1TNIA

Prediction of novel serine protease inhibitors
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Prediction of new serine proteinase inhibitors.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 51
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1994-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tniA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tniA02
1K9OE 5E8EH 1DICA 1F0RA 1T8OA 1D3TB 5FX5A 3UIRA 4WVPE 3FVFB 1CGIE 1GBAA 1Z6JH 2OCVB 3RM2H 1K1OA 1WYKA 5EOKA 1DFPA 1TGNA 2H9TH 3O8DA 1G37A 1NZQH 3L6PA 5L6NH 2HPQH 4E7NA 4UFDH 1FIZA 1JOUB 2HLCA 3E91A 2UWLA 1YPGH 2PKAA 3ZZDA 4MDSA 1VCQA 3PYHA 1YPMH 3URCA 3MO9A 1CA0B 2SGAA 3F9HA 1DITH 1QHRB 1TA2A 1EAIA 1V2TT 1IQEA 2BQWB 1TMUH 1P2IA 1GHXH 1Z6EA 1O2UA 1P57B 1SGIB 3A85A 2WV4A 1P2QA 3ZZAA 1TGSZ 2CXVA 1XVOA 2Y6TA 1GBHA 4JZ1A 1GJCB 4KTCA 1C1QA 1GI5A 2V0BA 3RDZA 1KXDA 1HDTH 3MU8A 7KMEH 1QJ7B 1BQYA 2A5AA 1XUJA 2C4FH 2ZG0H 1AD8H 2A4GA 1RGQA 1O38A 1GJ4H 3AAVA 2OXSA 4CBNA 1BA8B 3A7WA 1QY6A 5E2PA 1AWFH 1RTKA 1SMFE 1UVUH 3BF6H 2AFQB 4Y10E 2Z94A 1BRAA 1HAHH 1XUGA 4JCNA 1AMHA 1C1PA 1P03A 2FOHA 1GHZA 3B8JA 2BZ6H 3LGWA 5E2OA 3RMOH 7GCHG 4ISNA 1F0UA 3VXEH 1KXBA 5IDKA 1O3JA 1P2KA 2Z9IA 4IC6A 1C1OA 1Y3XA 3A86A 3LGYA 3I77A 1FN6A 1FI8A 1O2WA 1NT1A 4O3TA 1G36A 1KXCA 3AAUA 3GCHC 1NY22 5JYIA 2QF0A 3UR9A 1S83A 3L33A 1EOJA 3GDVA 1N6YA 3ZVEA 3A88A 1E38B 1CGHA 5EQSA 1BHXB 2BLWA 1N6XA 4Q7ZA 2R3UA 2W3KA 4XOJA 1ESTA 4GHQA 4UFEH 5DO4H 2Z3EA 1A0JA 1QL9A 5B6OA 1ESAA 1SSXA 5ETXA 2BY6X 1A61H 3OYPA 4MNXA 3IITA 3FZZA 2FOEA 1MTWA 1TNLA 1W14U 4AFUA 1SLXB 1EOLA 2B0FA 1J14A 5FXLA 3A7ZA 3ZVBA 1QIXB 4GCHF 3NUMA 4AN7A 3SGBE 4A1TA 1FN8A 3TLOA 1FLEE 1ZLRA 3M5NA 1A1RA 4CH2B 5JB8S 4SGBE 1D4PB 4Y11E 1GBMA 4TPYA 1IQJA 4AB9A 3RXKA 1PPHE 2NU0E 1D3DB 2JH0D 3LH1A 4KKDA 2FTMA 5GIBA 1EAWA 1JIRA 4D9QA 4X1NU 1Q2WA 4BAQB 3KNXA 1DE7H 1YGCH 2J4IA 1VITG 4NIXA 1O3BA 2H1UA 4ZKSU 1ELDE 4BAKB 1ZR0A 1BBRK 1OPHB 5J4QA 1Y5UT 2OC0A 4ABIA 1C4U2 1CU1A 5AFYH 4CRBA 5K7RA 2OC8A 1GHVH 4CHAB 1OWEA 3LDXH 4AB8A 4WWYA 3VPKA 3SUGA 4YT6H 1RIWC 2O8UA 1HJAC 2BD5A 4YZUA 2PHBA 4PROA 3URDA 1H9LB 1P12E 4XE4A 2ALVA 3SV7A 2BQ7B 3RC6A 1F5RA 1NC6A 2VH6A 3RXQA 1ETRH 5A0BA 1CA0C 3OSYA 2J9NA 1ZYOA 3A84A 5JBAS 1RRKA 2BMGB 2UUYA 1T8MA 5EODA 1ZMLA 2SNWA 1UHBA 1HCGA 1P05A 1ZGVA 4DOQA 5AFZH 4A5TS 5EW2H 2FTLE 2ZCHP 5C1XA 2GT7A 3GCOA 5DG6A 2FM2A 3CP7A 1MZAA 1OXGA 2QXJA 2WUBA 1ELTA 1ANBA 2PKSB 3MH5A 4E7RG 3V12A 3GCNA 1GCTB 5F8ZA 3GDUA 2XCNA 3MO6A 5DPAA 2VWNA 1Q3XA 2GV6A 2D2DA 1GDUA 2VIOA 3SUEA 3V7TA 4DT7B 3O8CA 3Q77A 1A5HA 1FY4A 2WPMS 5DK1A 2XXLA 4X2XA 2G5NA 1HBTH 1C1WH 1FY8E 2FI3E 1O5DH 1VR1H 2JETB 1OWHA 3U8RH 1DWBH 3VB4A 2QV1A 3CENA 1A3BH 1P2MA 1TQ7B 2GX4A 3Q3KA 3UUZA 5E0GA 1W12U 1DY8A 1XKBC 1ID5H 1CHOG 1DOJA 1EAUA 3RC4A 1GBDA 2QCYA 1C2HA 1T7CA 1L4ZA 5EPYA 2OUAA 1S6HA 4DW2U 2BM2A 2BHGA 1P2NA 1P2JA 3E16B 1OWJA 2AS9A 1EB2A 4MPXA 5LGOA 4AG1A 1CVWH 1PQ5A 5T3HA 2VNTA 3UQOA 2HPPH 2FI5E 4YLQH 1UTJA 3K65B 1LHDH 1PYTC 1O5GH 4Y76A 3BTWE 3P70B 1BTUA 3O8BA 5FHTA 1MU6B 1O2QA 3TH3H 5FPTA 1X7AC 5T6FA 2UWOA 2J2UA 2QAAA 4NSVA 1QR3E 5DP5A 6GCHF 2QXIA 1SOTA 3L3TA 3LONA 1A2CH 1KDQA 3FP8E 1ESBA 1F2SE 1GMHF 1TGCA 3S7HB 4OS4A 4TWYA 1S0QA 1L0ZA 2CGAA 2BDIA 3TK6A 1LVMA 2AMQA 2I6QA 1O2MA 3ZZ3A 4AX9H 1MBQA 1MKXK 1MTNB 1NRSH 4ZHMU 1ABIH 2H2ZA 1SQTA 1ZHPA 4CHAC 4LK4A 2SGEE 4H4FA 3PLBA 1INCA 1OP8A 1QL8A 1UVPA 3TK5A 1XKAC 2HOBA 1EPTB 3F1SB 5ABWA 2G8TA 1GI6A 1NRNH 1PPEE 1AE5A 1HIAB 3UREA 2BD9A 1J15A 1ELGA 1LMWB 1O2OA 2ZGJA 8GCHF 2P8OB 3BIUH 3EA7A 1AN1E 1LPZB 1BITA 2WINI 3FAOA 3C27B 2ZHDA 4K1SA 3MFJA 5E0JA 4D7FA 1HV7A 4HZHA 3D49H 3STIA 1OSSA 2RDLA 2DE9A 2VJ1A 1DS2E 1GMCF 5HM9A 5SGAE 3PROA 1TALA 1W8BH 2FP7B 1OX1A 1HAGE 1ZSKA 2TPIZ 1OYQA 2PKSC 1FJSA 1XUFA 1TQ0B 4FUIA 2P95A 4OS1A 1GCTC 3VB6A 1W13U 2ZO3H 1QCPA 2ZKSA 3TGJE 2NU3E 1C1UH 1O2NA 1UVSH 4OS2A 1JIMA 1O3KA 1GVZA 3T5FH 1C9PA 2ZA5A 3CS7A 3QTOH 3LC5A 5DP4A 1NM6A 3GOVB 2YOLA 3GCTG 4NG9H 1RS0A 2JETC 3GYLB 1QRZA 1XUHA 1W7GH 1GBKA 1C2EA 1DLEA 2EA3A 4NIWA 1TX7A 1YM0A 2VWOA 2D26C 2ZU3A 5L30H 2P3FH 2OC7A 5EW1H 1ELVA 2W26A 2KAIA 4MVNA 1G3BA 1O0DH 4K8BA 1PJPA 1QB9A 1XX9A 1RJXB 1QRWA 4GPGA 1ZOMA 5GWZA 1AKSB 1V2QT 2ZGCA 4MLFB 4D7GA 1IQKA 2TBSA 4NWKA 5JBTA 5TCCA 1HGTH 2R0LA 1DLKB 1UTOA 2HNTF 1C2LA 1D3QB 1LHCH 3T25A 4WJG2 5CMXH 2BOKA 1PPBH 4DIHH 1D6WA 3EAJA 1EZUC 1TNHA 5A2MH 1QNJA 1VJAU 4B75A 1F0SA 3ATLA 3R3GB 2HGTH 2TRMA 1C5PA 2XC0A 3T26A 4X6NA 2GCTB 4CBOA 4XDEA 4NCYA 1YYY1 3VB5A 2Z7FE 1IQLA 1NU7B 1S0RA 3BTKE 4KP0A 2WPIS 1TBRH 1K22H 1G3DA 1K21H 3LJJA 4O97A 1UTNA 3TITA 1ZTKA 1THPB 2STAE 1OS8A 1GJ5H 1KY9A 1ARCA 1O3AA 1G3CA 1NS3A 1C5XB 1DPOA 4AGJA 1FV9A 4DVAU 3M35A 3UWJH 1FXYA 1F5KU 2AYWA 4QT8C 2UUKB 5C5OA 1G2MA 3TK9A 1BB0B 2G55A 1AI8H 2IOTA 4GCHG 2WUCA 2BTCE 4TY7A 1MU8B 2BOHB 4YOJA 5GXPA 1GMDF 3F9EA 2P8OC 2P94A 2FMJA 3SV9A 4AG2A 3A8AA 4X0WU 4HTCH 4OS6A 4B2BA 4A1VA 2OC1A 1ZJKA 1Y8TA 1TRNA 1K2I1 1V2UT 2AGGX 4YTAA 3AW1A 2FDAA 4WY3A 1NTPA 1BTHH 2XBYA 3PTNA 2TGTA 4Y0ZE 3HGPA 5A0AE 2Z9LA 1AIXH 1QRXA 3MTYA 3BTDE 3T29A 1GHAF 1HLTH 5FCRA 1ANEA 1O2XA 1MKWH 2ZEBA 3PTBA 1QJ6B 1AY6H 4IC5A 4O9VA 1GI1A 2BD8A 2ZGHA 4X6OA 3SU0A 3TNSA 1SL3A 1OP2A 1KXEA 3MMGA 1C2GA 5EU8A 3U1JB 1V2VT 2DUCA 2OTVA 2J92A 2UUFB 3UWIA 4RN6A 1LDTT 4X1QU 4D9RA 1KYNA 3KQBA 1RTLA 1TIOA 2FEQH 3NPSA 1O33A 4MTBA 2TIOA 1G2LA 1SOZA 2H9HA 3A7VA 5DP6A 2QXHA 4M7GA 3PWBA 1SBWA 1HAIH 3NK8A 1SGRE 3QN7A 3VFEA 2O9QA 3GY8A 3UOUA 1Y5BT 1HAOH 5GPIB 5JPMH 3ZZ5A 2UWPA 1O31A 4X8VH 3MOCA 3QUMP 4BOHA 1C5ZB 1XM1A 1QBNA 2GCTC 4R0IA 3UY9A 3BTHE 4YESB 1IQIA 1S85A 2QF3A 1SGPE 1LHEH 1O2GH 1P3EA 1FIWA 2OINA 4U32A 3V0XA 3RXHA 2PKAB 1C1SA 3GY5A 5A8XA 5BRRE 2GDDA 1WQVH 4Q7YA 4AYYB 3M61U 2W7SA 5AVDA 1RIWB 1MAYA 2I6SA 1HJAB 2VWLA 4HI3A 1W2KH 3ZZBA 1JXPA 4B74A 4FVBA 1C9TA 4I8KA 1TE0A 1BT7A 1ELCA 4WMFA 1U6QA 5DKMA 1ELBA 1P9UA 3RUOA 2FYQA 1CO7E 4I8HA 1K1JA 1E0FD 1HAXB 1BCUH 6GCHG 4K3JA 4NWLA 2A5IA 1EZQA 4DGJA 1KXAA 1GMHG 1NPMA 2GD4B 3NCLA 2GDEH 4R8TB 1MQ6A 2R2WU 1FAXA 1E36B 2Z9KA 3QDZB 1A3EH 1V2NT 1S6FA 3NZIA 2ZU2A 1GWAA 2Z3DA 4IGDA 1LVBA 2PWXA 1OWIA 2ZQ1A 1DWDH 3UQVA 1TRYA 3MU4A 1UK3A 4I8GA 4TWWA 3HK6B 4A6LA 3LGVA 3SV2H 1OP0A 1SR5C 4NZLA 2JH5D 1AFQB 4D76A 2O8WA 3BG4C 1V2OT 1HFDA 3FP6E 3F9FA 5HMAA 2QGRA 1O3EA 1C2DA 2GZ8A 3RXFA 1GJ8B 1IOEA 1G30B 4GAWA 2RG3A 1PYTD 4X8TH 1BTWA 3SN8A 4MNVA 8GCHG 3GY7A 2BXUH 5PTPA 5EQRA 3SO3A 1S82A 1W11U 1ZZZA 3R0FA 3LJOA 5DJ7A 4JMYA 1DT2A 4IBLH 3OU0A 3SNCA 4X8UH 3K6YA 1GMCG 2BDYA 2BQ6B 4IS5A 4XSKU 2AGEX 2BDHA 4X1SU 2J94A 1SB1H 1OWDA 1V2RT 1W0YH 4TPIZ 1P8VC 2A7CA 3TJVA 1Z8JB 3MWIU 2ZPSA 4WMDA 1DWCH 1YP9A 3PB1E 1YPJH 3P8NA 4JZDH 4CRGA 1ELAA 1F5LA 4J1YA 3SHAH 1UCYE 4CRDA 3KQDA 1O3IA 2BVRH 1A4WH 1SGDE 1UTLM 3TJNA 2FI4E 3RLWH 1G9IE 1RD3B 5HXFA 3PV4A 2FXRA 1UTKA 1BRBE 3TPIZ 3DFJA 1P01A 1LO6A 2LPRA 4Y7AA 1TNGA 1LQEA 2FO9A 4HGCA 4H6TA 1A7SA 3T28A 1DSUA 2A0QB 1MKXH 3ATIA 2VVCA 2V3HH 2B8OH 3VXFH 1TPOA 4A1XA 4ABDA 1TGTA 3WY8A 1MMJN 3ZV9A 1EJMA 5FAHA 2V3OH 1SHYA 1DX5M 1KTSB 2XBWA 4NSYA 4IN1A 2Y80A 2ZF0H 4WMEA 1AE8H 2PR3A 4ZUHA 3RXVA 2PUQH 4AORA 2ZZUH 4H6SB 1NFUA 3SHCH 1PQAA 4NGAH 1ZJDA 4NFFA 1T4UH 1UHBB 1QTFA 4INLA 4ZHLU 2QA9E 2SGFE 1DSTA 4B2CA 1PFXC 3UTUH 1GI2A 1DUEA 1F0TA 2OQ5A 1ARBA 1TLDA 3KF2A 4FU9A 4BXWA 2HNTC 3MH7A 2XBVA 1TWXB 2ZGBH 3TGKE 2ZU5A 4AFSA 1T8LA 1NFYA 3GISB 2NU2E 2H6MA 2ZNKH 2HNTE 4UONA 4GVUA 2GCHF 1MZDA 5DP8A 1Y3YA 5EGMA 2VIPA 1GDQA 2A45B 1AFQC 4JZFH 4DY7B 1L1GA 3B9FH 1MD8A 2ESTE 3FANA 3RXTA 2ANKH 2P93A 3RXSA 3SU6A 1UMAH 3F6UH 1LTOA 2XWBI 1AUJA 4MPWA 4Y7BA 4J2YB 3M36A 3ITIA 1SGEE 3M5LA 3SUDA 1SGNE 3ZVGA 3F9GA 3ATMA 5A8ZA 1RFNA 5HGGA 2BVXH 2C90B 3SJKA 4UDWH 1SVPA 4K5ZA 4YO9A 1W10U 2A7JA 1SFQB 1KLIH 4ZKRU 1EZXC 1GI0A 1WOFA 3K2UA 1C5LH 1DWEH 1V2KT 1GHAG 4MPUA 2BDGA 1C4Y2 3SNDA 1EX3A 2ZFFH 1NFWA 4X2YA 5ESBA 4NA9H 3SNEA 3RMNH 3RXUA 2ZWLH 1QURH 2F91A 1GBJA 2ILNA 2ANMH 1KDQB 2A4OA 4B71A 3RXPA 1CT2E 2BY7X 4FUDA 2GP9B 1GJBB 2ODPA 2QYIA 1BRCE 2P16A 1O2JA 2SGQE 2FOBA 4U01A 5GCHF 2PV9B 1LCYA 3BIVH 1MCTA 2OBQA 1CQQA 1HYLA 3T27A 3A82A 3BEIB 3BTGE 4X1PU 5GJ4B 1NN6A 1A0HB 1O3DA 2ZP0H 2G5VA 3NXPA 4GSOA 1GBTA 3SW2B 2A5KA 1SQAA 3UNQA 4FU8A 1C5NH 2QXGA 1ZRBA 4Y8YA 3EQ0H 5L2YH 3GY4A 2CHAB 3HGNA 1O2ZA 3HKIB 4E06H 3UFAA 5C67A 3SUFA 2FWWA 3ATWA 3QWCH 3SGAE 6ESTA 4BTTB 3PO1B 2HVXA 4E05H 3SI4H 1O37A 4DURA 2BB4A 4B2AA 3UOPA 5LPRA 8LPRA 3F68H 1BTPA 1MAXA 3KCGH 5HYOA 1FY3A 2H5DA 1PPFE 1THSH 1EJAA 1GI8B 3PLKA 4Z6AH 1EASA 3M5OA 5F03A 5F8XA 3G01A 4RKOB 3U8OH 1QGFA 2VINA 2G00A 3ZV8A 1YPHC 4X6MA 1T31A 1O5BB 3UR6A 3SJOA 1SLWB 1ZHRA 5EQQA 1O2HA 2R2MB 3A7YA 1AVGH 1HJ9A 3ZZ7A 3ZVAA 1S5SA 2VVUA 1EKBB 1YPHE 3I29A 3QLPH 1FMGA 4INKA 3SNBA 2YNBA 3S69A 4B1TA 3SZNA 2ZU1A 3E1XB 2IPHA 4ZKNU 1SGFA 4ZHAA 3RXAA 2NU1E 1C5VA 3SBKA 1JRTA 4CH8B 2BDCA 1TOCB 1C2KA 4RKJB 3PMAB 4SGAE 1PQ8A 2FIRH 2ZCLP 4Y0YE 1GJ7B 4ASHA 1GL0E 2WYJA 5C20A 2KAIB 3GDSA 3E6PH 1EUFA 1DM4B 2ALPA 1TFXA 4DG4A 1SLUB 1NU9A 1J17T 4D8NA 1GVKB 2F3CE 3FFGA 3SOSA 3ZZ9A 1O3FA 3M5MA 4AYVB 3BN9A 4B73A 1GI9B 1F7ZA 1XUIA 2Q6DA 2JKHA 3LGIA 4LZ1H 1C5YB 3FP7E 3H7TA 4Y8ZA 4ZKOU 4BNRA 1P09A 1V2ST 3BTME 4Q80A 2HALA 1ZTLA 1TBQH 1HAZB 8ESTE 2FOGA 2EC9H 3BSQA 3HK3B 3ODDA 3SI3H 1O3OA 3ESTA 3IWMA 1CA8B 3V3MA 3M3TA 2VGCB 2STBE 1BUIA 4ISLA 3RXLA 3SORA 5JBCS 4CR5A 3D23A 2YNAA 1OYTH 4FU7A 1O2VA 1V6DA 3VB7A 1YLDA 3E0PB 1YCPK 5E0HA 4XBDA 5AF9H 2EEKA 2P3TB 5TCAA 1NFXA 1RXPA 3SV8A 3KIDU 1FPHH 2CHAC 4JK5A 1LVOA 4DCDA 1MCVA 2ZFQH 1FZZA 1YF4A 2ZIQH 3FZDA 1GPZA 2FOFA 3EE0B 1V2LT 3A7TA 2C93B 3Q3XA 3PO1C 2CF9H 5EXLA 1O3MA 1CT0E 2ZDKA 1VCWA 1YCPM 2ZHWH 4I8LA 1EB1H 2A4QA 2ZPQA 1O36A 2H9EH 3RMLH 3RM0H 4Z0KA 1GHWH 3LGTA 2F83A 4JZIA 4F4OC 1HXEH 2Q6FA 4BAOB 7LPRA 3E90B 1GHYH 2A7HA 4YOIA 4Y8XA 4JYUH 1AQ7A 2AIPA 1DANH 1BMNH 1C5SA 2ODQA 4JYTA 4JZEH 2A2XH 1IQHA 2SGPE 3SU2A 4MQAA 3Q76A 1WQSA 1XXDA 3BG4B 3EDXB 1ETSH 2P59A 1Y59T 2B5TB 1CHOF 4ZH8A 1CHGA 2GKVE 3U8TH 3DHKH 1B7XB 1KIGH 1BMMH 1OKXA 1G3EA 4FXGH 1D3PB 2ANYA 2ZECA 2FOCA 2AMPA 1DY9A 4U30A 2WV5A 1W0ZU 2ODYB 1SLVB 1VITH 6CHAB 1SC8U 1A46H 2BY5X 1Y3VA 3SJ8A 5L2ZH 1P02A 5DP7A 1EAXA 1TOMH 2BYAX 1PPCE 2GV7A 2XCFA 1C4V2 1YPKH 4KELA 1O30A 4NA8A 1ZHMA 2GCHG 3JZ1B 5CE1A 2W3IA 2J34A 4WXIA 2THFB 1QBOA 1QBVH 3MNSA 2BD2A 2OQUA 3OY5U 2TGDA 1AVXA 2Z3CA 1KXFA 3A8CA 3MI4A 3QZQA 3S7KB 1TABE 2PTCE 3P17H 5CHAC 1DXPA 4YM9A 3BEUA 5C1UA 3ODFA 2HRVA 1BTYA 2QY0B 3ENSB 1MD7A 3U1IB 3LH3A 1ZMJA 1P3CA 1VGCC 4YLUA 2VGCC 3MH6A 3BTFE 1O39A 2VU8E 3KL6A 1Q31A 7ESTE 2BXTH 4GHTA 1TPSA 5I25A 4I7YH 1BBRH 1VZQH 2G4TA 5BPEA 1SGYE 1TMBH 1Y3WA 5C3NA 3MNXA 4X8SH 1KLTA 1EZSC 2BLVA 2QIQA 1Z8IB 4IW4E 1OOKB 2PFEA 1MTUA 4CREA 5LPEA 2BZAA 2EI8A 1O2IA 1BJVA 3MNCA 1QB6A 3MO3A 2AIQA 2G4UA 1DUAA 3ZVCA 1C5OH 4KGAA 3BTTE 3RXRA 4ABJA 9ESTA 2HWLB 2ZFTA 4XBBA 3TH2H 1QA7A 1GJ6A 2NU4E 4AFZA 1NO9H 3TJOA 3NWUA 3KQEA 2FOMB 2ZI2H 3IG6B 4K1EA 1MH0A 4OGYA 1BMAA 1XVMA 3M3VA 1UCYK 3M7QA 1GBBA 4NIVA 2V6NA 3MU1A 1P06A 2VIWA 5FPYA 1S84A 1TRMA 2IN2A 1C5QA 3BEFB 1C2JA 1L2EA 1YBWA 5GCHG 1P9SA 4K8YA 1A5GH 2F9OA 1YLCA 2BLOA 1C1VH 1GHBF 1O5CB 2OLGA 3S0NA 1AHTH 1GBFA 3UPEA 1JMOH 1O2YA 3NKKA 4DIIH 3S9BA 1ANDA 1HUTH 4MNYA 4TY6A 2EI7A 1FY1A 4AOQA 3Q00A 1HXFH 1FNIA 1QQ4A 1K1MA 1QB1A 3VB3A 4FUBA 4BANB 2PGQB 3PMHB 4KTUA 3GCTF 5LPFA 1JBUH 2G81E 2G52A 4K2YA 3RXCA 3K6ZA 1K1IA 1NROH 2A2QH 2Q6GA 5A8YA 1C5UA 1AWHB 1CE5A 1KSNA 1O2TA 4ABEA 2A32A 4UFGH 1UVOA 3BV9B 1MBMA 4WH8A 2BY9X 2FPZA 1J9CH 1K1PA 4VGCC 2ZC9H 1O5AB 3RXGA 6CHAC 2OP9A 1P2OA 2GTBA 3E3TA 2OD3B 1FAKH 2ZDLA 3VGCB 1KTTB 1K28D 1EQ9A 4ZAEA 1ZRKA 3TJUA 1MKWK 4Q2KA 2W5EA 2DE8A 5A09A 4IMZA 1V3XA 3EYDA 3M7TA 1C1NA 1FDPA 3GY3A 1SI5H 1B0FA 1EXFA 1G32B 1Z1JA 2H5CA 1CSOE 1AZ8A 1QL7A 1HAVB 3PM3A 1O5EH 1O34A 1WUNH 1J8AA 1TMTH 2XRCA 3RC5A 2C3SA 3GYMA 3MH4A 3P8FA 1HAVA 1MQ5A 3AW0A 1ABJH 4Y71A 3ZZCA 3ATKA 4YT7H 4ISOA 3PWCA 2W7UA 1GBIA 3HPTB 1T8NA 5T6GA 1D9IA 2XYAA 2AMDA 2D1JA 1P04A 1W7XH 3RLYH 1GBCA 2UUJB 3I78A 4ABFA 3MU5A 5FPSA 2ZFPH 3RXOA 3V13A 2AEIH 1L1JA 2CF8H 2F9BH 3SJIA 3AASA 4ISHH 2J95A 1XUKA 1WCZA 3M7UA 2NWNA 1WBGB 1SGCA 2LNCA 1IQGA 3RU4E 3RXEA 4CRCA 2O8LA 5H4IB 1ETTH 1LHGH 1K1NA 2Z6BD 1H1BA 2O8TA 3A7XA 2PTNA 5G4BA 2SGDE 3S9AA 1TB6H 4LZ4B 3TU7H 5EG4A 3S9CA 1WV7H 2F9PA 4FUCA 2ZGXH 1HAYB 4O3UA 3UNRA 2BX3A 3LU9B 2C8XB 1H8IH 2WYGA 1DDJA 4MPVA 5F8TA 1P11E 3GY2A 3DFLA 4CRFA 4ABAA 3PLPA 4BAMB 5JBBS 3RXJA 5ESTE 3RXDA 2CN0H 2Y81A 1VCPA 4FUFA 1F92A 1BRUP 1AFEH 1Z8RA 1LVYA 2BY8X 3BTQE 3CS0A 3T2NA 1TYNA 1C2MA 2O8MA 2XW9A 1LKAA 1FPCH 5A0CA 1TONA 2VH0A 1H4WA 1GJ9B 2ZPRA 3P95A 3DD2H 5FCKA 2SFAA 1O32A 4NFEA 3C1KA 1XXFA 2GZ7A 1GMDG 1H9IE 2BD4A 3H5CB 5C1YA 1HJ8A 1C5RA 4AZ2B 1IQFA 1HAPH 4UFFH 3DT0H 3E8LA 5AHGH 1S81A 4NA7A 1GGDB 3QX5H 1E37B 3MU0A 3RXMA 1O5FH 1AZZA 2ZHFH 3B23B 4IN2A 2F9NA 2ASUB 4GUXA 3SU1A 4AFQA 1A0LA 3VGCC 1IHSH 4I33A 3PMBB 1DXWA 1UVTH 1P10A 1TNKA 1HNEE 4Y79A 1C1RA 3SQHE 1D6RA 2AERH 2WPKS 1FQ3A 4NIYA 4BTUB 1O2SA 4O03A 3QO6A 2ZCKP 3D65E 2P3UB 1V2MT 3RMMH 1TPAE 1NESE 3KEEA 4UE7H 4X6PA 1BIOA 3KN2A 4IMQA 2ZFSA 4WH6A 1BBRE 4FUJA 4OGXA 5FBIA 1Z1IA 4X2VA 3QK1A 1AGJA 1C2FA 1SPJA 1ZGIA 2TGAA 2CMYA 2OBOA 1GL1A 1WSSH 1Y3UA 1ORFA 4ESTE 4ISIH 1O3HA 4X1RU 3A87A 2ZDVH 5DP9A 1YCPH 1XMNB 5IYTA 1HB0B 2ZTZA 2M5TA 1AU8A 1MUEB 1C5TA 1GI3A 4ABBA 5DP3A 2C8ZB 2R0KA 3KHVA 3BG8A 4U2WA 1O35A 1FUJA 1C2IA 1TX8A 2XNIA 1QQUA 2Y5FA 3P6ZB 4FUGA 1SGTA 2VB0A 3Q3YA 4Y6DA 4CRAA 5J4SA 4FUEA 5GDSH 1TA6A 1UTQA 4JK6A 2CV3A 2ZQ2A 1UTPA 3A8BA 2Q1JA 3LPRA 2VIQA 1BTXA 4HFPB 3TH4H 2WPJS 1ZPCA 4ZMAH 4THNH 1GJAB 1QA0A 1GBLA 1C1TA 3STJA 1NRQH 1ZSLA 2J38A 5EXNA 1ZSJA 3N7OA 1EATA 1ZTJA 4ZXYH 3OX7U 6LPRA 3EGKH 2FYRA 4B76A 1FY5A 1AVWA 3P92A 3SJ9A 4I31A 1TAWA 2FODA 3ZVDA 3M3SA 3QGNB 3K9XB 3ZZ8A 3U69H 2SNVA 2B9LA 3U98H 4BAHB 3TGIE 3A80A 3TIUA 3E0NB 2BX4A 3SU3A 3A83A 1YC0A 7GCHF 2PLXA 1O2KA 1EPTA 1KLJH 2FLBH 2XWAA 4UD9H 3KQCA 2F9UA 1LHFH 1HIAA 2RCEA 1QJ1B 3HKJB 3EA8A 2Y7XA 2C8YB 2R9PA 4LOYH 1TNJA 1AB9B 1K1LA 1GDNA 4ABHA 5JDUB 1UK2A 2FX6A 5EPNA 2G51A 2RA0A 4MNWA 2V35A 2BD3A 1GG6B 1TPPA 5TJXA 2GVFA 1O2PA 1THRH 1CBWB 3RXIA 4MG3A 1GHBG 1NRPH 1P0SH 2WPLS 2FS8A 3O8RA 1GGDC 3JZ2B 2Y5HA 3P8GA 2GMTB 2A4RA 2RA3A 1N8OB 1O2LA 4FUHA 1SFIA 2VIVA 3MNBA 1TX6A 1BJUA 1NRRH 3ZYDA 2K1QA 1WAYB 4F49A 2GT8A 1WTGH 1GVLA 1T32A 2A31A 3D62A 3ZZ6A 1BOQA 2XTTB 1L4DA 5F6MA 3LT3A 5CHAB 2XBXA 3GICB 4UEHH 4CR9A 1GCDA 1VITF 1GBEA 1O3GA 3PMJA 2Z9JA 4WF8A 2D8WA 1O3CA 2AGIX 1SG8B 1VGCB 4BXSA 2ZTYA 1LPKB 1AKSA 4WXVA 3OTJE 2XC4A 3ZZ4A 3SNAA 3OY6U 1SGQE 1TBZH 2FS9A 1DVAH 1QFKH 2ZDAH 1PPZA 2FX4A 4ZROA 2FESH 3QTVH 4A92A 2F9VA 2GGVB 1BTZA 2QC2A 3SGQE 4BTIB 3SU5A 2PSYA 1UCYH 3M37A 3TVJB 1SGFG 1Z8GA 4ZXXH 1CT4E 5DGJA 1ZPZA 4X2WA 3ZYEA 1E34B 1C5MD 2VVVA 2TGPZ 3HATH 1LQDB 2ULLA 1HRTH 4Q7XA 1VJ9U 1MTNC 2BDAA 3DUXH 1ZPBA 1EJNA 3RU4T 1GI7B 4RSPA 1AUTC 2Y5GA 1ELFA 1GI4A 1BHXF 4A7IB 5FBEA 4OS5A 1J16A 1EP6A 1H9HE 3MHWU 2PW8H 1EPTC 1MTSA 1EP5A 3LGUA 1Y5AT 3A81A 5C2ZA 2EI6A 2VIDA 2GZ9A 1HPGA 1UTMA 4INHA 2A1DB 3AVZA 3U9AH 1IAUA 4XFQA 2ZTXA 3TNTA 2BDBA 2C8WB 3EA9A 1ELEE 3BTEE 3H7OA 2ZU4A 1SQOA 1Z7KA 1MTVA 4LXBH 3UNSA 1ZMNA 1UJ1A 2FZZA 5JB9S 1AB9C 4JYVH 3W95A 3SV6A 1B0EA 5HM2A 2VWMA 1GG6C 3LKWA 1O3LA 1JRSA 3LIWA 2ZFRH 1ANCA 2PUXB 1C5WB 4K60A 1TGBA 2FOAA 4H42U 4GLYA 1E35B 1YPLH 2FLRH 1PPGE 2AH4X 1CBWC 1BZXE 4VGCB 1Z71A 3DA9B 1LKBA 4NZQA 1BMLA 4I8JA 1OWKA 1WTHD 4AGKA 1O3NA 1UO6A 4XBCA 2GMTC 2PSXA 4K69A 1N8OC 2Z9GA 1LPGB 1IHTH 1RTFB 1B5GH 2BVSH 5FX6A 4KTSA 2ZHEH 1A5IA 1YPEH 3VEQB 1CGJE 1IQNA 5T6DA 4K1TA 3GCHB 3A89A 5LH8A 1YKTA 2ZDMA 2ZHQH 3RU4D 1GJDB 1L1NA 1O3PB 1WU1A 2CJIA 5I46H 3RXBA 1IQMA 2XC5A 4ABGA 1V2WT 1O2RA 2JH6D 1V2JT 2B7DH 3ELAH 1TNIA 4TYDA 2PGBB 9LPRA 3KGPA 1W3CA 4FVDA 1JWTA 3T62A 8KME2 4YOGA 2WPHS 1ACBE 4OS7A 4DJZB 1PQ7A 3W94A 3QGJA 1V2PT 2BD7A 2QN5T 2R3YA 5K0HA 2Y7ZA 1AO5A 1T4VH 3SQEE 3LOXA 3GY6A 3QZRA 3P8OA 3ZVFA 3LC3A 1M9UA 2ANWA 3SU4A 2Y82A 2IJOB 5C5NA 1FONA 4I32A 1SHHB 5EXMA 1BDAA 1N1LA 2BLQA 1H8DH 3MYWA 2ZDNA 3A8DA 3RP2A 1C1MA 1UK4A
chains in the Genus database with same CATH superfamily
1K9OE 5E8EH 1DICA 3OE7D 1F0RA 1T8OA 1D3TB 5FX5A 3UIRA 4WVPE 3FVFB 1CGIE 1GBAA 1Z6JH 2OCVB 3RM2H 1K1OA 1WYKA 5EOKA 1DFPA 1TGNA 2H9TH 3O8DA 1G37A 1NZQH 3L6PA 5L6NH 2HPQH 4E7NA 4UFDH 1FIZA 1JOUB 2HLCA 3E91A 2UWLA 1YPGH 2PKAA 3ZZDA 4MDSA 1VCQA 3PYHA 1YPMH 3URCA 3MO9A 1CA0B 2SGAA 3F9HA 1DITH 1QHRB 1TA2A 1EAIA 1V2TT 1IQEA 2BQWB 1TMUH 1P2IA 3AK5A 4Q63A 1GHXH 1Z6EA 1O2UA 1P57B 1SGIB 3A85A 2WV4A 1P2QA 3ZZAA 1TGSZ 2CXVA 1XVOA 2Y6TA 1GBHA 4JZ1A 1GJCB 4KTCA 1C1QA 1GI5A 2WHXA 2V0BA 3RDZA 1KXDA 1HDTH 3MU8A 7KMEH 1QJ7B 1BQYA 2A5AA 1XUJA 2C4FH 2ZG0H 1AD8H 2A4GA 1RGQA 5EIYA 1O38A 1GJ4H 3AAVA 2OXSA 4CBNA 1SKYE 3FN8A 1BA8B 3A7WA 1QY6A 5E2PA 1AWFH 1RTKA 1SMFE 1UVUH 3BF6H 2AFQB 4Y10E 5CHBA 2Z94A 1BRAA 1HAHH 1XUGA 5F53A 4JCNA 1AMHA 1C1PA 1P03A 2FOHA 1GHZA 3B8JA 2BZ6H 3FO8D 3LGWA 5E2OA 3RMOH 7GCHG 4ISNA 1F0UA 3VXEH 2LP6A 1KXBA 5IDKA 1O3JA 1P2KA 2Z9IA 1OHHD 4IC6A 1C1OA 1Y3XA 3A86A 3LGYA 3I77A 1FN6A 1FI8A 1O2WA 1NT1A 4O3TA 1G36A 1KXCA 3AAUA 3GCHC 1NY22 5JYIA 2QF0A 3UR9A 1S83A 3L33A 1EOJA 3GDVA 1N6YA 3ZVEA 3A88A 1E38B 1CGHA 5EQSA 2WSSD 1BHXB 2BLWA 1N6XA 4Q7ZA 2R3UA 2W3KA 4XOJA 1H8HD 1ESTA 4GHQA 4UFEH 5DO4H 2Z3EA 1A0JA 1QL9A 5B6OA 1ESAA 1SSXA 5ETXA 2BY6X 1A61H 3OYPA 4MNXA 3IITA 3FZZA 2FOEA 1MTWA 1TNLA 1W14U 4AFUA 1SLXB 1EOLA 2B0FA 1J14A 5FXLA 3A7ZA 3ZVBA 1QIXB 4GCHF 3NUMA 5T1VA 4AN7A 3SGBE 4A1TA 1FN8A 3TLOA 1FLEE 1ZLRA 2KZ4A 3M5NA 1A1RA 4CH2B 5JB8S 4SGBE 1D4PB 4Y11E 1GBMA 3KQ5A 4TPYA 1IQJA 4AB9A 3RXKA 1PPHE 2NU0E 1D3DB 2JH0D 3LH1A 4KKDA 2FTMA 5GIBA 1EAWA 1JIRA 4D9QA 4X1NU 1Q2WA 4BAQB 3KNXA 1DE7H 1YGCH 2J4IA 1VITG 4NIXA 1O3BA 2H1UA 4ZKSU 1ELDE 4BAKB 1ZR0A 1BBRK 1OPHB 5J4QA 1Y5UT 2OC0A 4ABIA 1C4U2 1CU1A 5AFYH 4CRBA 5K7RA 2OC8A 1GHVH 4CHAB 1OWEA 3LDXH 4AB8A 4WWYA 3VPKA 3SUGA 4YT6H 1RIWC 2O8UA 2XNDD 1HJAC 1COWD 2BD5A 2PHBA 4YZUA 4PROA 3URDA 1H9LB 1P12E 4XE4A 2ALVA 3SV7A 2BQ7B 3RC6A 3ZIAD 4RI0A 1F5RA 2V3MA 1NC6A 2VH6A 3RXQA 1ETRH 5A0BA 1CA0C 3OSYA 3OAAD 2J9NA 1ZYOA 3A84A 5JBAS 1RRKA 2BMGB 2KR7A 2UUYA 1T8MA 5EODA 4ZCNA 5KEDA 2F4LA 1ZMLA 2SNWA 3NRLA 1UHBA 1HCGA 1P05A 1ZGVA 4DOQA 5AFZH 4A5TS 5EW2H 2FTLE 2ZCHP 5C1XA 2KX4A 2GT7A 3GCOA 5DG6A 2FM2A 3CP7A 1MZAA 1OXGA 2QXJA 2WUBA 1ELTA 1ANBA 2PKSB 3MH5A 4E7RG 3V12A 3GCNA 1GCTB 5F8ZA 3GDUA 2XCNA 3MO6A 5DPAA 2VWNA 1Q3XA 2GV6A 1YWUA 2D2DA 1W0JD 1GDUA 2VIOA 3SUEA 3V7TA 4DT7B 3O8CA 3F2FA 3Q77A 1A5HA 1FY4A 2WPMS 5DK1A 2XXLA 4X2XA 2G5NA 1HBTH 1C1WH 1FY8E 2FI3E 1O5DH 1VR1H 2JETB 1OWHA 3U8RH 1DWBH 3VB4A 2QV1A 3CENA 1A3BH 1P2MA 1TQ7B 2GX4A 3Q3KA 3UUZA 5E0GA 1W12U 1DY8A 1XKBC 1ID5H 1CHOG 1DOJA 1EAUA 3RC4A 1GBDA 2QCYA 1C2HA 2KM0A 1T7CA 1L4ZA 5EPYA 2OUAA 1S6HA 4DW2U 2BM2A 2BHGA 1P2NA 1P2JA 3E16B 1OWJA 2AS9A 1EB2A 4MPXA 5LGOA 4AG1A 1CVWH 1PQ5A 5T3HA 2VNTA 3UQOA 3PRDA 2HPPH 2FI5E 4YLQH 1UTJA 3K65B 1LHDH 1PYTC 1O5GH 4Y76A 3BTWE 3P70B 1BTUA 2GJGA 3O8BA 5FHTA 1MU6B 1O2QA 3TH3H 5FPTA 1X7AC 5T6FA 2UWOA 2J2UA 2QAAA 4NSVA 4RT0A 1QR3E 5DP5A 6GCHF 2QXIA 1SOTA 3L3TA 3LONA 1A2CH 1NBME 1KDQA 3FP8E 1ESBA 1F2SE 1GMHF 1TGCA 3S7HB 2J5UA 4OS4A 4TWYA 1S0QA 1L0ZA 2CGAA 2BDIA 3TK6A 1LVMA 2AMQA 2I6QA 1O2MA 3ZZ3A 4AX9H 1MBQA 2KCAA 1MKXK 1MTNB 1NRSH 4ZHMU 1ABIH 2H2ZA 1SQTA 1ZHPA 4CHAC 4LK4A 2SGEE 4H4FA 3PLBA 1INCA 1OP8A 1QL8A 1UVPA 3SYJA 3TK5A 1XKAC 2HOBA 1EPTB 3F1SB 5ABWA 2G8TA 1GI6A 1NRNH 1PPEE 1AE5A 1HIAB 3UREA 2BD9A 1J15A 1ELGA 1LMWB 1O2OA 1QZ8A 2ZGJA 3N99A 8GCHF 2P8OB 3BIUH 3EA7A 1AN1E 1LPZB 1BITA 2WINI 3FAOA 3C27B 2ZHDA 4K1SA 3MFJA 4FOUC 5E0JA 4D7FA 1HV7A 4HZHA 3D49H 2RFKC 3STIA 1OSSA 2RDLA 2DE9A 2VJ1A 4XD7D 1DS2E 1GMCF 5HM9A 5SGAE 3PROA 1TALA 1W8BH 2FP7B 1OX1A 1HAGE 1ZSKA 2TPIZ 2AHME 1OYQA 2PKSC 1FJSA 1XUFA 1TQ0B 4FUIA 2P95A 4OS1A 1GCTC 3VB6A 1W13U 2ZO3H 1QCPA 2ZKSA 3TGJE 1C1UH 2NU3E 1O2NA 1UVSH 4OS2A 1JIMA 1O3KA 1GVZA 3T5FH 2IPQX 1C9PA 2ZA5A 3CS7A 3QTOH 3LC5A 4TT3D 5DP4A 1NM6A 3GOVB 2YOLA 3GCTG 4NG9H 1RS0A 2JETC 3GYLB 1QRZA 1XUHA 1W7GH 1GBKA 1C2EA 1DLEA 2EA3A 4NIWA 1TX7A 1YM0A 2VWOA 2D26C 2ZU3A 5L30H 2P3FH 2OC7A 5EW1H 1ELVA 2W26A 2KAIA 3FOAA 4MVNA 1G3BA 1O0DH 4K8BA 1PJPA 1QB9A 1XX9A 1RJXB 1QRWA 4GPGA 1ZOMA 5GWZA 1AKSB 1V2QT 2ZGCA 4MLFB 4D7GA 1IQKA 2TBSA 4NWKA 4ACAA 5JBTA 5TCCA 1HGTH 2R0LA 1DLKB 1UTOA 2HNTF 2HLDD 1C2LA 1D3QB 1LHCH 3T25A 1W0KD 4WJG2 5CMXH 2BOKA 1PPBH 4DIHH 1D6WA 3EAJA 1EZUC 1TNHA 1YLNA 5A2MH 2KFWA 1QNJA 1VJAU 4B75A 1F0SA 3ATLA 3R3GB 2HGTH 2TRMA 1C5PA 2XC0A 3T26A 4X6NA 2GCTB 4CBOA 4XDEA 4NCYA 1YYY1 4Q4LA 3VB5A 2Z7FE 1IQLA 1NU7B 1S0RA 3BTKE 4KP0A 2WPIS 1TBRH 1K22H 1G3DA 4F55A 1K21H 3LJJA 3OFND 4O97A 1UTNA 3TITA 1ZTKA 1THPB 2STAE 1OS8A 1GJ5H 1KY9A 1ARCA 1O3AA 1G3CA 1NS3A 1C5XB 1DPOA 4AGJA 1FV9A 4DVAU 3M35A 3UWJH 3VG8A 1FXYA 1F5KU 2AYWA 4QT8C 2UUKB 5C5OA 1G2MA 3TK9A 1BB0B 2G55A 1AI8H 2IOTA 4GCHG 2WUCA 2BTCE 5DSFA 4TY7A 1MU8B 2JIZD 2BOHB 4YOJA 5GXPA 1GMDF 3F9EA 2P8OC 2P94A 2FMJA 3SV9A 4AG2A 3A8AA 4X0WU 4HTCH 4OS6A 4B2BA 4A1VA 2OC1A 1ZJKA 1Y8TA 1TRNA 1K2I1 1V2UT 2AGGX 4YTAA 3AW1A 2PP6A 2FDAA 4WY3A 1NTPA 1BTHH 1WDIA 2XBYA 3PTNA 2TGTA 4Y0ZE 3HGPA 5A0AE 2Z9LA 1AIXH 1QRXA 3MTYA 3BTDE 3T29A 1GHAF 1HLTH 5FCRA 1ANEA 1O2XA 1MKWH 3UAIC 3F2GA 2ZEBA 3PTBA 1QJ6B 1AY6H 4IC5A 4O9VA 1GI1A 2BD8A 2QE7D 2ZGHA 4X6OA 3SU0A 3F0OA 3TNSA 1SL3A 1OP2A 1KXEA 3MMGA 1C2GA 5EU8A 4ASUD 3U1JB 1V2VT 2DUCA 2OTVA 2J92A 2UUFB 3UWIA 4RN6A 1LDTT 4X1QU 4D9RA 1KYNA 2HVYB 3KQBA 1RTLA 1TIOA 2FEQH 3NPSA 1O33A 4MTBA 2TIOA 1G2LA 1SOZA 2H9HA 3A7VA 5DP6A 2QXHA 4M7GA 3PWBA 1SBWA 2F43B 1HAIH 3NK8A 1SGRE 3QN7A 3VFEA 2O9QA 3GY8A 3UOUA 1Y5BT 1HAOH 5GPIB 5JPMH 3ZZ5A 2UWPA 1O31A 4X8VH 3MOCA 3QUMP 4BOHA 1C5ZB 1XM1A 1QBNA 2GCTC 4R0IA 3UY9A 3BTHE 4YESB 1IQIA 1S85A 2QF3A 1SGPE 1LHEH 1O2GH 1P3EA 1FIWA 2OINA 4U32A 3WWFA 3V0XA 3RXHA 2PKAB 1C1SA 3GY5A 5A8XA 5BRRE 2GDDA 1WQVH 4Q7YA 4AYYB 3M61U 2W7SA 3F2HA 5AVDA 1RIWB 1MAYA 2I6SA 1HJAB 2VWLA 4HI3A 1W2KH 3ZZBA 1JXPA 4B74A 4FVBA 1C9TA 4I8KA 1TE0A 1BT7A 1ELCA 4WMFA 1U6QA 5DKMA 1ELBA 1P9UA 3RUOA 2FYQA 1CO7E 4I8HA 1K1JA 1E0FD 1HAXB 1BCUH 6GCHG 4K3JA 4NWLA 2A5IA 5DN6D 1EZQA 4DGJA 1KXAA 1GMHG 1NPMA 5IK2D 2GD4B 3NCLA 2GDEH 4R8TB 1MQ6A 2R2WU 1FAXA 1E36B 2Z9KA 3QDZB 1A3EH 1V2NT 1S6FA 3NZIA 2ZU2A 1GWAA 2Z3DA 4IGDA 1LVBA 2PWXA 1OWIA 2ZQ1A 1DWDH 3UQVA 1TRYA 3MU4A 1UK3A 4I8GA 4TWWA 3HK6B 4A6LA 3LGVA 5FL7D 2LELA 2KCOA 3SV2H 1OP0A 1SR5C 4NZLA 4ACBA 2JH5D 1AFQB 4D76A 2O8WA 3BG4C 1V2OT 1HFDA 3FP6E 3F9FA 5HMAA 2QGRA 1O3EA 1C2DA 2GZ8A 3RXFA 1GJ8B 2QF5A 1IOEA 1G30B 4GAWA 2RG3A 1PYTD 4X8TH 1BTWA 3SN8A 4MNVA 8GCHG 3GY7A 2BXUH 5PTPA 5EQRA 3SO3A 1S82A 1W11U 1NBMD 1ZZZA 3R0FA 3LJOA 5DJ7A 4JMYA 1DT2A 4IBLH 3OU0A 3SNCA 4X8UH 3K6YA 1GMCG 2BDYA 2BQ6B 5HIZA 4IS5A 4XSKU 2AGEX 2BDHA 4X1SU 3UB0A 2J94A 1SB1H 1OWDA 1V2RT 1W0YH 4F48B 4TPIZ 1P8VC 2A7CA 3TJVA 1Z8JB 3MWIU 2ZPSA 4WMDA 1DWCH 1YP9A 3PB1E 1YPJH 3P8NA 4JZDH 4CRGA 1ELAA 1F5LA 4J1YA 3SHAH 1UCYE 4CRDA 3KQDA 1O3IA 2BVRH 1A4WH 1SGDE 1UTLM 3TJNA 2FI4E 3RLWH 1G9IE 1RD3B 5HXFA 2KCYA 3PV4A 2FXRA 1UTKA 1BRBE 3TPIZ 3DFJA 1P01A 1LO6A 2LPRA 4Y7AA 1TNGA 1LQEA 2FO9A 4HGCA 4H6TA 1A7SA 3T28A 1DSUA 2A0QB 1MKXH 3ATIA 2VVCA 2V3HH 2B8OH 3VXFH 1TPOA 4A1XA 4ABDA 1TGTA 3WY8A 1MMJN 3ZV9A 1EJMA 5FAHA 2V3OH 1SHYA 1DX5M 1KTSB 2XBWA 1E79D 4NSYA 2L74A 2Y80A 4IN1A 2ZF0H 4WMEA 1AE8H 2PR3A 4ZUHA 3RXVA 2PUQH 4AORA 2ZZUH 4H6SB 1NFUA 3SHCH 1PQAA 4NGAH 1ZJDA 4NFFA 1T4UH 1UHBB 1QTFA 4INLA 4ZHLU 2QA9E 2SGFE 1DSTA 4B2CA 1PFXC 3UTUH 1GI2A 1DUEA 1F0TA 2OQ5A 1ARBA 1TLDA 3KF2A 4FU9A 4BXWA 2HNTC 3MH7A 2XBVA 1TWXB 2ZGBH 3TGKE 2ZU5A 4AFSA 1T8LA 1NFYA 3GISB 2NU2E 2H6MA 2ZNKH 2HNTE 4UONA 4GVUA 2GCHF 1MZDA 5DP8A 1Y3YA 5EGMA 2VIPA 1GDQA 2A45B 1AFQC 4JZFH 4DY7B 1L1GA 2M2AA 3B9FH 1MD8A 2ESTE 3FANA 3RXTA 2ANKH 2P93A 3RXSA 3SU6A 1UMAH 3F6UH 1LTOA 2XWBI 1AUJA 4MPWA 4Y7BA 4J2YB 3M36A 3ITIA 1SGEE 3M5LA 3SUDA 1SGNE 3ZVGA 5B6LA 3F9GA 1EFRD 3ATMA 5A8ZA 1RFNA 5HGGA 2BVXH 2C90B 3SJKA 4UDWH 1SVPA 4K5ZA 4YO9A 1W10U 2A7JA 4TSFD 1SFQB 1KLIH 4ZKRU 1EZXC 1GI0A 1WOFA 3K2UA 1C5LH 1DWEH 1V2KT 1GHAG 4MPUA 2BDGA 1C4Y2 3SNDA 1EX3A 2ZFFH 1NFWA 3F3BA 4X2YA 5ESBA 4NA9H 3SNEA 3RMNH 3RXUA 2ZWLH 1QURH 2F91A 1GBJA 2ILNA 2ANMH 1KDQB 2A4OA 4B71A 5EJZA 3RXPA 1CT2E 2BY7X 4FUDA 1VKYA 2GP9B 1GJBB 2ODPA 2QYIA 1BRCE 2P16A 1O2JA 2SGQE 2FOBA 4U01A 5GCHF 2PV9B 1LCYA 3BIVH 1MCTA 2OBQA 1CQQA 1WXRA 1HYLA 3T27A 3A82A 3BEIB 3BTGE 4X1PU 5GJ4B 1NN6A 1A0HB 1O3DA 2ZP0H 2G5VA 3NXPA 4GSOA 1GBTA 3SW2B 2A5KA 1SQAA 3UNQA 4FU8A 1C5NH 2QXGA 1ZRBA 4Y8YA 3EQ0H 5L2YH 3GY4A 2CHAB 4M9FA 4RT1A 3HGNA 1O2ZA 3HKIB 4E06H 3UFAA 5C67A 3SUFA 2FWWA 3ATWA 3QWCH 3SGAE 6ESTA 4BTTB 3PO1B 2HVXA 4E05H 3SI4H 1O37A 4DURA 2BB4A 4B2AA 3UOPA 5LPRA 8LPRA 3F68H 1BTPA 1MAXA 3KCGH 5HYOA 1FY3A 2H5DA 1PPFE 1THSH 1EJAA 1GI8B 3PLKA 4Z6AH 1EASA 3M5OA 5F03A 5F8XA 5HKKD 3G01A 4RKOB 3U8OH 1QGFA 2VINA 2G00A 3ZV8A 1YPHC 4X6MA 1T31A 1O5BB 3UR6A 3SJOA 1SLWB 1ZHRA 5EQQA 1O2HA 2R2MB 3A7YA 1AVGH 1HJ9A 3ZZ7A 3ZVAA 1S5SA 2VVUA 1EKBB 1YPHE 3I29A 3QLPH 5C17A 1FMGA 4INKA 3SNBA 2YNBA 3DSPA 3H09A 3S69A 4B1TA 3SZNA 3OEED 2ZU1A 3E1XB 2IPHA 4ZKNU 1SGFA 4ZHAA 3RXAA 2NU1E 1C5VA 3SBKA 2RDEA 1JRTA 4CH8B 2BDCA 1TOCB 1C2KA 4RKJB 3PMAB 4SGAE 1PQ8A 2FIRH 2ZCLP 5GNDA 3PV2A 3DCLA 4Y0YE 2JJ2D 1GJ7B 4ASHA 1GL0E 2WYJA 5C20A 4B6FA 2KAIB 3GDSA 3E6PH 1EUFA 1DM4B 2ALPA 1TFXA 4DG4A 1SLUB 1NU9A 1J17T 4D8NA 1GVKB 2F3CE 3FFGA 3SOSA 3ZZ9A 1O3FA 3M5MA 4AYVB 3BN9A 4B73A 1GI9B 1F7ZA 1XUIA 2Q6DA 2JKHA 3LGIA 4LZ1H 1C5YB 3FP7E 3H7TA 4Y8ZA 4ZKOU 4BNRA 1P09A 1V2ST 3BTME 4Q80A 2HALA 1ZTLA 1TBQH 1HAZB 8ESTE 2FOGA 2EC9H 3BSQA 3HK3B 3ODDA 3SI3H 1O3OA 3ESTA 3IWMA 1CA8B 3V3MA 3M3TA 2VGCB 2STBE 1BUIA 4ISLA 3RXLA 3SORA 5JBCS 4CR5A 3D23A 2YNAA 1OYTH 4FU7A 1O2VA 1V6DA 4FETA 2QF4A 3VB7A 1YLDA 3E0PB 1YCPK 5E0HA 4B6EA 4XBDA 5AF9H 2EEKA 2P3TB 5TCAA 1NFXA 1RXPA 3SV8A 3SZEA 3KIDU 1FPHH 2CHAC 4JK5A 1LVOA 4DCDA 1MCVA 2ZFQH 1FZZA 1YF4A 2ZIQH 3FZDA 1GPZA 2FOFA 3EE0B 1V2LT 3A7TA 2C93B 3Q3XA 3PO1C 5CDFE 2CF9H 5EXLA 1O3MA 2J98A 1CT0E 2ZDKA 1VCWA 1YCPM 2ZHWH 4I8LA 1EB1H 2A4QA 2ZPQA 1O36A 2H9EH 3RMLH 3RM0H 4Z0KA 1GHWH 3LGTA 2F83A 4JZIA 4F4OC 1HXEH 2Q6FA 4BAOB 7LPRA 3E90B 1GHYH 2A7HA 4YOIA 4Y8XA 4JYUH 1AQ7A 2AIPA 1DANH 1BMNH 1C5SA 2ODQA 4JYTA 1E1QD 4JZEH 2A2XH 1IQHA 2SGPE 3SU2A 4MQAA 3Q76A 1WQSA 1XXDA 3BG4B 3EDXB 1ETSH 2P59A 1Y59T 2B5TB 1CHOF 4ZH8A 1CHGA 2IJD1 2GKVE 3U8TH 3DHKH 1B7XB 1KIGH 1BMMH 1OKXA 1G3EA 4FXGH 1D3PB 2ANYA 2ZECA 2FOCA 2AMPA 1DY9A 4U30A 2WV5A 1W0ZU 3PRBA 2ODYB 1SLVB 1VITH 6CHAB 1SC8U 1A46H 2BY5X 1Y3VA 3SJ8A 5L2ZH 1P02A 5DP7A 1EAXA 1TOMH 2BYAX 1PPCE 2K8IA 2GV7A 2XCFA 1C4V2 1YPKH 4KELA 1O30A 4NA8A 1ZHMA 2GCHG 3JZ1B 5CE1A 2W3IA 2J34A 4WXIA 2THFB 1QBOA 1QBVH 2WPDD 3MNSA 2BD2A 2OQUA 3OY5U 2TGDA 1FX0B 1AVXA 1E1RD 2Z3CA 1KXFA 3A8CA 3MI4A 3QZQA 3S7KB 1TABE 2PTCE 3P17H 5CHAC 1DXPA 4YM9A 3BEUA 5C1UA 3ODFA 2HRVA 1BTYA 1BMFD 2QY0B 3ENSB 1MD7A 3U1IB 3LH3A 1ZMJA 1P3CA 1VGCC 1YY3A 4YLUA 2VGCC 3MH6A 3BTFE 1O39A 2VU8E 3KL6A 1Q31A 7ESTE 2BXTH 4GHTA 1TPSA 5I25A 4I7YH 1BBRH 1VZQH 2G4TA 5BPEA 1SGYE 1TMBH 1Y3WA 5C3NA 3MNXA 4X8SH 1KLTA 1EZSC 2BLVA 2QIQA 1Z8IB 5KGOA 4IW4E 1OOKB 2PFEA 1MTUA 4CREA 2EQNA 5LPEA 2BZAA 2EI8A 1O2IA 1BJVA 3MNCA 1QB6A 3MO3A 2AIQA 2G4UA 1DUAA 3ZVCA 1C5OH 4KGAA 3BTTE 3RXRA 4ABJA 9ESTA 2HWLB 2ZFTA 4XBBA 3F0PA 3TH2H 1QA7A 1GJ6A 2NU4E 4AFZA 2JDID 1NO9H 3TJOA 3NWUA 3KQEA 2FOMB 2ZI2H 3IG6B 4I86A 1MH0A 4K1EA 4OGYA 1BMAA 1XVMA 3M3VA 1UCYK 3M7QA 1GBBA 4NIVA 2V6NA 3MU1A 1P06A 2VIWA 5FPYA 1S84A 1TRMA 2IN2A 1C5QA 3BEFB 1C2JA 1L2EA 1YBWA 5GCHG 1P9SA 4K8YA 1A5GH 2F9OA 1YLCA 2BLOA 1C1VH 1GHBF 1O5CB 2OLGA 3S0NA 1AHTH 1GBFA 3UPEA 1JMOH 1O2YA 3NKKA 4DIIH 3S9BA 1ANDA 1HUTH 4MNYA 4TY6A 2EI7A 1FY1A 4AOQA 3Q00A 1HXFH 1FNIA 1QQ4A 1K1MA 1QB1A 3VB3A 4FUBA 4BANB 2PGQB 3PMHB 2YMSC 4KTUA 3GCTF 3U28C 5LPFA 1JBUH 2G81E 2W6JD 2G52A 4K2YA 3RXCA 3K6ZA 1K1IA 1NROH 2A2QH 2Q6GA 5A8YA 1C5UA 1AWHB 1CE5A 1KSNA 1O2TA 4ABEA 2A32A 4UFGH 1UVOA 3BV9B 1MBMA 4WH8A 2BY9X 2FPZA 1J9CH 1K1PA 4VGCC 2ZC9H 1O5AB 3RXGA 6CHAC 2OP9A 1P2OA 2GTBA 3E3TA 2OD3B 1FAKH 2ZDLA 3VGCB 1KTTB 1K28D 1EQ9A 3CNRA 4ZAEA 1ZRKA 3TJUA 1MKWK 4Q2KA 2W5EA 2J97A 2DE8A 5A09A 4IMZA 1V3XA 3EYDA 3M7TA 2EY4C 1C1NA 1FDPA 3GY3A 1SI5H 1B0FA 1EXFA 1G32B 1Z1JA 3W1EA 2H5CA 1CSOE 1AZ8A 1QL7A 1HAVB 3PM3A 1O5EH 1O34A 1WUNH 1J8AA 2W6ID 4Z1MD 1TMTH 2XRCA 3RC5A 3EE7A 2C3SA 2KCPA 3GYMA 3MH4A 3P8FA 1HAVA 1MQ5A 3AW0A 1ABJH 4Y71A 3ZZCA 3ATKA 4YT7H 4ISOA 3PWCA 2W7UA 1GBIA 3HPTB 1T8NA 5T6GA 3OEHD 1D9IA 2XYAA 2AMDA 2D1JA 1P04A 1W7XH 3RLYH 1GBCA 2UUJB 3I78A 4ABFA 3MU5A 5FPSA 2ZFPH 3RXOA 3V13A 2AEIH 1L1JA 2CF8H 2F9BH 3SJIA 3AASA 3WWBA 4ISHH 2J95A 1XUKA 1WCZA 3M7UA 2NWNA 1WBGB 1SGCA 2LNCA 1IQGA 3RU4E 3RXEA 4CRCA 2O8LA 5H4IB 1ETTH 1LHGH 1K1NA 2Z6BD 1H1BA 2O8TA 3A7XA 2PTNA 5G4BA 2SGDE 3S9AA 1TB6H 2WV9A 4LZ4B 4P02A 5EG4A 3TU7H 3S9CA 1UW7A 1WV7H 2F9PA 4FUCA 2ZGXH 1HAYB 4O3UA 3UNRA 2BX3A 3LU9B 1H8ED 2C8XB 1H8IH 2WYGA 1DDJA 4MPVA 5F8TA 1P11E 3GY2A 5C94A 3DFLA 2JJ1D 4CRFA 4ABAA 3PLPA 2CK3D 4BAMB 5JBBS 3RXJA 5ESTE 3RXDA 2CN0H 2Y81A 1VCPA 4FUFA 1F92A 1BRUP 1AFEH 1Z8RA 1LVYA 2BY8X 3BTQE 3CS0A 3T2NA 1TYNA 1C2MA 2O8MA 2XW9A 3N7EA 1LKAA 1FPCH 1SQRA 5A0CA 1TONA 2VH0A 1H4WA 1GJ9B 2ZPRA 3P95A 3DD2H 5FCKA 2SFAA 1O32A 4NFEA 3C1KA 1XXFA 2GZ7A 1MABB 1GMDG 1H9IE 2BD4A 3H5CB 5C1YA 1HJ8A 1C5RA 4AZ2B 1IQFA 1HAPH 4UFFH 3DT0H 3E8LA 5AHGH 1S81A 4NA7A 1GGDB 3FKSD 3QX5H 1E37B 3MU0A 3RXMA 1O5FH 1AZZA 2ZHFH 3B23B 4IN2A 2F9NA 2ASUB 4GUXA 3SU1A 4AFQA 1A0LA 3VGCC 1IHSH 4I33A 3PMBB 1DXWA 1UVTH 5KECA 1P10A 1TNKA 1HNEE 4Y79A 1C1RA 3SQHE 1D6RA 2AERH 2WPKS 1FQ3A 4NIYA 4BTUB 1O2SA 4O03A 3QO6A 2ZCKP 3D65E 2P3UB 1V2MT 3RMMH 1TPAE 1NESE 3KEEA 4UE7H 4X6PA 1BIOA 3KN2A 4IMQA 2ZFSA 4WH6A 1BBRE 4FUJA 4OGXA 5FBIA 1Z1IA 4X2VA 3QK1A 1AGJA 1C2FA 1SPJA 1ZGIA 2TGAA 2CMYA 2OBOA 1GL1A 1WSSH 3WW7A 1Y3UA 1ORFA 4ESTE 4ISIH 1O3HA 4X1RU 3A87A 2ZDVH 5DP9A 1YCPH 1XMNB 5IYTA 1HB0B 2ZTZA 2M5TA 1AU8A 1MUEB 1C5TA 1GI3A 4ABBA 5DP3A 2C8ZB 2R0KA 3KHVA 3BG8A 5EJLA 4U2WA 1O35A 1FUJA 1C2IA 1TX8A 2XNIA 1QQUA 2Y5FA 3N7DA 3P6ZB 4FUGA 1SGTA 2VB0A 3Q3YA 4Y6DA 4CRAA 5J4SA 4FUEA 5GDSH 1TA6A 1UTQA 4JK6A 2L6OA 2CV3A 2ZQ2A 1UTPA 3A8BA 2Q1JA 3LPRA 2VIQA 1BTXA 4HFPB 3TH4H 2WPJS 1ZPCA 4ZMAH 4THNH 1GJAB 1QA0A 1GBLA 1C1TA 3STJA 1NRQH 1ZSLA 2J38A 4HG6A 5EXNA 1ZSJA 3N7OA 1EATA 1ZTJA 4ZXYH 3OX7U 6LPRA 3EGKH 2FYRA 4B76A 1FY5A 3PV5A 1K0HA 1AVWA 3P92A 1KMHB 4I31A 3SJ9A 1TAWA 2FODA 3ZVDA 3M3SA 3QGNB 3K9XB 2OK5A 3ZZ8A 3U69H 2SNVA 2B9LA 3U98H 4BAHB 3TGIE 3A80A 3TIUA 3E0NB 2BX4A 3SU3A 3A83A 1YC0A 7GCHF 2PLXA 1O2KA 1EPTA 1KLJH 2FLBH 2XWAA 4UD9H 3KQCA 2F9UA 1LHFH 1HIAA 2RCEA 1QJ1B 3HKJB 3EA8A 2Y7XA 2C8YB 2R9PA 4LOYH 1TNJA 1AB9B 1K1LA 1GDNA 4ABHA 5JDUB 1UK2A 2FX6A 5EPNA 2G51A 2RA0A 4MNWA 2V35A 2BD3A 1GG6B 1TPPA 5TJXA 2GVFA 1O2PA 3DSGA 1THRH 1CBWB 3RXIA 4MG3A 1GHBG 1NRPH 1P0SH 2WPLS 2FS8A 3O8RA 1GGDC 3JZ2B 2Y5HA 3P8GA 2GMTB 2A4RA 2RA3A 1N8OB 1O2LA 4FUHA 1SFIA 2VIVA 3MNBA 1TX6A 1BJUA 1NRRH 2K0QA 3ZYDA 2K1QA 1WAYB 4F49A 4OM9A 2GT8A 1WTGH 1GVLA 1T32A 2A31A 3D62A 3ZZ6A 3DSOA 1BOQA 2XTTB 1L4DA 1S6LA 5F6MA 3LT3A 5CHAB 2XBXA 3GICB 4UEHH 4CR9A 1GCDA 1VITF 1GBEA 1O3GA 3PMJA 2Z9JA 4WF8A 2D8WA 1O3CA 2AGIX 1SG8B 1VGCB 4BXSA 2WZQA 2ZTYA 1LPKB 1AKSA 4P00A 3OTJE 4WXVA 2XC4A 3ZZ4A 3SNAA 3OY6U 1SGQE 1TBZH 2FS9A 1DVAH 1QFKH 2ZDAH 1PPZA 2FX4A 4ZROA 2FESH 3QTVH 4A92A 2F9VA 2GGVB 2J98B 1BTZA 2QC2A 3SGQE 4BTIB 2V7QD 2XOKD 3SU5A 2PSYA 1UCYH 3M37A 3TVJB 3MQKC 1SGFG 1Z8GA 4ZXXH 1CT4E 5DGJA 1ZPZA 4X2WA 2YMSD 3ZYEA 1E34B 1C5MD 2VVVA 2TGPZ 3HATH 1LQDB 2ULLA 1HRTH 4Q7XA 1VJ9U 1MTNC 2BDAA 5C0TA 4AC9A 3DUXH 1ZPBA 1EJNA 3RU4T 1GI7B 4RSPA 1AUTC 2Y5GA 1ELFA 1GI4A 1BHXF 4A7IB 5FBEA 4OS5A 1J16A 1EP6A 1H9HE 3MHWU 2PW8H 1EPTC 1MTSA 1EP5A 3LGUA 1Y5AT 2VBCA 3A81A 5C2ZA 2EI6A 2VIDA 2GZ9A 1HPGA 1UTMA 4INHA 2A1DB 3AVZA 3U9AH 1IAUA 2YMSB 2ZTXA 4XFQA 3TNTA 2BDBA 2C8WB 3EA9A 1ELEE 3BTEE 3H7OA 2ZU4A 1SQOA 1Z7KA 1MTVA 3KYGA 4LXBH 1ZMNA 1UJ1A 2FZZA 3UNSA 5C0UA 5JB9S 1AB9C 4JYVH 3W95A 3SV6A 1B0EA 3GS9A 5HM2A 2VWMA 1GG6C 3LKWA 1O3LA 1JRSA 3LIWA 2ZFRH 5EJ1A 1ANCA 2PUXB 1C5WB 4K60A 1TGBA 2FOAA 4H42U 4GLYA 1E35B 1YPLH 2FLRH 1PPGE 2AH4X 1CBWC 4YXWD 1BZXE 4VGCB 1Z71A 3DA9B 1LKBA 4NZQA 1BMLA 4I8JA 1OWKA 1WTHD 4AGKA 1O3NA 1UO6A 4XBCA 2GMTC 2PSXA 4K69A 1N8OC 2Z9GA 1LPGB 1IHTH 1RTFB 1B5GH 2BVSH 5FX6A 4KTSA 2ZHEH 1A5IA 1YPEH 3VEQB 1CGJE 4XRNA 1IQNA 3KYFA 5T6DA 4K1TA 3GCHB 3A89A 5LH8A 1YKTA 2ZDMA 2ZHQH 3RU4D 1GJDB 1L1NA 1O3PB 1WU1A 2CJIA 5I46H 3RXBA 1IQMA 2XC5A 4ABGA 1V2WT 1O2RA 2JH6D 1V2JT 2B7DH 3ELAH 1TNIA 4TYDA 2PGBB 9LPRA 3KGPA 4DT4A 1W3CA 4FVDA 1JWTA 3T62A 8KME2 4YOGA 2WPHS 1ACBE 4OS7A 4DJZB 1PQ7A 3W94A 3QGJA 1V2PT 2BD7A 2QN5T 2R3YA 5K0HA 2Y7ZA 1AO5A 1T4VH 3SQEE 3LOXA 3OTPA 3GY6A 3QZRA 3P8OA 3ZVFA 3LC3A 1M9UA 2ANWA 3SU4A 2Y82A 2IJOB 5C5NA 1FONA 4I32A 1SHHB 5HIYA 5EXMA 1BDAA 1N1LA 2BLQA 1H8DH 3MYWA 2ZDNA 3A8DA 3RP2A 1C1MA 1UK4A
chains in the Genus database with same CATH topology
1K9OE 5E8EH 1DICA 1F0RA 1T8OA 1D3TB 5FX5A 3UIRA 4WVPE 3FVFB 1CGIE 1GBAA 1Z6JH 2OCVB 3RM2H 1K1OA 1WYKA 5EOKA 1DFPA 1TGNA 2H9TH 3O8DA 1G37A 1NZQH 3L6PA 5L6NH 2HPQH 4E7NA 4UFDH 1FIZA 1JOUB 2HLCA 3E91A 2UWLA 1YPGH 2PKAA 3ZZDA 4MDSA 1VCQA 3PYHA 1YPMH 3URCA 3MO9A 1CA0B 2SGAA 3F9HA 1DITH 1QHRB 1TA2A 1EAIA 1V2TT 1IQEA 2BQWB 1TMUH 1P2IA 1GHXH 1Z6EA 1O2UA 1P57B 1SGIB 3A85A 2WV4A 1P2QA 3ZZAA 1TGSZ 2CXVA 1XVOA 2Y6TA 1GBHA 4JZ1A 1GJCB 4KTCA 1C1QA 1GI5A 2V0BA 3RDZA 1KXDA 1HDTH 3MU8A 7KMEH 1QJ7B 1BQYA 2A5AA 1XUJA 2C4FH 2ZG0H 1AD8H 2A4GA 1RGQA 1O38A 1GJ4H 3AAVA 2OXSA 4CBNA 1BA8B 3A7WA 1QY6A 5E2PA 1AWFH 1RTKA 1SMFE 1UVUH 3BF6H 2AFQB 4Y10E 2Z94A 1BRAA 1HAHH 1XUGA 4JCNA 1AMHA 1C1PA 1P03A 2FOHA 1GHZA 3B8JA 2BZ6H 3LGWA 5E2OA 3RMOH 7GCHG 4ISNA 1F0UA 3VXEH 1KXBA 5IDKA 1O3JA 1P2KA 2Z9IA 4IC6A 1C1OA 1Y3XA 3A86A 3LGYA 3I77A 1FN6A 1FI8A 1O2WA 1NT1A 4O3TA 1G36A 1KXCA 3AAUA 3GCHC 1NY22 5JYIA 2QF0A 3UR9A 1S83A 3L33A 1EOJA 3GDVA 1N6YA 3ZVEA 3A88A 1E38B 1CGHA 5EQSA 1BHXB 2BLWA 1N6XA 4Q7ZA 2R3UA 2W3KA 4XOJA 1ESTA 4GHQA 4UFEH 5DO4H 2Z3EA 1A0JA 1QL9A 5B6OA 1ESAA 1SSXA 5ETXA 2BY6X 1A61H 3OYPA 4MNXA 3IITA 3FZZA 2FOEA 1MTWA 1TNLA 1W14U 4AFUA 1SLXB 1EOLA 2B0FA 1J14A 5FXLA 3A7ZA 3ZVBA 1QIXB 4GCHF 3NUMA 4AN7A 3SGBE 4A1TA 1FN8A 3TLOA 1FLEE 1ZLRA 3M5NA 1A1RA 4CH2B 5JB8S 4SGBE 1D4PB 4Y11E 1GBMA 4TPYA 1IQJA 4AB9A 3RXKA 1PPHE 2NU0E 1D3DB 2JH0D 3LH1A 4KKDA 2FTMA 5GIBA 1EAWA 1JIRA 4D9QA 4X1NU 1Q2WA 4BAQB 3KNXA 1DE7H 1YGCH 2J4IA 1VITG 4NIXA 1O3BA 2H1UA 4ZKSU 1ELDE 4BAKB 1ZR0A 1BBRK 1OPHB 5J4QA 1Y5UT 2OC0A 4ABIA 1C4U2 1CU1A 5AFYH 4CRBA 5K7RA 2OC8A 1GHVH 4CHAB 1OWEA 3LDXH 4AB8A 4WWYA 3VPKA 3SUGA 4YT6H 1RIWC 2O8UA 1HJAC 2BD5A 4YZUA 2PHBA 4PROA 3URDA 1H9LB 1P12E 4XE4A 2ALVA 3SV7A 2BQ7B 3RC6A 1F5RA 1NC6A 2VH6A 3RXQA 1ETRH 5A0BA 1CA0C 3OSYA 2J9NA 1ZYOA 3A84A 5JBAS 1RRKA 2BMGB 2UUYA 1T8MA 5EODA 1ZMLA 2SNWA 1UHBA 1HCGA 1P05A 1ZGVA 4DOQA 5AFZH 4A5TS 5EW2H 2FTLE 2ZCHP 5C1XA 2GT7A 3GCOA 5DG6A 2FM2A 3CP7A 1MZAA 1OXGA 2QXJA 2WUBA 1ELTA 1ANBA 2PKSB 3MH5A 4E7RG 3V12A 3GCNA 1GCTB 5F8ZA 3GDUA 2XCNA 3MO6A 5DPAA 2VWNA 1Q3XA 2GV6A 2D2DA 1GDUA 2VIOA 3SUEA 3V7TA 4DT7B 3O8CA 3Q77A 1A5HA 1FY4A 2WPMS 5DK1A 2XXLA 4X2XA 2G5NA 1HBTH 1C1WH 1FY8E 2FI3E 1O5DH 1VR1H 2JETB 1OWHA 3U8RH 1DWBH 3VB4A 2QV1A 3CENA 1A3BH 1P2MA 1TQ7B 2GX4A 3Q3KA 3UUZA 5E0GA 1W12U 1DY8A 1XKBC 1ID5H 1CHOG 1DOJA 1EAUA 3RC4A 1GBDA 2QCYA 1C2HA 1T7CA 1L4ZA 5EPYA 2OUAA 1S6HA 4DW2U 2BM2A 2BHGA 1P2NA 1P2JA 3E16B 1OWJA 2AS9A 1EB2A 4MPXA 5LGOA 4AG1A 1CVWH 1PQ5A 5T3HA 2VNTA 3UQOA 2HPPH 2FI5E 4YLQH 1UTJA 3K65B 1LHDH 1PYTC 1O5GH 4Y76A 3BTWE 3P70B 1BTUA 3O8BA 5FHTA 1MU6B 1O2QA 3TH3H 5FPTA 1X7AC 5T6FA 2UWOA 2J2UA 2QAAA 4NSVA 1QR3E 5DP5A 6GCHF 2QXIA 1SOTA 3L3TA 3LONA 1A2CH 1KDQA 3FP8E 1ESBA 1F2SE 1GMHF 1TGCA 3S7HB 4OS4A 4TWYA 1S0QA 1L0ZA 2CGAA 2BDIA 3TK6A 1LVMA 2AMQA 2I6QA 1O2MA 3ZZ3A 4AX9H 1MBQA 1MKXK 1MTNB 1NRSH 4ZHMU 1ABIH 2H2ZA 1SQTA 1ZHPA 4CHAC 4LK4A 2SGEE 4H4FA 3PLBA 1INCA 1OP8A 1QL8A 1UVPA 3TK5A 1XKAC 2HOBA 1EPTB 3F1SB 5ABWA 2G8TA 1GI6A 1NRNH 1PPEE 1AE5A 1HIAB 3UREA 2BD9A 1J15A 1ELGA 1LMWB 1O2OA 2ZGJA 8GCHF 2P8OB 3BIUH 3EA7A 1AN1E 1LPZB 1BITA 2WINI 3FAOA 3C27B 2ZHDA 4K1SA 3MFJA 5E0JA 4D7FA 1HV7A 4HZHA 3D49H 3STIA 1OSSA 2RDLA 2DE9A 2VJ1A 1DS2E 1GMCF 5HM9A 5SGAE 3PROA 1TALA 1W8BH 2FP7B 1OX1A 1HAGE 1ZSKA 2TPIZ 1OYQA 2PKSC 1FJSA 1XUFA 1TQ0B 4FUIA 2P95A 4OS1A 1GCTC 3VB6A 1W13U 2ZO3H 1QCPA 2ZKSA 3TGJE 2NU3E 1C1UH 1O2NA 1UVSH 4OS2A 1JIMA 1O3KA 1GVZA 3T5FH 1C9PA 2ZA5A 3CS7A 3QTOH 3LC5A 5DP4A 1NM6A 3GOVB 2YOLA 3GCTG 4NG9H 1RS0A 2JETC 3GYLB 1QRZA 1XUHA 1W7GH 1GBKA 1C2EA 1DLEA 2EA3A 4NIWA 1TX7A 1YM0A 2VWOA 2D26C 2ZU3A 5L30H 2P3FH 2OC7A 5EW1H 1ELVA 2W26A 2KAIA 4MVNA 1G3BA 1O0DH 4K8BA 1PJPA 1QB9A 1XX9A 1RJXB 1QRWA 4GPGA 1ZOMA 5GWZA 1AKSB 1V2QT 2ZGCA 4MLFB 4D7GA 1IQKA 2TBSA 4NWKA 5JBTA 5TCCA 1HGTH 2R0LA 1DLKB 1UTOA 2HNTF 1C2LA 1D3QB 1LHCH 3T25A 4WJG2 5CMXH 2BOKA 1PPBH 4DIHH 1D6WA 3EAJA 1EZUC 1TNHA 5A2MH 1QNJA 1VJAU 4B75A 1F0SA 3ATLA 3R3GB 2HGTH 2TRMA 1C5PA 2XC0A 3T26A 4X6NA 2GCTB 4CBOA 4XDEA 4NCYA 1YYY1 3VB5A 2Z7FE 1IQLA 1NU7B 1S0RA 3BTKE 4KP0A 2WPIS 1TBRH 1K22H 1G3DA 1K21H 3LJJA 4O97A 1UTNA 3TITA 1ZTKA 1THPB 2STAE 1OS8A 1GJ5H 1KY9A 1ARCA 1O3AA 1G3CA 1NS3A 1C5XB 1DPOA 4AGJA 1FV9A 4DVAU 3M35A 3UWJH 1FXYA 1F5KU 2AYWA 4QT8C 2UUKB 5C5OA 1G2MA 3TK9A 1BB0B 2G55A 1AI8H 2IOTA 4GCHG 2WUCA 2BTCE 4TY7A 1MU8B 2BOHB 4YOJA 5GXPA 1GMDF 3F9EA 2P8OC 2P94A 2FMJA 3SV9A 4AG2A 3A8AA 4X0WU 4HTCH 4OS6A 4B2BA 4A1VA 2OC1A 1ZJKA 1Y8TA 1TRNA 1K2I1 1V2UT 2AGGX 4YTAA 3AW1A 2FDAA 4WY3A 1NTPA 1BTHH 2XBYA 3PTNA 2TGTA 4Y0ZE 3HGPA 5A0AE 2Z9LA 1AIXH 1QRXA 3MTYA 3BTDE 3T29A 1GHAF 1HLTH 5FCRA 1ANEA 1O2XA 1MKWH 2ZEBA 3PTBA 1QJ6B 1AY6H 4IC5A 4O9VA 1GI1A 2BD8A 2ZGHA 4X6OA 3SU0A 3TNSA 1SL3A 1OP2A 1KXEA 3MMGA 1C2GA 5EU8A 3U1JB 1V2VT 2DUCA 2OTVA 2J92A 2UUFB 3UWIA 4RN6A 1LDTT 4X1QU 4D9RA 1KYNA 3KQBA 1RTLA 1TIOA 2FEQH 3NPSA 1O33A 4MTBA 2TIOA 1G2LA 1SOZA 2H9HA 3A7VA 5DP6A 2QXHA 4M7GA 3PWBA 1SBWA 1HAIH 3NK8A 1SGRE 3QN7A 3VFEA 2O9QA 3GY8A 3UOUA 1Y5BT 1HAOH 5GPIB 5JPMH 3ZZ5A 2UWPA 1O31A 4X8VH 3MOCA 3QUMP 4BOHA 1C5ZB 1XM1A 1QBNA 2GCTC 4R0IA 3UY9A 3BTHE 4YESB 1IQIA 1S85A 2QF3A 1SGPE 1LHEH 1O2GH 1P3EA 1FIWA 2OINA 4U32A 3V0XA 3RXHA 2PKAB 1C1SA 3GY5A 5A8XA 5BRRE 2GDDA 1WQVH 4Q7YA 4AYYB 3M61U 2W7SA 5AVDA 1RIWB 1MAYA 2I6SA 1HJAB 2VWLA 4HI3A 1W2KH 3ZZBA 1JXPA 4B74A 4FVBA 1C9TA 4I8KA 1TE0A 1BT7A 1ELCA 4WMFA 1U6QA 5DKMA 1ELBA 1P9UA 3RUOA 2FYQA 1CO7E 4I8HA 1K1JA 1E0FD 1HAXB 1BCUH 6GCHG 4K3JA 4NWLA 2A5IA 1EZQA 4DGJA 1KXAA 1GMHG 1NPMA 2GD4B 3NCLA 2GDEH 4R8TB 1MQ6A 2R2WU 1FAXA 1E36B 2Z9KA 3QDZB 1A3EH 1V2NT 1S6FA 3NZIA 2ZU2A 1GWAA 2Z3DA 4IGDA 1LVBA 2PWXA 1OWIA 2ZQ1A 1DWDH 3UQVA 1TRYA 3MU4A 1UK3A 4I8GA 4TWWA 3HK6B 4A6LA 3LGVA 3SV2H 1OP0A 1SR5C 4NZLA 2JH5D 1AFQB 4D76A 2O8WA 3BG4C 1V2OT 1HFDA 3FP6E 3F9FA 5HMAA 2QGRA 1O3EA 1C2DA 2GZ8A 3RXFA 1GJ8B 1IOEA 1G30B 4GAWA 2RG3A 1PYTD 4X8TH 1BTWA 3SN8A 4MNVA 8GCHG 3GY7A 2BXUH 5PTPA 5EQRA 3SO3A 1S82A 1W11U 1ZZZA 3R0FA 3LJOA 5DJ7A 4JMYA 1DT2A 4IBLH 3OU0A 3SNCA 4X8UH 3K6YA 1GMCG 2BDYA 2BQ6B 4IS5A 4XSKU 2AGEX 2BDHA 4X1SU 2J94A 1SB1H 1OWDA 1V2RT 1W0YH 4TPIZ 1P8VC 2A7CA 3TJVA 1Z8JB 3MWIU 2ZPSA 4WMDA 1DWCH 1YP9A 3PB1E 1YPJH 3P8NA 4JZDH 4CRGA 1ELAA 1F5LA 4J1YA 3SHAH 1UCYE 4CRDA 3KQDA 1O3IA 2BVRH 1A4WH 1SGDE 1UTLM 3TJNA 2FI4E 3RLWH 1G9IE 1RD3B 5HXFA 3PV4A 2FXRA 1UTKA 1BRBE 3TPIZ 3DFJA 1P01A 1LO6A 2LPRA 4Y7AA 1TNGA 1LQEA 2FO9A 4HGCA 4H6TA 1A7SA 3T28A 1DSUA 2A0QB 1MKXH 3ATIA 2VVCA 2V3HH 2B8OH 3VXFH 1TPOA 4A1XA 4ABDA 1TGTA 3WY8A 1MMJN 3ZV9A 1EJMA 5FAHA 2V3OH 1SHYA 1DX5M 1KTSB 2XBWA 4NSYA 4IN1A 2Y80A 2ZF0H 4WMEA 1AE8H 2PR3A 4ZUHA 3RXVA 2PUQH 4AORA 2ZZUH 4H6SB 1NFUA 3SHCH 1PQAA 4NGAH 1ZJDA 4NFFA 1T4UH 1UHBB 1QTFA 4INLA 4ZHLU 2QA9E 2SGFE 1DSTA 4B2CA 1PFXC 3UTUH 1GI2A 1DUEA 1F0TA 2OQ5A 1ARBA 1TLDA 3KF2A 4FU9A 4BXWA 2HNTC 3MH7A 2XBVA 1TWXB 2ZGBH 3TGKE 2ZU5A 4AFSA 1T8LA 1NFYA 3GISB 2NU2E 2H6MA 2ZNKH 2HNTE 4UONA 4GVUA 2GCHF 1MZDA 5DP8A 1Y3YA 5EGMA 2VIPA 1GDQA 2A45B 1AFQC 4JZFH 4DY7B 1L1GA 3B9FH 1MD8A 2ESTE 3FANA 3RXTA 2ANKH 2P93A 3RXSA 3SU6A 1UMAH 3F6UH 1LTOA 2XWBI 1AUJA 4MPWA 4Y7BA 4J2YB 3M36A 3ITIA 1SGEE 3M5LA 3SUDA 1SGNE 3ZVGA 3F9GA 3ATMA 5A8ZA 1RFNA 5HGGA 2BVXH 2C90B 3SJKA 4UDWH 1SVPA 4K5ZA 4YO9A 1W10U 2A7JA 1SFQB 1KLIH 4ZKRU 1EZXC 1GI0A 1WOFA 3K2UA 1C5LH 1DWEH 1V2KT 1GHAG 4MPUA 2BDGA 1C4Y2 3SNDA 1EX3A 2ZFFH 1NFWA 4X2YA 5ESBA 4NA9H 3SNEA 3RMNH 3RXUA 2ZWLH 1QURH 2F91A 1GBJA 2ILNA 2ANMH 1KDQB 2A4OA 4B71A 3RXPA 1CT2E 2BY7X 4FUDA 2GP9B 1GJBB 2ODPA 2QYIA 1BRCE 2P16A 1O2JA 2SGQE 2FOBA 4U01A 5GCHF 2PV9B 1LCYA 3BIVH 1MCTA 2OBQA 1CQQA 1HYLA 3T27A 3A82A 3BEIB 3BTGE 4X1PU 5GJ4B 1NN6A 1A0HB 1O3DA 2ZP0H 2G5VA 3NXPA 4GSOA 1GBTA 3SW2B 2A5KA 1SQAA 3UNQA 4FU8A 1C5NH 2QXGA 1ZRBA 4Y8YA 3EQ0H 5L2YH 3GY4A 2CHAB 3HGNA 1O2ZA 3HKIB 4E06H 3UFAA 5C67A 3SUFA 2FWWA 3ATWA 3QWCH 3SGAE 6ESTA 4BTTB 3PO1B 2HVXA 4E05H 3SI4H 1O37A 4DURA 2BB4A 4B2AA 3UOPA