEA 1O5CB 5DGJA 1O2LA 3SHAH 2BY8X 7KMEH 1BTWA 2A1DB 1GJCB 3V3MA 1A3EH 1XXFA 1Z8IB 2B9LA 4MPUA 1OKXA 4B75A 1O2WA 4DIIH 1O2JA 4X8TH 1YCPM 4FU7A 5EPYA 3F6UH 1YPHC 1PYTC 3RU4T 3NCLA 1NFXA 2FS9A 3Q3YA 2ZGJA 2Q6FA 2PKSB 4B2CA 2R3UA 1C1WH 3S9AA 4IBLH 4I8GA 1SQTA 2W7SA 3SI4H 1H4WA 5A8YA 3R3GB 3TK9A 2FDAA 2P95A 2GX4A 5JDUB 2PWXA 3M36A 2FYQA 2BDIA 4DJZB 3S7KB 1VCPA 1LVBA 3S0NA 5HMAA 3ATIA 4Y10E 1C5TA 1NZQH 3SGAE 1CA0C 1TFXA 1NM6A 6CHAC 3M61U 2H9TH 1THRH 1EXFA 1VCQA 4X0WU 2WUCA 2G8TA 1C2IA 1ELTA 6GCHG 5JB9S 1D6RA 1O5FH 4MLFB 1ELVA 4AZ2B 8LPRA 1XMNB 5FBIA 3KF2A 1SVPA 1W12U 7GCHF 4X1PU 3SW2B 1LMWB 1TNLA 1K28D 5E2OA 1OOKB 2EI7A 2FOEA 1BHXB 2QV1A 2UWLA 4O3UA 1GDQA 1LO6A 3CS7A 2D1JA 3CENA 3RU4D 4AX9H 3MWIU 3MHWU 2G55A 3LU9B 4X1RU 1O2TA 1BOQA 1ELBA 2P94A 3D62A 1ZJDA 8KME2 2C3SA 1F0TA 1GMHF 1EB2A 1KYNA 2GDEH 1XUHA 5GCHF 2BD3A 3AASA 1E0FD 2CMYA 5FX5A 1BMAA 2G5VA 1ZLRA 1MZAA 1A7SA 2A4RA 2ZNKH 3A7XA 1WOFA 5L2ZH 2H9EH 3BTKE 1PPHE 1SB1H 2J34A 1Z6EA 2FMJA 1FY1A 2SGFE 1V6DA 3SN8A 3PMHB 1UTOA 4CR9A 1LPZB 5AHGH 1A0JA 2BB4A 7GCHG 4R0IA 2ZFSA 4GVUA 1ETRH 1FI8A 3URDA 1GCTC 5C5NA 2Q6DA 5DP9A 4CREA 3SQHE 5DP5A 3F9FA 3LJJA 2ZTZA 3RXCA 3UTUH 1LHGH 2Z3CA 9ESTA 1D6WA 4PROA 1S0QA 1ZHMA 2QF3A 3VXEH 4D8NA 3PLBA 2FO9A 1NU7B 4A92A 2XW9A 1AZ8A 3SUEA 3V0XA 1NESE 4AFQA 4Q7YA 1GGDC 1GHAF 1C1SA 1C5OH 1GBAA 2F9VA 3LGUA 3LPRA 1Q31A 4XOJA 3HK3B 4ISHH 3QLPH 1XUGA 2FOMB 3PLPA 3I77A 1SHHB 3PO1C 1V2LT 1RIWB 1PPFE 4DGJA 3RXDA 4THNH 4NSYA 3FFGA 4KELA 4D7GA 4MNXA 1V2OT 4VGCB 5A0AE 1IQGA 2BMGB 2THFB 3OTJE 2WPHS 4WVPE 2ULLA 1FLEE 3MO9A 1YYY1 3VXFH 1N8OC 1LTOA 5I46H 4YZUA 1RGQA 1IAUA 1HJAB 3TH2H 1H9LB 1XXDA 1QRZA 2XBVA 4UE7H 4K1TA 3UIRA 5FAHA 1LQDB 3RXOA 3RXTA 1YBWA 4Y0ZE 1Y3VA 4D9QA 2GCTB 1HIAA 1EUFA 1GVKB 2BD4A 1CBWC 1O3CA 1TMBH 4WXVA 3PYHA 2WYJA 1AVXA 4X6MA 4HGCA 1V2TT 1WQVH 1HPGA 4LK4A 1G3DA 2QF0A 4X2YA 1ORFA 2OC0A 3M3SA 3VB6A 4NSVA 1AU8A 2R0KA 4KTCA 1C5UA 2J4IA 3U8TH 3TGIE 1O36A 3LJOA 3RU4E 1AB9B 3HATH 5C20A 1QURH 3E0PB 1AKSB 1NY22 1Z8GA 1AD8H 1ZPZA 3TK5A 1WUNH 1GBBA 1SPJA 1D3PB 6LPRA 1SL3A 1P03A 1P11E 2FI5E 2AMPA 1IQIA 2FTMA 3OYPA 1UHBB 1AQ7A 2ZDAH 3UR6A 2PKAB 3GYMA 2QGRA 2TGAA 3VPKA 3QDZB 4I8HA 2IN2A 1AFQB 2G4UA 2UWOA 4ISNA 4YLQH 3TK6A 4AG1A 1NRNH 2PW8H 4TY6A 1P0SH 3SGQE 3S9CA 2ZKSA 4OGXA 4Y7BA 2TPIZ 3QX5H 2BLVA 4K8YA 3EE0B 2TBSA 1T4UH 1QJ6B 1T32A 4X8UH 3UFAA 1W2KH 1O2UA 1NN6A 3GY6A 4ESTE 1YKTA 1ZYOA 2FI3E 4X2WA 3K6YA 3V7TA 1FV9A 4KGAA 2W3KA 2B5TB 1BBRK 2Q6GA 1P04A 1QJ1B 1JIMA 1X7AC 1P02A 4IGDA 3SJ9A 2VIWA 5HXFA 1MKWH 2WUBA 1AWFH 3BEIB 1DWDH 3BSQA 2BZAA 2HNTC 1BIOA 1O3DA 2Z3DA 1UCYK 3CS0A 5I25A 2OXSA 4HTCH 1AI8H 1BMMH 2G51A 4IW4E 1C2GA 1FDPA 1TNIA 1UK4A 2BOHB 4FVDA 2OQ5A 3MFJA 1EAWA 4X2VA 1P12E 4BTIB 4OS2A 5DO4H 1FY4A 1O32A 2QC2A 1ESAA 1P06A 1P2OA 1V2VT 1DT2A 1TMTH 4ZXXH 4NA8A 3T29A 2ILNA 4AORA 1D3QB 2A4GA 2A4QA 1B5GH 1G37A 3MU5A 1ZJKA 3EA7A 2NU0E 1AZZA 1PQ7A 4FU9A 1S82A 1C9TA 4CBOA 3P17H 1EPTC 1O3GA 2ZCHP 1LVOA 3M5LA 1HRTH 5DP7A 1TRNA 3PMJA 4HZHA 1WQSA 2O8LA 1NRRH 3RXFA 2TRMA 4DY7B 3ZZ9A 3MH4A 2A7HA 1MUEB 3LIWA 2A4OA 1GJ4H 4FUBA 5EXMA 1BB0B 3JZ1B 3A8CA 1K1OA 1B0FA 2STAE 1RS0A 2SNVA 2R2WU 1FY5A 1LHDH 4NCYA 1EJAA 1DLEA 1MKWK 2A5KA 2BY7X 5HM9A 3TH3H 4ABHA 1ACBE 2R9PA 4A5TS 1ESTA 2WV4A 3BTGE 3O8DA 1PYTD 1MCVA 1TYNA 3A82A 4AGJA 3RXMA 1C4Y2 1CVWH 4YLUA 5IYTA 3A7WA 2XWAA 1K1JA 1S84A 1VITH 1N6XA 1GDUA 1NPMA 1ELGA 2ALPA 2NU2E 1HAIH 1C1UH 3DUXH 4U01A 1EKBB 2YNBA 3EA8A 2O8UA 2VIQA 1HB0B 3GY5A 5DP6A 2GZ9A 2A2QH 3TPIZ 1SGPE 1TGTA 2F9PA 1P3EA 1FAKH 4XE4A 3RDZA 2VB0A 5FX6A 1CGHA 1O2YA 5EOKA 3MU4A 1A5IA 2NU3E 4IC5A 2ZGCA 3OSYA 1O2XA 1NT1A 4IC6A 1CA8B 3L33A 1V2ST 1YP9A 1HXFH 1OWIA 5JBCS 2JETC 1O34A 3M3VA 2GGVB 4UEHH 2ALVA 2NU4E 4ABBA 3RXUA 5A09A 1DFPA 1BDAA 4FUGA 4UONA 3SUDA 1PPBH 3M7QA 3OY6U 3BTHE 3Q3KA 2W5EA 1EZUC 1Z71A 3KQBA 1GHXH 1EQ9A 5E0GA 3LDXH 2WPLS 1YPGH 1LHFH 1TOMH 1DITH 1ZHPA 5EQQA 1DICA 1MD8A 1O3BA 3DT0H 4SGAE 4K5ZA 3UOPA 1HYLA 3W94A 2FS8A 5DG6A 3GDSA 1OXGA 2KAIB 4RKOB 4FVBA 2SGDE 4BAKB 1GI5A 1FQ3A 2HRVA 3UREA 5EW1H 1C5RA 2ZGHA 7LPRA 1TPSA 1WAYB 1EAIA 2P3FH 3SNBA 1IQMA 1KDQA 2O8WA 4E05H 3ATWA 3ZZ4A 1UTJA 4XFQA 3P92A 4FUJA 3U98H 3O8CA 3TGJE 1Z7KA 1PPCE 1YLCA 5K0HA 4DVAU 1Y3XA 1GG6B 1L1GA 1MTNB 1FN6A 4JYVH 1EPTA 1HAYB 3OY5U 1GVLA 5EPNA 2BD2A 1MKXH 3E90B 4OS7A 1JMOH 2BD9A 4NG9H 1O5BB 3FVFB 3P8FA 5BRRE 2CGAA 2F91A 3RXAA 3GY2A 4U30A 4E7RG 3W95A 4I8JA 2FZZA 3SU1A 1V2PT 4X1QU 2Y80A 1DY9A 1BTPA 1P09A 4GSOA 4DCDA 1ZGVA 2H9HA 1SBWA 3SO3A 1AUTC 1P9SA 1YPHE 2OC7A 4X8SH 1BCUH 1Q2WA 2PSXA 1MAXA 2WINI 1C1VH 1GVZA 1W7GH 2O8MA 1LKAA 3MU1A 3AAUA 3VGCB 5EXLA 1TQ7B 1O3HA 4ZHMU 3RXBA 2ZC9H 4H4FA 2DUCA 2PKSC 1FN8A 1SR5C 2F9OA 1GMCG 3RUOA 4DURA 5LPRA 1MAYA 2CHAC 3GY3A 4WWYA 1GWAA 4CRDA 1SHYA 1HJ9A 2GV7A 1O2PA 1O3KA 3LGVA 4Y8YA 1JRSA 3ZZCA 4ZMAH 2FP7B 1GHWH 1IQJA 1AHTH 5E2PA 3STIA 1V2JT 5ABWA 3P95A 5A8XA 1O2VA 3VB4A 1YPEH 3UUZA 5C1UA 3DA9B 3PROA 4NIWA 5G4BA 2BY6X 1QA7A 3A87A 4KTSA 4CHAB 2PTNA 5C1YA 5HM2A 1C2EA 3D49H 2XXLA 1IQEA 1ABIH 2ZPSA 1C5SA 1UTQA 1W14U 2P3UB 1K1NA 3BTWE 1TOCB 2VWNA 3S9BA 2TGDA 1DXWA 1HAVB 1VJ9U 3TJNA 3A7ZA 3OX7U 3AVZA 1QBNA 1EP5A 4I33A 4A1TA 1YCPH 2BOKA 1VGCB 6ESTA 2M5TA 1TONA 1XUKA 1C1NA 4AN7A 1OWJA 2GZ8A 2FESH 5JB8S 1ZSLA 1FY8E 2VWOA 3UQOA 6GCHF 2XRCA 4MNVA 1GI0A 3K2UA 1IQKA 3RXIA 1UVPA 2YNAA 3E6PH 2XCNA 3FP6E 1J17T 1BRUP 2BLOA 3GY4A 1ARCA 2A5IA 4WJG2 5CHAC 5DK1A 1KIGH 3G01A 2BLWA 1KLIH 5JBAS 4GPGA 2ZGXH 3E8LA 2BX4A 1QQ4A 3PMAB 3QWCH 2XNIA 3PTNA 5FPSA 1WTGH 1AUJA 2Z9GA 1C2LA 5EG4A 2WPIS 1B0EA 2FLRH 1D3DB 4AFZA 4AFSA 1MTUA 3ATMA 1SOTA 4WXIA 1SSXA 2VIVA 2OTVA 3FZZA 3C27B 1C2MA 1ELCA 3ZYDA 4B2BA 1NROH 2F9NA 3KCGH 1THPB 2ZDNA 3RM0H 4ISIH 3U9AH 1OYTH 2EC9H 3NKKA 1L2EA 3RXPA 1TNKA 1O3AA 1FZZA 5ETXA 1IQFA 1RIWC 2Y5HA 2FOGA 1O2HA 4WMFA 1CGJE 3LC5A 2SGAA 1A3BH 1K1IA 1LPGB 3PM3A 1OWHA 3SNEA 3HGPA 1ESBA 1DANH 2C8ZB 4Z6AH 2J9NA 2EA3A 2QY0B 3M3TA 2PSYA 1G3EA 2OLGA 2FTLE 1IQNA 4NZLA 4UFFH 2PUXB 4RN6A 1Z8JB 1OP8A 1TALA 3SU4A 3ZZ7A 3MNXA 3PLKA 1TX7A 2WPJS 1MTSA 2GCTC 1ELDE 2ZU1A 3I29A 2P8OC 1C5QA 1TPOA 2ZF0H 1UTKA 1NRQH 2ZQ2A 1G32B 1RTLA 2ZWLH 4RKJB 1GBIA 2RCEA 2BVXH 1TB6H 3GCHC 1VCWA 1TX8A 2AS9A 2ZCKP 4NIXA 1G3CA 2ZDKA 2VVCA 5DP3A 5EW2H 4BTTB 4NIYA 1GBFA 1XVOA 4INKA 4DOQA 3ATLA 1V2UT 4CRGA 5EXNA 2RA3A 1QB1A 4CBNA 4Y71A 3U8OH 1HDTH 3KIDU 1GBCA 1T7CA 1K22H 1V2WT 4X2XA 1O3MA 2IPHA 3V12A 3QTVH 3ZYEA 4WMEA 1AFQC 1SLXB 3HK6B 1L1JA 1ZSKA 3LT3A 1ZPBA 1FXYA 3O8BA 3VB7A 4Y79A 4A7IB 1O30A 3FZDA 1SC8U 4FU8A 3UWIA 3Q77A 1ZMNA 1O3FA 1QBOA 1CA0B 1LVYA 1A2CH 2W7UA 6CHAB 2H5CA 2BQ6B 1HAZB 1FONA 3KGPA 3SNAA 3STJA 4FUIA 4KKDA 4B73A 3RC6A 2AYWA 3T5FH 1OX1A 1QRWA 2ANMH 1QY6A 2RG3A 1OS8A 1TBRH 3K65B 2A7CA 4BAOB 2PFEA 2ESTE 1AGJA 3AW1A 1P01A 3GY8A 3ZVCA 1O5AB 2HNTE 3CP7A 1ELEE 4JZDH 3TVJB 2C8YB 2Z9JA 1A5GH 4GLYA 1GCDA 3BIUH 3M5MA 1SG8B 2BQWB 4MPWA 1S5SA 1XKAC 5FCKA 3A83A 2D8WA 3ZZ5A 2QXIA 3UPEA 1DE7H 4WH8A 1MZDA 1VJAU 1KXFA 4BAQB 3LOXA 1SGTA 1DSUA 4XBBA 1GI3A 4CRBA 1C2KA 1KLJH 1MH0A 1F5LA 1ZMJA 3TJOA 2G52A 1GPZA 2ODQA 3F9GA 1ANCA 4LZ1H 5FBEA 1SGEE 3MH6A 4I32A 5A0BA 4Y7AA 4ABAA 3SU3A 1S83A 3A7VA 2ZTXA 1UVSH 1F0SA 1Y3WA 4ABJA 1MBMA 1AE5A 3UR9A 3RC5A 2FOBA 3EQ0H 2XBWA 1XX9A 3ODDA 2FLBH 1GJ8B 2GT7A 4ZKNU 1GI4A 1DSTA 1ZTJA 3I78A 4AG2A 2YOLA 1IHSH 1RXPA 4GCHF 2PGBB 1UVUH 5EQSA 3RXRA 2HGTH 1OP0A 2GP9B 1Y5BT 2OINA 1O2SA 1F5RA 2V6NA 2HPQH 1OYQA 3SU5A 1AIXH 4O9VA 1CT2E 1E34B 2QXJA 3S69A 1W13U 1NC6A 2ZFTA 4TWWA 1C4V2 2ZDMA 1HLTH 1S6HA 2JKHA 1BJVA 4F49A 1GBLA 1SI5H 1UJ1A 4DG4A 1HUTH 1GGDB 3RXEA 2FOAA 1QR3E 4WY3A 1HAOH 2HNTF 1AKSA 5LGOA 3ENSB 1QIXB 3M5OA 3GCTF 3BG4C 1GHZA 1UTPA 2ZHQH 2FX6A 2VU8E 1MD7A 1O3OA 2ZPRA 1INCA 4R8TB 1BBRE 2XC5A 3FP7E 4GCHG 1P10A 3H7OA 5DPAA 1NFYA 3A7TA 3MNCA 4NIVA 3TH4H 5GXPA 1AWHB 2ASUB 2GVFA 2ZI2H 1YGCH 5JYIA 1N8OB 4YTAA 5EODA 4CH2B 1S6FA 3E91A 1QTFA 3V13A 1KXDA 3DFLA 1UCYE 3URCA 1GHVH 1DM4B 1TQ0B 3NK8A 2VVVA 2D2DA 1RJXB 1K1MA 3N7OA 4X6NA 4WMDA 2ZDLA 1P2JA 2F83A 3RP2A 3BTME 1TGBA 4B1TA 1QB9A 4XDEA 1C5VA 3H5CB 1KXBA 4O03A 3FP8E 3L6PA 4OS1A 3GCTG 3LH1A 4QT8C 1C2HA 4MNYA 5DP4A 1PQAA 1J9CH 2ZO3H 4WF8A 2J95A 3S7HB 4I31A 2CV3A 2BD7A 3BV9B 4Y76A 2ANWA 2OP9A 2CJIA 2ZPQA 3K9XB 3PWBA 3Q00A 1K21H 1NS3A 1T8MA 3HKIB 3TNTA 1SGQE 3PWCA 5C67A 1J8AA 2ZDVH 1EJMA 4K8BA 4ZH8A 3QGJA 1FPHH 1BRAA 1BTUA 3SJ8A 1QL7A 2VH0A 1TWXB 3U69H 3QZQA 2A7JA 2WPMS 2WV5A 5T6FA 1JOUB 1KXEA 1Z8RA 2H2ZA 1W10U 2NU1E 4FXGH 2BVSH 1A46H 3A89A 4ABGA 1KSNA 2P16A 5GPIB 1MBQA 3RMLH 1KXCA 2FODA 1SFIA 1O3PB 3SJIA 4A1XA 3SV6A 1LHCH 2C93B 3RXKA 3SNCA 3LGTA 1F2SE 1O2OA 4B2AA 2ZHFH 1NO9H 1DUAA 4Y11E 1XUJA 1BMNH 1SFQB 1CE5A 5A8ZA 2BM2A 1CHGA 3LC3A 5E8EH 1C5XB 2XCFA 1E35B 1C1MA 1O2QA 5F8XA 1O5GH 3LH3A 1OWEA 2J2UA 3SU2A 3A80A 4FUDA 1EOLA 1Q3XA 2HVXA 2SNWA 3BTDE 2SFAA 1C1PA 2ZU4A 1JRTA 2F9BH 2WYGA 2O8TA 3A86A 1A4WH 1GI7B 3OU0A 5T3HA 4FUHA 5AVDA 2UUKB 3P70B 1HAXB 4BAHB 5A2MH 1CT0E 4A1VA 1EATA 5T6GA 1SLWB 1ELFA 1KDQB 4WH6A 1KLTA 2BYAX 4OS4A 1C4U2 1FUJA 4Y8ZA 2BDHA 3MO6A 3M5NA 1DDJA 4YOGA 4GAWA 4K1EA 3SOSA 1G9IE 1G30B 1EPTB 1PPEE 1BTYA 5CMXH 1Y5UT 4NA9H 3T25A 2OUAA 1V2QT 1DWCH 4F4OC 2HLCA 4ZKOU 4X8VH 4FUFA 2BHGA 2J92A 4RSPA 4CRCA 1DLKB 4A6LA 4KP0A 2R0LA 1BTXA 3ZV8A 1O33A 2ZQ1A 2FOCA 5JPMH 1TBZH 3ELAH 4MVNA 4YOIA 1H8DH 2G00A 1QB6A 1QBVH 3A8DA 5B6OA 5C1XA 1FY3A 1SGDE 2Z9IA 3NUMA 2CF8H 1GHBG 1GMCF 4IMZA 2VGCC 4MNWA 3MO3A 4YOJA 1W11U 2V3OH 1V2NT 4JZFH 5EGMA 2ANYA 5E0HA 3C1KA 3EA9A 1T8LA 3HPTB 8GCHG 1H8IH 3F9EA 5A0CA 1C9PA 4O97A 3VEQB 2CN0H 1GBTA 5HGGA 1VGCC 1HBTH 1MQ6A 1XUFA 2BDGA 2BZ6H 4GHQA 1GI2A 1QFKH 4NGAH 3SJOA 1PFXC 5TCCA 3GDUA 3BTQE 1NTPA 4UFEH 4AGKA 5PTPA 4ABFA 3GISB 1BMLA 1VZQH 4K60A 2FI4E 3TIUA 3E3TA 3TLOA 2QIQA 4DIHH 1HJ8A 1T31A 1QHRB 3ZZ6A 1EOJA 1GBDA 5CE1A 3U8RH 4MPVA 1C5LH 3ZZBA 2JETB 3RXHA 3UWJH 2BY9X 2JH6D 1UK3A 1IHTH 3RXSA 1QA0A 4BXWA 1F92A 3BN9A 1C1TA 3WY8A 2QN5T 3FANA 1YPKH 2FEQH 2H1UA 5L2YH 1GL1A 1G3BA 4YO9A 3PTBA 1P57B 5FPYA 1TPPA 4Q7ZA 1EZQA 4JZIA 2GMTB 3PV4A 4Z0KA 1ABJH 1DUEA 1GI1A 1Y3UA 1GBKA 2EEKA 2XC0A 1V2RT 1VITF 1LDTT 1K1LA 1MKXK 3ZVBA 5BPEA 3KEEA 3MH7A 3MNBA 1CU1A 1TLDA 4ZUHA 1Z1JA 1JWTA 4DT7B 5F8TA 1BTHH 1EX3A 3RMNH 3KQCA 1ZPCA 2PV9B 1FNIA 4YESB 1T4VH 2OC1A 2Z6BD 2ZHDA 4ASHA 2AIPA 5FHTA 4CRFA 2OD3B 3MNSA 3NPSA 2ZIQH 1LCYA 2G4TA 4IN1A 3KN2A 3MU0A 1L0ZA 2FWWA 4ISOA 1Z1IA 4NFFA 3Q3XA 1W0ZU 4TWYA 5DKMA 1DWBH 1AY6H 2ZG0H 2PR3A 3E16B 3EGKH 1VITG 2SGQE 2ZFPH 1E38B 3UNRA 1G36A 1TNGA 2Y81A 3QO6A 4U32A 3SUFA 4INLA 2BTCE 2FOHA 2BY5X 1OPHB 1TRYA 2O9QA 1BQYA 3BG8A 1C2FA 2AGIX 3RLYH 1O5DH 1C5YB 1DX5M 3MTYA 3M7TA 2Y7ZA 5E0JA 4UFGH 5AFYH 4LOYH 4TPYA 1SQOA 1HAVA 1Y8TA 1GJAB 2V0BA 3UNQA 1IQHA 1Y5AT 4AOQA 3LONA 8ESTE 3O8RA 4X1SU 1F0UA 4CR5A 3SHCH 4XBCA 2CHAB 2VWMA 1IOEA 1MMJN 2FPZA 1UTNA 2ODPA 2PTCE 2ZCLP 4MTBA 2Z7FE 3SQEE 2UUFB 1F0RA 4TPIZ 1SGYE 1YPLH 4XSKU 1L4ZA 3A85A 1THSH 1DVAH 1MCTA 1O38A 1RTKA 2R2MB 1C2JA 1QL8A 1TX6A 5F03A 1WCZA 2ZHWH 1YCPK 4VGCC 4D76A 2BXTH 1HV7A 3FAOA 4ZAEA 2C90B 1QGFA 1P05A 1SLVB 1XVMA 3AW0A 3M7UA 1F5KU 3M37A 1O31A 3ZVAA 4ABIA 2DE8A 4HFPB 3TJUA 1ID5H 4J2YB 3LGWA 1FJSA 1J14A 1ANEA 1HJAC 1O5EH 1J15A 1OSSA 1G2LA 4B76A 4UFDH 1BITA 1KY9A 3QZRA 2H5DA 3Q76A 1O3EA 3RXQA 1H1BA 1MQ5A 3SGBE 4BOHA 4AB8A 3EYDA 3BTTE 1P2QA 1HCGA 4MG3A 3H7TA 1CHOF 2OC8A 2B7DH 1RRKA 1P2NA 3LGIA 4ZKRU 1GJ6A 2TGTA 2AH4X 2TIOA 5C5OA 3A8AA 4ABDA 3MI4A 3GOVB 1AB9C 1QCPA 1YC0A 3SV8A 5TCAA 3VFEA 4JK5A 3VB3A 1BT7A 1YPMH 3B23B 2K1QA 1TPAE 2A32A 4K69A 1BJUA 2ANKH 3UNSA 3PMBB 2BDAA 4KTUA 3TGKE 1SQAA 1UMAH 1O3IA 4D9RA 2J94A 3U1JB 1FPCH 1O2RA 4X6PA 4AYVB 1XKBC 1H9IE 1TABE 2NWNA 3SNDA 5FPTA 1K1PA 2XTTB 5CHAB 1FIWA 1ZTLA 4LXBH 3ZZ8A 1S85A 3RXJA 1MTWA 1W7XH 1TNJA 2XBXA 1A0HB 2W3IA 2XYAA 1KTSB 3NXPA 1C1RA 1O2GH 3ATKA 1CHOG 1P2MA 1HXEH 4H6SB 1GMHG 5GCHG 2XC4A 1BRCE 1ZRKA 2ZP0H 4YM9A 2ZHEH 2BDCA 1HIAB 1YLDA 3SV2H 2IOTA 3K6ZA 1QL9A 4DW2U 1AVGH 2WPKS 9LPRA 1UO6A 1TA2A 2VNTA 3T26A 1GI6A 1YM0A 3A8BA 3BTEE 2PUQH 1WBGB 1Z6JH 5C2ZA 3KQEA 3TU7H 1ARBA 4TY7A 4AB9A 4BANB 1QQUA 1U6QA 3GYLB 1DWEH 2SGPE 5DJ7A 4JMYA 1O35A 1KTTB 1QNJA 2Y7XA 2GCHF 4JCNA 4B71A 5J4QA 2BQ7B 2BX3A 1GBEA 2P59A 3D65E 1N1LA 4UDWH 1V3XA 1F7ZA 4BNRA 2XBYA 4ZROA 1TNHA 1SGFG 5HYOA 2C4FH 3EDXB 1DXPA 3UOUA 3ESTA 5LH8A 3SZNA 4E06H 1BBRH 1CSOE 4IMQA 1TBQH 2ZFQH 3M35A 5DP8A 3R0FA 1GHAG 2P8OB 1NFWA 2UWPA 1P3CA 2ZU3A 1FMGA 5K7RA 1LHEH 1UCYH 1TA6A 5F6MA 3KL6A 1P2KA 3F9HA 1HFDA 2GKVE 3GCHB 1GCTB 4OGYA 1GJBB 3BEUA 2ZZUH 5J4SA 1A5HA 2GCHG 4K3JA 2W26A 2Z9LA 2AGGX 1OP2A 2QCYA 3ODFA 2ZEBA 2QYIA 5AFZH 2V35A 3UY9A 3DHKH 3QUMP 1ZRBA 3ZVGA 2ZFRH 1GI9B 2P93A 3P8NA 1KXAA 3RM2H 5L6NH 1C2DA 4D7FA 1ZZZA 1ETSH 2BDBA 5GWZA 4ZHAA 2BVRH 4CRAA 5GJ4B 3NWUA 2HOBA 4MPXA 7ESTE 4B74A 3T28A 3ZVFA 3A88A 1O2KA 1PPGE 3PO1B 5GIBA 4NZQA 3BEFB 2LPRA 1TGCA 3DD2H 1O3LA 1UHBA 4AFUA 2VVUA 4Y0YE 2PKAA 2CXVA 3LGYA 2HPPH 3SV7A 4FUCA 2BDYA 4Y8XA 1C1OA 2F3CE 2ZA5A 4HI3A 4ZXYH 1IQLA 4JZEH 1GJ5H 1PQ8A 1WU1A 4X6OA 1E36B 1O3JA 5EU8A 1CGIE 1ZGIA 2A5AA 1W8BH 5FXLA 3RC4A 3SORA 2UUYA 1EZXC 1GJ7B 1SGRE 5ESBA 1O2IA 2Q1JA 3ZVDA 1CBWB 1ZTKA 1SGFA 3MMGA 5JBTA 2TGPZ 4NWLA 1O37A 2JH5D 1JXPA 2A45B 1RD3B 1ZR0A 2DE9A 1HAPH 1DOJA 1UTMA 1VR1H 1GBJA 3B8JA 2GTBA 2XWBI 5AF9H 5IDKA 3MYWA 3RXGA 3KHVA 2QAAA 4Q7XA 3D23A 1GBMA 1PJPA 4AYYB 2PGQB 4XBDA 4H42U 1C5MD 4JYUH 1TGSZ 3BTFE 1P8VC 4K2YA 1FAXA 5LPEA 1D9IA 3ZZDA 1L4DA 1TAWA 3U1IB 2AGEX 1N6YA 5F8ZA 1AVWA 2EI6A 1ETTH 4BTUB 4IN2A 4YT6H 3SJKA 4I8KA 5LPFA 2Y5FA 4NA7A 3P6ZB 3A7YA 2BD8A 3SI3H 1SGNE 3E1XB 5ESTE 4FUEA 4E7NA 2D26C 1E37B 1UVTH 2Z9KA 2VJ1A 1OWKA 2ODYB 1WYKA 1GG6C 1MTNC 3TNSA 3IITA 3SU0A 1W3CA 2Y6TA 1J16A 1TGNA 2AMDA 1NRPH 1OWDA 2OBOA 3E0NB 1S81A 4Q2KA 3TJVA 2C8XB 2GD4B 3BG4B 1O3NA 4I8LA 4SGBE 1L1NA 2VIOA 2ZFFH 4J1YA 2ZTYA 3HGNA 1EAUA 2H6MA 1O39A 3RLWH 2QA9E 1EZSC 3KNXA 1HAGE 4M7GA 1CT4E 2AFQB 1EJNA 2Z3EA 1SLUB 1YPJH 3MU8A 1AFEH 1UVOA 2STBE 3RMOH 1S0RA 1V2MT 2C8WB 1C1QA 1M9UA 4ZKSU 1V2KT 3VGCC 4JYTA 3T2NA 2JH0D 2VIDA 3GCNA 3KQDA 2J38A 1O0DH 1RTFB 2I6SA 1SGIB 2Y82A 1EB1H 2OBQA 1GHBF 3A84A 2RDLA 4IS5A 3AAVA 3NZIA 3L3TA 1D3TB 2ZU5A 2IJOB 1GL0E 1SMFE 2BLQA 1BTZA 2A31A 4K1SA 1WTHD 8GCHF 4NFEA 3DFJA 1DPOA 1A1RA 1DS2E 3F1SB 5C3NA 5SGAE 4U2WA 3MOCA 1BZXE 4X1NU 2QXHA 2AMQA 2AIQA 2GMTC 1JIRA 1PPZA 3T62A 1AN1E 4UD9H 1TRMA 3JZ2B 1LVMA 4BXSA 1AMHA 2VINA 4OS5A 4Q80A 1GI8B 2P3TB 1MTVA 3RXLA 4CHAC 2BD5A 2OQUA 1BRBE 5L30H 1D4PB 2OCVB 1QRXA 2UUJB 5T6DA 3BIVH 1O2MA 1P9UA 2B0FA 1ANBA 1K2I1 3SBKA 5TJXA 1GHYH 3QTOH 1HNEE 3GDVA 1NFUA 3PB1E 1Y3YA 1JBUH 3RXVA 1ELAA 2G81E 3RMMH 4Y6DA 1XUIA 2VIPA 1MU6B 2GV6A 2KAIA 1LKBA 2CF9H 1MU8B 4MDSA 2SGEE 1CQQA 3TITA 1Y59T 3BF6H 3QK1A 2R3YA 1FIZA 3SUGA 2RA0A 2HALA 1QJ7B 1TMUH 3P8GA 1GMDF 2HWLB 3VB5A 2FYRA 1XM1A 2FOFA 3GY7A 3SU6A 1O2NA 4OS6A 3ZV9A 2VH6A 2Z94A 1EASA 1G2MA 3LKWA 2Y5GA 1T8NA 4H6TA 1TIOA 2BXUH 1T8OA 1C5ZB 1O2ZA 3MH5A 2FX4A 1PQ5A 1YF4A 5H4IB 1C5NH 4GHTA 4GUXA 1TE0A 3ITIA 2PHBA 3IWMA 1GBHA 1H9HE 3A81A 4ZHLU 2FXRA 2AEIH 1LQEA 2ZECA 1BUIA 3ZVEA 1GJ9B 2FM2A 2G5NA 1HGTH 2LNCA 2VWLA 5JBBS 3ZZ3A 1W0YH 1BHXF 1EAXA 4LZ4B 1GJDB 1GMDG 2A2XH 1C5PA 1DY8A 1ZOMA 2B8OH 5EQRA 2PLXA 3QGNB 4BAMB 2GT8A 1NU9A 2EI8A 4JK6A 1SGCA 3F68H 2I6QA 1ZHRA 4MQAA 2ZU2A 1AO5A 3HKJB 4JZ1A 1ZMLA 1WSSH 1C5WB 1K9OE 2AERH 3EAJA 1HAHH 1EP6A 3QN7A 1CO7E 3UQVA 1AE8H 2ZGBH 1ZSJA
chains in the Genus database with same CATH superfamily
1B7XB 2F9UA 1ANDA 2JIZD 1RFNA 3P8OA 1A0LA 4NWKA 5FCRA 2FIRH 2V3HH 5GDSH 4I7YH 3SV9A 3T27A 1LPKB 4CH8B 1BA8B 4ISLA 1P2IA 3IG6B 4YT7H 2A0QB 4O3TA 2GZ7A 1K0HA 2VGCB 4TYDA 1UK2A 3B9FH 1SOZA 2QXGA 3ZZAA 1UTLM 1NRSH 4INHA 2GDDA 1GDNA 1WV7H 3GICB 1A61H 3GCOA 4ABEA 1O5CB 5DGJA 1O2LA 3SHAH 2BY8X 7KMEH 1BTWA 2A1DB 1GJCB 3V3MA 1A3EH 1XXFA 1Z8IB 2B9LA 4MPUA 4RT1A 1OKXA 4B75A 1O2WA 3PRDA 4DIIH 1O2JA 4X8TH 1YCPM 4FU7A 5EPYA 3F6UH 1YPHC 1PYTC 3RU4T 3NCLA 1NFXA 1W0KD 2FS9A 2ZGJA 3Q3YA 2Q6FA 2PKSB 4B2CA 2R3UA 1C1WH 3S9AA 4IBLH 4I8GA 1SQTA 2W7SA 3SI4H 1H4WA 5A8YA 3R3GB 3TK9A 2FDAA 2P95A 2GX4A 5JDUB 2PWXA 3M36A 2FYQA 2BDIA 4DJZB 3S7KB 1VCPA 1LVBA 3S0NA 5HMAA 3ATIA 4Y10E 1C5TA 1NZQH 3SGAE 1CA0C 1TFXA 1NM6A 2J97A 6CHAC 3M61U 2H9TH 1THRH 1EXFA 1VCQA 1UW7A 4X0WU 2WUCA 2G8TA 1C2IA 1ELTA 6GCHG 5JB9S 1D6RA 1O5FH 4MLFB 1ELVA 4AZ2B 8LPRA 1XMNB 5FBIA 3KF2A 1SVPA 1W12U 7GCHF 4X1PU 3SW2B 1LMWB 1TNLA 1K28D 5E2OA 1OOKB 2EI7A 2FOEA 1BHXB 2QV1A 2UWLA 4O3UA 1GDQA 1LO6A 3CS7A 2D1JA 3CENA 3RU4D 4AX9H 3MWIU 3MHWU 2G55A 3LU9B 2L6OA 4X1RU 1O2TA 1BOQA 3F0OA 1ELBA 2P94A 3D62A 1ZJDA 8KME2 2C3SA 1F0TA 1GMHF 1EB2A 1KYNA 2GDEH 1XUHA 5GCHF 2BD3A 3FOAA 3AASA 1E0FD 2CMYA 5FX5A 1BMAA 2G5VA 1ZLRA 1MZAA 1A7SA 2A4RA 2ZNKH 3A7XA 1WOFA 5L2ZH 2H9EH 3BTKE 1PPHE 1SB1H 2J34A 1Z6EA 2FMJA 1FY1A 2SGFE 1V6DA 3SN8A 3PMHB 1UTOA 4CR9A 1LPZB 5AHGH 1A0JA 2BB4A 7GCHG 4R0IA 3N7DA 4XRNA 2ZFSA 4GVUA 1ETRH 1FI8A 3URDA 1GCTC 5C5NA 2Q6DA 5DP9A 4CREA 3SQHE 5DP5A 3F9FA 3LJJA 2ZTZA 3RXCA 3UTUH 1LHGH 2Z3CA 9ESTA 1D6WA 4PROA 1S0QA 1ZHMA 2QF3A 3VXEH 4D8NA 3PLBA 2FO9A 1NU7B 4A92A 2XW9A 1AZ8A 3SUEA 3V0XA 1NESE 4AFQA 4Q7YA 1GGDC 1GHAF 3NRLA 1C1SA 1C5OH 5EJZA 1GBAA 4I86A 2F9VA 3LGUA 3LPRA 1Q31A 4XOJA 3HK3B 4ACBA 4ISHH 3QLPH 1XUGA 2FOMB 3PLPA 3I77A 1SHHB 3PO1C 1V2LT 1RIWB 1PPFE 4DGJA 3RXDA 4THNH 4NSYA 3FFGA 4KELA 4D7GA 4MNXA 1V2OT 4VGCB 5A0AE 1IQGA 2BMGB 2THFB 3OTJE 2WPHS 4WVPE 2ULLA 1FLEE 3MO9A 1YYY1 3VXFH 1N8OC 1LTOA 2YMSD 5I46H 4YZUA 1RGQA 1IAUA 1HJAB 3TH2H 1H9LB 1XXDA 1QRZA 2XBVA 4UE7H 4K1TA 2F4LA 3UIRA 5FAHA 1LQDB 3RXOA 3RXTA 1YBWA 4Y0ZE 1Y3VA 3DCLA 4D9QA 2GCTB 1HIAA 1EUFA 5C17A 1GVKB 2BD4A 1CBWC 1O3CA 1TMBH 4WXVA 3PYHA 2WYJA 1AVXA 4X6MA 4HGCA 1V2TT 1WQVH 1HPGA 4LK4A 1G3DA 2QF0A 4X2YA 1ORFA 2OC0A 3M3SA 3SZEA 2QE7D 5DSFA 3VB6A 2WZQA 1AU8A 2R0KA 4KTCA 4NSVA 1C5UA 2J4IA 3U8TH 3TGIE 1O36A 3LJOA 3RU4E 1AB9B 3HATH 5C20A 1QURH 3E0PB 1AKSB 1NY22 1Z8GA 1AD8H 1ZPZA 3TK5A 1WUNH 5HIZA 1GBBA 1SPJA 1D3PB 6LPRA 1SL3A 1P03A 1P11E 2FI5E 2AMPA 1IQIA 2FTMA 3OYPA 1UHBB 1AQ7A 2ZDAH 3UR6A 2PKAB 3GYMA 2QGRA 2TGAA 3VPKA 3QDZB 4I8HA 2F43B 2IN2A 1AFQB 2G4UA 2UWOA 4ISNA 4YLQH 4B6EA 3TK6A 1COWD 4AG1A 1NRNH 2PW8H 4TY6A 1P0SH 3SGQE 3S9CA 2ZKSA 4OGXA 4Y7BA 2TPIZ 3QX5H 2BLVA 4K8YA 3EE0B 2TBSA 1T4UH 1QJ6B 1T32A 4X8UH 3UFAA 1W2KH 1O2UA 1NN6A 3GY6A 4ESTE 1YKTA 1ZYOA 2FI3E 4X2WA 3K6YA 3V7TA 1FV9A 4KGAA 2W3KA 2B5TB 3KYFA 1BBRK 2Q6GA 1P04A 1QJ1B 1JIMA 1X7AC 1P02A 4IGDA 3SJ9A 2VIWA 5HXFA 1MKWH 4Q63A 2WUBA 1AWFH 3BEIB 1DWDH 3BSQA 4DT4A 2BZAA 2HNTC 3DSPA 1BIOA 1O3DA 2Z3DA 1UCYK 3CS0A 5I25A 2OXSA 4HTCH 1AI8H 1BMMH 2G51A 4IW4E 1C2GA 1FDPA 1TNIA 1UK4A 2BOHB 4FVDA 2OQ5A 3MFJA 1EAWA 4X2VA 1P12E 4XD7D 4OS2A 4BTIB 1FY4A 5DO4H 1O32A 2QC2A 1ESAA 1P06A 1P2OA 1V2VT 1DT2A 1TMTH 4ZXXH 4NA8A 3T29A 2ILNA 5T1VA 4AORA 1D3QB 2A4GA 2A4QA 1B5GH 1G37A 3MU5A 1ZJKA 3EA7A 2NU0E 1AZZA 1E79D 1PQ7A 4FU9A 1S82A 1C9TA 4CBOA 3SYJA 3P17H 1EPTC 1O3GA 2ZCHP 1LVOA 3M5LA 1HRTH 5DP7A 1TRNA 2KCPA 3PMJA 4HZHA 1WQSA 2O8LA 1NRRH 3RXFA 3OEHD 2TRMA 4DY7B 3ZZ9A 3MH4A 2A7HA 1MUEB 3LIWA 2A4OA 1GJ4H 3CNRA 4FUBA 1BB0B 5EXMA 3JZ1B 3A8CA 1K1OA 1B0FA 2STAE 1RS0A 2SNVA 2R2WU 1FY5A 1LHDH 4NCYA 1EJAA 1DLEA 1MKWK 2A5KA 2BY7X 5HM9A 3TH3H 4ABHA 1ACBE 2R9PA 4A5TS 1ESTA 2WV4A 3BTGE 3O8DA 1PYTD 1MCVA 1TYNA 3A82A 4AGJA 3RXMA 1C4Y2 1CVWH 4YLUA 5IYTA 3A7WA 2HVYB 2XWAA 1K1JA 1S84A 1VITH 2K0QA 1N6XA 1GDUA 1NPMA 1ELGA 2ALPA 1HAIH 2NU2E 1C1UH 3DUXH 4U01A 1EKBB 2YNBA 3EA8A 2O8UA 2VIQA 1HB0B 3GY5A 5DP6A 2GZ9A 2A2QH 3TPIZ 1SGPE 1TGTA 2F9PA 1P3EA 1FAKH 4XE4A 3RDZA 2VB0A 5FX6A 1CGHA 1O2YA 5EOKA 3MU4A 1A5IA 2NU3E 4IC5A 2ZGCA 3OSYA 1O2XA 1NT1A 4IC6A 1CA8B 3L33A 1V2ST 1YP9A 1HXFH 1OWIA 4FETA 5JBCS 1WXRA 2JETC 4HG6A 1O34A 3M3VA 2GGVB 4UEHH 2ALVA 2NU4E 4ABBA 3RXUA 5A09A 1DFPA 1BDAA 4FUGA 4UONA 3SUDA 2YMSC 1PPBH 4RT0A 3M7QA 3OY6U 3BTHE 3Q3KA 2W5EA 1EZUC 1Z71A 3KQBA 2EQNA 1GHXH 1EQ9A 5E0GA 3LDXH 2WPLS 1YPGH 1LHFH 1TOMH 1DITH 1ZHPA 5EQQA 1DICA 1MD8A 1O3BA 3H09A 3DT0H 4SGAE 4K5ZA 3UOPA 1HYLA 3W94A 2FS8A 5DG6A 3GDSA 1OXGA 2KAIB 4RKOB 2IPQX 4ASUD 4FVBA 2SGDE 4BAKB 1GI5A 1FQ3A 2HRVA 3UREA 5EW1H 1C5RA 2ZGHA 7LPRA 1TPSA 1WAYB 1EAIA 2P3FH 3SNBA 1IQMA 1KDQA 2O8WA 4E05H 3ATWA 3ZZ4A 1UTJA 4XFQA 3P92A 4FUJA 3U98H 3O8CA 3TGJE 1Z7KA 1PPCE 1YLCA 5K0HA 4DVAU 1Y3XA 1GG6B 1L1GA 1MTNB 1FN6A 4JYVH 1EPTA 1HAYB 2J5UA 3OY5U 1GVLA 5EPNA 2BD2A 1MKXH 3E90B 4OS7A 1JMOH 2BD9A 4NG9H 1O5BB 3FVFB 3P8FA 5BRRE 2CGAA 2F91A 3RXAA 3GY2A 4U30A 4E7RG 3W95A 4I8JA 2FZZA 3SU1A 2K8IA 1V2PT 4X1QU 2Y80A 1DY9A 1BTPA 1P09A 4GSOA 4DCDA 1ZGVA 2H9HA 5DN6D 1SBWA 3SO3A 1AUTC 1P9SA 1YPHE 2OC7A 4X8SH 2CK3D 2KM0A 1BCUH 1Q2WA 2PSXA 1MAXA 2WINI 5C0TA 1C1VH 1GVZA 1W7GH 2O8MA 1LKAA 2KCYA 3MU1A 3AAUA 3VGCB 5EXLA 2XNDD 1TQ7B 1O3HA 4ZHMU 3RXBA 2ZC9H 4H4FA 3VG8A 2DUCA 2PKSC 1FN8A 1SR5C 2F9OA 1GMCG 3RUOA 4DURA 5LPRA 1MAYA 2CHAC 3GY3A 4WWYA 1GWAA 4CRDA 1SHYA 1HJ9A 2GV7A 1O2PA 1O3KA 3LGVA 4Y8YA 1JRSA 3ZZCA 4ZMAH 2FP7B 1GHWH 1IQJA 1AHTH 5E2PA 3STIA 1V2JT 5ABWA 3P95A 5A8XA 1O2VA 3VB4A 1YPEH 3UUZA 5C1UA 3DA9B 3PROA 4NIWA 5G4BA 2BY6X 1QA7A 3A87A 4KTSA 4CHAB 2PTNA 5C1YA 5HM2A 1C2EA 3D49H 2XXLA 1IQEA 4Z1MD 1ABIH 2ZPSA 1C5SA 4Q4LA 1UTQA 1W14U 1OHHD 2P3UB 1K1NA 3BTWE 1TOCB 2VWNA 3S9BA 2TGDA 1DXWA 1HAVB 1VJ9U 3TJNA 3A7ZA 3OX7U 3AVZA 1QBNA 1EP5A 4I33A 4A1TA 1YCPH 2BOKA 2GJGA 1VGCB 6ESTA 2M5TA 1TONA 1XUKA 1C1NA 4AN7A 1OWJA 2GZ8A 2FESH 5JB8S 1ZSLA 1FY8E 2VWOA 3UQOA 6GCHF 2XRCA 4MNVA 1GI0A 3K2UA 1IQKA 3RXIA 1UVPA 2YNAA 3E6PH 2XCNA 3FP6E 1J17T 1BRUP 2BLOA 5C94A 3GY4A 1ARCA 2A5IA 4WJG2 5CHAC 5DK1A 1KIGH 3G01A 2BLWA 1KLIH 5JBAS 4GPGA 2ZGXH 3E8LA 2BX4A 1QQ4A 3PMAB 3QWCH 2XNIA 3PTNA 5FPSA 1WTGH 1AUJA 2Z9GA 1C2LA 5EG4A 2WPIS 2KCOA 1B0EA 2FLRH 1D3DB 4AFZA 4AFSA 1MTUA 3ATMA 1SOTA 4WXIA 1SSXA 2VIVA 2OTVA 3FZZA 3C27B 1C2MA 1ELCA 3ZYDA 4B2BA 1NROH 2F9NA 3AK5A 3KCGH 1THPB 2KR7A 2ZDNA 3RM0H 4ISIH 3U9AH 1OYTH 2EC9H 3NKKA 1L2EA 3RXPA 1TNKA 1O3AA 1FZZA 5ETXA 1W0JD 1IQFA 1RIWC 2Y5HA 2FOGA 1O2HA 5EJ1A 4WMFA 1CGJE 3LC5A 2SGAA 1A3BH 1K1IA 1LPGB 3PM3A 5IK2D 1OWHA 3SNEA 3HGPA 1ESBA 1DANH 2C8ZB 4Z6AH 2J9NA 2EA3A 2QY0B 3M3TA 2PSYA 1G3EA 2OLGA 2FTLE 1IQNA 4NZLA 4UFFH 2PUXB 4RN6A 1Z8JB 1OP8A 3OEED 1TALA 3SU4A 3ZZ7A 3MNXA 3PLKA 1TX7A 2WPJS 1MTSA 2GCTC 1ELDE 2ZU1A 3I29A 2P8OC 1C5QA 1TPOA 2ZF0H 1UTKA 1NRQH 2ZQ2A 1G32B 1RTLA 2ZWLH 2QF5A 4RKJB 1GBIA 2RCEA 2KZ4A 2BVXH 1TB6H 3GCHC 1VCWA 1TX8A 2AS9A 2ZCKP 4NIXA 1G3CA 2ZDKA 2VVCA 5DP3A 5EW2H 4BTTB 4NIYA 1GBFA 1XVOA 4INKA 4DOQA 3ATLA 1V2UT 4CRGA 5EXNA 3DSGA 2RA3A 1QB1A 4CBNA 4Y71A 3U8OH 1HDTH 3KIDU 1GBCA 1T7CA 1K22H 1V2WT 4X2XA 1O3MA 2IPHA 3V12A 3QTVH 3ZYEA 4WMEA 1AFQC 1SLXB 3HK6B 1L1JA 1ZSKA 3LT3A 1ZPBA 1FXYA 3O8BA 3VB7A 4Y79A 4A7IB 1O30A 3FZDA 1SC8U 4FU8A 3UWIA 3Q77A 1ZMNA 1O3FA 1QBOA 1CA0B 1LVYA 1A2CH 2W7UA 6CHAB 2H5CA 3F0PA 2BQ6B 1HAZB 1FONA 3KGPA 3SNAA 3STJA 4FUIA 4KKDA 4B73A 3RC6A 2AYWA 3T5FH 1OX1A 1QRWA 2ANMH 1QY6A 2RG3A 1OS8A 1TBRH 3K65B 2A7CA 4BAOB 2PFEA 2ESTE 1AGJA 3AW1A 1P01A 3GY8A 3ZVCA 1O5AB 2HNTE 3CP7A 1ELEE 4JZDH 3TVJB 2C8YB 2Z9JA 1A5GH 4GLYA 1GCDA 3BIUH 3M5MA 1SG8B 2BQWB 4MPWA 1S5SA 2J98A 1XKAC 5FCKA 3A83A 2D8WA 3ZZ5A 2QXIA 3UPEA 1DE7H 4WH8A 1MZDA 1VJAU 1KXFA 4BAQB 3LOXA 1SGTA 1DSUA 4XBBA 1GI3A 2QF4A 4CRBA 1C2KA 1KLJH 1MH0A 1F5LA 1ZMJA 3TJOA 2G52A 1GPZA 2ODQA 3N99A 3F9GA 1ANCA 4LZ1H 5FBEA 1SGEE 3MH6A 4I32A 5FL7D 4F48B 4Y7AA 5A0BA 4ABAA 3SU3A 1S83A 3A7VA 2ZTXA 1UVSH 1F0SA 1Y3WA 4ABJA 1MBMA 1AE5A 3UR9A 3RC5A 2FOBA 3EQ0H 2XBWA 1XX9A 3ODDA 2FLBH 1GJ8B 2GT7A 4ZKNU 2LP6A 1GI4A 1DSTA 1ZTJA 3I78A 4AG2A 2YOLA 1IHSH 1RXPA 4GCHF 2PGBB 1UVUH 5EQSA 3RXRA 2HGTH 1OP0A 2GP9B 1Y5BT 2OINA 1O2SA 3OAAD 1F5RA 5F53A 2V6NA 2HPQH 1OYQA 3SU5A 1AIXH 3PRBA 4O9VA 1CT2E 1E34B 2QXJA 3S69A 1W13U 1NC6A 2ZFTA 4TWWA 1C4V2 2ZDMA 1HLTH 1S6HA 2JKHA 1BJVA 4F49A 1GBLA 1SI5H 1UJ1A 4DG4A 1HUTH 1GGDB 3RXEA 2FOAA 1QR3E 4WY3A 1HAOH 2HNTF 1AKSA 4FOUC 5LGOA 3ENSB 1QIXB 3M5OA 3GCTF 3BG4C 1GHZA 1FX0B 1UTPA 2L74A 2ZHQH 3W1EA 2FX6A 2VU8E 1MD7A 1O3OA 2ZPRA 1INCA 4R8TB 1BBRE 2XC5A 3FP7E 4GCHG 1E1QD 1P10A 3H7OA 5DPAA 1NFYA 3A7TA 3MNCA 4NIVA 3TH4H 5GXPA 1AWHB 2ASUB 2GVFA 2ZI2H 1YGCH 5B6LA 5JYIA 1N8OB 4YTAA 5EODA 4CH2B 1S6FA 3E91A 1QTFA 3V13A 1KXDA 3DFLA 1UCYE 3URCA 1GHVH 1DM4B 1TQ0B 3NK8A 2VVVA 2D2DA 1RJXB 1K1MA 3N7OA 4X6NA 4WMDA 2KFWA 2ZDLA 1P2JA 2F83A 5GNDA 3RP2A 3BTME 1SQRA 1TGBA 4B1TA 1QB9A 4XDEA 1C5VA 3H5CB 1KXBA 4O03A 3FP8E 3L6PA 4OS1A 3GCTG 3LH1A 4QT8C 1C2HA 4MNYA 5DP4A 1PQAA 1J9CH 2ZO3H 4WF8A 2J95A 3S7HB 4I31A 2CV3A 2BD7A 3BV9B 4Y76A 2ANWA 2OP9A 2CJIA 2ZPQA 3K9XB 3PWBA 3Q00A 1K21H 1NS3A 1T8MA 3HKIB 3TNTA 1SGQE 3PWCA 5C67A 1J8AA 3FO8D 2ZDVH 1EJMA 4K8BA 4ZH8A 3QGJA 1FPHH 1BRAA 1BTUA 3SJ8A 1QL7A 2VH0A 1TWXB 3U69H 3QZQA 2A7JA 2WPMS 2WV5A 4TT3D 5T6FA 1JOUB 1KXEA 3WW7A 1Z8RA 2H2ZA 1W10U 2NU1E 4FXGH 2BVSH 1YWUA 1A46H 3A89A 4OM9A 4ABGA 1KSNA 2P16A 5GPIB 1MBQA 3RMLH 1KXCA 2FODA 1SFIA 1O3PB 2WSSD 3SJIA 4A1XA 3SV6A 1LHCH 2C93B 3RXKA 3SNCA 3LGTA 1F2SE 1O2OA 4B2AA 2ZHFH 1YY3A 1NO9H 1DUAA 4Y11E 1XUJA 1BMNH 1SFQB 1CE5A 3UAIC 5A8ZA 2BM2A 1CHGA 5HIYA 3LC3A 5E8EH 2IJD1 1C5XB 2XCFA 1E35B 1C1MA 3KYGA 1O2QA 5F8XA 1O5GH 3LH3A 1OWEA 2J2UA 2W6JD 3SU2A 3A80A 4FUDA 1EOLA 1Q3XA 2HVXA 2SNWA 3BTDE 2SFAA 1C1PA 2ZU4A 1JRTA 2F9BH 2WYGA 2O8TA 3A86A 1A4WH 2RDEA 1GI7B 3OU0A 5T3HA 4FUHA 5AVDA 2UUKB 3P70B 1HAXB 4BAHB 5A2MH 3EE7A 1CT0E 4A1VA 1EATA 5T6GA 1SLWB 1ELFA 1KDQB 4WH6A 1KLTA 2BYAX 4OS4A 1C4U2 1FUJA 4Y8ZA 2BDHA 3MO6A 3M5NA 1DDJA 4YOGA 4GAWA 4K1EA 3SOSA 1G9IE 1G30B 1EPTB 1PPEE 3N7EA 1BTYA 5CMXH 1Y5UT 4NA9H 1VKYA 3T25A 2OUAA 1V2QT 1DWCH 4F4OC 2HLCA 4ZKOU 4X8VH 4FUFA 2BHGA 2J92A 4RSPA 4CRCA 1DLKB 4A6LA 4KP0A 2R0LA 1BTXA 3ZV8A 1O33A 2ZQ1A 2FOCA 5JPMH 1TBZH 3ELAH 4MVNA 4YOIA 1H8DH 2G00A 1QB6A 1QBVH 3A8DA 5B6OA 5C1XA 1FY3A 1SGDE 2Z9IA 3NUMA 2CF8H 1GHBG 1GMCF 4IMZA 2VGCC 4MNWA 3MO3A 4YOJA 1W11U 2KX4A 2V3OH 1V2NT 4JZFH 5EGMA 4ACAA 2ANYA 5E0HA 3C1KA 3EA9A 1T8LA 3HPTB 8GCHG 1H8IH 3F9EA 5A0CA 1C9PA 4O97A 3VEQB 2CN0H 1GBTA 5HGGA 1VGCC 1HBTH 1MQ6A 1XUFA 2BDGA 2BZ6H 4GHQA 1GI2A 1QFKH 4NGAH 3SJOA 1PFXC 5TCCA 3U28C 3GDUA 3BTQE 1NTPA 4UFEH 4AGKA 5PTPA 4ABFA 3GISB 1BMLA 1VZQH 4K60A 2HLDD 2FI4E 3TIUA 3E3TA 3TLOA 2QIQA 4DIHH 1HJ8A 1T31A 1QHRB 3ZZ6A 1EOJA 1GBDA 5CE1A 3U8RH 4MPVA 1C5LH 3ZZBA 2JETB 3RXHA 3UWJH 4P00A 2BY9X 2JH6D 1UK3A 1IHTH 3RXSA 1QA0A 4BXWA 1F92A 3BN9A 1C1TA 3WY8A 2YMSB 2JJ2D 2QN5T 1SKYE 3FANA 1H8ED 1YPKH 2FEQH 2H1UA 5L2YH 1GL1A 1G3BA 4YO9A 3PTBA 1P57B 5FPYA 1TPPA 4Q7ZA 1EZQA 4JZIA 2GMTB 3PV4A 4Z0KA 1ABJH 1DUEA 1GI1A 1Y3UA 1GBKA 2EEKA 3F3BA 2XC0A 1V2RT 1VITF 1LDTT 1K1LA 1MKXK 3ZVBA 5BPEA 3KEEA 3MH7A 3MNBA 1CU1A 1TLDA 4ZUHA 1Z1JA 1JWTA 3KQ5A 4DT7B 5F8TA 1BTHH 1EX3A 3RMNH 3KQCA 1ZPCA 2PV9B 1FNIA 4YESB 1T4VH 2OC1A 2Z6BD 2ZHDA 4ASHA 2AIPA 5FHTA 4CRFA 2OD3B 3MNSA 3NPSA 2ZIQH 1LCYA 2G4TA 4IN1A 3KN2A 3MU0A 1L0ZA 2FWWA 4ISOA 1Z1IA 4NFFA 3Q3XA 1W0ZU 4TWYA 5DKMA 1DWBH 3FN8A 1AY6H 2ZG0H 2PR3A 3PV2A 3E16B 2PP6A 3EGKH 1VITG 2SGQE 2ZFPH 1E38B 5HKKD 3UNRA 2VBCA 1G36A 1TNGA 2Y81A 3QO6A 4U32A 3SUFA 4INLA 2BTCE 2FOHA 2BY5X 1OPHB 1TRYA 1BQYA 2O9QA 3BG8A 1C2FA 2AGIX 3RLYH 1O5DH 1C5YB 1DX5M 3MTYA 3M7TA 2Y7ZA 5E0JA 4UFGH 5AFYH 4LOYH 4TPYA 1SQOA 1S6LA 1HAVA 1Y8TA 1GJAB 2V0BA 3UNQA 1IQHA 1Y5AT 4AOQA 3LONA 8ESTE 3O8RA 4X1SU 1F0UA 4CR5A 3SHCH 4XBCA 3OFND 2CHAB 2VWMA 1IOEA 1MMJN 2FPZA 1UTNA 2ODPA 2PTCE 2ZCLP 4MTBA 2Z7FE 1QZ8A 3SQEE 1KMHB 2UUFB 1F0RA 4TPIZ 1SGYE 1YPLH 4XSKU 1L4ZA 3A85A 1THSH 1DVAH 1MCTA 1O38A 1RTKA 2R2MB 1C2JA 1QL8A 1TX6A 5F03A 1WCZA 2ZHWH 1YCPK 4VGCC 4D76A 2BXTH 1HV7A 3FAOA 4ZAEA 2C90B 1QGFA 1P05A 1SLVB 1XVMA 3AW0A 3M7UA 1F5KU 3M37A 1O31A 3ZVAA 4ABIA 2DE8A 4HFPB 3TJUA 1ID5H 4J2YB 3LGWA 1FJSA 1J14A 4AC9A 1ANEA 1HJAC 1O5EH 1J15A 1OSSA 1G2LA 3PV5A 4B76A 4UFDH 1BITA 1KY9A 3QZRA 2H5DA 3Q76A 1O3EA 3RXQA 1H1BA 1MQ5A 3SGBE 4BOHA 4AB8A 3EYDA 3BTTE 1P2QA 1HCGA 4MG3A 3H7TA 1CHOF 2OC8A 2B7DH 1RRKA 1P2NA 3LGIA 4ZKRU 1GJ6A 2TGTA 2AH4X 2TIOA 5C5OA 5KECA 3A8AA 4ABDA 3MI4A 3GOVB 1AB9C 1QCPA 1YC0A 3SV8A 5TCAA 3VFEA 4JK5A 3VB3A 1BT7A 2WV9A 1YPMH 3B23B 2K1QA 1TPAE 2A32A 4K69A 1BJUA 2ANKH 2WPDD 3PMBB 3UNSA 2BDAA 4KTUA 3TGKE 1SQAA 1UMAH 5EJLA 1O3IA 4D9RA 2J94A 3U1JB 1FPCH 1O2RA 4X6PA 4AYVB 1XKBC 1H9IE 1TABE 2NWNA 3SNDA 5FPTA 1K1PA 2XTTB 5CHAB 1FIWA 1ZTLA 4LXBH 3ZZ8A 1NBMD 1S85A 3RXJA 1MTWA 1W7XH 1TNJA 2XBXA 1A0HB 4P02A 2W3IA 2XYAA 1KTSB 3NXPA 1C1RA 1O2GH 3ATKA 3WWFA 1CHOG 1YLNA 1P2MA 1HXEH 4H6SB 4B6FA 1GMHG 5GCHG 2XC4A 2J98B 1BRCE 1ZRKA 2LELA 2ZP0H 4YM9A 3F2GA 2ZHEH 2BDCA 1HIAB 1YLDA 3SV2H 2IOTA 3K6ZA 1QL9A 4DW2U 1AVGH 2WPKS 9LPRA 2OK5A 3F2HA 1UO6A 1TA2A 2VNTA 3T26A 1GI6A 1YM0A 3A8BA 3BTEE 2PUQH 1BMFD 1WBGB 1Z6JH 5C2ZA 3KQEA 3TU7H 1ARBA 3MQKC 4TY7A 4AB9A 4BANB 1QQUA 1U6QA 3GYLB 1DWEH 2SGPE 5DJ7A 4JMYA 1O35A 1KTTB 1QNJA 2Y7XA 2GCHF 4JCNA 4B71A 5J4QA 2BQ7B 2BX3A 1GBEA 2P59A 3D65E 1N1LA 4UDWH 1V3XA 1F7ZA 2W6ID 4BNRA 2XBYA 4F55A 4ZROA 1TNHA 1SGFG 5HYOA 2C4FH 3EDXB 1DXPA 3UOUA 3ESTA 5LH8A 3SZNA 4E06H 2RFKC 1BBRH 1CSOE 4IMQA 1TBQH 3WWBA 2ZFQH 3M35A 5DP8A 4TSFD 3R0FA 1GHAG 2P8OB 1NFWA 2UWPA 1P3CA 2ZU3A 1FMGA 5K7RA 1LHEH 1UCYH 1TA6A 5F6MA 3KL6A 3FKSD 1P2KA 3F9HA 1HFDA 2GKVE 3GCHB 1GCTB 4OGYA 1GJBB 3BEUA 2ZZUH 5J4SA 1A5HA 2GCHG 4K3JA 2W26A 2Z9LA 2AGGX 1OP2A 2QCYA 3ODFA 2ZEBA 2QYIA 5AFZH 2V35A 3UY9A 3DHKH 3QUMP 1ZRBA 3ZVGA 2ZFRH 1GI9B 2P93A 3P8NA 1KXAA 1EFRD 3RM2H 5L6NH 1C2DA 4D7FA 1ZZZA 1ETSH 2BDBA 5GWZA 4ZHAA 2BVRH 4CRAA 1WDIA 5GJ4B 3NWUA 2HOBA 4MPXA 7ESTE 4B74A 3T28A 3ZVFA 3A88A 1O2KA 1PPGE 3PO1B 5GIBA 4NZQA 3BEFB 1NBME 2LPRA 1TGCA 3DD2H 1O3LA 1UHBA 4AFUA 2VVUA 4Y0YE 2PKAA 2CXVA 3LGYA 2HPPH 3SV7A 4FUCA 2BDYA 4Y8XA 1C1OA 2F3CE 2ZA5A 4HI3A 4ZXYH 1IQLA 4JZEH 1GJ5H 1PQ8A 1WU1A 4X6OA 1E36B 1O3JA 5EU8A 1CGIE 1ZGIA 2A5AA 3UB0A 1W8BH 5FXLA 3RC4A 3SORA 2UUYA 1EZXC 1GJ7B 1SGRE 5ESBA 1O2IA 2Q1JA 3ZVDA 5KEDA 1CBWB 1ZTKA 1SGFA 3MMGA 5JBTA 2TGPZ 4NWLA 1O37A 2JH5D 1JXPA 2A45B 1RD3B 1ZR0A 2DE9A 1HAPH 1DOJA 1UTMA 2V7QD 1VR1H 1GBJA 3B8JA 2GTBA 2XWBI 5KGOA 5AF9H 5IDKA 3MYWA 3RXGA 3KHVA 2QAAA 4Q7XA 3D23A 1GBMA 1PJPA 4AYYB 2PGQB 4XBDA 2XOKD 4H42U 1C5MD 4JYUH 5EIYA 2JJ1D 1TGSZ 3BTFE 1P8VC 4K2YA 1FAXA 5LPEA 1D9IA 3ZZDA 1L4DA 1TAWA 3U1IB 2AGEX 1N6YA 5F8ZA 1AVWA 2EI6A 1ETTH 4BTUB 3GS9A 5CDFE 4IN2A 4YT6H 3SJKA 2WHXA 4I8KA 5LPFA 2Y5FA 4NA7A 3P6ZB 3A7YA 2BD8A 3SI3H 1SGNE 3E1XB 5ESTE 4FUEA 4E7NA 2D26C 1E37B 1UVTH 2Z9KA 2VJ1A 1OWKA 2ODYB 1WYKA 1GG6C 1MTNC 3TNSA 3IITA 3SU0A 1W3CA 2Y6TA 1J16A 1TGNA 2AMDA 1NRPH 1OWDA 2OBOA 3E0NB 1S81A 4Q2KA 3TJVA 2C8XB 2GD4B 3BG4B 1O3NA 4I8LA 4SGBE 1L1NA 2VIOA 2ZFFH 4J1YA 2ZTYA 3HGNA 1EAUA 2H6MA 1O39A 3RLWH 2QA9E 1EZSC 3KNXA 1HAGE 4M7GA 1CT4E 2AFQB 4YXWD 1EJNA 2Z3EA 1SLUB 1YPJH 3MU8A 1AFEH 1UVOA 2STBE 3RMOH 1S0RA 1V2MT 2C8WB 1C1QA 1M9UA 4ZKSU 5CHBA 1V2KT 3VGCC 4JYTA 3T2NA 2JH0D 2VIDA 3GCNA 3KQDA 2J38A 1O0DH 1RTFB 2I6SA 1SGIB 2Y82A 1EB1H 2OBQA 1GHBF 3A84A 2RDLA 4IS5A 3AAVA 3NZIA 3L3TA 3OTPA 3F2FA 1D3TB 2ZU5A 4RI0A 2IJOB 1GL0E 1SMFE 2BLQA 1BTZA 2A31A 4K1SA 1WTHD 8GCHF 4NFEA 3DFJA 1DPOA 1A1RA 1DS2E 3F1SB 5C3NA 5SGAE 4U2WA 3MOCA 1BZXE 4X1NU 2QXHA 3DSOA 2AMQA 2AIQA 2GMTC 1JIRA 1PPZA 3T62A 1H8HD 1AN1E 4UD9H 1TRMA 3JZ2B 1LVMA 4BXSA 1AMHA 4ZCNA 2VINA 4OS5A 4Q80A 1GI8B 2P3TB 1MTVA 3RXLA 4CHAC 2BD5A 2OQUA 1BRBE 5L30H 1D4PB 2OCVB 1QRXA 2UUJB 5T6DA 3BIVH 1O2MA 1P9UA 2B0FA 1ANBA 1K2I1 3SBKA 5TJXA 1GHYH 3QTOH 1HNEE 3GDVA 2V3MA 1NFUA 3PB1E 1Y3YA 1JBUH 3RXVA 1ELAA 2G81E 3RMMH 4Y6DA 1XUIA 2AHME 3ZIAD 2VIPA 1MU6B 2GV6A 2KAIA 1LKBA 2CF9H 1MU8B 4MDSA 2SGEE 1CQQA 3TITA 1Y59T 3BF6H 3QK1A 2R3YA 1FIZA 3SUGA 2RA0A 2HALA 2EY4C 1QJ7B 1TMUH 3P8GA 1GMDF 2HWLB 3VB5A 2FYRA 5C0UA 1XM1A 2FOFA 3OE7D 3GY7A 3SU6A 1E1RD 1O2NA 4OS6A 3ZV9A 2VH6A 2Z94A 1EASA 1G2MA 3LKWA 2Y5GA 2JDID 1T8NA 4H6TA 1TIOA 2BXUH 1T8OA 1C5ZB 1O2ZA 3MH5A 2FX4A 1PQ5A 1YF4A 5H4IB 1C5NH 4GHTA 4GUXA 1TE0A 3ITIA 2PHBA 3IWMA 1GBHA 1H9HE 3A81A 4ZHLU 2FXRA 2AEIH 1LQEA 2ZECA 1BUIA 3ZVEA 1GJ9B 2FM2A 2G5NA 1HGTH 2LNCA 2VWLA 5JBBS 1MABB 3ZZ3A 1W0YH 1BHXF 1EAXA 4LZ4B 1GJDB 1GMDG 2A2XH 1C5PA 1DY8A 1ZOMA 2B8OH 5EQRA 2KCAA 2M2AA 2PLXA 3QGNB 4BAMB 2GT8A 1NU9A 2EI8A 4M9FA 4JK6A 1SGCA 3F68H 2I6QA 1ZHRA 4MQAA 2ZU2A 1AO5A 3HKJB 4JZ1A 1ZMLA 1WSSH 1C5WB 1K9OE 2AERH 3EAJA 1HAHH 1EP6A 3QN7A 1CO7E 3UQVA 1AE8H 2ZGBH 1ZSJA
chains in the Genus database with same CATH topology
1B7XB 2F9UA 1ANDA 1RFNA 3P8OA 1A0LA 4NWKA 5FCRA 2FIRH 2V3HH 5GDSH 4I7YH 3SV9A 3T27A 1LPKB 4CH8B 1BA8B 4ISLA 1P2IA 3IG6B 4YT7H 2A0QB 4O3TA 2GZ7A 2VGCB 4TYDA 1UK2A 3B9FH 1SOZA 2QXGA 3ZZAA 1UTLM 1NRSH 4INHA 2GDDA 1GDNA 1WV7H 3GICB 1A61H 3GCOA 4ABEA 1O5CB 5DGJA 1O2LA 3SHAH 2BY8X 7KMEH 1BTWA 2A1DB 1GJCB 3V3MA 1A3EH 1XXFA 1Z8IB 2B9LA 4MPUA 1OKXA 4B75A 1O2WA 4DIIH 1O2JA 4X8TH 1YCPM 4FU7A 5EPYA 3F6UH 1YPHC 1PYTC 3RU4T 3NCLA 1NFXA 2FS9A 3Q3YA 2ZGJA 2Q6FA 2PKSB 4B2CA 2R3UA 1C1WH 3S9AA 4IBLH 4I8GA 1SQTA 2W7SA 3SI4H 1H4WA 5A8YA 3R3GB 3TK9A 2FDAA 2P95A 2GX4A 5JDUB 2PWXA 3M36A 2FYQA 2BDIA 4DJZB 3S7KB 1VCPA 1LVBA 3S0NA 5HMAA 3ATIA 4Y10E 1C5TA 1NZQH 3SGAE 1CA0C 1TFXA 1NM6A 6CHAC 3M61U 2H9TH 1THRH 1EXFA 1VCQA 4X0WU 2WUCA 2G8TA 1C2IA 1ELTA 6GCHG 5JB9S 1D6RA 1O5FH 4MLFB 1ELVA 4AZ2B 8LPRA 1XMNB 5FBIA 3KF2A 1SVPA 1W12U 7GCHF 4X1PU 3SW2B 1LMWB 1TNLA 1K28D 5E2OA 1OOKB 2EI7A 2FOEA 1BHXB 2QV1A 2UWLA 4O3UA 1GDQA 1LO6A 3CS7A 2D1JA 3CENA 3RU4D 4AX9H 3MWIU 3MHWU 2G55A 3LU9B 4X1RU 1O2TA 1BOQA 1ELBA 2P94A 3D62A 1ZJDA 8KME2 2C3SA 1F0TA 1GMHF 1EB2A 1KYNA 2GDEH 1XUHA 5GCHF 2BD3A 3AASA 1E0FD 2CMYA 5FX5A 1BMAA 2G5VA 1ZLRA 1MZAA 1A7SA 2A4RA 2ZNKH 3A7XA 1WOFA 5L2ZH 2H9EH 3BTKE 1PPHE 1SB1H 2J34A 1Z6EA 2FMJA 1FY1A 2SGFE 1V6DA 3SN8A 3PMHB 1UTOA 4CR9A 1LPZB 5AHGH 1A0JA 2BB4A 7GCHG 4R0IA 2ZFSA 4GVUA 1ETRH 1FI8A 3URDA 1GCTC 5C5NA 2Q6DA 5DP9A 4CREA 3SQHE 5DP5A 3F9FA 3LJJA 2ZTZA 3RXCA 3UTUH 1LHGH 2Z3CA 9ESTA 1D6WA 4PROA 1S0QA 1ZHMA 2QF3A 3VXEH 4D8NA 3PLBA 2FO9A 1NU7B 4A92A 2XW9A 1AZ8A 3SUEA 3V0XA 1NESE 4AFQA 4Q7YA 1GGDC 1GHAF 1C1SA 1C5OH 1GBAA 2F9VA 3LGUA 3LPRA 1Q31A 4XOJA 3HK3B 4ISHH 3QLPH 1XUGA 2FOMB 3PLPA 3I77A 1SHHB 3PO1C 1V2LT 1RIWB 1PPFE 4DGJA 3RXDA 4THNH 4NSYA 3FFGA 4KELA 4D7GA 4MNXA 1V2OT 4VGCB 5A0AE 1IQGA 2BMGB 2THFB 3OTJE 2WPHS 4WVPE 2ULLA 1FLEE 3MO9A 1YYY1 3VXFH 1N8OC 1LTOA 5I46H 4YZUA 1RGQA 1IAUA 1HJAB 3TH2H 1H9LB 1XXDA 1QRZA 2XBVA 4UE7H 4K1TA 3UIRA 5FAHA 1LQDB 3RXOA 3RXTA 1YBWA 4Y0ZE 1Y3VA 4D9QA 2GCTB 1HIAA 1EUFA 1GVKB 2BD4A 1CBWC 1O3CA 1TMBH 4WXVA 3PYHA 2WYJA 1AVXA 4X6MA 4HGCA 1V2TT 1WQVH 1HPGA 4LK4A 1G3DA 2QF0A 4X2YA 1ORFA 2OC0A 3M3SA 3VB6A 4NSVA 1AU8A 2R0KA 4KTCA 1C5UA 2J4IA 3U8TH 3TGIE 1O36A 3LJOA 3RU4E 1AB9B 3HATH 5C20A 1QURH 3E0PB 1AKSB 1NY22 1Z8GA 1AD8H 1ZPZA 3TK5A 1WUNH 1GBBA 1SPJA 1D3PB 6LPRA 1SL3A 1P03A 1P11E 2FI5E 2AMPA 1IQIA 2FTMA 3OYPA 1UHBB 1AQ7A 2ZDAH 3UR6A 2PKAB 3GYMA 2QGRA 2TGAA 3VPKA 3QDZB 4I8HA 2IN2A 1AFQB 2G4UA 2UWOA 4ISNA 4YLQH 3TK6A 4AG1A 1NRNH 2PW8H 4TY6A 1P0SH 3SGQE 3S9CA 2ZKSA 4OGXA 4Y7BA 2TPIZ 3QX5H 2BLVA 4K8YA 3EE0B 2TBSA 1T4UH 1QJ6B 1T32A 4X8UH 3UFAA 1W2KH 1O2UA 1NN6A 3GY6A 4ESTE 1YKTA 1ZYOA 2FI3E 4X2WA 3K6YA 3V7TA 1FV9A 4KGAA 2W3KA 2B5TB 1BBRK 2Q6GA 1P04A 1QJ1B 1JIMA 1X7AC 1P02A 4IGDA 3SJ9A 2VIWA 5HXFA 1MKWH 2WUBA 1AWFH 3BEIB 1DWDH 3BSQA 2BZAA 2HNTC 1BIOA 1O3DA 2Z3DA 1UCYK 3CS0A 5I25A 2OXSA 4HTCH 1AI8H 1BMMH 2G51A 4IW4E 1C2GA 1FDPA 1TNIA 1UK4A 2BOHB 4FVDA 2OQ5A 3MFJA 1EAWA 4X2VA 1P12E 4BTIB 4OS2A 5DO4H 1FY4A 1O32A 2QC2A 1ESAA 1P06A 1P2OA 1V2VT 1DT2A 1TMTH 4ZXXH 4NA8A 3T29A 2ILNA 4AORA 1D3QB 2A4GA 2A4QA 1B5GH 1G37A 3MU5A 1ZJKA 3EA7A 2NU0E 1AZZA 1PQ7A 4FU9A 1S82A 1C9TA 4CBOA 3P17H 1EPTC 1O3GA 2ZCHP 1LVOA 3M5LA 1HRTH 5DP7A 1TRNA 3PMJA 4HZHA 1WQSA 2O8LA 1NRRH 3RXFA 2TRMA 4DY7B 3ZZ9A 3MH4A 2A7HA 1MUEB 3LIWA 2A4OA 1GJ4H 4FUBA 5EXMA 1BB0B 3JZ1B 3A8CA 1K1OA 1B0FA 2STAE 1RS0A 2SNVA 2R2WU 1FY5A 1LHDH 4NCYA 1EJAA 1DLEA 1MKWK 2A5KA 2BY7X 5HM9A 3TH3H 4ABHA 1ACBE 2R9PA 4A5TS 1ESTA 2WV4A 3BTGE 3O8DA 1PYTD 1MCVA 1TYNA 3A82A 4AGJA 3RXMA 1C4Y2 1CVWH 4YLUA 5IYTA 3A7WA 2XWAA 1K1JA 1S84A 1VITH 1N6XA 1GDUA 1NPMA 1ELGA 2ALPA 2NU2E 1HAIH 1C1UH 3DUXH 4U01A 1EKBB 2YNBA 3EA8A 2O8UA 2VIQA 1HB0B 3GY5A 5DP6A 2GZ9A 2A2QH 3TPIZ 1SGPE 1TGTA 2F9PA 1P3EA 1FAKH 4XE4A 3RDZA 2VB0A 5FX6A 1CGHA 1O2YA 5EOKA 3MU4A 1A5IA 2NU3E 4IC5A 2ZGCA 3OSYA 1O2XA 1NT1A 4IC6A 1CA8B 3L33A 1V2ST 1YP9A 1HXFH 1OWIA 5JBCS 2JETC 1O34A 3M3VA 2GGVB 4UEHH 2ALVA 2NU4E 4ABBA 3RXUA 5A09A 1DFPA 1BDAA 4FUGA 4UONA 3SUDA 1PPBH 3M7QA 3OY6U 3BTHE 3Q3KA 2W5EA 1EZUC 1Z71A 3KQBA 1GHXH 1EQ9A 5E0GA 3LDXH 2WPLS 1YPGH 1LHFH 1TOMH 1DITH 1ZHPA 5EQQA 1DICA 1MD8A 1O3BA 3DT0H 4SGAE 4K5ZA 3UOPA 1HYLA 3W94A 2FS8A 5DG6A 3GDSA 1OXGA 2KAIB 4RKOB 4FVBA 2SGDE 4BAKB 1GI5A 1FQ3A 2HRVA 3UREA 5EW1H 1C5RA 2ZGHA 7LPRA 1TPSA 1WAYB 1EAIA 2P3FH 3SNBA 1IQMA 1KDQA 2O8WA 4E05H 3ATWA 3ZZ4A 1UTJA 4XFQA 3P92A 4FUJA 3U98H 3O8CA 3TGJE 1Z7KA 1PPCE 1YLCA 5K0HA 4DVAU 1Y3XA 1GG6B 1L1GA 1MTNB 1FN6A 4JYVH 1EPTA 1HAYB 3OY5U 1GVLA 5EPNA 2BD2A 1MKXH 3E90B 4OS7A 1JMOH 2BD9A 4NG9H 1O5BB 3FVFB 3P8FA 5BRRE 2CGAA 2F91A 3RXAA 3GY2A 4U30A 4E7RG 3W95A 4I8JA 2FZZA 3SU1A 1V2PT 4X1QU 2Y80A 1DY9A 1BTPA 1P09A 4GSOA 4DCDA 1ZGVA 2H9HA 1SBWA 3SO3A 1AUTC 1P9SA 1YPHE 2OC7A 4X8SH 1BCUH 1Q2WA 2PSXA 1MAXA 2WINI 1C1VH 1GVZA 1W7GH 2O8MA 1LKAA 3MU1A 3AAUA 3VGCB 5EXLA 1TQ7B 1O3HA 4ZHMU 3RXBA 2ZC9H 4H4FA 2DUCA 2PKSC 1FN8A 1SR5C 2F9OA 1GMCG 3RUOA 4DURA 5LPRA 1MAYA 2CHAC 3GY3A 4WWYA 1GWAA 4CRDA 1SHYA 1HJ9A 2GV7A 1O2PA 1O3KA 3LGVA 4Y8YA 1JRSA 3ZZCA 4ZMAH 2FP7B 1GHWH 1IQJA 1AHTH 5E2PA 3STIA 1V2JT 5ABWA 3P95A 5A8XA 1O2VA 3VB4A 1YPEH 3UUZA 5C1UA 3DA9B 3PROA 4NIWA 5G4BA 2BY6X 1QA7A 3A87A 4KTSA 4CHAB 2PTNA 5C1YA 5HM2A 1C2EA 3D49H 2XXLA 1IQEA 1ABIH 2ZPSA 1C5SA 1UTQA 1W14U 2P3UB 1K1NA 3BTWE 1TOCB 2VWNA 3S9BA 2TGDA 1DXWA 1HAVB 1VJ9U 3TJNA 3A7ZA 3OX7U 3AVZA 1QBNA 1EP5A 4I33A 4A1TA 1YCPH 2BOKA 1VGCB 6ESTA 2M5TA 1TONA 1XUKA 1C1NA 4AN7A 1OWJA 2GZ8A 2FESH 5JB8S 1ZSLA 1FY8E 2VWOA 3UQOA 6GCHF 2XRCA 4MNVA 1GI0A 3K2UA 1IQKA 3RXIA 1UVPA 2YNAA 3E6PH 2XCNA 3FP6E 1J17T 1BRUP 2BLOA 3GY4A 1ARCA 2A5IA 4WJG2 5CHAC 5DK1A 1KIGH 3G01A 2BLWA 1KLIH 5JBAS 4GPGA 2ZGXH 3E8LA 2BX4A 1QQ4A 3PMAB 3QWCH 2XNIA 3PTNA 5FPSA 1WTGH 1AUJA 2Z9GA 1C2LA 5EG4A 2WPIS 1B0EA 2FLRH 1D3DB 4AFZA 4AFSA 1MTUA 3ATMA 1SOTA 4WXIA 1SSXA 2VIVA 2OTVA 3FZZA 3C27B 1C2MA 1ELCA 3ZYDA 4B2BA 1NROH 2F9NA 3KCGH 1THPB 2ZDNA 3RM0H 4ISIH 3U9AH 1OYTH 2EC9H 3NKKA 1L2EA 3RXPA 1TNKA 1O3AA 1FZZA 5ETXA 1IQFA 1RIWC 2Y5HA 2FOGA 1O2HA 4WMFA 1CGJE 3LC5A 2SGAA 1A3BH 1K1IA 1LPGB 3PM3A 1OWHA 3SNEA 3HGPA 1ESBA 1DANH 2C8ZB 4Z6AH 2J9NA 2EA3A 2QY0B 3M3TA 2PSYA 1G3EA 2OLGA 2FTLE 1IQNA 4NZLA 4UFFH 2PUXB 4RN6A 1Z8JB 1OP8A 1TALA 3SU4A 3ZZ7A 3MNXA 3PLKA 1TX7A 2WPJS 1MTSA 2GCTC 1ELDE 2ZU1A 3I29A 2P8OC 1C5QA 1TPOA 2ZF0H 1UTKA 1NRQH 2ZQ2A 1G32B 1RTLA 2ZWLH 4RKJB 1GBIA 2RCEA 2BVXH 1TB6H 3GCHC 1VCWA 1TX8A 2AS9A 2ZCKP 4NIXA 1G3CA 2ZDKA 2VVCA 5DP3A 5EW2H 4BTTB 4NIYA 1GBFA 1XVOA 4INKA 4DOQA 3ATLA 1V2UT 4CRGA 5EXNA 2RA3A 1QB1A 4CBNA 4Y71A 3U8OH 1HDTH 3KIDU 1GBCA 1T7CA 1K22H 1V2WT 4X2XA 1O3MA 2IPHA 3V12A 3QTVH 3ZYEA 4WMEA 1AFQC 1SLXB 3HK6B 1L1JA 1ZSKA 3LT3A 1ZPBA 1FXYA 3O8BA 3VB7A 4Y79A 4A7IB 1O30A 3FZDA 1SC8U 4FU8A 3UWIA 3Q77A 1ZMNA 1O3FA 1QBOA 1CA0B 1LVYA 1A2CH 2W7UA 6CHAB 2H5CA 2BQ6B 1HAZB 1FONA 3KGPA 3SNAA 3STJA 4FUIA 4KKDA 4B73A 3RC6A 2AYWA 3T5FH 1OX1A 1QRWA 2ANMH 1QY6A 2RG3A 1OS8A 1TBRH 3K65B 2A7CA 4BAOB 2PFEA 2ESTE 1AGJA 3AW1A 1P01A 3GY8A 3ZVCA 1O5AB 2HNTE 3CP7A 1ELEE 4JZDH 3TVJB 2C8YB 2Z9JA 1A5GH 4GLYA 1GCDA 3BIUH 3M5MA 1SG8B 2BQWB 4MPWA 1S5SA 1XKAC 5FCKA 3A83A 2D8WA 3ZZ5A 2QXIA 3UPEA 1DE7H 4WH8A 1MZDA 1VJAU 1KXFA 4BAQB 3LOXA 1SGTA 1DSUA 4XBBA 1GI3A 4CRBA 1C2KA 1KLJH 1MH0A 1F5LA 1ZMJA 3TJOA 2G52A 1GPZA 2ODQA 3F9GA 1ANCA 4LZ1H 5FBEA 1SGEE 3MH6A 4I32A 5A0BA 4Y7AA 4ABAA 3SU3A 1S83A 3A7VA 2ZTXA 1UVSH 1F0SA 1Y3WA 4ABJA 1MBMA 1AE5A 3UR9A 3RC5A 2FOBA 3EQ0H 2XBWA 1XX9A 3ODDA 2FLBH 1GJ8B 2GT7A 4ZKNU 1GI4A 1DSTA 1ZTJA 3I78A 4AG2A 2YOLA 1IHSH 1RXPA 4GCHF 2PGBB 1UVUH 5EQSA 3RXRA 2HGTH 1OP0A 2GP9B 1Y5BT 2OINA 1O2SA 1F5RA 2V6NA 2HPQH 1OYQA 3SU5A 1AIXH 4O9VA 1CT2E 1E34B 2QXJA 3S69A 1W13U 1NC6A 2ZFTA 4TWWA 1C4V2 2ZDMA 1HLTH 1S6HA 2JKHA 1BJVA 4F49A 1GBLA 1SI5H 1UJ1A 4DG4A 1HUTH 1GGDB 3RXEA 2FOAA 1QR3E 4WY3A 1HAOH 2HNTF 1AKSA 5LGOA 3ENSB 1QIXB 3M5OA 3GCTF 3BG4C 1GHZA 1UTPA 2ZHQH 2FX6A 2VU8E 1MD7A 1O3OA 2ZPRA 1INCA 4R8TB 1BBRE</