3A7YA

Crystal structure of trypsin complexed with (e)-4-((1-methylpiperidin-3-yloxyimino)methyl)benzimidamide (soaking 2hours)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cationic trypsin
publication title In-Crystal Chemical Ligation for Drug Discovery
rcsb
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a7yA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a7yA02
3A85A 5E0JA 2FLBH 1C1QA 4DURA 3RLYH 1GBFA 1MUEB 3ZZ5A 4I33A 4IN2A 3SV8A 3U8TH 1NS3A 1MTNC 4ZHLU 2YOLA 5HM2A 1KDQA 1ELDE 3R0FA 3MYWA 4K1EA 4MNWA 3KQDA 3VGCB 3SNEA 2PKSC 5AF9H 1BMLA 5DG6A 5L2ZH 1OS8A 1TABE 3RDZA 1ZPBA 2VGCC 4JYVH 3BSQA 1VGCB 2QV1A 2ZTYA 4INKA 1TAWA 3GCTG 2SGFE 4E7RG 1FN6A 1AFQC 1ETSH 1AE5A 3UPEA 2P3TB 1L2EA 1SQOA 1SOTA 2HNTF 2O8LA 1MKXH 3MH7A 3ZZ6A 1N8OC 1W14U 1AUTC 5GIBA 3SJKA 2ZIQH 1GHAG 1DWCH 3PWBA 1SGDE 1O2TA 4X8VH 1YM0A 1TLDA 5EG4A 4X6OA 1YF4A 4FUFA 4LXBH 1RRKA 2DUCA 5GCHG 2SFAA 5FCRA 4AYVB 4I32A 4X2YA 2R2MB 3MO9A 1TQ7B 4H42U 4OGYA 2ZGHA 1Z7KA 4Y7BA 4DG4A 1WCZA 5DKMA 3M5NA 1C2FA 2XBYA 5ESTE 2C8ZB 3ODDA 4GLYA 2FM2A 1O5BB 2WPHS 1XXFA 3U8RH 4RSPA 2XWAA 1S0RA 2HNTE 2K1QA 1WV7H 1TONA 2HVXA 1AVGH 3QUMP 1BIOA 1WOFA 1ACBE 3BG4C 3TJVA 1IQIA 1S81A 1S83A 4K2YA 4KTCA 5FAHA 2QXHA 3EA8A 2THFB 4CRCA 3M36A 4FVBA 4FU7A 1ZGVA 4BTTB 1E35B 1ABJH 2BD4A 1FXYA 1P06A 4TYDA 1YKTA 1UMAH 2C93B 2FTLE 4Y79A 1LHFH 1LVOA 1UCYK 3LJOA 1C5YB 1DWEH 1MTVA 1O36A 4OS4A 3LGIA 3VXEH 3SUGA 4YZUA 2QGRA 1LHCH 1BUIA 2ZWLH 3PO1B 1ZLRA 3T28A 3TNSA 1C2JA 2FEQH 3DHKH 3RXVA 4MNVA 1ZTJA 2ILNA 1UVOA 2FIRH 5GJ4B 3MNCA 3RC5A 3DFJA 1S6FA 3H5CB 2SGDE 4FUEA 1K1OA 1SBWA 2BQWB 3AAUA 3MH4A 1FIWA 4OS2A 1GMHF 1P3CA 2BLQA 4AB9A 1KLTA 1CSOE 3SUFA 2QF0A 1W0YH 1FUJA 1JOUB 4MNYA 1PPEE 4U32A 1V2OT 1Z6JH 2O9QA 3STJA 4NWKA 1V2UT 3TH3H 2UWLA 2FZZA 2UUKB 3MNBA 1Y5BT 2XWBI 1C4Y2 4FU8A 3DA9B 2AGIX 4X1SU 3Q77A 9ESTA 3RXLA 4ABBA 1QA0A 1P02A 1C2IA 2QXIA 4GHQA 3E0PB 1WQSA 1EOLA 2ZDNA 3AASA 2ZPSA 3OY5U 4WH6A 1UVTH 1BHXF 1F0RA 2OCVB 1OXGA 1OP2A 4ZHMU 5HXFA 1EUFA 3UWJH 5G4BA 1GBEA 1GBHA 3RXHA 3RUOA 2HPQH 3VB5A 4AOQA 2AMDA 2XYAA 3IITA 1EZQA 1UHBB 3PMAB 3HATH 1WTHD 3ATLA 1GCTC 1FMGA 2ZQ2A 1P2QA 1THSH 2FX4A 1UTQA 4OS1A 5I25A 5FHTA 4BAHB 4ABDA 1UTOA 2ZECA 1YLDA 4Q80A 2OBOA 2ZU1A 1A5HA 3MMGA 5JB8S 3EDXB 3B9FH 4BANB 2SGQE 1SSXA 4OS7A 3UTUH 4H4FA 5L2YH 2A4GA 3ELAH 5LPFA 2SNVA 2YNAA 2FOEA 1D6WA 1DUAA 2QF3A 1KYNA 2OXSA 3SO3A 1UK3A 2A5IA 4CRFA 1LVYA 2CN0H 1EXFA 2A4OA 3FZDA 1HV7A 1BBRE 5AVDA 4Y0YE 5CHAB 3RC6A 1C5WB 1O34A 2P95A 3QDZB 1A4WH 3H7TA 2FYRA 3EQ0H 4GCHF 1GJBB 1T4VH 1ELEE 1AKSB 1ELCA 2HGTH 1OYQA 1BJUA 1K21H 3MHWU 1N1LA 2F9BH 1ZMLA 3GY4A 1C4U2 1NESE 4VGCB 2FYQA 3TGJE 3ZZ7A 2W26A 2YNBA 3SNCA 5DP9A 1V2ST 1TNHA 1ZTLA 4MVNA 4FU9A 1AVWA 4MTBA 4D9QA 1DY9A 1YPHC 2J38A 3UOPA 2C3SA 1IQFA 1QA7A 5K0HA 1LKAA 1NRRH 1CT0E 2VINA 5EQSA 4R8TB 2CF8H 1PYTC 2FOCA 5GDSH 1TPAE 2Y5FA 1K22H 1A2CH 1A0HB 3SU3A 3VGCC 1MU8B 2IJOB 1RTFB 2H2ZA 4UD9H 1GI3A 1P2OA 1MTWA 4DCDA 1WTGH 1TGSZ 4DIIH 3I29A 5DP8A 3PROA 2P8OB 1VGCC 1FQ3A 2VWNA 1OOKB 4Q2KA 1GCDA 3S0NA 3BTWE 1W12U 3S69A 1SLXB 1VITG 3HKIB 4D7FA 4THNH 3MNSA 1H8DH 2J94A 1GJCB 3A8AA 2OD3B 1AI8H 2PSYA 1SHYA 2ZKSA 1SG8B 2BVXH 1E34B 1DSUA 1XUFA 1D3TB 2F3CE 2GCHF 2VIWA 2ANWA 1C5VA 1V3XA 2AH4X 3NKKA 1O0DH 1MKXK 2XC4A 1C5SA 4AX9H 1HB0B 1GI4A 1HDTH 3D23A 1S84A 3QWCH 2A4RA 1T8OA 1H4WA 3MO3A 4HGCA 1UTKA 5JBAS 1MTUA 4AGKA 1YCPK 1IHTH 2OBQA 1O2SA 3ZVDA 3ZZCA 2FPZA 1NC6A 1EKBB 1MKWK 1MTNB 2JKHA 1AVXA 1ANCA 3ZZ4A 1C9PA 3R3GB 1Z8RA 1KTSB 2J92A 3LGVA 3GCHB 2GTBA 5A8XA 2UUYA 3BEUA 3GCOA 4AB8A 3T26A 2FOAA 9LPRA 2VGCB 2P94A 3BEIB 2FODA 1RD3B 1C2GA 3E6PH 1TA2A 1TGNA 2F9VA 1LO6A 1O3GA 1O3HA 2W7SA 2JH6D 3BF6H 3A88A 4JZ1A 1Y5AT 1WSSH 2OTVA 1UO6A 3TJNA 4WWYA 4X8TH 4ZH8A 3PO1C 1Q3XA 1BTWA 1FPHH 3TGKE 1TIOA 4PROA 4ABIA 2ZPQA 1O2HA 3GY7A 1SGEE 5EU8A 3SHAH 4AFZA 4XOJA 4D8NA 1SMFE 2VIVA 1BMMH 4X1RU 1QJ7B 1VJAU 1MD8A 2Z3DA 4NCYA 1LHDH 4Y71A 1E37B 3PM3A 2PKAB 1AKSA 3MU1A 3LC5A 3MH6A 3PLBA 3ZVGA 2V6NA 3TH2H 4CRGA 1TB6H 3UNQA 2XXLA 2FP7B 3A8CA 1C9TA 3RXEA 4MPXA 1AIXH 2BD3A 2PTCE 3BTTE 3EAJA 1BTUA 1T31A 2RA0A 2Z9GA 5GWZA 1HIAB 2Y7ZA 8KME2 1O2NA 1T8NA 2A7CA 1UTJA 1O2VA 1QB9A 5FPSA 1SQAA 1C5MD 2ZA5A 3SJ9A 1O5FH 1VITH 2BY9X 4K1SA 2BDGA 1INCA 1HAYB 4AORA 3T29A 2CHAC 2OC8A 4B2BA 3G01A 3PYHA 4FUIA 1UCYH 4J1YA 2STBE 2P59A 1IHSH 1O2MA 4HZHA 1YYY1 1TGBA 3MNXA 4NGAH 1PPFE 2VH6A 3ATIA 1D9IA 3QO6A 1PQ7A 2ZDKA 2OP9A 2ODPA 4XBBA 5EODA 1D4PB 5EOKA 1CHOG 4JK5A 1GHBG 1UVPA 1VZQH 3F1SB 3U9AH 1DXWA 1YCPM 7GCHG 3RP2A 3ESTA 3PV4A 3P95A 3RXAA 3ATWA 1GDUA 3AAVA 3PWCA 1MZAA 3DT0H 4BNRA 3BTME 3GCTF 3PMBB 4KKDA 4YO9A 3RXGA 1TGTA 2OC7A 2D1JA 4R0IA 3F68H 1P2JA 1NU9A 2XNIA 1DM4B 1DWDH 3SGAE 1MQ6A 1TOMH 4I8KA 5CHAC 2HOBA 1GHAF 5DO4H 1LCYA 1OPHB 1P11E 4Y0ZE 5JPMH 2HPPH 1GBMA 4U01A 2SGAA 1QJ6B 4ABJA 1TNIA 1BJVA 1GVLA 5T6FA 4FUCA 5GCHF 1GBKA 1B5GH 3QGNB 3UR9A 1AMHA 2BY5X 2FI4E 4ISNA 1SQTA 1TRNA 4Q7ZA 3LC3A 3NWUA 4ZMAH 1PYTD 1J14A 2FXRA 1ZYOA 5DPAA 2XRCA 3RMLH 1EOJA 1Y3WA 5F03A 5AFZH 1EPTC 8LPRA 1N6XA 1RTKA 1GJ9B 1T8LA 1F7ZA 4TY6A 2GZ7A 4XBCA 3URDA 3PTNA 5EQQA 5A0AE 1CA0B 1UJ1A 3P8OA 4HTCH 3SZNA 1QL8A 1NRSH 3OYPA 5E0GA 3QGJA 1QRXA 6LPRA 1JMOH 1DFPA 3CENA 4NWLA 5DP5A 4MLFB 1O3AA 1K28D 3UUZA 4AFQA 2ZHWH 4I31A 1JBUH 1C1VH 1ZSLA 1EQ9A 2PKAA 1D3DB 2XBWA 4NZQA 5AHGH 1HJAB 4DIHH 3MU0A 1HAHH 3ZVFA 2A45B 1EX3A 2G81E 1OWIA 4FUHA 4WXVA 8ESTE 2TGPZ 1K1MA 4U30A 1A5IA 3HKJB 1GHVH 4NFFA 1HIAA 1BCUH 4FUDA 2VJ1A 5EXMA 5H4IB 1C5LH 1XX9A 2BXTH 1ETTH 1ELVA 4UEHH 4OGXA 3UREA 3UWIA 2ZFSA 3BEFB 1O2IA 3TIUA 2SNWA 5BPEA 1SGTA 1GG6C 1ANBA 2ZHDA 2G51A 2XBXA 5JBTA 2F83A 2Z3EA 1CGHA 3M5OA 5F8TA 2H9TH 3E91A 1L4ZA 1LPKB 4Q7XA 3SU2A 4K5ZA 1ANEA 4K8BA 4NIYA 2R2WU 3GCHC 5TCAA 1BA8B 4AN7A 1UVSH 1O37A 1P8VC 1O2YA 1E38B 2Q6GA 3AW0A 4DY7B 3P17H 2ZPRA 1BMAA 1GL1A 1G2LA 2J4IA 1TMTH 2EI6A 2ZFFH 2J95A 7KMEH 2WV5A 1TPOA 2ODYB 5IYTA 4XSKU 2FI5E 2WINI 1TA6A 1P2MA 4LZ4B 3LGWA 3E90B 5T6GA 1JWTA 1JRTA 5DJ7A 4IGDA 3EYDA 1GJAB 2GDEH 1TMUH 2FDAA 2ZHFH 2BTCE 1W7GH 1O5AB 2BZAA 2Z7FE 1HAZB 2PSXA 1YCPH 2ZU4A 3P8GA 7ESTE 3SV6A 1V2PT 3SOSA 1GBAA 1NM6A 1NN6A 2VVCA 1IQMA 1BTYA 2Z3CA 1FJSA 4MDSA 1MKWH 4NA8A 3RXCA 1ZTKA 2ZDMA 1Z71A 3QZQA 1K1NA 1HXEH 4O03A 5LPRA 2ZGCA 2ZFQH 1GI8B 4LOYH 1S85A 1GBIA 1ARBA 1SHHB 2AMPA 3K65B 3V13A 1VJ9U 1NRPH 4RKOB 1J8AA 3M5MA 1PPZA 2QY0B 3E1XB 2PFEA 2C8WB 1QIXB 1XKAC 1O3MA 1P05A 1FI8A 1DY8A 4I7YH 1BZXE 4K8YA 1HJ8A 5GPIB 1OP0A 1YPGH 1V2VT 1YPHE 1BRUP 3SNDA 2ZU2A 5J4SA 3E3TA 1S82A 1BOQA 4WY3A 3M5LA 2P93A 1J9CH 1NROH 3TGIE 3GYMA 2ZDVH 1E36B 3RXIA 1GWAA 2Z9JA 2ZGBH 1LMWB 1ELBA 1H1BA 4RN6A 1MCVA 1XVOA 1V2TT 1SL3A 2R0KA 1ZJDA 2GV6A 4TWWA 2B0FA 2GT7A 4B2CA 1AB9C 2ZDLA 3SGBE 2ZTXA 1YPJH 5EQRA 1SR5C 4CHAB 4WMFA 6CHAC 1O3CA 1VITF 3S7KB 1H9IE 1WQVH 1TRYA 2BLVA 4UE7H 5DP4A 1JIRA 1TWXB 4FUGA 1FY8E 1QURH 2A2QH 3SJOA 1W11U 3DUXH 1ID5H 2Z6BD 3P6ZB 1JRSA 1ELAA 3RXOA 2A5AA 1VCWA 1BTPA 2H6MA 2ASUB 1C2HA 1E0FD 3IWMA 4KTSA 4JZDH 4KGAA 1C1NA 3MTYA 2FOFA 1AHTH 3RXSA 4O9VA 4DT7B 3BG8A 5EXLA 1YPEH 2CHAB 2FO9A 2CF9H 2J9NA 4Y7AA 1F0SA 1AZ8A 5E0HA 3GY5A 4DGJA 2TBSA 1O5CB 2ZCLP 3TK5A 1XVMA 4BAQB 2AFQB 1C5PA 1SLVB 1QQUA 1W0ZU 1C5QA 4TPIZ 1IQEA 1Z6EA 1S5SA 3PLPA 1PQAA 1UCYE 3IG6B 2V3HH 1CA0C 3MFJA 1AZZA 1ZRKA 3T27A 3MOCA 4YOIA 3ZZ3A 3O8RA 1C5ZB 3NCLA 1QNJA 1O2ZA 1K2I1 1UK4A 2D26C 1HAGE 2WPMS 3SV7A 2M5TA 5ETXA 3M7TA 1ZSKA 2BDCA 3KQEA 3RXBA 1HJAC 1RIWB 1F2SE 1C1OA 2BD8A 1FNIA 3VPKA 1BDAA 3FVFB 3V7TA 4E7NA 3A86A 3H7OA 1ESTA 2I6SA 4AZ2B 3TK9A 3FFGA 1GJ7B 1QJ1B 4NG9H 3C1KA 1GI9B 1Z8IB 2LNCA 2WV4A 1C1MA 2GMTB 5A2MH 1W13U 1Y3YA 3CS0A 4IBLH 4CBOA 2V3OH 3ZV9A 1ELFA 1SGYE 2B5TB 2C4FH 4AFSA 1F5KU 5F8XA 1A0LA 1GI5A 4F49A 3TH4H 2EC9H 2G00A 7LPRA 1EAUA 3BIVH 1MTSA 4JCNA 5HMAA 2ZEBA 1A3EH 1SGFA 3L33A 1EPTB 2A32A 3OU0A 1GDNA 3KIDU 4JK6A 5EXNA 1K1JA 1O3KA 4GHTA 3M7QA 4BOHA 4CH8B 5J4QA 2A1DB 1CO7E 4YESB 1HXFH 3SNBA 3DD2H 2H5CA 3Q3XA 1Y59T 3RXFA 3SU1A 1O30A 3RXPA 2QCYA 4ABHA 4CR9A 1YPKH 3A7XA 5AFYH 1ZHPA 1C2EA 3KEEA 1C1TA 3P8FA 1C5NH 3S9AA 4UONA 4XDEA 1P2NA 1OWDA 1NTPA 2BHGA 3LOXA 1O38A 2UWPA 3RM0H 2ALVA 1CHOF 1OWHA 1GHBF 4IN1A 1SOZA 1ELTA 7GCHF 1DT2A 1SGIB 1GDQA 1SGFG 1HAXB 3T25A 4Y10E 4UFGH 1OYTH 3SU4A 3P92A 3AVZA 1EP6A 1WBGB 5E2PA 3VB4A 3MI4A 1DLKB 1FLEE 3Q3KA 1P01A 1ZJKA 3ITIA 1PPGE 3ZYDA 2FOHA 3DFLA 4AG1A 1O2WA 4Z6AH 3OTJE 3UNSA 3RMMH 4X2WA 3T62A 2CJIA 2P3FH 5C1XA 2OC1A 1C2KA 1CT4E 3QN7A 3S9BA 1GG6B 1WUNH 1GBTA 2ODQA 1GMCG 3D65E 3KCGH 2FTMA 1YP9A 2H5DA 3T2NA 4GPGA 1MBMA 4MPUA 1EZXC 1O5EH 2XW9A 1C5UA 2RG3A 2EI8A 2EA3A 2TGTA 5T3HA 4Y8YA 4CR5A 3RC4A 3UNRA 1OWJA 2BVRH 2BY6X 4DVAU 1BRBE 3FAOA 2V0BA 2R3UA 1C1PA 1V2QT 4HI3A 2BDBA 5DP7A 1FIZA 3A84A 3O8CA 2HALA 2NU4E 1GI2A 3UFAA 2VH0A 3SW2B 3E8LA 5DP3A 2FMJA 4UFEH 5JDUB 3A81A 2BOKA 4GSOA 1O2UA 2OQUA 1KXEA 2UUJB 4MNXA 4CHAC 4X1NU 3ZYEA 1LHEH 2ALPA 1TALA 2WPKS 1O32A 1GHZA 2FOMB 5EPNA 3QX5H 3ODFA 4MG3A 1ELGA 4JZFH 2VNTA 3SU0A 2AIQA 2BM2A 2GZ8A 1P2KA 2VVUA 3PTBA 4O3UA 3V3MA 1T8MA 2OUAA 4ABEA 3MU4A 4D76A 1GVZA 1ZMNA 2P16A 3LGTA 1AE8H 3A7ZA 1O3EA 2QXGA 3URCA 2J2UA 4X0WU 3U8OH 1O3BA 4UFFH 1IQGA 2QXJA 4INHA 5GXPA 1AU8A 1EPTA 1H9HE 2BLOA 2ZG0H 3F9FA 3M3TA 2ZGXH 4Q7YA 1O5GH 1ZGIA 2AGEX 2FLRH 1TMBH 4ZKRU 4IC6A 3K6YA 3BTEE 2Y7XA 2EEKA 2WYGA 3JZ1B 5A8YA 1UTMA 4BAMB 3M3SA 1GGDC 3FANA 3FP8E 2GDDA 4OS6A 3LU9B 1S0QA 1XUHA 4YOJA 1J17T 4FVDA 4ZROA 4X1QU 4A1XA 2XCFA 1TYNA 1GJ8B 4H6TA 5C67A 3V12A 1X7AC 1TNLA 2VB0A 1NRQH 4LK4A 4BTUB 1DX5M 2BX3A 3F9GA 3TLOA 3ZVAA 1LDTT 2ZHEH 2ZFPH 3MU5A 3ZV8A 1AB9B 1TBQH 1BB0B 4I8GA 5JYIA 1ZRBA 2IOTA 1Z8JB 5DP6A 3SJIA 6CHAB 4KP0A 1FY3A 1ORFA 2TIOA 4MPWA 4WJG2 2VIDA 2O8WA 1LQEA 1O2RA 3W94A 2G5VA 1RIWC 2DE9A 3D49H 2WPIS 3Q3YA 3M7UA 4YT6H 4JZEH 1FONA 1ETRH 4K1TA 1G37A 3C27B 1TBZH 4RKJB 1KXAA 1GHXH 1OKXA 2JH5D 3SV2H 3NPSA 2GMTC 3SI4H 2FI3E 1DXPA 3K2UA 1KXBA 3KL6A 4OS5A 1MD7A 2WUCA 1GVKB 1DDJA 2ZFRH 2B7DH 3TITA 2G52A 2ZGJA 3F9HA 1OWEA 1GJDB 2ZCHP 5C2ZA 1QGFA 1KTTB 2W3IA 4CRAA 4WH8A 5HYOA 3STIA 5JB9S 2XCNA 2ZC9H 3TJUA 2BQ6B 3UQOA 3EGKH 1ANDA 3LJJA 4INLA 5SGAE 1V2KT 1K1IA 4ZAEA 5C3NA 3BTQE 1K1LA 5F6MA 6GCHG 1G30B 5L6NH 1XMNB 3OX7U 3SNAA 2BD5A 2ZP0H 2BZ6H 1FN8A 1SGRE 1W8BH 4D7GA 1D3PB 1P04A 1MBQA 4WF8A 2FS9A 4K69A 3UQVA 1Z1JA 1V2JT 2AYWA 5K7RA 5CMXH 4B73A 2PLXA 2GGVB 4ISHH 3NXPA 2PGQB 3SHCH 2A4QA 5FPTA 1T32A 2JETB 2G4UA 4NIVA 1CGIE 1EJAA 3A7YA 1PFXC 1YPLH 2V35A 5C1UA 1A61H 1PQ5A 2VWLA 1FPCH 1O3DA 1CVWH 3U69H 4E06H 1CT2E 5TJXA 1GBLA 3RXRA 1D3QB 3MO6A 1Z1IA 1ZMJA 1F0TA 4A5TS 1NFUA 2VIOA 1EATA 2B8OH 2CMYA 4ZKNU 2QN5T 5ESBA 4IC5A 1TBRH 1B7XB 3SBKA 1GI6A 2QC2A 3Q00A 2Y82A 3TPIZ 5JBCS 2O8UA 5BRRE 1C2LA 2FOGA 1GMDG 3PLKA 1ZR0A 1CHGA 1TX8A 1SGQE 1ESBA 3O8DA 3VB7A 2H9HA 2QYIA 1DSTA 4DW2U 3GDVA 3SGQE 1C5XB 2RDLA 1SFQB 1LPZB 4ISLA 2G55A 4X6MA 4BAOB 2PTNA 1O3IA 3T5FH 3W95A 2BDAA 3BTKE 4IMQA 2JH0D 2BX4A 2F9UA 2NU0E 4ZHAA 3TK6A 3I77A 1GJ4H 1TE0A 1ZPCA 5LPEA 1T7CA 2CXVA 1P12E 4B2AA 1UTLM 3A7TA 5FBIA 5FX6A 2BOHB 4BXSA 4I8JA 3BV9B 3LGUA 4IS5A 2Z9LA 5PTPA 1UVUH 4ASHA 1XUJA 1FDPA 1F92A 4M7GA 2SGEE 1O5DH 2C8YB 2Y80A 1PPHE 3LPRA 2TPIZ 1O2KA 2VVVA 1A0JA 3GOVB 1GJ6A 1TRMA 1YGCH 4HFPB 1IQNA 1XUKA 2A31A 2R9PA 3KGPA 3UR6A 1AWHB 3NZIA 1C2DA 1EJMA 2A5KA 2GD4B 2ZQ1A 1O2JA 1NFXA 3LKWA 1IQKA 1DANH 4D9RA 6ESTA 2PWXA 4BXWA 1NZQH 1QL9A 4H6SB 3A83A 1RTLA 1K1PA 1HRTH 2RCEA 1CBWB 1ZOMA 2RA3A 1T4UH 4Z0KA 1HAVB 4UDWH 3RXUA 4YLUA 8GCHG 4GUXA 2ZCKP 1CE5A 4ZKSU 1ZZZA 1CQQA 1Q31A 4X2VA 3KF2A 1P03A 2BD7A 2BXUH 1P0SH 1IQLA 2Q6DA 1DICA 1KXDA 4NA7A 4XFQA 3A8DA 2BY7X 3GDSA 3D62A 1RS0A 2A7JA 2A7HA 3Q76A 4B1TA 1LHGH 3SV9A 5T6DA 1P10A 1SI5H 1Y5UT 2ULLA 3GCNA 3WY8A 1GPZA 1Y8TA 3ATMA 1F5RA 2SGPE 3ZVCA 5FCKA 1C1RA 1QB6A 2AIPA 1YPMH 2GKVE 3OSYA 3K6ZA 3M3VA 3PMHB 1B0EA 5DK1A 4O3TA 2F91A 2LPRA 4E05H 1N6YA 3TNTA 2CV3A 2FWWA 2GZ9A 4NIXA 2Q6FA 2TGAA 2WYJA 4K60A 1Z8GA 1Y3VA 1GBDA 1NO9H 3A80A 4X8SH 2AS9A 3A7VA 3ZZBA 5IDKA 1HFDA 1ZSJA 2W3KA 4FUJA 3UOUA 1J15A 1QHRB 1V2NT 3KN2A 1G3DA 3ZZ8A 1GJ5H 3KQCA 3A8BA 4SGAE 2TRMA 1YBWA 3LDXH 1EAWA 3N7OA 1BHXB 1QRWA 1UTNA 2PR3A 4B76A 2IN2A 4CRDA 2IPHA 1GI7B 3GDUA 3HPTB 5ABWA 4TWYA 4O97A 4IMZA 3QZRA 1BBRK 1TNGA 1JXPA 2PW8H 1NU7B 3TU7H 1V2WT 2GT8A 3U1IB 1ABIH 1QQ4A 1HGTH 1SGPE 4KELA 2ANYA 1BQYA 3GY8A 3QK1A 4KTUA 2VIQA 1GMCF 3U1JB 5EW2H 1GGDB 4SGBE 1QCPA 4JMYA 1SC8U 3K9XB 1HLTH 1C5TA 1OX1A 4IW4E 4X6PA 1OP8A 1LQDB 4ZXYH 1HUTH 2D2DA 1FAXA 1CU1A 1O3LA 1LPGB 1EAXA 1A1RA 1OSSA 2VWOA 1BTHH 2Z9IA 3GYLB 5JBBS 2UWOA 4J2YB 1RGQA 5F8ZA 3GY3A 3V0XA 2Y5HA 2XC0A 3PB1E 3VB6A 4AGJA 2ZHQH 1VCPA 2JETC 4B75A 1KLJH 1DOJA 1KXFA 1DVAH 3MH5A 1ZHMA 4WXIA 2FESH 3BTGE 4U2WA 2ESTE 2HRVA 1SB1H 1TNKA 5A8ZA 1TQ0B 3FZZA 2ZNKH 1QR3E 2DE8A 1DS2E 3NUMA 2BDHA 2Y5GA 1SGNE 1FAKH 3O8BA 3MWIU 1HAVA 3HK6B 3E16B 1ARCA 2Y81A 1G36A 2GCTB 3HGNA 1PPCE 1W3CA 1F0UA 4ZKOU 1EJNA 5B6OA 1UK2A 3B23B 2NU3E 1O3FA 1MH0A 3F9EA 1D6RA 1QBOA 4JZIA 4YTAA 2HWLB 3HGPA 1GI1A 1FZZA 1LTOA 1SLUB 5LGOA 1EZUC 2HLCA 2F9NA 1VR1H 4TPYA 1DLEA 2I6QA 3PMJA 1KIGH 4ABFA 2BD2A 2NWNA 2BD9A 1A3BH 4K3JA 3ZVBA 1QB1A 2BY8X 2HNTC 2Z9KA 1VCQA 1C4V2 1EP5A 2P3UB 5LH8A 2AEIH 2R3YA 4NZLA 1MAXA 2VIPA 3FP6E 1W7XH 4A7IB 1DPOA 1HCGA 2BB4A 1V2LT 2KAIB 2OQ5A 2ZU5A 2A2XH 2ZTZA 2BYAX 3M61U 3BN9A 3RXDA 1H9LB 4A92A 1DITH 2H9EH 5C5NA 1KY9A 5C1YA 1BMNH 3RXMA 3JZ2B 3VEQB 4NSVA 1NPMA 1F5LA 2B9LA 1XUGA 2O8TA 4WMEA 3S7HB 4UFDH 1P57B 1TPPA 2ZFTA 3RM2H 2WUBA 1O3JA 2O8MA 1AUJA 1V6DA 1GMHG 2C8XB 4AYYB 3L6PA 3S9CA 4B71A 2OINA 3SUDA 3ZZAA 1CBWC 1Y3UA 5HGGA 5I46H 3UIRA 2ANMH 5EW1H 3SI3H 4CRBA 5TCCA 4A1TA 2GV7A 4B74A 2R0LA 1AGJA 3RMOH 4F4OC 3LIWA 1FY5A 1GBJA 3SQEE 1V2RT 3RLWH 3KNXA 3SORA 3ZVEA 4DOQA 1LVMA 1QFKH 1ZPZA 4MQAA 1XUIA 1SGCA 1FV9A 3VB3A 1S6HA 2OC0A 2BMGB 3HK3B 1C1SA 4NSYA 4YM9A 3AW1A 1L0ZA 1O3NA 3SQHE 3B8JA 3A7WA 3KQBA 2STAE 1G2MA 5E8EH 1O33A 2XC5A 1QTFA 1XM1A 3MU8A 1O39A 2NU2E 1HAIH 1AWFH 2BDIA 1DUEA 1A5GH 1TOCB 4Y76A 1A7SA 6GCHF 1UHBA 4QT8C 2PV9B 3FP7E 1O3OA 3RMNH 2PKSB 1O2PA 1U6QA 1IQHA 3BTFE 1Q2WA 2PUQH 1EB1H 4I8HA 1J16A 4JYUH 4NIWA 1SFIA 3QLPH 1XKBC 3RU4D 2H1UA 1QL7A 1WU1A 1EZSC 3SU6A 1O2XA 2ZI2H 4TY7A 1MZDA 1TFXA 1WYKA 1C2MA 1AFQB 3QTVH 4WVPE 5FPYA 4GVUA 1HPGA 2G4TA 3RXJA 1GBBA 4MPVA 1MMJN 1XXDA 1N8OB 2J34A 1AY6H 2PUXB 3BIUH 1AFEH 3M37A 2QAAA 1AO5A 1MQ5A 4GCHG 3GICB 1DE7H 2XBVA 3RXTA 4X1PU 4ABAA 1YC0A 1TX6A 3LONA 3UY9A 3GY2A 2AMQA 2G8TA 2ZF0H 3ZZ9A 1GMDF 1O2QA 3LGYA 2PHBA 4Y11E 1EB2A 1C1UH 1DWBH 3E0NB 2F9PA 1B0FA 5FX5A 1SVPA 3QTOH 2GP9B 1TGCA 3SJ8A 1P09A 3CP7A 1NFWA 1G3EA 2VWMA 1MU6B 3P70B 5L30H 1L1GA 3ENSB 4Y8ZA 2EI7A 1BTXA 4YT7H 2Y6TA 1GBCA 4I8LA 4YOGA 1H8IH 1W10U 1PQ8A 1Y3XA 2Z94A 3BG4B 1ESAA 1BTZA 2KAIA 1G32B 1LVBA 3I78A 1THRH 3GY6A 1SLWB 1RXPA 1IAUA 1P9UA 1AQ7A 1O31A 1KLIH 4DJZB 2ANKH 1KDQB 1NRNH 4CH2B 3VXFH 1BRCE 3ZZDA 2ZU3A 4FUBA 1C5OH 3ATKA 3A89A 4ESTE 2W5EA 1BITA 1G3CA 1HBTH 1O2LA 5EGMA 2OLGA 2BDYA 1THPB 3P8NA 2FS8A 5C20A 1QY6A 4FXGH 4AFUA 4LZ1H 1GHWH 2BQ7B 4A6LA 1V2MT 1HAPH 3U98H 1KXCA 2WPJS 1BBRH 3LT3A 1P9SA 4BTIB 1C1WH 3M35A 3L3TA 5HM9A 1RFNA 1TPSA 2PGBB 4WMDA 3SN8A 2FX6A 2GCHG 4X6NA 2GCTC 2GVFA 1OWKA 2AGGX 2QIQA 4X2XA 1HNEE 2ZO3H 5A09A 1FY1A 3SUEA 4Y8XA 1K9OE 1BT7A 4ZXXH 3A87A 3A82A 3CS7A 3TJOA 1GL0E 1M9UA 5DGJA 1A46H 1L1NA 8GCHF 2UUFB 3TVJB 1MAYA 4ABGA 3BTHE 1P2IA 4JYTA 3LH3A 1HJ9A 3EE0B 1IQJA 3GISB 4NA9H 1SPJA 2WPLS 2D8WA 4GAWA 4NFEA 4CREA 1QBNA 2C90B 5C5OA 4VGCC 1NFYA 1IOEA 3EA7A 1CGJE 1O2OA 1YLCA 1ZHRA 2AERH 1O3PB 5E2OA 1TX7A 1QRZA 2A0QB 2F9OA 4YLQH 1HAOH 3KHVA 4ISOA 2TGDA 1KSNA 3RXKA 5FBEA 1QBVH 3BTDE 1P3EA 2QA9E 1GCTB 1RJXB 1PPBH 4XE4A 1AD8H 1JIMA 2G5NA 1GHYH 1UTPA 5FXLA 1BRAA 1AN1E 1NT1A 3OY6U 1GI0A 4X8UH 1NY22 2NU1E 1G9IE 5A0CA 2ZZUH 1W2KH 3F6UH 2W7UA 2P8OC 1LKBA 1TNJA 3LH1A 5EPYA 2Q1JA 4BAKB 1C5RA 2CGAA 1FY4A 2XTTB 4A1VA 4AG2A 3RU4E 1MCTA 4ISIH 3EA9A 3VFEA 4CBNA 2VU8E 1WAYB 1O35A 2BLWA 3SU5A 2BVSH 1CA8B 3RXQA 1HYLA 1L1JA 2GX4A 5CE1A 3RU4T 1EASA 1EAIA 1PJPA 1G3BA 2FOBA 4ZUHA 5A0BA 1O2GH 3NK8A 4Y6DA 2ZDAH 1L4DA 4XBDA
chains in the Genus database with same CATH superfamily
3A85A 5E0JA 2FLBH 1C1QA 4DURA 3RLYH 1GBFA 1MUEB 3ZZ5A 4I33A 4IN2A 3SV8A 3U8TH 1NS3A 1MTNC 4ZHLU 2YOLA 5HM2A 1KDQA 1ELDE 3R0FA 3MYWA 4K1EA 4MNWA 4F55A 3KQDA 3VGCB 3SNEA 2PKSC 5AF9H 1BMLA 5DG6A 2K8IA 5L2ZH 1OS8A 1TABE 3ZIAD 3RDZA 1ZPBA 2VGCC 4JYVH 3BSQA 1VGCB 2QV1A 2ZTYA 4ACBA 4INKA 1TAWA 3GCTG 2SGFE 4E7RG 1FN6A 1AFQC 1ETSH 1AE5A 3UPEA 2P3TB 1L2EA 1SQOA 1SOTA 2HNTF 2O8LA 1MKXH 3MH7A 3ZZ6A 1N8OC 1W14U 1AUTC 5GIBA 3SJKA 2ZIQH 1GHAG 1DWCH 3OTPA 3PWBA 1SGDE 1O2TA 4FOUC 4X8VH 1YM0A 1TLDA 5EG4A 4X6OA 1YF4A 4FUFA 4LXBH 1RRKA 2DUCA 5GCHG 2SFAA 5FCRA 4AYVB 4I32A 4X2YA 2R2MB 3MO9A 1TQ7B 4H42U 4OGYA 4P02A 2ZGHA 1Z7KA 4Y7BA 4DG4A 1WCZA 5DKMA 3M5NA 1C2FA 2XBYA 5ESTE 2C8ZB 3ODDA 4GLYA 2FM2A 1O5BB 2WPHS 1XXFA 3U8RH 4RSPA 2XWAA 1S0RA 2HNTE 2K1QA 4ACAA 1WV7H 1TONA 2HVXA 1AVGH 3QUMP 1BIOA 1WOFA 1ACBE 3BG4C 3TJVA 1IQIA 1S81A 1S83A 4K2YA 4KTCA 5FAHA 2QXHA 3EA8A 2THFB 4CRCA 3M36A 2V7QD 4FVBA 4FU7A 1ZGVA 4BTTB 1E35B 2EY4C 1ABJH 2BD4A 1FXYA 1P06A 4TYDA 1YKTA 1UMAH 2C93B 2FTLE 4Y79A 1LHFH 1LVOA 4RI0A 1UCYK 3LJOA 1C5YB 1DWEH 1MTVA 1O36A 4OS4A 3LGIA 3VXEH 3SUGA 4YZUA 5DN6D 2QGRA 1WXRA 1LHCH 1BUIA 2ZWLH 3PO1B 1ZLRA 3T28A 3FN8A 3TNSA 1C2JA 2FEQH 3DHKH 3RXVA 4MNVA 1ZTJA 2ILNA 1E79D 1UVOA 2FIRH 5GJ4B 3MNCA 3RC5A 3DFJA 1S6FA 3H5CB 2SGDE 4FUEA 1K1OA 1SBWA 2L6OA 2BQWB 3AAUA 3MH4A 1FIWA 4OS2A 1GMHF 1P3CA 2BLQA 4AB9A 1KLTA 1CSOE 3SUFA 2QF0A 1W0YH 1FUJA 1JOUB 4MNYA 1PPEE 4U32A 1V2OT 1Z6JH 2O9QA 3STJA 4NWKA 1S6LA 1V2UT 3TH3H 2UWLA 2FZZA 2UUKB 3MNBA 1Y5BT 2XWBI 1C4Y2 3F3BA 4FU8A 3DA9B 2AGIX 4X1SU 3F2FA 3Q77A 9ESTA 3RXLA 4ABBA 1QA0A 1P02A 2RFKC 1C2IA 2QXIA 4GHQA 3E0PB 1WQSA 1EOLA 1BMFD 2ZDNA 3AASA 2ZPSA 3OY5U 4WH6A 1UVTH 1BHXF 1F0RA 2OCVB 1H8HD 1OXGA 1OP2A 4ZHMU 5HXFA 1EUFA 3UWJH 5G4BA 1GBEA 1GBHA 3RXHA 3RUOA 2HPQH 3VB5A 4AOQA 2AMDA 3WWBA 2XYAA 3IITA 1EZQA 1UHBB 3PMAB 3HATH 1WTHD 3ATLA 1GCTC 1FMGA 2ZQ2A 1P2QA 1THSH 2FX4A 1UTQA 4OS1A 5I25A 5FHTA 4BAHB 4ABDA 1UTOA 2ZECA 1YLDA 4Q80A 2OBOA 2ZU1A 1A5HA 2YMSD 3MMGA 3EDXB 5JB8S 3B9FH 4BANB 2SGQE 1SSXA 2V3MA 4OS7A 4Q4LA 4H4FA 3UTUH 5L2YH 2A4GA 3ELAH 5LPFA 2SNVA 2K0QA 2YNAA 2FOEA 1D6WA 1DUAA 2QF3A 1KYNA 2OXSA 3SO3A 1UK3A 2A5IA 4CRFA 1LVYA 2CN0H 1EXFA 2A4OA 3FZDA 1HV7A 1BBRE 5AVDA 4Y0YE 5CHAB 3RC6A 1C5WB 1O34A 2P95A 3QDZB 1A4WH 3H7TA 2FYRA 3EQ0H 4GCHF 1GJBB 1T4VH 4DT4A 2WZQA 1ELEE 1AKSB 1ELCA 2HGTH 1OYQA 1BJUA 1K21H 3MHWU 1N1LA 2F9BH 1ZMLA 3GY4A 2IPQX 1C4U2 1NESE 4VGCB 2FYQA 3TGJE 3ZZ7A 2W26A 2YNBA 3SNCA 5DP9A 1V2ST 1TNHA 1ZTLA 4MVNA 2F4LA 4FU9A 1AVWA 4MTBA 4D9QA 1DY9A 1YPHC 2J38A 3UOPA 2C3SA 1IQFA 1QA7A 5K0HA 1LKAA 1NRRH 1CT0E 2VINA 5EQSA 4R8TB 2CF8H 1PYTC 2FOCA 5GDSH 1TPAE 2Y5FA 1K22H 3KYFA 1A2CH 4XRNA 1A0HB 3SU3A 3VGCC 1MU8B 4ASUD 2IJOB 1RTFB 2H2ZA 4UD9H 1GI3A 1P2OA 1MTWA 4DCDA 1WTGH 1TGSZ 4DIIH 3I29A 5DP8A 3PROA 2P8OB 1VGCC 1FQ3A 2VWNA 1OOKB 4Q2KA 1GCDA 3S0NA 3BTWE 1W12U 3S69A 1SLXB 1VITG 3HKIB 4D7FA 4THNH 2J97A 3MNSA 1H8DH 2J94A 1GJCB 3A8AA 2OD3B 1AI8H 2PSYA 1SHYA 2ZKSA 1SG8B 2BVXH 1E34B 1DSUA 1XUFA 1D3TB 2F3CE 2GCHF 2VIWA 2ANWA 1C5VA 2KR7A 1V3XA 2AH4X 3NKKA 1O0DH 1MKXK 2XC4A 1C5SA 4AX9H 2XOKD 1HB0B 1GI4A 1HDTH 3D23A 1S84A 3QWCH 2A4RA 3W1EA 1T8OA 1H4WA 3MO3A 4HGCA 1UTKA 5JBAS 1MTUA 4AGKA 1YCPK 1IHTH 2OBQA 1O2SA 3ZVDA 3ZZCA 2FPZA 1NC6A 1EKBB 1MKWK 1MTNB 2QF5A 2JKHA 1AVXA 1ANCA 3ZZ4A 1C9PA 3R3GB 1Z8RA 1KTSB 2J92A 3LGVA 3GCHB 2GTBA 5A8XA 2UUYA 3BEUA 3GCOA 4AB8A 3T26A 2FOAA 9LPRA 3DSPA 2KCAA 2P94A 2VGCB 3BEIB 5FL7D 2FODA 1RD3B 1C2GA 3E6PH 1TA2A 1TGNA 2F9VA 1LO6A 1O3GA 1O3HA 2W7SA 2JH6D 3BF6H 3A88A 4JZ1A 1Y5AT 1WSSH 1YY3A 2OTVA 1UO6A 3TJNA 5DSFA 4WWYA 4X8TH 4ZH8A 3PO1C 1Q3XA 1BTWA 1FPHH 5EIYA 3TGKE 1TIOA 4PROA 4ABIA 2ZPQA 1O2HA 3GY7A 1SGEE 5EU8A 3SHAH 4AFZA 4XOJA 4D8NA 1SMFE 2VIVA 1BMMH 4X1RU 1QJ7B 1VJAU 1MD8A 2Z3DA 4NCYA 1LHDH 4Y71A 1E37B 3PM3A 2PKAB 1AKSA 3MU1A 3LC5A 3MH6A 3PLBA 3ZVGA 2V6NA 3TH2H 4CRGA 1TB6H 3UNQA 2XXLA 2FP7B 3A8CA 1C9TA 3RXEA 4MPXA 1AIXH 2BD3A 2PTCE 3BTTE 3EAJA 1BTUA 1T31A 2RA0A 2Z9GA 5GWZA 1HIAB 4TT3D 2Y7ZA 8KME2 1O2NA 1T8NA 2A7CA 3SZEA 1UTJA 1O2VA 1QB9A 5FPSA 1SQAA 1C5MD 2ZA5A 3SJ9A 1O5FH 1VITH 2BY9X 4K1SA 2BDGA 1INCA 1HAYB 4AORA 3T29A 2CHAC 2OC8A 4B2BA 3G01A 3PYHA 4FUIA 1UCYH 2PP6A 4J1YA 2STBE 2P59A 1IHSH 1O2MA 4HZHA 1YYY1 1TGBA 3MNXA 4NGAH 1PPFE 2VH6A 3ATIA 1D9IA 3QO6A 1PQ7A 2ZDKA 2OP9A 2ODPA 4XBBA 5EODA 3OAAD 1D4PB 5EOKA 1CHOG 4JK5A 1GHBG 2KCOA 1UVPA 1VZQH 3N7EA 3F1SB 3U9AH 1DXWA 1YCPM 7GCHG 3RP2A 3ESTA 3PV4A 3P95A 3RXAA 3ATWA 1GDUA 3AAVA 3PWCA 1MZAA 3DT0H 4BNRA 3BTME 3GCTF 2XNDD 3PMBB 4KKDA 4YO9A 3RXGA 1TGTA 2OC7A 2D1JA 4R0IA 3F68H 1P2JA 1NU9A 2XNIA 1DM4B 1DWDH 3SGAE 1MQ6A 1TOMH 4I8KA 5CHAC 2HOBA 1GHAF 5DO4H 1LCYA 1OPHB 1P11E 4Y0ZE 5JPMH 2HPPH 1GBMA 4U01A 2SGAA 1QJ6B 4ABJA 1TNIA 1BJVA 1GVLA 5T6FA 4FUCA 5GCHF 1GBKA 1B5GH 3QGNB 3UR9A 1AMHA 2BY5X 2FI4E 4ISNA 1SQTA 1TRNA 2HLDD 3LC3A 4Q7ZA 3NWUA 4ZMAH 1PYTD 1J14A 2FXRA 1ZYOA 5DPAA 2XRCA 3RMLH 1EOJA 1Y3WA 5F03A 5AFZH 1EPTC 8LPRA 1N6XA 1RTKA 1GJ9B 1T8LA 4B6EA 3PV5A 1F7ZA 4TY6A 2GZ7A 4XBCA 3URDA 3PTNA 5EQQA 5A0AE 1CA0B 1UJ1A 5CDFE 3P8OA 4HTCH 3SZNA 1QL8A 1NRSH 3OYPA 5E0GA 3QGJA 1QRXA 6LPRA 1JMOH 1DFPA 3CENA 4NWLA 5DP5A 4MLFB 1O3AA 1K28D 3UUZA 4AFQA 2ZHWH 4I31A 1JBUH 1C1VH 1ZSLA 1EQ9A 1KMHB 2PKAA 1D3DB 2XBWA 4NZQA 5AHGH 1HJAB 4DIHH 3MU0A 1HAHH 3ZVFA 2A45B 1EX3A 2G81E 1OWIA 4FUHA 4WXVA 8ESTE 2TGPZ 1K1MA 4U30A 1A5IA 3HKJB 1GHVH 4NFFA 1HIAA 1BCUH 4FUDA 3VG8A 4YXWD 2VJ1A 5EXMA 5F53A 5H4IB 1C5LH 1XX9A 2BXTH 1ETTH 1ELVA 4UEHH 4OGXA 3UREA 3UWIA 2ZFSA 3BEFB 1O2IA 3TIUA 2SNWA 5BPEA 1SGTA 1GG6C 1ANBA 2ZHDA 2G51A 2XBXA 5JBTA 2F83A 4Z1MD 2Z3EA 1CGHA 3M5OA 5F8TA 3SYJA 2H9TH 3E91A 1L4ZA 1LPKB 4Q7XA 3SU2A 4K5ZA 1ANEA 4K8BA 4NIYA 2R2WU 3GCHC 5TCAA 1BA8B 4AN7A 1UVSH 1O37A 1P8VC 1O2YA 3WWFA 1E38B 2Q6GA 3AW0A 2WSSD 4DY7B 3P17H 2ZPRA 1BMAA 1GL1A 1G2LA 2J4IA 1TMTH 2EI6A 2ZFFH 2J95A 7KMEH 2WV5A 1TPOA 2ODYB 5IYTA 4XSKU 2FI5E 2WINI 1TA6A 3F2GA 1P2MA 3KQ5A 4LZ4B 3LGWA 3E90B 2KZ4A 1JWTA 5T6GA 1JRTA 5DJ7A 4IGDA 3EYDA 1GJAB 2GDEH 1TMUH 2FDAA 2ZHFH 2BTCE 1W7GH 1O5AB 2BZAA 2Z7FE 1HAZB 2PSXA 1YCPH 2ZU4A 3P8GA 7ESTE 3SV6A 1V2PT 3SOSA 1GBAA 1NM6A 1NN6A 2VVCA 1IQMA 1BTYA 2Z3CA 1FJSA 4MDSA 1MKWH 2JIZD 4NA8A 3RXCA 1ZTKA 2ZDMA 1Z71A 3QZQA 1K1NA 1HXEH 4O03A 5LPRA 2ZGCA 2ZFQH 1GI8B 4LOYH 1S85A 1GBIA 1ARBA 1SHHB 2AMPA 1H8ED 3K65B 1VJ9U 1NRPH 4RKOB 3V13A 1J8AA 3M5MA 1PPZA 2QY0B 3E1XB 2C8WB 2J5UA 1QIXB 2PFEA 1XKAC 1O3MA 1P05A 1FI8A 1DY8A 4I7YH 1BZXE 4K8YA 1HJ8A 5GPIB 1OP0A 1YPGH 1V2VT 1YPHE 1BRUP 3SNDA 2ZU2A 5J4SA 3E3TA 1S82A 1BOQA 4WY3A 3PRDA 3M5LA 2P93A 1J9CH 1NROH 3TGIE 3GYMA 2ZDVH 1E36B 3RXIA 1GWAA 2Z9JA 2ZGBH 1LMWB 1ELBA 1H1BA 4RN6A 1MCVA 1XVOA 1V2TT 1SL3A 2R0KA 1ZJDA 2GV6A 3PRBA 4TSFD 4TWWA 2B0FA 2GT7A 4B2CA 1AB9C 2ZDLA 3SGBE 2ZTXA 1YPJH 5EQRA 1SR5C 4CHAB 4WMFA 6CHAC 1O3CA 1QZ8A 1VITF 3S7KB 1H9IE 1WQVH 1TRYA 2BLVA 4UE7H 5DP4A 1JIRA 1TWXB 4FUGA 1FY8E 1QURH 2A2QH 3SJOA 1W11U 3DUXH 1ID5H 2Z6BD 3P6ZB 1JRSA 1ELAA 3RXOA 2A5AA 1VCWA 1BTPA 2H6MA 2ASUB 1C2HA 3OFND 1E0FD 3IWMA 4KTSA 2W6JD 4JZDH 4KGAA 1C1NA 3MTYA 2FOFA 1AHTH 3RXSA 4O9VA 4DT7B 3BG8A 5EXLA 1YPEH 2CHAB 2FO9A 2CF9H 2J9NA 4Y7AA 1F0SA 1AZ8A 5E0HA 3GY5A 4DGJA 2TBSA 1O5CB 2ZCLP 3TK5A 1XVMA 4BAQB 2AFQB 2OK5A 1C5PA 1SLVB 1QQUA 1W0ZU 1C5QA 4TPIZ 1IQEA 1Z6EA 1S5SA 3PLPA 1PQAA 1UCYE 5GNDA 3IG6B 2V3HH 1CA0C 3MFJA 1AZZA 1ZRKA 3T27A 3MOCA 4YOIA 2WHXA 3ZZ3A 3O8RA 1C5ZB 3NCLA 1QNJA 1O2ZA 3OEED 1K2I1 1UK4A 2D26C 1HAGE 2WPMS 3SV7A 2M5TA 5ETXA 3M7TA 1ZSKA 2BDCA 3KQEA 3RXBA 1HJAC 1RIWB 1F2SE 1C1OA 2BD8A 1FNIA 1COWD 3VPKA 1BDAA 3FVFB 3V7TA 4E7NA 5C0UA 3A86A 5KECA 3H7OA 1ESTA 2I6SA 4AZ2B 3TK9A 3FFGA 1GJ7B 1QJ1B 4NG9H 3C1KA 1GI9B 1Z8IB 2LNCA 2WV4A 1C1MA 2GMTB 2KX4A 3OE7D 5A2MH 1W13U 1Y3YA 3CS0A 4IBLH 4CBOA 2V3OH 3ZV9A 1ELFA 1SGYE 2B5TB 2C4FH 4AFSA 1F5KU 5F8XA 1A0LA 1GI5A 4F49A 3TH4H 2EC9H 2G00A 7LPRA 1EAUA 3BIVH 1MTSA 4JCNA 5HMAA 2ZEBA 1A3EH 1SGFA 1E1QD 3L33A 1EPTB 2A32A 3OU0A 1GDNA 3KIDU 4JK6A 5EXNA 1K1JA 1O3KA 4GHTA 2W6ID 3M7QA 4BOHA 4CH8B 5J4QA 2A1DB 1CO7E 3DSGA 4YESB 1HXFH 3SNBA 3DD2H 2H5CA 3Q3XA 1Y59T 3RXFA 3SU1A 1O30A 3RXPA 2QCYA 4ABHA 4CR9A 1YPKH 3A7XA 4AC9A 5AFYH 1ZHPA 1C2EA 3KEEA 1C1TA 3P8FA 1C5NH 3H09A 3S9AA 4UONA 3PV2A 4XDEA 1P2NA 1OWDA 1NTPA 2BHGA 3LOXA 1O38A 2UWPA 3RM0H 2ALVA 1CHOF 1OWHA 1GHBF 4IN1A 1SOZA 1ELTA 7GCHF 1DT2A 1SGIB 1GDQA 1SGFG 1HAXB 3T25A 4Y10E 4UFGH 1OYTH 3SU4A 3P92A 3AVZA 1EP6A 1WBGB 5E2PA 3VB4A 3MI4A 1DLKB 1FLEE 3Q3KA 1P01A 1ZJKA 3ITIA 1PPGE 3ZYDA 2FOHA 2KFWA 3DFLA 2YMSB 4AG1A 1O2WA 4Z6AH 3OTJE 3UNSA 3RMMH 4X2WA 3T62A 3DCLA 2CJIA 2P3FH 5C1XA 2OC1A 1C2KA 1CT4E 3QN7A 3S9BA 5HIYA 1GG6B 1WUNH 1GBTA 2ODQA 1GMCG 3D65E 3KCGH 2FTMA 1YP9A 2H5DA 3T2NA 4GPGA 1MBMA 4MPUA 1EZXC 1O5EH 2XW9A 1C5UA 2RG3A 2EI8A 2EA3A 2TGTA 4P00A 5T3HA 4Y8YA 4CR5A 3RC4A 3UNRA 1OWJA 2BVRH 2BY6X 4DVAU 1BRBE 3FAOA 2V0BA 2IJD1 2R3UA 1C1PA 1V2QT 4HI3A 2BDBA 5DP7A 1FIZA 3A84A 3O8CA 2HALA 2NU4E 1GI2A 3UFAA 2VH0A 3SW2B 3E8LA 5DP3A 2FMJA 4UFEH 5JDUB 3A81A 2BOKA 4GSOA 1O2UA 2OQUA 1KXEA 2UUJB 4MNXA 4CHAC 4X1NU 3ZYEA 1LHEH 2ALPA 1TALA 2WPKS 1O32A 1GHZA 2FOMB 5EPNA 3QX5H 3ODFA 4MG3A 1ELGA 4JZFH 2VNTA 3SU0A 2AIQA 2BM2A 2GZ8A 1P2KA 2VVUA 3PTBA 4O3UA 3V3MA 2JDID 1T8MA 3MQKC 2OUAA 4ABEA 3MU4A 4D76A 1GVZA 1ZMNA 2P16A 3LGTA 1AE8H 3F0PA 3A7ZA 1O3EA 2QXGA 3URCA 2J2UA 4X0WU 3U8OH 1O3BA 4UFFH 1IQGA 2QXJA 4INHA 5GXPA 1AU8A 1EPTA 1H9HE 2BLOA 2ZG0H 3F9FA 3M3TA 2ZGXH 4Q7YA 1O5GH 1ZGIA 2AGEX 2FLRH 1TMBH 4ZKRU 4IC6A 5C0TA 3K6YA 3BTEE 2Y7XA 2EEKA 2WYGA 3JZ1B 4XD7D 5A8YA 1UTMA 4BAMB 3CNRA 3M3SA 1GGDC 3FANA 3FP8E 2GDDA 4OS6A 3LU9B 1S0QA 1XUHA 4YOJA 1J17T 4FVDA 4ZROA 4X1QU 4A1XA 2XCFA 1TYNA 1GJ8B 4H6TA 5C67A 3V12A 1X7AC 1TNLA 2VB0A 3N99A 1NRQH 4LK4A 4BTUB 1DX5M 2BX3A 3F9GA 3TLOA 3ZVAA 1LDTT 2ZHEH 2ZFPH 3MU5A 3ZV8A 1AB9B 1TBQH 1BB0B 4I8GA 5JYIA 1ZRBA 2IOTA 1Z8JB 5DP6A 3SJIA 6CHAB 4KP0A 1FY3A 1ORFA 2TIOA 4MPWA 4WJG2 2VIDA 2O8WA 1LQEA 1O2RA 3W94A 4I86A 2G5VA 1RIWC 2DE9A 3D49H 2WPIS 3Q3YA 3M7UA 4YT6H 4JZEH 1FONA 1ETRH 4K1TA 1YLNA 1G37A 3C27B 1TBZH 4RKJB 1KXAA 1GHXH 1OKXA 2JH5D 3SV2H 3NPSA 2GMTC 3SI4H 2FI3E 1DXPA 2JJ1D 3K2UA 1KXBA 3KL6A 4OS5A 1MD7A 2WUCA 1GVKB 1DDJA 2ZFRH 2B7DH 3TITA 2G52A 2ZGJA 3F9HA 1OWEA 1GJDB 2ZCHP 5C2ZA 1QGFA 1KTTB 2W3IA 4CRAA 4WH8A 5C17A 3STIA 5HYOA 5JB9S 2XCNA 2ZC9H 3TJUA 2BQ6B 3UQOA 3EGKH 1ANDA 3LJJA 4INLA 5SGAE 1V2KT 1K1IA 4ZAEA 5C3NA 3BTQE 1K1LA 5F6MA 6GCHG 1G30B 5L6NH 1XMNB 3OX7U 3SNAA 2BD5A 2ZP0H 2BZ6H 1FN8A 1SGRE 3OEHD 1W8BH 4D7GA 1D3PB 1P04A 1MBQA 4WF8A 2FS9A 3FO8D 4K69A 3UQVA 2HVYB 1Z1JA 1V2JT 1EFRD 2AYWA 5K7RA 5CMXH 4B73A 2PLXA 2GGVB 4ISHH 2RDEA 1SQRA 3NXPA 2QE7D 2PGQB 3SHCH 2A4QA 5FPTA 1T32A 2JETB 2G4UA 4NIVA 1CGIE 2M2AA 1EJAA 3A7YA 1PFXC 1YPLH 2V35A 5C1UA 1A61H 1PQ5A 3AK5A 2VWLA 1FPCH 5T1VA 1O3DA 1CVWH 3U69H 4E06H 1CT2E 5TJXA 1GBLA 3RXRA 1D3QB 3MO6A 1Z1IA 1ZMJA 1F0TA 4A5TS 1NFUA 2VIOA 1EATA 2B8OH 2CMYA 4ZKNU 1MABB 2QN5T 5ESBA 4IC5A 1TBRH 1B7XB 3SBKA 1GI6A 2QC2A 3Q00A 2Y82A 3TPIZ 5JBCS 2O8UA 2YMSC 1C2LA 5BRRE 2FOGA 1GMDG 3PLKA 1ZR0A 1CHGA 1TX8A 1SGQE 1ESBA 3O8DA 3VB7A 2H9HA 2QYIA 1DSTA 4DW2U 3GDVA 3SGQE 1C5XB 2RDLA 1SFQB 1LPZB 4ISLA 2G55A 4X6MA 4BAOB 2PTNA 4B6FA 1O3IA 3N7DA 3T5FH 5C94A 3W95A 2GJGA 2BDAA 3BTKE 4IMQA 2JH0D 2BX4A 2F9UA 2NU0E 4ZHAA 3TK6A 3I77A 1GJ4H 1TE0A 1ZPCA 5LPEA 1T7CA 2CXVA 1P12E 4B2AA 1UTLM 3A7TA 5FBIA 5FX6A 2BOHB 4BXSA 4I8JA 3BV9B 3LGUA 4IS5A 5KGOA 2Z9LA 5PTPA 1UVUH 4ASHA 1XUJA 1FDPA 1F92A 4M7GA 2SGEE 1O5DH 2C8YB 2Y80A 1PPHE 3LPRA 2TPIZ 1O2KA 2VVVA 1A0JA 3GOVB 1GJ6A 1TRMA 1YGCH 2WPDD 4HFPB 1IQNA 1XUKA 2A31A 2R9PA 3KGPA 3UR6A 1AWHB 3NZIA 1C2DA 1EJMA 2A5KA 2GD4B 2ZQ1A 1O2JA 1NFXA 3LKWA 1IQKA 1DANH 4D9RA 6ESTA 2PWXA 4BXWA 1NZQH 1QL9A 4H6SB 3A83A 1RTLA 3FOAA 1K1PA 1HRTH 2RCEA 1CBWB 1ZOMA 2RA3A 1T4UH 4Z0KA 1HAVB 4UDWH 3RXUA 4YLUA 8GCHG 3DSOA 4GUXA 2ZCKP 1CE5A 4ZKSU 1ZZZA 1CQQA 1Q31A 4X2VA 3KF2A 1P03A 2BD7A 2BXUH 1P0SH 1IQLA 2F43B 2JJ2D 2Q6DA 1DICA 1KXDA 4NA7A 4XFQA 3A8DA 2BY7X 3GDSA 3D62A 1RS0A 2A7JA 2A7HA 3Q76A 4B1TA 1LHGH 3SV9A 5T6DA 1P10A 1SI5H 1Y5UT 2ULLA 3GCNA 3WY8A 1GPZA 3WW7A 1Y8TA 3ATMA 1F5RA 2SGPE 4OM9A 3ZVCA 1C1RA 5FCKA 1QB6A 2AIPA 1YPMH 2GKVE 3OSYA 1WDIA 3K6ZA 1FX0B 4M9FA 3M3VA 1W0JD 1B0EA 3PMHB 5DK1A 4O3TA 2F91A 2LPRA 4E05H 1N6YA 3TNTA 2CV3A 2FWWA 1YWUA 2GZ9A 4NIXA 2Q6FA 2WV9A 2TGAA 2WYJA 4K60A 2LELA 1Z8GA 1Y3VA 1GBDA 1NO9H 3A80A 4X8SH 2AS9A 3A7VA 3ZZBA 5IDKA 1HFDA 1ZSJA 2W3KA 4FUJA 5HKKD 3UOUA 1J15A 1QHRB 1V2NT 3U28C 3KN2A 1G3DA 3ZZ8A 1GJ5H 3KQCA 3A8BA 4SGAE 2TRMA 1YBWA 3LDXH 1EAWA 3N7OA 1BHXB 1QRWA 1UTNA 2PR3A 4B76A 2IN2A 4CRDA 2IPHA 1GI7B 3GDUA 3HPTB 5ABWA 4TWYA 4O97A 4IMZA 3QZRA 1BBRK 1TNGA 3FKSD 5KEDA 1JXPA 2PW8H 1NU7B 3TU7H 1V2WT 2GT8A 3U1IB 1ABIH 1QQ4A 1HGTH 1SGPE 4KELA 4F48B 4ZCNA 2ANYA 2KCYA 1BQYA 3GY8A 3QK1A 4KTUA 2VIQA 1GMCF 3U1JB 5EW2H 1GGDB 4SGBE 1QCPA 4JMYA 1SC8U 3K9XB 1HLTH 5EJ1A 1C5TA 1OX1A 4IW4E 4X6PA 1OP8A 1LQDB 4ZXYH 1HUTH 2D2DA 1FAXA 1CU1A 1O3LA 1LPGB 1EAXA 1A1RA 1OSSA 2VWOA 1BTHH 2Z9IA 1OHHD 3GYLB 5JBBS 2UWOA 4J2YB 1RGQA 5F8ZA 3GY3A 3V0XA 2Y5HA 2XC0A 3PB1E 4RT0A 3VB6A 4AGJA 2ZHQH 1VCPA 2JETC 4B75A 1KLJH 1DOJA 1KXFA 1DVAH 3MH5A 1ZHMA 4WXIA 2FESH 3BTGE 4U2WA 2ESTE 2HRVA 1SB1H 1TNKA 5A8ZA 1TQ0B 3FZZA 2ZNKH 1QR3E 2DE8A 1DS2E 3NUMA 2BDHA 2Y5GA 1SGNE 1FAKH 3O8BA 3MWIU 1HAVA 3HK6B 3E16B 1ARCA 2Y81A 1G36A 2GCTB 3HGNA 1PPCE 1W3CA 3F0OA 1F0UA 4HG6A 4ZKOU 1EJNA 2VBCA 5B6OA 1UK2A 3B23B 2NU3E 1O3FA 2KM0A 1MH0A 1SKYE 3F9EA 1NBMD 3F2HA 1D6RA 1QBOA 4JZIA 4YTAA 2HWLB 3HGPA 1GI1A 1FZZA 1LTOA 1SLUB 5LGOA 2EQNA 1EZUC 2HLCA 2QF4A 2F9NA 2L74A 1VR1H 4TPYA 1DLEA 2I6QA 3PMJA 1KIGH 4ABFA 2BD2A 2NWNA 2BD9A 1A3BH 4K3JA 3ZVBA 1QB1A 2BY8X 2HNTC 2Z9KA 1VCQA 1C4V2 1EP5A 2P3UB 5LH8A 2AEIH 2R3YA 4NZLA 1MAXA 2VIPA 3FP6E 1W7XH 4A7IB 1DPOA 1HCGA 2BB4A 2LP6A 1V2LT 2KAIB 2OQ5A 2ZU5A 2A2XH 2ZTZA 2BYAX 3M61U 3BN9A 3RXDA 1H9LB 4A92A 1DITH 2H9EH 5EJZA 5C5NA 1KY9A 5C1YA 1BMNH 3RXMA 3JZ2B 3VEQB 4NSVA 1NPMA 1F5LA 2B9LA 1XUGA 2O8TA 4WMEA 3S7HB 4UFDH 1P57B 1TPPA 2ZFTA 3RM2H 2WUBA 1O3JA 2O8MA 1AUJA 1V6DA 1GMHG 2C8XB 4AYYB 3L6PA 3S9CA 4B71A 2OINA 3SUDA 3ZZAA 1CBWC 1Y3UA 5HGGA 5I46H 3UIRA 2ANMH 5EW1H 3SI3H 4CRBA 5TCCA 4A1TA 2GV7A 4B74A 2R0LA 1AGJA 3RMOH 4F4OC 3LIWA 1FY5A 1GBJA 3SQEE 1V2RT 3RLWH 3KNXA 3SORA 3ZVEA 4DOQA 1LVMA 1QFKH 1ZPZA 4MQAA 1XUIA 1SGCA 1FV9A 3VB3A 1S6HA 2KCPA 2OC0A 2BMGB 3HK3B 1C1SA 4NSYA 4YM9A 3AW1A 1L0ZA 1O3NA 3SQHE 3B8JA 3A7WA 3KQBA 2STAE 1G2MA 5E8EH 1O33A 2XC5A 1QTFA 1XM1A 3MU8A 1O39A 2NU2E 1HAIH 1AWFH 2BDIA 1DUEA 1A5GH 3KYGA 1TOCB 4Y76A 1A7SA 6GCHF 1UHBA 4QT8C 2PV9B 3FP7E 1O3OA 3RMNH 2PKSB 1O2PA 1U6QA 1IQHA 3BTFE 1Q2WA 2PUQH 1EB1H 4I8HA 1J16A 4JYUH 4NIWA 1SFIA 3QLPH 1XKBC 3RU4D 4Q63A 2H1UA 1QL7A 1WU1A 1EZSC 3SU6A 1O2XA 2ZI2H 4TY7A 1MZDA 1TFXA 1WYKA 1C2MA 1AFQB 3QTVH 5B6LA 4WVPE 5FPYA 4GVUA 1HPGA 3UB0A 2G4TA 3RXJA 1GBBA 4MPVA 5CHBA 1MMJN 1XXDA 1N8OB 2J34A 1AY6H 2PUXB 3BIUH 1AFEH 3M37A 2QAAA 1AO5A 1MQ5A 4GCHG 3GICB 1DE7H 2XBVA 3RXTA 4X1PU 4ABAA 1YC0A 1TX6A 3LONA 3UY9A 3GY2A 2AMQA 2G8TA 2ZF0H 3ZZ9A 1GMDF 1O2QA 3LGYA 2PHBA 4Y11E 1EB2A 1C1UH 1DWBH 3E0NB 2F9PA 1B0FA 5FX5A 1SVPA 3QTOH 2GP9B 1TGCA 3SJ8A 1P09A 3CP7A 1NFWA 1G3EA 2VWMA 1MU6B 3P70B 5L30H 1L1GA 3ENSB 4Y8ZA 2EI7A 1NBME 1BTXA 4YT7H 2J98B 2Y6TA 1GBCA 4I8LA 4YOGA 1H8IH 1W10U 1PQ8A 1Y3XA 2Z94A 3BG4B 1ESAA 1BTZA 2KAIA 1G32B 1LVBA 3I78A 1THRH 3GY6A 1SLWB 1RXPA 1IAUA 1P9UA 1AQ7A 1O31A 1KLIH 4DJZB 2ANKH 1KDQB 1NRNH 4CH2B 3VXFH 1BRCE 1UW7A 3ZZDA 2ZU3A 4FUBA 1C5OH 3ATKA 3A89A 4ESTE 2W5EA 1BITA 1G3CA 1HBTH 1O2LA 5EGMA 2OLGA 2BDYA 1THPB 3P8NA 2FS8A 5C20A 1QY6A 4FXGH 4AFUA 4LZ1H 1GHWH 2BQ7B 4A6LA 3UAIC 1V2MT 1HAPH 3U98H 1KXCA 2WPJS 1BBRH 3LT3A 1P9SA 4BTIB 5EJLA 1C1WH 3M35A 3L3TA 5HM9A 1RFNA 1TPSA 2PGBB 4WMDA 3SN8A 2FX6A 2GCHG 2AHME 2GCTC 2GVFA 4X6NA 1OWKA 2AGGX 2QIQA 4X2XA 1HNEE 2ZO3H 5A09A 1FY1A 3SUEA 4Y8XA 1K9OE 1BT7A 4ZXXH 3A87A 3A82A 3CS7A 3TJOA 1GL0E 1M9UA 5DGJA 1A46H 1L1NA 8GCHF 2UUFB 3TVJB 1MAYA 4ABGA 1K0HA 3BTHE 3NRLA 1P2IA 4JYTA 3LH3A 1HJ9A 3EE0B 1IQJA 3GISB 4NA9H 1SPJA 2WPLS 2D8WA 4GAWA 4NFEA 4CREA 1QBNA 2C90B 5C5OA 4VGCC 1NFYA 2CK3D 1IOEA 3EA7A 1CGJE 1O2OA 1YLCA 1ZHRA 2AERH 1O3PB 5E2OA 1TX7A 1QRZA 2A0QB 2F9OA 4YLQH 1HAOH 3KHVA 1VKYA 4ISOA 2TGDA 1KSNA 3RXKA 5FBEA 1QBVH 4FETA 3BTDE 1P3EA 1E1RD 1GCTB 1RJXB 1PPBH 2QA9E 1AD8H 1JIMA 2G5NA 1GHYH 1UTPA 4XE4A 5FXLA 1BRAA 1AN1E 1NT1A 3OY6U 1GI0A 4X8UH 1NY22 2NU1E 1G9IE 5A0CA 2ZZUH 1W2KH 3F6UH 2W7UA 2P8OC 1LKBA 1TNJA 3LH1A 5EPYA 2Q1JA 4BAKB 5IK2D 4RT1A 1C5RA 2CGAA 1FY4A 2XTTB 4A1VA 4AG2A 3RU4E 1MCTA 4ISIH 3EA9A 3VFEA 4CBNA 2VU8E 1WAYB 1O35A 2BLWA 3SU5A 2BVSH 1CA8B 3RXQA 1HYLA 1L1JA 2GX4A 5CE1A 3RU4T 1EASA 1EAIA 1PJPA 1G3BA 2FOBA 3EE7A 4ZUHA 1W0KD 5A0BA 1O2GH 3NK8A 4Y6DA 2ZDAH 5HIZA 2J98A 3GS9A 1L4DA 4XBDA
chains in the Genus database with same CATH topology
3A85A 5E0JA 2FLBH 1C1QA 4DURA 3RLYH 1GBFA 1MUEB 3ZZ5A 4I33A 4IN2A 3SV8A 3U8TH 1NS3A 1MTNC 4ZHLU 2YOLA 5HM2A 1KDQA 1ELDE 3R0FA 3MYWA 4K1EA 4MNWA 3KQDA 3VGCB 3SNEA 2PKSC 5AF9H 1BMLA 5DG6A 5L2ZH 1OS8A 1TABE 3RDZA 1ZPBA 2VGCC 4JYVH 3BSQA 1VGCB 2QV1A 2ZTYA 4INKA 1TAWA 3GCTG 2SGFE 4E7RG 1FN6A 1AFQC 1ETSH 1AE5A 3UPEA 2P3TB 1L2EA 1SQOA 1SOTA 2HNTF 2O8LA 1MKXH 3MH7A 3ZZ6A 1N8OC 1W14U 1AUTC 5GIBA 3SJKA 2ZIQH 1GHAG 1DWCH 3PWBA 1SGDE 1O2TA 4X8VH 1YM0A 1TLDA 5EG4A 4X6OA 1YF4A 4FUFA 4LXBH 1RRKA 2DUCA 5GCHG 2SFAA 5FCRA 4AYVB 4I32A 4X2YA 2R2MB 3MO9A 1TQ7B 4H42U 4OGYA 2ZGHA 1Z7KA 4Y7BA 4DG4A 1WCZA 5DKMA 3M5NA 1C2FA 2XBYA 5ESTE 2C8ZB 3ODDA 4GLYA 2FM2A 1O5BB 2WPHS 1XXFA 3U8RH 4RSPA 2XWAA 1S0RA 2HNTE 2K1QA 1WV7H 1TONA 2HVXA 1AVGH 3QUMP 1BIOA 1WOFA 1ACBE 3BG4C 3TJVA 1IQIA 1S81A 1S83A 4K2YA 4KTCA 5FAHA 2QXHA 3EA8A 2THFB 4CRCA 3M36A 4FVBA 4FU7A 1ZGVA 4BTTB 1E35B 1ABJH 2BD4A 1FXYA 1P06A 4TYDA 1YKTA 1UMAH 2C93B 2FTLE 4Y79A 1LHFH 1LVOA 1UCYK 3LJOA 1C5YB 1DWEH 1MTVA 1O36A 4OS4A 3LGIA 3VXEH 3SUGA 4YZUA 2QGRA 1LHCH 1BUIA 2ZWLH 3PO1B 1ZLRA 3T28A 3TNSA 1C2JA 2FEQH 3DHKH 3RXVA 4MNVA 1ZTJA 2ILNA 1UVOA 2FIRH 5GJ4B 3MNCA 3RC5A 3DFJA 1S6FA 3H5CB 2SGDE 4FUEA 1K1OA 1SBWA 2BQWB 3AAUA 3MH4A 1FIWA 4OS2A 1GMHF 1P3CA 2BLQA 4AB9A 1KLTA 1CSOE 3SUFA 2QF0A 1W0YH 1FUJA 1JOUB 4MNYA 1PPEE 4U32A 1V2OT 1Z6JH 2O9QA 3STJA 4NWKA 1V2UT 3TH3H 2UWLA 2FZZA 2UUKB 3MNBA 1Y5BT 2XWBI 1C4Y2 4FU8A 3DA9B 2AGIX 4X1SU 3Q77A 9ESTA 3RXLA 4ABBA 1QA0A 1P02A 1C2IA 2QXIA 4GHQA 3E0PB 1WQSA 1EOLA 2ZDNA 3AASA 2ZPSA 3OY5U 4WH6A 1UVTH 1BHXF 1F0RA 2OCVB 1OXGA 1OP2A 4ZHMU 5HXFA 1EUFA 3UWJH 5G4BA 1GBEA 1GBHA 3RXHA 3RUOA 2HPQH 3VB5A 4AOQA 2AMDA 2XYAA 3IITA 1EZQA 1UHBB 3PMAB 3HATH 1WTHD 3ATLA 1GCTC 1FMGA 2ZQ2A 1P2QA 1THSH 2FX4A 1UTQA 4OS1A 5I25A 5FHTA 4BAHB 4ABDA 1UTOA 2ZECA 1YLDA 4Q80A 2OBOA 2ZU1A 1A5HA 3MMGA 5JB8S 3EDXB 3B9FH 4BANB 2SGQE 1SSXA 4OS7A 3UTUH 4H4FA 5L2YH 2A4GA 3ELAH 5LPFA 2SNVA 2YNAA 2FOEA 1D6WA 1DUAA 2QF3A 1KYNA 2OXSA 3SO3A 1UK3A 2A5IA 4CRFA 1LVYA 2CN0H 1EXFA 2A4OA 3FZDA 1HV7A 1BBRE 5AVDA 4Y0YE 5CHAB 3RC6A 1C5WB 1O34A 2P95A 3QDZB 1A4WH 3H7TA 2FYRA 3EQ0H 4GCHF 1GJBB 1T4VH 1ELEE 1AKSB 1ELCA 2HGTH 1OYQA 1BJUA 1K21H 3MHWU 1N1LA 2F9BH 1ZMLA 3GY4A 1C4U2 1NESE 4VGCB 2FYQA 3TGJE 3ZZ7A 2W26A 2YNBA 3SNCA 5DP9A 1V2ST 1TNHA 1ZTLA 4MVNA 4FU9A 1AVWA 4MTBA 4D9QA 1DY9A 1YPHC 2J38A 3UOPA 2C3SA 1IQFA 1QA7A 5K0HA 1LKAA 1NRRH 1CT0E 2VINA 5EQSA 4R8TB 2CF8H 1PYTC 2FOCA 5GDSH 1TPAE 2Y5FA 1K22H 1A2CH 1A0HB 3SU3A 3VGCC 1MU8B 2IJOB 1RTFB 2H2ZA 4UD9H 1GI3A 1P2OA 1MTWA 4DCDA 1WTGH 1TGSZ 4DIIH 3I29A 5DP8A 3PROA 2P8OB 1VGCC 1FQ3A 2VWNA 1OOKB 4Q2KA 1GCDA 3S0NA 3BTWE 1W12U 3S69A 1SLXB 1VITG 3HKIB 4D7FA 4THNH 3MNSA 1H8DH 2J94A 1GJCB 3A8AA 2OD3B 1AI8H 2PSYA 1SHYA 2ZKSA 1SG8B 2BVXH 1E34B 1DSUA 1XUFA 1D3TB 2F3CE 2GCHF 2VIWA 2ANWA 1C5VA 1V3XA 2AH4X 3NKKA 1O0DH 1MKXK 2XC4A 1C5SA 4AX9H 1HB0B 1GI4A 1HDTH 3D23A 1S84A 3QWCH 2A4RA 1T8OA 1H4WA 3MO3A 4HGCA 1UTKA 5JBAS 1MTUA 4AGKA 1YCPK 1IHTH 2OBQA 1O2SA 3ZVDA 3ZZCA 2FPZA 1NC6A 1EKBB 1MKWK 1MTNB 2JKHA 1AVXA 1ANCA 3ZZ4A 1C9PA 3R3GB 1Z8RA 1KTSB 2J92A 3LGVA 3GCHB 2GTBA 5A8XA 2UUYA 3BEUA 3GCOA 4AB8A 3T26A 2FOAA 9LPRA 2VGCB 2P94A 3BEIB 2FODA 1RD3B 1C2GA 3E6PH 1TA2A 1TGNA 2F9VA 1LO6A 1O3GA 1O3HA 2W7SA 2JH6D 3BF6H 3A88A 4JZ1A 1Y5AT 1WSSH 2OTVA 1UO6A 3TJNA 4WWYA 4X8TH 4ZH8A 3PO1C 1Q3XA 1BTWA 1FPHH 3TGKE 1TIOA 4PROA 4ABIA 2ZPQA 1O2HA 3GY7A 1SGEE 5EU8A 3SHAH 4AFZA 4XOJA 4D8NA 1SMFE 2VIVA 1BMMH 4X1RU 1QJ7B 1VJAU 1MD8A 2Z3DA 4NCYA 1LHDH 4Y71A 1E37B 3PM3A 2PKAB 1AKSA 3MU1A 3LC5A 3MH6A 3PLBA 3ZVGA 2V6NA 3TH2H 4CRGA 1TB6H 3UNQA 2XXLA 2FP7B 3A8CA 1C9TA 3RXEA 4MPXA 1AIXH 2BD3A 2PTCE 3BTTE 3EAJA 1BTUA 1T31A 2RA0A 2Z9GA 5GWZA 1HIAB 2Y7ZA 8KME2 1O2NA 1T8NA 2A7CA 1UTJA 1O2VA 1QB9A 5FPSA 1SQAA 1C5MD 2ZA5A 3SJ9A 1O5FH 1VITH 2BY9X 4K1SA 2BDGA 1INCA 1HAYB 4AORA 3T29A 2CHAC 2OC8A 4B2BA 3G01A 3PYHA 4FUIA 1UCYH 4J1YA 2STBE 2P59A 1IHSH 1O2MA 4HZHA 1YYY1 1TGBA 3MNXA 4NGAH 1PPFE 2VH6A 3ATIA 1D9IA 3QO6A 1PQ7A 2ZDKA 2OP9A 2ODPA 4XBBA 5EODA 1D4PB 5EOKA 1CHOG 4JK5A 1GHBG 1UVPA 1VZQH 3F1SB 3U9AH 1DXWA 1YCPM 7GCHG 3RP2A 3ESTA 3PV4A 3P95A 3RXAA 3ATWA 1GDUA 3AAVA 3PWCA 1MZAA 3DT0H 4BNRA 3BTME 3GCTF 3PMBB 4KKDA 4YO9A 3RXGA 1TGTA 2OC7A 2D1JA 4R0IA 3F68H 1P2JA 1NU9A 2XNIA 1DM4B 1DWDH 3SGAE 1MQ6A 1TOMH 4I8KA 5CHAC 2HOBA 1GHAF 5DO4H 1LCYA 1OPHB 1P11E 4Y0ZE 5JPMH 2HPPH 1GBMA 4U01A 2SGAA 1QJ6B 4ABJA 1TNIA 1BJVA 1GVLA 5T6FA 4FUCA 5GCHF 1GBKA 1B5GH 3QGNB 3UR9A 1AMHA 2BY5X 2FI4E 4ISNA 1SQTA 1TRNA 4Q7ZA 3LC3A 3NWUA 4ZMAH 1PYTD 1J14A 2FXRA 1ZYOA 5DPAA 2XRCA 3RMLH 1EOJA 1Y3WA 5F03A 5AFZH 1EPTC 8LPRA 1N6XA 1RTKA 1GJ9B 1T8LA 1F7ZA 4TY6A 2GZ7A 4XBCA 3URDA 3PTNA 5EQQA 5A0AE 1CA0B 1UJ1A 3P8OA 4HTCH 3SZNA 1QL8A 1NRSH 3OYPA 5E0GA 3QGJA 1QRXA 6LPRA 1JMOH 1DFPA 3CENA 4NWLA 5DP5A 4MLFB 1O3AA 1K28D 3UUZA 4AFQA 2ZHWH 4I31A 1JBUH 1C1VH 1ZSLA 1EQ9A 2PKAA 1D3DB 2XBWA 4NZQA 5AHGH 1HJAB 4DIHH 3MU0A 1HAHH 3ZVFA 2A45B 1EX3A 2G81E 1OWIA 4FUHA 4WXVA 8ESTE 2TGPZ 1K1MA 4U30A 1A5IA 3HKJB 1GHVH 4NFFA 1HIAA 1BCUH 4FUDA 2VJ1A 5EXMA 5H4IB 1C5LH 1XX9A 2BXTH 1ETTH 1ELVA 4UEHH 4OGXA 3UREA 3UWIA 2ZFSA 3BEFB 1O2IA 3TIUA 2SNWA 5BPEA 1SGTA 1GG6C 1ANBA 2ZHDA 2G51A 2XBXA 5JBTA 2F83A 2Z3EA 1CGHA 3M5OA 5F8TA 2H9TH 3E91A 1L4ZA 1LPKB 4Q7XA 3SU2A 4K5ZA 1ANEA 4K8BA 4NIYA 2R2WU 3GCHC 5TCAA 1BA8B 4AN7A 1UVSH 1O37A 1P8VC 1O2YA 1E38B 2Q6GA 3AW0A 4DY7B 3P17H 2ZPRA 1BMAA 1GL1A 1G2LA 2J4IA 1TMTH 2EI6A 2ZFFH 2J95A 7KMEH 2WV5A 1TPOA 2ODYB 5IYTA 4XSKU 2FI5E 2WINI 1TA6A 1P2MA 4LZ4B 3LGWA 3E90B 5T6GA 1JWTA 1JRTA 5DJ7A 4IGDA 3EYDA 1GJAB 2GDEH 1TMUH 2FDAA 2ZHFH 2BTCE 1W7GH 1O5AB 2BZAA 2Z7FE 1HAZB 2PSXA 1YCPH 2ZU4A 3P8GA 7ESTE 3SV6A 1V2PT 3SOSA 1GBAA 1NM6A 1NN6A 2VVCA 1IQMA 1BTYA 2Z3CA 1FJSA 4MDSA 1MKWH 4NA8A 3RXCA 1ZTKA 2ZDMA 1Z71A 3QZQA 1K1NA 1HXEH 4O03A 5LPRA 2ZGCA 2ZFQH 1GI8B 4LOYH 1S85A 1GBIA 1ARBA 1SHHB 2AMPA 3K65B 3V13A 1VJ9U 1NRPH 4RKOB 1J8AA 3M5MA 1PPZA 2QY0B 3E1XB 2PFEA 2C8WB 1QIXB 1XKAC 1O3MA 1P05A 1FI8A 1DY8A 4I7YH 1BZXE 4K8YA 1HJ8A 5GPIB 1OP0A 1YPGH 1V2VT 1YPHE 1BRUP 3SNDA 2ZU2A 5J4SA 3E3TA 1S82A 1BOQA 4WY3A 3M5LA 2P93A 1J9CH 1NROH 3TGIE 3GYMA 2ZDVH 1E36B 3RXIA 1GWAA 2Z9JA 2ZGBH 1LMWB 1ELBA 1H1BA 4RN6A 1MCVA 1XVOA 1V2TT 1SL3A 2R0KA 1ZJDA 2GV6A 4TWWA 2B0FA 2GT7A 4B2CA 1AB9C 2ZDLA 3SGBE 2ZTXA 1YPJH 5EQRA 1SR5C 4CHAB 4WMFA 6CHAC 1O3CA 1VITF 3S7KB 1H9IE 1WQVH 1TRYA 2BLVA 4UE7H 5DP4A 1JIRA 1TWXB 4FUGA 1FY8E 1QURH 2A2QH 3SJOA 1W11U 3DUXH 1ID5H 2Z6BD 3P6ZB 1JRSA 1ELAA 3RXOA 2A5AA 1VCWA 1BTPA 2H6MA 2ASUB 1C2HA 1E0FD 3IWMA 4KTSA 4JZDH 4KGAA 1C1NA 3MTYA 2FOFA 1AHTH 3RXSA 4O9VA 4DT7B 3BG8A 5EXLA 1YPEH 2CHAB 2FO9A 2CF9H 2J9NA 4Y7AA 1F0SA 1AZ8A 5E0HA 3GY5A 4DGJA 2TBSA 1O5CB 2ZCLP 3TK5A 1XVMA 4BAQB 2AFQB 1C5PA 1SLVB 1QQUA 1W0ZU 1C5QA 4TPIZ 1IQEA 1Z6EA 1S5SA 3PLPA 1PQAA 1UCYE 3IG6B 2V3HH 1CA0C 3MFJA 1AZZA 1ZRKA 3T27A 3MOCA 4YOIA 3ZZ3A 3O8RA 1C5ZB 3NCLA 1QNJA 1O2ZA 1K2I1 1UK4A 2D26C 1HAGE 2WPMS 3SV7A 2M5TA 5ETXA 3M7TA 1ZSKA 2BDCA 3KQEA 3RXBA 1HJAC 1RIWB 1F2SE 1C1OA 2BD8A 1FNIA 3VPKA 1BDAA 3FVFB 3V7TA 4E7NA 3A86A 3H7OA 1ESTA 2I6SA 4AZ2B 3TK9A 3FFGA 1GJ7B 1QJ1B 4NG9H 3C1KA 1GI9B 1Z8IB 2LNCA 2WV4A 1C1MA 2GMTB 5A2MH 1W13U 1Y3YA 3CS0A 4IBLH 4CBOA 2V3OH 3ZV9A 1ELFA 1SGYE 2B5TB 2C4FH 4AFSA 1F5KU 5F8XA 1A0LA 1GI5A 4F49A 3TH4H 2EC9H 2G00A 7LPRA 1EAUA 3BIVH 1MTSA 4JCNA 5HMAA 2ZEBA 1A3EH 1SGFA 3L33A 1EPTB 2A32A 3OU0A 1GDNA 3KIDU 4JK6A 5EXNA 1K1JA 1O3KA 4GHTA 3M7QA 4BOHA 4CH8B 5J4QA 2A1DB 1CO7E 4YESB 1HXFH 3SNBA 3DD2H 2H5CA 3Q3XA 1Y59T 3RXFA 3SU1A 1O30A 3RXPA 2QCYA 4ABHA 4CR9A 1YPKH 3A7XA 5AFYH 1ZHPA 1C2EA 3KEEA 1C1TA 3P8FA 1C5NH 3S9AA 4UONA 4XDEA 1P2NA 1OWDA 1NTPA 2BHGA 3LOXA 1O38A 2UWPA 3RM0H 2ALVA 1CHOF 1OWHA 1GHBF 4IN1A 1SOZA 1ELTA 7GCHF 1DT2A 1SGIB 1GDQA 1SGFG 1HAXB 3T25A 4Y10E 4UFGH 1OYTH 3SU4A 3P92A 3AVZA 1EP6A 1WBGB 5E2PA 3VB4A 3MI4A 1DLKB 1FLEE 3Q3KA 1P01A 1ZJKA 3ITIA 1PPGE 3ZYDA 2FOHA 3DFLA 4AG1A 1O2WA 4Z6AH 3OTJE 3UNSA 3RMMH 4X2WA 3T62A 2CJIA 2P3FH 5C1XA