4ASHA

Crystal structure of the ns6 protease from murine norovirus 1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
184
structure length
177
Chain Sequence
SAPVSIWSRVVQFGTGWGFWVSGHVFITAKHVAPPKGTEIFGRKPGDFTVTSSGDFLKYYFTSAVRPDIPAMVLENGCQEGVVASVLVKRASGEMLALAVRMGSQAAIKIGSAVVHGQTGMLLTDLGTIPGDAGCPYVYKKGNTWVVIGVHVAATRSGNTVIAATHGEPTLEALEFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NS6 PROTEASE
publication title Structure of a Murine Norovirus Ns6 Protease-Product Complex Revealed by Adventitious Crystallisation.
pubmed doi rcsb
source organism Murine norovirus 1
molecule tags Hydrolase
total genus 35
structure length 177
sequence length 184
chains with identical sequence B
ec nomenclature ec 3.4.22.66: Calicivirin.
pdb deposition date 2012-05-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ashA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ashA01
2ZU2A 1BBRE 1A2CH 1FONA 1OS8A 2ZFTA 1Y5UT 2PFEA 5B6OA 4ZAEA 1PPEE 2LPRA 3SU3A 1KSNA 1YGCH 2Z94A 2QCYA 1EZXC 1A46H 2Y6TA 1YPJH 1DANH 1DPOA 4NGAH 2Q6GA 2G55A 1GCDA 1C9PA 2TPIZ 1L0ZA 3KHVA 1DITH 1TMBH 3BIUH 4A1VA 4K69A 1MTSA 3BN9A 1VR1H 1O2RA 1YF4A 5FXLA 4D8NA 1FIWA 2VU8E 3UR9A 2VWOA 2A2QH 4NG9H 3SORA 1HAOH 2OBOA 2A45B 1O3OA 1GBIA 2GDDA 4CRGA 3L33A 4AOQA 4I31A 2ZA5A 3LDXH 2ZC9H 5I46H 1P2IA 2AIQA 1GBTA 1DSTA 1C5LH 2TIOA 5A0AE 4KKDA 1SLUB 4GAWA 3RMNH 3ZVBA 3W94A 1D3PB 1H9HE 3TK9A 1UTLM 3SHCH 1IQMA 1NT1A 3FP8E 1QHRB 1Y3XA 4WH6A 2CF8H 3A81A 2ZDKA 2BZAA 3ZZ7A 1K2I1 3U1JB 2UWLA 2VWLA 1KXBA 1DS2E 1GG6C 1AMHA 1S83A 4YLUA 2BD9A 3TH3H 5DJ7A 3SNBA 1C5UA 2ILNA 1YPKH 2JH0D 1GJ9B 2BM2A 1AIXH 1LKBA 5E8EH 1KYNA 1EOLA 1SGNE 3FZDA 4CRBA 4FXGH 3SGQE 1XUJA 3VGCB 1Q31A 4B2CA 1KY9A 3MO3A 3GDUA 1ZTKA 1VJ9U 2JETB 1T4UH 5C5OA 5FPTA 2FLRH 1CT4E 3LU9B 3QZRA 2A7CA 3IG6B 3LONA 4CRFA 1F5RA 5GWZA 3ZYDA 2QF0A 2Z3EA 3SU0A 3OY6U 2UWOA 1HRTH 1O2KA 4TPYA 1SSXA 2GT8A 3JZ1B 3UUZA 2B5TB 1TGTA 3ZVCA 3MTYA 2H5CA 1O36A 3RXSA 1HBTH 4FU7A 2C8XB 1AFQC 3QX5H 4Y6DA 3LC5A 1FZZA 4K8BA 4MPVA 3DUXH 1BZXE 2GCTB 1NRSH 1ELDE 1PYTC 2R3YA 1NFUA 4X6PA 4X8VH 4BTTB 2HLCA 1BUIA 3RXGA 1XUFA 1EAUA 4H6SB 1GJ7B 1NESE 1TMUH 2P8OB 2FI5E 2ZTXA 2WYJA 3RLWH 3SJKA 3EA9A 4XFQA 1MTVA 2GZ8A 1GI9B 1GPZA 1N8OB 3GY6A 4JCNA 4NCYA 1NFWA 3Q76A 2GV6A 1O35A 3SJ8A 1JRTA 2QXIA 1F5LA 3NCLA 2PTNA 4K8YA 1RIWC 1C2IA 3E90B 2XBVA 1QNJA 5FCKA 1ZTLA 1K1PA 1KDQA 2GCHF 1LKAA 3F9GA 5FBEA 3VB5A 1XMNB 4D9RA 4I8LA 3Q77A 1BRAA 1CHGA 3BTHE 2BDCA 4X6OA 2QYIA 2DUCA 5JBCS 4R8TB 1ANEA 1DE7H 2J95A 5K7RA 5T3HA 4NZQA 4BOHA 1ZPZA 1ARBA 2SGDE 2GD4B 1C5YB 4AORA 2V35A 4Q7ZA 1C1WH 3ZZ6A 1KXAA 1GGDB 2BLOA 2C3SA 2NU0E 3SJIA 4MDSA 5GIBA 3G01A 4ISHH 2BOHB 1ETRH 2VH6A 2FOEA 1QL9A 1P05A 3PO1B 3RLYH 1GJ6A 1VITG 5DG6A 3F6UH 3K9XB 1AUJA 1ETTH 1TPPA 5TCAA 2G4UA 2FXRA 3B9FH 3GY7A 1NM6A 5GCHF 3RM2H 4GHTA 1ZPCA 1FDPA 1C2FA 1D3DB 3DFLA 5G4BA 1S81A 1C4V2 5EXMA 1MTNC 1O2IA 1XUIA 1PQ5A 1LDTT 1UTQA 1E0FD 5DP6A 3SU6A 3RXDA 2FYRA 3SI3H 3S0NA 4Y0ZE 4A1XA 1DFPA 3HPTB 1ELFA 2OBQA 2GZ9A 3P92A 2VIDA 5EODA 3RP2A 1UTKA 3GY2A 4FVDA 4H6TA 2G5NA 2YOLA 1V6DA 5L2ZH 4KELA 2C90B 1V2KT 2B8OH 3KF2A 1ANDA 2AIPA 3W95A 1IQGA 2W5EA 1HAYB 3A7XA 1GBMA 1GBLA 4X1NU 3EQ0H 3TPIZ 1A1RA 2I6SA 4GPGA 1HUTH 1ZMJA 1ZZZA 1QJ6B 2QY0B 3F68H 2FYQA 1ELAA 1Y3YA 4OS4A 1Y3UA 1W12U 5HXFA 1O37A 2ZDNA 3O8BA 5JPMH 1GHBG 3GCTF 1EQ9A 1EKBB 4ABHA 5A0BA 5T6GA 1O3CA 3RXVA 3VEQB 6CHAB 4X1QU 1UTJA 1T4VH 1MBMA 2P3FH 1DY9A 4X2XA 2Z9JA 5DP5A 1AWHB 4UE7H 5FX6A 2VVUA 5DGJA 1EX3A 3TITA 3UY9A 2FO9A 2OLGA 2R2WU 6GCHF 3M37A 1JXPA 3UOUA 3BTFE 1A0JA 3MO9A 2VIWA 3VB3A 5FBIA 1D3QB 2WPJS 3SI4H 1MAXA 5EQQA 1C4U2 1C1TA 3NUMA 3U8TH 3P8NA 1FIZA 1C5PA 2ZHDA 1BTPA 1KXEA 4DY7B 1O39A 3P95A 4E7RG 1MZAA 2XBWA 1MZDA 1NPMA 1TGCA 2QXGA 3C27B 4YZUA 1O0DH 4WXIA 2PV9B 3UNQA 1K1IA 1UHBB 1XUGA 2ZEBA 1FQ3A 1EAIA 2OXSA 1H1BA 1XXFA 3BEUA 4DURA 1AN1E 3GCOA 4FU9A 1MQ5A 5DP4A 4A5TS 1H9IE 3QWCH 3A7WA 2F9VA 2GX4A 2J2UA 3K2UA 1V2MT 2UUYA 2BX4A 4NZLA 1EUFA 1V2LT 3VGCC 1YLDA 7ESTE 3TLOA 3HGPA 3VXEH 2JETC 1DSUA 1V3XA 1BHXB 2VINA 1K1MA 3OX7U 4JMYA 2GKVE 4U32A 1G3EA 3PMHB 1Y5BT 1O3GA 2ZDAH 4YLQH 2GGVB 4Z0KA 3ZZ4A 4I7YH 2BZ6H 1NRPH 1CQQA 1S0RA 1TNKA 3MHWU 1BJVA 1SG8B 3RXPA 1BRCE 2B0FA 1O2PA 9LPRA 1F0UA 1L4DA 2PLXA 1KXDA 3PV4A 2ZIQH 3RMMH 4HGCA 4X6MA 2GCTC 3LGUA 3QK1A 1UVUH 1YPLH 3NPSA 1FAKH 4X1SU 3HGNA 1S84A 4OGYA 1YM0A 3SV9A 2FLBH 3PB1E 2FZZA 2ANMH 3SUGA 4UFFH 1JBUH 1LPKB 1WQSA 3F1SB 4TY7A 5AF9H 2ODPA 1O2VA 3RUOA 1NROH 1FN6A 2ZU1A 1N8OC 3GY8A 1GMDF 3OU0A 4I32A 4WY3A 2FTMA 1HJAB 1TONA 3PM3A 4YOJA 1YP9A 4AFSA 2FP7B 2ZFRH 2V3OH 3NWUA 1UCYE 1OWKA 2FX6A 1T31A 3MNBA 2FOFA 3KCGH 1SGEE 1OKXA 2XBXA 3K65B 4AFUA 2IN2A 3SJOA 1GI4A 3SU4A 3P70B 2SGEE 3BG4B 1TIOA 4B71A 5DP3A 3RMLH 3MU1A 2WPMS 2BDYA 3U8OH 1V2QT 8GCHG 3H7TA 1S0QA 2Y5GA 4DVAU 1IHTH 3RXTA 4JZFH 2PUXB 1K28D 1C5XB 2GZ7A 2A5IA 1GI6A 3VB6A 3QO6A 4TWWA 3LIWA 2ZCKP 2F9OA 2AH4X 4LK4A 2BX3A 3HK6B 1QBOA 2ANYA 4BAKB 1GGDC 1UVTH 1SGYE 1WUNH 1J14A 1OWJA 3STJA 3WY8A 1O30A 1G32B 2FS8A 4D9QA 4A6LA 1EASA 3PO1C 3DFJA 3QUMP 1C4Y2 3M35A 4BAHB 3I29A 1J9CH 1GI1A 1UMAH 1FMGA 1O5CB 4AG2A 2HNTF 1P11E 1C1QA 5DP9A 1ZMLA 1XKAC 3A86A 2F9BH 1CT2E 1DM4B 1G30B 1SGTA 3VB4A 1ZHMA 3LT3A 1C2MA 1P2OA 1NFYA 2BVXH 1C9TA 1SOTA 2R3UA 4E7NA 2XTTB 3LGWA 2ZGCA 1O2MA 3SV8A 4E06H 4UFGH 2R2MB 1TX7A 3ZZAA 3UWJH 1HCGA 1GDUA 1P3CA 1O3JA 3FVFB 1YC0A 1C2LA 1N6XA 3BEFB 1QY6A 3SBKA 2WV5A 1CGHA 1HFDA 4XDEA 1P2NA 3C1KA 4YTAA 1FN8A 3EA7A 2Y80A 1ZPBA 3AAUA 2ZF0H 3I77A 1EZSC 4FUDA 2HNTE 1MKXK 1GJDB 4B75A 2H2ZA 4SGAE 4NA9H 5TJXA 3TVJB 5FAHA 4NIWA 3EYDA 1ABJH 2PSYA 4Y76A 1LQEA 3MI4A 2Y7XA 2AFQB 4ZKSU 1TFXA 2OC0A 1D3TB 1QA7A 2V0BA 1NN6A 3A89A 2P59A 3CS7A 4U01A 4Y7AA 2Q6DA 4KTCA 1DDJA 4GLYA 4ZXXH 1HJ9A 4Y79A 3BSQA 1CGJE 3P6ZB 1EP5A 1P06A 6CHAC 1QURH 4MNWA 1W7GH 1TBZH 1V2JT 3AAVA 5C1YA 4CRDA 5EQSA 1H8DH 3ATMA 1TPSA 2EEKA 1LHCH 3V3MA 1KIGH 3T25A 3NXPA 3UOPA 5C67A 3ESTA 2NU3E 2XW9A 1A0HB 3A7TA 3LJOA 1LHFH 1Z6JH 1CBWB 1DOJA 4ABBA 2NU1E 3ZZ9A 4J2YB 1CE5A 3MU5A 3VPKA 1ABIH 4ESTE 1GMHG 1LHGH 2FTLE 1O3KA 1BTHH 1O2YA 2ANWA 1G2MA 1P8VC 1RGQA 4Q80A 2SFAA 1TYNA 1SQOA 1P2JA 4B73A 1G37A 4ZUHA 2G00A 2VWNA 1E34B 5ESBA 3SO3A 2QXJA 1DVAH 3AW1A 2QA9E 2BTCE 3ZZ3A 2HWLB 2PSXA 4H4FA 2ZGHA 3IITA 2A31A 1A0LA 2BDHA 2WPIS 1UVOA 3UNSA 1HXEH 1CT0E 2BVRH 1O38A 1GHVH 1C2GA 1C2JA 1PFXC 3Q3XA 3GDVA 2H5DA 1OWHA 4Z6AH 1QB1A 5CHAB 5ESTE 1S6HA 3RXKA 3S9BA 1GJ4H 1GBFA 3BTTE 1W13U 1TGNA 3PYHA 5C1UA 3H7OA 3TH2H 4Y10E 3V7TA 3ZZ5A 1BOQA 1O3PB 5JBTA 2IPHA 2FWWA 4Y0YE 1BTYA 2XNIA 3RXOA 1AFEH 1L4ZA 1GVKB 2J34A 3CP7A 3ZZDA 3E0PB 4NA7A 1J17T 1NO9H 1D9IA 1ELCA 1SGQE 1XXDA 1O2QA 4JZDH 1C5QA 3ZVGA 1HDTH 2NU4E 1KDQB 1UTMA 1MD7A 1MMJN 1AVGH 2Z7FE 2ZU3A 1P3EA 1Q2WA 1O3NA 1EAXA 3A8AA 4O3TA 1OWIA 2OQUA 1HJAC 1QFKH 2C93B 1DX5M 3O8RA 4NWKA 3V12A 1IQIA 2VVVA 2CF9H 4BAQB 1ACBE 1TX8A 3SQHE 5EW1H 5A8XA 4WVPE 1VGCB 3ODFA 1F92A 2ZDVH 1PPHE 1TWXB 2NWNA 3TK5A 4Q7XA 3QGNB 5E0JA 4CH8B 4AGJA 1OP2A 1SPJA 1OYQA 4Y71A 2WPKS 1GI0A 1J8AA 3BG4C 1BBRH 1BBRK 1O3LA 1JMOH 1O5DH 4U2WA 4ZHLU 1SBWA 3MU8A 4CRCA 3NZIA 3MNSA 1THRH 4ZHAA 1DUEA 1C1OA 1D4PB 1RS0A 3RC5A 1RFNA 1AY6H 1BITA 1AKSB 4RSPA 2XC0A 3BTQE 4TYDA 2VIVA 4A1TA 1B5GH 1HAZB 1Z1JA 1TNGA 2FMJA 1O2XA 1DLKB 2GDEH 1MCVA 4MNVA 1QRWA 3LOXA 1RD3B 1W14U 2A5KA 1BIOA 3TNTA 3GDSA 5F8TA 4JYTA 1O3MA 3MNCA 4UONA 2VGCC 1THPB 3KN2A 1SLXB 4Y7BA 2OCVB 4WF8A 1EPTA 3HATH 2TGDA 1H8IH 1GBAA 2R0KA 4O9VA 3UREA 1O3HA 1L1GA 1Z8GA 2ZDLA 5JDUB 1O5BB 1TA2A 1OP0A 1BTXA 1TB6H 3DHKH 3OTJE 4WMEA 4OS2A 1P2MA 1BDAA 2D8WA 3A7YA 1ZSLA 1VITF 1WV7H 1C1RA 1ZGVA 4MLFB 3IWMA 2AS9A 1GBCA 2BQ6B 3PLPA 2WPHS 1T8MA 3A8CA 1DWDH 4Y8XA 3PROA 3RC4A 4ABIA 2D2DA 4HI3A 2VVCA 5EGMA 1BT7A 1J16A 4X2WA 2AGGX 2XXLA 4X1PU 3K6YA 1DXWA 4O97A 3TIUA 4TY6A 4MPXA 4IGDA 1ZJDA 3UTUH 2GMTB 4JZ1A 1ZRKA 4AX9H 3SUDA 1K21H 1MUEB 1LHDH 2BDGA 2FOCA 3GYMA 1GHAG 3RM0H 1KTTB 1CA0B 2ZZUH 1AVXA 1TNJA 1RTFB 1FLEE 1SGPE 1JWTA 5C1XA 4VGCB 1HAHH 3SGAE 1L1NA 2ZHWH 3KQEA 1FV9A 2G5VA 1V2OT 3A84A 1C5MD 2ZU4A 1AKSA 3BV9B 2IOTA 1SGRE 5A09A 1TE0A 4RKJB 1C5TA 1ELBA 2BD5A 3AW0A 5T6DA 1CBWC 1GHBF 1NU7B 2PGBB 1P02A 3KQCA 3MOCA 5DP8A 1SHHB 3LH3A 1BJUA 3MFJA 1O2NA 1DICA 3FFGA 3UIRA 1FAXA 1QQUA 2O8WA 1ANCA 2A4QA 1AQ7A 3QGJA 1OPHB 2BLQA 3DT0H 1GBEA 1GJ8B 1YPMH 1YCPK 1YCPH 2BY9X 2C8ZB 3U98H 1FNIA 2D1JA 1GDQA 5JB8S 2ZDMA 3M61U 2FI4E 3N7OA 1W2KH 1SB1H 3ZVEA 2VH0A 1TABE 4ABEA 3NK8A 2BY8X 1C1UH 2A2XH 1GMCG 1UVSH 2H9HA 1J15A 1H4WA 4DCDA 1SOZA 1Z71A 1HNEE 4PROA 1S6FA 2ODYB 2O8MA 2WYGA 1BMMH 1UTNA 1B0EA 4ISOA 1ZLRA 2HALA 4GCHG 1C5VA 1ARCA 2RA3A 3MO6A 1Y5AT 1ZTJA 2Z9GA 1LMWB 3M7UA 4LXBH 1DT2A 2ZQ1A 1MU8B 5AFZH 1EJAA 4MTBA 1SGFA 2BMGB 4BTIB 2G51A 2ZGJA 4FUFA 2SNWA 2GP9B 1C1MA 5E0GA 5SGAE 3ATKA 1KXCA 1T32A 1FXYA 3T27A 1UK4A 2ZG0H 3E3TA 3S7HB 2QC2A 1EJMA 1BMLA 3TJNA 1S85A 1GBHA 5TCCA 2A32A 3UNRA 3A85A 1Y8TA 5FPYA 1O2SA 1AB9B 5ABWA 4NIVA 4OS1A 4AGKA 1P2QA 1BTWA 1X7AC 2ZU5A 2VIPA 1T7CA 1RXPA 4RKOB 3S9AA 2XC4A 1U6QA 3PLKA 2A7JA 1BRBE 1ORFA 4GVUA 1LVOA 4RN6A 1W7XH 3T62A 1VGCC 2OC1A 3E6PH 1TBQH 2ZTZA 5A8ZA 1F7ZA 1TGBA 3ATIA 2XWBI 2FPZA 3EA8A 1BQYA 1QL7A 5ETXA 1DY8A 3ATWA 2ZPQA 2A4OA 1AE8H 4X0WU 2K1QA 4I8KA 3P17H 4MPUA 1CSOE 4Y11E 4YESB 2XCFA 2HOBA 3EE0B 1O32A 4NA8A 1SFIA 4Q2KA 2G81E 1A61H 1ZSKA 1QB6A 1SGCA 4B2AA 3EDXB 1W10U 3QLPH 1GBJA 2ZGXH 1UK3A 5F8XA 7KMEH 1MH0A 5JBAS 1YLCA 3B8JA 4X8TH 2RCEA 1BA8B 4JZEH 3UQVA 2BHGA 1NZQH 5DK1A 2LNCA 4DT7B 4BXSA 1E38B 8GCHF 3HK3B 1QIXB 1Y3VA 1JIMA 2SGPE 2OINA 1MTUA 3MH5A 3RXIA 4CBNA 1CHOG 4AB9A 4AFQA 4X2YA 4CBOA 4BXWA 1VJAU 2BVSH 2G8TA 2P8OC 4FUGA 4A92A 5AVDA 4UEHH 2JH5D 2V3HH 1IQEA 4KTUA 1SGDE 5F6MA 2Q1JA 3PTNA 1Y59T 3Q3YA 2XC5A 4JK5A 1E35B 1QBNA 6LPRA 3RXLA 2BDBA 3A7ZA 1FJSA 4FUBA 4LZ1H 2A0QB 2QAAA 2CJIA 2PR3A 4ISLA 5LH8A 4CH2B 4FUHA 1O3DA 1QRZA 3SU2A 2THFB 1HYLA 2AERH 1KTSB 3PWBA 5A0CA 3M7QA 3SNCA 3GISB 1GBKA 3DA9B 2Y7ZA 1IOEA 1GI2A 2GMTC 1Y3WA 1IHSH 2R9PA 5DO4H 1VCQA 4MNXA 1KXFA 3MU0A 1TBRH 3K6ZA 4B2BA 3FANA 1PPFE 4MG3A 3ZZ8A 2QIQA 3PMAB 1CA0C 1G3BA 1FY3A 1RJXB 1WTGH 2C4FH 1O3EA 4GUXA 2NU2E 1F0TA 1GDNA 5C3NA 5EXLA 1O2HA 4VGCC 3LJJA 5L6NH 1OOKB 4WXVA 1HPGA 1QJ1B 1LVBA 1TMTH 1P12E 1O3BA 2Z6BD 1GL1A 2XRCA 2ZNKH 4KTSA 1TQ7B 2AMQA 1SQAA 3GCNA 1GJBB 4R0IA 1D6WA 2ZPRA 3RXFA 1QRXA 1Z8RA 2P16A 1PQ7A 2ZQ2A 2TGTA 3QZQA 1BTZA 3BTGE 3ZV9A 4NIXA 2ZO3H 3V13A 1GCTB 2BOKA 1QBVH 3SOSA 1HLTH 5I25A 3LGIA 1RRKA 3U1IB 1AO5A 1EXFA 2ZECA 2M5TA 3TGIE 1P10A 5C20A 4THNH 2HPPH 1DUAA 1NY22 3QTVH 2PTCE 1UCYH 1UCYK 4BTUB 1AU8A 2BQ7B 3OSYA 1OYTH 1AI8H 2G4TA 1GJ5H 1O3FA 1UK2A 1CGIE 1C2HA 1GMHF 4FU8A 4B76A 1NC6A 1EOJA 2W3IA 1ZOMA 2AGIX 4K60A 1UTPA 3E0NB 3MMGA 4X6NA 4JZIA 5DKMA 5GJ4B 2EI7A 3D49H 1P2KA 2SGAA 1A4WH 4B74A 1TNHA 5K0HA 2I6QA 2J38A 3P8FA 1RTKA 2H9TH 2JH6D 1L1JA 3LC3A 1F2SE 1SI5H 1AZ8A 3H5CB 3HKJB 3ELAH 3R0FA 2BLVA 3RU4D 5E2OA 1NRQH 4UDWH 1W0YH 3LGYA 1FY4A 3P8GA 3URCA 1V2UT 1YPGH 1GHYH 1K1LA 2STBE 1GJCB 4FUIA 1HIAB 4WH8A 2H6MA 1ANBA 1TNLA 3RXBA 1C5WB 1YYY1 1FI8A 1PPZA 1QGFA 2BDIA 4XSKU 2ZKSA 1PJPA 3LH1A 1AB9C 4M7GA 1C5NH 1O2WA 2HGTH 3SU5A 3A8BA 1SGIB 2W7SA 1JRSA 1O5FH 2A7HA 4YT7H 2UWPA 1EZUC 1UJ1A 2D26C 2F3CE 2W26A 4YM9A 1UTOA 3A8DA 3BTME 2QGRA 4ISIH 1ESAA 3SN8A 4K1EA 3KIDU 1IQLA 5EQRA 3OYPA 5HYOA 1O2GH 3FP6E 2TBSA 1SLVB 4K2YA 4INHA 2OC8A 1MQ6A 4X8UH 5E2PA 1E37B 3D65E 4YOIA 3SUEA 1HJ8A 1V2NT 4WMFA 1O2ZA 1BCUH 1W8BH 5EPYA 1LQDB 1QL8A 1EPTB 3SZNA 4AZ2B 3RDZA 1O5EH 2PKSB 2ZTYA 1GBBA 1AHTH 1F0SA 1LVYA 2GTBA 1IQKA 4IBLH 1PPGE 7GCHG 2ZPSA 1AVWA 1FY1A 2SGFE 4AG1A 3A88A 3QTOH 4D7FA 3TJOA 4HFPB 2VJ1A 1P0SH 1EAWA 4NSVA 2FIRH 1OX1A 2BXTH 4ABDA 3M36A 3D23A 1HV7A 1QA0A 3MH4A 4K5ZA 1ELEE 1F5KU 4MPWA 1TALA 5EU8A 1Z7KA 3SNEA 1SMFE 3AVZA 3LKWA 3SV2H 1A3EH 1HIAA 2PWXA 1F0RA 1HAVB 3SW2B 6ESTA 2SNVA 2BXUH 2CMYA 3CENA 8LPRA 2C8YB 2ZGBH 2FOMB 1P09A 1W11U 1XX9A 1UO6A 1MCTA 5HGGA 1HAPH 1O5GH 2W3KA 2ZFFH 2F9PA 4QT8C 5A2MH 1TLDA 4ABAA 1FY5A 1O5AB 2BD4A 1O3AA 1C1NA 1FY8E 3BTWE 3UQOA 1SLWB 3RXHA 4Y8YA 5IDKA 3MWIU 2YNBA 1HGTH 3CS0A 1NRRH 1N1LA 4IN1A 4TPIZ 2BDAA 3TH4H 3SGBE 3Q00A 4XBBA 3A82A 5DPAA 4NIYA 4DGJA 1WSSH 1C2DA 1QJ7B 1IQHA 3JZ2B 1GWAA 4HZHA 2BB4A 3RXJA 1K1NA 3TK6A 4IMZA 1GJAB 1OWDA 4BAMB 3KNXA 4BANB 1ID5H 5CE1A 1QTFA 1C1PA 1LVMA 1TA6A 2O8LA 3M5OA 3SNDA 2QV1A 1C5ZB 1BB0B 2FDAA 2CXVA 3BF6H 4UD9H 2O8TA 1GHAF 1WQVH 5J4QA 2ZCLP 2OTVA 1Z8IB 2Z9IA 2HNTC 4LOYH 3PWCA 5LPEA 1H9LB 4AYVB 4WWYA 1GVLA 1MTWA 3SNAA 1LPGB 1GCTC 3KQBA 2ZWLH 1UVPA 1YPHE 1Z8JB 4YO9A 3SU1A 5F03A 1TPAE 3TGJE 1FUJA 2ZHFH 1HB0B 5FPSA 4AN7A 1OSSA 2BY5X 2FI3E 2ZP0H 1V2VT 1DWEH 4UFEH 3E8LA 5GXPA 1O3IA 2DE9A 5EOKA 5F8ZA 1XVOA 1ESBA 3A83A 2EI6A 3DD2H 1HAVA 1ZHRA 4BNRA 4UFDH 1MBQA 3EGKH 1O33A 1C1SA 4CHAB 1QB9A 4MNYA 3UR6A 5IYTA 3D62A 3TGKE 3GYLB 4K1SA 1DLEA 3ZVFA 2Z9LA 2ALVA 1MD8A 5T6FA 2H9EH 1ZYOA 4CR9A 3V0XA 4INLA 3O8DA 4AFZA 1CA8B 2ANKH 2WPLS 4MQAA 2PW8H 1G3DA 2A5AA 2AYWA 2O8UA 3S69A 1GMCF 2EI8A 1CVWH 3BTKE 3SHAH 1MKWH 1MKWK 2G52A 5H4IB 1OP8A 3RXAA 3Q3KA 2WUCA 3F9HA 4FUEA 4NSYA 2ZFQH 1JOUB 5GDSH 1PYTD 4GCHF 3RC6A 2ASUB 3F9EA 8KME2 1ZRBA 2A4GA 3M7TA 4H42U 4KP0A 2P3TB 1WYKA 2EA3A 1HAGE 3QDZB 4ZHMU 1A3BH 1OWEA 2BY7X 3A87A 1IQNA 4GSOA 2GCHG 5AHGH 3SJ9A 3LPRA 1TNIA 3RU4E 1MAYA 2ZCHP 3GCHB 1LHEH 1EB1H 1LPZB 2IJOB 1SGFG 1WAYB 1G2LA 1OXGA 5EPNA 4ZKNU 2ULLA 2J9NA 3VB7A 2GVFA 3SQEE 4IC5A 1FPCH 1V2TT 1C5OH 4D76A 1PPBH 5LPFA 1LCYA 2WUBA 1V2WT 2KAIB 1W3CA 4JK6A 5CHAC 5CMXH 2DE8A 3MU4A 5A8YA 1ELTA 1AUTC 1P03A 3S7KB 3U8RH 3M5LA 1TAWA 1XUKA 3ZVAA 3GICB 3TJUA 2OUAA 4XBCA 5AFYH 2J94A 3TJVA 4JYUH 4DW2U 2OD3B 3SV7A 4E05H 1BRUP 1WBGB 1TGSZ 3VFEA 1O2TA 2CHAB 1FPHH 1EPTC 4O3UA 4ABGA 1SL3A 1VITH 3OY5U 1ZR0A 5FX5A 3ENSB 2PKSC 4A7IB 2ZHEH 5GCHG 8ESTE 1O2JA 2A4RA 1N6YA 1S5SA 3RXQA 3GY4A 2VNTA 3RMOH 1GI3A 1EATA 4ZKRU 3QN7A 1AZZA 2BD2A 3SUFA 1WTHD 1B0FA 2Y81A 5FHTA 2PGQB 3KGPA 4ABJA 1Q3XA 4DJZB 3PLBA 2UUJB 3UWIA 1O2LA 2F9NA 1S82A 1A5IA 3E16B 3NKKA 3L3TA 4I8HA 4IC6A 3O8CA 1SVPA 5GPIB 4F49A 2FODA 1QCPA 4FVBA 2TRMA 1THSH 1BMAA 1CHOF 2P3UB 3RXRA 2ZI2H 2WINI 1ELGA 1C2KA 2XBYA 2XWAA 1BMNH 1O34A 2P94A 1GBDA 2ZHQH 5PTPA 1XM1A 1CO7E 3UPEA 1C2EA 2Y5HA 2V6NA 3P8OA 2AEIH 1KLIH 3BIVH 2BQWB 1VCPA 3STIA 2Y5FA 2VWMA 4ZKOU 5HMAA 1A7SA 4NFFA 2XCNA 3GCTG 3ZZBA 4SGBE 2GT7A 3GY3A 3AASA 4F4OC 1P57B 4GHQA 4OS5A 3R3GB 4I8JA 1HAIH 1TRYA 1AGJA 1C5RA 3PTBA 2F9UA 1T8LA 2EC9H 1DXPA 1IAUA 5BPEA 5HM9A 2J92A 1BHXF 4K3JA 4FUJA 5LGOA 2FX4A 4IMQA 4X1RU 9ESTA 2KAIA 2BY6X 2VIOA 6GCHG 4OGXA 3ATLA 4KGAA 2J4IA 1YKTA 1IQFA 2BD3A 1LO6A 2STAE 3FP7E 5L30H 3E91A 3M3SA 4WMDA 3FZZA 1QR3E 1KLTA 4XBDA 1EJNA 1EB2A 2HRVA 4D7GA 2PKAB 1DWBH 3M3TA 1YPHC 1GVZA 3GOVB 2BD7A 4TWYA 3T2NA 1D6RA 3T28A 3EAJA 1V2RT 2CN0H 1GHXH 1EP6A 1K1JA 1WCZA 2Z3DA 3T29A 2W7UA 2QXHA 1Z6EA 2FESH 1G36A 4IS5A 1E36B 1M9UA 3S9CA 2RG3A 4J1YA 4U30A 4I8GA 1ZMNA 2PHBA 3U69H 2VIQA 3T5FH 3M5NA 5FCRA 4CREA 3B23B 1GG6B 4AYYB 3F9FA 1XVMA 2YNAA 1O2OA 3MH6A 4CR5A 1VZQH 1P9SA 3FAOA 5JB9S 3KEEA 3SV6A 4ABFA 1V2PT 1ZHPA 2ESTE 1TRNA 2HVXA 1VCWA 1EZQA 3GY5A 2C8WB 2OP9A 4CHAC 3A80A 2UUKB 5J4SA 1RTLA 3RXEA 1GI8B 4ISNA 1HXFH 5JBBS 3UFAA 7LPRA 3RXMA 1O2UA 2P95A 2UUFB 2FS9A 5EG4A 3MNXA 2RA0A 4ZROA 1K22H 2R0LA 1UHBA 2FOGA 3ZV8A 1YBWA 5LPRA 1GL0E 2ODQA 4BAOB 5L2YH 4LZ4B 2QF3A 1TQ0B 3BG8A 1LTOA 3MH7A 2BD8A 4JYVH 1QQ4A 4IW4E 1AFQB 2F91A 4OS6A 2P93A 2FOBA 1GMDG 2Z3CA 4ZMAH 4YOGA 1Z1IA 3MYWA 4XOJA 3BTDE 4ASHA 3RXUA 4I33A 5C5NA 1P9UA 4MVNA 1GHWH 2SGQE 2PKAA 2VGCB 2WV4A 5E0HA 1V2ST 4FUCA 3TNSA 4Q7YA 3ZYEA 1YCPM 3GCHC 3KL6A 5JYIA 1TOMH 4ZH8A 3M3VA 1AD8H 1NTPA 1PQ8A 3HKIB 3BTEE 1AWFH 1P04A 3L6PA 1C5SA 1PPCE 2HPQH 4HTCH 2PUQH 1RIWB 1TOCB 3URDA 2ZFPH 2O9QA 1G9IE 4ZXYH 3E1XB 2RDLA 1NFXA 1NU9A 4DG4A 1SC8U 3ODDA 1INCA 1K1OA 4X2VA 4X8SH 4Y8ZA 4O03A 1ESTA 1BTUA 2XYAA 3LGVA 1ZGIA 5C2ZA 2FOHA 2A1DB 4DIIH 2FEQH 1TRMA 1CU1A 2Z9KA 1C1VH 3VXFH 1MKXH 2VB0A 3ZZCA 1K9OE 3A7VA 1SHYA 1NS3A 2TGPZ 2TGAA 4NFEA 1SR5C 4B1TA 2JKHA 2AGEX 1ZJKA 1GI5A 1XKBC 3ITIA 2FM2A 5DP7A 3M5MA 2CHAC 3KQDA 2ZFSA 4DIHH 3ZVDA 1YPEH 4INKA 2Y82A 1XUHA 4WJG2 2ALPA 1ETSH 2B7DH 1A5HA 5HM2A 1O31A 1L2EA 3I78A 3T26A 4K1TA 1NRNH 3PMBB 2H1UA 1PQAA 1TX6A 2BYAX 4OS7A 1SFQB 4XE4A 1DWCH 1HAXB 3TU7H 1GI7B 1WU1A 3PMJA 4CRAA 1MU6B 2CGAA 2FOAA 2F83A 1ELVA 1W0ZU 1T8OA 1P01A 1IQJA 5EXNA 1B7XB 2OQ5A 2B9LA 2GV7A 3LGTA 2OC7A 4AB8A 2CV3A 1SQTA 4NWLA 1AE5A 1ZSJA 5BRRE 4IN2A 3RU4T 7GCHF 2QN5T 1TPOA 2AMPA 1MTNB 4DOQA 5EW2H 1WOFA 2AMDA 1T8NA 2BLWA 4YT6H 1KLJH 3U9AH 1GHZA 2Q6FA 3BEIB 1G3CA 3RXCA 1A5GH 1JIRA
chains in the Genus database with same CATH superfamily
2ZU2A 1BBRE 1A2CH 1FONA 1OS8A 2ZFTA 1Y5UT 2PFEA 5B6OA 4ZAEA 1PPEE 2LPRA 3SU3A 1KSNA 1YGCH 2Z94A 2QCYA 1EZXC 1A46H 2Y6TA 1YPJH 1DANH 1DPOA 4NGAH 2Q6GA 2G55A 1GCDA 1C9PA 2TPIZ 1L0ZA 3KHVA 1DITH 1TMBH 3BIUH 4A1VA 4TT3D 4K69A 1MTSA 3BN9A 1VR1H 1O2RA 1YF4A 5FXLA 4D8NA 1FIWA 2V3MA 2VU8E 2VWOA 3UR9A 2A2QH 4NG9H 3SORA 1HAOH 2OBOA 3DCLA 2A45B 1O3OA 1GBIA 2GDDA 4CRGA 3L33A 4AOQA 4I31A 2ZA5A 3LDXH 2ZC9H 5I46H 1P2IA 2AIQA 1GBTA 1DSTA 3KQ5A 1C5LH 2TIOA 5A0AE 4KKDA 1SLUB 4GAWA 3RMNH 3ZVBA 3W94A 1D3PB 1H9HE 3TK9A 1UTLM 3SHCH 1IQMA 1NT1A 3FP8E 1QHRB 1Y3XA 4WH6A 2CF8H 3A81A 2ZDKA 2BZAA 3ZZ7A 1K2I1 3U1JB 2UWLA 2VWLA 1KXBA 1DS2E 1GG6C 1AMHA 1S83A 4YLUA 2BD9A 3TH3H 5DJ7A 3SNBA 1C5UA 2ILNA 1YPKH 3OAAD 2JH0D 1GJ9B 2BM2A 1AIXH 1LKBA 5E8EH 1KYNA 1EOLA 1SGNE 3FZDA 4CRBA 2K8IA 4FXGH 2YMSC 3SGQE 5C0TA 1XUJA 3VGCB 1Q31A 4B2CA 1KY9A 3MO3A 3GDUA 1ZTKA 1VJ9U 2JETB 1T4UH 5C5OA 5FPTA 2FLRH 1CT4E 3LU9B 3QZRA 2A7CA 3IG6B 3LONA 4CRFA 1F5RA 5KGOA 5GWZA 3ZYDA 2QF0A 2Z3EA 3SU0A 3OY6U 2UWOA 1HRTH 1O2KA 4TPYA 1SSXA 2GT8A 3JZ1B 3UUZA 2B5TB 1TGTA 3ZVCA 3MTYA 3FKSD 2H5CA 1O36A 3RXSA 1HBTH 4FU7A 2C8XB 1AFQC 3QX5H 4Y6DA 3LC5A 1FZZA 4K8BA 4MPVA 3DUXH 1BZXE 2L74A 2GCTB 1NRSH 1ELDE 1PYTC 2R3YA 2JJ2D 1NFUA 4X6PA 4X8VH 4BTTB 2HLCA 1BUIA 3RXGA 1XUFA 1EAUA 4H6SB 5DSFA 1GJ7B 1NESE 1TMUH 2P8OB 2LELA 2FI5E 2ZTXA 2WYJA 3RLWH 1S6LA 3EA9A 4RT0A 3SJKA 4XFQA 1MTVA 2W6JD 2W6ID 2GZ8A 1GI9B 1GPZA 1N8OB 3GY6A 4JCNA 4NCYA 1NFWA 3Q76A 2GV6A 3WWBA 1O35A 3PRBA 3SJ8A 1JRTA 2QXIA 1F5LA 3NCLA 2PTNA 4K8YA 1RIWC 1C2IA 3E90B 2XBVA 1BMFD 1QNJA 5FCKA 2YMSD 1ZTLA 1K1PA 1KDQA 2GCHF 1LKAA 3F9GA 5FBEA 3VB5A 1XMNB 4D9RA 4I8LA 3Q77A 1BRAA 1CHGA 3BTHE 2BDCA 4X6OA 1EFRD 2QYIA 2DUCA 5JBCS 1QZ8A 4R8TB 1ANEA 1DE7H 2J95A 5K7RA 5T3HA 4NZQA 4BOHA 1ZPZA 1ARBA 2SGDE 2GD4B 1C5YB 4AORA 2V35A 4Q7ZA 3N7EA 1C1WH 3ZZ6A 1KXAA 1GGDB 2BLOA 2C3SA 2NU0E 3SJIA 4MDSA 5GIBA 3MQKC 3G01A 4ISHH 2BOHB 1ETRH 2VH6A 2FOEA 1QL9A 1P05A 3PO1B 3DSOA 3RLYH 1GJ6A 1VITG 5DG6A 3F6UH 3K9XB 1AUJA 1ETTH 1TPPA 5TCAA 2G4UA 2FXRA 3B9FH 3GS9A 3GY7A 1NM6A 5GCHF 3RM2H 4GHTA 1ZPCA 1FDPA 1C2FA 1D3DB 3DFLA 3KYGA 1S81A 5G4BA 1C4V2 5EXMA 1MTNC 1O2IA 1XUIA 1PQ5A 1LDTT 1UTQA 1E0FD 5DP6A 3SU6A 3RXDA 2FYRA 3SI3H 3S0NA 4Y0ZE 4A1XA 1DFPA 3HPTB 1ELFA 2OBQA 2WHXA 2GZ9A 3P92A 2VIDA 5EODA 3RP2A 1UTKA 3GY2A 4FVDA 4H6TA 2G5NA 2YOLA 5FL7D 1V6DA 1W0KD 5L2ZH 4KELA 2C90B 1V2KT 2B8OH 3KF2A 1ANDA 2AIPA 3W95A 1IQGA 2W5EA 1HAYB 3A7XA 1GBMA 1GBLA 4X1NU 3EQ0H 3TPIZ 1A1RA 2I6SA 4GPGA 1HUTH 1ZMJA 1ZZZA 1QJ6B 2QY0B 3F68H 2FYQA 1ELAA 1Y3YA 4OS4A 1Y3UA 1W12U 5HXFA 1O37A 2ZDNA 3O8BA 5JPMH 1GHBG 3GCTF 1EQ9A 1EKBB 4ABHA 5A0BA 5T6GA 1O3CA 3RXVA 3VEQB 1UW7A 6CHAB 4X1QU 1UTJA 1T4VH 1MBMA 2P3FH 1DY9A 4X2XA 2Z9JA 5DP5A 1AWHB 4UE7H 4ASUD 5FX6A 2VVUA 5DGJA 1EX3A 3TITA 3UY9A 2FO9A 2OLGA 2R2WU 4ACAA 6GCHF 3M37A 1JXPA 3UOUA 3BTFE 1A0JA 3MO9A 2VIWA 3VB3A 5FBIA 1D3QB 2WPJS 3SI4H 2GJGA 1MAXA 5EQQA 2XNDD 1C4U2 1C1TA 3NUMA 3U8TH 3P8NA 1FIZA 1C5PA 2ZHDA 1BTPA 1KXEA 4DY7B 1O39A 3P95A 4E7RG 1MZAA 2XBWA 1MZDA 1NPMA 1TGCA 2QXGA 3C27B 4YZUA 1O0DH 4WXIA 2PV9B 3UNQA 1K1IA 1UHBB 1XUGA 2ZEBA 1FQ3A 1EAIA 5HKKD 2OXSA 1H1BA 1XXFA 3BEUA 4DURA 1AN1E 3GCOA 4FU9A 1MQ5A 5DP4A 4A5TS 1H9IE 3QWCH 3A7WA 2F9VA 2GX4A 2J2UA 3K2UA 1V2MT 2UUYA 2BX4A 4NZLA 1EUFA 1V2LT 3VGCC 1YLDA 7ESTE 3TLOA 3HGPA 4B6FA 3VXEH 2JETC 1DSUA 1V3XA 1BHXB 2VINA 1K1MA 3OX7U 4JMYA 2GKVE 4U32A 1G3EA 3PMHB 1Y5BT 1O3GA 2ZDAH 4YLQH 2GGVB 4Z0KA 3ZZ4A 4I7YH 2BZ6H 1NRPH 1MABB 1CQQA 1S0RA 1TNKA 3MHWU 1BJVA 1SG8B 3RXPA 1BRCE 2B0FA 1O2PA 9LPRA 1F0UA 1L4DA 2PLXA 1KXDA 3PV4A 2ZIQH 3ZIAD 3RMMH 4HGCA 4X6MA 2GCTC 4P00A 3LGUA 3QK1A 1UVUH 5KECA 1YPLH 3NPSA 1FAKH 4X1SU 3HGNA 1S84A 4OGYA 1YM0A 3SV9A 2FLBH 3PB1E 2FZZA 1WXRA 2ANMH 3SUGA 4UFFH 1JBUH 1LPKB 1WQSA 3F1SB 4TY7A 5AF9H 2ODPA 1O2VA 3RUOA 1NROH 1FN6A 2ZU1A 1N8OC 3GY8A 1GMDF 3OU0A 4I32A 4WY3A 2FTMA 1HJAB 1TONA 3PM3A 4YOJA 1YP9A 4AFSA 2FP7B 2ZFRH 2V3OH 3NWUA 1UCYE 1OWKA 2FX6A 1T31A 3MNBA 2FOFA 3KCGH 1SGEE 1OKXA 2XBXA 3K65B 4AFUA 2IN2A 3SJOA 1GI4A 3SU4A 3P70B 2SGEE 2QF4A 3BG4B 1TIOA 4B71A 5DP3A 3RMLH 3MU1A 2WPMS 2VBCA 2BDYA 3U8OH 1V2QT 8GCHG 3H7TA 1S0QA 2Y5GA 4DVAU 1IHTH 3RXTA 4JZFH 2PUXB 1K28D 2KFWA 1C5XB 2GZ7A 2A5IA 1GI6A 3VB6A 3QO6A 4TWWA 3LIWA 2ZCKP 2F9OA 2AH4X 4LK4A 2BX3A 3HK6B 1QBOA 2ANYA 4BAKB 1GGDC 1UVTH 1SGYE 1WUNH 1J14A 1OWJA 3H09A 3STJA 1O30A 1G32B 2FS8A 3WY8A 4D9QA 4A6LA 1EASA 3PO1C 3DFJA 3QUMP 1C4Y2 3M35A 4BAHB 3I29A 1J9CH 1GI1A 1UMAH 1FMGA 1O5CB 4AG2A 2HNTF 5B6LA 3FO8D 1WDIA 1P11E 1C1QA 5DP9A 1ZMLA 1XKAC 3A86A 5T1VA 2F9BH 1CT2E 1DM4B 1G30B 1SGTA 3VB4A 1ZHMA 3LT3A 1C2MA 1P2OA 1NFYA 2BVXH 1C9TA 1SOTA 2R3UA 4E7NA 2XTTB 3LGWA 2ZGCA 1O2MA 3SV8A 4E06H 4UFGH 2R2MB 1TX7A 4OM9A 3ZZAA 3UWJH 1HCGA 1GDUA 1P3CA 1O3JA 3FVFB 1YC0A 1C2LA 1N6XA 3BEFB 1QY6A 3SBKA 2WV5A 1CGHA 1HFDA 4XDEA 1P2NA 3C1KA 4YTAA 1FN8A 3EA7A 2Y80A 1ZPBA 3AAUA 2ZF0H 3I77A 1EZSC 4FUDA 2J98A 2HNTE 4FOUC 1MKXK 1GJDB 4B75A 4TSFD 2H2ZA 4SGAE 4NA9H 5TJXA 4I86A 5F53A 3TVJB 4NIWA 5FAHA 3EYDA 1ABJH 2PSYA 4Y76A 1LQEA 5EJLA 3MI4A 2Y7XA 2AFQB 4ZKSU 1TFXA 2OC0A 1D3TB 1QA7A 2V0BA 1NN6A 3A89A 2P59A 3CS7A 4U01A 4Y7AA 2Q6DA 4KTCA 1DDJA 4GLYA 4ZXXH 1HJ9A 4Y79A 3BSQA 1CGJE 3P6ZB 1EP5A 1P06A 6CHAC 3SYJA 1QURH 4MNWA 1KMHB 1W7GH 1TBZH 1V2JT 3AAVA 5C1YA 4CRDA 2WSSD 1E1RD 5EQSA 1H8DH 3ATMA 1TPSA 2EEKA 1LHCH 3V3MA 1KIGH 3OEHD 3NXPA 3T25A 3F2GA 3UOPA 5C67A 3ESTA 2NU3E 2XW9A 1A0HB 3A7TA 3LJOA 1LHFH 3U28C 1Z6JH 1CBWB 1DOJA 4ABBA 2NU1E 3ZZ9A 4J2YB 1CE5A 3MU5A 3VPKA 1ABIH 4ESTE 1GMHG 1LHGH 2FTLE 1O3KA 1BTHH 1O2YA 2ANWA 1G2MA 1P8VC 1RGQA 4Q80A 2SFAA 1TYNA 1SQOA 1P2JA 4B73A 1G37A 4ZUHA 2G00A 2VWNA 1E34B 5ESBA 3SO3A 2QXJA 1DVAH 3AW1A 2QA9E 2BTCE 3ZZ3A 2HWLB 2PSXA 4H4FA 2ZGHA 3IITA 2A31A 1A0LA 2BDHA 2WPIS 1UVOA 3UNSA 1HXEH 5CDFE 1CT0E 2BVRH 1O38A 1GHVH 1C2GA 1C2JA 1PFXC 3Q3XA 3GDVA 2H5DA 1OWHA 4Z6AH 1QB1A 5CHAB 5ESTE 1S6HA 3RXKA 3S9BA 1GJ4H 1GBFA 3BTTE 1W13U 1TGNA 3PYHA 5C1UA 3H7OA 3TH2H 4Y10E 3V7TA 3ZZ5A 1BOQA 1O3PB 5JBTA 2IPHA 2FWWA 4Y0YE 1BTYA 2XNIA 3RXOA 1AFEH 1L4ZA 1GVKB 2J34A 3CP7A 3ZZDA 3E0PB 4NA7A 1J17T 4DT4A 1NO9H 1D9IA 1ELCA 1E79D 1SGQE 1XXDA 1O2QA 4JZDH 1C5QA 3ZVGA 1HDTH 1KDQB 2NU4E 1UTMA 1MD7A 1MMJN 1AVGH 2Z7FE 2ZU3A 1P3EA 1Q2WA 1O3NA 1EAXA 3A8AA 4O3TA 1OWIA 2OQUA 1HJAC 1QFKH 2C93B 1DX5M 3O8RA 1YY3A 4NWKA 3V12A 1IQIA 2VVVA 2CF9H 4BAQB 1ACBE 1TX8A 3SQHE 5EW1H 5A8XA 4WVPE 1VGCB 3ODFA 1F92A 2ZDVH 1PPHE 1TWXB 2NWNA 3TK5A 4Q7XA 3QGNB 5E0JA 4CH8B 4AGJA 1OP2A 1SPJA 1OYQA 4Y71A 2WPKS 1GI0A 1J8AA 3BG4C 1BBRH 1BBRK 1O3LA 1JMOH 1O5DH 4U2WA 4ZHLU 1SBWA 2M2AA 3MU8A 4CRCA 3NZIA 2HLDD 3MNSA 1THRH 4ZHAA 1DUEA 1C1OA 1D4PB 5KEDA 1RS0A 3RC5A 1RFNA 1AY6H 1BITA 1AKSB 4RSPA 1SKYE 2XC0A 3BTQE 3PRDA 4TYDA 2VIVA 4A1TA 1B5GH 1HAZB 1Z1JA 1TNGA 2JIZD 2FMJA 1O2XA 1DLKB 2GDEH 1MCVA 4MNVA 1QRWA 3LOXA 1RD3B 1W14U 2J5UA 2A5KA 1BIOA 3TNTA 3GDSA 4AC9A 5F8TA 4JYTA 1O3MA 1FX0B 2L6OA 3WW7A 3MNCA 4UONA 2VGCC 1THPB 3KN2A 1SLXB 4Y7BA 2OCVB 4WF8A 1EPTA 3HATH 2TGDA 1H8IH 1GBAA 2R0KA 2K0QA 4O9VA 3UREA 1O3HA 1L1GA 1Z8GA 2ZDLA 5JDUB 4YXWD 1O5BB 1TA2A 1OP0A 1BTXA 1TB6H 3DHKH 3OTJE 1K0HA 4WMEA 4OS2A 1P2MA 1BDAA 2D8WA 3A7YA 1ZSLA 1VITF 1WV7H 5GNDA 1C1RA 1ZGVA 4MLFB 3IWMA 2AS9A 1GBCA 2BQ6B 3PLPA 2WPHS 1T8MA 3A8CA 1DWDH 4Y8XA 3PROA 3RC4A 4ABIA 2D2DA 4HI3A 2VVCA 5EGMA 2JJ1D 1BT7A 1J16A 4X2WA 2AGGX 2XXLA 4X1PU 3K6YA 1DXWA 4O97A 3TIUA 4TY6A 4MPXA 3UAIC 4IGDA 1ZJDA 3F2HA 3UTUH 2GMTB 4JZ1A 1ZRKA 4AX9H 3SUDA 1K21H 1MUEB 1LHDH 2BDGA 2FOCA 3GYMA 1GHAG 3RM0H 1KTTB 3AK5A 1CA0B 2ZZUH 1AVXA 1TNJA 3FN8A 1RTFB 4Q63A 1FLEE 1SGPE 1JWTA 5C1XA 1YLNA 4VGCB 1HAHH 3SGAE 1L1NA 2ZHWH 3KQEA 1FV9A 2G5VA 1V2OT 3A84A 1C5MD 2ZU4A 1AKSA 3BV9B 2IOTA 1SGRE 4F48B 5A09A 5EIYA 1TE0A 4RKJB 1C5TA 4RI0A 1ELBA 2BD5A 3AW0A 5T6DA 1CBWC 1GHBF 1NU7B 2PGBB 1P02A 3KQCA 3MOCA 5DP8A 1SHHB 3LH3A 1BJUA 3MFJA 1O2NA 4HG6A 1DICA 3FFGA 3UIRA 1FAXA 1QQUA 2O8WA 1ANCA 2A4QA 1H8ED 1AQ7A 3QGJA 1OPHB 2BLQA 3DT0H 1GBEA 1GJ8B 1YPMH 1YCPK 1YCPH 2BY9X 3F0OA 2C8ZB 3U98H 1FNIA 2D1JA 1GDQA 5JB8S 2ZDMA 3M61U 2FI4E 3N7OA 1W2KH 1SB1H 3ZVEA 3CNRA 2VH0A 1TABE 4ABEA 3NK8A 2BY8X 1C1UH 2A2XH 1GMCG 1UVSH 2H9HA 1J15A 1H4WA 4DCDA 1SOZA 1Z71A 1HNEE 4PROA 1S6FA 2ODYB 2O8MA 2WYGA 1BMMH 1UTNA 1B0EA 4ISOA 1ZLRA 2HALA 4GCHG 1C5VA 4FETA 1ARCA 2RA3A 3MO6A 1Y5AT 2OK5A 1ZTJA 2Z9GA 1LMWB 3M7UA 3OEED 4LXBH 1DT2A 2ZQ1A 1MU8B 5AFZH 1EJAA 4MTBA 1SGFA 2BMGB 4BTIB 2G51A 2ZGJA 4FUFA 2SNWA 2GP9B 1C1MA 5E0GA 5SGAE 3ATKA 1KXCA 1T32A 1FXYA 3T27A 1UK4A 2ZG0H 3E3TA 3S7HB 2QC2A 1EJMA 1BMLA 3TJNA 1S85A 1GBHA 5TCCA 2A32A 2KX4A 3UNRA 3A85A 1Y8TA 5FPYA 1O2SA 1AB9B 5ABWA 4NIVA 4OS1A 4ZCNA 4AGKA 1P2QA 1BTWA 1W0JD 1X7AC 2XOKD 2ZU5A 2VIPA 1T7CA 1RXPA 4RKOB 3S9AA 2XC4A 1U6QA 3PLKA 2A7JA 1OHHD 2KM0A 3W1EA 1BRBE 2F43B 1ORFA 4GVUA 1LVOA 4RN6A 1W7XH 3T62A 2KR7A 1VGCC 2OC1A 3E6PH 1TBQH 2ZTZA 5A8ZA 1F7ZA 1TGBA 3ATIA 2XWBI 5HIYA 2FPZA 3EA8A 1BQYA 1QL7A 5ETXA 1DY8A 2CK3D 3ATWA 2ZPQA 2A4OA 4F55A 1AE8H 4X0WU 2K1QA 4I8KA 3P17H 4MPUA 1CSOE 4Y11E 4YESB 4B6EA 2XCFA 2HOBA 3EE0B 1O32A 4NA8A 1SFIA 4Q2KA 2G81E 1A61H 1ZSKA 1QB6A 3FOAA 1SGCA 4B2AA 3EDXB 1W10U 3QLPH 1GBJA 2ZGXH 1UK3A 5F8XA 7KMEH 1MH0A 5JBAS 1YLCA 3B8JA 4X8TH 2RCEA 2WPDD 1BA8B 4JZEH 3UQVA 2BHGA 1NZQH 5DK1A 2LNCA 4DT7B 4BXSA 1E38B 8GCHF 3HK3B 1QIXB 1Y3VA 1JIMA 2SGPE 2OINA 1MTUA 3MH5A 3RXIA 4CBNA 1CHOG 4AB9A 4AFQA 4X2YA 4CBOA 2J97A 4BXWA 1VJAU 2BVSH 2G8TA 2P8OC 3SZEA 4FUGA 4A92A 5AVDA 3F2FA 4UEHH 2JH5D 2V3HH 1IQEA 4KTUA 2J98B 1SGDE 5F6MA 2Q1JA 3PTNA 1Y59T 3Q3YA 2XC5A 4JK5A 1E35B 1QBNA 6LPRA 3RXLA 2BDBA 3A7ZA 1FJSA 4FUBA 4LZ1H 2A0QB 2QAAA 2CJIA 2PR3A 4ISLA 5LH8A 4CH2B 4FUHA 1O3DA 1QRZA 3SU2A 2THFB 1HYLA 2AERH 3EE7A 1KTSB 3PWBA 5A0CA 3M7QA 3SNCA 3GISB 2QF5A 1GBKA 3DA9B 2Y7ZA 1IOEA 1GI2A 2GMTC 1Y3WA 1IHSH 3NRLA 2R9PA 3PV5A 5DO4H 1VCQA 4MNXA 1KXFA 3MU0A 1TBRH 3K6ZA 4B2BA 3FANA 1PPFE 1H8HD 4MG3A 3ZZ8A 2QIQA 3PMAB 1CA0C 1G3BA 2RFKC 1FY3A 1RJXB 1WTGH 2C4FH 1O3EA 4GUXA 2NU2E 1F0TA 1GDNA 5C3NA 5EXLA 1O2HA 4VGCC 3LJJA 5L6NH 1OOKB 4WXVA 1HPGA 1QJ1B 1LVBA 1TMTH 1P12E 1O3BA 2Z6BD 1GL1A 2XRCA 2ZNKH 4KTSA 1TQ7B 2AMQA 1SQAA 5EJ1A 3GCNA 1GJBB 4R0IA 1D6WA 2ZPRA 3RXFA 4Q4LA 1QRXA 1Z8RA 2P16A 1PQ7A 2ZQ2A 2TGTA 3QZQA 1BTZA 3BTGE 3ZV9A 4NIXA 2ZO3H 3V13A 1GCTB 2BOKA 1QBVH 2V7QD 3VG8A 3SOSA 1HLTH 5I25A 3LGIA 1RRKA 3U1IB 1AO5A 1EXFA 2ZECA 2M5TA 3TGIE 1P10A 5C20A 4THNH 2HPPH 1DUAA 1NY22 3QTVH 2PTCE 1UCYH 1UCYK 4BTUB 1AU8A 2BQ7B 3OSYA 1OYTH 1AI8H 5EJZA 2G4TA 1GJ5H 1O3FA 1UK2A 1CGIE 1C2HA 1GMHF 4FU8A 4B76A 1NC6A 1EOJA 2W3IA 1ZOMA 2AGIX 4K60A 1UTPA 3E0NB 3MMGA 4X6NA 4XD7D 4JZIA 5DKMA 5GJ4B 2EI7A 3D49H 1P2KA 2SGAA 1A4WH 4B74A 1TNHA 4XRNA 5K0HA 2I6QA 2J38A 3P8FA 1RTKA 2H9TH 2JH6D 1L1JA 3LC3A 1F2SE 1SI5H 1AZ8A 3H5CB 3HKJB 1NBMD 3ELAH 3R0FA 2QE7D 2BLVA 3RU4D 5E2OA 1NRQH 4UDWH 2PP6A 1W0YH 3LGYA 1FY4A 3P8GA 3URCA 1V2UT 1YPGH 1GHYH 1K1LA 2STBE 1GJCB 4FUIA 1HIAB 4WH8A 2H6MA 1ANBA 1TNLA 3RXBA 2KCPA 1C5WB 1YYY1 1FI8A 1PPZA 1QGFA 2BDIA 4XSKU 2ZKSA 1PJPA 2LP6A 3LH1A 1AB9C 4M7GA 1C5NH 1O2WA 2HGTH 3SU5A 3A8BA 1SGIB 3WWFA 2W7SA 1JRSA 1O5FH 2A7HA 4YT7H 2UWPA 1EZUC 1UJ1A 2D26C 2F3CE 2W26A 4YM9A 1UTOA 3A8DA 3BTME 5C94A 2QGRA 4ISIH 1ESAA 3SN8A 4K1EA 3KIDU 1IQLA 5EQRA 3OYPA 5HYOA 1O2GH 1COWD 3FP6E 2TBSA 1SLVB 4K2YA 4INHA 2OC8A 1MQ6A 3F0PA 4X8UH 1E37B 5E2PA 3DSGA 3D65E 4YOIA 3SUEA 1HJ8A 1V2NT 4WMFA 1O2ZA 1BCUH 1W8BH 5EPYA 3N99A 1LQDB 1QL8A 1EPTB 3SZNA 4AZ2B 3RDZA 1O5EH 2PKSB 2ZTYA 1GBBA 1AHTH 1F0SA 1LVYA 2GTBA 1IQKA 4IBLH 1PPGE 7GCHG 2ZPSA 1AVWA 1FY1A 2SGFE 4AG1A 3A88A 3QTOH 4D7FA 3TJOA 4HFPB 2VJ1A 1P0SH 1EAWA 4NSVA 2FIRH 1OX1A 2BXTH 4ABDA 3M36A 3D23A 1HV7A 1QA0A 3MH4A 4K5ZA 1ELEE 1F5KU 4MPWA 1TALA 5EU8A 1Z7KA 3SNEA 1SMFE 3AVZA 3LKWA 3SV2H 1A3EH 1HIAA 2PWXA 1F0RA 1HAVB 3SW2B 6ESTA 2SNVA 2BXUH 2CMYA 3CENA 8LPRA 2C8YB 2ZGBH 2FOMB 1P09A 1W11U 1XX9A 2EQNA 1UO6A 1MCTA 5HGGA 1HAPH 1O5GH 1VKYA 2W3KA 2ZFFH 2F9PA 4QT8C 5A2MH 1TLDA 2KCAA 4ABAA 1FY5A 1O5AB 2BD4A 1O3AA 1C1NA 1FY8E 3BTWE 3UQOA 1SLWB 3RXHA 4Y8YA 5IDKA 3MWIU 2YNBA 1HGTH 3CS0A 1NRRH 1N1LA 4IN1A 2F4LA 4TPIZ 2BDAA 3TH4H 3SGBE 3Q00A 4XBBA 3A82A 5DPAA 4NIYA 4DGJA 2WZQA 1WSSH 1C2DA 1QJ7B 1IQHA 3JZ2B 1GWAA 4HZHA 2BB4A 3RXJA 1K1NA 3TK6A 4IMZA 1GJAB 1OWDA 4BAMB 3KNXA 4BANB 1ID5H 5CE1A 1QTFA 1C1PA 1LVMA 1TA6A 2O8LA 3M5OA 3SNDA 2QV1A 1C5ZB 1BB0B 2FDAA 2CXVA 3BF6H 4UD9H 2O8TA 1GHAF 3PV2A 1WQVH 5J4QA 2ZCLP 2KCYA 1Z8IB 2OTVA 2Z9IA 2HNTC 4LOYH 3PWCA 5LPEA 1H9LB 4AYVB 4WWYA 1GVLA 1MTWA 3SNAA 1LPGB 1GCTC 3KQBA 2ZWLH 1UVPA 1YPHE 1Z8JB 4YO9A 3SU1A 5F03A 1TPAE 3TGJE 1FUJA 2ZHFH 1HB0B 5FPSA 4AN7A 1OSSA 2BY5X 2FI3E 2ZP0H 1V2VT 1DWEH 4UFEH 3E8LA 5GXPA 1O3IA 2DE9A 5EOKA 5F8ZA 1XVOA 1ESBA 3A83A 2EI6A 3DD2H 1HAVA 1ZHRA 4BNRA 4UFDH 1MBQA 3EGKH 1O33A 1C1SA 4CHAB 1QB9A 4MNYA 3UR6A 5IYTA 3D62A 3TGKE 3GYLB 4K1SA 1DLEA 3ZVFA 2Z9LA 1SQRA 2ALVA 1MD8A 5T6FA 2H9EH 1ZYOA 4CR9A 3V0XA 4INLA 3O8DA 4AFZA 1CA8B 2ANKH 2WPLS 4MQAA 2PW8H 1G3DA 2A5AA 2AYWA 2O8UA 3S69A 1GMCF 2EI8A 1CVWH 1E1QD 3BTKE 3SHAH 1MKWH 1MKWK 2G52A 5H4IB 1OP8A 5DN6D 3RXAA 3Q3KA 2WUCA 3F9HA 4FUEA 4NSYA 2ZFQH 1JOUB 5GDSH 1PYTD 4GCHF 3RC6A 2ASUB 3F9EA 8KME2 1ZRBA 5CHBA 2A4GA 3M7TA 4H42U 4KP0A 2P3TB 1WYKA 2EA3A 1HAGE 3QDZB 4ZHMU 1A3BH 1OWEA 1NBME 2BY7X 3A87A 2WV9A 1IQNA 4GSOA 2GCHG 5AHGH 3SJ9A 3LPRA 1TNIA 3RU4E 1MAYA 2ZCHP 3GCHB 4Z1MD 1LHEH 1EB1H 1LPZB 2IJOB 1SGFG 1WAYB 1G2LA 1OXGA 5EPNA 4ZKNU 2ULLA 2J9NA 3VB7A 2GVFA 3SQEE 4IC5A 1FPCH 1V2TT 1C5OH 4D76A 1PPBH 5LPFA 1LCYA 2WUBA 1V2WT 2KAIB 1W3CA 4JK6A 5CHAC 2AHME 2DE8A 5CMXH 3MU4A 5A8YA 1ELTA 1AUTC 1P03A 3S7KB 3U8RH 3M5LA 1TAWA 1XUKA 3ZVAA 3GICB 2EY4C 5HIZA 3TJUA 2OUAA 4XBCA 5AFYH 2J94A 3TJVA 4JYUH 4DW2U 2OD3B 3SV7A 4E05H 1BRUP 1WBGB 1TGSZ 3VFEA 1O2TA 2CHAB 1FPHH 1EPTC 4O3UA 4ABGA 1SL3A 1VITH 3OY5U 1ZR0A 5FX5A 3ENSB 2PKSC 4A7IB 2ZHEH 5GCHG 8ESTE 1O2JA 2A4RA 1N6YA 1S5SA 3RXQA 3GY4A 2VNTA 3RMOH 1GI3A 1EATA 4ZKRU 3QN7A 1AZZA 2BD2A 3SUFA 1WTHD 1B0FA 2Y81A 5IK2D 5FHTA 2PGQB 3KGPA 4ABJA 1Q3XA 4DJZB 3PLBA 2UUJB 3UWIA 1O2LA 2F9NA 1S82A 1A5IA 3E16B 3NKKA 3L3TA 4I8HA 4IC6A 5C17A 3O8CA 1SVPA 5GPIB 4F49A 2FODA 1QCPA 4FVBA 2TRMA 1THSH 1BMAA 1CHOF 2P3UB 3RXRA 2ZI2H 2WINI 1ELGA 1C2KA 2XBYA 2XWAA 1BMNH 1O34A 2P94A 1GBDA 2ZHQH 5PTPA 1XM1A 1CO7E 3UPEA 1C2EA 2Y5HA 2V6NA 3P8OA 2AEIH 1KLIH 3BIVH 2BQWB 1VCPA 3STIA 2Y5FA 2VWMA 4ZKOU 5HMAA 1A7SA 4NFFA 2XCNA 3GCTG 4RT1A 3ZZBA 4SGBE 2GT7A 3GY3A 3AASA 4F4OC 1P57B 4GHQA 4OS5A 3DSPA 3R3GB 4I8JA 1HAIH 1TRYA 1AGJA 1C5RA 3PTBA 2IPQX 2F9UA 1T8LA 2EC9H 1DXPA 1IAUA 5BPEA 5HM9A 3F3BA 2J92A 1BHXF 4K3JA 4FUJA 5LGOA 2FX4A 4IMQA 4X1RU 9ESTA 2KAIA 2BY6X 2VIOA 6GCHG 4OGXA 3ATLA 4KGAA 2J4IA 1YKTA 1IQFA 2BD3A 1LO6A 2STAE 3FP7E 5L30H 3E91A 3M3SA 4WMDA 3N7DA 3FZZA 1QR3E 1KLTA 4XBDA 1EJNA 1EB2A 2HRVA 4D7GA 2PKAB 1DWBH 3M3TA 1YPHC 1GVZA 3GOVB 2BD7A 4TWYA 3T2NA 1D6RA 3T28A 3OTPA 3EAJA 1V2RT 3KYFA 2CN0H 1GHXH 1EP6A 1K1JA 1WCZA 2Z3DA 3T29A 2W7UA 2QXHA 1Z6EA 2FESH 1G36A 4IS5A 1E36B 1M9UA 3S9CA 2RG3A 4J1YA 4U30A 4I8GA 1ZMNA 2PHBA 3U69H 2VIQA 2IJD1 3T5FH 3M5NA 5FCRA 2KCOA 4CREA 3B23B 1GG6B 4AYYB 3F9FA 1XVMA 2YNAA 1O2OA 1YWUA 3MH6A 4CR5A 1VZQH 1P9SA 3FAOA 5JB9S 3KEEA 3SV6A 4ABFA 1V2PT 1ZHPA 2ESTE 1TRNA 2HVXA 1VCWA 1EZQA 3GY5A 2C8WB 2OP9A 3UB0A 4CHAC 3A80A 2UUKB 5J4SA 2YMSB 1RTLA 3RXEA 1GI8B 4ISNA 1HXFH 5JBBS 3UFAA 7LPRA 3RXMA 1O2UA 2P95A 2UUFB 2FS9A 5EG4A 3MNXA 2RA0A 4ZROA 1K22H 2R0LA 1UHBA 2FOGA 3ZV8A 1YBWA 5LPRA 1GL0E 2RDEA 2ODQA 4BAOB 5L2YH 4LZ4B 2QF3A 1TQ0B 3BG8A 1LTOA 3MH7A 2BD8A 4JYVH 1QQ4A 4IW4E 1AFQB 2F91A 4OS6A 2P93A 2FOBA 1GMDG 2Z3CA 4ZMAH 4YOGA 1Z1IA 3MYWA 4XOJA 3BTDE 4ASHA 3RXUA 4I33A 5C5NA 4M9FA 1P9UA 4MVNA 1GHWH 2SGQE 2PKAA 2VGCB 2WV4A 5E0HA 1V2ST 4FUCA 3OFND 3TNSA 4Q7YA 3ZYEA 1YCPM 3GCHC 3KL6A 5JYIA 1TOMH 4ZH8A 3M3VA 1AD8H 1NTPA 1PQ8A 3HKIB 3BTEE 1AWFH 1P04A 3L6PA 1C5SA 1PPCE 2HPQH 4HTCH 2PUQH 1RIWB 1TOCB 3URDA 2ZFPH 2O9QA 1G9IE 2HVYB 4ZXYH 3E1XB 2RDLA 4P02A 1NFXA 1NU9A 4DG4A 1SC8U 3ODDA 1INCA 1K1OA 4X2VA 4X8SH 4Y8ZA 4O03A 1ESTA 1BTUA 2XYAA 3LGVA 1ZGIA 5C2ZA 2FOHA 2A1DB 4DIIH 2FEQH 1TRMA 2JDID 1CU1A 2Z9KA 1C1VH 3VXFH 1MKXH 2VB0A 3ZZCA 1K9OE 3A7VA 1SHYA 1NS3A 2TGPZ 2TGAA 4NFEA 1SR5C 4B1TA 2JKHA 2AGEX 1ZJKA 1GI5A 1XKBC 3ITIA 2FM2A 5DP7A 3M5MA 2CHAC 3KQDA 2ZFSA 4DIHH 5C0UA 3ZVDA 1YPEH 4INKA 2Y82A 1XUHA 4ACBA 4WJG2 2ALPA 1ETSH 2B7DH 1A5HA 5HM2A 1O31A 1L2EA 3I78A 3T26A 4K1TA 1NRNH 3PMBB 2H1UA 2KZ4A 1PQAA 1TX6A 2BYAX 4OS7A 1SFQB 4XE4A 1DWCH 1HAXB 3TU7H 1GI7B 1WU1A 3PMJA 4CRAA 1MU6B 2CGAA 2FOAA 2F83A 1ELVA 1W0ZU 1T8OA 1P01A 1IQJA 5EXNA 1B7XB 2OQ5A 2B9LA 2GV7A 3LGTA 2OC7A 4AB8A 2CV3A 1SQTA 4NWLA 1AE5A 1ZSJA 5BRRE 4IN2A 3RU4T 7GCHF 2QN5T 1TPOA 2AMPA 1MTNB 4DOQA 5EW2H 1WOFA 2AMDA 1T8NA 2BLWA 4YT6H 1KLJH 3U9AH 1GHZA 3OE7D 2Q6FA 3BEIB 1G3CA 3RXCA 1A5GH 1JIRA
chains in the Genus database with same CATH topology
2ZU2A 1BBRE 1A2CH 1FONA 1OS8A 2ZFTA 1Y5UT 2PFEA 5B6OA 4ZAEA 1PPEE 2LPRA 3SU3A 1KSNA 1YGCH 2Z94A 2QCYA 1EZXC 1A46H 2Y6TA 1YPJH 1DANH 1DPOA 4NGAH 2Q6GA 2G55A 1GCDA 1C9PA 2TPIZ 1L0ZA 3KHVA 1DITH 1TMBH 3BIUH 4A1VA 4K69A 1MTSA 3BN9A 1VR1H 1O2RA 1YF4A 5FXLA 4D8NA 1FIWA 2VU8E 3UR9A 2VWOA 2A2QH 4NG9H 3SORA 1HAOH 2OBOA 2A45B 1O3OA 1GBIA 2GDDA 4CRGA 3L33A 4AOQA 4I31A 2ZA5A 3LDXH 2ZC9H 5I46H 1P2IA 2AIQA 1GBTA 1DSTA 1C5LH 2TIOA 5A0AE 4KKDA 1SLUB 4GAWA 3RMNH 3ZVBA 3W94A 1D3PB 1H9HE 3TK9A 1UTLM 3SHCH 1IQMA 1NT1A 3FP8E 1QHRB 1Y3XA 4WH6A 2CF8H 3A81A 2ZDKA 2BZAA 3ZZ7A 1K2I1 3U1JB 2UWLA 2VWLA 1KXBA 1DS2E 1GG6C 1AMHA 1S83A 4YLUA 2BD9A 3TH3H 5DJ7A 3SNBA 1C5UA 2ILNA 1YPKH 2JH0D 1GJ9B 2BM2A 1AIXH 1LKBA 5E8EH 1KYNA 1EOLA 1SGNE 3FZDA 4CRBA 4FXGH 3SGQE 1XUJA 3VGCB 1Q31A 4B2CA 1KY9A 3MO3A 3GDUA 1ZTKA 1VJ9U 2JETB 1T4UH 5C5OA 5FPTA 2FLRH 1CT4E 3LU9B 3QZRA 2A7CA 3IG6B 3LONA 4CRFA 1F5RA 5GWZA 3ZYDA 2QF0A 2Z3EA 3SU0A 3OY6U 2UWOA 1HRTH 1O2KA 4TPYA 1SSXA 2GT8A 3JZ1B 3UUZA 2B5TB 1TGTA 3ZVCA 3MTYA 2H5CA 1O36A 3RXSA 1HBTH 4FU7A 2C8XB 1AFQC 3QX5H 4Y6DA 3LC5A 1FZZA 4K8BA 4MPVA 3DUXH 1BZXE 2GCTB 1NRSH 1ELDE 1PYTC 2R3YA 1NFUA 4X6PA 4X8VH 4BTTB 2HLCA 1BUIA 3RXGA 1XUFA 1EAUA 4H6SB 1GJ7B 1NESE 1TMUH 2P8OB 2FI5E 2ZTXA 2WYJA 3RLWH 3SJKA 3EA9A 4XFQA 1MTVA 2GZ8A 1GI9B 1GPZA 1N8OB 3GY6A 4JCNA 4NCYA 1NFWA 3Q76A 2GV6A 1O35A 3SJ8A 1JRTA 2QXIA 1F5LA 3NCLA 2PTNA 4K8YA 1RIWC 1C2IA 3E90B 2XBVA 1QNJA 5FCKA 1ZTLA 1K1PA 1KDQA 2GCHF 1LKAA 3F9GA 5FBEA 3VB5A 1XMNB 4D9RA 4I8LA 3Q77A 1BRAA 1CHGA 3BTHE 2BDCA 4X6OA 2QYIA 2DUCA 5JBCS 4R8TB 1ANEA 1DE7H 2J95A 5K7RA 5T3HA 4NZQA 4BOHA 1ZPZA 1ARBA 2SGDE 2GD4B 1C5YB 4AORA 2V35A 4Q7ZA 1C1WH 3ZZ6A 1KXAA 1GGDB 2BLOA 2C3SA 2NU0E 3SJIA 4MDSA 5GIBA 3G01A 4ISHH 2BOHB 1ETRH 2VH6A 2FOEA 1QL9A 1P05A 3PO1B 3RLYH 1GJ6A 1VITG 5DG6A 3F6UH 3K9XB 1AUJA 1ETTH 1TPPA 5TCAA 2G4UA 2FXRA 3B9FH 3GY7A 1NM6A 5GCHF 3RM2H 4GHTA 1ZPCA 1FDPA 1C2FA 1D3DB 3DFLA 5G4BA 1S81A 1C4V2 5EXMA 1MTNC 1O2IA 1XUIA 1PQ5A 1LDTT 1UTQA 1E0FD 5DP6A 3SU6A 3RXDA 2FYRA 3SI3H 3S0NA 4Y0ZE 4A1XA 1DFPA 3HPTB 1ELFA 2OBQA 2GZ9A 3P92A 2VIDA 5EODA 3RP2A 1UTKA 3GY2A 4FVDA 4H6TA 2G5NA 2YOLA 1V6DA 5L2ZH 4KELA 2C90B 1V2KT 2B8OH 3KF2A 1ANDA 2AIPA 3W95A 1IQGA 2W5EA 1HAYB 3A7XA 1GBMA 1GBLA 4X1NU 3EQ0H 3TPIZ 1A1RA 2I6SA 4GPGA 1HUTH 1ZMJA 1ZZZA 1QJ6B 2QY0B 3F68H 2FYQA 1ELAA 1Y3YA 4OS4A 1Y3UA 1W12U 5HXFA 1O37A 2ZDNA 3O8BA 5JPMH 1GHBG 3GCTF 1EQ9A 1EKBB 4ABHA 5A0BA 5T6GA 1O3CA 3RXVA 3VEQB 6CHAB 4X1QU 1UTJA 1T4VH 1MBMA 2P3FH 1DY9A 4X2XA 2Z9JA 5DP5A 1AWHB 4UE7H 5FX6A 2VVUA 5DGJA 1EX3A 3TITA 3UY9A 2FO9A 2OLGA 2R2WU 6GCHF 3M37A 1JXPA 3UOUA 3BTFE 1A0JA 3MO9A 2VIWA 3VB3A 5FBIA 1D3QB 2WPJS 3SI4H 1MAXA 5EQQA 1C4U2 1C1TA 3NUMA 3U8TH 3P8NA 1FIZA 1C5PA 2ZHDA 1BTPA 1KXEA 4DY7B 1O39A 3P95A 4E7RG 1MZAA 2XBWA 1MZDA 1NPMA 1TGCA 2QXGA 3C27B 4YZUA 1O0DH 4WXIA 2PV9B 3UNQA 1K1IA 1UHBB 1XUGA 2ZEBA 1FQ3A 1EAIA 2OXSA 1H1BA 1XXFA 3BEUA 4DURA 1AN1E 3GCOA 4FU9A 1MQ5A 5DP4A 4A5TS 1H9IE 3QWCH 3A7WA 2F9VA 2GX4A 2J2UA 3K2UA 1V2MT 2UUYA 2BX4A 4NZLA 1EUFA 1V2LT 3VGCC 1YLDA 7ESTE 3TLOA 3HGPA 3VXEH 2JETC 1DSUA 1V3XA 1BHXB 2VINA 1K1MA 3OX7U 4JMYA 2GKVE 4U32A 1G3EA 3PMHB 1Y5BT 1O3GA 2ZDAH 4YLQH 2GGVB 4Z0KA 3ZZ4A 4I7YH 2BZ6H 1NRPH 1CQQA 1S0RA 1TNKA 3MHWU 1BJVA 1SG8B 3RXPA 1BRCE 2B0FA 1O2PA 9LPRA 1F0UA 1L4DA 2PLXA 1KXDA 3PV4A 2ZIQH 3RMMH 4HGCA 4X6MA 2GCTC 3LGUA 3QK1A 1UVUH 1YPLH 3NPSA 1FAKH 4X1SU 3HGNA 1S84A 4OGYA 1YM0A 3SV9A 2FLBH 3PB1E 2FZZA 2ANMH 3SUGA 4UFFH 1JBUH 1LPKB 1WQSA 3F1SB 4TY7A 5AF9H 2ODPA 1O2VA 3RUOA 1NROH 1FN6A 2ZU1A 1N8OC 3GY8A 1GMDF 3OU0A 4I32A 4WY3A 2FTMA 1HJAB 1TONA 3PM3A 4YOJA 1YP9A 4AFSA 2FP7B 2ZFRH 2V3OH 3NWUA 1UCYE 1OWKA 2FX6A 1T31A 3MNBA 2FOFA 3KCGH 1SGEE 1OKXA 2XBXA 3K65B 4AFUA 2IN2A 3SJOA 1GI4A 3SU4A 3P70B 2SGEE 3BG4B 1TIOA 4B71A 5DP3A 3RMLH 3MU1A 2WPMS 2BDYA 3U8OH 1V2QT 8GCHG 3H7TA 1S0QA 2Y5GA 4DVAU 1IHTH 3RXTA 4JZFH 2PUXB 1K28D 1C5XB 2GZ7A 2A5IA 1GI6A 3VB6A 3QO6A 4TWWA 3LIWA 2ZCKP 2F9OA 2AH4X 4LK4A 2BX3A 3HK6B 1QBOA 2ANYA 4BAKB 1GGDC 1UVTH 1SGYE 1WUNH 1J14A 1OWJA 3STJA 3WY8A 1O30A 1G32B 2FS8A 4D9QA 4A6LA 1EASA 3PO1C 3DFJA 3QUMP 1C4Y2 3M35A 4BAHB 3I29A 1J9CH 1GI1A 1UMAH 1FMGA 1O5CB 4AG2A 2HNTF 1P11E 1C1QA 5DP9A 1ZMLA 1XKAC 3A86A 2F9BH 1CT2E 1DM4B 1G30B 1SGTA 3VB4A 1ZHMA 3LT3A 1C2MA 1P2OA 1NFYA 2BVXH 1C9TA 1SOTA 2R3UA 4E7NA 2XTTB 3LGWA 2ZGCA 1O2MA 3SV8A 4E06H 4UFGH 2R2MB 1TX7A 3ZZAA 3UWJH 1HCGA 1GDUA 1P3CA 1O3JA 3FVFB 1YC0A 1C2LA 1N6XA 3BEFB 1QY6A 3SBKA 2WV5A 1CGHA 1HFDA 4XDEA 1P2NA 3C1KA 4YTAA 1FN8A 3EA7A 2Y80A 1ZPBA 3AAUA 2ZF0H 3I77A 1EZSC 4FUDA 2HNTE 1MKXK 1GJDB 4B75A 2H2ZA 4SGAE 4NA9H 5TJXA 3TVJB 5FAHA 4NIWA 3EYDA 1ABJH 2PSYA 4Y76A 1LQEA 3MI4A 2Y7XA 2AFQB 4ZKSU 1TFXA 2OC0A 1D3TB 1QA7A 2V0BA 1NN6A 3A89A 2P59A 3CS7A 4U01A 4Y7AA 2Q6DA 4KTCA 1DDJA 4GLYA 4ZXXH 1HJ9A 4Y79A 3BSQA 1CGJE 3P6ZB 1EP5A 1P06A 6CHAC 1QURH 4MNWA 1W7GH 1TBZH 1V2JT 3AAVA 5C1YA 4CRDA 5EQSA 1H8DH 3ATMA 1TPSA 2EEKA 1LHCH 3V3MA 1KIGH 3T25A 3NXPA 3UOPA 5C67A 3ESTA 2NU3E 2XW9A 1A0HB 3A7TA 3LJOA 1LHFH 1Z6JH 1CBWB 1DOJA 4ABBA 2NU1E 3ZZ9A 4J2YB 1CE5A 3MU5A 3VPKA 1ABIH 4ESTE 1GMHG 1LHGH 2FTLE 1O3KA 1BTHH 1O2YA 2ANWA 1G2MA 1P8VC 1RGQA 4Q80A 2SFAA 1TYNA 1SQOA 1P2JA 4B73A 1G37A 4ZUHA 2G00A 2VWNA 1E34B 5ESBA 3SO3A 2QXJA 1DVAH 3AW1A 2QA9E 2BTCE 3ZZ3A 2HWLB 2PSXA 4H4FA 2ZGHA 3IITA 2A31A 1A0LA 2BDHA 2WPIS 1UVOA 3UNSA 1HXEH 1CT0E 2BVRH 1O38A 1GHVH 1C2GA 1C2JA 1PFXC 3Q3XA 3GDVA 2H5DA 1OWHA 4Z6AH 1QB1A 5CHAB 5ESTE 1S6HA 3RXKA 3S9BA 1GJ4H 1GBFA 3BTTE 1W13U 1TGNA 3PYHA 5C1UA 3H7OA 3TH2H 4Y10E 3V7TA 3ZZ5A 1BOQA 1O3PB 5JBTA 2IPHA 2FWWA 4Y0YE 1BTYA 2XNIA 3RXOA 1AFEH 1L4ZA 1GVKB 2J34A 3CP7A 3ZZDA 3E0PB 4NA7A 1J17T 1NO9H 1D9IA 1ELCA 1SGQE 1XXDA 1O2QA 4JZDH 1C5QA 3ZVGA 1HDTH 2NU4E 1KDQB 1UTMA 1MD7A 1MMJN 1AVGH 2Z7FE 2ZU3A 1P3EA 1Q2WA 1O3NA 1EAXA 3A8AA 4O3TA 1OWIA 2OQUA 1HJAC 1QFKH 2C93B 1DX5M 3O8RA 4NWKA 3V12A 1IQIA 2VVVA 2CF9H 4BAQB 1ACBE 1TX8A 3SQHE 5EW1H 5A8XA 4WVPE 1VGCB 3ODFA 1F92A 2ZDVH 1PPHE 1TWXB 2NWNA 3TK5A 4Q7XA 3QGNB 5E0JA 4CH8B 4AGJA 1OP2A 1SPJA 1OYQA 4Y71A 2WPKS 1GI0A 1J8AA 3BG4C 1BBRH 1BBRK 1O3LA 1JMOH 1O5DH 4U2WA 4ZHLU 1SBWA 3MU8A 4CRCA 3NZIA 3MNSA 1THRH 4ZHAA 1DUEA 1C1OA 1D4PB 1RS0A 3RC5A 1RFNA 1AY6H 1BITA 1AKSB 4RSPA 2XC0A 3BTQE 4TYDA 2VIVA 4A1TA 1B5GH 1HAZB 1Z1JA 1TNGA 2FMJA 1O2XA 1DLKB 2GDEH 1MCVA 4MNVA 1QRWA 3LOXA 1RD3B 1W14U 2A5KA 1BIOA 3TNTA 3GDSA 5F8TA 4JYTA 1O3MA 3MNCA 4UONA 2VGCC 1THPB 3KN2A 1SLXB 4Y7BA 2OCVB 4WF8A 1EPTA 3HATH 2TGDA 1H8IH 1GBAA 2R0KA 4O9VA 3UREA 1O3HA 1L1GA 1Z8GA 2ZDLA 5JDUB 1O5BB 1TA2A 1OP0A 1BTXA 1TB6H 3DHKH 3OTJE 4WMEA 4OS2A 1P2MA 1BDAA 2D8WA 3A7YA 1ZSLA 1VITF 1WV7H 1C1RA 1ZGVA 4MLFB 3IWMA 2AS9A 1GBCA 2BQ6B 3PLPA 2WPHS 1T8MA 3A8CA 1DWDH 4Y8XA 3PROA 3RC4A 4ABIA 2D2DA 4HI3A 2VVCA 5EGMA 1BT7A 1J16A 4X2WA 2AGGX 2XXLA 4X1PU 3K6YA 1DXWA 4O97A 3TIUA 4TY6A 4MPXA 4IGDA 1ZJDA 3UTUH 2GMTB 4JZ1A 1ZRKA 4AX9H 3SUDA 1K21H 1MUEB 1LHDH 2BDGA 2FOCA 3GYMA 1GHAG 3RM0H 1KTTB 1CA0B 2ZZUH 1AVXA 1TNJA 1RTFB 1FLEE 1SGPE 1JWTA 5C1XA 4VGCB 1HAHH 3SGAE 1L1NA 2ZHWH 3KQEA 1FV9A 2G5VA 1V2OT 3A84A 1C5MD 2ZU4A 1AKSA 3BV9B 2IOTA 1SGRE 5A09A 1TE0A 4RKJB 1C5TA 1ELBA 2BD5A 3AW0A 5T6DA 1CBWC 1GHBF 1NU7B 2PGBB 1P02A 3KQCA 3MOCA 5DP8A 1SHHB 3LH3A 1BJUA 3MFJA 1O2NA 1DICA 3FFGA 3UIRA 1FAXA 1QQUA 2O8WA 1ANCA 2A4QA 1AQ7A 3QGJA 1OPHB 2BLQA 3DT0H 1GBEA 1GJ8B 1YPMH 1YCPK 1YCPH 2BY9X 2C8ZB 3U98H 1FNIA 2D1JA 1GDQA 5JB8S 2ZDMA 3M61U 2FI4E 3N7OA 1W2KH 1SB1H 3ZVEA 2VH0A 1TABE 4ABEA 3NK8A 2BY8X 1C1UH 2A2XH 1GMCG 1UVSH 2H9HA 1J15A 1H4WA 4DCDA 1SOZA 1Z71A 1HNEE 4PROA 1S6FA 2ODYB 2O8MA 2WYGA 1BMMH 1UTNA 1B0EA 4ISOA 1ZLRA 2HALA 4GCHG 1C5VA 1ARCA 2RA3A 3MO6A 1Y5AT 1ZTJA 2Z9GA 1LMWB 3M7UA 4LXBH 1DT2A 2ZQ1A 1MU8B 5AFZH 1EJAA 4MTBA 1SGFA 2BMGB 4BTIB 2G51A 2ZGJA 4FUFA 2SNWA 2GP9B 1C1MA 5E0GA 5SGAE 3ATKA 1KXCA 1T32A 1FXYA 3T27A 1UK4A 2ZG0H 3E3TA 3S7HB 2QC2A 1EJMA 1BMLA 3TJNA 1S85A 1GBHA 5TCCA 2A32A 3UNRA 3A85A 1Y8TA 5FPYA 1O2SA 1AB9B 5ABWA