1TNIA

Prediction of novel serine protease inhibitors
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Prediction of new serine proteinase inhibitors.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 51
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1994-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tniA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tniA02
1ZHMA 2LPRA 4ZXYH 1MTSA 3ZVEA 4FXGH 5A8ZA 3OX7U 1SGRE 1U6QA 2ANWA 3A80A 1Z8JB 4INHA 1TQ7B 3GY6A 3N7OA 1H8IH 3ZZ8A 2OD3B 1SQTA 4JCNA 3T25A 2GMTC 2VIQA 1QBVH 1GBMA 1TOMH 1XVMA 2FX4A 2ZHFH 4MDSA 2JH6D 1MZAA 1D9IA 1V2VT 1TFXA 3RXEA 1HAGE 1TPAE 4AYVB 4LK4A 3GCTF 3UIRA 3BTQE 2V3OH 2RG3A 2VINA 1NT1A 1J17T 2XBYA 1C1PA 3F6UH 1FY5A 4FUEA 2BVXH 2FLBH 1O2MA 3QTVH 1HAPH 3OYPA 1GJCB 1QTFA 3Q76A 2G4TA 1HYLA 2J94A 3TIUA 1GMDF 1BITA 2ZGJA 1F5RA 4U32A 3SV8A 1HAVB 1SLVB 1LHEH 2BX4A 3LH3A 2BZ6H 1O3LA 2H5DA 3MO3A 1QJ6B 3E91A 3L33A 5DKMA 1T8OA 4UFFH 1P3EA 3ODDA 1CHOG 1C4Y2 4B73A 1O2SA 1QB9A 1DX5M 1HUTH 3D65E 4X8UH 3NWUA 1SGEE 1S83A 1S0QA 2AMQA 3GDVA 1WQSA 2BQWB 4JZDH 1ZZZA 4LOYH 3ZVAA 2QF3A 1WTGH 5FBIA 2SGPE 2C8WB 2Z9IA 1ESAA 4DOQA 1B7XB 1ZHRA 3A83A 2Y5GA 3DFJA 1Z8RA 4O03A 3BTWE 4YT6H 4LZ4B 4O9VA 1F92A 3O8CA 2ZIQH 2WV5A 1FJSA 4CRDA 3MU5A 2BZAA 3TGKE 2CGAA 3LT3A 1O3KA 3CS0A 1ID5H 1KXCA 1BTWA 5JPMH 3GYMA 1K28D 2O8TA 4IC5A 4CRCA 6CHAC 1SMFE 2VGCC 1ZGIA 1FY4A 1TMTH 1O3JA 1P9SA 4ABBA 4TPYA 2ZU5A 1UVSH 3GCTG 1OWKA 4AG1A 4GVUA 2XRCA 1GBDA 2Q6FA 1QCPA 2ZTZA 4TY7A 1EB2A 1E0FD 2P93A 4H6SB 2OBOA 3SU2A 1EPTA 1TX8A 3BTFE 2FIRH 4GHQA 1KLTA 1MKXK 2ZDKA 1SGCA 3F9GA 1TIOA 3PLBA 4FUGA 1YM0A 3OSYA 3MNSA 1GMDG 1UMAH 4K1TA 2WYJA 1H1BA 1WBGB 2WPLS 3SJIA 4UFGH 5E8EH 2KAIB 1AZ8A 4YO9A 3QZQA 4MPXA 4BAOB 1AFEH 2TGDA 2GD4B 3MNXA 5FPYA 4I8JA 4XE4A 1O37A 1P2IA 1TNJA 3HGPA 2FYQA 1MCVA 4I8LA 1TPSA 2FOGA 1GVLA 2Y80A 1PPHE 2PGQB 3R3GB 1ZMNA 2G81E 2SGDE 3SN8A 1GBTA 3SUDA 2C8YB 4OGYA 5FPSA 3RXVA 1C5YB 1YBWA 1O5AB 3RUOA 1TLDA 3T62A 3RXSA 3R0FA 4F4OC 1C5XB 3UPEA 4BAQB 1AVXA 3TJVA 1J8AA 3S69A 1DM4B 2LNCA 3S9BA 2C8ZB 1K21H 3URCA 1Y5BT 1DANH 1OP0A 3M3TA 5EG4A 1Z1JA 2PUQH 1RRKA 2CF8H 3EGKH 4X8VH 1EAXA 4YOJA 2BLVA 3E1XB 1NN6A 1KXFA 4XBCA 1OOKB 3A86A 8GCHF 1NU7B 5JBBS 2WPJS 1JMOH 3BG8A 3U8OH 5HM9A 4UFDH 1LKAA 3SHCH 1N1LA 3RXDA 1Y59T 1AB9B 1O2WA 2F9PA 2AYWA 2YNAA 1TNHA 3M5NA 1O3MA 2WPIS 2AS9A 4MNWA 1GJDB 3GY4A 3TITA 1TA6A 1G9IE 1W11U 3ZVGA 1TGBA 3VPKA 1VZQH 3ATKA 1FY1A 1TGCA 3UUZA 1ZJDA 2WYGA 2XBVA 5I25A 2F9OA 5DP9A 3PWBA 2P8OB 4X6PA 4X0WU 4K2YA 1AU8A 4HTCH 3H7OA 2D26C 3A7TA 3TK6A 1A2CH 3VGCB 2A2XH 3LGVA 4X6OA 1BMAA 2GCTC 1V2UT 1PPGE 5TJXA 4D7GA 1Q3XA 2ZCLP 5EODA 1V2MT 3ZZ6A 1KDQA 3ATWA 1BMLA 1KY9A 2ZQ1A 1O3AA 2D1JA 2QC2A 3NKKA 2QGRA 4K69A 2A31A 1QFKH 1GI7B 1ZPZA 1BQYA 3PB1E 2BDYA 2FS9A 1JWTA 3T27A 2FOAA 4DG4A 1GMCF 2EC9H 1P11E 3ZZCA 1SGFA 2PUXB 4DIIH 2GVFA 4NGAH 1ZTKA 1O2NA 1BB0B 3RXBA 2J34A 4YZUA 5FXLA 1ESTA 4JYTA 3D23A 2ZFQH 2CJIA 2ZKSA 8GCHG 1ARCA 2F3CE 3GDSA 1ZLRA 2ZCHP 4WF8A 4WJG2 1LHCH 2VIWA 3GOVB 1P0SH 1SGTA 3BIVH 2G8TA 3EA7A 1C5UA 2FX6A 1KDQB 4HI3A 4GUXA 2SGFE 1E34B 1QBOA 1O3NA 3RLWH 1CVWH 2ODYB 2HNTF 1AVGH 4FUIA 2ZWLH 1GPZA 1BUIA 1MTWA 1OWJA 3VB6A 4Z6AH 4KP0A 1IQLA 1E38B 3RU4D 4FUDA 1XXDA 2AMDA 4A5TS 5L6NH 1YGCH 1D3TB 1O2PA 1TGNA 3VXEH 1K1OA 4UEHH 4X2XA 2VIVA 3P6ZB 3SNDA 5GDSH 2ZU4A 1C5TA 1Q31A 3BSQA 2JETC 1W3CA 1AO5A 3SI4H 2QF0A 1O5BB 3A7XA 4ABGA 7LPRA 1MU6B 1ELAA 5T6FA 5EW2H 1H4WA 1QGFA 1C5OH 1T8MA 1QQ4A 1IAUA 3LONA 1DSUA 4JZFH 4ZAEA 1O3OA 1FN8A 1NFYA 5SGAE 3LPRA 1CO7E 2FM2A 4RN6A 2WV4A 2EA3A 1ELEE 1F5KU 1A46H 1P02A 3SI3H 3TJNA 1GDNA 2R0LA 2Z3CA 1F0SA 1C2MA 1XUJA 3QDZB 1TA2A 5FCRA 2SFAA 1GMCG 3NZIA 2G00A 3AASA 5DP5A 3EA8A 4RKJB 4CRBA 1RTLA 2VVVA 1MTUA 1ZR0A 1C1QA 4BANB 1C4U2 4X8TH 3UNSA 1F0UA 2OC7A 1FI8A 3LH1A 1EZXC 1XUIA 1RTKA 2P16A 1AB9C 1GJ7B 2HOBA 1C5MD 3RMOH 1P2KA 1Y5AT 3UOPA 1ARBA 1AFQB 4FUBA 4D8NA 1LCYA 1PYTD 5C1XA 4I32A 4OS4A 1KTSB 4AORA 2BY7X 2I6SA 3F9HA 2GV6A 1PJPA 3LGUA 5DJ7A 5I46H 2ZDMA 1PQ7A 1SOTA 5C1YA 3E0NB 1YP9A 1BTXA 3S9AA 1FMGA 3SJ9A 5ETXA 1T32A 1SVPA 3VGCC 2BY8X 2NU3E 1GBCA 2PKAB 2GGVB 2O8UA 3ESTA 1O2ZA 1S0RA 3DFLA 4X1PU 1GBHA 2WUCA 1FDPA 1EZUC 1CGIE 2BD5A 1DS2E 2GTBA 1W0ZU 1ZRBA 5H4IB 2QIQA 1V2PT 2BVSH 4GCHF 4A1XA 2BDCA 3VB3A 1DT2A 5C5OA 1G32B 4FU7A 1HJAB 1GI3A 1GJ8B 5LH8A 4NFEA 1CE5A 2OC1A 3NUMA 2IOTA 1UO6A 1LQDB 2Y7ZA 1EATA 3RP2A 1C1SA 1HIAA 2FESH 1SG8B 1TRNA 2ESTE 3P92A 1AWHB 2PSXA 1H9LB 2P3UB 1O2KA 1TNGA 2ZTYA 4XSKU 3RXOA 1O2VA 1ACBE 1C2GA 1DY8A 1VCQA 2H1UA 3ZZ7A 1IQKA 2BY5X 1C5VA 1DSTA 4U30A 3E3TA 3LDXH 2VNTA 1XKAC 2FODA 5HM2A 1SI5H 3BTHE 1OP8A 3RXCA 9ESTA 1IHTH 4YLUA 1NESE 4YOGA 2A5KA 4JZ1A 1G36A 1GHAF 2GZ9A 4Y71A 1O3BA 3BEUA 1O34A 1XUHA 4X1RU 1NRNH 1ELBA 4O3UA 1HAXB 1NRPH 1C2LA 1EUFA 4I31A 1L1NA 1O2QA 3TJOA 1NFWA 4NA7A 1K9OE 1L4ZA 6LPRA 5JDUB 4AFUA 3RXQA 1ZTJA 4NWKA 4R0IA 3PMJA 2ZNKH 5GPIB 2BY6X 3SJOA 1BIOA 1PPEE 2J95A 1SGIB 2FS8A 1UK2A 4GCHG 2VH6A 1M9UA 2TGAA 1YCPM 3OY5U 3U8TH 4DY7B 2ULLA 2A4GA 4J2YB 3RXPA 3CP7A 5EW1H 1K1PA 1THPB 1UTOA 1O2JA 2ODPA 3M61U 3GYLB 1CU1A 1GI8B 1V3XA 3UWJH 1VCPA 1ETSH 1QL8A 3ATMA 1S84A 2CF9H 1EQ9A 4NZQA 5C2ZA 3RDZA 4H42U 4K60A 2UWPA 2TGTA 1X7AC 3M36A 4X6MA 3DUXH 1O2TA 2GDDA 1UCYH 4FU9A 1KXDA 2ZTXA 5CMXH 1RXPA 1NZQH 3M5OA 1G3BA 1LDTT 1NRSH 2ILNA 4ABEA 1GHWH 1YF4A 5DP8A 1QR3E 4B2AA 1NS3A 5BRRE 1OSSA 2B0FA 1JIMA 1GHAG 3SORA 1FNIA 2BLWA 4JZIA 1VCWA 1AE8H 1HAVA 3E90B 2R2MB 2GP9B 3ELAH 4I8KA 5F8TA 2G52A 1AMHA 5TCCA 4ABFA 1T8LA 1UTNA 1T31A 4AFSA 4K8YA 4Y8XA 1FIZA 2EEKA 2HWLB 3EQ0H 2ANKH 4Y8ZA 2QN5T 4KTSA 2HNTE 4AG2A 3F9EA 1K1LA 4BTIB 1SHHB 1MH0A 4Q7YA 1C5WB 1GI5A 5C3NA 4M7GA 1SQAA 2A4QA 4D7FA 1A0LA 1AZZA 1MD8A 1MD7A 2GX4A 3MWIU 2NU4E 1TABE 3F9FA 1A5IA 1H8DH 7KMEH 2SGEE 2QV1A 3ZVFA 1HJAC 1LPZB 1VITH 4ZKOU 2BOKA 1GG6B 4ABJA 1V2KT 4SGAE 2ALVA 2VWMA 4A1TA 1KXEA 2C90B 2J9NA 3SU3A 3KHVA 3RC5A 3LOXA 1BBRH 1MAXA 5F8XA 3KQBA 4OS5A 1CA8B 1NROH 5C1UA 3A88A 4Y8YA 1NU9A 3GICB 1C2EA 2Z6BD 3BTDE 4OS1A 1FPHH 1CGHA 2GCTB 2GKVE 2SGQE 5FX6A 1BTUA 3A81A 4ISIH 1P9UA 3QUMP 4IN2A 3HATH 3T29A 2HLCA 1G2MA 1GJ4H 4ISOA 1F0RA 1MBMA 2GT7A 1BMMH 5B6OA 1EASA 4ZHAA 3RXKA 3UNRA 4AX9H 1GJ9B 2XTTB 1P03A 1P2MA 3TJUA 1NY22 2ZEBA 3D62A 4WH8A 1BTHH 4X6NA 1OP2A 3UWIA 1O35A 3SUGA 2Q1JA 3B9FH 1GHBG 2A5IA 1GVKB 1ZSJA 1KLJH 4YESB 2KAIA 3SU1A 4AGJA 1BRAA 1Y3VA 1GVZA 8LPRA 3KF2A 5AFZH 1RD3B 3RXFA 1C2FA 1BJVA 1OKXA 3SV7A 3QX5H 2FI4E 1O2LA 5E2PA 4ABHA 2EI8A 1TPPA 1Y3XA 2BX3A 1TMBH 3K6YA 3MU1A 3BN9A 1IQMA 1HJ9A 1F7ZA 5EQQA 1P09A 3O8RA 2FLRH 1THSH 4MVNA 4XOJA 2RA3A 3I29A 2OTVA 5EXLA 3T28A 4B1TA 2XXLA 4I8GA 4TYDA 2FOMB 1D6RA 4FUFA 4WMFA 1SHYA 2GCHF 4GAWA 4XBBA 4CRFA 2OXSA 4K1EA 1T7CA 3E16B 3GY5A 2ZDLA 4ZXXH 1TALA 3UQVA 5GJ4B 2Z3EA 3ATIA 1MTVA 1P2OA 2JETB 3AVZA 4NCYA 1HAOH 1PPFE 2NWNA 3ODFA 1MKWK 3URDA 2BDAA 2FOCA 4X1QU 5FBEA 2Y5HA 1O38A 3PLPA 3SUFA 2W5EA 1GL0E 1W12U 1V2NT 2ZI2H 3GDUA 1HCGA 3A82A 1L1GA 1TPOA 3ZZBA 1LVYA 2BQ6B 3RMLH 3MO9A 3HKJB 1JRTA 4AN7A 2P94A 2QA9E 1SGNE 3PLKA 1EZQA 1ZGVA 4GSOA 3Q3YA 4E05H 1GBAA 3FP6E 1OWIA 5DP6A 1C1NA 2F9BH 4AZ2B 2BB4A 3U9AH 4E7RG 3RXIA 3TNTA 1AUJA 1NO9H 1XM1A 2FYRA 3MH4A 2Z9GA 3IITA 1LHDH 1FZZA 2PV9B 3T26A 1DDJA 1VR1H 1YKTA 2IJOB 2A1DB 1OX1A 1BTZA 3PTNA 3FZZA 3ZYDA 1TQ0B 1TGTA 2VWNA 1O39A 2ZDNA 2ZFFH 3TK9A 4AGKA 3UOUA 1AQ7A 1HFDA 1SLXB 2Z9JA 3SNEA 1CSOE 5ESTE 2FMJA 3QZRA 3U98H 3SV6A 3P8FA 5GXPA 3RLYH 1GBLA 7GCHG 1GG6C 4BXSA 1UTPA 2GCHG 3V13A 2IN2A 3SNBA 4YOIA 1HAIH 1O3CA 2ZG0H 4NIWA 1C4V2 3SJKA 2BD9A 5L30H 4X2VA 1GJ6A 3V7TA 1EJAA 3ITIA 3MHWU 1VITF 8ESTE 1LQEA 4FUCA 4Q7ZA 3UR9A 1ELDE 1HPGA 1O2XA 1A5GH 4QT8C 5L2ZH 4XFQA 1C1MA 1C5LH 1VJ9U 1YLCA 2QY0B 4ISHH 1P10A 1DFPA 2GZ8A 3MI4A 2JH0D 3M7QA 4IBLH 1MQ5A 5T6GA 2PWXA 2PGBB 1ETTH 3PV4A 2UUKB 2ZPQA 5LPFA 3M5LA 1RJXB 1IQFA 1O3DA 3DA9B 3KGPA 3PMBB 1EP6A 1BTYA 4Y79A 1BT7A 1O3IA 1QJ1B 4FUHA 3IG6B 3TH4H 3A87A 4DT7B 2ZHQH 3PYHA 2I6QA 4A92A 4A7IB 5EOKA 1S6HA 1GCTB 1NRQH 2Y7XA 4INKA 3H5CB 3QGNB 1ANEA 3RXJA 3F68H 3A7ZA 1ZMLA 1DWCH 1MTNB 2OQ5A 3UNQA 4LXBH 1DUAA 1G37A 1JIRA 1GJBB 1BRCE 1WYKA 2Z94A 1AHTH 1LVMA 1P04A 1YPJH 1YCPK 4IMZA 2ZU3A 1DWDH 1A3BH 2OC0A 1MKXH 1EOJA 1C5SA 4AOQA 4RKOB 2V3HH 3ZVDA 2ZHEH 5BPEA 3QWCH 3O8BA 1ELCA 2H9HA 1D6WA 3A7YA 3UR6A 1N6XA 4DW2U 3A8CA 1H9IE 1W8BH 3OTJE 2EI7A 2BHGA 3SNAA 3E6PH 4IN1A 1S85A 4RSPA 1FAXA 1PPCE 3RM0H 2A7HA 1NM6A 2K1QA 2AGEX 1C2IA 1KYNA 4TWWA 3RM2H 1TRYA 4Y7BA 1VITG 2P95A 3HK6B 1EAWA 2ZA5A 1C2HA 4KTUA 1AGJA 3HPTB 4JZEH 4X2WA 4E7NA 1TOCB 5FX5A 3GCNA 2VWLA 1EJNA 1GI0A 3Q3XA 5C5NA 2XC4A 1D3QB 1D3PB 1SQOA 2H9TH 1OXGA 1YPGH 5DP3A 2XYAA 2ZFTA 1S82A 3STJA 2FP7B 3VB4A 4DURA 4HZHA 1O32A 3MNCA 1ZHPA 2B7DH 2O8WA 5ESBA 2BXTH 4FVDA 5AFYH 1O3FA 4BNRA 1QJ7B 2AMPA 1B0FA 1A0HB 4H6TA 4MQAA 3TH2H 4MTBA 1SOZA 2Z9LA 1W7GH 3C27B 1BJUA 1V2JT 3QN7A 5E2OA 2PKAA 2Z7FE 1ZSLA 5GWZA 1SFQB 3ZZDA 4BOHA 1IQGA 4DCDA 3BV9B 1GJAB 1XVOA 2ZU2A 2D2DA 3A7WA 1WOFA 1V2OT 2ZDAH 2FO9A 2CN0H 1ABJH 1SC8U 3M5MA 1O5GH 2H6MA 1UVPA 2F91A 2PTNA 1G3CA 1AI8H 1SLUB 1ZMJA 3VFEA 1ZSKA 1ZOMA 2Y82A 4ZKRU 4X1SU 1QA7A 1MQ6A 1NRRH 2QYIA 4CR5A 2XW9A 1EX3A 5A09A 5HYOA 4B76A 4O97A 4A1VA 4D9QA 1C5ZB 1W7XH 4NFFA 5A2MH 1BMNH 1FV9A 2F9NA 4ZKNU 1GBJA 3LIWA 2PSYA 4SGBE 4Q7XA 2G55A 1CHGA 1C1VH 1FIWA 3SGAE 1O2OA 2OC8A 1AWFH 3P8GA 4WMEA 1AKSB 3HK3B 1A3EH 3Q77A 3STIA 3FP7E 1UHBB 3AW0A 1IQHA 1J15A 3P8NA 3TGIE 1HB0B 4WY3A 1TNIA 3A8AA 5EXNA 4MLFB 5DO4H 1DPOA 3A84A 1V2QT 2Q6GA 1C1RA 3K65B 2BD8A 1ELVA 3TK5A 5A8YA 5JBAS 1ELTA 4TY6A 4Y0YE 1DITH 1DLEA 1GCTC 3PM3A 2CHAB 3KNXA 2BD4A 3PTBA 4IMQA 3RU4T 1MTNC 1NFXA 3MU4A 1GWAA 1SLWB 1A7SA 1SR5C 1D4PB 2AFQB 3M3SA 1NPMA 1F5LA 5IDKA 4YT7H 3UQOA 1N8OB 2PHBA 1P8VC 1UCYE 1SGPE 1YPMH 1JBUH 1XX9A 1MBQA 5DP4A 2ZECA 2TRMA 1QRXA 1WSSH 1QQUA 1MMJN 1QBNA 2Z9KA 3TH3H 1TNKA 4CBOA 1CA0B 2CV3A 1A1RA 3U8RH 2W7UA 1UTMA 3BG4B 1GHYH 3KQDA 4MNYA 4B71A 4XBDA 2AGIX 4B74A 4CHAB 1NFUA 1LPGB 5DP7A 1C1WH 3LU9B 2RDLA 3SU6A 5A0CA 1CBWB 3QGJA 5F6MA 1Z7KA 1T4VH 1OPHB 3V12A 2ALPA 1QURH 3A8DA 1HAHH 5K0HA 4ZHMU 4NSVA 1XXFA 3FANA 1O2GH 1LVOA 1GBBA 3E0PB 2FOBA 3S7HB 4X1NU 1GI4A 3PROA 4AFZA 3AAVA 3K6ZA 2ZDVH 1GBFA 3QTOH 2EI6A 4WMDA 3D49H 2ZF0H 3TNSA 5EGMA 1ZYOA 1S81A 1K1JA 2BXUH 2YOLA 3L6PA 2VVUA 2TGPZ 5DG6A 1HAZB 1TBRH 1BBRE 3CENA 4YTAA 3MO6A 1O3PB 1EB1H 1YPLH 2IPHA 5G4BA 2PLXA 3M37A 4KELA 2PW8H 3EA9A 3BTME 4ZMAH 2W3IA 2ZGHA 2G5NA 1V2WT 2XC5A 5EU8A 5JB9S 2P59A 1GL1A 1GMHG 1MU8B 4X8SH 2Z3DA 2QXGA 2P3FH 1WTHD 1KTTB 1VJAU 1WUNH 2SNVA 3UFAA 2BDBA 1XUGA 1HJ8A 2GT8A 2TPIZ 1GHBF 3LJJA 4MPUA 1UTQA 1C1UH 1THRH 3KN2A 4NA8A 4GPGA 1PQ5A 1GBEA 1S5SA 2BDGA 2VIDA 5F8ZA 3MU8A 5J4SA 1L0ZA 2UWLA 1NC6A 5HGGA 5FCKA 3SQHE 3ENSB 3UREA 5A0BA 1EZSC 1FONA 1G30B 3AAUA 1TBZH 2H5CA 1O5FH 4K8BA 1SB1H 3DD2H 4H4FA 4AYYB 3GY7A 1GDQA 1O0DH 3UY9A 2FI3E 2J4IA 3PWCA 1DLKB 3FAOA 1B5GH 3IWMA 1Y8TA 3HGNA 1SGDE 4K3JA 1C5NH 1E37B 1VGCB 4MPVA 2ODQA 1C9PA 4DGJA 2SGAA 2R0KA 1CQQA 3P70B 2ANMH 2C3SA 4FUJA 1P2JA 4UDWH 2BDHA 2BMGB 3BTTE 5GCHG 1ZTLA 1HNEE 1MZDA 1UVTH 1O2RA 3M35A 2SNWA 2CXVA 2VJ1A 3LGTA 2CHAC 4HGCA 2V6NA 4I7YH 1FY8E 1ANDA 2J38A 3S0NA 4OS7A 2O9QA 3PO1B 3H7TA 1N8OC 1SFIA 1QNJA 2HPQH 1IQEA 5JB8S 1Y5UT 4OS6A 2GZ7A 1CT2E 1Z8IB 1DOJA 1AIXH 5GIBA 1JXPA 3ATLA 1AVWA 2AH4X 1IQNA 1EAUA 5F03A 2BOHB 2R9PA 1HDTH 3MU0A 2WINI 4NIXA 4NIYA 1CA0C 3P8OA 1TNLA 5AF9H 2XC0A 3BG4C 3RC6A 4F49A 2BTCE 4CHAC 1LKBA 3L3TA 5DPAA 1OWDA 2Y6TA 4IW4E 5AHGH 2A32A 1CBWC 3GCHB 3ZZ3A 1XUKA 4CH2B 1DWBH 1G3DA 3TLOA 1E36B 2JKHA 2FDAA 1HBTH 1T4UH 1P05A 1TMUH 1Z6JH 4THNH 3VB5A 3TPIZ 2R3YA 2ZHWH 4WXVA 2AIQA 1QL7A 4CH8B 2FXRA 4FU8A 2ZU1A 4KKDA 1O2UA 3O8DA 1CGJE 1O3EA 2B5TB 3MH5A 3EYDA 1BCUH 2OQUA 1ANBA 2VVCA 5EQSA 3BTGE 1RIWC 3SZNA 2OCVB 3CS7A 7GCHF 2FTMA 1BTPA 2C4FH 4Q80A 1IOEA 1J16A 2HGTH 1DXPA 1C1OA 2OINA 3P95A 4OGXA 4KGAA 2P3TB 4MNVA 3GY2A 3FVFB 2UUFB 1ANCA 1AUTC 2ZQ2A 4AB8A 4NWLA 5TCAA 4WH6A 1AE5A 4AB9A 1C1TA 2XCNA 3A89A 1SBWA 1O3GA 3BTKE 3NXPA 3SO3A 3WY8A 3LGYA 2RCEA 4OS2A 4NG9H 4WXIA 1E35B 3HKIB 1DY9A 4BXWA 2BVRH 2HVXA 2AERH 1L2EA 1O5DH 2ZGCA 3RMNH 2HRVA 1TYNA 2UUJB 4Y7AA 1UK3A 1WV7H 1H9HE 2DE9A 3Q3KA 3U1IB 4IGDA 1W13U 4JYVH 1Y3UA 1W2KH 1A5HA 1AD8H 2J2UA 1EPTB 2A2QH 5CE1A 1KXBA 2XBWA 4JYUH 2A4OA 3BEFB 4K5ZA 2Y81A 4DJZB 1FY3A 3TGJE 2R3UA 3I77A 1F0TA 1Y3YA 3LJOA 1C5RA 1OYQA 4WWYA 3RXTA 3SU4A 1TWXB 4GLYA 3UTUH 3QO6A 3RXLA 1JRSA 3T5FH 3MFJA 3RC4A 2BD3A 3SW2B 1NTPA 1QB6A 3SJ8A 1VGCC 4PROA 2C8XB 3KL6A 4IS5A 3SGQE 5EPYA 4I8HA 5LPEA 2AEIH 2NU1E 1C2DA 3RXHA 1UTJA 6GCHF 2FI5E 5JBTA 4ISNA 3SU0A 1C9TA 2YNBA 1PPZA 1LTOA 2H9EH 3B23B 3QK1A 5C67A 1C2JA 1RGQA 1Y3WA 3NCLA 2ZPRA 1WU1A 2BM2A 3MOCA 1BZXE 3LC3A 1UVOA 3PO1C 2PFEA 3ZZ5A 1HXEH 3RXMA 3ZZ9A 2FPZA 4YLQH 4R8TB 1DICA 3RXGA 4CBNA 3V0XA 1OWHA 2VIPA 1Q2WA 1TGSZ 3PMHB 1GBIA 1O2HA 2PKSB 1WQVH 3BF6H 3MNBA 2NU2E 1XMNB 2RA0A 1EP5A 3P17H 5E0HA 1K22H 1O36A 3ZVBA 2M5TA 1ORFA 4UE7H 1GGDB 5A0AE 3I78A 1O2IA 1P2NA 1XKBC 2BQ7B 3RXUA 3DT0H 4BAKB 1O3HA 2ZHDA 3U1JB 1O2YA 4ABIA 1LPKB 1Z71A 1LHGH 1RTFB 3G01A 1AY6H 3GCHC 4AFQA 3LKWA 3SBKA 2HPPH 5CHAB 3SQEE 1UVUH 1YPKH 1HGTH 2A5AA 5JBCS 2HALA 7ESTE 1GI6A 4ZROA 3SNCA 5T3HA 3MMGA 3W94A 2VH0A 4NSYA 1GHXH 2V0BA 4GHTA 2W7SA 3BTEE 5L2YH 2BD2A 3OY6U 2ZO3H 1G3EA 2H2ZA 1ZPCA 4CR9A 1TX6A 5DK1A 1GI1A 4IC6A 3ZVCA 1HAYB 1ELGA 2FWWA 2G4UA 3BEIB 1LO6A 3RMMH 3KQEA 2FOEA 6GCHG 1UK4A 5ABWA 1DXWA 3AW1A 2DUCA 1V2TT 1CT0E 4TWYA 4Y76A 4YM9A 3KIDU 2C93B 1L4DA 3EAJA 4ZHLU 1QY6A 1YPEH 1D3DB 1ZPBA 2VWOA 1C2KA 5FPTA 1DUEA 1MKWH 3T2NA 2STAE 3W95A 1DWEH 9LPRA 4BAMB 2GDEH 2TBSA 1Z6EA 5HMAA 1KIGH 5E0GA 3QLPH 3VB7A 4ABAA 1FPCH 2VIOA 1W0YH 2ASUB 3K9XB 2R2WU 4WVPE 3NPSA 1RS0A 1UTKA 1SGYE 3JZ2B 2ZFPH 4U01A 1FLEE 4E06H 3LC5A 2STBE 1O31A 2QCYA 5AVDA 5EPNA 1DE7H 1OYTH 1V2RT 1IHSH 4BTUB 1P57B 2XCFA 2O8LA 3E8LA 1P2QA 3F1SB 1HXFH 2FTLE 2F83A 2BLOA 1MCTA 1EPTC 2AGGX 3LGIA 1J14A 1P12E 1CT4E 1FN6A 2UWOA 1PQAA 3LGWA 2FZZA 3M7UA 4FVBA 3GISB 3NK8A 2Q6DA 1AN1E 1FAKH 1XUFA 4ISLA 4JK6A 3GY3A 1A4WH 1A61H 1W14U 1TONA 2FEQH 1LHFH 1AKSA 1DVAH 3MTYA 4CRGA 3RXAA 3V3MA 1UHBA 2GV7A 2UUYA 4Z0KA 4B2BA 1UJ1A 2ZC9H 5EXMA 1TE0A 4A6LA 4VGCB 2V35A 1O5CB 1SGFG 8KME2 2B9LA 1WCZA 1ELFA 2ANYA 3SV2H 1O33A 3PMAB 1K2I1 1LMWB 1PYTC 1YC0A 2FOFA 3SHAH 2A0QB 3JZ1B 2Y5FA 3ZV8A 1GBKA 4ABDA 1UCYK 3U69H 1K1NA 3SU5A 1SL3A 1BOQA 2W26A 2PR3A 2WPHS 3FP8E 3KCGH 4MG3A 4DIHH 3B8JA 1YLDA 2ZCKP 4B2CA 3RU4E 5EQRA 1TB6H 2A4RA 5T6DA 3C1KA 1F2SE 1QIXB 3M3VA 4KTCA 3EE0B 3A8BA 1EXFA 2GMTB 2QXIA 2TIOA 5DGJA 4DVAU 1GCDA 2PKSC 2P8OC 3GY8A 4ZKSU 1HLTH 2BY9X 1BHXF 1JOUB 1A0JA 3ZZ4A 1GGDC 2NU0E 1J9CH 1TBQH 1HV7A 2XWAA 1UTLM 3Q00A 4UD9H 2QXHA 3GCOA 3VXFH 2OBQA 1V2LT 1BRBE 2ZPSA 4I33A 5CHAC 1P01A 2F9VA 4TPIZ 1MAYA 2XNIA 4NA9H 1ZRKA 1T8NA 2WPMS 3RXRA 1HRTH 1OWEA 1YCPH 4B75A 4HFPB 3BIUH 4BAHB 2ZGBH 1BHXB 1EOLA 3K2UA 3KQCA 1BRUP 4MNXA 3ZZAA 4D9RA 2ZP0H 3ZYEA 4ESTE 4BTTB 3SUEA 1BA8B 1ZJKA 1GI2A 3MYWA 1QHRB 5LPRA 4JK5A 4UONA 2A45B 1LVBA 1V6DA 1S6FA 3TVJB 1GMHF 1ETRH 2B8OH 3DHKH 1BBRK 3M7TA 2O8MA 4NIVA 2QAAA 2OUAA 3VEQB 3FFGA 4Y11E 3SGBE 4K1SA 1RFNA 1KSNA 3FZDA 2G51A 2XBXA 3A85A 1YPHC 1K1MA 1WAYB 1GI9B 4JMYA 4O3TA 1L1JA 5K7RA 2ZFSA 4CRAA 1P06A 2A7CA 2BD7A 2ZZUH 1N6YA 2AIPA 1V2ST 6ESTA 1FXYA 3EDXB 2BYAX 4XDEA 1QB1A 2VB0A 1KLIH 3MH6A 2VU8E 2J92A 1OS8A 2OLGA 4LZ1H 2ZGXH 4Y10E 1QRZA 2ZFRH 4NZLA 4U2WA 1G2LA 5J4QA 1HIAB 6CHAB 1BDAA 2VGCB 1W10U 5PTPA 1EJMA 2HNTC 1ESBA 1ABIH 1O5EH 1RIWB 1K1IA 2PTCE 4MPWA 3SOSA 4D76A 5GCHF 3S9CA 4Y6DA 1FUJA 1IQIA 1TRMA 2DE8A 2G5VA 3S7KB 1PQ8A 2FOHA 1EAIA 5JYIA 1GHZA 2WPKS 2JH5D 5FHTA 4CREA 5HXFA 1PPBH 5FAHA 1YYY1 1QRWA 5A8XA 1O30A 1TX7A 1GHVH 5IYTA 2THFB 1GDUA 1MUEB 1QA0A 1B0EA 4INLA 4X2YA 1CHOF 1FQ3A 1P3CA 1SGQE 1PFXC 4Q2KA 4Y0ZE 1TAWA 1Z8GA 4UFEH 4VGCC 4ASHA 5LGOA 2QXJA 2OP9A 3MH7A 2XWBI 2BLQA 3ZV9A 1IQJA 2A7JA 3KEEA 1C5PA 4ZH8A 3OU0A 3A7VA 1INCA 1SSXA 2W3KA 3TU7H 5C20A 1AFQC 2F9UA 1C5QA 4ZUHA 1QL9A 1EKBB 2CMYA 1YPHE 5E0JA 1SPJA 1GJ5H 4J1YA 3SV9A 2WUBA 1KXAA 2BDIA 2D8WA 1Z1IA
chains in the Genus database with same CATH superfamily
1ZHMA 2LPRA 4ZXYH 1MTSA 3ZVEA 4FXGH 5A8ZA 3OX7U 1SGRE 1U6QA 2ANWA 3A80A 1Z8JB 4INHA 1TQ7B 3GY6A 3N7OA 1H8IH 3ZZ8A 2OD3B 1SQTA 4JCNA 3CNRA 3T25A 2GMTC 2VIQA 1QBVH 1GBMA 1TOMH 1XVMA 2FX4A 2ZHFH 4MDSA 2JH6D 1MZAA 1D9IA 2WV9A 1V2VT 1TFXA 3RXEA 1HAGE 1TPAE 4AYVB 4LK4A 3GCTF 2XOKD 3UIRA 3BTQE 2V3OH 2RG3A 2VINA 1W0JD 1NT1A 1J17T 2XBYA 1C1PA 3F6UH 1FY5A 4FUEA 2BVXH 2FLBH 1O2MA 3QTVH 1HAPH 3OYPA 1GJCB 1QTFA 3Q76A 5HIZA 2G4TA 1HYLA 2J94A 3TIUA 2KM0A 1GMDF 1BITA 2ZGJA 1F5RA 4U32A 3SV8A 1HAVB 1SLVB 1LHEH 2BX4A 3LH3A 2BZ6H 1O3LA 2H5DA 3MO3A 1QJ6B 3E91A 3L33A 5DKMA 1T8OA 4UFFH 1P3EA 3ODDA 1CHOG 4Q4LA 1C4Y2 4B73A 1O2SA 1QB9A 3PV5A 1DX5M 1HUTH 3D65E 4X8UH 3NWUA 1SGEE 1S83A 1S0QA 2AMQA 3GDVA 1WQSA 2BQWB 4JZDH 1ZZZA 4LOYH 3ZVAA 4B6EA 2QF3A 1WTGH 5FBIA 2SGPE 2C8WB 2Z9IA 1ESAA 4DOQA 1B7XB 1ZHRA 5CDFE 3A83A 2Y5GA 3DFJA 1Z8RA 4O03A 3BTWE 4YT6H 4LZ4B 4O9VA 1F92A 3O8CA 2ZIQH 2WV5A 1FJSA 4CRDA 3MU5A 2BZAA 3TGKE 2CGAA 3LT3A 1O3KA 3CS0A 1ID5H 1KXCA 1QZ8A 1BTWA 5JPMH 3GYMA 1K28D 3GS9A 2O8TA 4IC5A 4CRCA 6CHAC 1SMFE 2VGCC 1ZGIA 1FY4A 1TMTH 1O3JA 1P9SA 4ABBA 4TPYA 2ZU5A 1UVSH 3GCTG 1OWKA 1H8ED 4AG1A 4GVUA 2XRCA 1GBDA 2Q6FA 1QCPA 2ZTZA 4TY7A 1EB2A 1E0FD 2P93A 4H6SB 2OBOA 3SU2A 1EPTA 1TX8A 3BTFE 2FIRH 4GHQA 1KLTA 1MKXK 2ZDKA 1SGCA 3F9GA 1TIOA 3PLBA 4FUGA 1YM0A 3OSYA 3MNSA 3UAIC 5B6LA 1GMDG 1UMAH 4K1TA 2WYJA 2KR7A 1H1BA 1WBGB 2WPLS 3SJIA 4UFGH 5E8EH 2KAIB 1AZ8A 4YO9A 5DN6D 1UW7A 3QZQA 4MPXA 4BAOB 1AFEH 2TGDA 2GD4B 3MNXA 5FPYA 4I8JA 4XE4A 1O37A 1P2IA 1TNJA 3HGPA 2FYQA 1MCVA 4I8LA 1TPSA 2FOGA 1GVLA 2KFWA 2Y80A 1PPHE 2PGQB 3R3GB 1ZMNA 2G81E 2SGDE 3SN8A 1GBTA 3SUDA 2C8YB 4OGYA 5FPSA 3RXVA 1C5YB 1YBWA 1O5AB 3RUOA 1TLDA 3T62A 3RXSA 3R0FA 4F4OC 1C5XB 3UPEA 4BAQB 1AVXA 3TJVA 1J8AA 3S69A 1DM4B 2LNCA 3S9BA 1BMFD 2C8ZB 2RFKC 1K21H 3URCA 1Y5BT 1DANH 1OP0A 3M3TA 5EG4A 1Z1JA 2PUQH 1RRKA 2CF8H 3EGKH 4X8VH 1EAXA 4YOJA 2BLVA 3E1XB 1NN6A 1KXFA 2F43B 1OOKB 4XBCA 3A86A 8GCHF 1NU7B 5JBBS 2WPJS 1JMOH 3BG8A 3U8OH 5HM9A 4UFDH 1LKAA 3SHCH 1N1LA 3RXDA 1Y59T 5C0TA 1AB9B 1O2WA 2F9PA 2AYWA 2YNAA 1TNHA 3M5NA 1O3MA 1K0HA 2WPIS 2AS9A 4MNWA 1GJDB 3GY4A 3TITA 1TA6A 1G9IE 1W11U 3ZVGA 3N7EA 4RT1A 1TGBA 3VPKA 1VZQH 3ATKA 1FY1A 1TGCA 3UUZA 1ZJDA 2WYGA 2XBVA 1OHHD 5I25A 2F9OA 5DP9A 3PWBA 2P8OB 3OEED 4X6PA 4X0WU 4K2YA 1AU8A 4HTCH 3H7OA 2D26C 3A7TA 3TK6A 1A2CH 3VGCB 2A2XH 3LGVA 4X6OA 1BMAA 4AC9A 2GCTC 1V2UT 5EJ1A 1PPGE 5T1VA 5TJXA 4D7GA 1Q3XA 2ZCLP 5EODA 1V2MT 3ZZ6A 1KDQA 3ATWA 1BMLA 1KY9A 2ZQ1A 1O3AA 2D1JA 2QC2A 5EIYA 3NKKA 2QGRA 4K69A 2A31A 1QFKH 1GI7B 5HIYA 1ZPZA 1BQYA 3PB1E 2BDYA 2FS9A 1JWTA 3T27A 2FOAA 4DG4A 1GMCF 2EC9H 1P11E 3ZZCA 1SGFA 2PUXB 4DIIH 2GVFA 4NGAH 1ZTKA 1O2NA 1BB0B 3RXBA 2J34A 4YZUA 5FXLA 1ESTA 2IPQX 4JYTA 3D23A 2ZFQH 2CJIA 2ZKSA 8GCHG 1ARCA 2F3CE 3GDSA 1ZLRA 2ZCHP 4WF8A 4WJG2 1LHCH 2VIWA 3GOVB 1P0SH 1SGTA 3BIVH 2G8TA 3EA7A 1C5UA 2FX6A 3F0OA 1KDQB 4HI3A 2YMSC 4GUXA 2SGFE 1E34B 1QBOA 1O3NA 3KYFA 3RLWH 1CVWH 2ODYB 2HNTF 1AVGH 3F2HA 4FUIA 2ZWLH 2VBCA 1GPZA 1BUIA 1MTWA 1OWJA 3VB6A 4Z6AH 4KP0A 3VG8A 1IQLA 1E38B 3RU4D 4FUDA 1XXDA 2AMDA 4A5TS 5L6NH 1YGCH 1D3TB 1O2PA 1TGNA 3VXEH 1K1OA 4UEHH 4X2XA 2VIVA 3P6ZB 3SNDA 5GDSH 2ZU4A 4Z1MD 1C5TA 1Q31A 3BSQA 2JETC 1W3CA 1AO5A 3SI4H 2QF0A 1O5BB 3A7XA 4ABGA 7LPRA 1MU6B 1ELAA 5T6FA 5EW2H 1H4WA 1QGFA 1C5OH 1T8MA 4FOUC 1QQ4A 1IAUA 3LONA 1DSUA 4JZFH 4ZAEA 1WDIA 1O3OA 1FN8A 1NFYA 5SGAE 3LPRA 1CO7E 2FM2A 4RN6A 2WV4A 2EA3A 1ELEE 1F5KU 1A46H 1P02A 3SI3H 3TJNA 1GDNA 2R0LA 2Z3CA 1F0SA 1C2MA 1XUJA 3QDZB 1TA2A 5FCRA 5GNDA 4OM9A 2SFAA 1GMCG 3NZIA 2G00A 3AASA 5DP5A 3EA8A 4RKJB 4CRBA 1RTLA 4ACBA 2VVVA 1MTUA 1ZR0A 1C1QA 4BANB 1C4U2 4X8TH 3UNSA 5KEDA 1F0UA 2OC7A 1FI8A 3LH1A 3N7DA 1EZXC 1XUIA 1RTKA 2P16A 1AB9C 1GJ7B 2HOBA 1C5MD 3RMOH 1P2KA 1Y5AT 3UOPA 1ARBA 1AFQB 4FUBA 4D8NA 1LCYA 1PYTD 5C1XA 4I32A 4OS4A 1KTSB 4AORA 4HG6A 2BY7X 2I6SA 3F9HA 2GV6A 1PJPA 3LGUA 5DJ7A 2M2AA 5I46H 2KCAA 2ZDMA 1PQ7A 4TSFD 1SOTA 5C1YA 3E0NB 1YP9A 1BTXA 3S9AA 1FMGA 3SJ9A 5ETXA 1T32A 1SVPA 3VGCC 2BY8X 2NU3E 1GBCA 2PKAB 2GGVB 2O8UA 3ESTA 1O2ZA 1S0RA 3DFLA 4X1PU 1GBHA 2WUCA 1FDPA 1EZUC 1CGIE 2BD5A 2WPDD 1DS2E 2GTBA 1W0ZU 1ZRBA 5H4IB 2QIQA 1V2PT 2BVSH 4GCHF 4A1XA 2BDCA 3OEHD 3VB3A 1DT2A 5C5OA 1G32B 4FU7A 1HJAB 1GI3A 1GJ8B 5LH8A 4NFEA 1CE5A 2WHXA 2OC1A 3NUMA 2IOTA 1UO6A 1LQDB 2Y7ZA 1EATA 3KYGA 3RP2A 1C1SA 1HIAA 2FESH 1SG8B 1TRNA 2ESTE 3P92A 3H09A 1AWHB 2PSXA 1H9LB 2P3UB 1O2KA 1TNGA 2ZTYA 4XSKU 3RXOA 4XRNA 1O2VA 1ACBE 1C2GA 1DY8A 1VCQA 2H1UA 3ZZ7A 1IQKA 2BY5X 1C5VA 1DSTA 4U30A 3E3TA 3LDXH 2VNTA 1XKAC 2FODA 5HM2A 1SI5H 3BTHE 1OP8A 3RXCA 9ESTA 1IHTH 4YLUA 1NESE 4YOGA 2A5KA 1S6LA 1G36A 4JZ1A 1GHAF 2GZ9A 4Y71A 1O3BA 3BEUA 1O34A 1XUHA 3DSPA 4X1RU 1NRNH 1ELBA 4O3UA 1HAXB 1NRPH 1C2LA 1EUFA 4I31A 1L1NA 1O2QA 3TJOA 1EFRD 1NFWA 3DSGA 4NA7A 1K9OE 1L4ZA 6LPRA 5JDUB 4AFUA 4Q63A 3RXQA 1ZTJA 4NWKA 4YXWD 4R0IA 3PMJA 2ZNKH 5GPIB 2BY6X 2KCYA 3SJOA 1BIOA 1PPEE 2J95A 1SGIB 2FS8A 1UK2A 4GCHG 2VH6A 1M9UA 2TGAA 1YCPM 3OY5U 3U8TH 4DY7B 2ULLA 2A4GA 4J2YB 3RXPA 3CP7A 5EW1H 1K1PA 1THPB 1UTOA 1O2JA 2ODPA 3M61U 3GYLB 1CU1A 1GI8B 1V3XA 3UWJH 5KECA 1VCPA 3W1EA 1ETSH 1QL8A 3ATMA 1S84A 2CF9H 1EQ9A 4NZQA 5C2ZA 3RDZA 4H42U 4K60A 2UWPA 2TGTA 1X7AC 3M36A 4X6MA 3DUXH 1O2TA 2GDDA 1UCYH 4FU9A 1KXDA 2ZTXA 5CMXH 1RXPA 1NZQH 3M5OA 1G3BA 1LDTT 1NRSH 2ILNA 4ABEA 1GHWH 1YF4A 5DP8A 1QR3E 4B2AA 1NS3A 5BRRE 1OSSA 2B0FA 1JIMA 1GHAG 3SORA 1FNIA 2BLWA 4JZIA 1VCWA 1AE8H 1HAVA 3E90B 2R2MB 2GP9B 3ELAH 4I8KA 5F8TA 2G52A 1AMHA 5TCCA 4ABFA 1T8LA 1UTNA 1T31A 4AFSA 4K8YA 4Y8XA 1FIZA 2EEKA 2J98B 3WW7A 2HWLB 3EQ0H 2ANKH 4Y8ZA 1E79D 1E1QD 2QN5T 4KTSA 2HNTE 3F3BA 4AG2A 3F9EA 1K1LA 4BTIB 1SHHB 1MH0A 4Q7YA 1C5WB 1GI5A 5C3NA 4M7GA 1SQAA 2A4QA 4D7FA 1A0LA 1AZZA 1MD8A 1MD7A 2GX4A 3MWIU 2NU4E 1TABE 3F9FA 1A5IA 1H8DH 7KMEH 2SGEE 5C0UA 2QV1A 3ZVFA 1HJAC 1LPZB 1VITH 4ZKOU 2BOKA 1GG6B 4ABJA 1V2KT 4SGAE 2ALVA 2VWMA 4A1TA 1KXEA 2C90B 2J9NA 3SU3A 3KHVA 3RC5A 3LOXA 1BBRH 1MAXA 5F8XA 3KQBA 4OS5A 1CA8B 1NROH 5C1UA 3A88A 4Y8YA 1NU9A 3GICB 1C2EA 2Z6BD 3BTDE 4OS1A 1FPHH 1CGHA 2GCTB 2GKVE 2SGQE 5FX6A 1BTUA 3A81A 4ISIH 1H8HD 1P9UA 1NBME 3QUMP 4IN2A 3HATH 3T29A 2HLCA 3OFND 1G2MA 1GJ4H 4ISOA 1F0RA 1MBMA 2GT7A 1BMMH 5B6OA 1EASA 4ZHAA 3RXKA 3UNRA 4AX9H 1GJ9B 2XTTB 1P03A 1P2MA 3TJUA 1NY22 2ZEBA 3D62A 4WH8A 1BTHH 4X6NA 1OP2A 3UWIA 1O35A 3SUGA 2Q1JA 3B9FH 1GHBG 2A5IA 1GVKB 1ZSJA 1KLJH 4YESB 2KAIA 3SU1A 4AGJA 1BRAA 1Y3VA 1GVZA 8LPRA 5FL7D 3KF2A 5AFZH 1RD3B 3RXFA 1C2FA 1BJVA 1OKXA 3SV7A 3QX5H 2FI4E 1O2LA 5E2PA 4ABHA 2EI8A 1TPPA 1Y3XA 2BX3A 1TMBH 3K6YA 3MU1A 2YMSB 3BN9A 1IQMA 1HJ9A 1F7ZA 5EQQA 1P09A 3O8RA 2FLRH 1THSH 4MVNA 4XOJA 2RA3A 3KQ5A 3I29A 2OTVA 5EXLA 3T28A 4B1TA 2XXLA 4I8GA 4TYDA 2FOMB 1D6RA 4FUFA 4WMFA 1SHYA 2GCHF 4GAWA 4XBBA 4CRFA 2OXSA 4K1EA 1T7CA 3E16B 3GY5A 2ZDLA 4ZXXH 1TALA 3UQVA 5GJ4B 2Z3EA 3ATIA 1MTVA 1P2OA 2JETB 3AVZA 4NCYA 1HAOH 1PPFE 2NWNA 3ODFA 1MKWK 3URDA 2BDAA 2FOCA 4X1QU 5FBEA 2Y5HA 1O38A 3PLPA 3SUFA 2W5EA 1GL0E 1W12U 1V2NT 2ZI2H 3GDUA 1HCGA 3A82A 1L1GA 1TPOA 3ZZBA 3MQKC 1LVYA 2BQ6B 3RMLH 3MO9A 3DCLA 3HKJB 1JRTA 4AN7A 2P94A 2QA9E 1SGNE 3PLKA 1EZQA 1ZGVA 4GSOA 3Q3YA 4E05H 1GBAA 3FP6E 1OWIA 5DP6A 1C1NA 2F9BH 4AZ2B 2BB4A 3PRDA 3U9AH 4E7RG 3RXIA 3TNTA 1AUJA 2KCPA 1NO9H 1XM1A 2FYRA 3MH4A 2Z9GA 3IITA 1LHDH 1FZZA 2PV9B 3T26A 1DDJA 1VR1H 1YKTA 2IJOB 2A1DB 1OX1A 1BTZA 3PTNA 3FZZA 3ZYDA 1TQ0B 1TGTA 2VWNA 1O39A 2ZDNA 2ZFFH 3TK9A 4AGKA 4F48B 3UOUA 1AQ7A 1HFDA 1SLXB 2Z9JA 3SNEA 5C17A 1CSOE 5ESTE 2FMJA 2JIZD 3QZRA 3U98H 3SV6A 1SKYE 3P8FA 5GXPA 3RLYH 1GBLA 7GCHG 1GG6C 4BXSA 1UTPA 2GCHG 3V13A 2IN2A 3SNBA 4YOIA 1HAIH 1O3CA 2ZG0H 4NIWA 1C4V2 3SJKA 2BD9A 5L30H 4X2VA 2LP6A 1GJ6A 3V7TA 1EJAA 3ITIA 3MHWU 1VITF 8ESTE 3ZIAD 1LQEA 4FUCA 4Q7ZA 3UR9A 1ELDE 1HPGA 1O2XA 1A5GH 4QT8C 5L2ZH 4XFQA 2JDID 1C1MA 1C5LH 1VJ9U 1YLCA 2QY0B 4ISHH 1P10A 1DFPA 2GZ8A 3MI4A 2JH0D 3M7QA 4IBLH 1MQ5A 5T6GA 2PWXA 2PGBB 1ETTH 3PV4A 2UUKB 2ZPQA 5LPFA 3M5LA 1RJXB 1IQFA 1O3DA 3DA9B 3KGPA 3PMBB 1EP6A 1BTYA 4Y79A 1BT7A 1O3IA 1QJ1B 4FUHA 3IG6B 3TH4H 3A87A 4DT7B 2ZHQH 3PYHA 2I6QA 4A92A 4A7IB 5EOKA 1S6HA 1GCTB 1NRQH 2Y7XA 4INKA 3H5CB 3QGNB 1ANEA 3RXJA 3F68H 3A7ZA 1ZMLA 3FN8A 1DWCH 1MTNB 2OQ5A 3UNQA 4LXBH 1DUAA 1G37A 1JIRA 1GJBB 1BRCE 1WYKA 2Z94A 1AHTH 1LVMA 1P04A 1YPJH 1YCPK 4IMZA 2ZU3A 1DWDH 1A3BH 2K0QA 2OC0A 1MKXH 1EOJA 1C5SA 4B6FA 4AOQA 4RKOB 2V3HH 3ZVDA 2J5UA 2ZHEH 5BPEA 3QWCH 3O8BA 1ELCA 2H9HA 1D6WA 3A7YA 3UR6A 1N6XA 4DW2U 3A8CA 3N99A 1H9IE 1W8BH 3OTJE 2EI7A 2BHGA 3SNAA 1FX0B 3E6PH 4IN1A 1S85A 4RSPA 1FAXA 1PPCE 3RM0H 2A7HA 1NM6A 2K1QA 2AGEX 1C2IA 1KYNA 4TWWA 3RM2H 2V3MA 1TRYA 4Y7BA 1VITG 2P95A 3HK6B 1EAWA 2ZA5A 1C2HA 4KTUA 1AGJA 3HPTB 4JZEH 4X2WA 4E7NA 1TOCB 5FX5A 3GCNA 2VWLA 1EJNA 1GI0A 3Q3XA 5C5NA 2XC4A 1D3QB 1D3PB 1SQOA 2H9TH 1OXGA 4P00A 1YPGH 5DP3A 2XYAA 2ZFTA 1S82A 3STJA 2FP7B 3VB4A 4DURA 4HZHA 1O32A 3MNCA 1ZHPA 2B7DH 2O8WA 5ESBA 2BXTH 4FVDA 5AFYH 1O3FA 4BNRA 1QJ7B 2AMPA 1B0FA 1A0HB 4H6TA 4MQAA 3TH2H 4MTBA 1SOZA 2Z9LA 1W7GH 3C27B 1BJUA 1V2JT 3QN7A 5E2OA 2PKAA 2Z7FE 1ZSLA 5GWZA 1SFQB 3ZZDA 3SYJA 4BOHA 1IQGA 4DCDA 3BV9B 1GJAB 1XVOA 2ZU2A 2D2DA 3A7WA 1WOFA 1V2OT 2ZDAH 2FO9A 2CN0H 1ABJH 1SC8U 3M5MA 1O5GH 2H6MA 1UVPA 2F91A 2PTNA 1G3CA 1AI8H 1SLUB 1ZMJA 3VFEA 1ZSKA 1ZOMA 2Y82A 4ZKRU 2HLDD 4X1SU 1QA7A 1MQ6A 1NRRH 2QYIA 3EE7A 4CR5A 2XW9A 1EX3A 2EQNA 5A09A 5HYOA 4B76A 4O97A 3WWBA 4A1VA 4D9QA 1C5ZB 1W7XH 3PV2A 4NFFA 5A2MH 1BMNH 1FV9A 2F9NA 4ZKNU 1GBJA 3LIWA 2PSYA 4SGBE 4Q7XA 2G55A 1CHGA 1C1VH 1FIWA 3SGAE 1O2OA 2OC8A 1AWFH 3P8GA 4WMEA 1YY3A 1AKSB 3HK3B 1A3EH 3Q77A 3STIA 3FP7E 1UHBB 3AW0A 1IQHA 1J15A 3P8NA 3TGIE 1HB0B 4WY3A 1TNIA 3A8AA 5EXNA 4MLFB 5DO4H 1DPOA 3DSOA 3A84A 1V2QT 2Q6GA 1C1RA 3K65B 2BD8A 1ELVA 3TK5A 5A8YA 5JBAS 1ELTA 4TY6A 4Y0YE 1DITH 1DLEA 1GCTC 3PM3A 2CHAB 3KNXA 2BD4A 3PTBA 4IMQA 3RU4T 1MTNC 1NFXA 3MU4A 1GWAA 1SLWB 1A7SA 1SR5C 1D4PB 2AFQB 3M3SA 1NPMA 1F5LA 5IDKA 4YT7H 3UQOA 1N8OB 2PHBA 1P8VC 1UCYE 1SGPE 1YPMH 1JBUH 1XX9A 1MBQA 5DP4A 2ZECA 2TRMA 1QRXA 1WSSH 1QQUA 1KMHB 1MMJN 1QBNA 2Z9KA 3TH3H 1TNKA 4CBOA 1CA0B 2CV3A 1A1RA 3U8RH 2W7UA 1UTMA 3BG4B 1GHYH 2L6OA 3KQDA 4MNYA 4B71A 4XBDA 2AGIX 4B74A 4CHAB 1NFUA 1LPGB 5DP7A 1C1WH 3LU9B 2RDLA 3SU6A 5A0CA 1CBWB 3QGJA 5F6MA 1Z7KA 1T4VH 1OPHB 3V12A 2ALPA 1QURH 3A8DA 1HAHH 5K0HA 4ZHMU 4NSVA 3SZEA 1XXFA 3FANA 1O2GH 1LVOA 1GBBA 3E0PB 2FOBA 3S7HB 3FOAA 4X1NU 1GI4A 3PROA 4AFZA 3AAVA 3K6ZA 2ZDVH 3OE7D 1GBFA 3QTOH 2EI6A 4WMDA 3D49H 2ZF0H 3TNSA 2QF5A 5EGMA 1ZYOA 2EY4C 1S81A 1K1JA 2BXUH 2YOLA 3L6PA 2J98A 2VVUA 2TGPZ 5DG6A 1HAZB 1TBRH 1BBRE 3CENA 4YTAA 3MO6A 1O3PB 1EB1H 1YPLH 2IPHA 5G4BA 2PLXA 3M37A 4KELA 2PW8H 3EA9A 3BTME 4ZMAH 2W3IA 2ZGHA 2G5NA 1V2WT 2XC5A 2KX4A 5EU8A 5JB9S 2P59A 1GL1A 1NBMD 1GMHG 1MU8B 4X8SH 2Z3DA 2QXGA 2P3FH 1WTHD 1KTTB 1VJAU 1WUNH 2SNVA 3UFAA 2BDBA 1XUGA 1HJ8A 2GT8A 2TPIZ 1GHBF 3LJJA 4MPUA 1UTQA 1C1UH 1THRH 3KN2A 4NA8A 4GPGA 1PQ5A 1GBEA 1S5SA 2BDGA 4ACAA 2VIDA 5F8ZA 5EJLA 3MU8A 5J4SA 1L0ZA 2UWLA 1NC6A 5HGGA 5FCKA 3SQHE 3ENSB 3UREA 5A0BA 1EZSC 1FONA 1G30B 3AAUA 1TBZH 2H5CA 1O5FH 4K8BA 1SB1H 3DD2H 4H4FA 4AYYB 4FETA 3GY7A 1GDQA 1O0DH 3UY9A 2FI3E 2J4IA 3PWCA 1DLKB 3FAOA 1B5GH 3IWMA 1Y8TA 3HGNA 1SGDE 4K3JA 1C5NH 1E37B 1VGCB 4MPVA 2ODQA 1C9PA 4DGJA 2SGAA 2R0KA 1CQQA 4XD7D 3P70B 2ANMH 2C3SA 4FUJA 1P2JA 4UDWH 2BDHA 2BMGB 2WSSD 3BTTE 1ZTLA 5GCHG 1HNEE 1MZDA 1UVTH 1O2RA 3M35A 2SNWA 2CXVA 2VJ1A 3LGTA 2CHAC 4HGCA 2V6NA 4I7YH 1FY8E 1ANDA 2J38A 3S0NA 2KZ4A 4OS7A 2O9QA 3PO1B 3H7TA 1N8OC 1SFIA 3PRBA 1QNJA 2HPQH 1IQEA 5JB8S 1Y5UT 4OS6A 2GZ7A 1CT2E 1Z8IB 1DOJA 1AIXH 5GIBA 1JXPA 3ATLA 1AVWA 2AH4X 1IQNA 1EAUA 5F03A 2BOHB 2R9PA 1HDTH 3MU0A 2WINI 4NIXA 4NIYA 1CA0C 3P8OA 1TNLA 3OTPA 5AF9H 2XC0A 3BG4C 3RC6A 4F49A 2BTCE 4CHAC 1LKBA 3L3TA 5DPAA 1OWDA 2Y6TA 4IW4E 5AHGH 2A32A 1CBWC 3GCHB 3ZZ3A 1XUKA 4CH2B 1DWBH 1G3DA 3TLOA 1E36B 2JKHA 2FDAA 1HBTH 1T4UH 1P05A 1TMUH 1Z6JH 4THNH 3VB5A 3TPIZ 2R3YA 2ZHWH 4WXVA 2AIQA 1QL7A 4CH8B 2KCOA 2FXRA 4FU8A 2ZU1A 3AK5A 4KKDA 1O2UA 3O8DA 1CGJE 1O3EA 2B5TB 3MH5A 3EYDA 1BCUH 2OQUA 1ANBA 2VVCA 5EQSA 3BTGE 1RIWC 3SZNA 2OCVB 3CS7A 7GCHF 2FTMA 1BTPA 5C94A 4RT0A 2IJD1 2C4FH 4Q80A 1IOEA 1J16A 2HGTH 1DXPA 1C1OA 2OINA 3P95A 4OGXA 4KGAA 2P3TB 4MNVA 3GY2A 3FVFB 3F2GA 2UUFB 1ANCA 5EJZA 1VKYA 1AUTC 2ZQ2A 4AB8A 4NWLA 5TCAA 4WH6A 1AE5A 2GJGA 4AB9A 1C1TA 2XCNA 3A89A 1SBWA 1O3GA 3BTKE 3NXPA 3SO3A 3WY8A 3LGYA 2RCEA 4OS2A 4NG9H 4TT3D 4WXIA 1E35B 3HKIB 2AHME 1DY9A 4BXWA 4I86A 5KGOA 2BVRH 4ASUD 2HVXA 1W0KD 2AERH 1L2EA 1O5DH 2ZGCA 3RMNH 3OAAD 2HRVA 1TYNA 2UUJB 4Y7AA 1UK3A 1WV7H 1H9HE 2DE9A 3Q3KA 3U1IB 4IGDA 1W13U 4JYVH 1Y3UA 1W2KH 1A5HA 1AD8H 3FO8D 2LELA 2J2UA 1EPTB 2A2QH 5CE1A 1KXBA 2XBWA 4JYUH 2A4OA 3BEFB 4K5ZA 2Y81A 4DJZB 1FY3A 3TGJE 2R3UA 1COWD 3I77A 1F0TA 1Y3YA 2K8IA 1C5RA 1OYQA 3LJOA 4WWYA 3RXTA 3SU4A 1TWXB 4GLYA 3UTUH 3QO6A 3RXLA 1JRSA 3T5FH 3MFJA 3RC4A 2QF4A 2W6JD 2BD3A 3SW2B 1NTPA 1QB6A 3SJ8A 1VGCC 4PROA 2C8XB 3KL6A 4IS5A 3SGQE 5EPYA 4I8HA 5LPEA 2AEIH 2NU1E 1C2DA 3RXHA 1UTJA 6GCHF 2FI5E 5JBTA 4ISNA 3SU0A 1C9TA 2YNBA 1PPZA 1LTOA 2H9EH 3B23B 3QK1A 5C67A 1C2JA 1RGQA 1Y3WA 3NCLA 2ZPRA 2V7QD 1WU1A 2HVYB 2BM2A 3MOCA 1BZXE 3LC3A 1UVOA 3PO1C 2PFEA 3ZZ5A 1MABB 1HXEH 3RXMA 3ZZ9A 2FPZA 4YLQH 4R8TB 1DICA 3RXGA 4CBNA 3V0XA 1OWHA 2VIPA 1Q2WA 1TGSZ 3PMHB 1GBIA 1O2HA 2PKSB 1WQVH 3BF6H 3MNBA 2NU2E 1XMNB 2RA0A 1EP5A 3P17H 5E0HA 1K22H 1O36A 3ZVBA 1YWUA 2F4LA 2M5TA 1ORFA 3F2FA 4RI0A 4UE7H 1GGDB 5A0AE 3I78A 4M9FA 1O2IA 1P2NA 1XKBC 2BQ7B 3RXUA 3DT0H 4BAKB 1O3HA 2ZHDA 3U1JB 1O2YA 4ABIA 1LPKB 1Z71A 1YLNA 1LHGH 1RTFB 3G01A 1AY6H 3GCHC 4AFQA 3LKWA 3SBKA 2HPPH 5CHAB 3SQEE 1UVUH 2J97A 5DSFA 1YPKH 1HGTH 2A5AA 5JBCS 2HALA 7ESTE 1GI6A 4ZROA 3SNCA 5T3HA 3MMGA 3W94A 2VH0A 5IK2D 4NSYA 1GHXH 2V0BA 4GHTA 2W7SA 3BTEE 5L2YH 2BD2A 3OY6U 2ZO3H 1G3EA 2H2ZA 1ZPCA 3UB0A 4CR9A 1TX6A 5DK1A 1GI1A 4IC6A 2YMSD 3ZVCA 1HAYB 1ELGA 2FWWA 2G4UA 3BEIB 1LO6A 3RMMH 3KQEA 2FOEA 6GCHG 1UK4A 5ABWA 1DXWA 3AW1A 2DUCA 1V2TT 1CT0E 4TWYA 4Y76A 4YM9A 3KIDU 2C93B 1L4DA 3EAJA 4ZHLU 1QY6A 1YPEH 1D3DB 1ZPBA 2VWOA 1C2KA 5FPTA 1DUEA 1MKWH 3T2NA 2STAE 3W95A 1DWEH 9LPRA 4BAMB 2GDEH 2TBSA 1Z6EA 5HMAA 1KIGH 5E0GA 3QLPH 3VB7A 4ABAA 2WZQA 1FPCH 2VIOA 1W0YH 2ASUB 3K9XB 2R2WU 4WVPE 3NPSA 1RS0A 1UTKA 1SGYE 3JZ2B 2ZFPH 4U01A 1FLEE 4E06H 3LC5A 2STBE 1O31A 2XNDD 2QCYA 5AVDA 5EPNA 1WXRA 1DE7H 1OYTH 1V2RT 1IHSH 4BTUB 1P57B 2XCFA 2O8LA 3E8LA 1P2QA 3F1SB 1HXFH 2FTLE 2F83A 2BLOA 1MCTA 1EPTC 2AGGX 3LGIA 1J14A 1P12E 1CT4E 1FN6A 2UWOA 1PQAA 3LGWA 2FZZA 3M7UA 4FVBA 3GISB 3NK8A 2Q6DA 1AN1E 1FAKH 1XUFA 2PP6A 5CHBA 4ISLA 4JK6A 3GY3A 1A4WH 1A61H 1W14U 1TONA 2FEQH 1LHFH 1AKSA 1DVAH 3MTYA 4CRGA 3RXAA 3V3MA 1UHBA 2GV7A 2UUYA 4Z0KA 4B2BA 1UJ1A 2ZC9H 5EXMA 1TE0A 2CK3D 4A6LA 4VGCB 2V35A 1O5CB 1SGFG 8KME2 2B9LA 1WCZA 1ELFA 2ANYA 3SV2H 1O33A 3PMAB 1K2I1 1LMWB 1PYTC 1YC0A 2FOFA 3SHAH 2A0QB 3JZ1B 2QE7D 2Y5FA 3ZV8A 1GBKA 4ABDA 1UCYK 3U69H 1K1NA 3SU5A 1SL3A 1BOQA 2W26A 2PR3A 2WPHS 3FP8E 3KCGH 4MG3A 4DIHH 3B8JA 1YLDA 2ZCKP 4B2CA 3RU4E 5EQRA 1TB6H 2A4RA 4P02A 5T6DA 3C1KA 1F2SE 1QIXB 3M3VA 4KTCA 3EE0B 3A8BA 1EXFA 2GMTB 2QXIA 2TIOA 5DGJA 4DVAU 1GCDA 2PKSC 2P8OC 3GY8A 4ZKSU 1HLTH 2BY9X 1BHXF 1JOUB 1A0JA 3ZZ4A 1GGDC 4ZCNA 2NU0E 1J9CH 1TBQH 1HV7A 2XWAA 1UTLM 3Q00A 4UD9H 3U28C 2QXHA 3GCOA 3VXFH 2OBQA 1V2LT 2L74A 1BRBE 2ZPSA 4I33A 5CHAC 1P01A 3WWFA 2F9VA 4TPIZ 1MAYA 2XNIA 4NA9H 1ZRKA 4F55A 1T8NA 2WPMS 3RXRA 1HRTH 1OWEA 1YCPH 4B75A 4HFPB 3BIUH 4BAHB 2ZGBH 1BHXB 1EOLA 3K2UA 3KQCA 1BRUP 4MNXA 3ZZAA 4D9RA 2ZP0H 3ZYEA 4ESTE 4BTTB 3SUEA 1BA8B 1ZJKA 1GI2A 3MYWA 1QHRB 5LPRA 4JK5A 4UONA 2A45B 1LVBA 5F53A 1V6DA 1S6FA 3TVJB 1GMHF 1ETRH 2B8OH 3DHKH 1BBRK 3M7TA 2O8MA 4NIVA 2QAAA 2OUAA 2OK5A 3VEQB 3FFGA 4Y11E 3SGBE 4K1SA 1RFNA 1KSNA 3FZDA 2G51A 2XBXA 3A85A 1YPHC 1K1MA 1WAYB 1GI9B 4JMYA 4O3TA 1L1JA 5K7RA 2ZFSA 4CRAA 1P06A 2A7CA 2BD7A 2ZZUH 1N6YA 2RDEA 2AIPA 1V2ST 6ESTA 1FXYA 3EDXB 2BYAX 4XDEA 1QB1A 2VB0A 1KLIH 3MH6A 2VU8E 2J92A 1OS8A 2OLGA 4DT4A 4LZ1H 2ZGXH 4Y10E 3NRLA 1QRZA 2ZFRH 4NZLA 4U2WA 1G2LA 5J4QA 1HIAB 6CHAB 3F0PA 1BDAA 2VGCB 1W10U 5PTPA 1EJMA 2HNTC 1ESBA 1ABIH 1O5EH 1RIWB 1E1RD 2W6ID 1K1IA 2PTCE 4MPWA 3SOSA 4D76A 5GCHF 3S9CA 4Y6DA 1FUJA 1IQIA 1TRMA 2DE8A 2G5VA 5HKKD 3FKSD 1PQ8A 3S7KB 2FOHA 1EAIA 5JYIA 1GHZA 1SQRA 2WPKS 2JH5D 5FHTA 4CREA 5HXFA 1PPBH 2JJ1D 5FAHA 1YYY1 1QRWA 5A8XA 1O30A 1TX7A 1GHVH 5IYTA 2THFB 1GDUA 1MUEB 1QA0A 1B0EA 4INLA 2JJ2D 4X2YA 1CHOF 1FQ3A 1P3CA 1SGQE 1PFXC 4Q2KA 4Y0ZE 1TAWA 1Z8GA 4UFEH 4VGCC 4ASHA 5LGOA 2QXJA 2OP9A 3MH7A 2XWBI 2BLQA 3ZV9A 1IQJA 2A7JA 3KEEA 1C5PA 4ZH8A 3OU0A 3A7VA 1INCA 1SSXA 2W3KA 3TU7H 5C20A 1AFQC 2F9UA 1C5QA 4ZUHA 1QL9A 1EKBB 2CMYA 1YPHE 5E0JA 1SPJA 1GJ5H 4J1YA 3SV9A 2WUBA 1KXAA 2BDIA 2D8WA 1Z1IA
chains in the Genus database with same CATH topology
1ZHMA 2LPRA 4ZXYH 1MTSA 3ZVEA 4FXGH 5A8ZA 3OX7U 1SGRE 1U6QA 2ANWA 3A80A 1Z8JB 4INHA 1TQ7B 3GY6A 3N7OA 1H8IH 3ZZ8A 2OD3B 1SQTA 4JCNA 3T25A 2GMTC 2VIQA 1QBVH 1GBMA 1TOMH 1XVMA 2FX4A 2ZHFH 4MDSA 2JH6D 1MZAA 1D9IA 1V2VT 1TFXA 3RXEA 1HAGE 1TPAE 4AYVB 4LK4A 3GCTF 3UIRA 3BTQE 2V3OH 2RG3A 2VINA 1NT1A 1J17T 2XBYA 1C1PA 3F6UH 1FY5A 4FUEA 2BVXH 2FLBH 1O2MA 3QTVH 1HAPH 3OYPA 1GJCB 1QTFA 3Q76A 2G4TA 1HYLA 2J94A 3TIUA 1GMDF 1BITA 2ZGJA 1F5RA 4U32A 3SV8A 1HAVB 1SLVB 1LHEH 2BX4A 3LH3A 2BZ6H 1O3LA 2H5DA 3MO3A 1QJ6B 3E91A 3L33A 5DKMA 1T8OA 4UFFH 1P3EA 3ODDA 1CHOG 1C4Y2 4B73A 1O2SA 1QB9A 1DX5M 1HUTH 3D65E 4X8UH 3NWUA 1SGEE 1S83A 1S0QA 2AMQA 3GDVA 1WQSA 2BQWB 4JZDH 1ZZZA 4LOYH 3ZVAA 2QF3A 1WTGH 5FBIA 2SGPE 2C8WB 2Z9IA 1ESAA 4DOQA 1B7XB 1ZHRA 3A83A 2Y5GA 3DFJA 1Z8RA 4O03A 3BTWE 4YT6H 4LZ4B 4O9VA 1F92A 3O8CA 2ZIQH 2WV5A 1FJSA 4CRDA 3MU5A 2BZAA 3TGKE 2CGAA 3LT3A 1O3KA 3CS0A 1ID5H 1KXCA 1BTWA 5JPMH 3GYMA 1K28D 2O8TA 4IC5A 4CRCA 6CHAC 1SMFE 2VGCC 1ZGIA 1FY4A 1TMTH 1O3JA 1P9SA 4ABBA 4TPYA 2ZU5A 1UVSH 3GCTG 1OWKA 4AG1A 4GVUA 2XRCA 1GBDA 2Q6FA 1QCPA 2ZTZA 4TY7A 1EB2A 1E0FD 2P93A 4H6SB 2OBOA 3SU2A 1EPTA 1TX8A 3BTFE 2FIRH 4GHQA 1KLTA 1MKXK 2ZDKA 1SGCA 3F9GA 1TIOA 3PLBA 4FUGA 1YM0A 3OSYA 3MNSA 1GMDG 1UMAH 4K1TA 2WYJA 1H1BA 1WBGB 2WPLS 3SJIA 4UFGH 5E8EH 2KAIB 1AZ8A 4YO9A 3QZQA 4MPXA 4BAOB 1AFEH 2TGDA 2GD4B 3MNXA 5FPYA 4I8JA 4XE4A 1O37A 1P2IA 1TNJA 3HGPA 2FYQA 1MCVA 4I8LA 1TPSA 2FOGA 1GVLA 2Y80A 1PPHE 2PGQB 3R3GB 1ZMNA 2G81E 2SGDE 3SN8A 1GBTA 3SUDA 2C8YB 4OGYA 5FPSA 3RXVA 1C5YB 1YBWA 1O5AB 3RUOA 1TLDA 3T62A 3RXSA 3R0FA 4F4OC 1C5XB 3UPEA 4BAQB 1AVXA 3TJVA 1J8AA 3S69A 1DM4B 2LNCA 3S9BA 2C8ZB 1K21H 3URCA 1Y5BT 1DANH 1OP0A 3M3TA 5EG4A 1Z1JA 2PUQH 1RRKA 2CF8H 3EGKH 4X8VH 1EAXA 4YOJA 2BLVA 3E1XB 1NN6A 1KXFA 4XBCA 1OOKB 3A86A 8GCHF 1NU7B 5JBBS 2WPJS 1JMOH 3BG8A 3U8OH 5HM9A 4UFDH 1LKAA 3SHCH 1N1LA 3RXDA 1Y59T 1AB9B 1O2WA 2F9PA 2AYWA 2YNAA 1TNHA 3M5NA 1O3MA 2WPIS 2AS9A 4MNWA 1GJDB 3GY4A 3TITA 1TA6A 1G9IE 1W11U 3ZVGA 1TGBA 3VPKA 1VZQH 3ATKA 1FY1A 1TGCA 3UUZA 1ZJDA 2WYGA 2XBVA 5I25A 2F9OA 5DP9A 3PWBA 2P8OB 4X6PA 4X0WU 4K2YA 1AU8A 4HTCH 3H7OA 2D26C 3A7TA 3TK6A 1A2CH 3VGCB 2A2XH 3LGVA 4X6OA 1BMAA 2GCTC 1V2UT 1PPGE 5TJXA 4D7GA 1Q3XA 2ZCLP 5EODA 1V2MT 3ZZ6A 1KDQA 3ATWA 1BMLA 1KY9A 2ZQ1A 1O3AA 2D1JA 2QC2A 3NKKA 2QGRA 4K69A 2A31A 1QFKH 1GI7B 1ZPZA 1BQYA 3PB1E 2BDYA 2FS9A 1JWTA 3T27A 2FOAA 4DG4A 1GMCF 2EC9H 1P11E 3ZZCA 1SGFA 2PUXB 4DIIH 2GVFA 4NGAH 1ZTKA 1O2NA 1BB0B 3RXBA 2J34A 4YZUA 5FXLA 1ESTA 4JYTA 3D23A 2ZFQH 2CJIA 2ZKSA 8GCHG 1ARCA 2F3CE 3GDSA 1ZLRA 2ZCHP 4WF8A 4WJG2 1LHCH 2VIWA 3GOVB 1P0SH 1SGTA 3BIVH 2G8TA 3EA7A 1C5UA 2FX6A 1KDQB 4HI3A 4GUXA 2SGFE 1E34B 1QBOA 1O3NA 3RLWH 1CVWH 2ODYB 2HNTF 1AVGH 4FUIA 2ZWLH 1GPZA 1BUIA 1MTWA 1OWJA 3VB6A 4Z6AH 4KP0A 1IQLA 1E38B 3RU4D 4FUDA 1XXDA 2AMDA 4A5TS 5L6NH 1YGCH 1D3TB 1O2PA 1TGNA 3VXEH 1K1OA 4UEHH 4X2XA 2VIVA 3P6ZB 3SNDA 5GDSH 2ZU4A 1C5TA 1Q31A 3BSQA 2JETC 1W3CA 1AO5A 3SI4H 2QF0A 1O5BB 3A7XA 4ABGA 7LPRA 1MU6B 1ELAA 5T6FA 5EW2H 1H4WA 1QGFA 1C5OH 1T8MA 1QQ4A 1IAUA 3LONA 1DSUA 4JZFH 4ZAEA 1O3OA 1FN8A 1NFYA 5SGAE 3LPRA 1CO7E 2FM2A 4RN6A 2WV4A 2EA3A 1ELEE 1F5KU 1A46H 1P02A 3SI3H 3TJNA 1GDNA 2R0LA 2Z3CA 1F0SA 1C2MA 1XUJA 3QDZB 1TA2A 5FCRA 2SFAA 1GMCG 3NZIA 2G00A 3AASA 5DP5A 3EA8A 4RKJB 4CRBA 1RTLA 2VVVA 1MTUA 1ZR0A 1C1QA 4BANB 1C4U2 4X8TH 3UNSA 1F0UA 2OC7A 1FI8A 3LH1A 1EZXC 1XUIA 1RTKA 2P16A 1AB9C 1GJ7B 2HOBA 1C5MD 3RMOH 1P2KA 1Y5AT 3UOPA 1ARBA 1AFQB 4FUBA 4D8NA 1LCYA 1PYTD 5C1XA 4I32A 4OS4A 1KTSB 4AORA 2BY7X 2I6SA 3F9HA 2GV6A 1PJPA 3LGUA 5DJ7A 5I46H 2ZDMA 1PQ7A 1SOTA 5C1YA 3E0NB 1YP9A 1BTXA 3S9AA 1FMGA 3SJ9A 5ETXA 1T32A 1SVPA 3VGCC 2BY8X 2NU3E 1GBCA 2PKAB 2GGVB 2O8UA 3ESTA 1O2ZA 1S0RA 3DFLA 4X1PU 1GBHA 2WUCA 1FDPA 1EZUC 1CGIE 2BD5A 1DS2E 2GTBA 1W0ZU 1ZRBA 5H4IB 2QIQA 1V2PT 2BVSH 4GCHF 4A1XA 2BDCA 3VB3A 1DT2A 5C5OA 1G32B 4FU7A 1HJAB 1GI3A 1GJ8B 5LH8A 4NFEA 1CE5A 2OC1A 3NUMA 2IOTA 1UO6A 1LQDB 2Y7ZA 1EATA 3RP2A 1C1SA 1HIAA 2FESH 1SG8B 1TRNA 2ESTE 3P92A 1AWHB 2PSXA 1H9LB 2P3UB 1O2KA 1TNGA 2ZTYA 4XSKU 3RXOA 1O2VA 1ACBE 1C2GA 1DY8A 1VCQA 2H1UA 3ZZ7A 1IQKA 2BY5X 1C5VA 1DSTA 4U30A 3E3TA 3LDXH 2VNTA 1XKAC 2FODA 5HM2A 1SI5H 3BTHE 1OP8A 3RXCA 9ESTA 1IHTH 4YLUA 1NESE 4YOGA 2A5KA 4JZ1A 1G36A 1GHAF 2GZ9A 4Y71A 1O3BA 3BEUA 1O34A 1XUHA 4X1RU 1NRNH 1ELBA 4O3UA 1HAXB 1NRPH 1C2LA 1EUFA 4I31A 1L1NA 1O2QA 3TJOA 1NFWA 4NA7A 1K9OE 1L4ZA 6LPRA 5JDUB 4AFUA 3RXQA 1ZTJA 4NWKA 4R0IA 3PMJA 2ZNKH 5GPIB 2BY6X 3SJOA 1BIOA 1PPEE 2J95A 1SGIB 2FS8A 1UK2A 4GCHG 2VH6A 1M9UA 2TGAA 1YCPM 3OY5U 3U8TH 4DY7B 2ULLA 2A4GA 4J2YB 3RXPA 3CP7A 5EW1H 1K1PA 1THPB 1UTOA 1O2JA 2ODPA 3M61U 3GYLB 1CU1A 1GI8B 1V3XA 3UWJH 1VCPA 1ETSH 1QL8A 3ATMA 1S84A 2CF9H 1EQ9A 4NZQA 5C2ZA 3RDZA 4H42U 4K60A 2UWPA 2TGTA 1X7AC 3M36A 4X6MA 3DUXH 1O2TA 2GDDA 1UCYH 4FU9A 1KXDA 2ZTXA 5CMXH 1RXPA 1NZQH 3M5OA 1G3BA 1LDTT 1NRSH 2ILNA 4ABEA 1GHWH 1YF4A 5DP8A 1QR3E 4B2AA 1NS3A 5BRRE 1OSSA 2B0FA 1JIMA 1GHAG 3SORA 1FNIA 2BLWA 4JZIA 1VCWA 1AE8H 1HAVA 3E90B 2R2MB 2GP9B 3ELAH 4I8KA 5F8TA 2G52A 1AMHA 5TCCA 4ABFA 1T8LA 1UTNA 1T31A 4AFSA 4K8YA 4Y8XA 1FIZA 2EEKA 2HWLB 3EQ0H 2ANKH 4Y8ZA 2QN5T 4KTSA 2HNTE 4AG2A 3F9EA 1K1LA 4BTIB 1SHHB 1MH0A 4Q7YA 1C5WB 1GI5A 5C3NA 4M7GA 1SQAA 2A4QA 4D7FA 1A0LA 1AZZA 1MD8A 1MD7A 2GX4A 3MWIU 2NU4E 1TABE 3F9FA 1A5IA 1H8DH 7KMEH 2SGEE 2QV1A 3ZVFA 1HJAC 1LPZB 1VITH 4ZKOU 2BOKA 1GG6B 4ABJA 1V2KT 4SGAE 2ALVA 2VWMA 4A1TA 1KXEA 2C90B 2J9NA 3SU3A 3KHVA 3RC5A 3LOXA 1BBRH 1MAXA 5F8XA 3KQBA 4OS5A 1CA8B 1NROH 5C1UA 3A88A 4Y8YA 1NU9A 3GICB 1C2EA 2Z6BD 3BTDE 4OS1A 1FPHH 1CGHA 2GCTB 2GKVE 2SGQE 5FX6A 1BTUA 3A81A 4ISIH 1P9UA 3QUMP 4IN2A 3HATH 3T29A 2HLCA 1G2MA 1GJ4H 4ISOA 1F0RA 1MBMA 2GT7A 1BMMH 5B6OA 1EASA 4ZHAA 3RXKA 3UNRA 4AX9H 1GJ9B 2XTTB 1P03A 1P2MA 3TJUA 1NY22 2ZEBA 3D62A 4WH8A 1BTHH 4X6NA 1OP2A 3UWIA 1O35A 3SUGA 2Q1JA 3B9FH 1GHBG 2A5IA 1GVKB 1ZSJA 1KLJH 4YESB 2KAIA 3SU1A 4AGJA 1BRAA 1Y3VA 1GVZA 8LPRA 3KF2A 5AFZH 1RD3B 3RXFA 1C2FA 1BJVA 1OKXA 3SV7A 3QX5H 2FI4E 1O2LA 5E2PA 4ABHA 2EI8A 1TPPA 1Y3XA 2BX3A 1TMBH 3K6YA 3MU1A 3BN9A 1IQMA 1HJ9A 1F7ZA 5EQQA 1P09A 3O8RA 2FLRH 1THSH 4MVNA 4XOJA 2RA3A 3I29A 2OTVA 5EXLA 3T28A 4B1TA 2XXLA 4I8GA 4TYDA 2FOMB 1D6RA 4FUFA 4WMFA 1SHYA 2GCHF 4GAWA 4XBBA 4CRFA 2OXSA 4K1EA 1T7CA 3E16B 3GY5A 2ZDLA 4ZXXH 1TALA 3UQVA 5GJ4B 2Z3EA 3ATIA 1MTVA 1P2OA 2JETB 3AVZA 4NCYA 1HAOH 1PPFE 2NWNA 3ODFA 1MKWK 3URDA 2BDAA 2FOCA 4X1QU 5FBEA 2Y5HA 1O38A 3PLPA 3SUFA 2W5EA 1GL0E 1W12U 1V2NT 2ZI2H 3GDUA 1HCGA 3A82A 1L1GA 1TPOA 3ZZBA 1LVYA 2BQ6B 3RMLH 3MO9A 3HKJB 1JRTA 4AN7A 2P94A 2QA9E 1SGNE 3PLKA 1EZQA 1ZGVA 4GSOA 3Q3YA 4E05H 1GBAA 3FP6E 1OWIA 5DP6A 1C1NA 2F9BH 4AZ2B 2BB4A 3U9AH 4E7RG 3RXIA 3TNTA 1AUJA 1NO9H 1XM1A 2FYRA 3MH4A 2Z9GA 3IITA 1LHDH 1FZZA 2PV9B 3T26A 1DDJA 1VR1H 1YKTA 2IJOB 2A1DB 1OX1A 1BTZA 3PTNA 3FZZA 3ZYDA 1TQ0B 1TGTA 2VWNA 1O39A 2ZDNA 2ZFFH 3TK9A 4AGKA 3UOUA 1AQ7A 1HFDA 1SLXB 2Z9JA 3SNEA 1CSOE 5ESTE 2FMJA 3QZRA 3U98H 3SV6A 3P8FA 5GXPA 3RLYH 1GBLA 7GCHG 1GG6C 4BXSA 1UTPA 2GCHG 3V13A 2IN2A 3SNBA 4YOIA 1HAIH 1O3CA 2ZG0H 4NIWA 1C4V2 3SJKA 2BD9A 5L30H 4X2VA 1GJ6A 3V7TA 1EJAA 3ITIA 3MHWU 1VITF 8ESTE 1LQEA 4FUCA 4Q7ZA 3UR9A 1ELDE 1HPGA 1O2XA 1A5GH 4QT8C 5L2ZH 4XFQA 1C1MA 1C5LH 1VJ9U 1YLCA 2QY0B 4ISHH 1P10A 1DFPA 2GZ8A 3MI4A 2JH0D 3M7QA 4IBLH 1MQ5A 5T6GA 2PWXA 2PGBB 1ETTH 3PV4A 2UUKB 2ZPQA 5LPFA 3M5LA 1RJXB 1IQFA 1O3DA 3DA9B 3KGPA 3PMBB 1EP6A 1BTYA 4Y79A 1BT7A 1O3IA 1QJ1B 4FUHA 3IG6B 3TH4H 3A87A 4DT7B 2ZHQH 3PYHA 2I6QA 4A92A 4A7IB 5EOKA 1S6HA 1GCTB 1NRQH 2Y7XA 4INKA 3H5CB 3QGNB 1ANEA 3RXJA 3F68H 3A7ZA 1ZMLA 1DWCH 1MTNB 2OQ5A 3UNQA 4LXBH 1DUAA 1G37A 1JIRA 1GJBB 1BRCE 1WYKA 2Z94A 1AHTH 1LVMA 1P04A 1YPJH 1YCPK 4IMZA 2ZU3A 1DWDH 1A3BH 2OC0A 1MKXH 1EOJA 1C5SA 4AOQA 4RKOB 2V3HH 3ZVDA 2ZHEH 5BPEA 3QWCH 3O8BA 1ELCA 2H9HA 1D6WA 3A7YA 3UR6A 1N6XA 4DW2U 3A8CA 1H9IE 1W8BH 3OTJE 2EI7A 2BHGA 3SNAA 3E6PH 4IN1A 1S85A 4RSPA 1FAXA 1PPCE