1TNIA

Prediction of novel serine protease inhibitors
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Prediction of new serine proteinase inhibitors.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 51
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1994-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tniA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tniA02
3BTHE 2FOHA 3A80A 3KHVA 1FN6A 1AWFH 4AN7A 1UHBB 3K2UA 1V2VT 3V13A 1KY9A 1EJMA 4SGBE 2ODPA 2FLRH 1EUFA 2FOBA 4XBBA 1JIMA 1ZR0A 1B0EA 1C1NA 4B2AA 1Y5BT 3PB1E 3RC4A 5K0HA 4SGAE 1NU9A 1A2CH 2ZHWH 1FAKH 1MKWK 2UWOA 4E05H 2FS8A 1SGNE 3QUMP 1SLXB 3UQVA 3MU0A 3T62A 5ABWA 1MD8A 2BX4A 1DUAA 2G51A 1FXYA 1LKBA 1C1SA 1E0FD 4NFEA 1SFQB 2FXRA 2P94A 2ZECA 4Y10E 3VFEA 3L33A 1D4PB 1RIWC 2OC0A 3P8GA 2ZCKP 1CVWH 4VGCB 3VB7A 1C5QA 4IC6A 4Y0ZE 5EXMA 1E38B 1OWDA 4Y7AA 1O3OA 4I33A 1Z7KA 3UR6A 1J9CH 4X6NA 3ZZ9A 1W8BH 4IC5A 1RJXB 3PMHB 1O2UA 1DUEA 2XWBI 3TGJE 1UTJA 3QZQA 1L4ZA 5DP6A 1BBRK 2VVUA 1AUJA 3UQOA 1TNIA 1IAUA 3A87A 5A8ZA 1JBUH 1C5XB 1OKXA 3MYWA 3PV4A 1SGFA 1ELFA 1OWEA 3PO1B 1CT4E 2ZU2A 1AN1E 2P59A 1MKXH 3BTDE 2OINA 2BQ7B 3M3VA 1YF4A 1THSH 3LPRA 3UNSA 1GI0A 4CBNA 4O9VA 4AFUA 2ZTZA 4OS4A 3SBKA 1NRQH 3M5MA 4XE4A 5DP5A 3QLPH 1PQ8A 1GI7B 4B1TA 1T8MA 3QTVH 1DWEH 1S85A 2H9HA 2WPJS 5FBEA 1GDUA 3ATWA 1GHBF 2OBQA 1S6HA 3UREA 2HPQH 3FAOA 2NU2E 1GVZA 1ZPCA 4LZ1H 2Z3CA 1IQGA 1GG6B 3RMLH 3VB6A 4TPIZ 3DT0H 3F9FA 4Q80A 1ACBE 1WUNH 1XUGA 2BDGA 1RTLA 1LPKB 2ZFSA 2D26C 4GCHG 3TK6A 3LGUA 2GT7A 1DDJA 1YPGH 1HJAB 1K1PA 2SGAA 2YOLA 1XX9A 3RXLA 4DW2U 1GCDA 1SBWA 2XBXA 4X1QU 1NRRH 1QQUA 2FI5E 1YPHE 4AGKA 3RXJA 3DD2H 4MLFB 1ELAA 1K1OA 1PYTC 4K69A 1W7GH 3SZNA 3IG6B 1AFQB 3RXPA 4MVNA 4CRGA 2ZNKH 4MDSA 4ABEA 4X0WU 1WSSH 1OOKB 1MQ5A 4IN1A 1ZPBA 1LKAA 2ALPA 1HNEE 1O2TA 1B0FA 1W10U 2VH6A 2DUCA 1A3BH 1IOEA 3TJVA 1MKWH 4Y79A 5G4BA 2P8OC 2Z6BD 2AIQA 3GCNA 5F6MA 1LTOA 4MNXA 1F0SA 3TH3H 3R0FA 2OCVB 1YGCH 2QGRA 1J14A 1XVOA 4H6TA 5FPYA 3VXFH 3LGWA 2AGGX 7LPRA 3S0NA 1CT0E 3MNSA 5IYTA 1A0LA 1TPAE 2WYGA 2BHGA 2PKAA 4WVPE 2D8WA 2ZI2H 3M61U 1OWIA 2ZFRH 2CF9H 1FY8E 4H42U 1OX1A 1EASA 4MTBA 1BHXB 1GMCF 3E1XB 3TU7H 1F0TA 1NZQH 2H2ZA 1T8OA 3SORA 1SR5C 1ZGIA 2KAIA 1HCGA 1G3CA 1KLIH 1G2MA 1BBRH 3RLWH 2FI4E 3LH3A 1CHGA 1MTVA 1FI8A 4WY3A 3RXVA 3RXCA 1WTHD 2RA0A 1C2GA 3QGNB 1VCPA 1Z1IA 1BT7A 4HZHA 4BTUB 1C2DA 1J8AA 1GPZA 5L30H 1LO6A 1W0YH 1YYY1 3A89A 1N6YA 3SI3H 2O8LA 1QB6A 1RS0A 1L1GA 1EP5A 1H9LB 1WV7H 3F9GA 2Q6GA 1JOUB 1UK4A 3UNRA 1BITA 1O5CB 1LCYA 2VIOA 4YOGA 1BCUH 2XRCA 3ZZCA 3MNCA 4I8JA 2AIPA 1TFXA 4TPYA 2H9EH 4FUDA 1FIWA 5A09A 3M35A 1K28D 3SNBA 4ZHLU 5A0BA 1EPTA 4X8TH 3SNCA 3D49H 8ESTE 3V7TA 5L2ZH 4ISNA 1P05A 3Q3KA 4X8VH 4ZROA 2QF3A 4CREA 1TOMH 3EA7A 4FUBA 1CHOF 4M7GA 5C1UA 1V2UT 3EE0B 3OX7U 2XCNA 2ZEBA 1FJSA 2BLWA 3PROA 1C5SA 1TGTA 3RXGA 2O8UA 1TX6A 2XXLA 1T8LA 1SGQE 1D6RA 2EEKA 2QV1A 2UUJB 4ABBA 2PKSC 1DVAH 3SHCH 1GJ5H 1TNLA 1C5VA 2G5NA 1HUTH 2A2QH 1HAZB 3A7ZA 1BRBE 2WV4A 2J38A 3ODFA 1W14U 4ZKOU 3OY6U 3RXSA 3U8RH 2AMPA 2FM2A 1K1MA 3RXQA 4H4FA 3LOXA 1AU8A 3E0NB 4OS6A 4I8LA 4AORA 1T8NA 3KEEA 2OXSA 1AVXA 1N8OB 1P2MA 1SI5H 2J2UA 2GCTC 3SU6A 1UTNA 1SGTA 4AYVB 1F5KU 4UFGH 4TWWA 2ZG0H 5HGGA 1O3MA 1P3CA 2QF0A 4MPWA 3RMNH 1P9UA 1DLEA 3T26A 1RXPA 1ZPZA 4WXIA 2PTNA 2PHBA 1EZUC 4U01A 1CSOE 1VGCB 3LIWA 3LT3A 1ANDA 3B23B 2FYQA 1OP2A 2Y5HA 1AE8H 1O31A 5BPEA 4A1XA 4AB9A 1FV9A 1HYLA 1SMFE 4B74A 5JBTA 5GIBA 1TGSZ 5PTPA 1O32A 1C5UA 3E0PB 1GMDF 1EKBB 4Y0YE 2VJ1A 2GDEH 3TLOA 3MU4A 3M5OA 1TQ7B 3ESTA 4NA8A 2A4QA 2CN0H 1Z8IB 5FPTA 3BN9A 4K1EA 1EB2A 1O2PA 2PKAB 3EDXB 1O34A 1KLJH 3GYLB 1L2EA 2QYIA 2GCHF 1A61H 3MO3A 1O39A 1BOQA 5AHGH 2BD7A 3V12A 2ULLA 3A7XA 5C3NA 4CRCA 2ZP0H 1QBOA 1QFKH 2BX3A 2SNVA 4OGYA 4UFEH 1GI8B 1G9IE 3S69A 1GL1A 1OWKA 3QZRA 2A2XH 5EGMA 5AFYH 1UHBA 8LPRA 3OU0A 4O03A 4DVAU 5JB9S 2XC4A 4ZHMU 2AMQA 5AFZH 3O8BA 2AERH 1S0RA 1C1VH 2IOTA 1G32B 2BOHB 4X8UH 4CHAB 7GCHF 2HGTH 2BVXH 2ZPSA 1GJCB 1UK3A 4THNH 5ESBA 1GBAA 2P93A 1AB9B 1ZRKA 1TIOA 1GI3A 2B9LA 4CRBA 3F68H 3A7TA 4ZMAH 3RXEA 3VEQB 5I46H 1C5NH 1GI2A 1K1LA 1ELBA 4A6LA 4X6OA 3ZYEA 4JZ1A 3MNBA 2WUBA 1TALA 2A4GA 1GCTC 1KDQB 1MMJN 1C1WH 3SV7A 1GHYH 1O5AB 4UFFH 1A1RA 1UK2A 5TJXA 1YPEH 1L4DA 1YPHC 1UCYH 3UFAA 3H5CB 5EPYA 1QJ7B 2FZZA 4X2YA 1FLEE 1SQOA 2FOGA 2R9PA 3HK3B 1GBMA 2Y6TA 2W7SA 1AVWA 1NU7B 3RXAA 1YP9A 4FUFA 3FANA 2A1DB 3E3TA 4Z6AH 1YLCA 3U98H 3SUFA 1UTQA 1VJAU 2ASUB 1QHRB 1C9PA 1TA6A 1W0ZU 5T6DA 1BDAA 1OP0A 4IMQA 3ZV9A 4WXVA 1MH0A 1ZSJA 1O3LA 2ALVA 1AGJA 2AYWA 2R2MB 3M3TA 1OYQA 5C20A 1C1PA 3S9BA 1V2KT 2H9TH 1P11E 2OP9A 3BTTE 2G8TA 3AW0A 1HAVA 1V2TT 4NFFA 1C2KA 1TB6H 1SPJA 2ZDLA 1GDNA 1OYTH 5DP3A 3SW2B 1AY6H 3SU0A 4TWYA 3R3GB 3V0XA 2BZAA 4DG4A 2BDYA 8GCHF 4DCDA 1O3GA 1ZSLA 1O3NA 2XNIA 5CMXH 2A5IA 4CH2B 1EAUA 1HAOH 1EZXC 2PGBB 5ESTE 1Y5AT 4OS2A 1CQQA 1F92A 2IN2A 1O5BB 1AZZA 4K60A 3PMBB 2HPPH 1QGFA 3BTEE 1ANCA 4YM9A 2VWLA 5H4IB 5B6OA 1NFXA 3RXKA 1G30B 4ZXXH 2ZFPH 2V35A 1C5LH 4YOIA 1N6XA 4JYVH 4BAHB 2BXTH 4A1VA 3MH4A 1JMOH 2F3CE 1UTLM 1G37A 2QCYA 3RP2A 3SUGA 3NZIA 1F0RA 4U32A 2RA3A 1BJVA 1P2JA 2GMTC 1C2IA 1TMTH 4MG3A 3BEUA 1P09A 4Q2KA 4I32A 1IQKA 5HXFA 2JETB 3MOCA 1ZLRA 3P70B 2M5TA 3RC6A 3SUEA 2A31A 1AKSB 3BTME 4J1YA 3BTKE 1ZTKA 1D3DB 3BG4B 2R2WU 2BZ6H 1DXWA 1HJ8A 3RXOA 4B76A 1Z8RA 2BB4A 3F1SB 3NKKA 3HATH 4KTSA 1NESE 1O3AA 1YCPK 2TPIZ 1V2QT 1A4WH 1GJ8B 1SLVB 1SHYA 2UUYA 2EI6A 2HNTF 3ZVAA 3ZZAA 1O33A 1O3CA 3UUZA 3U1JB 3BEFB 3MH6A 2FESH 9ESTA 4UD9H 1FAXA 4D7GA 2C8YB 3A8DA 4FUEA 4B73A 2A32A 2ZQ1A 1TPPA 1O30A 3GCOA 3A7YA 4E06H 2TRMA 6GCHF 1C1OA 2H5CA 1GBLA 2ZPQA 3FP6E 3IWMA 1GWAA 4D8NA 5BRRE 3HGNA 1OS8A 1DY9A 1S5SA 1ELGA 1FY1A 1JXPA 5GXPA 1TGNA 4WF8A 1EB1H 4JK6A 4ZXYH 3GISB 1GHBG 1NFUA 3TK9A 1PJPA 4RSPA 1Y3WA 1O3FA 4CRAA 3H7OA 1TWXB 1BRAA 3D65E 2ZHDA 2GZ7A 4A7IB 2V0BA 4BTIB 1XUKA 4ZKNU 4A92A 3MU5A 5T6GA 3M5LA 1C5TA 1DSUA 1V2NT 4ABAA 1PPZA 1TBZH 5A8YA 2FX4A 3ZVEA 1F7ZA 2VWOA 4YO9A 1C1TA 2HNTE 5L2YH 2XC0A 5C67A 1CBWC 1W3CA 3UTUH 4Y76A 1DICA 3NUMA 7KMEH 2LNCA 4BXWA 3E6PH 4FUCA 1EZSC 1FPHH 5A0AE 4Y6DA 2ANKH 3UIRA 1EXFA 3AVZA 4D7FA 3QWCH 2BDBA 3PLKA 4F49A 1BMMH 1O2WA 4FUHA 3RXIA 5JBBS 1IQIA 3SV9A 2XBWA 2TGTA 3EGKH 2CV3A 2ZU3A 2OLGA 1EAIA 3GY6A 3HGPA 1NM6A 1HAVB 4ZKSU 1V3XA 2G00A 1X7AC 1OSSA 1TRMA 1O2MA 2ZFFH 4DY7B 1S82A 4A1TA 2F91A 1HIAB 3UY9A 1Q31A 5F8ZA 1MTUA 2GVFA 1BHXF 2ZDVH 2J95A 1AB9C 1Z6JH 4Q7YA 3T2NA 4ZUHA 5HM9A 1TNKA 1MCTA 1YCPM 2P95A 4MNYA 3ZVDA 2WUCA 2F9PA 1ZTLA 2PUQH 2VGCB 2ZFQH 1EPTC 4KELA 1IQNA 1ELCA 2BXUH 1SL3A 2TBSA 1RGQA 3ZZ6A 3P8OA 1O5GH 1VCWA 1GJ9B 5EQQA 9LPRA 1C2MA 4OGXA 1LPZB 1XXFA 1GMCG 5C2ZA 4PROA 1GBEA 1TMUH 2TIOA 3MNXA 4KKDA 5HYOA 1S81A 2DE8A 3RMOH 2BOKA 2Y5GA 1C1UH 1O2ZA 1P04A 2NWNA 2ZU5A 4GHQA 1IQLA 4FU7A 5LPEA 2BLQA 1GBFA 1BTHH 2D2DA 3MH7A 1LVBA 1GBBA 5DGJA 1YCPH 2GD4B 4JYUH 1DSTA 2PSYA 4GLYA 4JK5A 2ZCLP 1BB0B 1ZJKA 2STAE 3SJOA 3ATLA 3A83A 3QK1A 5JBCS 3LC5A 4JYTA 2BVSH 5CHAC 5J4SA 3U9AH 4NGAH 3ZZ8A 1AMHA 1FIZA 1ELEE 2PSXA 3GY3A 1ABIH 2UWLA 1LVOA 1W12U 1WTGH 3LGIA 2HWLB 2WPKS 2K1QA 5ETXA 3NPSA 3O8CA 4FVDA 1GVKB 4NA7A 1ARBA 2C8XB 1SB1H 3MMGA 2O8TA 1QY6A 1BTWA 3T25A 1CHOG 1PPGE 4O97A 2CHAB 1GBCA 3FVFB 5DG6A 5F8XA 3SQHE 2XC5A 1GMHF 2W7UA 4Y71A 4YOJA 2I6SA 2BY7X 3BTQE 2GV7A 3ATIA 3WY8A 1IQEA 2BY5X 4GSOA 1P12E 4DJZB 1K1NA 3A8CA 3A7WA 4WMDA 2ZHQH 5C5OA 3O8RA 1O3BA 5TCAA 3MO9A 4KP0A 4JZIA 1P01A 1TGCA 1C9TA 3RXFA 3AASA 5DKMA 2UUFB 1EOLA 1O35A 1TA2A 2LPRA 3UR9A 1GBIA 1MTNB 1ZOMA 4GAWA 2TGPZ 4D76A 1HAGE 4NSYA 3KQEA 1TRNA 2PTCE 3IITA 3PWCA 4YESB 4NWKA 1WQSA 1UVUH 1O37A 1ZTJA 1EZQA 3M5NA 2CJIA 3TNSA 3M7QA 6LPRA 3M3SA 3UWJH 1XUHA 1DLKB 2JKHA 2W3KA 1CGJE 1ZMLA 2ZTXA 5GPIB 2OD3B 1NTPA 1EP6A 3SU2A 2VWMA 1ORFA 1BTPA 1TX7A 2BYAX 1FY5A 1TNJA 3RXUA 1CGIE 2XBVA 1K9OE 1NFWA 1LVMA 1DM4B 5IDKA 1EJAA 4JZEH 1S84A 1SFIA 1TGBA 1HAHH 3SUDA 1M9UA 1C5RA 1XUIA 1KDQA 1C5ZB 2FOCA 4HGCA 1HJ9A 1UVSH 5SGAE 3F9EA 1CE5A 1LPGB 1MZAA 1DY8A 4DURA 2NU1E 2SGFE 2W5EA 1GMDG 1Y3YA 1O2IA 1ZYOA 1H9HE 3URCA 3DA9B 3BIVH 4CH8B 3UWIA 3VB3A 1FN8A 3HPTB 2D1JA 4YTAA 6CHAB 2Z7FE 1O3KA 2G4UA 1ZRBA 1QBNA 1EAXA 2P3TB 2J94A 2GCHG 2OC7A 1K21H 3GY7A 3LJOA 3VGCB 3ZVGA 3MU8A 4VGCC 3SV2H 2ZDMA 2ANWA 4KTCA 1ZSKA 1NRNH 3PLPA 2JH0D 1O3JA 3BEIB 1E37B 5K7RA 3L6PA 1BTXA 3MTYA 5GDSH 2EI7A 4ABJA 1SGEE 4WMFA 3BG8A 1GBTA 4HFPB 2O8MA 4YT7H 4DT7B 5DP8A 5DK1A 1L1JA 1ZMJA 3Q00A 2QXGA 1SGDE 2A4OA 2ZZUH 3U8TH 3SV8A 1GGDB 1Q3XA 1FY3A 5DO4H 1K1IA 2EA3A 1D3TB 1KSNA 1GBKA 2DE9A 2JH6D 2BD3A 4R0IA 1KXDA 3SNDA 3PO1C 1TNHA 1YPKH 3TITA 3KCGH 1F5RA 2WV5A 7GCHG 1Z8JB 1QNJA 4NCYA 4GHTA 2QXJA 3M36A 3PTNA 5FAHA 2PV9B 3P6ZB 2IJOB 2CXVA 2WYJA 1HLTH 1C2FA 1GJ4H 3A8BA 1DT2A 1EJNA 2ZIQH 3P95A 1DPOA 3GY8A 3RLYH 4JCNA 3NCLA 3PMAB 4JZDH 3UOUA 3BTGE 1NRSH 2J92A 1A7SA 4ASHA 1G3BA 3BIUH 4UEHH 3TJUA 4RN6A 1H8IH 3MU1A 5C1YA 4I7YH 3RU4D 3QGJA 2FOAA 3KIDU 1H9IE 2VIQA 3DFLA 3ZZDA 2HNTC 3UNQA 1BMLA 2Z94A 3GYMA 3P8FA 1TPSA 3NWUA 2RG3A 1GG6C 2VVVA 1TYNA 4ZH8A 1GHWH 1AFEH 3LGVA 3SHAH 4BTTB 4ABHA 2FX6A 4X2WA 4IGDA 2Z9KA 5EOKA 3KGPA 4ISIH 2C90B 2Q6DA 3MFJA 2H1UA 2G5VA 2STBE 1AKSA 3GDUA 1VR1H 1ELVA 1PPHE 3ZZ4A 5GWZA 1HJAC 2SFAA 2FIRH 1OPHB 2FDAA 1ELDE 2NU4E 1D9IA 2PGQB 4LK4A 2THFB 5C1XA 1TABE 1PPBH 1ELTA 2AH4X 4ZKRU 5T6FA 4FVBA 1XMNB 2GV6A 4BAMB 4CRDA 1AFQC 4UE7H 2QC2A 1BMNH 1C5PA 1TBQH 4Z0KA 1F0UA 1BTYA 1UVOA 3I29A 3TJNA 1GJBB 4NIYA 2ZGBH 3M7TA 1LHGH 3VB4A 5EW1H 2OQ5A 1K1JA 4XBDA 4X6PA 2B0FA 3RXTA 2BDIA 3DUXH 8GCHG 4NIVA 3SU5A 3ATMA 5F8TA 4GUXA 1QRWA 1WU1A 2BD8A 1WAYB 4TY7A 3ZV8A 1SGPE 1V2WT 2A7CA 1MD7A 1O38A 2FWWA 2BLVA 2GZ8A 2QY0B 2QA9E 4I8KA 1XM1A 1D3QB 1PPCE 2ZTYA 1WBGB 1E36B 2BQWB 4DGJA 1GHVH 2F9BH 2R3YA 4NZLA 4B2CA 2GX4A 1JIRA 2HVXA 2BDCA 3H7TA 1N1LA 2Y7ZA 1BTUA 3O8DA 4NA9H 4D9RA 8KME2 5JPMH 4UFDH 4O3UA 3SQEE 4FUIA 1QL9A 2WPIS 1ESTA 1ESBA 1AHTH 1E35B 1SGRE 2FOMB 2ZDAH 2ZKSA 3DHKH 1QA7A 3E8LA 4RKJB 3TH4H 2PUXB 1DOJA 1P3EA 5EODA 1XXDA 3M7UA 2Z9LA 1EOJA 1MTSA 1AI8H 1C1MA 2HOBA 1QTFA 5A8XA 2FTLE 3SJIA 1J16A 4FUJA 1YPMH 2BD9A 2BD4A 4I8GA 2Q6FA 3PMJA 1HIAA 4OS5A 4AG2A 1XKBC 4IN2A 3S9CA 2BQ6B 5DJ7A 1GVLA 3OTJE 1H8DH 2P8OB 2ZA5A 1XUJA 5HMAA 1VITF 1HRTH 3SN8A 3PYHA 4NIXA 2ESTE 2FI3E 1YBWA 1LVYA 3ODDA 1GBDA 6GCHG 2ZU4A 1CGHA 3BV9B 5JB8S 2SGQE 3OY5U 1IQFA 1HFDA 1UVPA 4H6SB 1GL0E 1GJDB 4LZ4B 1F2SE 1E34B 4NWLA 3B8JA 1A46H 3S7HB 5JDUB 1THRH 1V2MT 2BD2A 1P9SA 1QURH 1XVMA 1GBJA 5GCHF 1SGIB 1P8VC 3AW1A 1V2JT 4QT8C 1HV7A 4IMZA 1VITH 3VB5A 1P2NA 2A5AA 3TGKE 5E0JA 4BAKB 2RDLA 3RXBA 2IPHA 1CA0B 3GY4A 3A8AA 1GI9B 1KYNA 5AVDA 1O0DH 4BAOB 3ATKA 4AYYB 2AEIH 2GDDA 3E91A 4Y8XA 3RM0H 1N8OC 4I31A 1P2QA 5TCCA 1YKTA 2QXIA 2JH5D 1K2I1 4NG9H 5E0HA 1Y3UA 2ZU1A 1NT1A 4GVUA 1UTKA 2VINA 2B8OH 3ZVFA 2BLOA 1ZHPA 4MNWA 4AZ2B 1KXEA 1ANEA 1GHAF 2PWXA 2XWAA 3TK5A 2Y5FA 2ZHFH 1LMWB 1RTKA 1THPB 3ZVBA 3BSQA 1VGCC 1W11U 4MPVA 3KQDA 2G81E 3VXEH 2A7JA 4XOJA 1Q2WA 4U30A 1SLWB 3M37A 3OYPA 1C4V2 1OXGA 1UTPA 3SNAA 1Y8TA 4Y7BA 1O2NA 2C8ZB 5FX6A 1OWJA 3E16B 1KTTB 1NY22 1L0ZA 3G01A 5CE1A 1DXPA 4INLA 3I78A 1EX3A 1Y3XA 4CR9A 1SC8U 3ENSB 2FS9A 2J34A 4J2YB 1LHEH 5HM2A 3ZZ7A 1XKAC 4MQAA 3TNTA 1IQHA 2VVCA 1KXBA 5L6NH 1IHSH 1QRZA 4K1SA 1P2OA 3JZ2B 1C2JA 1Z1JA 4WMEA 1KIGH 1LDTT 3EAJA 1J17T 2PKSB 1SGFG 3GCTF 3SJ9A 1P06A 1SLUB 1HB0B 1ETRH 4ESTE 2C4FH 3MH5A 1BTZA 3KNXA 2VIDA 3C27B 4ISHH 4DIHH 3GDSA 3QDZB 1YC0A 5GJ4B 2VH0A 1P10A 1O2XA 1OWHA 1DITH 2TGAA 1Y59T 1QB1A 2B5TB 5A2MH 1Y3VA 5FHTA 1V2RT 3KQBA 1C5WB 1A0HB 2GCTB 1AIXH 1HAXB 1HAIH 1RD3B 1MTWA 3Q77A 1O3HA 5EXNA 2CF8H 1GBHA 4CHAC 3GOVB 1FPCH 1EATA 1PPFE 2Y82A 1O2GH 4X6MA 1A5HA 1ZMNA 2A7HA 1O5DH 2XTTB 3HKJB 3A85A 1DX5M 1S83A 2ODQA 1GJ6A 2VB0A 1DS2E 3NK8A 1T32A 4ISOA 3PWBA 1IQJA 2H5DA 4TY6A 3UOPA 3RXRA 2R3UA 1FZZA 1SGYE 4CRFA 4MPUA 5JYIA 2Q1JA 1HPGA 2FOEA 1GMHG 2FODA 6ESTA 1PFXC 1ID5H 1SQTA 1TMBH 2F9VA 2F9UA 4U2WA 3BF6H 3Q3YA 2AFQB 3GDVA 1QCPA 2EI8A 5FCKA 3D23A 1O3EA 1GI4A 1O2HA 1DWDH 3RM2H 2HALA 1A3EH 1P2KA 3Q3XA 3LDXH 4WH8A 2R0LA 4JZFH 1SSXA 1QB9A 1BJUA 1AZ8A 1FNIA 1UTOA 4OS1A 1Y5UT 2OC8A 5C5NA 2ZDKA 3SJ8A 1FQ3A 1H4WA 4X1RU 1FMGA 1DWCH 3SOSA 1O3DA 3KQCA 1T4VH 5EXLA 1GI6A 4X2XA 2YNAA 4K1TA 3JZ1B 4O3TA 2Y7XA 3LONA 1UTMA 1UVTH 5LGOA 1BZXE 4LXBH 4JMYA 3EQ0H 4Q7ZA 2QIQA 2FYRA 1QIXB 2PLXA 2SNWA 2AMDA 3EA8A 1GJAB 1WYKA 4AOQA 1T31A 3HKIB 1HDTH 3D62A 3STIA 2BY8X 3VPKA 1P57B 4BANB 4IW4E 5EU8A 3GY5A 5I25A 3RUOA 2I6QA 5AF9H 3GCHB 2ODYB 1KXFA 1BIOA 1VJ9U 1SOTA 4DIIH 1GI5A 2AGEX 1AUTC 3S7KB 3RDZA 4YZUA 1A5GH 1SQAA 2HRVA 3CENA 2ZCHP 1GCTB 1C1QA 1O3PB 4MPXA 3LGYA 3I77A 1HBTH 1G2LA 1LQDB 4HTCH 5E8EH 3MO6A 3SO3A 3FZDA 1D6WA 1V2OT 4K2YA 5E0GA 2SGDE 3AAUA 3UPEA 2VWNA 3U1IB 4Y11E 3QO6A 4X2VA 5DPAA 5E2PA 3TGIE 3MWIU 4GCHF 1IQMA 1QL7A 1O2RA 5FXLA 2PFEA 1O2VA 1V2PT 2V3OH 4TYDA 2C93B 2G55A 3T29A 2JETC 1W2KH 3RMMH 1KXCA 1V2ST 2A45B 2VIWA 2W3IA 3L3TA 2WPMS 1CA0C 1MQ6A 1A5IA 2SGPE 1GJ7B 1NN6A 2PR3A 3BG4C 2FTMA 4XFQA 3A88A 3T28A 3T27A 2Y81A 2TGDA 2GT8A 4YT6H 3CS7A 4AG1A 1HXFH 4INHA 3SI4H 1W13U 1RTFB 4ABDA 5LPFA 2C3SA 5EG4A 3A84A 2RCEA 1BBRE 1BMAA 4K3JA 2QXHA 1C2LA 3EA9A 5LPRA 1O36A 4B71A 5FCRA 1BA8B 2WINI 1KTSB 1NFYA 2Z3EA 4ZAEA 4MNVA 4INKA 4FUGA 5EQSA 3SNEA 2GKVE 3TH2H 5LH8A 3PLBA 1O2JA 4B75A 1NO9H 2FLBH 3MHWU 3RU4T 1NC6A 3GY2A 3SV6A 4NZQA 4X1NU 1MBMA 4XBCA 1DWBH 1SG8B 2PW8H 1Z71A 1AE5A 1F5LA 2Z3DA 4ABFA 4GPGA 3LH1A 4X1SU 1ZZZA 2ANYA 2FP7B 2G4TA 2Z9IA 1TAWA 2OUAA 1HAYB 3K6YA 2GMTB 1NPMA 1SHHB 4F4OC 2GGVB 1TRYA 1G3EA 1ZGVA 3Q76A 2XYAA 2F9OA 1JRTA 1QBVH 1TONA 3A7VA 1SOZA 1P03A 2A4RA 3K65B 1UCYK 3F9HA 1XUFA 4YLUA 1T7CA 4BOHA 1HXEH 4Y8ZA 1ETTH 1K22H 3N7OA 3CP7A 2A5KA 2ILNA 1V2LT 4I8HA 4XSKU 5DP9A 3P17H 1TNGA 1EQ9A 2O9QA 1DE7H 3T5FH 3NXPA 2XCFA 1Z8GA 2Z9JA 3LC3A 1TQ0B 3SGQE 5FPSA 4KGAA 2ZF0H 5DP4A 3RXDA 1MU6B 2ZO3H 1P0SH 1PYTD 3OSYA 3SU3A 1OP8A 1QL8A 2GZ9A 2ZPRA 1A0JA 1TE0A 3FP8E 7ESTE 5E2OA 1NROH 1FUJA 5EW2H 1UMAH 4WWYA 5DP7A 1L1NA 1RFNA 1G3DA 1T4UH 2CGAA 1H1BA 1RRKA 1JWTA 2VGCC 1O2LA 4AFZA 3TIUA 1LQEA 3RXHA 2ZC9H 5F03A 3A81A 2OC1A 4IBLH 4ISLA 3KL6A 4Q7XA 1ZHRA 1KLTA 3QTOH 1RIWB 1YPLH 1B5GH 3LKWA 2ZFTA 3S9AA 4E7NA 2J4IA 2QAAA 4AFQA 1J15A 1MAXA 1QR3E 4AFSA 1C4U2 3V3MA 2NU3E 1CO7E 2GP9B 2ZWLH 2ZGHA 3AAVA 3BTFE 1AQ7A 1UO6A 3C1KA 4X1PU 3P92A 2OBOA 4KTUA 3ZVCA 4A5TS 2VU8E 1CBWB 2HLCA 1C5YB 1S0QA 3GICB 3HK6B 4NSVA 2P3UB 2BY9X 2KAIB 5A0CA 2FOFA 3FZZA 1C2HA 1KXAA 3SJKA 1YM0A 3SU1A 2AGIX 3DFJA 2FMJA 1CT2E 2VNTA 1WQVH 1MCVA 1ANBA 2Z9GA 5FX5A 2ZGXH 1JRSA 3P8NA 4B2BA 3MI4A 1TLDA 2A0QB 4BAQB 1O2OA 3SGBE 1S6FA 3TPIZ 4YLQH 2V6NA 1O2SA 1VITG 4FXGH 1DANH 1NS3A 2BD5A 4K8BA 1FONA 3LU9B 3KN2A 1G36A 3B9FH 3LGTA 4ABIA 2F83A 4IS5A 1CU1A 1YPJH 1INCA 1B7XB 3GCHC 1IHTH 4CBOA 1ETSH 2CHAC 1ABJH 3RU4E 1GHXH 1LHDH 3F6UH 1EPTB 3U69H 3LJJA 3BTWE 3CS0A 1O2YA 2G52A 4Y8YA 4E7RG 1TPOA 1WOFA 1PQ7A 3ZZ5A 3FP7E 2VIPA 1ZJDA 5GCHG 4OS7A 2C8WB 2F9NA 1AO5A 1TBRH 3SGAE 3ZYDA 4BXSA 4K5ZA 1P2IA 5EQRA 1AVGH 3PTBA 1GHZA 2NU0E 3EYDA 3QN7A 2W26A 2ZGCA 1MTNC 1HAPH 3PM3A 1D3PB 2AS9A 2Y80A 4DOQA 3TJOA 1FDPA 4BNRA 1QJ1B 3W95A 1SVPA 1ZHMA 1C2EA 1LHCH 2FEQH 2QN5T 4CR5A 1BRUP 1UCYE 1NRPH 1GI1A 1MBQA 3ITIA 4ABGA 2CMYA 1TOCB 1Z6EA 2GTBA 1C4Y2 1MAYA 3K9XB 4FU9A 1AD8H 4AGJA 2WPHS 1SGCA 2ZHEH 1P02A 2XW9A 2XBYA 2BY6X 4UDWH 4ZHAA 5JBAS 1GHAG 1O2QA 2B7DH 2BVRH 4WJG2 4R8TB 4WH6A 1PPEE 1MZDA 2ZDNA 1PQAA 4XDEA 1MKXK 1WCZA 1BRCE 1HGTH 2J9NA 1QJ6B 5CHAB 1FY4A 1PQ5A 1GDQA 1ARCA 1C5MD 3ZZBA 5T3HA 2YNBA 5EPNA 4FU8A 3KF2A 1CA8B 1LHFH 2WPLS 2OTVA 2SGEE 2BM2A 2ZGJA 1O5FH 2BTCE 1DFPA 1C5OH 1W7XH 1MUEB 3RC5A 1UJ1A 2VIVA 4D9QA 1U6QA 2FO9A 6CHAC 1BQYA 1MU8B 1AWHB 3ELAH 3SU4A 3A82A 4NIWA 2BMGB 4UONA 1TX8A 1VCQA 2O8WA 2R0KA 5J4QA 3VGCC 2V3HH 2ANMH 2OQUA 4K8YA 2FPZA 2P16A 3GCTG 2UUKB 2P3FH 1QRXA 1ESAA 3FFGA 4X8SH 1QA0A 4HI3A 2H6MA 4AB8A 3STJA 1V6DA 1BUIA 1O3IA 3RXMA 1QQ4A 3K6ZA 4AX9H 3E90B 4LOYH 3ZZ3A 3URDA 3TVJB 2BDAA 3QX5H 1O2KA 2ZQ2A 1GGDC 1O5EH 4RKOB 3A86A 5FBIA 2BDHA 3U8OH 1EAWA 1C1RA 3W94A 1YLDA 1VZQH 2EC9H 2UWPA
chains in the Genus database with same CATH superfamily
3BTHE 2FOHA 2KCPA 3A80A 1H8ED 3KHVA 1FN6A 1AWFH 4AN7A 1UHBB 3K2UA 1V2VT 3V13A 1KY9A 1EJMA 4SGBE 2ODPA 2FLRH 1EUFA 3ZIAD 2FOBA 4XBBA 1JIMA 1ZR0A 1B0EA 1C1NA 4B2AA 1Y5BT 3PB1E 3RC4A 2WPDD 5K0HA 4SGAE 1NU9A 1A2CH 2ZHWH 1FAKH 1MKWK 2UWOA 4E05H 2FS8A 1SGNE 3QUMP 1SLXB 3UQVA 3MU0A 3T62A 3N7DA 5ABWA 1MD8A 2BX4A 1DUAA 2G51A 1FXYA 1LKBA 1C1SA 1E0FD 4NFEA 1SFQB 2FXRA 2P94A 2ZECA 4Y10E 3VFEA 3L33A 1D4PB 1RIWC 2OC0A 3P8GA 2ZCKP 1CVWH 4VGCB 3VB7A 1C5QA 4IC6A 4Y0ZE 5EXMA 1E38B 1OWDA 4Y7AA 1O3OA 4I33A 1Z7KA 3UR6A 1J9CH 4X6NA 3ZZ9A 3F0PA 3PRDA 1W8BH 4IC5A 1RJXB 2V7QD 3PMHB 1O2UA 5DN6D 1DUEA 2XWBI 3TGJE 1UTJA 4B6EA 3QZQA 1L4ZA 5DP6A 1BBRK 2VVUA 1AUJA 4OM9A 3UQOA 1TNIA 1IAUA 3A87A 5A8ZA 1JBUH 1C5XB 1OKXA 1SQRA 3MYWA 3PV4A 1SGFA 1ELFA 1OWEA 3PO1B 1CT4E 2ZU2A 1AN1E 2P59A 1MKXH 3BTDE 2OINA 2BQ7B 3M3VA 1YF4A 1THSH 3LPRA 2KCAA 3UNSA 1GI0A 4CBNA 4O9VA 4AFUA 2ZTZA 4OS4A 3SBKA 1NRQH 2YMSC 3M5MA 4XE4A 2VBCA 5DP5A 3QLPH 1PQ8A 1GI7B 4B1TA 1T8MA 3QTVH 1DWEH 1S85A 3CNRA 2H9HA 2WPJS 5FBEA 1GDUA 3ATWA 1GHBF 2OBQA 1S6HA 2L6OA 2HPQH 3FAOA 2NU2E 3UREA 1GVZA 1QZ8A 1ZPCA 3FOAA 4LZ1H 2Z3CA 3OE7D 1IQGA 1GG6B 3WWBA 4ACBA 3RMLH 3VB6A 4TPIZ 3DT0H 3F9FA 4Q80A 1ACBE 1WUNH 3KYFA 1XUGA 2BDGA 1RTLA 1LPKB 2ZFSA 4TT3D 2D26C 4GCHG 3DSGA 3TK6A 3LGUA 2GT7A 1DDJA 1YPGH 1HJAB 1K1PA 2SGAA 2YOLA 1XX9A 3RXLA 4DW2U 1GCDA 1SBWA 2XBXA 4X1QU 1NRRH 1QQUA 2FI5E 1YPHE 4AGKA 3RXJA 3DD2H 4MLFB 1ELAA 1K1OA 3F2HA 1PYTC 4K69A 1W7GH 3SZNA 1BMFD 3IG6B 1AFQB 3RXPA 4MVNA 4CRGA 4ACAA 2PP6A 2ZNKH 4MDSA 4ABEA 4X0WU 1WSSH 1OOKB 5KGOA 1MQ5A 4IN1A 3OEED 1ZPBA 2GJGA 1LKAA 2ALPA 1HNEE 1O2TA 1B0FA 1W10U 2VH6A 2DUCA 1A3BH 1IOEA 3TJVA 1MKWH 4Y79A 5G4BA 2P8OC 2Z6BD 2AIQA 3GCNA 5F6MA 1LTOA 4MNXA 1F0SA 3TH3H 3R0FA 2OCVB 1YGCH 2QGRA 1J14A 1XVOA 4H6TA 5FPYA 3VXFH 3LGWA 3OEHD 2AGGX 7LPRA 3S0NA 1CT0E 3MNSA 5IYTA 1A0LA 1TPAE 2WYGA 4DT4A 2BHGA 2PKAA 4WVPE 2D8WA 2ZI2H 3M61U 1OWIA 2ZFRH 5KECA 2CF9H 5CDFE 1FY8E 4H42U 1OX1A 1EASA 4MTBA 1BHXB 1GMCF 3E1XB 3TU7H 1F0TA 1NZQH 2H2ZA 1T8OA 3OFND 3SORA 1SR5C 1ZGIA 2KAIA 1HCGA 1G3CA 1KLIH 1G2MA 1BBRH 3RLWH 2FI4E 3LH3A 1CHGA 1MTVA 1FI8A 4WY3A 3RXVA 3RXCA 1WTHD 2RA0A 1C2GA 3QGNB 1VCPA 1Z1IA 1BT7A 4HZHA 4BTUB 1C2DA 1J8AA 1GPZA 5L30H 1LO6A 1W0YH 1YYY1 3A89A 1N6YA 3SI3H 2O8LA 1QB6A 1RS0A 1L1GA 1EP5A 1H9LB 1WV7H 1YY3A 3F9GA 1JOUB 4FETA 2Q6GA 1UK4A 3UNRA 1BITA 1O5CB 1LCYA 2VIOA 4YOGA 1BCUH 2LP6A 2XRCA 3ZZCA 3MNCA 4M9FA 4I8JA 2AIPA 1TFXA 4TPYA 2H9EH 4FUDA 1FIWA 5A09A 3M35A 1K28D 3SNBA 4ZHLU 5A0BA 1EPTA 4X8TH 3SNCA 3D49H 8ESTE 3V7TA 5L2ZH 4ISNA 1P05A 3Q3KA 4X8VH 4ZROA 2QF3A 4CREA 1TOMH 5FL7D 3EA7A 4FUBA 1CHOF 2WSSD 4M7GA 5C1UA 1V2UT 3EE0B 3OX7U 2XCNA 3UAIC 3PV2A 2ZEBA 1FJSA 2BLWA 3PROA 1C5SA 1TGTA 3RXGA 2O8UA 1TX6A 2XXLA 1T8LA 1SGQE 1D6RA 2EEKA 2QV1A 2UUJB 4ABBA 2PKSC 1DVAH 3SHCH 1GJ5H 1TNLA 1C5VA 2G5NA 1HUTH 2A2QH 1HAZB 3A7ZA 1BRBE 2WV4A 2J38A 3ODFA 1W14U 4ZKOU 3OY6U 3RXSA 3U8RH 2AMPA 2FM2A 1K1MA 3RXQA 4H4FA 3LOXA 1AU8A 3E0NB 4OS6A 4I8LA 4AORA 1T8NA 3KEEA 2OXSA 1AVXA 1N8OB 5KEDA 1P2MA 1SI5H 2J2UA 2GCTC 3SU6A 1UTNA 4RI0A 1SGTA 4AYVB 1F5KU 4UFGH 4TWWA 2ZG0H 5HGGA 1O3MA 3W1EA 1P3CA 2QF0A 4MPWA 3RMNH 1P9UA 1DLEA 3T26A 1RXPA 1ZPZA 4WXIA 2PTNA 2PHBA 1EZUC 4U01A 1CSOE 1VGCB 3LIWA 3LT3A 1ANDA 3B23B 2FYQA 1OP2A 2Y5HA 1AE8H 1O31A 5BPEA 2J97A 4A1XA 4AB9A 1FV9A 1HYLA 1SMFE 4B74A 5JBTA 5GIBA 1TGSZ 5PTPA 1O32A 1C5UA 3E0PB 1GMDF 1EKBB 4Y0YE 2VJ1A 4ZCNA 2GDEH 3TLOA 3MU4A 3M5OA 1TQ7B 3ESTA 4NA8A 2A4QA 2CN0H 1Z8IB 5FPTA 3BN9A 4K1EA 1EB2A 1O2PA 2PKAB 3EDXB 1O34A 1KLJH 3GYLB 1L2EA 2QYIA 2GCHF 1A61H 3MO3A 1O39A 1BOQA 5AHGH 2BD7A 3V12A 2ULLA 3A7XA 5C3NA 4CRCA 2ZP0H 3SYJA 1QBOA 1QFKH 2BX3A 2SNVA 4OGYA 4UFEH 1GI8B 1S6LA 1G9IE 3S69A 1GL1A 1OWKA 3QZRA 2A2XH 5EGMA 5AFYH 1UHBA 8LPRA 1SKYE 3OU0A 4O03A 4DVAU 5JB9S 2XC4A 4ZHMU 2AMQA 5AFZH 3O8BA 2AERH 1S0RA 1C1VH 2IOTA 1G32B 2BOHB 4X8UH 4CHAB 7GCHF 2HGTH 2BVXH 2ZPSA 1GJCB 1UK3A 4THNH 5ESBA 1GBAA 2P93A 1AB9B 1ZRKA 1TIOA 1GI3A 2B9LA 4CRBA 3F68H 3A7TA 4ZMAH 3H09A 3RXEA 3VEQB 5I46H 1C5NH 1GI2A 1K1LA 2IPQX 3GS9A 1ELBA 4A6LA 4X6OA 3ZYEA 2WHXA 4JZ1A 3MNBA 2WUBA 1TALA 2A4GA 1GCTC 1KDQB 1MMJN 1C1WH 3SV7A 1GHYH 1O5AB 2J98A 4UFFH 1A1RA 1UK2A 5TJXA 1YPEH 1L4DA 1YPHC 1UCYH 3N99A 3UFAA 3H5CB 5EPYA 1QJ7B 2FZZA 4X2YA 1FLEE 1SQOA 2FOGA 2R9PA 3HK3B 1GBMA 2Y6TA 2W7SA 1AVWA 1NU7B 3RXAA 1YP9A 4FUFA 3FANA 2A1DB 3E3TA 4Z6AH 1YLCA 3U98H 3SUFA 1UTQA 1VJAU 2ASUB 1QHRB 2KR7A 1C9PA 1TA6A 1W0ZU 5T6DA 1BDAA 1OP0A 4IMQA 3ZV9A 4WXVA 1MH0A 4TSFD 1ZSJA 1O3LA 2ALVA 1AGJA 2AYWA 2R2MB 3M3TA 1OYQA 5C20A 1C1PA 3S9BA 1V2KT 2H9TH 1P11E 2KX4A 2OP9A 3BTTE 2G8TA 3AW0A 1HAVA 1V2TT 4NFFA 1C2KA 1NBME 1TB6H 1SPJA 2ZDLA 1GDNA 3F2GA 1OYTH 5DP3A 3SW2B 1AY6H 3SU0A 4TWYA 3R3GB 3V0XA 2BZAA 1FX0B 4DG4A 5T1VA 2BDYA 8GCHF 4DCDA 1O3GA 1ZSLA 1O3NA 2XNIA 5CMXH 2A5IA 4CH2B 1EAUA 1HAOH 1EZXC 2PGBB 5ESTE 1Y5AT 2OK5A 4OS2A 1CQQA 1F92A 2IN2A 1O5BB 1AZZA 4K60A 3PMBB 2HPPH 1QGFA 3BTEE 1YLNA 1ANCA 4YM9A 2VWLA 5H4IB 5B6OA 1NFXA 3RXKA 1G30B 4ZXXH 2ZFPH 2V35A 1C5LH 4YOIA 1N6XA 4JYVH 4BAHB 2BXTH 4A1VA 3MH4A 1JMOH 2F3CE 1UTLM 1G37A 2QCYA 3RP2A 3SUGA 3NZIA 1F0RA 4U32A 2KZ4A 1BJVA 2RA3A 1P2JA 2GMTC 1C2IA 1TMTH 4MG3A 3BEUA 1P09A 4Q2KA 4I32A 1IQKA 5HXFA 2JETB 3MOCA 1ZLRA 3P70B 2M5TA 3RC6A 3SUEA 2A31A 1AKSB 3BTME 4J1YA 3BTKE 1ZTKA 1D3DB 3BG4B 2R2WU 5C94A 2BZ6H 1DXWA 1HJ8A 3RXOA 4B76A 1Z8RA 2BB4A 3F1SB 3NKKA 3HATH 4KTSA 4I86A 1NESE 1O3AA 1YCPK 2TPIZ 1V2QT 1A4WH 1GJ8B 1SLVB 1SHYA 2UUYA 2EI6A 2HNTF 3ZVAA 3ZZAA 1O33A 1O3CA 3UUZA 3U1JB 3BEFB 3MH6A 2FESH 9ESTA 4UD9H 1FAXA 4D7GA 2C8YB 3A8DA 4FUEA 4B73A 2A32A 2ZQ1A 1TPPA 1O30A 3GCOA 4XRNA 3A7YA 4E06H 1E79D 2TRMA 6GCHF 1C1OA 2H5CA 1GBLA 2ZPQA 3FP6E 3IWMA 1GWAA 4D8NA 5BRRE 3HGNA 1OS8A 1DY9A 1S5SA 1ELGA 1FY1A 1JXPA 5GXPA 1TGNA 3PRBA 4WF8A 1EB1H 4JK6A 4ZXYH 3GISB 1GHBG 1NFUA 3TK9A 1PJPA 4YXWD 4RSPA 1Y3WA 1O3FA 4CRAA 3H7OA 1TWXB 1BRAA 3D65E 2ZHDA 2GZ7A 4A7IB 2J98B 2V0BA 4BTIB 1XUKA 4ZKNU 4A92A 3MU5A 2RFKC 5T6GA 3M5LA 1C5TA 1DSUA 1V2NT 4ABAA 1PPZA 1TBZH 5A8YA 2FX4A 2K8IA 3ZVEA 1F7ZA 2VWOA 4YO9A 1C1TA 2HNTE 2KCOA 2RDEA 3UB0A 5L2YH 2XC0A 5C67A 1CBWC 1W3CA 3UTUH 4Y76A 1DICA 3NUMA 7KMEH 2LNCA 1H8HD 4BXWA 3E6PH 5EJ1A 4FUCA 1EZSC 1FPHH 5A0AE 4Y6DA 2ANKH 3UIRA 1EXFA 3AVZA 4D7FA 3QWCH 2BDBA 3PLKA 4F49A 1BMMH 1O2WA 4FUHA 3RXIA 5JBBS 4P02A 1IQIA 3SV9A 2XBWA 2TGTA 3EGKH 2CV3A 2ZU3A 2OLGA 1EAIA 3GY6A 3HGPA 1NM6A 1HAVB 4ZKSU 1V3XA 2G00A 1X7AC 1OSSA 1TRMA 1O2MA 2ZFFH 4DY7B 1S82A 4A1TA 2F91A 1HIAB 3UY9A 1Q31A 5F8ZA 1MTUA 2GVFA 1BHXF 2ZDVH 2J95A 1AB9C 1Z6JH 4Q7YA 3T2NA 4ZUHA 5HM9A 1TNKA 1MCTA 1YCPM 2P95A 4MNYA 3ZVDA 2WUCA 2F9PA 1ZTLA 2PUQH 2VGCB 2ZFQH 3FO8D 1EPTC 5C17A 4KELA 1IQNA 1ELCA 2BXUH 2QE7D 1SL3A 2TBSA 1RGQA 3ZZ6A 3P8OA 1O5GH 1VCWA 1GJ9B 5EQQA 9LPRA 1C2MA 4OGXA 1LPZB 1XXFA 1GMCG 5C2ZA 4PROA 1GBEA 1TMUH 2TIOA 3MNXA 4KKDA 5HYOA 1S81A 2DE8A 3RMOH 2BOKA 2Y5GA 1C1UH 1O2ZA 1P04A 2NWNA 2ZU5A 4GHQA 1IQLA 4FU7A 2WZQA 5LPEA 2BLQA 1GBFA 1BTHH 2D2DA 3MH7A 1LVBA 1GBBA 5DGJA 1YCPH 2GD4B 4JYUH 1DSTA 2PSYA 4GLYA 4JK5A 2ZCLP 1BB0B 1ZJKA 2STAE 3SJOA 3ATLA 3A83A 3WW7A 3QK1A 5JBCS 3LC5A 4JYTA 2BVSH 5CHAC 5J4SA 3U9AH 4NGAH 3ZZ8A 1AMHA 1FIZA 1ELEE 2PSXA 3GY3A 1ABIH 2UWLA 1LVOA 1W12U 1WTGH 3LGIA 2HWLB 2WPKS 2K1QA 5ETXA 3NPSA 3O8CA 4FVDA 1GVKB 1W0JD 1ARBA 2C8XB 1SB1H 3MMGA 4NA7A 2O8TA 1QY6A 1BTWA 3T25A 1CHOG 1PPGE 4O97A 2CHAB 1GBCA 3FVFB 5DG6A 5F8XA 3SQHE 2XC5A 1GMHF 2W7UA 4Y71A 4YOJA 2I6SA 2BY7X 3BTQE 2GV7A 3ATIA 3WY8A 1IQEA 2BY5X 4GSOA 1P12E 4DJZB 1K1NA 3A8CA 3A7WA 4WMDA 2ZHQH 5C5OA 3O8RA 1O3BA 5TCAA 3MO9A 4KP0A 4JZIA 1P01A 1TGCA 1C9TA 3RXFA 3AASA 5DKMA 2UUFB 1EOLA 1O35A 1TA2A 2LPRA 3UR9A 1GBIA 1MTNB 1ZOMA 4GAWA 2TGPZ 4D76A 1HAGE 4NSYA 3KQEA 1TRNA 2PTCE 3IITA 3PWCA 4YESB 4NWKA 1WQSA 1UVUH 1O37A 1ZTJA 1EZQA 3M5NA 2CJIA 3TNSA 3M7QA 6LPRA 3M3SA 3UWJH 1XUHA 1DLKB 2JKHA 2W3KA 1CGJE 1ZMLA 2ZTXA 5GPIB 2OD3B 4RT1A 2KM0A 1NTPA 1EP6A 3SU2A 2VWMA 1ORFA 1BTPA 1TX7A 4F55A 2BYAX 1FY5A 1TNJA 3RXUA 1CGIE 2XBVA 1K9OE 1NFWA 1LVMA 1DM4B 5IDKA 1EJAA 3WWFA 1KMHB 4JZEH 1S84A 1SFIA 1TGBA 1HAHH 3SUDA 1M9UA 1C5RA 1XUIA 1KDQA 1C5ZB 2FOCA 4HGCA 1HJ9A 1UVSH 5SGAE 3F9EA 1CE5A 1LPGB 1MZAA 1DY8A 4DURA 2NU1E 2SGFE 2W5EA 1GMDG 1Y3YA 1O2IA 1ZYOA 1H9HE 3URCA 3DA9B 3BIVH 4CH8B 3UWIA 3VB3A 1FN8A 3HPTB 2D1JA 4YTAA 6CHAB 2Z7FE 1O3KA 2G4UA 1ZRBA 4XD7D 1QBNA 1EAXA 2P3TB 2J94A 2GCHG 2OC7A 1K21H 3GY7A 3LJOA 3VGCB 3ZVGA 3MU8A 4VGCC 1OHHD 3SV2H 2ZDMA 2ANWA 4KTCA 1ZSKA 1NRNH 3PLPA 2JH0D 1O3JA 3BEIB 1E37B 5K7RA 3L6PA 1BTXA 3MTYA 5GDSH 2EI7A 4ABJA 1SGEE 4WMFA 3BG8A 1GBTA 4HFPB 2CK3D 2O8MA 4YT7H 4DT7B 5DP8A 5DK1A 1L1JA 1ZMJA 3Q00A 2QXGA 1SGDE 2A4OA 2HLDD 2ZZUH 3U8TH 3SV8A 1GGDB 1Q3XA 1FY3A 5DO4H 1K1IA 2EA3A 1D3TB 1KSNA 1GBKA 2DE9A 2JH6D 2BD3A 4R0IA 1KXDA 3KQ5A 3SNDA 3PO1C 1TNHA 1YPKH 3TITA 3KCGH 1F5RA 2WV5A 7GCHG 1Z8JB 1QNJA 4NCYA 4GHTA 2QXJA 3M36A 3PTNA 5FAHA 2PV9B 3P6ZB 2IJOB 2CXVA 2AHME 2WYJA 1HLTH 1C2FA 1GJ4H 3A8BA 1DT2A 1EJNA 2ZIQH 3P95A 1DPOA 3GY8A 3RLYH 4JCNA 2KFWA 3NCLA 3PMAB 1VKYA 4JZDH 3UOUA 3BTGE 2W6ID 1NRSH 2J92A 1A7SA 4ASHA 1G3BA 3BIUH 4UEHH 3TJUA 4RN6A 1H8IH 3MU1A 5C1YA 4I7YH 3RU4D 3OTPA 3QGJA 2FOAA 3KIDU 1H9IE 2VIQA 3DFLA 3ZZDA 2HNTC 3UNQA 1BMLA 2Z94A 3GYMA 3P8FA 1TPSA 3NWUA 2RG3A 1GG6C 2VVVA 1TYNA 4ZH8A 1GHWH 1AFEH 3LGVA 3SHAH 4BTTB 4ABHA 2FX6A 4X2WA 4IGDA 2Z9KA 5EOKA 3KGPA 4ISIH 2C90B 2Q6DA 3MFJA 2H1UA 2G5VA 2STBE 1AKSA 3GDUA 1VR1H 1ELVA 1PPHE 3ZZ4A 5GWZA 1HJAC 2SFAA 2FIRH 1OPHB 2FDAA 1ELDE 2NU4E 1D9IA 2PGQB 4LK4A 2THFB 5C1XA 1TABE 5F53A 1PPBH 1ELTA 2JJ1D 2AH4X 4ZKRU 5T6FA 4FVBA 3U28C 1XMNB 2GV6A 4BAMB 4CRDA 1AFQC 4UE7H 2QC2A 1BMNH 1C5PA 1TBQH 4Z0KA 1F0UA 5GNDA 1BTYA 1UVOA 3I29A 3TJNA 1GJBB 4NIYA 2ZGBH 3M7TA 1LHGH 3VB4A 5EW1H 2OQ5A 1K1JA 4XBDA 4X6PA 2B0FA 3RXTA 2BDIA 3DUXH 8GCHG 4NIVA 3SU5A 3ATMA 2YMSB 5F8TA 4GUXA 1QRWA 2EY4C 1WU1A 2BD8A 1WAYB 4TY7A 3ZV8A 1SGPE 1V2WT 2A7CA 1MD7A 1O38A 2FWWA 2BLVA 2GZ8A 2QY0B 2QA9E 4I8KA 1XM1A 2HVYB 1D3QB 1PPCE 2ZTYA 1WBGB 1E36B 2BQWB 4DGJA 1GHVH 2F9BH 2R3YA 4NZLA 2XNDD 4B2CA 2GX4A 1JIRA 2HVXA 2BDCA 3H7TA 1N1LA 2Y7ZA 1BTUA 3O8DA 4NA9H 4D9RA 8KME2 5JPMH 4UFDH 4O3UA 3SQEE 4FUIA 1QL9A 2WPIS 1ESTA 2JIZD 1ESBA 1AHTH 1E35B 1SGRE 2FOMB 2ZDAH 2ZKSA 3DHKH 1QA7A 3E8LA 4RKJB 3TH4H 2PUXB 1DOJA 1P3EA 5EODA 1XXDA 3M7UA 2Z9LA 1EOJA 1MTSA 1AI8H 1C1MA 2HOBA 1QTFA 5A8XA 2QF5A 2FTLE 3SJIA 1J16A 4FUJA 1YPMH 2BD9A 2BD4A 4I8GA 2Q6FA 3PMJA 1HIAA 4Q4LA 4OS5A 4AG2A 1XKBC 4IN2A 3S9CA 2BQ6B 5DJ7A 1GVLA 3OTJE 1H8DH 2P8OB 2ZA5A 1XUJA 5HMAA 1VITF 1HRTH 3SN8A 3PYHA 4NIXA 2ESTE 2FI3E 1YBWA 1LVYA 3ODDA 1GBDA 6GCHG 2ZU4A 1CGHA 3BV9B 5JB8S 2SGQE 3OY5U 1IQFA 1HFDA 1UVPA 4H6SB 1GL0E 2J5UA 1GJDB 4LZ4B 1F2SE 1E34B 4NWLA 5EIYA 3B8JA 1A46H 3S7HB 5JDUB 1THRH 1V2MT 2BD2A 1P9SA 1QURH 1XVMA 1GBJA 2XOKD 5GCHF 1SGIB 1P8VC 3SZEA 3AW1A 1V2JT 4QT8C 1HV7A 4IMZA 1VITH 3VB5A 1P2NA 2A5AA 3TGKE 5E0JA 4BAKB 2RDLA 3RXBA 2IPHA 1CA0B 2KCYA 3GY4A 3A8AA 1GI9B 1KYNA 5AVDA 1O0DH 4BAOB 3ATKA 4AYYB 1WXRA 2AEIH 2GDDA 3E91A 4Y8XA 3RM0H 1K0HA 1N8OC 4I31A 1P2QA 5TCCA 1YKTA 2QXIA 2JH5D 1K2I1 4NG9H 5E0HA 1Y3UA 2ZU1A 1NT1A 4GVUA 1UTKA 2VINA 2B8OH 3ZVFA 2BLOA 1ZHPA 4MNWA 4AZ2B 1KXEA 1ANEA 1GHAF 2PWXA 2XWAA 3TK5A 2Y5FA 2ZHFH 1LMWB 1RTKA 1THPB 3ZVBA 3BSQA 5CHBA 1VGCC 1W11U 4MPVA 3KQDA 2G81E 3VXEH 2A7JA 4HG6A 4XOJA 1Q2WA 4U30A 2IJD1 1SLWB 3M37A 3OYPA 1C4V2 1OXGA 1UTPA 3SNAA 1Y8TA 4Y7BA 1O2NA 2C8ZB 5FX6A 1OWJA 3E16B 1KTTB 1NY22 1L0ZA 3G01A 5CE1A 3AK5A 1DXPA 4INLA 3I78A 1EX3A 1Y3XA 4CR9A 1SC8U 3ENSB 2FS9A 2J34A 4J2YB 1LHEH 5HM2A 3ZZ7A 1XKAC 4MQAA 3TNTA 1IQHA 2VVCA 1KXBA 5L6NH 1IHSH 1QRZA 4K1SA 1P2OA 3JZ2B 1UW7A 1C2JA 1Z1JA 4WMEA 1KIGH 1LDTT 3EAJA 1J17T 2PKSB 1SGFG 3GCTF 3SJ9A 1P06A 1SLUB 1HB0B 1ETRH 4ESTE 2C4FH 3MH5A 1BTZA 3KNXA 2VIDA 3C27B 4ISHH 4DIHH 3GDSA 3QDZB 1YC0A 5GJ4B 2VH0A 1P10A 1O2XA 1OWHA 1DITH 2TGAA 1Y59T 5HKKD 1QB1A 2B5TB 3PV5A 5A2MH 1Y3VA 5FHTA 1V2RT 3KQBA 4FOUC 1C5WB 1A0HB 2GCTB 1AIXH 1HAXB 1HAIH 1RD3B 1MTWA 2JDID 3Q77A 1O3HA 5EXNA 2CF8H 1GBHA 4CHAC 3GOVB 1FPCH 1EATA 1PPFE 2Y82A 1O2GH 4X6MA 1A5HA 1ZMNA 2A7HA 1O5DH 2XTTB 3HKJB 3A85A 1DX5M 1S83A 2ODQA 1GJ6A 3NRLA 2VB0A 1DS2E 3NK8A 1T32A 4ISOA 3PWBA 1IQJA 2H5DA 4TY6A 3UOPA 3RXRA 2R3UA 1FZZA 1SGYE 4CRFA 4MPUA 5JYIA 2Q1JA 1HPGA 2FOEA 5IK2D 1GMHG 2FODA 6ESTA 1PFXC 1ID5H 1SQTA 1TMBH 2F9VA 2F9UA 4U2WA 3BF6H 3Q3YA 2AFQB 3GDVA 1QCPA 2EI8A 1YWUA 5FCKA 3D23A 1O3EA 1GI4A 1O2HA 1DWDH 3RM2H 2HALA 1A3EH 1P2KA 3Q3XA 3LDXH 4WH8A 2R0LA 4JZFH 1SSXA 1QB9A 1BJUA 1AZ8A 1FNIA 1UTOA 4OS1A 1Y5UT 2OC8A 5C5NA 2ZDKA 3SJ8A 1FQ3A 1H4WA 4X1RU 1FMGA 1DWCH 3SOSA 1O3DA 3KQCA 1T4VH 5EXLA 1GI6A 4X2XA 2YNAA 4K1TA 3JZ1B 4O3TA 2Y7XA 3LONA 1UTMA 1UVTH 5LGOA 1BZXE 3KYGA 4LXBH 4JMYA 3EQ0H 4Q7ZA 2QIQA 4Q63A 2FYRA 5EJZA 1QIXB 2PLXA 2SNWA 2AMDA 3EA8A 1GJAB 1WYKA 4AOQA 1T31A 3HKIB 1HDTH 3D62A 3STIA 2BY8X 3VPKA 1P57B 4BANB 1COWD 4IW4E 5EU8A 3GY5A 5I25A 3RUOA 2I6QA 5AF9H 4F48B 3GCHB 2ODYB 4P00A 1KXFA 1BIOA 1VJ9U 1SOTA 4DIIH 1GI5A 2AGEX 1AUTC 3S7KB 3RDZA 4YZUA 1A5GH 1WDIA 1SQAA 5C0TA 2HRVA 3CENA 2ZCHP 1GCTB 1C1QA 1O3PB 4MPXA 3LGYA 3I77A 1HBTH 1G2LA 1LQDB 4HTCH 5E8EH 3MO6A 3SO3A 3FZDA 1D6WA 1V2OT 4K2YA 5E0GA 2SGDE 3AAUA 3UPEA 2VWNA 3U1IB 4Y11E 3QO6A 4X2VA 5DPAA 5E2PA 3TGIE 5DSFA 3MWIU 4GCHF 1IQMA 1QL7A 1O2RA 4RT0A 5FXLA 2PFEA 3FKSD 1O2VA 1V2PT 2V3OH 3F2FA 4TYDA 2C93B 2G55A 3T29A 2JETC 1W2KH 3RMMH 1KXCA 1V2ST 2A45B 2VIWA 3DCLA 2W3IA 3L3TA 2WPMS 1CA0C 1MQ6A 1A5IA 2SGPE 1GJ7B 1NN6A 2PR3A 3BG4C 2FTMA 2JJ2D 3A88A 4XFQA 3T28A 3T27A 2Y81A 2TGDA 2GT8A 4YT6H 3CS7A 4ASUD 4AG1A 1HXFH 4INHA 3SI4H 1W13U 1RTFB 4ABDA 5LPFA 3OAAD 2C3SA 5EG4A 3A84A 2RCEA 1BBRE 1BMAA 4K3JA 2QXHA 1C2LA 3EA9A 5LPRA 1O36A 4B71A 3N7EA 5FCRA 1BA8B 2WINI 1KTSB 1NFYA 2Z3EA 4ZAEA 4MNVA 4INKA 4FUGA 5EQSA 3SNEA 2GKVE 3TH2H 5LH8A 3PLBA 1O2JA 4B75A 1NO9H 2FLBH 3MHWU 3RU4T 1NC6A 3GY2A 3SV6A 4NZQA 4X1NU 1MBMA 2YMSD 4XBCA 1DWBH 1SG8B 2PW8H 1Z71A 1AE5A 1F5LA 2Z3DA 4ABFA 4Z1MD 4GPGA 2EQNA 3LH1A 4X1SU 1ZZZA 2ANYA 2FP7B 2G4TA 2Z9IA 1TAWA 2OUAA 1HAYB 3K6YA 2GMTB 1NPMA 1SHHB 4F4OC 2GGVB 1TRYA 1G3EA 1ZGVA 3Q76A 2XYAA 2F9OA 1JRTA 1QBVH 1TONA 3A7VA 1SOZA 1P03A 2A4RA 3K65B 1UCYK 3F9HA 1XUFA 4YLUA 1T7CA 4BOHA 1HXEH 4Y8ZA 1ETTH 1K22H 3F0OA 3N7OA 3VG8A 3CP7A 2A5KA 2ILNA 1V2LT 4I8HA 4XSKU 5DP9A 3P17H 1TNGA 1EQ9A 2O9QA 1DE7H 5EJLA 3T5FH 3NXPA 2XCFA 1Z8GA 2Z9JA 3LC3A 1TQ0B 2W6JD 3SGQE 5FPSA 4KGAA 2ZF0H 5DP4A 3RXDA 1MU6B 2ZO3H 1P0SH 1PYTD 3OSYA 3SU3A 1OP8A 1QL8A 2GZ9A 2QF4A 2ZPRA 1A0JA 1TE0A 3FP8E 7ESTE 5E2OA 1NROH 5HIZA 1FUJA 5EW2H 1UMAH 4WWYA 5DP7A 1L1NA 1RFNA 1G3DA 1T4UH 2CGAA 1H1BA 1RRKA 1JWTA 2VGCC 1O2LA 4AFZA 3TIUA 1LQEA 3RXHA 2ZC9H 5F03A 3A81A 2OC1A 4IBLH 4ISLA 3KL6A 4Q7XA 1ZHRA 1KLTA 3QTOH 1RIWB 1YPLH 1B5GH 1W0KD 3LKWA 2ZFTA 3S9AA 4E7NA 2J4IA 2QAAA 4AFQA 1J15A 1MAXA 1QR3E 4AFSA 1C4U2 3V3MA 2NU3E 1CO7E 2GP9B 2ZWLH 2ZGHA 3AAVA 3F3BA 3BTFE 1E1RD 1AQ7A 1UO6A 3C1KA 4X1PU 3P92A 2OBOA 4KTUA 3ZVCA 4A5TS 2VU8E 1CBWB 2HLCA 1C5YB 1S0QA 3GICB 3HK6B 4NSVA 2P3UB 2BY9X 2KAIB 5A0CA 2FOFA 1E1QD 3FZZA 1C2HA 1KXAA 3SJKA 1YM0A 3SU1A 2AGIX 3DFJA 2FMJA 1CT2E 2VNTA 1WQVH 1MCVA 1ANBA 2Z9GA 5FX5A 2ZGXH 1JRSA 3P8NA 4B2BA 1NBMD 3MI4A 1TLDA 2A0QB 4AC9A 4BAQB 1O2OA 3SGBE 1S6FA 3TPIZ 4YLQH 2V6NA 1O2SA 2F4LA 1VITG 4FXGH 1DANH 1NS3A 2BD5A 4K8BA 1FONA 3LU9B 3KN2A 2WV9A 1G36A 3B9FH 3LGTA 4ABIA 2F83A 4IS5A 3EE7A 1CU1A 1YPJH 1INCA 1B7XB 3GCHC 1IHTH 4CBOA 1ETSH 2CHAC 1ABJH 3RU4E 1GHXH 1LHDH 3F6UH 1EPTB 3U69H 3LJJA 3BTWE 3CS0A 1O2YA 2G52A 3MQKC 4Y8YA 4E7RG 1TPOA 1WOFA 1PQ7A 5HIYA 3FP7E 3ZZ5A 5B6LA 2VIPA 1ZJDA 5GCHG 4OS7A 2C8WB 2F9NA 1AO5A 1TBRH 2M2AA 3SGAE 3ZYDA 4BXSA 4K5ZA 1P2IA 5EQRA 1AVGH 3PTBA 1GHZA 2NU0E 3EYDA 3QN7A 2W26A 2ZGCA 1MTNC 1HAPH 3PM3A 1EFRD 1D3PB 2L74A 2AS9A 2Y80A 4DOQA 3TJOA 1FDPA 4BNRA 1QJ1B 3W95A 1SVPA 1ZHMA 1C2EA 1LHCH 2FEQH 2F43B 2QN5T 4CR5A 1BRUP 1UCYE 1NRPH 1GI1A 1MBQA 3ITIA 4ABGA 2CMYA 1TOCB 1Z6EA 2GTBA 1C4Y2 3FN8A 1MAYA 3K9XB 4FU9A 1AD8H 4AGJA 1MABB 1SGCA 2WPHS 2ZHEH 1P02A 2K0QA 2XW9A 2XBYA 2BY6X 4UDWH 4ZHAA 5JBAS 2V3MA 1GHAG 1O2QA 2B7DH 2BVRH 4WJG2 4R8TB 4WH6A 1PPEE 1MZDA 2ZDNA 1PQAA 4XDEA 1MKXK 1WCZA 1BRCE 1HGTH 2J9NA 1QJ6B 3DSPA 5CHAB 1FY4A 1PQ5A 1GDQA 1ARCA 5C0UA 1C5MD 3ZZBA 5T3HA 2YNBA 5EPNA 4FU8A 3KF2A 1CA8B 1LHFH 3DSOA 2WPLS 2OTVA 2SGEE 2BM2A 2ZGJA 1O5FH 2BTCE 1DFPA 1C5OH 1W7XH 1MUEB 3RC5A 1UJ1A 2VIVA 4D9QA 1U6QA 2FO9A 6CHAC 1BQYA 1MU8B 1AWHB 3ELAH 3SU4A 4B6FA 3A82A 4NIWA 2BMGB 4UONA 1TX8A 1VCQA 2O8WA 2R0KA 5J4QA 3VGCC 2V3HH 2ANMH 2OQUA 4K8YA 2FPZA 2P16A 3GCTG 2UUKB 2P3FH 1QRXA 1ESAA 3FFGA 4X8SH 1QA0A 4HI3A 2H6MA 4AB8A 3STJA 1V6DA 1BUIA 1O3IA 3RXMA 1QQ4A 3K6ZA 4AX9H 3E90B 4LOYH 3ZZ3A 2LELA 3URDA 3TVJB 2BDAA 3QX5H 1O2KA 2ZQ2A 1GGDC 1O5EH 4RKOB 3A86A 5FBIA 2BDHA 3U8OH 1EAWA 1C1RA 3W94A 1YLDA 1VZQH 2EC9H 2UWPA
chains in the Genus database with same CATH topology
3BTHE 2FOHA 3A80A 3KHVA 1FN6A 1AWFH 4AN7A 1UHBB 3K2UA 1V2VT 3V13A 1KY9A 1EJMA 4SGBE 2ODPA 2FLRH 1EUFA 2FOBA 4XBBA 1JIMA 1ZR0A 1B0EA 1C1NA 4B2AA 1Y5BT 3PB1E 3RC4A 5K0HA 4SGAE 1NU9A 1A2CH 2ZHWH 1FAKH 1MKWK 2UWOA 4E05H 2FS8A 1SGNE 3QUMP 1SLXB 3UQVA 3MU0A 3T62A 5ABWA 1MD8A 2BX4A 1DUAA 2G51A 1FXYA 1LKBA 1C1SA 1E0FD 4NFEA 1SFQB 2FXRA 2P94A 2ZECA 4Y10E 3VFEA 3L33A 1D4PB 1RIWC 2OC0A 3P8GA 2ZCKP 1CVWH 4VGCB 3VB7A 1C5QA 4IC6A 4Y0ZE 5EXMA 1E38B 1OWDA 4Y7AA 1O3OA 4I33A 1Z7KA 3UR6A 1J9CH 4X6NA 3ZZ9A 1W8BH 4IC5A 1RJXB 3PMHB 1O2UA 1DUEA 2XWBI 3TGJE 1UTJA 3QZQA 1L4ZA 5DP6A 1BBRK 2VVUA 1AUJA 3UQOA 1TNIA 1IAUA 3A87A 5A8ZA 1JBUH 1C5XB 1OKXA 3MYWA 3PV4A 1SGFA 1ELFA 1OWEA 3PO1B 1CT4E 2ZU2A 1AN1E 2P59A 1MKXH 3BTDE 2OINA 2BQ7B 3M3VA 1YF4A 1THSH 3LPRA 3UNSA 1GI0A 4CBNA 4O9VA 4AFUA 2ZTZA 4OS4A 3SBKA 1NRQH 3M5MA 4XE4A 5DP5A 3QLPH 1PQ8A 1GI7B 4B1TA 1T8MA 3QTVH 1DWEH 1S85A 2H9HA 2WPJS 5FBEA 1GDUA 3ATWA 1GHBF 2OBQA 1S6HA 3UREA 2HPQH 3FAOA 2NU2E 1GVZA 1ZPCA 4LZ1H 2Z3CA 1IQGA 1GG6B 3RMLH 3VB6A 4TPIZ 3DT0H 3F9FA 4Q80A 1ACBE 1WUNH 1XUGA 2BDGA 1RTLA 1LPKB 2ZFSA 2D26C 4GCHG 3TK6A 3LGUA 2GT7A 1DDJA 1YPGH 1HJAB 1K1PA 2SGAA 2YOLA 1XX9A 3RXLA 4DW2U 1GCDA 1SBWA 2XBXA 4X1QU 1NRRH 1QQUA 2FI5E 1YPHE 4AGKA 3RXJA 3DD2H 4MLFB 1ELAA 1K1OA 1PYTC 4K69A 1W7GH 3SZNA 3IG6B 1AFQB 3RXPA 4MVNA 4CRGA 2ZNKH 4MDSA 4ABEA 4X0WU 1WSSH 1OOKB 1MQ5A 4IN1A 1ZPBA 1LKAA 2ALPA 1HNEE 1O2TA 1B0FA 1W10U 2VH6A 2DUCA 1A3BH 1IOEA 3TJVA 1MKWH 4Y79A 5G4BA 2P8OC 2Z6BD 2AIQA 3GCNA 5F6MA 1LTOA 4MNXA 1F0SA 3TH3H 3R0FA 2OCVB 1YGCH 2QGRA 1J14A 1XVOA 4H6TA 5FPYA 3VXFH 3LGWA 2AGGX 7LPRA 3S0NA 1CT0E 3MNSA 5IYTA 1A0LA 1TPAE 2WYGA 2BHGA 2PKAA 4WVPE 2D8WA 2ZI2H 3M61U 1OWIA 2ZFRH 2CF9H 1FY8E 4H42U 1OX1A 1EASA 4MTBA 1BHXB 1GMCF 3E1XB 3TU7H 1F0TA 1NZQH 2H2ZA 1T8OA 3SORA 1SR5C 1ZGIA 2KAIA 1HCGA 1G3CA 1KLIH 1G2MA 1BBRH 3RLWH 2FI4E 3LH3A 1CHGA 1MTVA 1FI8A 4WY3A 3RXVA 3RXCA 1WTHD 2RA0A 1C2GA 3QGNB 1VCPA 1Z1IA 1BT7A 4HZHA 4BTUB 1C2DA 1J8AA 1GPZA 5L30H 1LO6A 1W0YH 1YYY1 3A89A 1N6YA 3SI3H 2O8LA 1QB6A 1RS0A 1L1GA 1EP5A 1H9LB 1WV7H 3F9GA 2Q6GA 1JOUB 1UK4A 3UNRA 1BITA 1O5CB 1LCYA 2VIOA 4YOGA 1BCUH 2XRCA 3ZZCA 3MNCA 4I8JA 2AIPA 1TFXA 4TPYA 2H9EH 4FUDA 1FIWA 5A09A 3M35A 1K28D 3SNBA 4ZHLU 5A0BA 1EPTA 4X8TH 3SNCA 3D49H 8ESTE 3V7TA 5L2ZH 4ISNA 1P05A 3Q3KA 4X8VH 4ZROA 2QF3A 4CREA 1TOMH 3EA7A 4FUBA 1CHOF 4M7GA 5C1UA 1V2UT 3EE0B 3OX7U 2XCNA 2ZEBA 1FJSA 2BLWA 3PROA 1C5SA 1TGTA 3RXGA 2O8UA 1TX6A 2XXLA 1T8LA 1SGQE 1D6RA 2EEKA 2QV1A 2UUJB 4ABBA 2PKSC 1DVAH 3SHCH 1GJ5H 1TNLA 1C5VA 2G5NA 1HUTH 2A2QH 1HAZB 3A7ZA 1BRBE 2WV4A 2J38A 3ODFA 1W14U 4ZKOU 3OY6U 3RXSA 3U8RH 2AMPA 2FM2A 1K1MA 3RXQA 4H4FA 3LOXA 1AU8A 3E0NB 4OS6A 4I8LA 4AORA 1T8NA 3KEEA 2OXSA 1AVXA 1N8OB 1P2MA 1SI5H 2J2UA 2GCTC 3SU6A 1UTNA 1SGTA 4AYVB 1F5KU 4UFGH 4TWWA 2ZG0H 5HGGA 1O3MA 1P3CA 2QF0A 4MPWA 3RMNH 1P9UA 1DLEA 3T26A 1RXPA 1ZPZA 4WXIA 2PTNA 2PHBA 1EZUC 4U01A 1CSOE 1VGCB 3LIWA 3LT3A 1ANDA 3B23B 2FYQA 1OP2A 2Y5HA 1AE8H 1O31A 5BPEA 4A1XA 4AB9A 1FV9A 1HYLA 1SMFE 4B74A 5JBTA 5GIBA 1TGSZ 5PTPA 1O32A 1C5UA 3E0PB 1GMDF 1EKBB 4Y0YE 2VJ1A 2GDEH 3TLOA 3MU4A 3M5OA 1TQ7B 3ESTA 4NA8A 2A4QA 2CN0H 1Z8IB 5FPTA 3BN9A 4K1EA 1EB2A 1O2PA 2PKAB 3EDXB 1O34A 1KLJH 3GYLB 1L2EA 2QYIA 2GCHF 1A61H 3MO3A 1O39A 1BOQA 5AHGH 2BD7A 3V12A 2ULLA 3A7XA 5C3NA 4CRCA 2ZP0H 1QBOA 1QFKH 2BX3A 2SNVA 4OGYA 4UFEH 1GI8B 1G9IE 3S69A 1GL1A 1OWKA 3QZRA 2A2XH 5EGMA 5AFYH 1UHBA 8LPRA 3OU0A 4O03A 4DVAU 5JB9S 2XC4A 4ZHMU 2AMQA 5AFZH 3O8BA 2AERH 1S0RA 1C1VH 2IOTA 1G32B 2BOHB 4X8UH 4CHAB 7GCHF 2HGTH 2BVXH 2ZPSA 1GJCB 1UK3A 4THNH 5ESBA 1GBAA 2P93A 1AB9B 1ZRKA 1TIOA 1GI3A 2B9LA 4CRBA 3F68H 3A7TA 4ZMAH 3RXEA 3VEQB 5I46H 1C5NH 1GI2A 1K1LA 1ELBA 4A6LA 4X6OA 3ZYEA 4JZ1A 3MNBA 2WUBA 1TALA 2A4GA 1GCTC 1KDQB 1MMJN 1C1WH 3SV7A 1GHYH 1O5AB 4UFFH 1A1RA 1UK2A 5TJXA 1YPEH 1L4DA 1YPHC 1UCYH 3UFAA 3H5CB 5EPYA 1QJ7B 2FZZA 4X2YA 1FLEE 1SQOA 2FOGA 2R9PA 3HK3B 1GBMA 2Y6TA 2W7SA 1AVWA 1NU7B 3RXAA 1YP9A 4FUFA 3FANA 2A1DB 3E3TA 4Z6AH 1YLCA 3U98H 3SUFA 1UTQA 1VJAU 2ASUB 1QHRB 1C9PA 1TA6A 1W0ZU 5T6DA 1BDAA 1OP0A 4IMQA 3ZV9A 4WXVA 1MH0A 1ZSJA 1O3LA 2ALVA 1AGJA 2AYWA 2R2MB 3M3TA 1OYQA 5C20A 1C1PA 3S9BA 1V2KT 2H9TH 1P11E 2OP9A 3BTTE 2G8TA 3AW0A 1HAVA 1V2TT 4NFFA 1C2KA 1TB6H 1SPJA 2ZDLA 1GDNA 1OYTH 5DP3A 3SW2B 1AY6H 3SU0A 4TWYA 3R3GB 3V0XA 2BZAA 4DG4A 2BDYA 8GCHF 4DCDA 1O3GA 1ZSLA 1O3NA 2XNIA 5CMXH 2A5IA 4CH2B 1EAUA 1HAOH 1EZXC 2PGBB 5ESTE 1Y5AT 4OS2A 1CQQA 1F92A 2IN2A 1O5BB 1AZZA 4K60A 3PMBB 2HPPH 1QGFA 3BTEE 1ANCA 4YM9A 2VWLA 5H4IB 5B6OA 1NFXA 3RXKA 1G30B 4ZXXH 2ZFPH 2V35A 1C5LH 4YOIA 1N6XA 4JYVH 4BAHB 2BXTH 4A1VA 3MH4A 1JMOH 2F3CE 1UTLM 1G37A 2QCYA 3RP2A 3SUGA 3NZIA 1F0RA 4U32A 2RA3A 1BJVA 1P2JA 2GMTC 1C2IA 1TMTH 4MG3A 3BEUA 1P09A 4Q2KA 4I32A 1IQKA 5HXFA 2JETB 3MOCA 1ZLRA 3P70B 2M5TA 3RC6A 3SUEA 2A31A 1AKSB 3BTME 4J1YA 3BTKE 1ZTKA 1D3DB 3BG4B 2R2WU 2BZ6H 1DXWA 1HJ8A 3RXOA 4B76A 1Z8RA 2BB4A 3F1SB 3NKKA 3HATH 4KTSA 1NESE 1O3AA 1YCPK 2TPIZ 1V2QT 1A4WH 1GJ8B 1SLVB 1SHYA 2UUYA 2EI6A 2HNTF 3ZVAA 3ZZAA 1O33A 1O3CA 3UUZA 3U1JB 3BEFB 3MH6A 2FESH 9ESTA 4UD9H 1FAXA 4D7GA 2C8YB 3A8DA 4FUEA 4B73A 2A32A 2ZQ1A 1TPPA 1O30A 3GCOA 3A7YA 4E06H 2TRMA 6GCHF 1C1OA 2H5CA 1GBLA 2ZPQA 3FP6E 3IWMA 1GWAA 4D8NA 5BRRE 3HGNA 1OS8A 1DY9A 1S5SA 1ELGA 1FY1A 1JXPA 5GXPA 1TGNA 4WF8A 1EB1H 4JK6A 4ZXYH 3GISB 1GHBG 1NFUA 3TK9A 1PJPA 4RSPA 1Y3WA 1O3FA 4CRAA 3H7OA 1TWXB 1BRAA 3D65E 2ZHDA 2GZ7A 4A7IB 2V0BA 4BTIB 1XUKA 4ZKNU 4A92A 3MU5A 5T6GA 3M5LA 1C5TA 1DSUA 1V2NT 4ABAA 1PPZA 1TBZH 5A8YA 2FX4A 3ZVEA 1F7ZA 2VWOA 4YO9A 1C1TA 2HNTE 5L2YH 2XC0A 5C67A 1CBWC 1W3CA 3UTUH 4Y76A 1DICA 3NUMA 7KMEH 2LNCA 4BXWA 3E6PH 4FUCA 1EZSC 1FPHH 5A0AE 4Y6DA 2ANKH 3UIRA 1EXFA 3AVZA 4D7FA 3QWCH 2BDBA 3PLKA 4F49A 1BMMH 1O2WA 4FUHA 3RXIA 5JBBS 1IQIA 3SV9A 2XBWA 2TGTA 3EGKH 2CV3A 2ZU3A 2OLGA 1EAIA 3GY6A 3HGPA 1NM6A 1HAVB 4ZKSU 1V3XA 2G00A 1X7AC 1OSSA 1TRMA 1O2MA 2ZFFH 4DY7B 1S82A 4A1TA 2F91A 1HIAB 3UY9A 1Q31A 5F8ZA 1MTUA 2GVFA 1BHXF 2ZDVH 2J95A 1AB9C 1Z6JH 4Q7YA 3T2NA 4ZUHA 5HM9A 1TNKA 1MCTA 1YCPM 2P95A 4MNYA 3ZVDA 2WUCA 2F9PA 1ZTLA 2PUQH 2VGCB 2ZFQH 1EPTC 4KELA 1IQNA 1ELCA 2BXUH 1SL3A 2TBSA 1RGQA 3ZZ6A 3P8OA 1O5GH 1VCWA 1GJ9B 5EQQA 9LPRA 1C2MA 4OGXA 1LPZB 1XXFA 1GMCG 5C2ZA 4PROA 1GBEA 1TMUH 2TIOA 3MNXA 4KKDA 5HYOA 1S81A 2DE8A 3RMOH 2BOKA 2Y5GA 1C1UH 1O2ZA 1P04A 2NWNA 2ZU5A 4GHQA 1IQLA 4FU7A 5LPEA 2BLQA 1GBFA 1BTHH 2D2DA 3MH7A 1LVBA 1GBBA 5DGJA 1YCPH 2GD4B 4JYUH 1DSTA 2PSYA 4GLYA 4JK5A 2ZCLP 1BB0B 1ZJKA 2STAE 3SJOA 3ATLA 3A83A 3QK1A 5JBCS 3LC5A 4JYTA 2BVSH 5CHAC 5J4SA 3U9AH 4NGAH 3ZZ8A 1AMHA 1FIZA 1ELEE 2PSXA 3GY3A 1ABIH 2UWLA 1LVOA 1W12U 1WTGH 3LGIA 2HWLB 2WPKS 2K1QA 5ETXA 3NPSA 3O8CA 4FVDA 1GVKB 4NA7A 1ARBA 2C8XB 1SB1H 3MMGA 2O8TA 1QY6A 1BTWA 3T25A 1CHOG 1PPGE 4O97A 2CHAB 1GBCA 3FVFB 5DG6A 5F8XA 3SQHE 2XC5A 1GMHF 2W7UA 4Y71A 4YOJA 2I6SA 2BY7X 3BTQE 2GV7A 3ATIA 3WY8A 1IQEA 2BY5X 4GSOA 1P12E 4DJZB 1K1NA 3A8CA 3A7WA 4WMDA 2ZHQH 5C5OA 3O8RA 1O3BA 5TCAA 3MO9A 4KP0A 4JZIA 1P01A 1TGCA 1C9TA 3RXFA 3AASA 5DKMA 2UUFB 1EOLA 1O35A 1TA2A 2LPRA 3UR9A 1GBIA 1MTNB 1ZOMA 4GAWA 2TGPZ 4D76A 1HAGE 4NSYA 3KQEA 1TRNA 2PTCE 3IITA 3PWCA 4YESB 4NWKA 1WQSA 1UVUH 1O37A 1ZTJA 1EZQA 3M5NA 2CJIA 3TNSA 3M7QA 6LPRA 3M3SA 3UWJH 1XUHA 1DLKB 2JKHA 2W3KA 1CGJE 1ZMLA 2ZTXA 5GPIB 2OD3B 1NTPA 1EP6A 3SU2A 2VWMA 1ORFA 1BTPA 1TX7A 2BYAX 1FY5A 1TNJA 3RXUA 1CGIE 2XBVA 1K9OE 1NFWA 1LVMA 1DM4B 5IDKA 1EJAA 4JZEH 1S84A 1SFIA 1TGBA 1HAHH 3SUDA 1M9UA 1C5RA 1XUIA 1KDQA 1C5ZB 2FOCA 4HGCA 1HJ9A 1UVSH 5SGAE 3F9EA 1CE5A 1LPGB 1MZAA 1DY8A 4DURA 2NU1E 2SGFE 2W5EA 1GMDG 1Y3YA 1O2IA 1ZYOA 1H9HE 3URCA 3DA9B 3BIVH 4CH8B 3UWIA 3VB3A 1FN8A 3HPTB 2D1JA 4YTAA 6CHAB 2Z7FE 1O3KA 2G4UA 1ZRBA 1QBNA 1EAXA 2P3TB 2J94A 2GCHG 2OC7A 1K21H 3GY7A 3LJOA 3VGCB 3ZVGA 3MU8A 4VGCC 3SV2H 2ZDMA 2ANWA 4KTCA 1ZSKA 1NRNH 3PLPA 2JH0D 1O3JA 3BEIB 1E37B 5K7RA 3L6PA 1BTXA 3MTYA 5GDSH 2EI7A 4ABJA 1SGEE 4WMFA 3BG8A 1GBTA 4HFPB 2O8MA