1TNIA

Prediction of novel serine protease inhibitors
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords TRYPSIN
publication title Prediction of new serine proteinase inhibitors.
pubmed doi rcsb
source organism Bos taurus
total genus 51
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1994-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tniA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tniA02
3G01A 3DHKH 1NFUA 3QDZB 4B75A 5CE1A 2ZU2A 3R0FA 4D76A 1EJNA 3A8AA 4IN2A 5FXLA 1TABE 3M61U 1O5DH 1BMNH 2NWNA 1B7XB 4NA9H 5EW2H 1TNHA 1AY6H 1ANDA 2HPQH 2GCHG 1G9IE 3UOPA 2O8LA 1QL8A 2Z3EA 4FUEA 2ZGJA 1AWHB 1SGCA 5EQRA 1UVTH 1E35B 3RXHA 1ZRKA 2FPZA 2BY9X 3P6ZB 3HKJB 2FO9A 5EODA 2BDYA 4GVUA 3K9XB 2GTBA 1BB0B 3QZQA 1ELGA 3SBKA 1NS3A 4AFUA 4J1YA 3QWCH 3LJJA 1AFEH 4X1SU 3UREA 2P3UB 2BD8A 4UEHH 1BDAA 1OP0A 1LHFH 2ANWA 3RXSA 4E05H 1BBRK 2V6NA 2WPIS 3L6PA 1QRXA 4GPGA 4K2YA 2W26A 1WSSH 1E37B 1ELBA 1O2WA 1QB1A 2ILNA 3KNXA 3PB1E 5E0HA 1HIAB 2G5VA 1AWFH 1BUIA 1FY8E 2VH6A 2C4FH 1YBWA 1NTPA 5A0BA 6CHAC 1YLDA 1BTYA 1FDPA 1TX8A 4NA7A 1ESAA 1D3QB 1O2IA 4A1XA 1RFNA 3K2UA 1MTVA 2WPMS 1AZ8A 3SJIA 1AO5A 4MPXA 3TGKE 3SU4A 3GCNA 1YYY1 4WMDA 4DT7B 1O2VA 1TAWA 1ARBA 3UWIA 1GBDA 1T8NA 6CHAB 2RG3A 4MNYA 2Z9JA 1D3TB 2Z3DA 3QZRA 5F6MA 2A2QH 2Q6GA 3O8BA 1O2XA 1ANBA 1DVAH 1IQGA 2BYAX 3O8CA 3BV9B 1NU7B 2CV3A 4IMZA 1SOZA 2WV4A 5TCAA 1A4WH 5A2MH 1GMDG 4NIVA 2C3SA 4JZEH 3M5MA 4YESB 4O97A 1EATA 1KXDA 2UUJB 1ZTKA 3A8CA 3SGBE 4MNXA 1GMCG 3SNDA 1GI7B 2WPHS 4OS1A 5G4BA 3M5OA 2R0LA 3ZZ3A 1J17T 3P70B 1EB2A 2NU3E 1UVPA 1UTLM 1C1QA 1GBLA 1UTNA 2QXIA 3UOUA 5DP8A 1VITG 3K6YA 2SGDE 1OX1A 1YC0A 2Q1JA 3RXAA 1CGHA 3SUEA 2J94A 1YGCH 2ZFRH 4D9QA 4DIHH 1GJ9B 4Y7BA 1G32B 5AVDA 5C2ZA 1MTNC 4NWLA 1V2LT 1LHEH 3FP7E 3IITA 1S81A 1E34B 4YO9A 3TJVA 4KTCA 8ESTE 1XKAC 4UFGH 1B5GH 2BDIA 4OGYA 2SGPE 3RXJA 2LPRA 4XE4A 1SGTA 1ZHMA 3ZZ6A 1OYQA 5JYIA 1GJ4H 3RLWH 1P11E 1B0EA 1GHBF 1NM6A 1JXPA 2ZDKA 4X6MA 1WUNH 2DUCA 2ANMH 4NCYA 3P95A 1H8IH 1MTNB 3OSYA 4J2YB 1Q3XA 3UQVA 3SNCA 1IQIA 1YPLH 2P94A 3S0NA 1A0LA 3M3VA 1G30B 1YPHE 3P92A 1EAXA 4TPYA 1ETSH 1P03A 2BD3A 5SGAE 2ZTYA 1YLCA 2QXJA 1ZGIA 1ZSJA 2PTNA 1PPBH 5JBBS 3SI3H 1MCTA 3A7YA 3S69A 1DWCH 1ID5H 1VJAU 1ELCA 1MKWK 1BA8B 2V3HH 3TNTA 1GI1A 4CRAA 4GSOA 4I8HA 1O2LA 4X2YA 2AMPA 1BJVA 2Y7ZA 1BZXE 3SW2B 3E16B 1RTLA 5A0AE 1TYNA 1JOUB 5ABWA 5C1YA 3E91A 3MU1A 2SNWA 4ZKSU 3S9AA 1S84A 1A5GH 4YM9A 2G4TA 1C5WB 1SI5H 1MAXA 2H1UA 2FLBH 3RXBA 4JZIA 3U9AH 1GBKA 2ZDAH 1JIMA 3RM0H 3FP8E 1Y8TA 1AGJA 5HMAA 1IQHA 3MO6A 1TQ7B 2UUFB 1C5PA 5PTPA 2SGFE 1O5BB 4FUDA 4B76A 1QY6A 1C5TA 3TU7H 2FYRA 2WPJS 1SGEE 4UFEH 1T31A 3OU0A 1LVYA 4A1TA 3LJOA 1C1PA 2F83A 3MWIU 7LPRA 4X6NA 2FI4E 1BTUA 4MNVA 1Z1IA 2V3OH 4IS5A 4Y76A 1L1JA 3A89A 1C2MA 4YOJA 1H9HE 4FUHA 3PWCA 4HZHA 2ZDVH 4FU7A 3SUGA 4BTTB 2IPHA 1GCTC 3A8BA 5A8XA 1DX5M 4OS5A 5JDUB 1NO9H 3SNBA 3NK8A 4BXWA 3TLOA 1TLDA 1LPGB 1V2ST 2QN5T 2XWAA 1THSH 2VWNA 3D49H 1CSOE 4ISNA 2OQ5A 1DS2E 4FUBA 3MU5A 2VWLA 5CHAC 3ZVBA 1TNIA 3D65E 1G3EA 4KTUA 1NPMA 1LPZB 3TH4H 2BXTH 1AQ7A 1TMTH 1ZZZA 2W7SA 1C5XB 1ELEE 1A2CH 1FJSA 2BVRH 1GCTB 3FANA 4AGJA 1BITA 1C2JA 3LKWA 2ZPQA 5GDSH 1SGNE 1E38B 3BTTE 2BY7X 1XUGA 2H9HA 1O30A 1PPEE 1C5SA 4WWYA 1ZRBA 3C27B 1T8MA 4Z6AH 2ODQA 3E0PB 5LGOA 1O36A 1GJCB 1P02A 1ABIH 1CO7E 1ELAA 2OINA 1MZDA 4LZ4B 1P2MA 3CP7A 1F0SA 2UWPA 1H1BA 2FYQA 1KDQA 1RTKA 1O3OA 5FPSA 1A5IA 4ISOA 1SSXA 2Z6BD 4UFDH 2C93B 3ZZBA 3Q76A 2C8WB 1WOFA 1QB6A 3M5NA 5FAHA 4ZHMU 4AX9H 1HAIH 1HCGA 5GWZA 1SLXB 4XOJA 1OKXA 2Z9KA 1QR3E 1T8OA 3DUXH 4ZKNU 3ATLA 4GLYA 1Z8GA 2QXGA 3UTUH 2B9LA 2A5KA 1OSSA 5EXNA 1GVKB 1INCA 3RXMA 1HLTH 2R9PA 1V2VT 5I46H 1P2QA 2J38A 1YPMH 4YOIA 1LVBA 2ALVA 1D6RA 5GIBA 1UK2A 2VB0A 5TCCA 2C8ZB 3SJOA 4E7RG 3A84A 3ODFA 1LVMA 2ODPA 2G52A 2C8YB 5EW1H 1N6YA 3MHWU 3QUMP 1FLEE 1MU8B 3ESTA 3NZIA 1SGFA 2OC7A 4I32A 4D7GA 3ZV9A 3RXQA 4D9RA 4BANB 4ZHLU 4Y0YE 1CHOG 1GDUA 2F9OA 2ZCHP 1GGDC 1Y3YA 4LK4A 2ZO3H 1QBOA 3TK5A 3LH3A 1O2KA 2SGQE 4K1EA 1SGPE 4GAWA 1ESBA 5BRRE 4XBDA 1C5OH 2ZC9H 1LKBA 1FZZA 3VB6A 3HKIB 1C1SA 3E6PH 1ETTH 1Z6JH 3BSQA 3Q3YA 1P2IA 2YNBA 4YT7H 3FZZA 1EOLA 2PSXA 1KSNA 2P16A 3RXLA 4BTIB 4ZROA 2PV9B 2QC2A 1H9IE 1HAYB 4O9VA 1SLUB 1QURH 2VWOA 1BTPA 3Q3XA 3RXGA 2BLOA 1BHXF 3M35A 1W11U 1CBWC 2ZFQH 1KXFA 3IG6B 1BMLA 4X8UH 3NWUA 1VJ9U 1UTJA 2HNTE 4XBCA 2G55A 3ZZAA 1XXFA 4Y0ZE 3LC3A 2OXSA 2FEQH 2RA3A 1OP2A 1YF4A 2BX3A 1KXEA 4B1TA 3A82A 1WV7H 3B9FH 2JH6D 1J16A 2AMDA 4JYVH 4DG4A 1CBWB 4GHQA 4X2WA 3M36A 1GI8B 4TY6A 3SNEA 2FMJA 1ARCA 1XVOA 2AS9A 2BDCA 3GOVB 4ZXXH 5ESTE 2C8XB 3UUZA 3RMMH 3AW1A 3ITIA 5EGMA 1Z8JB 4CRFA 1EZXC 2H5DA 1O35A 1O2HA 1W14U 1RGQA 4CREA 1T7CA 1CT4E 5BPEA 6GCHF 1V2JT 1THRH 4DW2U 4WY3A 3A85A 1ZGVA 1C1RA 1QJ6B 1IQFA 1F0RA 1GJBB 3ZZDA 1HJ9A 3PO1C 1CA0C 4H6SB 1GJ5H 1L0ZA 4B71A 2ZU5A 2XCFA 1WTGH 2A32A 2PR3A 4ZXYH 4JCNA 2Q6DA 1UO6A 1IQNA 2PFEA 2Y6TA 1XM1A 1AVXA 1GVZA 1ZPZA 2BQWB 1FY3A 1DT2A 2ZHQH 3EQ0H 1MTUA 1W7XH 4NSVA 1P2OA 1O3PB 1O2UA 3PO1B 2D26C 1CA0B 1HB0B 1O2YA 5FBIA 3MOCA 2A2XH 3N7OA 1Y5BT 2PSYA 1P05A 2RCEA 2B8OH 1PFXC 3MI4A 1K1JA 3L33A 1GI9B 1IQLA 3QN7A 2FESH 1F0UA 4MLFB 1ETRH 3BN9A 4ZMAH 5FX5A 1S83A 1ZJKA 2H5CA 4BAOB 3S7KB 3UPEA 5A8ZA 2XRCA 1VGCC 1FIZA 3TGJE 2AMQA 2WYJA 1HAGE 3M7QA 5E0GA 2GKVE 2ZFTA 1H9LB 1L1NA 2FI3E 2VNTA 2BQ7B 1O2OA 1AUTC 5HYOA 2A5AA 1VCWA 1GJDB 1V2KT 1HAHH 3BTQE 3UNQA 1K21H 1SB1H 4FUJA 2XBYA 4O03A 1C5RA 1P3EA 3CENA 2ZFFH 1VGCB 1V6DA 4K8YA 4KP0A 1SLWB 1HAVB 3NXPA 1C2IA 4RN6A 3P8FA 2D8WA 3M37A 2QGRA 4IW4E 4MNWA 2THFB 1Y3VA 2UWOA 3M3TA 1C2LA 2W7UA 5DK1A 2BY6X 3CS0A 3MNSA 1EQ9A 2PKSC 2H9EH 1H8DH 1QQUA 4R0IA 2JETC 3M7TA 2HVXA 3PLBA 4ABIA 1G37A 4TWYA 1C2FA 1P8VC 4X1RU 1O3HA 3LDXH 4UONA 3ZVAA 1P10A 4XSKU 2TRMA 4MQAA 8GCHG 4AFSA 3DA9B 2ZF0H 4AG1A 4CHAC 8KME2 2F9PA 4U2WA 4X8VH 1O3NA 3FFGA 3GY7A 3MU8A 1BHXB 4CBOA 4MVNA 1D9IA 2PKSB 3AVZA 5C3NA 2I6QA 1XXDA 2JETB 2VVVA 1EAWA 1KTTB 3JZ2B 1F0TA 1W12U 1ZTJA 1CGIE 3PLKA 4FUCA 4JYTA 1UTKA 1YPKH 3ZVCA 1QRWA 1DUAA 3GCTG 3JZ1B 4SGBE 1YCPM 5T6DA 1FIWA 2VIDA 1HNEE 4Y8YA 1GMHF 2BM2A 1V2PT 1XUIA 4CHAB 5DGJA 1DUEA 3RM2H 4JYUH 1TMUH 1MZAA 1UCYE 4NA8A 1KXAA 2D1JA 1NT1A 3I78A 3T5FH 5GCHF 3RU4T 5AFYH 1QTFA 1BTZA 8LPRA 3AAVA 1AE5A 2XNIA 4K5ZA 1HXEH 3BG4C 1C2HA 3RUOA 3T27A 3L3TA 4A7IB 3MH5A 4KGAA 4YOGA 3BTGE 1IOEA 5TJXA 1ANCA 4NG9H 5K7RA 4FUIA 1DFPA 5J4SA 5GXPA 1K1OA 4E06H 1O3FA 4FVBA 1W3CA 3T28A 1O38A 4Q2KA 3F68H 3P8GA 4Y11E 1A7SA 1BIOA 2ZQ2A 3Q00A 1NFYA 3P17H 1HAOH 5FPTA 4NWKA 3LGWA 3BG4B 1H4WA 3S7HB 2JH5D 4NGAH 4Q80A 1FQ3A 1ANEA 1UMAH 1O2TA 3ZZ5A 1DLKB 9ESTA 4FUGA 1RJXB 2VJ1A 4H4FA 5JBCS 1JIRA 4LOYH 5L6NH 7GCHF 2AEIH 1XUHA 3FP6E 2XBWA 4AYVB 3M5LA 1EPTC 3RXKA 4ABBA 2UUYA 3DT0H 1P2KA 1BJUA 1ZLRA 1JWTA 2XWBI 1O2RA 1BRBE 2CHAC 2HLCA 4I31A 3VPKA 3A7TA 1KY9A 4Z0KA 3ATIA 1VITH 5C1XA 3QTVH 4DGJA 5JBTA 1C5UA 1EPTB 1HAVA 1DWBH 3OY6U 4X1PU 3ZYDA 1ACBE 3SU6A 2CHAB 3RMLH 5FCRA 1EJMA 3NKKA 1EUFA 1PQAA 3BTHE 5DPAA 1KTSB 3UR6A 1C1NA 1AUJA 4WXIA 1YPEH 4ZHAA 1TRYA 2HOBA 2Z3CA 1ORFA 2A45B 2O8TA 2UWLA 2VU8E 4IC5A 3UIRA 1IQEA 1DSUA 1IQKA 1ZSKA 1KDQB 4A1VA 1SQAA 5JB8S 2BVSH 4FU9A 1ABJH 2R3UA 1MTWA 3SV2H 2AYWA 1EZUC 1ELTA 1AFQC 2RA0A 1PPGE 2BD2A 1TA6A 5DP6A 1GHAF 1QJ7B 3T26A 4OS6A 1N1LA 3E8LA 1IHSH 1TFXA 4NIWA 4I8JA 2XBVA 1Z8RA 1PPFE 3F1SB 4MPWA 3SU0A 1Q2WA 4CRBA 1TMBH 2TPIZ 4WXVA 1AHTH 1QA0A 1MUEB 3W94A 1SC8U 1AFQB 1FMGA 4JZFH 4UDWH 5C5NA 2GDDA 3DFLA 1GI2A 1GBMA 1O3GA 2ZHDA 1K1NA 3SNAA 2GP9B 1J9CH 4MTBA 1LQEA 1O2NA 1V2UT 2QXHA 2ZHWH 3BIUH 1XUFA 3RC6A 5A0CA 5LPFA 1LKAA 3ELAH 2J4IA 2A5IA 1GVLA 3E90B 3GCHC 1HAXB 3URCA 1W10U 1WCZA 4Q7YA 3KGPA 4B73A 3BTME 2STAE 3QLPH 4I8KA 3BEFB 1TX6A 3PMAB 3FZDA 1ELDE 3UY9A 1KYNA 4BAHB 1C4U2 2ZECA 4AYYB 2ZKSA 1SGIB 3GCHB 1DY9A 1C5LH 3GDUA 2SNVA 1FXYA 1S0QA 4CRDA 3SHAH 1FNIA 4NIXA 5DP4A 1TE0A 2FOFA 4DVAU 3F9FA 4CRCA 1GCDA 2BD7A 1W0ZU 3RXRA 1O3MA 2AERH 3GISB 2CF8H 4U32A 1SFQB 1T8LA 3TGIE 1C5ZB 1NESE 1P9SA 5EOKA 3UFAA 1BOQA 3RXPA 3A88A 2PKAA 1GHYH 4Y79A 2K1QA 3H5CB 1ZR0A 3SU1A 3D62A 3E3TA 3O8DA 1EPTA 1P09A 1EOJA 3RC4A 1KXBA 1MH0A 4JZDH 2ZTZA 1NRRH 1OP8A 1GBTA 2GCHF 3LIWA 1O3CA 2A7CA 1UK3A 1GHVH 3MNBA 2FS8A 3PYHA 4O3TA 4BOHA 1JRSA 1C1OA 4A5TS 1LHCH 1EKBB 1O5CB 1U6QA 1L4DA 2F3CE 1OWEA 4HFPB 5CHAB 1XUKA 1TNKA 3IWMA 2TIOA 4ASHA 1O3AA 1T4VH 2BD5A 3UNRA 1O2MA 1TNGA 4NZQA 4YLQH 1AZZA 1O3BA 2BY5X 1C1TA 2Y5HA 3LC5A 3A81A 2OC8A 4LXBH 2OD3B 2XBXA 2GZ9A 1CVWH 3B23B 2AGIX 1TGBA 4RKOB 1JMOH 3S9CA 3LT3A 4HTCH 3ZZ9A 1TBQH 1TRMA 3DD2H 1C2KA 1CHGA 2GCTC 1TBRH 2BOHB 3SGQE 1ZJDA 1CGJE 1QB9A 3BTKE 1S0RA 2FWWA 3BEUA 3QTOH 1DM4B 1O2GH 2FX4A 1AI8H 3KEEA 2PHBA 4K69A 4Y8XA 2AFQB 3K65B 3MH4A 1AVWA 5L2YH 3HPTB 2VIOA 4DURA 3OX7U 1GI3A 2ZU1A 4PROA 2ZWLH 2GCTB 5AFZH 3SO3A 3TK9A 2TGPZ 1C5QA 1GHWH 4K8BA 4SGAE 3BF6H 2CJIA 3ZVGA 2B5TB 2CN0H 1GBFA 1F92A 4TWWA 4AG2A 1C9PA 1S6HA 2CXVA 4Y10E 1Y5AT 1SVPA 2R2MB 4TYDA 4ABEA 1LMWB 1QBNA 3GY4A 2ZPRA 2ZDNA 1FY1A 1GMDF 3A8DA 1SGFG 1NY22 4ABFA 1GL0E 5E2OA 1GMCF 2GZ8A 3SQHE 1QBVH 2FXRA 1TNLA 3A7ZA 1K9OE 1GG6C 5AHGH 3SGAE 2OC1A 1TB6H 1C5YB 1VITF 3VFEA 5JB9S 2VVUA 1C4V2 3TH3H 2FOCA 1O3EA 4Y6DA 3TITA 3QGJA 1C5MD 2FX6A 1SHYA 2QCYA 2PW8H 1DY8A 1V3XA 2EC9H 1FONA 1HAZB 1IQJA 2D2DA 2HNTF 3NUMA 1P0SH 2Q6FA 5C67A 2FTLE 4AZ2B 1GGDB 1L4ZA 1GG6B 1ZMJA 1XX9A 1TQ0B 5F8XA 4B74A 1MMJN 2TBSA 2OLGA 2ZU4A 1J14A 2P8OC 1DOJA 2P3FH 2G51A 1GL1A 2F9BH 3KHVA 3TIUA 2BOKA 1NRPH 5EQSA 5C5OA 1GBBA 3KCGH 3A87A 2QYIA 3RXFA 1YKTA 2BHGA 2GVFA 4H42U 3KQBA 1HGTH 1QRZA 2KAIA 2A7HA 3PMJA 1O31A 1ZSLA 1A61H 5LH8A 4XDEA 2P8OB 1GBHA 3BTDE 1ELFA 2J34A 2BX4A 1OWIA 1DICA 2BMGB 1EZSC 1J15A 2ESTE 1DXPA 2GDEH 2GGVB 1K28D 1G2MA 1HJAC 4F4OC 1LQDB 4OS4A 4CH8B 1EP6A 4TPIZ 1GHBG 3MO9A 1UHBB 1BTXA 2AIQA 3LPRA 5L2ZH 3EAJA 1OWHA 4IMQA 3PTBA 2FTMA 1UVOA 2ZFPH 2F9NA 1UK4A 2M5TA 1A3EH 3ATWA 2V35A 1M9UA 1GI4A 3R3GB 1HJAB 3KQEA 5B6OA 4OGXA 1N6XA 1SBWA 5FBEA 2H9TH 1IHTH 1XMNB 2V0BA 4KKDA 1L1GA 2ZZUH 4ZH8A 3B8JA 4XFQA 2NU1E 2IN2A 1SLVB 2OCVB 2IJOB 4RSPA 1DE7H 2O8UA 3STIA 2P95A 2A1DB 4BNRA 1FN6A 1FI8A 2Y80A 4U30A 1UTMA 1VCPA 2GX4A 1LDTT 1W7GH 1MQ5A 3GICB 4INHA 5DP5A 1EAUA 3RXEA 1OPHB 2O8MA 1O5GH 3MNXA 1K1MA 2XYAA 3GY5A 5F03A 5HM2A 5EG4A 1NRQH 3A86A 3PM3A 1V2WT 1WU1A 4Q7XA 1JBUH 1T4UH 1TGCA 3ZV8A 4CR5A 1NC6A 3LONA 1IQMA 2QV1A 3QO6A 1O5FH 1THPB 3P8NA 3SN8A 2ODYB 1TGTA 1PQ7A 3KL6A 2FOGA 5T6FA 4E7NA 2BTCE 4FXGH 3EGKH 1SFIA 5FX6A 3VB3A 3F9GA 2OC0A 1ZPBA 3VXEH 1Y3WA 1C5NH 1A0JA 3ZZ7A 2OQUA 2TGTA 2Y81A 3T25A 3SOSA 1OWDA 1AKSB 3SZNA 4IC6A 1SG8B 2OTVA 3RMNH 4A6LA 1Z6EA 1MBMA 1QNJA 4I8GA 1DSTA 5DP7A 1UTQA 3VB5A 3KQCA 4KELA 1E36B 4ISLA 2FOAA 1GJAB 5EPYA 1AIXH 4D8NA 1D6WA 1LHDH 4IN1A 3EA9A 2PUQH 4UD9H 2YNAA 4YLUA 2QA9E 4BTUB 1W8BH 1P04A 2QAAA 2DE8A 4MG3A 4WH6A 1ZTLA 5DO4H 3RU4D 1QQ4A 2ULLA 4BXSA 3A7VA 5I25A 1OYTH 2ZEBA 3GDSA 2BDGA 5DKMA 3T29A 1O34A 1UJ1A 1O37A 2GV7A 3MFJA 1SQTA 2LNCA 4ABJA 1G3BA 1O32A 2BDBA 3RMOH 3BTFE 1FUJA 1O2ZA 1L2EA 1HPGA 4F49A 1GI0A 1KLIH 1NRSH 1P57B 1UHBA 5DJ7A 4MPVA 2Z94A 3PLPA 1ZMLA 2QIQA 2BDAA 5LPEA 2VIPA 2EI6A 2J9NA 4ESTE 4Y8ZA 4INLA 1K1IA 5FHTA 5T3HA 1RIWC 1CT2E 3LGVA 1GPZA 1LVOA 4WF8A 1CA8B 4JMYA 5EXMA 1HV7A 1TWXB 1V2RT 3SQEE 3BIVH 1EZQA 1CU1A 4CH2B 1RRKA 2P3TB 3TK6A 4DOQA 4M7GA 1BRAA 2A7JA 3V13A 1OXGA 1CHOF 3SUDA 1C1UH 2IOTA 1AN1E 5FPYA 1QJ1B 2A0QB 1MD7A 1K1LA 2ZGBH 1LCYA 3QK1A 1PQ5A 1RIWB 2ZP0H 2AIPA 2BDHA 2JKHA 2O9QA 3MO3A 1MBQA 4GUXA 3LOXA 1S5SA 1AMHA 2GV6A 3I77A 2ZTXA 3LH1A 3T62A 2ZA5A 2F91A 3PROA 1FV9A 2ZU3A 2WPLS 1TPAE 2VIWA 2FZZA 2PKAB 2PLXA 5GPIB 2VIVA 3WY8A 1Z8IB 4CBNA 3AW0A 3PTNA 4NSYA 5EU8A 1MAYA 3HK6B 1Z7KA 3KIDU 2XTTB 1NU9A 3PV4A 4AORA 1BBRE 2SGAA 1WQSA 5T6GA 1TONA 5CMXH 2ZGCA 5H4IB 5E2PA 1O2PA 1SR5C 1SGYE 3RU4E 2PGBB 5IYTA 3TH2H 3AASA 1EXFA 1V2OT 1O5AB 1WTHD 4AGKA 1SMFE 2B7DH 3CS7A 3U8RH 3LGIA 4K1TA 1OWJA 1AKSA 1UVSH 3ODDA 3RXOA 4UFFH 5DP3A 1DWDH 1IAUA 1MD8A 1ZHPA 1Y3XA 4RKJB 1C2GA 5AF9H 1HFDA 2XXLA 1TALA 2WUCA 3BTWE 2HGTH 4FUFA 1GDQA 3KF2A 3VEQB 1MQ6A 1TPOA 2ZGXH 3GY3A 2BQ6B 2ZPSA 4THNH 3ZVDA 1PPZA 2FDAA 4K3JA 2PUXB 3TJUA 1GBEA 1FY4A 1QGFA 1G3CA 4X6PA 3SJ9A 2A4QA 2W3KA 2ANKH 2Z9IA 1DANH 1C1VH 2J2UA 1G3DA 4AB8A 1F7ZA 6LPRA 4AB9A 3SV8A 1QIXB 5LPRA 3T2NA 3LGUA 1BRCE 1NROH 1RXPA 2XCNA 3VXFH 2ZCKP 3ZZCA 2A4RA 3GYLB 2P93A 3TVJB 1GBCA 3U8OH 1QL9A 1O0DH 4X6OA 4DY7B 4KTSA 1PPHE 2EA3A 2GD4B 2R2WU 1YCPH 2F9UA 4AN7A 3KN2A 3GY6A 2FI5E 4Y7AA 1C2DA 2EI7A 3GY8A 2EI8A 6GCHG 4MDSA 3SV9A 4ZKOU 3U8TH 3OY5U 2W5EA 1HAPH 3HK3B 4X8SH 1OS8A 1FPCH 3F6UH 2C90B 4ABDA 3A83A 3LGTA 1C9TA 1DITH 3V7TA 5EXLA 2UUKB 1HIAA 2OBQA 4MPUA 2BB4A 1ZPCA 1TIOA 1P01A 3BTEE 1DLEA 2R0KA 3MH6A 1KLJH 2NU0E 3U69H 4IBLH 1MKXH 3HGPA 1ZOMA 1F2SE 3GCOA 2QF3A 1ZYOA 1LHGH 1O39A 1X7AC 2P59A 1EB1H 2Y82A 3RLYH 3ZVEA 3VB7A 3Q77A 1A1RA 3SU3A 2QF0A 4A92A 1A5HA 2FS9A 1RS0A 2WUBA 1PQ8A 4YTAA 1T32A 3TPIZ 4INKA 1PYTD 3ATKA 1A46H 2ZIQH 2EEKA 1P9UA 3NPSA 3HATH 1Y5UT 2WINI 1KLTA 4B2AA 1O3DA 1BMAA 1DWEH 1QL7A 7KMEH 1Z71A 2PWXA 8GCHF 1WYKA 2HRVA 1ELVA 1TPSA 4ZKRU 3V3MA 1QA7A 2KAIB 4FU8A 3F9EA 3U1IB 3EA8A 1F5LA 2BD9A 2I6SA 4GCHG 2Y7XA 1D4PB 1EX3A 3OTJE 1YPHC 1SPJA 2FOHA 2BLVA 4BAMB 2Z9GA 3DFJA 2TGAA 3SHCH 2XC4A 3GCTF 3GY2A 2OBOA 3SORA 3H7TA 2TGDA 1MTSA 5EQQA 1EP5A 5A09A 3EE0B 1TGNA 6ESTA 1D3DB 1DXWA 3PMBB 1UCYH 1KIGH 1BTHH 1NZQH 2HALA 2RDLA 1CT0E 4JK6A 2FLRH 5C20A 5F8TA 3SU5A 3F9HA 1SOTA 3RXIA 1AE8H 4NZLA 3ZYEA 2WYGA 3QGNB 5ETXA 2HPPH 2BLWA 1K22H 1TOCB 1YP9A 2BXUH 3ZVFA 1E0FD 3A7WA 4JZ1A 5HM9A 2A4OA 3W95A 3RDZA 1WAYB 2GMTC 3MH7A 1UVUH 4ZAEA 2H6MA 1QHRB 3NCLA 3SI4H 4AFZA 1BMMH 5A8YA 1GMHG 1GJ8B 2WV5A 1VR1H 4HI3A 3VB4A 1V2NT 2BY8X 2G4UA 1YPGH 1HRTH 2A4GA 2VWMA 5GCHG 4ABGA 5DP9A 1Z1JA 3U1JB 2GMTB 5F8ZA 4X8TH 4H6TA 4X2VA 2HWLB 5J4QA 4AOQA 1GBJA 3VGCC 1Q31A 1TPPA 1PPCE 1GHXH 2GT8A 2NU4E 4NFFA 1S82A 3BEIB 2VINA 5JBAS 4IGDA 3PMHB 4CR9A 1NFWA 1FPHH 1VZQH 3FVFB 3STJA 3AAUA 1LPKB 2BZ6H 3Q3KA 1SHHB 1GBIA 1FAXA 3MYWA 3E1XB 3UQOA 1YPJH 2XC5A 3K6ZA 1NN6A 5DG6A 3RXCA 2BD4A 1GWAA 2B0FA 3SU2A 1V2QT 4BAQB 4BAKB 4CRGA 2XC0A 1TA2A 3GYMA 4K1SA 3VGCB 1MU6B 5FCKA 1O33A 3M7UA 1BBRH 4D7FA 3EDXB 3SJ8A 1DPOA 1Y59T 3EA7A 1BTWA 2AGEX 4ISHH 4GHTA 2FP7B 1QCPA 3ATMA 3TJOA 3U98H 3MMGA 1HYLA 7GCHG 1TOMH 1ZMNA 2ZHFH 1XUJA 5K0HA 2XW9A 2OP9A 5E0JA 1AB9C 4B2CA 2AH4X 2O8WA 3A80A 1SGRE 3RXTA 4X2XA 3V12A 2FM2A 2VH0A 3HGNA 3BG8A 4NFEA 5ESBA 5HGGA 1C1WH 1HJ8A 4OS2A 1J8AA 2ALPA 1P12E 2OUAA 2YOLA 1WBGB 1K2I1 1C2EA 4YZUA 1O3KA 1YCPK 1UTPA 1NRNH 1O3IA 2GT7A 2ZQ1A 3FAOA 3E0NB 4X1NU 1P06A 1WQVH 1QFKH 4ABAA 3UNSA 2CMYA 4NIYA 2F9VA 1AB9B 1HXFH 1MCVA 4FVDA 4ISIH 4QT8C 1G36A 2ZFSA 5JPMH 2R3YA 3GDVA 1JRTA 1O5EH 1XVMA 4I8LA 1W0YH 3SV6A 2CF9H 2ZI2H 2QY0B 2ZNKH 3V0XA 5E8EH 1TX7A 1A0HB 5C1UA 2ZCLP 1C5VA 1P3CA 9LPRA 1TGSZ 4DJZB 1GHZA 2DE9A 1TNJA 1BT7A 2AGGX 2G5NA 2G81E 1GI5A 1W2KH 1ESTA 1MKXK 1GBAA 3MU4A 2SGEE 1FAKH 1W13U 2G00A 2J92A 4AFQA 1PYTC 1GJ6A 2PGQB 2BVXH 2ZG0H 4LZ1H 1BQYA 1O2SA 1O3LA 4Q7ZA 4U01A 1XKBC 3KQDA 3UR9A 4WMEA 3LU9B 1GHAG 1EASA 1D3PB 1NFXA 4DCDA 2GZ7A 1SGQE 3SJKA 3SV7A 1EJAA 1O2QA 2NU2E 5L30H 2PTCE 1K1PA 1FN8A 1SQOA 3TJNA 2FODA 1S6FA 4K60A 4ABHA 1EAIA 2VVCA 4I7YH 1FY5A 4R8TB 3LGYA 2FOBA 3RXVA 2W3IA 5HXFA 1O2JA 1Y3UA 3URDA 1BCUH 1PJPA 1HBTH 2STBE 1RTFB 2J95A 1AU8A 1VCQA 4DIIH 1S85A 1C4Y2 3RXDA 1LO6A 3S9BA 3I29A 1O3JA 4TY7A 3QX5H 2ZGHA 4WVPE 5EPNA 3SUFA 1V2MT 4WMFA 4I33A 1P2NA 3H7OA 1F5KU 2FIRH 2SFAA 3MTYA 3ZZ4A 5IDKA 1SGDE 4X1QU 1UTOA 4VGCC 2FOMB 1A3BH 4XBBA 5GJ4B 3O8RA 3MU0A 3RP2A 2BZAA 3C1KA 1BRUP 1UCYK 1DDJA 2JH0D 1HUTH 4ZUHA 1KXCA 2ZDLA 3ENSB 4O3UA 3A7XA 4B2BA 1OOKB 2Z9LA 1HDTH 3P8OA 2HNTC 1OWKA 1G2LA 1RD3B 1AD8H 3M3SA 2ANYA 4JK5A 1ZHRA 1P2JA 1MKWH 1SL3A 3MNCA 1GJ7B 2BLQA 4VGCB 3RC5A 3ZZ8A 2VGCC 1N8OC 1F5RA 3TNSA 4YT6H 2A31A 4GCHF 7ESTE 2Z7FE 3EYDA 3RXUA 4OS7A 1C1MA 1AVGH 3UWJH 4UE7H 4X0WU 3PWBA 1GI6A 1TBZH 1YM0A 2CGAA 4HGCA 2FOEA 2G8TA 2Y5FA 2ZHEH 1CE5A 1TRNA 2ASUB 1B0FA 2Y5GA 3D23A 3OYPA 2ZDMA 4WJG2 4Y71A 2H2ZA 2WPKS 2VIQA 4WH8A 1LTOA 1N8OB 2VGCB 1V2TT 1GDNA 1CQQA
chains in the Genus database with same CATH superfamily
3G01A 3DHKH 1NFUA 3QDZB 4B75A 1S6LA 5CE1A 2ZU2A 5EIYA 3R0FA 4D76A 1EJNA 3A8AA 4IN2A 5FXLA 1TABE 3M61U 1O5DH 1BMNH 2NWNA 1B7XB 4NA9H 5EW2H 1TNHA 1AY6H 1ANDA 2HPQH 2GCHG 1G9IE 3UOPA 2O8LA 1QL8A 2Z3EA 4FUEA 3WWBA 2ZGJA 1AWHB 1SGCA 5EQRA 1UVTH 1E35B 3RXHA 1ZRKA 2FPZA 2YMSC 2BY9X 3P6ZB 3HKJB 2FO9A 5EODA 2BDYA 4GVUA 3K9XB 2GTBA 1BB0B 3QZQA 1ELGA 3SBKA 1NS3A 4AFUA 4J1YA 3QWCH 3LJJA 1AFEH 4X1SU 3UREA 2P3UB 2BD8A 4UEHH 1BDAA 1OP0A 1LHFH 2ANWA 3RXSA 4E05H 1BBRK 2V6NA 2WPIS 3L6PA 1QRXA 4Z1MD 4GPGA 4K2YA 2W26A 4OM9A 3FOAA 1WSSH 3F0OA 2F4LA 1E37B 1ELBA 1O2WA 1QB1A 2ILNA 3KNXA 2YMSB 3PB1E 5EJZA 5E0HA 1HIAB 2G5VA 1AWFH 1BUIA 5C0UA 1FY8E 2VH6A 2C4FH 1YBWA 1NTPA 5A0BA 2RFKC 6CHAC 1YLDA 1BTYA 3FN8A 1FDPA 1TX8A 4NA7A 1ESAA 1D3QB 1O2IA 4A1XA 1RFNA 3K2UA 1MTVA 2WPMS 1AZ8A 3SJIA 1AO5A 4MPXA 3TGKE 3SU4A 3GCNA 1YYY1 4WMDA 4DT7B 1O2VA 1TAWA 1ARBA 1H8HD 3UWIA 1GBDA 1T8NA 6CHAB 2RG3A 4MNYA 2Z9JA 1D3TB 2Z3DA 3QZRA 5F6MA 2A2QH 2Q6GA 3O8BA 1O2XA 4RI0A 1ANBA 1DVAH 1IQGA 2BYAX 3O8CA 3BV9B 1NU7B 5T1VA 2CV3A 4IMZA 1SOZA 2WV4A 5TCAA 1A4WH 5A2MH 1GMDG 4NIVA 2C3SA 4JZEH 3M5MA 4YESB 4O97A 1EATA 1KXDA 2UUJB 1ZTKA 3A8CA 3SGBE 4MNXA 1GMCG 3SNDA 1GI7B 3N7EA 3OEHD 2WPHS 4OS1A 5G4BA 3M5OA 2R0LA 3ZZ3A 5DSFA 1J17T 3P70B 1EB2A 2NU3E 1UVPA 1UTLM 1C1QA 1GBLA 4ACAA 1UTNA 2QXIA 3UOUA 5DP8A 1VITG 3K6YA 2SGDE 3U28C 3GS9A 1OX1A 1YC0A 2Q1JA 3RXAA 1CGHA 3SUEA 2J94A 1YGCH 2ZFRH 4D9QA 4DIHH 2KFWA 1GJ9B 4Y7BA 1G32B 5AVDA 5C2ZA 1MTNC 4NWLA 1V2LT 1LHEH 3FP7E 3IITA 1S81A 1E34B 4YO9A 3TJVA 4KTCA 8ESTE 1XKAC 4UFGH 2WPDD 1B5GH 2JJ1D 2BDIA 4OGYA 2SGPE 3RXJA 2LPRA 4XE4A 1SGTA 1ZHMA 3ZZ6A 1OYQA 5JYIA 1GJ4H 3RLWH 1P11E 1B0EA 1GHBF 1NM6A 1JXPA 2ZDKA 4X6MA 1WUNH 2DUCA 2ANMH 4NCYA 3P95A 2OK5A 1H8IH 1MTNB 3OSYA 4J2YB 1Q3XA 3UQVA 3SNCA 1IQIA 1YPLH 2P94A 3S0NA 1A0LA 1W0JD 3M3VA 1G30B 1YPHE 3P92A 1EAXA 4TPYA 1ETSH 1P03A 2BD3A 5SGAE 2ZTYA 1YLCA 2QXJA 1ZGIA 1ZSJA 2PTNA 1PPBH 5JBBS 3SI3H 1MCTA 3A7YA 2WSSD 3S69A 1DWCH 1ID5H 1VJAU 1ELCA 1MKWK 4DT4A 1BA8B 2V3HH 3TNTA 1GI1A 4CRAA 3KYGA 4GSOA 4I8HA 1O2LA 4X2YA 2AMPA 1BJVA 2Y7ZA 1BZXE 3SW2B 3E16B 1RTLA 5A0AE 1TYNA 1JOUB 5ABWA 5C1YA 3E91A 3MU1A 2SNWA 4ZKSU 3S9AA 1S84A 1A5GH 2J5UA 4YM9A 2G4TA 2WV9A 1C5WB 1SI5H 1MAXA 2H1UA 2FLBH 3RXBA 4JZIA 3U9AH 1GBKA 2XNDD 2ZDAH 1JIMA 3RM0H 3FP8E 1Y8TA 1AGJA 4B6FA 5HMAA 1IQHA 3MO6A 5C17A 1TQ7B 2UUFB 1C5PA 5PTPA 2SGFE 1O5BB 4FUDA 4B76A 1QY6A 1C5TA 5B6LA 3TU7H 2FYRA 2WPJS 1SGEE 4UFEH 1T31A 3OU0A 1LVYA 3PRBA 4A1TA 3LJOA 5HKKD 1C1PA 2F83A 3MWIU 7LPRA 4X6NA 2FI4E 1BTUA 4MNVA 1Z1IA 2V3OH 4IS5A 4Y76A 1L1JA 3A89A 1C2MA 4YOJA 1H9HE 4FUHA 3PWCA 4HZHA 2ZDVH 4FU7A 3SUGA 4BTTB 2IPHA 1GCTC 3A8BA 5A8XA 1DX5M 3OFND 4M9FA 4OS5A 5JDUB 1NO9H 3SNBA 3NK8A 4BXWA 3TLOA 1TLDA 1LPGB 1V2ST 2QN5T 2XWAA 1THSH 2VWNA 3D49H 1CSOE 4ISNA 2OQ5A 1DS2E 4FUBA 3MU5A 2VWLA 5CHAC 3ZVBA 1TNIA 3D65E 1G3EA 4KTUA 1NPMA 1LPZB 3TH4H 2BXTH 1AQ7A 1TMTH 1ZZZA 2W7SA 1C5XB 1ELEE 1A2CH 1FJSA 2BVRH 1GCTB 3FANA 4AGJA 1BITA 1C2JA 3LKWA 2ZPQA 5GDSH 1SGNE 1E38B 3BTTE 2BY7X 1XUGA 2H9HA 1O30A 1PPEE 1C5SA 4WWYA 1ZRBA 3C27B 1T8MA 4Z6AH 2ODQA 3E0PB 5LGOA 1O36A 1GJCB 1P02A 1ABIH 1CO7E 1BMFD 1ELAA 2OINA 1MZDA 4LZ4B 1P2MA 3CP7A 1F0SA 2UWPA 4F55A 1H1BA 2FYQA 1KDQA 1RTKA 1O3OA 5FPSA 1A5IA 4ISOA 1SSXA 2Z6BD 4UFDH 2C93B 3ZZBA 3Q76A 2C8WB 1WOFA 1QB6A 3M5NA 5FAHA 4ZHMU 5CDFE 4AX9H 1HAIH 1HCGA 5GWZA 1SLXB 4XOJA 1OKXA 2Z9KA 1NBMD 1QR3E 1T8OA 3DUXH 4ZKNU 4FOUC 3ATLA 4GLYA 1Z8GA 2QXGA 3FO8D 3UTUH 2B9LA 2A5KA 1OSSA 5EXNA 1GVKB 1INCA 2J98B 3RXMA 1HLTH 2R9PA 1V2VT 5I46H 1P2QA 2J38A 1YPMH 4YOIA 1LVBA 2ALVA 1D6RA 5GIBA 1UK2A 2VB0A 5TCCA 2C8ZB 3SJOA 4E7RG 3A84A 4Q4LA 3ODFA 4Q63A 1LVMA 2ODPA 2G52A 2C8YB 5EW1H 1N6YA 3MHWU 3QUMP 1FLEE 2KR7A 1MU8B 3ESTA 3NZIA 1SGFA 2OC7A 4I32A 4D7GA 3ZV9A 3RXQA 4D9RA 4BANB 4ZHLU 4Y0YE 1CHOG 1GDUA 2F9OA 2ZCHP 1GGDC 1Y3YA 4LK4A 2ZO3H 1QBOA 3TK5A 3LH3A 1O2KA 2SGQE 4K1EA 1SGPE 4GAWA 1ESBA 5BRRE 5CHBA 4XBDA 1C5OH 2ZC9H 1LKBA 2M2AA 1FZZA 3VB6A 3HKIB 1C1SA 3E6PH 1ETTH 1Z6JH 3BSQA 3Q3YA 1P2IA 2YNBA 4YT7H 3FZZA 1EOLA 2PSXA 1KSNA 2P16A 3RXLA 4BTIB 4ZROA 2PV9B 2QC2A 1H9IE 1HAYB 4O9VA 1SLUB 1QURH 2VWOA 1BTPA 3Q3XA 3RXGA 2BLOA 1BHXF 3M35A 1W11U 1CBWC 2ZFQH 1KXFA 3IG6B 1BMLA 4X8UH 3NWUA 1VJ9U 1UTJA 2HNTE 4XBCA 2G55A 3ZZAA 1XXFA 4Y0ZE 3LC3A 2OXSA 2FEQH 2RA3A 1OP2A 1YF4A 2BX3A 1KXEA 4B1TA 3A82A 1WV7H 3B9FH 2JH6D 1J16A 2AMDA 4JYVH 4DG4A 1CBWB 3PV5A 4GHQA 4X2WA 3M36A 1GI8B 4TY6A 3SNEA 2FMJA 1ARCA 1XVOA 2AS9A 2BDCA 3GOVB 4ZXXH 5ESTE 2C8XB 3UUZA 1NBME 3RMMH 3AW1A 3ITIA 5EGMA 1Z8JB 4CRFA 1EZXC 2H5DA 3N7DA 1O35A 1O2HA 1W14U 1RGQA 4CREA 1T7CA 1CT4E 1E79D 5BPEA 6GCHF 1V2JT 1THRH 4DW2U 4WY3A 3A85A 1ZGVA 1C1RA 1QJ6B 1IQFA 1F0RA 1GJBB 3ZZDA 1HJ9A 3PO1C 1CA0C 4H6SB 1GJ5H 1L0ZA 4B71A 2ZU5A 2XCFA 1WTGH 2A32A 2PR3A 1VKYA 4ZXYH 2L74A 4JCNA 2Q6DA 1UO6A 1IQNA 2PFEA 2Y6TA 1XM1A 4RT0A 1AVXA 1GVZA 1ZPZA 2BQWB 1FY3A 1DT2A 2ZHQH 3EQ0H 1MTUA 1W7XH 4NSVA 1P2OA 1O3PB 1O2UA 3PO1B 2D26C 1CA0B 1HB0B 1O2YA 5FBIA 3MOCA 2A2XH 3N7OA 1Y5BT 2PSYA 1P05A 2RCEA 2B8OH 1PFXC 3MI4A 1K1JA 3L33A 1GI9B 1IQLA 3QN7A 2FESH 1F0UA 4MLFB 1ETRH 3BN9A 4ZMAH 5FX5A 1S83A 2K0QA 1ZJKA 2H5CA 4BAOB 5FL7D 3S7KB 3UPEA 5A8ZA 2XRCA 1VGCC 1FIZA 3TGJE 2AMQA 2V7QD 2WYJA 1HAGE 3M7QA 5E0GA 2GKVE 2ZFTA 1H9LB 1L1NA 2FI3E 2VNTA 2F43B 2BQ7B 1O2OA 1AUTC 5HYOA 2A5AA 1VCWA 1GJDB 1V2KT 1HAHH 3BTQE 3UNQA 1K21H 1SB1H 4FUJA 3N99A 2XBYA 4O03A 1C5RA 1P3EA 3CENA 2ZFFH 1VGCB 1V6DA 4K8YA 4KP0A 1SLWB 1HAVB 3NXPA 1C2IA 4RN6A 3P8FA 3H09A 2D8WA 3M37A 2QGRA 4IW4E 4MNWA 2THFB 1Y3VA 2UWOA 3M3TA 1C2LA 2W7UA 5DK1A 2BY6X 3CS0A 3MNSA 1EQ9A 2PKSC 2H9EH 1H8DH 1QQUA 4R0IA 2JETC 3M7TA 2HVXA 3PLBA 4ABIA 1G37A 4TWYA 1C2FA 1P8VC 4X1RU 1O3HA 3LDXH 4UONA 3ZVAA 1P10A 4XSKU 2TRMA 4MQAA 8GCHG 4AFSA 3DA9B 2ZF0H 4AG1A 4CHAC 8KME2 2F9PA 4U2WA 4X8VH 1O3NA 2LP6A 3FFGA 3GY7A 3MU8A 1BHXB 4CBOA 4MVNA 1D9IA 2PKSB 3AVZA 5C3NA 2I6QA 1XXDA 2JETB 4B6EA 2VVVA 1EAWA 1KTTB 3JZ2B 1F0TA 1W12U 1ZTJA 1CGIE 3PLKA 4FUCA 4JYTA 1UTKA 1YPKH 3ZVCA 1QRWA 1DUAA 2L6OA 3GCTG 3JZ1B 4SGBE 1YCPM 5T6DA 1FIWA 2VIDA 1HNEE 4Y8YA 1GMHF 2BM2A 1V2PT 1XUIA 4CHAB 5DGJA 1DUEA 3RM2H 4JYUH 1TMUH 1MZAA 1UCYE 4NA8A 1KXAA 2D1JA 1NT1A 3I78A 3T5FH 5GCHF 3RU4T 5AFYH 1QTFA 1BTZA 8LPRA 3AAVA 3DCLA 1AE5A 2XNIA 4K5ZA 1HXEH 3BG4C 1C2HA 3RUOA 3T27A 3L3TA 4A7IB 3MH5A 4KGAA 4YOGA 3BTGE 1IOEA 4XRNA 5TJXA 1ANCA 4NG9H 5K7RA 4FUIA 1DFPA 5J4SA 5GXPA 1K1OA 4E06H 1O3FA 4FVBA 1W3CA 3T28A 1O38A 4Q2KA 3F68H 3P8GA 4Y11E 1A7SA 1BIOA 2EQNA 2ZQ2A 3Q00A 1NFYA 2JIZD 3P17H 1HAOH 5FPTA 4NWKA 3LGWA 3BG4B 1H4WA 3S7HB 2JH5D 4NGAH 4Q80A 1FQ3A 5KGOA 1ANEA 1UMAH 1O2TA 3ZZ5A 1DLKB 9ESTA 4FUGA 1RJXB 2VJ1A 1WDIA 4H4FA 5JBCS 1JIRA 4LOYH 5L6NH 7GCHF 2AEIH 1XUHA 3FP6E 2XBWA 4AYVB 3M5LA 3KYFA 1EPTC 3RXKA 4ABBA 2UUYA 3DT0H 1P2KA 1BJUA 1ZLRA 1JWTA 2XWBI 1O2RA 1BRBE 2CHAC 2HLCA 2KCYA 4I31A 3VPKA 3A7TA 1KY9A 4Z0KA 3ATIA 1VITH 5C1XA 3QTVH 4DGJA 5JBTA 1C5UA 1EPTB 1HAVA 3UB0A 2K8IA 1DWBH 3OY6U 4X1PU 3ZYDA 1ACBE 3SU6A 4YXWD 2CHAB 3VG8A 3RMLH 5FCRA 1EJMA 3NKKA 1EUFA 1PQAA 3BTHE 5DPAA 1KTSB 3UR6A 1C1NA 1AUJA 3UAIC 4WXIA 1YPEH 4ZHAA 1TRYA 2HOBA 2IJD1 4I86A 2Z3CA 1ORFA 2A45B 2O8TA 2UWLA 2VU8E 4IC5A 3UIRA 1IQEA 1DSUA 1IQKA 1ZSKA 1KDQB 4A1VA 1SQAA 5JB8S 2BVSH 4FU9A 1ABJH 2R3UA 1MTWA 3SV2H 2AYWA 1EZUC 1ELTA 1AFQC 2RA0A 1PPGE 2BD2A 1TA6A 5DP6A 1GHAF 1QJ7B 3T26A 4OS6A 1N1LA 3E8LA 1IHSH 1TFXA 2IPQX 4NIWA 4I8JA 2XBVA 1Z8RA 1PPFE 3F1SB 4MPWA 3SU0A 1Q2WA 4CRBA 1TMBH 2TPIZ 4WXVA 1AHTH 1QA0A 1MUEB 3W94A 1SC8U 1AFQB 1FMGA 4JZFH 4UDWH 5C5NA 2GDDA 3DFLA 1GI2A 1GBMA 1O3GA 1COWD 2ZHDA 1K1NA 3SNAA 2GP9B 1J9CH 4MTBA 1LQEA 1O2NA 2QF4A 1V2UT 2QXHA 2ZHWH 3BIUH 1XUFA 3RC6A 5A0CA 5LPFA 1LKAA 3ELAH 2J4IA 2A5IA 3F3BA 1GVLA 3E90B 3GCHC 1HAXB 3URCA 1W10U 1WCZA 4Q7YA 3KGPA 4B73A 3BTME 2STAE 3QLPH 4I8KA 3BEFB 1TX6A 3PMAB 3FZDA 1ELDE 3UY9A 1KYNA 4BAHB 3WWFA 1C4U2 2ZECA 4AYYB 2ZKSA 1SGIB 3GCHB 1DY9A 1C5LH 3GDUA 1H8ED 3DSPA 2SNVA 1FXYA 1S0QA 2XOKD 4CRDA 3SHAH 1FNIA 4NIXA 5DP4A 1TE0A 2AHME 2FOFA 4DVAU 2KCOA 3F9FA 2KX4A 4CRCA 1GCDA 2BD7A 1W0ZU 3RXRA 1O3MA 2AERH 3GISB 2CF8H 4U32A 1SFQB 3MQKC 1T8LA 3TGIE 1C5ZB 1NESE 1P9SA 5EOKA 3UFAA 1BOQA 3RXPA 3A88A 2PKAA 1GHYH 4Y79A 2K1QA 2J97A 3H5CB 1ZR0A 3SU1A 3D62A 3E3TA 3O8DA 1EPTA 1FX0B 1OHHD 4P00A 1P09A 1EOJA 3RC4A 1KXBA 1MH0A 4JZDH 2ZTZA 1NRRH 1OP8A 1GBTA 2GCHF 3LIWA 1O3CA 2A7CA 1UK3A 1GHVH 3MNBA 2FS8A 3PYHA 4O3TA 4BOHA 1JRSA 1C1OA 4A5TS 1LHCH 1EKBB 1O5CB 1U6QA 1L4DA 2F3CE 1OWEA 4HFPB 5CHAB 1XUKA 1TNKA 3IWMA 2TIOA 4ASHA 1O3AA 1T4VH 2BD5A 3UNRA 1O2MA 1TNGA 4NZQA 4YLQH 3SYJA 1AZZA 1O3BA 2BY5X 1C1TA 3F0PA 2Y5HA 3LC5A 3A81A 2OC8A 4LXBH 2OD3B 2XBXA 2GZ9A 1CVWH 2KZ4A 2AGIX 1TGBA 3B23B 1JMOH 4RKOB 3S9CA 3LT3A 4HTCH 3ZZ9A 1TBQH 1TRMA 3DD2H 1C2KA 1CHGA 2GCTC 1TBRH 2BOHB 3SGQE 1ZJDA 1CGJE 1QB9A 3BTKE 1S0RA 2FWWA 3SZEA 3BEUA 3QTOH 1DM4B 1O2GH 2FX4A 1AI8H 3KEEA 2PHBA 4K69A 4Y8XA 2AFQB 3K65B 3MH4A 1AVWA 5L2YH 3HPTB 2VIOA 3ZIAD 4DURA 3OX7U 1GI3A 2ZU1A 4PROA 2ZWLH 2GCTB 5AFZH 3SO3A 3TK9A 2TGPZ 1C5QA 1GHWH 4K8BA 4SGAE 3F2GA 3BF6H 2CJIA 3ZVGA 2B5TB 2CN0H 1GBFA 1F92A 4TWWA 4AG2A 1C9PA 1S6HA 2CXVA 4Y10E 1Y5AT 1SVPA 2R2MB 4TYDA 4ABEA 1LMWB 1QBNA 3GY4A 2ZPRA 2ZDNA 1FY1A 1GMDF 3A8DA 2HVYB 1SGFG 1NY22 4ABFA 1GL0E 5E2OA 1GMCF 2GZ8A 3SQHE 1QBVH 2FXRA 1E1QD 1TNLA 3A7ZA 1K9OE 1GG6C 5AHGH 3SGAE 2OC1A 2RDEA 1TB6H 1C5YB 1VITF 3OEED 3VFEA 5JB9S 2VVUA 2LELA 1C4V2 3TH3H 2FOCA 1O3EA 4Y6DA 3TITA 3QGJA 1C5MD 2FX6A 1SHYA 2QCYA 2PW8H 1DY8A 1V3XA 2EC9H 1FONA 1HAZB 1IQJA 2D2DA 2HNTF 3NUMA 1P0SH 2Q6FA 5C67A 2FTLE 4AZ2B 1GGDB 1YWUA 1L4ZA 1GG6B 1ZMJA 1XX9A 1TQ0B 5F8XA 4B74A 1MMJN 2TBSA 2OLGA 2ZU4A 1J14A 2P8OC 1DOJA 2P3FH 2G51A 1GL1A 2F9BH 3KHVA 3TIUA 2BOKA 1NRPH 5EQSA 5C5OA 1GBBA 3KCGH 3A87A 2QYIA 3RXFA 1YKTA 2BHGA 2GVFA 4H42U 3KQBA 1HGTH 1QRZA 2KAIA 2A7HA 3PMJA 1O31A 1ZSLA 1A61H 5LH8A 4XDEA 2P8OB 1GBHA 3BTDE 1ELFA 2J34A 2BX4A 1OWIA 1DICA 2BMGB 1EZSC 1J15A 2ESTE 1DXPA 2GDEH 2GGVB 1K28D 1G2MA 1HJAC 4F4OC 4ACBA 1LQDB 4OS4A 4CH8B 1EP6A 4TPIZ 1GHBG 3MO9A 1UHBB 1BTXA 2AIQA 3F2FA 3LPRA 5L2ZH 3EAJA 1OWHA 4IMQA 2EY4C 3PTBA 2FTMA 1UVOA 2ZFPH 2F9NA 1UK4A 2M5TA 1A3EH 3ATWA 2V35A 1M9UA 1GI4A 3R3GB 1HJAB 2PP6A 3KQEA 5B6OA 4OGXA 3WW7A 1N6XA 1SBWA 5FBEA 1YY3A 2H9TH 1IHTH 1XMNB 2V0BA 4KKDA 1L1GA 2ZZUH 4ZH8A 3B8JA 4XFQA 2NU1E 2IN2A 3DSOA 1SLVB 2OCVB 2IJOB 4RSPA 1DE7H 2VBCA 2O8UA 3STIA 2P95A 2A1DB 4BNRA 1FN6A 1FI8A 1YLNA 2Y80A 4U30A 1UTMA 1VCPA 2GX4A 1LDTT 1W7GH 1MQ5A 3GICB 4INHA 5DP5A 1EAUA 3RXEA 1OPHB 2O8MA 1O5GH 3MNXA 2CK3D 1K1MA 2XYAA 3GY5A 5F03A 5HM2A 5EG4A 1NRQH 3A86A 3PM3A 1V2WT 1WU1A 4Q7XA 1JBUH 3FKSD 3PRDA 1T4UH 1TGCA 3ZV8A 4CR5A 5KECA 1NC6A 3CNRA 1IQMA 2QV1A 3LONA 3QO6A 1O5FH 1THPB 3P8NA 3SN8A 2ODYB 1TGTA 1PQ7A 3KL6A 2FOGA 2KM0A 5T6FA 4E7NA 2BTCE 4FXGH 3EGKH 1SFIA 5FX6A 3VB3A 3F9GA 2OC0A 1ZPBA 3VXEH 1Y3WA 2QF5A 1C5NH 1A0JA 3ZZ7A 2OQUA 2TGTA 2Y81A 3T25A 3SOSA 1OWDA 1AKSB 3SZNA 4IC6A 1SG8B 2OTVA 3RMNH 4A6LA 1Z6EA 1MBMA 1QNJA 4I8GA 1DSTA 5DP7A 1UTQA 3VB5A 3KQCA 4KELA 1E36B 4ISLA 2FOAA 1GJAB 5EPYA 1AIXH 4D8NA 1D6WA 1LHDH 4IN1A 3EA9A 2PUQH 4UD9H 2YNAA 4YLUA 2QA9E 4BTUB 1W8BH 1P04A 2QAAA 2DE8A 4MG3A 4WH6A 3PV2A 1ZTLA 5DO4H 3RU4D 1QQ4A 2ULLA 4BXSA 3A7VA 5I25A 1OYTH 2ZEBA 3GDSA 2BDGA 4F48B 5DKMA 4XD7D 3T29A 1O34A 4TT3D 1UJ1A 1O37A 2GV7A 3MFJA 1SQTA 2LNCA 4ABJA 1G3BA 1O32A 2BDBA 3RMOH 3BTFE 1FUJA 1O2ZA 1L2EA 1HPGA 4F49A 1GI0A 1KLIH 1NRSH 1P57B 1UHBA 5DJ7A 4MPVA 2Z94A 3PLPA 1ZMLA 2QIQA 2BDAA 5LPEA 2VIPA 3W1EA 2EI6A 2J9NA 4ESTE 4Y8ZA 4INLA 1K1IA 5FHTA 5T3HA 1RIWC 1CT2E 3LGVA 1GPZA 1LVOA 4WF8A 1CA8B 4JMYA 5EXMA 1KMHB 1HV7A 1TWXB 1V2RT 3SQEE 3BIVH 1EZQA 1CU1A 4CH2B 1RRKA 2P3TB 3TK6A 4DOQA 4M7GA 1BRAA 2A7JA 3V13A 1OXGA 1CHOF 3SUDA 1C1UH 2IOTA 1AN1E 5FPYA 1QJ1B 2A0QB 1MD7A 2HLDD 1K1LA 2ZGBH 1LCYA 3QK1A 1PQ5A 1RIWB 2ZP0H 2AIPA 2BDHA 2JKHA 2O9QA 2GJGA 3MO3A 1MBQA 4GUXA 3LOXA 1S5SA 1AMHA 2GV6A 3I77A 2ZTXA 3LH1A 3T62A 2ZA5A 2F91A 3PROA 1FV9A 2ZU3A 2WPLS 5HIYA 1TPAE 2VIWA 2FZZA 2PKAB 2PLXA 5GPIB 2VIVA 3WY8A 1Z8IB 4CBNA 3AW0A 3PTNA 4NSYA 4FETA 5EU8A 1MAYA 3HK6B 1Z7KA 3KIDU 2XTTB 1NU9A 3PV4A 4AORA 1BBRE 2SGAA 1WQSA 5T6GA 1TONA 5CMXH 2ZGCA 5H4IB 5E2PA 1O2PA 1SR5C 1SGYE 3RU4E 2PGBB 3DSGA 5IYTA 3TH2H 3AASA 1EXFA 1V2OT 1O5AB 1WTHD 4AGKA 1SMFE 2B7DH 3CS7A 3U8RH 3LGIA 4K1TA 1OWJA 1AKSA 1UVSH 3ODDA 3RXOA 4UFFH 5DP3A 1DWDH 1IAUA 1MD8A 1ZHPA 1Y3XA 4RKJB 1C2GA 5AF9H 1HFDA 2XXLA 1TALA 2WUCA 3BTWE 2HGTH 4FUFA 1GDQA 3KF2A 3VEQB 1MQ6A 1TPOA 2ZGXH 3GY3A 2BQ6B 3OE7D 2ZPSA 4THNH 3ZVDA 1PPZA 2FDAA 4K3JA 2PUXB 3TJUA 1GBEA 1FY4A 1QGFA 1G3CA 4X6PA 3SJ9A 2A4QA 2W3KA 2ANKH 2Z9IA 1DANH 3NRLA 1C1VH 2J2UA 1G3DA 4AB8A 1F7ZA 6LPRA 2V3MA 4AB9A 3SV8A 1QIXB 5LPRA 3T2NA 3LGUA 1BRCE 1NROH 1RXPA 2XCNA 3VXFH 1QZ8A 2ZCKP 3ZZCA 2A4RA 3GYLB 2P93A 3TVJB 1GBCA 3U8OH 1QL9A 1O0DH 4X6OA 4DY7B 4KTSA 1PPHE 2EA3A 2GD4B 2R2WU 1YCPH 2F9UA 4AN7A 3KN2A 3GY6A 2FI5E 4Y7AA 1C2DA 2EI7A 3GY8A 2EI8A 6GCHG 4MDSA 3SV9A 4ZKOU 3U8TH 3OY5U 2W5EA 1HAPH 3HK3B 4X8SH 1OS8A 1FPCH 3F6UH 2C90B 4ABDA 3A83A 3LGTA 1C9TA 1DITH 3V7TA 5EXLA 2UUKB 1HIAA 2OBQA 4MPUA 2BB4A 1ZPCA 1TIOA 1P01A 3BTEE 1DLEA 2R0KA 3MH6A 1KLJH 2NU0E 3U69H 4IBLH 1MKXH 3HGPA 1EFRD 1ZOMA 5C94A 1F2SE 3GCOA 1K0HA 2QF3A 1ZYOA 1LHGH 5EJ1A 1O39A 1X7AC 2P59A 1EB1H 2Y82A 3RLYH 3ZVEA 3VB7A 3Q77A 1A1RA 3SU3A 2QF0A 4A92A 1A5HA 2FS9A 1RS0A 5C0TA 2WUBA 1PQ8A 4YTAA 1MABB 1T32A 3TPIZ 4INKA 1PYTD 3ATKA 1A46H 2ZIQH 2EEKA 1P9UA 3NPSA 3HATH 1Y5UT 2WINI 3OAAD 1KLTA 4B2AA 1O3DA 1BMAA 1DWEH 1QL7A 7KMEH 1Z71A 2PWXA 8GCHF 1WYKA 4P02A 2HRVA 1ELVA 1TPSA 4ZKRU 3V3MA 1QA7A 2KAIB 4FU8A 3F9EA 3U1IB 3EA8A 1F5LA 2BD9A 2I6SA 2JDID 4GCHG 5F53A 2Y7XA 1D4PB 1EX3A 3OTJE 1YPHC 1SPJA 2FOHA 3EE7A 2BLVA 4BAMB 2Z9GA 3DFJA 2TGAA 3SHCH 2XC4A 3GCTF 3GY2A 2OBOA 3SORA 3H7TA 2TGDA 1MTSA 3AK5A 5EQQA 1EP5A 5A09A 3EE0B 1TGNA 6ESTA 1D3DB 1DXWA 3PMBB 1UCYH 1KIGH 1BTHH 1NZQH 2HALA 2RDLA 1CT0E 4JK6A 2FLRH 1SKYE 5C20A 5F8TA 3SU5A 3F9HA 1SOTA 3RXIA 1AE8H 4NZLA 3ZYEA 2WYGA 3QGNB 5ETXA 3KQ5A 2HPPH 2BLWA 1K22H 1WXRA 1TOCB 1YP9A 2BXUH 3F2HA 3ZVFA 1E0FD 3A7WA 4JZ1A 5HM9A 2A4OA 3W95A 3RDZA 1WAYB 2GMTC 3MH7A 1UVUH 4ZAEA 2H6MA 1QHRB 3NCLA 2W6ID 3SI4H 2WHXA 4AFZA 1SQRA 1BMMH 5A8YA 1GMHG 1GJ8B 2WV5A 1VR1H 4HI3A 3VB4A 1V2NT 2BY8X 2G4UA 1YPGH 1HRTH 2A4GA 2VWMA 3OTPA 5GCHG 4ABGA 5DP9A 1Z1JA 3U1JB 2GMTB 5F8ZA 4X8TH 4H6TA 4X2VA 2HWLB 5J4QA 4AOQA 1GBJA 3VGCC 1Q31A 1TPPA 1PPCE 1GHXH 2GT8A 2NU4E 4NFFA 1S82A 3BEIB 2VINA 5JBAS 4IGDA 3PMHB 4CR9A 1NFWA 1FPHH 1VZQH 2QE7D 3FVFB 3STJA 3AAUA 1LPKB 2BZ6H 3Q3KA 1SHHB 1GBIA 1FAXA 3MYWA 3E1XB 3UQOA 1YPJH 2XC5A 3K6ZA 1NN6A 5DG6A 3RXCA 2BD4A 1GWAA 2B0FA 3SU2A 1V2QT 4BAQB 4BAKB 4CRGA 1W0KD 2XC0A 1TA2A 3GYMA 4K1SA 3VGCB 1MU6B 5FCKA 1O33A 3M7UA 1BBRH 4D7FA 3EDXB 3SJ8A 1DPOA 1Y59T 3EA7A 1BTWA 2YMSD 2AGEX 4ISHH 4GHTA 2FP7B 1QCPA 3ATMA 3TJOA 3U98H 3MMGA 1HYLA 7GCHG 1TOMH 1ZMNA 2ZHFH 1XUJA 5K0HA 2XW9A 2OP9A 4RT1A 5E0JA 1AB9C 4B2CA 2AH4X 2O8WA 3A80A 1SGRE 3RXTA 4X2XA 3V12A 2FM2A 4HG6A 2VH0A 3HGNA 1UW7A 3BG8A 4NFEA 5ESBA 5HGGA 1C1WH 1HJ8A 4ASUD 4OS2A 1J8AA 2ALPA 1P12E 2OUAA 2YOLA 1WBGB 1K2I1 1C2EA 4YZUA 1O3KA 1YCPK 5DN6D 1UTPA 1NRNH 1O3IA 2GT7A 2ZQ1A 3FAOA 3E0NB 4X1NU 1P06A 1WQVH 1QFKH 4ABAA 3UNSA 2CMYA 4NIYA 2F9VA 1AB9B 1HXFH 1MCVA 4FVDA 4ISIH 4QT8C 1G36A 2ZFSA 5JPMH 2R3YA 3GDVA 1JRTA 2W6JD 1O5EH 1XVMA 4I8LA 1W0YH 3SV6A 2CF9H 2ZI2H 4AC9A 2QY0B 2ZNKH 3V0XA 5E8EH 1TX7A 1A0HB 5C1UA 2ZCLP 1C5VA 1P3CA 9LPRA 1TGSZ 2KCAA 4DJZB 1GHZA 2DE9A 1TNJA 1BT7A 2AGGX 2G5NA 2G81E 1GI5A 1W2KH 1ESTA 1MKXK 1GBAA 3MU4A 2SGEE 1FAKH 1W13U 2G00A 2J92A 4AFQA 1PYTC 1GJ6A 2PGQB 2BVXH 2ZG0H 4LZ1H 1BQYA 1O2SA 1O3LA 4Q7ZA 4U01A 1XKBC 3KQDA 3UR9A 4WMEA 3LU9B 1GHAG 1EASA 1D3PB 1NFXA 4DCDA 2GZ7A 1SGQE 3SJKA 3SV7A 1EJAA 1O2QA 2NU2E 5L30H 2PTCE 1K1PA 1FN8A 1SQOA 3TJNA 2FODA 1S6FA 4K60A 4ABHA 1EAIA 2VVCA 4I7YH 1FY5A 4R8TB 3LGYA 5EJLA 2FOBA 3RXVA 5KEDA 2W3IA 5HXFA 1O2JA 1Y3UA 3URDA 1BCUH 1PJPA 1HBTH 2STBE 1RTFB 2J95A 1AU8A 1VCQA 4DIIH 1S85A 1C4Y2 3RXDA 1LO6A 3S9BA 3I29A 1O3JA 4TY7A 3QX5H 2ZGHA 4WVPE 5EPNA 3SUFA 1V2MT 4WMFA 4I33A 1P2NA 3H7OA 1F5KU 2FIRH 2SFAA 3MTYA 3ZZ4A 5IDKA 1SGDE 4X1QU 1UTOA 4VGCC 2FOMB 1A3BH 2KCPA 4XBBA 2J98A 5GJ4B 3O8RA 3MU0A 3RP2A 2BZAA 5HIZA 3C1KA 1BRUP 4TSFD 1UCYK 1DDJA 2JH0D 1HUTH 4ZUHA 1KXCA 2ZDLA 4ZCNA 3ENSB 4O3UA 3A7XA 4B2BA 1OOKB 2Z9LA 1HDTH 3P8OA 2HNTC 1E1RD 1OWKA 1G2LA 1RD3B 1AD8H 3M3SA 2ANYA 4JK5A 1ZHRA 1P2JA 1MKWH 1SL3A 3MNCA 1GJ7B 2BLQA 4VGCB 3RC5A 3ZZ8A 2VGCC 1N8OC 1F5RA 3TNSA 4YT6H 2A31A 4GCHF 5IK2D 7ESTE 2Z7FE 3EYDA 3RXUA 4OS7A 2WZQA 1C1MA 1AVGH 2JJ2D 3UWJH 4UE7H 4X0WU 3PWBA 1GI6A 1TBZH 1YM0A 2CGAA 4HGCA 2FOEA 2G8TA 2Y5FA 2ZHEH 1CE5A 1TRNA 5GNDA 2ASUB 1B0FA 2Y5GA 3D23A 3OYPA 2ZDMA 4WJG2 4Y71A 2H2ZA 2WPKS 2VIQA 4WH8A 1LTOA 1N8OB 2VGCB 1V2TT 1GDNA 1CQQA
chains in the Genus database with same CATH topology
3G01A 3DHKH 1NFUA 3QDZB 4B75A 5CE1A 2ZU2A 3R0FA 4D76A 1EJNA 3A8AA 4IN2A 5FXLA 1TABE 3M61U 1O5DH 1BMNH 2NWNA 1B7XB 4NA9H 5EW2H 1TNHA 1AY6H 1ANDA 2HPQH 2GCHG 1G9IE 3UOPA 2O8LA 1QL8A 2Z3EA 4FUEA 2ZGJA 1AWHB 1SGCA 5EQRA 1UVTH 1E35B 3RXHA 1ZRKA 2FPZA 2BY9X 3P6ZB 3HKJB 2FO9A 5EODA 2BDYA 4GVUA 3K9XB 2GTBA 1BB0B 3QZQA 1ELGA 3SBKA 1NS3A 4AFUA 4J1YA 3QWCH 3LJJA 1AFEH 4X1SU 3UREA 2P3UB 2BD8A 4UEHH 1BDAA 1OP0A 1LHFH 2ANWA 3RXSA 4E05H 1BBRK 2V6NA 2WPIS 3L6PA 1QRXA 4GPGA 4K2YA 2W26A 1WSSH 1E37B 1ELBA 1O2WA 1QB1A 2ILNA 3KNXA 3PB1E 5E0HA 1HIAB 2G5VA 1AWFH 1BUIA 1FY8E 2VH6A 2C4FH 1YBWA 1NTPA 5A0BA 6CHAC 1YLDA 1BTYA 1FDPA 1TX8A 4NA7A 1ESAA 1D3QB 1O2IA 4A1XA 1RFNA 3K2UA 1MTVA 2WPMS 1AZ8A 3SJIA 1AO5A 4MPXA 3TGKE 3SU4A 3GCNA 1YYY1 4WMDA 4DT7B 1O2VA 1TAWA 1ARBA 3UWIA 1GBDA 1T8NA 6CHAB 2RG3A 4MNYA 2Z9JA 1D3TB 2Z3DA 3QZRA 5F6MA 2A2QH 2Q6GA 3O8BA 1O2XA 1ANBA 1DVAH 1IQGA 2BYAX 3O8CA 3BV9B 1NU7B 2CV3A 4IMZA 1SOZA 2WV4A 5TCAA 1A4WH 5A2MH 1GMDG 4NIVA 2C3SA 4JZEH 3M5MA 4YESB 4O97A 1EATA 1KXDA 2UUJB 1ZTKA 3A8CA 3SGBE 4MNXA 1GMCG 3SNDA 1GI7B 2WPHS 4OS1A 5G4BA 3M5OA 2R0LA 3ZZ3A 1J17T 3P70B 1EB2A 2NU3E 1UVPA 1UTLM 1C1QA 1GBLA 1UTNA 2QXIA 3UOUA 5DP8A 1VITG 3K6YA 2SGDE 1OX1A 1YC0A 2Q1JA 3RXAA 1CGHA 3SUEA 2J94A 1YGCH 2ZFRH 4D9QA 4DIHH 1GJ9B 4Y7BA 1G32B 5AVDA 5C2ZA 1MTNC 4NWLA 1V2LT 1LHEH 3FP7E 3IITA 1S81A 1E34B 4YO9A 3TJVA 4KTCA 8ESTE 1XKAC 4UFGH 1B5GH 2BDIA 4OGYA 2SGPE 3RXJA 2LPRA 4XE4A 1SGTA 1ZHMA 3ZZ6A 1OYQA 5JYIA 1GJ4H 3RLWH 1P11E 1B0EA 1GHBF 1NM6A 1JXPA 2ZDKA 4X6MA 1WUNH 2DUCA 2ANMH 4NCYA 3P95A 1H8IH 1MTNB 3OSYA 4J2YB 1Q3XA 3UQVA 3SNCA 1IQIA 1YPLH 2P94A 3S0NA 1A0LA 3M3VA 1G30B 1YPHE 3P92A 1EAXA 4TPYA 1ETSH 1P03A 2BD3A 5SGAE 2ZTYA 1YLCA 2QXJA 1ZGIA 1ZSJA 2PTNA 1PPBH 5JBBS 3SI3H 1MCTA 3A7YA 3S69A 1DWCH 1ID5H 1VJAU 1ELCA 1MKWK 1BA8B 2V3HH 3TNTA 1GI1A 4CRAA 4GSOA 4I8HA 1O2LA 4X2YA 2AMPA 1BJVA 2Y7ZA 1BZXE 3SW2B 3E16B 1RTLA 5A0AE 1TYNA 1JOUB 5ABWA 5C1YA 3E91A 3MU1A 2SNWA 4ZKSU 3S9AA 1S84A 1A5GH 4YM9A 2G4TA 1C5WB 1SI5H 1MAXA 2H1UA 2FLBH 3RXBA 4JZIA 3U9AH 1GBKA 2ZDAH 1JIMA 3RM0H 3FP8E 1Y8TA 1AGJA 5HMAA 1IQHA 3MO6A 1TQ7B 2UUFB 1C5PA 5PTPA 2SGFE 1O5BB 4FUDA 4B76A 1QY6A 1C5TA 3TU7H 2FYRA 2WPJS 1SGEE 4UFEH 1T31A 3OU0A 1LVYA 4A1TA 3LJOA 1C1PA 2F83A 3MWIU 7LPRA 4X6NA 2FI4E 1BTUA 4MNVA 1Z1IA 2V3OH 4IS5A 4Y76A 1L1JA 3A89A 1C2MA 4YOJA 1H9HE 4FUHA 3PWCA 4HZHA 2ZDVH 4FU7A 3SUGA 4BTTB 2IPHA 1GCTC 3A8BA 5A8XA 1DX5M 4OS5A 5JDUB 1NO9H 3SNBA 3NK8A 4BXWA 3TLOA 1TLDA 1LPGB 1V2ST 2QN5T 2XWAA 1THSH 2VWNA 3D49H 1CSOE 4ISNA 2OQ5A 1DS2E 4FUBA 3MU5A 2VWLA 5CHAC 3ZVBA 1TNIA 3D65E 1G3EA 4KTUA 1NPMA 1LPZB 3TH4H 2BXTH 1AQ7A 1TMTH 1ZZZA 2W7SA 1C5XB 1ELEE 1A2CH 1FJSA 2BVRH 1GCTB 3FANA 4AGJA 1BITA 1C2JA 3LKWA 2ZPQA 5GDSH 1SGNE 1E38B 3BTTE 2BY7X 1XUGA 2H9HA 1O30A 1PPEE 1C5SA 4WWYA 1ZRBA 3C27B 1T8MA 4Z6AH 2ODQA 3E0PB 5LGOA 1O36A 1GJCB 1P02A 1ABIH 1CO7E 1ELAA 2OINA 1MZDA 4LZ4B 1P2MA 3CP7A 1F0SA 2UWPA 1H1BA 2FYQA 1KDQA 1RTKA 1O3OA 5FPSA 1A5IA 4ISOA 1SSXA 2Z6BD 4UFDH 2C93B 3ZZBA 3Q76A 2C8WB 1WOFA 1QB6A 3M5NA 5FAHA 4ZHMU 4AX9H 1HAIH 1HCGA 5GWZA 1SLXB 4XOJA 1OKXA 2Z9KA 1QR3E 1T8OA 3DUXH 4ZKNU 3ATLA 4GLYA 1Z8GA 2QXGA 3UTUH 2B9LA 2A5KA 1OSSA 5EXNA 1GVKB 1INCA 3RXMA 1HLTH 2R9PA 1V2VT 5I46H 1P2QA 2J38A 1YPMH 4YOIA 1LVBA 2ALVA 1D6RA 5GIBA 1UK2A 2VB0A 5TCCA 2C8ZB 3SJOA 4E7RG 3A84A 3ODFA 1LVMA 2ODPA 2G52A 2C8YB 5EW1H 1N6YA 3MHWU 3QUMP 1FLEE 1MU8B 3ESTA 3NZIA 1SGFA 2OC7A 4I32A 4D7GA 3ZV9A 3RXQA 4D9RA 4BANB 4ZHLU 4Y0YE 1CHOG 1GDUA 2F9OA 2ZCHP 1GGDC 1Y3YA 4LK4A 2ZO3H 1QBOA 3TK5A 3LH3A 1O2KA 2SGQE 4K1EA 1SGPE 4GAWA 1ESBA 5BRRE 4XBDA 1C5OH 2ZC9H 1LKBA 1FZZA 3VB6A 3HKIB 1C1SA 3E6PH 1ETTH 1Z6JH 3BSQA 3Q3YA 1P2IA 2YNBA 4YT7H 3FZZA 1EOLA 2PSXA 1KSNA 2P16A 3RXLA 4BTIB 4ZROA 2PV9B 2QC2A 1H9IE 1HAYB 4O9VA 1SLUB 1QURH 2VWOA 1BTPA 3Q3XA 3RXGA 2BLOA 1BHXF 3M35A 1W11U 1CBWC 2ZFQH 1KXFA 3IG6B 1BMLA 4X8UH 3NWUA 1VJ9U 1UTJA 2HNTE 4XBCA 2G55A 3ZZAA 1XXFA 4Y0ZE 3LC3A 2OXSA 2FEQH 2RA3A 1OP2A 1YF4A 2BX3A 1KXEA 4B1TA 3A82A 1WV7H 3B9FH 2JH6D 1J16A 2AMDA 4JYVH 4DG4A 1CBWB 4GHQA 4X2WA 3M36A 1GI8B 4TY6A 3SNEA 2FMJA 1ARCA 1XVOA 2AS9A 2BDCA 3GOVB 4ZXXH 5ESTE 2C8XB 3UUZA 3RMMH 3AW1A 3ITIA 5EGMA 1Z8JB 4CRFA 1EZXC 2H5DA 1O35A 1O2HA 1W14U 1RGQA 4CREA 1T7CA 1CT4E 5BPEA 6GCHF 1V2JT 1THRH 4DW2U 4WY3A 3A85A 1ZGVA 1C1RA 1QJ6B 1IQFA 1F0RA 1GJBB 3ZZDA 1HJ9A 3PO1C 1CA0C 4H6SB 1GJ5H 1L0ZA 4B71A 2ZU5A 2XCFA 1WTGH 2A32A 2PR3A 4ZXYH 4JCNA 2Q6DA 1UO6A 1IQNA 2PFEA 2Y6TA 1XM1A 1AVXA 1GVZA 1ZPZA 2BQWB 1FY3A 1DT2A 2ZHQH 3EQ0H 1MTUA 1W7XH 4NSVA 1P2OA 1O3PB 1O2UA 3PO1B 2D26C 1CA0B 1HB0B 1O2YA 5FBIA 3MOCA 2A2XH 3N7OA 1Y5BT 2PSYA 1P05A 2RCEA 2B8OH 1PFXC 3MI4A 1K1JA 3L33A 1GI9B 1IQLA 3QN7A 2FESH 1F0UA 4MLFB 1ETRH 3BN9A 4ZMAH 5FX5A 1S83A 1ZJKA 2H5CA 4BAOB 3S7KB 3UPEA 5A8ZA 2XRCA 1VGCC 1FIZA 3TGJE 2AMQA 2WYJA 1HAGE 3M7QA 5E0GA 2GKVE 2ZFTA 1H9LB 1L1NA 2FI3E 2VNTA 2BQ7B 1O2OA 1AUTC 5HYOA 2A5AA 1VCWA 1GJDB 1V2KT 1HAHH 3BTQE 3UNQA 1K21H 1SB1H 4FUJA 2XBYA 4O03A 1C5RA 1P3EA 3CENA 2ZFFH 1VGCB 1V6DA 4K8YA 4KP0A 1SLWB 1HAVB 3NXPA 1C2IA 4RN6A 3P8FA 2D8WA 3M37A 2QGRA 4IW4E 4MNWA 2THFB 1Y3VA 2UWOA 3M3TA 1C2LA 2W7UA 5DK1A 2BY6X 3CS0A 3MNSA 1EQ9A 2PKSC 2H9EH 1H8DH 1QQUA 4R0IA 2JETC 3M7TA 2HVXA 3PLBA 4ABIA 1G37A 4TWYA 1C2FA 1P8VC 4X1RU 1O3HA 3LDXH 4UONA 3ZVAA 1P10A 4XSKU 2TRMA 4MQAA 8GCHG 4AFSA 3DA9B 2ZF0H 4AG1A 4CHAC 8KME2 2F9PA 4U2WA 4X8VH 1O3NA 3FFGA 3GY7A 3MU8A 1BHXB 4CBOA 4MVNA 1D9IA 2PKSB 3AVZA 5C3NA 2I6QA 1XXDA 2JETB 2VVVA 1EAWA 1KTTB 3JZ2B 1F0TA 1W12U 1ZTJA 1CGIE 3PLKA 4FUCA 4JYTA 1UTKA 1YPKH 3ZVCA 1QRWA 1DUAA 3GCTG 3JZ1B 4SGBE 1YCPM 5T6DA 1FIWA 2VIDA 1HNEE 4Y8YA 1GMHF 2BM2A 1V2PT 1XUIA 4CHAB 5DGJA 1DUEA 3RM2H 4JYUH 1TMUH 1MZAA 1UCYE 4NA8A 1KXAA 2D1JA 1NT1A 3I78A 3T5FH 5GCHF 3RU4T 5AFYH 1QTFA 1BTZA 8LPRA 3AAVA 1AE5A 2XNIA 4K5ZA 1HXEH 3BG4C 1C2HA 3RUOA 3T27A 3L3TA 4A7IB 3MH5A 4KGAA 4YOGA 3BTGE 1IOEA 5TJXA 1ANCA 4NG9H 5K7RA 4FUIA 1DFPA 5J4SA 5GXPA 1K1OA 4E06H 1O3FA 4FVBA 1W3CA 3T28A 1O38A 4Q2KA 3F68H 3P8GA 4Y11E 1A7SA 1BIOA 2ZQ2A 3Q00A 1NFYA 3P17H 1HAOH 5FPTA 4NWKA 3LGWA 3BG4B 1H4WA 3S7HB 2JH5D 4NGAH 4Q80A 1FQ3A 1ANEA 1UMAH 1O2TA 3ZZ5A 1DLKB 9ESTA 4FUGA 1RJXB 2VJ1A 4H4FA 5JBCS 1JIRA 4LOYH 5L6NH 7GCHF 2AEIH 1XUHA 3FP6E 2XBWA 4AYVB 3M5LA 1EPTC 3RXKA 4ABBA 2UUYA 3DT0H 1P2KA 1BJUA 1ZLRA 1JWTA 2XWBI 1O2RA 1BRBE 2CHAC 2HLCA 4I31A 3VPKA 3A7TA 1KY9A 4Z0KA 3ATIA 1VITH 5C1XA 3QTVH 4DGJA 5JBTA 1C5UA 1EPTB 1HAVA 1DWBH 3OY6U 4X1PU 3ZYDA 1ACBE 3SU6A 2CHAB 3RMLH 5FCRA 1EJMA 3NKKA 1EUFA 1PQAA 3BTHE 5DPAA 1KTSB 3UR6A 1C1NA 1AUJA 4WXIA 1YPEH 4ZHAA 1TRYA 2HOBA 2Z3CA 1ORFA 2A45B 2O8TA 2UWLA 2VU8E 4IC5A 3UIRA 1IQEA 1DSUA 1IQKA 1ZSKA 1KDQB 4A1VA 1SQAA 5JB8S 2BVSH 4FU9A 1ABJH 2R3UA 1MTWA 3SV2H 2AYWA 1EZUC 1ELTA 1AFQC 2RA0A 1PPGE 2BD2A 1TA6A 5DP6A 1GHAF 1QJ7B 3T26A 4OS6A 1N1LA 3E8LA 1IHSH 1TFXA 4NIWA 4I8JA 2XBVA 1Z8RA 1PPFE 3F1SB 4MPWA 3SU0A 1Q2WA 4CRBA 1TMBH 2TPIZ 4WXVA 1AHTH 1QA0A 1MUEB 3W94A 1SC8U 1AFQB 1FMGA 4JZFH 4UDWH 5C5NA 2GDDA 3DFLA 1GI2A 1GBMA 1O3GA 2ZHDA 1K1NA 3SNAA 2GP9B 1J9CH 4MTBA 1LQEA 1O2NA 1V2UT 2QXHA 2ZHWH 3BIUH 1XUFA 3RC6A 5A0CA 5LPFA 1LKAA 3ELAH 2J4IA 2A5IA 1GVLA 3E90B 3GCHC 1HAXB 3URCA 1W10U 1WCZA 4Q7YA 3KGPA 4B73A 3BTME 2STAE 3QLPH 4I8KA 3BEFB 1TX6A 3PMAB 3FZDA 1ELDE 3UY9A 1KYNA 4BAHB 1C4U2 2ZECA 4AYYB 2ZKSA 1SGIB 3GCHB 1DY9A 1C5LH 3GDUA 2SNVA 1FXYA 1S0QA 4CRDA 3SHAH 1FNIA 4NIXA 5DP4A 1TE0A 2FOFA 4DVAU 3F9FA 4CRCA 1GCDA 2BD7A 1W0ZU 3RXRA 1O3MA 2AERH 3GISB 2CF8H 4U32A 1SFQB 1T8LA 3TGIE 1C5ZB 1NESE 1P9SA 5EOKA 3UFAA 1BOQA 3RXPA 3A88A 2PKAA 1GHYH 4Y79A 2K1QA 3H5CB 1ZR0A 3SU1A 3D62A 3E3TA 3O8DA 1EPTA 1P09A 1EOJA 3RC4A 1KXBA 1MH0A 4JZDH 2ZTZA 1NRRH 1OP8A 1GBTA 2GCHF 3LIWA 1O3CA 2A7CA 1UK3A 1GHVH 3MNBA 2FS8A 3PYHA 4O3TA 4BOHA 1JRSA 1C1OA 4A5TS 1LHCH 1EKBB 1O5CB 1U6QA 1L4DA 2F3CE 1OWEA 4HFPB 5CHAB 1XUKA 1TNKA 3IWMA 2TIOA 4ASHA 1O3AA 1T4VH 2BD5A 3UNRA 1O2MA 1TNGA 4NZQA 4YLQH 1AZZA 1O3BA 2BY5X 1C1TA 2Y5HA 3LC5A