1C2EA

Recruiting zinc to mediate potent, specific inhibition of serine proteases
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords TRYPSIN
publication title Design of potent selective zinc-mediated serine protease inhibitors.
pubmed doi rcsb
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c2eA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c2eA02
4MLFB 2CGAA 1D6RA 2BD9A 1RTLA 1IQHA 5HXFA 3BG4C 2BQWB 3V12A 3P8FA 1OSSA 2BTCE 1T8OA 5A8XA 1B5GH 2AGIX 1C9PA 1F5KU 4Y79A 1KDQA 3A82A 3SNEA 4B71A 2ZTYA 3ZVCA 1FONA 4YOIA 1ZLRA 5BPEA 1GJ4H 1AZZA 3ZVGA 1V2RT 3LH3A 2XCNA 1BIOA 1QB6A 3LPRA 1CT4E 2F9PA 1TMUH 1MMJN 3HGPA 4MNWA 1HFDA 2QIQA 3MO9A 2BX3A 5F8ZA 2CJIA 3MH4A 2WPHS 3PMJA 5JPMH 2Q1JA 1ZSJA 1CA8B 1ZGVA 1QJ7B 1OP0A 1ABIH 1OX1A 1O2XA 2OC1A 1BHXB 1OWEA 2BD3A 2QXIA 3ZZCA 2J9NA 1V2UT 2G8TA 1UHBB 4BNRA 1ZRBA 2VGCC 6GCHF 4O03A 1C1QA 1TNIA 1O2WA 1AB9B 1P2KA 3TK5A 4D8NA 1HAOH 1VCQA 2P3UB 1VITF 2XNIA 5FPYA 3LJJA 3FP6E 1TFXA 2C4FH 2V0BA 1GI7B 1SBWA 4Y8ZA 2D1JA 3E16B 2Y5HA 1KYNA 4Q7YA 4CH2B 1O2NA 3BN9A 4Q7ZA 1MBMA 7ESTE 4NCYA 4A1TA 2GTBA 3TVJB 1AE8H 1FXYA 4FXGH 2WPIS 5IYTA 2WPLS 3U9AH 1VJAU 2ZI2H 1CU1A 5E2PA 2ZGJA 1HAXB 2ANKH 1TRNA 2XXLA 2ZHEH 2VGCB 3A87A 1IQGA 5L2ZH 2FYQA 3M5NA 3SJ8A 3EE0B 2TPIZ 5T3HA 1ACBE 4O3UA 1C1TA 1W10U 4YOGA 1TPSA 1O3MA 2FS9A 2ZWLH 1AFQC 1ZJKA 3PTBA 4IN1A 4JYTA 4Y76A 5I46H 2G5NA 2P16A 1UTOA 1GCTC 1IOEA 1HXEH 3W95A 1G3EA 2HPPH 1UK4A 3ESTA 2ZF0H 3QGNB 1EPTA 1JXPA 1HAVB 1A5HA 2A7JA 2A4OA 1FDPA 1H4WA 5T6GA 3MU8A 1T7CA 3Q3YA 1D3TB 3FP7E 4NA8A 4IGDA 3SBKA 1AZ8A 1KLJH 3A8CA 1PPFE 3RMOH 1CQQA 3TJOA 1AUTC 4TY7A 3LONA 4MPUA 1MTUA 4NWKA 4IS5A 3RXPA 1HAIH 1EB1H 4H6SB 1FPCH 1GCTB 1S6FA 3ZYEA 2RG3A 1BMLA 2EA3A 2SNVA 1MKXH 1TQ7B 2ZHFH 3ZZDA 4BTTB 4CBNA 1TNHA 1V3XA 2ZGBH 1GJBB 3UWJH 2BB4A 2EI7A 1D3DB 4AYVB 2C3SA 3GYMA 1Z7KA 2BY8X 4MTBA 3QTVH 1Z6EA 2FZZA 1Y5BT 1G2LA 2VIWA 3KEEA 4E7RG 1GG6C 3BTDE 1O3KA 1TGTA 1UTQA 1ID5H 1W2KH 4K60A 2ZCLP 2B8OH 5FAHA 2P93A 1DE7H 3O8CA 1ZTLA 4MQAA 1EJMA 4TWWA 5K7RA 3SU1A 4X1NU 1HBTH 1TNKA 4Z6AH 4CR9A 1WUNH 2FM2A 1TALA 4DY7B 1UTLM 1KLTA 1HIAB 3RXQA 3KQBA 2BXTH 2ZA5A 3SQHE 3ZZ9A 1LHDH 1D6WA 1QL8A 1UTNA 3TNSA 5EW2H 2SFAA 3SNBA 1PFXC 1WTHD 1Z8JB 1MKWH 4BOHA 2OP9A 3SN8A 2BDCA 2LPRA 5ETXA 3NXPA 2F9VA 2HGTH 1MQ6A 1OKXA 2FWWA 3A7VA 5EPNA 2HLCA 4GLYA 3UQOA 3SGAE 4TYDA 3RXFA 4TY6A 3LT3A 4WXVA 2OLGA 1CO7E 1P0SH 1GJAB 3M5MA 1O3IA 2TGAA 2SGDE 1PQ5A 3I78A 2EEKA 2PTCE 5ESTE 3F9FA 2K1QA 2AERH 1EP5A 1ABJH 1HGTH 3TH3H 1S0RA 1AIXH 1W13U 5FXLA 4Q2KA 1SSXA 1BBRE 1HJAC 5C1UA 4MNYA 5C3NA 5DK1A 4ABGA 4ISLA 1Y3UA 4WF8A 1NT1A 1FAXA 2VWLA 1EAWA 4Y7BA 2B5TB 4AG1A 2O8TA 1O2LA 1TBQH 2A2XH 1HJ9A 2TIOA 3UR9A 1YPHE 1TPOA 4NFEA 5DKMA 1GJ5H 4MG3A 2ZHWH 2FTMA 5EG4A 1D9IA 1B0FA 1PPGE 5FBIA 4Y8XA 1GHWH 3ZV9A 3PO1C 5FPTA 1B0EA 1HJAB 1J16A 3M3SA 3M36A 4ZHMU 3RM0H 4AX9H 1WYKA 1GJ8B 5LPFA 2Z6BD 2PHBA 4NSYA 5GCHF 3RXEA 3KQEA 2Y5FA 2ZU2A 2C90B 3SNCA 4HZHA 3UNRA 4GCHF 2XC4A 1O31A 3K6ZA 5JBCS 1TONA 5K0HA 4JZEH 3C27B 2ZGHA 3UUZA 1O38A 1SGTA 1DWCH 2NU1E 1V2VT 4WMDA 1TLDA 4AFZA 2VJ1A 3PO1B 2ZPSA 1LKBA 1HB0B 4I32A 4OS6A 2GZ7A 2J34A 3BTQE 4DIIH 1QL7A 4AGJA 2HALA 1YKTA 3QWCH 4WJG2 1HAPH 1SGCA 4HI3A 3URCA 3DFLA 3K6YA 3T28A 3E0PB 2ZTZA 3AAUA 1O3DA 2D8WA 1GHBG 3K9XB 2ULLA 1GI6A 3GCTG 3QDZB 2B9LA 1GI4A 2ZU4A 3LGUA 4A1XA 1NRSH 2CN0H 3L6PA 1C5YB 2PGQB 3RXDA 4ISHH 1FIZA 1THSH 1BRUP 1RTFB 1Z8RA 1DPOA 1NFWA 1GBIA 2DE8A 1UK2A 1KDQB 3T2NA 1Y3XA 1QRWA 2NU0E 1UCYE 3PLBA 1O3NA 4DW2U 2BVRH 2Q6DA 2D2DA 1YCPM 2NU4E 2XRCA 3S7HB 3SI4H 3STIA 3F9GA 4K1TA 5DP9A 3ZZ7A 5L2YH 8GCHG 1SGNE 1W0YH 3PV4A 3FVFB 1JIRA 1P2QA 2XCFA 7LPRA 4ABIA 4YM9A 2FDAA 1S85A 3WY8A 4X8SH 1FN8A 1ELBA 3ATKA 3LOXA 3MNBA 1J14A 3RXRA 3E1XB 3BTEE 5GDSH 1QQUA 3ZVAA 1Y5AT 1P2OA 1PYTC 3M3VA 5A8ZA 2FYRA 2EC9H 1P04A 2HOBA 3RDZA 4FUEA 2P3TB 2GD4B 1BTWA 1E38B 3P8OA 2UUYA 4A1VA 1HJ8A 2FESH 3M61U 4BXWA 1C2FA 3RXSA 3M5OA 1SFIA 1EP6A 1DS2E 4IN2A 4E05H 1CBWC 1TNGA 3U8OH 2KAIA 2ZZUH 3SV9A 1EPTC 1SLWB 3UREA 1NC6A 4J1YA 1DLEA 4ZKOU 4XDEA 2R2WU 4HFPB 2C8ZB 5EODA 5A0BA 1QGFA 1C5RA 2ANWA 5C1XA 3PMAB 2OD3B 2FMJA 2OBOA 3RMMH 3MH6A 2SGPE 2HNTE 3LH1A 1C5MD 1MUEB 3A8DA 4BANB 5H4IB 3TGKE 3PLPA 1HRTH 3RMLH 1LVMA 2Q6FA 5AFZH 1GI5A 2FX6A 5E8EH 4BAQB 3T25A 1G3DA 2ZQ2A 1O3EA 3MU0A 3IITA 5DO4H 1EPTB 1LCYA 1V2JT 1EB2A 1TYNA 1O3LA 4YLQH 4AB9A 1C4U2 3KHVA 1S84A 3QX5H 1A3EH 2STAE 1P09A 3IWMA 2QC2A 4O3TA 3MMGA 4Y11E 2F3CE 1TMTH 1PQ7A 1ZR0A 1C5LH 4XFQA 1OS8A 2R0LA 4ASHA 2ANMH 1SHHB 1ZMLA 4X6PA 3E6PH 3QGJA 3RXBA 1GHAF 1UTPA 3TH4H 1G3BA 1PJPA 2G55A 1NRPH 1VR1H 1JIMA 2BM2A 3ATLA 3C1KA 3OY6U 6CHAC 4DCDA 5EXNA 1C2HA 2GDEH 5ABWA 1O2SA 1C1UH 4XBCA 3UTUH 3PLKA 2R3YA 2CF9H 3FZDA 1O2GH 3UOPA 3ZVEA 3SJ9A 2QGRA 3GDVA 3VGCC 1LKAA 1XUHA 3TITA 3UIRA 4ABFA 1HAZB 1YPGH 4ZXXH 2VB0A 1INCA 1C5TA 4BAHB 2JH5D 1SGYE 1TWXB 1MZDA 4NIWA 1BTYA 1DLKB 1XVMA 1SFQB 4FU8A 5I25A 1ZOMA 5AVDA 1S6HA 2TRMA 2XC5A 4F4OC 1K9OE 3T62A 1VCPA 2XBWA 4UFEH 4ZUHA 3Q00A 3TPIZ 5LPEA 1O2UA 4ZKRU 3LC3A 2WPJS 3E3TA 3U1IB 1SQTA 1GMCF 4FU9A 1CVWH 3VGCB 3H7OA 3SJIA 1BTHH 1W0ZU 2G4UA 2Y81A 1IHTH 3SV7A 1P06A 4INLA 4U30A 2QYIA 1DSUA 1GMHG 3AW0A 1IQMA 2EI6A 4B2BA 4CRGA 5FBEA 3RXLA 4ABEA 3P92A 5C20A 2O8UA 1RIWB 3H5CB 1QBVH 1T4UH 3D62A 2AH4X 1TX8A 2A7HA 1YC0A 1EASA 1LTOA 3KN2A 2RCEA 4KGAA 2H9HA 2BQ7B 4I8KA 1ELDE 1D4PB 1IQNA 1V6DA 1O32A 5AHGH 3VB5A 1BMAA 1Q31A 1EZXC 1BTZA 2Y6TA 2J4IA 2WV4A 1T8NA 1QY6A 2BD2A 1CT2E 2Y80A 3RU4T 4UE7H 2ZKSA 4B74A 1YF4A 1BTXA 3SU0A 3M7TA 3NKKA 1IAUA 3GYLB 4BAMB 1THPB 1HLTH 1O3GA 1UTKA 2BDIA 3LC5A 1QL9A 2XBYA 1EAUA 2ZHDA 3ZVBA 4JK5A 3FFGA 2PW8H 1BTPA 4E7NA 1O5GH 1A3BH 2QXHA 1V2NT 2ZU1A 3BTFE 2XBXA 5HM2A 1C5QA 1AMHA 1VGCC 2Z94A 4Y0YE 1C5UA 1OWIA 2CHAB 2G4TA 2WYJA 4TPYA 1QCPA 1WU1A 1ZTJA 2V3HH 1KXBA 2FX4A 7KMEH 4Z0KA 1C1SA 1BBRH 1BHXF 2BHGA 4ABBA 1UVSH 2AGEX 3BTTE 3TJVA 6GCHG 1KSNA 4ZHLU 1K1MA 2PKAA 1FUJA 3ODFA 1MKXK 1BT7A 1UK3A 1VITG 2R0KA 2XC0A 1ZHRA 1O3AA 4NWLA 4OS5A 1V2ST 3ZYDA 2ALPA 2AMPA 3LGIA 3D23A 4FUHA 1TB6H 1IHSH 1MAXA 1Q3XA 1G30B 3GY5A 1VGCB 1WV7H 3BG4B 1Z1JA 1W7XH 1HYLA 2PFEA 1AVXA 2GT8A 3P70B 2QA9E 3CS0A 2QV1A 4I8JA 3V7TA 3TGIE 1GCDA 1P2NA 1GJ6A 1A4WH 1FN6A 1K28D 2GT7A 1SGDE 2W7UA 1KXAA 4NSVA 2XWBI 2ESTE 3BEUA 1ZSKA 3LJOA 3GY3A 4GHTA 1H8DH 3SU4A 1K1NA 2FIRH 1ZGIA 1N6YA 4MPWA 3U8TH 5EPYA 2OBQA 1T8MA 3Q3XA 2RA0A 3KIDU 3MTYA 1GVLA 1PQAA 1GI8B 3PWCA 4K3JA 3URDA 1H9HE 4ZAEA 5HMAA 1C5PA 4JMYA 5C5OA 5TJXA 2BD7A 2SGAA 1FJSA 5EGMA 1MKWK 4BXSA 3SU6A 2ZGCA 3BF6H 2EI8A 5DP4A 5F8TA 1P2IA 2P3FH 3SOSA 3OY5U 2BY9X 5JBAS 1NZQH 1ARCA 1P3CA 1FI8A 1TGNA 1W14U 1XX9A 1DDJA 1SOTA 1NESE 3P8GA 2HNTF 4H4FA 2ZNKH 1LDTT 6ESTA 3CENA 1YCPH 3GY6A 2FOGA 3M7QA 2GV6A 3SUDA 3TJNA 2H9EH 4I8GA 2IOTA 1A5IA 4JYVH 1FY8E 1NO9H 3SUGA 3MOCA 5GJ4B 1C1VH 3UQVA 1C5SA 1UCYH 3TJUA 1ELVA 2ASUB 1DVAH 2GCHF 2Z3DA 4HGCA 1C2JA 1L1GA 1L4DA 1XKBC 1DWEH 3UPEA 5DP8A 2BYAX 5DP5A 2H5DA 1SG8B 2UUFB 2BMGB 1P57B 5LPRA 3PTNA 1FPHH 1LVYA 1NU7B 1AFQB 1TBZH 2R3UA 4ZMAH 4Y7AA 3PMBB 1MBQA 1Z8IB 1P01A 3SU3A 2QF3A 5E0JA 2O8MA 2OQ5A 1H1BA 1ZMNA 1ZZZA 1K2I1 4GUXA 1AKSA 1GBAA 2FOEA 5DP7A 2F9UA 2BOHB 4K2YA 2VWNA 2QN5T 1H9LB 1ZJDA 1AWFH 1S0QA 2THFB 3PM3A 1GJCB 3NPSA 1GL1A 3MNSA 4X1QU 1JOUB 1ARBA 4D7FA 3BTGE 3DUXH 2F83A 1KXCA 3LIWA 2OXSA 1ESBA 2ZDLA 4B73A 3A88A 1ANBA 1EZQA 5EXMA 1NTPA 3SGBE 1C2GA 1YPLH 4M7GA 4I7YH 3ZVDA 1C2DA 2BLQA 1PPCE 2OTVA 8KME2 3F68H 1Z1IA 1P8VC 4H6TA 3BSQA 5F6MA 1ESAA 2Z9GA 1LO6A 5DJ7A 3UNSA 2PUQH 1YBWA 3D65E 1GG6B 1C5XB 1V2LT 1A1RA 1TE0A 4YZUA 4ESTE 2VVUA 3KL6A 2HRVA 4X8UH 1BUIA 2Z9LA 1GPZA 4VGCC 3SV6A 1UJ1A 2AFQB 4FUJA 1A5GH 1Y8TA 2DUCA 3KQCA 1T32A 3RXCA 4DT7B 5GWZA 4AFQA 1Y5UT 3VB4A 3KCGH 3P17H 2BDYA 4NA7A 1O35A 2GV7A 5FHTA 1JMOH 5BRRE 2AMQA 1J15A 2VIPA 3SGQE 1F0RA 2Q6GA 4UDWH 3SNDA 3KGPA 2PSYA 3HK6B 1LHEH 1GI1A 1QRZA 1OPHB 4AN7A 1QQ4A 1IQLA 3SUEA 1P12E 1H8IH 1BITA 1XKAC 3HGNA 1L4ZA 2PTNA 2CV3A 4VGCB 3KQDA 3A7XA 1DWBH 1GI2A 3RP2A 4IMZA 1RTKA 3BG8A 4UEHH 5GCHG 5PTPA 1XUKA 2IJOB 1KXFA 2ZCHP 1KXDA 4OGYA 4GCHG 3OYPA 3BTWE 1GBBA 3MO6A 3TNTA 4A7IB 8ESTE 1VJ9U 4X2WA 1O33A 1O3HA 4JK6A 1GBFA 2H5CA 4RSPA 1DT2A 1O3PB 4X1SU 1M9UA 2C8YB 2ZQ1A 1OWHA 3RXMA 1LHCH 1BOQA 1EQ9A 1N8OC 2AEIH 1BMMH 1EZUC 1MU8B 2OUAA 1DICA 3GY4A 4XE4A 4CH8B 1F92A 4SGAE 3RXIA 5GPIB 4K8BA 4UONA 1SR5C 2TGDA 3F6UH 1WQVH 2FTLE 2VNTA 1YPEH 1W12U 3OSYA 1HUTH 1DXPA 1T4VH 1FQ3A 3VB6A 2A4QA 3M37A 3QUMP 3SV8A 1F2SE 2GMTC 1N8OB 1SL3A 4ABHA 2FOHA 5ESBA 1CA0C 1F7ZA 4UFDH 1GGDC 3A84A 3NCLA 1E0FD 2ZO3H 4YLUA 1K1OA 2QXJA 1NFYA 3I29A 3GDSA 1K1IA 2VINA 5T6FA 3SW2B 4F49A 4AG2A 5LH8A 3O8BA 4I33A 3JZ2B 1LVOA 2SNWA 2XW9A 2G52A 2BDAA 5CMXH 2BD8A 2LNCA 1U6QA 1GJDB 1LPZB 4FUDA 1O37A 3L33A 4HTCH 2J38A 3DD2H 1OP8A 2BDGA 2PUXB 2TGPZ 1HPGA 5A09A 3SJKA 1XUFA 1ELTA 4WWYA 3ATMA 3H7TA 1V2QT 1V2WT 4OS1A 1E35B 2FI4E 3PWBA 5E0HA 4DG4A 2SGEE 1GMDF 2CF8H 1ANEA 1PPZA 5DP6A 1KLIH 3ATWA 1EXFA 4AORA 1C5VA 2WPKS 1O36A 1MTWA 4WVPE 1C2IA 1GVZA 3RXGA 1ZHMA 1TGCA 3GCNA 4LZ4B 1Z6JH 1EAXA 1XMNB 3BTHE 3A8AA 1O2JA 3P6ZB 2P8OC 2A45B 1JBUH 1MCTA 1TMBH 2NU3E 1FY4A 4X0WU 1EZSC 1QFKH 1EJAA 3RLYH 4CRFA 1C1RA 1NN6A 3EGKH 1NFXA 5EQRA 2VWOA 3SV2H 2NWNA 1K1PA 1GHXH 1HAVA 3HATH 2HPQH 3A89A 4CRCA 1GDUA 2F91A 4U2WA 4WY3A 1C1NA 3V3MA 3UY9A 1C4Y2 1G32B 1V2MT 3P95A 1RGQA 3PMHB 3LGYA 3MU4A 5E0GA 2P8OB 1TQ0B 1UVOA 1GDQA 3T29A 1GI0A 2H2ZA 3UNQA 1AWHB 2P59A 1FZZA 4Q7XA 4BAKB 2BVXH 1YM0A 5FX6A 4OGXA 4DIHH 4SGBE 2FOAA 5AF9H 1QB9A 1FY3A 4NGAH 1SPJA 1GHAG 2AYWA 4NIVA 1L1JA 4JZDH 1SGIB 2ZDNA 1DSTA 4CREA 4A92A 3BTME 2HVXA 1YGCH 1O3OA 2XWAA 4NG9H 5HYOA 4YTAA 1BA8B 4X2XA 4KKDA 2ZFFH 5EQSA 4A6LA 1CBWB 3EYDA 3B8JA 3M35A 4NIXA 3F9HA 1SGQE 1O0DH 1O2VA 5CHAC 2A31A 1O5EH 2GZ9A 2R9PA 1T8LA 3EAJA 1D3QB 1GHVH 4IW4E 1TOMH 1SGRE 5HGGA 3U1JB 1Y3WA 1UTMA 1XUIA 2BOKA 1GDNA 2BZAA 3EA9A 1PPBH 4X6MA 4UFFH 3K2UA 1ELGA 1YPKH 3MFJA 1IQIA 1WCZA 4ZH8A 2ZPRA 4AZ2B 5F8XA 2I6SA 3P8NA 1Z8GA 2I6QA 5FCRA 2BQ6B 3QZQA 1YLDA 3RUOA 1QBNA 1BBRK 2PSXA 3E91A 2AIPA 1YYY1 5DP3A 2QY0B 1UVTH 1DITH 1QIXB 3F1SB 4CRAA 1Q2WA 1GMCG 1P9UA 3SQEE 2AMDA 2BLOA 2FEQH 1OXGA 3RXHA 5B6OA 2WUCA 1AKSB 1O2HA 1PQ8A 1SGEE 2BLWA 4MNVA 1AFEH 1DANH 4MPVA 3A85A 1A0HB 1AY6H 1Z71A 1ANCA 2O8LA 1GHYH 1MAYA 2VIDA 1YPMH 4D9QA 3E90B 2A4GA 3QO6A 4U01A 3PYHA 4LXBH 2A7CA 5J4SA 5A8YA 2FPZA 2ZEBA 3AW1A 6CHAB 2P94A 2PWXA 4WMEA 1WAYB 5DGJA 3S7KB 2ZC9H 4K8YA 1QA7A 1EJNA 1FY1A 1TGSZ 3RU4E 1SLVB 2PR3A 5HM9A 5JB9S 5L30H 1L1NA 3SORA 3TU7H 3A80A 1ELFA 1ZRKA 4LK4A 3UWIA 4AFSA 1PPHE 3S9CA 1FY5A 1EKBB 1J8AA 4X2YA 3RXTA 3TK9A 4ABAA 1A0JA 2F9BH 1NPMA 2BDHA 1MCVA 4LZ1H 2C93B 4NZQA 5FPSA 2V6NA 1NM6A 2GP9B 3EA8A 1AO5A 4CHAC 4OS4A 3LGWA 1YPHC 1UVUH 2BY6X 1SLUB 1O3FA 2WPMS 1SVPA 4NFFA 3ZVFA 4X8VH 3UOUA 4XBDA 4DURA 1QR3E 1TNJA 3TIUA 1OYTH 1THRH 4LOYH 1SQAA 3SNAA 3SO3A 1YCPK 3JZ1B 1WBGB 1NRNH 3PROA 1TA6A 4FVBA 2ZHQH 2ZP0H 3UR6A 1GWAA 1QA0A 1O2PA 2ODYB 3ELAH 1C1MA 2XTTB 1B7XB 1ETSH 9ESTA 2F9OA 7GCHF 3FZZA 4CHAB 3B9FH 1UCYK 1C1WH 3S69A 4AB8A 4NA9H 1GJ7B 1EAIA 5LGOA 3A8BA 3OU0A 4KTUA 2SGFE 1P2MA 3A83A 2ZFRH 2W7SA 3EQ0H 1G2MA 4J2YB 3MNXA 2RA3A 3N7OA 1N1LA 1C5WB 3HPTB 1O3CA 3ZZ8A 4ZHAA 2NU2E 1F5RA 1DUAA 1ORFA 1RD3B 1LMWB 2PKSC 4X6NA 1P2JA 1C2EA 1O2RA 1DX5M 1CGIE 4D7GA 2ZDAH 1CHOF 2A4RA 1DY8A 1C5NH 1V2TT 3GCHC 5AFYH 4NZLA 1AD8H 2PGBB 1FV9A 2ZU3A 1E34B 1AVGH 1TPAE 4WH6A 4XSKU 5A0CA 1EOJA 1BQYA 1BDAA 1F0TA 4CBOA 2OINA 3L3TA 3SI3H 3LKWA 4KTCA 2ZIQH 1W7GH 3BEIB 2G00A 3GCOA 1CHGA 1AB9C 2GKVE 2QXGA 4R0IA 3ZZBA 1CGJE 2VIVA 3DT0H 2PKSB 1TAWA 3EA7A 1OYQA 2QAAA 2OC7A 1RS0A 2FLBH 2WV5A 1O39A 4WH8A 1MTVA 3GCHB 1UVPA 1GBTA 1V2PT 3SZNA 3FP8E 4X6OA 1ZHPA 3A7ZA 4ZXYH 1QURH 3NZIA 1TA2A 4GHQA 1O3JA 3VXEH 5JDUB 4K69A 1G36A 1OWJA 1KY9A 4D9RA 1ZPZA 3RLWH 4FU7A 3TK6A 2GCTC 1BJVA 2GCHG 3SHCH 4ZROA 1HAHH 2V3OH 2FP7B 2BZ6H 1A0LA 1TBRH 5GIBA 5GXPA 1HV7A 1Y3VA 2G5VA 3VB3A 4FUCA 3E0NB 1KIGH 3ZZ4A 2B7DH 4TWYA 3O8DA 3ODDA 1GI9B 3MU5A 5EXLA 1MTSA 2G51A 1QBOA 3SU5A 4Y71A 4DVAU 1GBCA 3BIVH 5CE1A 1F0SA 1SMFE 2ZECA 2UUJB 2W5EA 4O97A 1BRCE 3DHKH 2QF0A 1ELAA 1ELEE 2GCTB 1PYTD 1DM4B 2UWLA 1C4V2 1TOCB 1LVBA 2ZFPH 1UO6A 4XBBA 1L2EA 2FOFA 1RJXB 2AGGX 2HNTC 1YLCA 3AVZA 4X1PU 1WSSH 1NS3A 3QTOH 2ZU5A 1J9CH 3HKIB 2ANYA 1P11E 3KNXA 4FUGA 1NROH 2ALVA 2J94A 2Y7ZA 1LHGH 1O2YA 1VCWA 3MYWA 5JBTA 1UMAH 2KAIB 1TABE 4IMQA 2OQUA 1MU6B 1PPEE 2BD4A 3ITIA 9LPRA 2A2QH 3GDUA 2GDDA 4AYYB 2VVCA 3TH2H 1JRTA 5C67A 2BY7X 1O2IA 3A7YA 2OC0A 1P02A 1HXFH 2M5TA 1KTTB 1O2MA 4ISOA 3OX7U 1VITH 1LPGB 3DFJA 2FOBA 1P10A 1IQEA 2ODQA 3LU9B 1CT0E 1FNIA 1WOFA 1O5AB 4B76A 1O2QA 1G37A 1ZYOA 2BX4A 4IBLH 4BTIB 1AGJA 1FMGA 1O2TA 1LPKB 1W11U 1BTUA 1DFPA 2B0FA 1MQ5A 1C5ZB 1T31A 1O3BA 2H1UA 2FLRH 3ZV8A 2GVFA 1F0UA 1Y3YA 1O5BB 2TGTA 1P03A 3ZZ6A 1QJ6B 1O2KA 1S83A 4FUIA 3GY7A 2ZDKA 3A81A 3A86A 4YT6H 3SUFA 1GBEA 1TIOA 3VXFH 4GPGA 1IQJA 1QTFA 3R0FA 1GBHA 3BEFB 4R8TB 1TNLA 4YOJA 2OC8A 3U98H 3U8RH 1SOZA 1K1LA 1GHZA 4ISNA 3MWIU 6LPRA 1C2LA 1KTSB 4ISIH 4MVNA 3E8LA 4KP0A 1UTJA 3SU2A 1ANDA 3GY2A 1JRSA 4MNXA 2FXRA 3RXVA 1BB0B 2AS9A 4Y8YA 2J95A 2F9NA 1GVKB 3OTJE 3QLPH 4FUBA 3R3GB 4B1TA 5EOKA 1EATA 1S82A 1QB1A 1GJ9B 1L0ZA 1O5DH 3DA9B 2BD5A 2CXVA 3NK8A 1SQOA 4I31A 1LQEA 1AN1E 2FODA 1S5SA 4OS7A 4RKOB 1ZPCA 2ILNA 4YESB 3TLOA 1A61H 2A0QB 1HCGA 1CE5A 3RC5A 2GGVB 3GICB 3S9BA 3LDXH 1G9IE 4WXIA 1KXEA 1HAGE 2AIQA 3F9EA 1NU9A 5C5NA 8LPRA 1GBJA 4JYUH 1OWDA 1ZPBA 4AOQA 5T6DA 1WTGH 2O8WA 2ZDMA 1GBLA 2ZDVH 3MH7A 4RN6A 4B75A 4ABDA 3W94A 1NFUA 1XVOA 2FI3E 1HAYB 2D26C 3CP7A 4X1RU 1C9TA 4UD9H 1FIWA 5A2MH 4H42U 2XYAA 1GMDG 2FI5E 5EQQA 2ZFQH 1ELCA 2VVVA 3RC6A 1D3PB 3VB7A 1SLXB 1BJUA 2FS8A 3MHWU 4JZFH 1SC8U 3GISB 3T27A 4O9VA 3FANA 3BIUH 4Q80A 4CRDA 1A46H 1AE5A 1ZMJA 1RXPA 1C5OH 1IQKA 2GMTB 1NRRH 1MD8A 2TBSA 2Z9IA 4D76A 4JZ1A 1UHBA 4QT8C 1CA0B 1AUJA 4I8HA 1C2KA 1GGDB 2YNAA 2BLVA 2ZCKP 1C1OA 1VZQH 1NRQH 1MH0A 4DJZB 4A5TS 4X8TH 3AAVA 1K22H 2W3IA 3VPKA 2IN2A 4K5ZA 1F5LA 1XM1A 4K1SA 2PKAB 4Y0ZE 1H9IE 2J2UA 3KF2A 2PLXA 1TGBA 4GAWA 1DY9A 2BDBA 3V0XA 2YNBA 1O30A 1ETRH 2OCVB 1BCUH 3VFEA 2A1DB 1SGFA 4Y6DA 2ZPQA 2CMYA 1OWKA 2FO9A 3Q77A 2WINI 3HK3B 4JZIA 1AI8H 4X2VA 3S9AA 1AVWA 2DE9A 2A5IA 1EOLA 1CGHA 3EDXB 1G3CA 1XXDA 1GBKA 1EX3A 2UUKB 1MZAA 1GHBF 2A5KA 1TX6A 3GCTF 3K65B 1P3EA 4YO9A 3IG6B 3RM2H 2R2MB 1HNEE 1DUEA 4PROA 5A0AE 3CS7A 1BRBE 1A2CH 3SHAH 3ZZAA 5FX5A 4E06H 1N6XA 1NY22 3SJOA 1TRMA 3MU1A 2Z9JA 3D49H 1LQDB 3LGTA 2Z9KA 2VWMA 5JB8S 8GCHF 5TCAA 4DOQA 2V35A 3NWUA 3TGJE 1A7SA 2BY5X 1C1PA 3VEQB 4KELA 4B2AA 1DWDH 2GZ8A 2JKHA 1V2OT 1O2ZA 1ETTH 1EUFA 3BV9B 5FCKA 1K21H 5F03A 5EW1H 1FAKH 1ESTA 1HDTH 1YPJH 2ZFSA 3GOVB 5J4QA 1GBDA 4ZKNU 2QCYA 3MO3A 3I77A 3MNCA 4AGKA 1RFNA 1DXWA 1J17T 1P9SA 3RXUA 2WYGA 4INKA 3MI4A 2Y5GA 1QJ1B 4B2CA 2O9QA 3RC4A 2ZGXH 1HIAA 2FOMB 2JETC 3STJA 2ZFTA 2C8XB 1QRXA 2RDLA 4KTSA 1Y59T 2Z7FE 4CR5A 1GBMA 1MTNC 2XBVA 1C2MA 1TX7A 1AU8A 2ZG0H 4NIYA 3AASA 4FUFA 5CHAB 1IQFA 2UWOA 5L6NH 3FAOA 3PB1E 2PV9B 4AFUA 1DOJA 1SGPE 4RKJB 4TPIZ 3B23B 4U32A 1SI5H 4WMFA 5TCCA 2W3KA 3ZZ5A 1SB1H 3A7TA 1TPPA 2JETB 4MPXA 3M3TA 1E37B 1ZTKA 5E2OA 3V13A 4FVDA 3M7UA 2UWPA 3T5FH 1QNJA 2ZTXA 3G01A 3ATIA 1MTNB 2VH0A 2C8WB 1S81A 3RU4D 3T26A 2Z3EA 5C2ZA 2A5AA 2YOLA 3RXAA 5JBBS 2G81E 2STBE 3GY8A 3RXOA 5DG6A 4ZKSU 4ABJA 1AHTH 2VU8E 5JYIA 3QK1A 5C1YA 2SGQE 2VIOA 1BMNH 4INHA 1RIWC 1O5CB 4IC6A 2W26A 4GSOA 3A7WA 7GCHG 2P95A 2Z3CA 1E36B 2BXUH 1SHYA 4BTUB 1V2KT 1XXFA 1O2OA 3RXKA 4BAOB 3ENSB 2ODPA 1FLEE 2J92A 1QHRB 1RRKA 2BVSH 3UFAA 3Q76A 1CSOE 4JCNA 3BTKE 2HWLB 3U69H 5EU8A 2GX4A 2IPHA 4MDSA 4Y10E 1BRAA 5G4BA 1P05A 3MH5A 4CRBA 2WUBA 2H9TH 1XUGA 1K1JA 3RMNH 5SGAE 4GVUA 1BZXE 3HKJB 1CHOG 2Y7XA 3NUMA 3Q3KA 3QN7A 4DGJA 5IDKA 1GL0E 4OS2A 1WQSA 4YT7H 1MD7A 1YP9A 1O34A 1TRYA 2CHAC 1GI3A 2JH6D 1X7AC 4THNH 3ZZ3A 1LHFH 4IC5A 2FOCA 2VH6A 4XOJA 1ZSLA 3M5LA 2H6MA 1OOKB 1AQ7A 1JWTA 1XUJA 4UFGH 1W3CA 1W8BH 1GMHF 2Y82A 3LGVA 2JH0D 1O5FH 1SGFG 5DPAA 3S0NA 3O8RA 1OP2A 2VIQA 2A32A 3QZRA 4K1EA 4I8LA 3RXJA
chains in the Genus database with same CATH superfamily
4MLFB 2CGAA 1D6RA 2BD9A 1RTLA 1IQHA 5HXFA 3BG4C 2BQWB 3V12A 3P8FA 1OSSA 2BTCE 1T8OA 5A8XA 1B5GH 2AGIX 1C9PA 1F5KU 4Y79A 1KDQA 3A82A 3SNEA 4B71A 2ZTYA 3ZVCA 1FONA 4YOIA 1ZLRA 5BPEA 1GJ4H 5EJZA 1AZZA 3ZVGA 1V2RT 4P02A 3LH3A 2XCNA 1BIOA 1QB6A 3LPRA 1CT4E 2F9PA 1TMUH 1MMJN 3HGPA 3WW7A 4MNWA 1HFDA 2QIQA 3MO9A 2BX3A 5F8ZA 2CJIA 3MH4A 2WPHS 3PMJA 5JPMH 2Q1JA 1ZSJA 1CA8B 1ZGVA 1QJ7B 1OP0A 2K0QA 1ABIH 5GNDA 1OX1A 1O2XA 2OC1A 1BHXB 1OWEA 2BD3A 2QXIA 2M2AA 3ZZCA 2J9NA 1V2UT 2G8TA 1UHBB 4BNRA 1ZRBA 1UW7A 2VGCC 6GCHF 4O03A 1C1QA 1TNIA 1O2WA 1AB9B 1P2KA 3TK5A 4D8NA 1HAOH 4Q4LA 1VCQA 2P3UB 1VITF 2XNIA 5FPYA 3LJJA 3FP6E 1TFXA 2C4FH 2V0BA 1GI7B 1SBWA 4Y8ZA 2D1JA 3PV2A 3E16B 2Y5HA 1KYNA 4Q7YA 4CH2B 1O2NA 3BN9A 4Q7ZA 1MBMA 7ESTE 4NCYA 4A1TA 2GTBA 3TVJB 1AE8H 1FXYA 4FXGH 2WPIS 5IYTA 2WPLS 3U9AH 1VJAU 2ZI2H 1CU1A 5E2PA 2ZGJA 1HAXB 2ANKH 1TRNA 2XXLA 2ZHEH 2VGCB 3A87A 2XNDD 1IQGA 5L2ZH 2FYQA 3M5NA 3SJ8A 3EE0B 2TPIZ 5T3HA 4B6FA 1ACBE 4O3UA 1C1TA 1W10U 4YOGA 1TPSA 1O3MA 2FS9A 2ZWLH 1AFQC 1ZJKA 3PTBA 4IN1A 4JYTA 4Y76A 5I46H 2W6JD 2G5NA 2P16A 1UTOA 1GCTC 1IOEA 1HXEH 3W95A 1G3EA 2HPPH 1UK4A 3ESTA 2ZF0H 3QGNB 3GS9A 1EPTA 1JXPA 1HAVB 1A5HA 2A7JA 2A4OA 1FDPA 1H4WA 5T6GA 3MU8A 1T7CA 3Q3YA 1D3TB 3FP7E 4NA8A 4IGDA 3SBKA 1AZ8A 1KLJH 3A8CA 1PPFE 3RMOH 1CQQA 3TJOA 1AUTC 4TY7A 3LONA 4MPUA 1MTUA 4NWKA 4IS5A 3RXPA 1EFRD 1HAIH 1EB1H 4H6SB 1FPCH 1GCTB 1S6FA 3ZYEA 2RG3A 1BMLA 2EA3A 2SNVA 1MKXH 1TQ7B 2ZHFH 3ZZDA 4BTTB 4CBNA 1TNHA 1V3XA 2ZGBH 1GJBB 1OHHD 3UWJH 2BB4A 2EI7A 1D3DB 4AYVB 2C3SA 3GYMA 1Z7KA 2BY8X 4MTBA 3QTVH 1Z6EA 2FZZA 1Y5BT 1G2LA 2VIWA 3KEEA 4E7RG 1GG6C 3BTDE 1O3KA 1TGTA 1UTQA 2V7QD 1ID5H 1W2KH 4K60A 2ZCLP 2B8OH 5FAHA 2P93A 1DE7H 3O8CA 1ZTLA 4MQAA 1EJMA 4TWWA 5K7RA 3SU1A 4X1NU 1HBTH 1TNKA 4Z6AH 4CR9A 1WUNH 2FM2A 1TALA 4DY7B 1UTLM 1KLTA 1HIAB 3RXQA 3KQBA 2BXTH 2ZA5A 3SQHE 3ZZ9A 1LHDH 1D6WA 1QL8A 1UTNA 3TNSA 5EW2H 2SFAA 3SNBA 1FX0B 1PFXC 1WTHD 1Z8JB 1MKWH 4BOHA 2OP9A 3SN8A 2BDCA 2LPRA 5ETXA 3NXPA 2F9VA 2HGTH 1MQ6A 1OKXA 2FWWA 3A7VA 5EPNA 4XD7D 2HLCA 4GLYA 3UQOA 3SGAE 4TYDA 3RXFA 4TY6A 3LT3A 4WXVA 2OLGA 1CO7E 1P0SH 1GJAB 3M5MA 1O3IA 2TGAA 2SGDE 1PQ5A 3I78A 2EEKA 2PTCE 5ESTE 3F9FA 2K1QA 2AERH 1EP5A 1ABJH 1HGTH 3TH3H 1S0RA 1AIXH 1W13U 5FXLA 4Q2KA 1SSXA 1BBRE 1HJAC 5C1UA 4MNYA 5C3NA 5DK1A 4ABGA 4ISLA 1Y3UA 4WF8A 1NT1A 1FAXA 2VWLA 1EAWA 4Y7BA 2B5TB 4AG1A 2O8TA 1O2LA 1TBQH 2A2XH 1HJ9A 2TIOA 3UR9A 1YPHE 1TPOA 4NFEA 5DKMA 1GJ5H 4MG3A 2ZHWH 2FTMA 5EG4A 1D9IA 1B0FA 1PPGE 5FBIA 4Y8XA 1GHWH 3ZV9A 3PO1C 5DSFA 5FPTA 1B0EA 1HJAB 1J16A 3M3SA 3M36A 4ZHMU 3RM0H 4AX9H 1WYKA 1GJ8B 5LPFA 2Z6BD 2J5UA 2PHBA 4NSYA 5GCHF 3RXEA 3KQEA 3FN8A 2Y5FA 2ZU2A 2C90B 3SNCA 4HZHA 3UNRA 4GCHF 2XC4A 1O31A 3K6ZA 5JBCS 1TONA 4HG6A 5K0HA 4JZEH 2J98A 3C27B 2ZGHA 3UUZA 1O38A 1SGTA 1DWCH 2NU1E 1V2VT 4WMDA 1TLDA 4AFZA 2VJ1A 3PO1B 2ZPSA 1LKBA 1HB0B 3FKSD 4I32A 2GZ7A 2J34A 3BTQE 4OS6A 4DIIH 1QL7A 4AGJA 2HALA 1YKTA 3QWCH 4WJG2 1HAPH 1SGCA 4ACAA 4HI3A 3URCA 3DFLA 3K6YA 3T28A 2F43B 3E0PB 2ZTZA 3AAUA 1O3DA 2D8WA 1GHBG 3K9XB 2ULLA 1GI6A 2QF4A 3GCTG 3QDZB 2B9LA 1GI4A 2ZU4A 3DSPA 3LGUA 4A1XA 1NRSH 2CN0H 1S6LA 3L6PA 1C5YB 5EJ1A 1K0HA 2PGQB 3RXDA 4ISHH 1FIZA 1THSH 1BRUP 1RTFB 1Z8RA 1DPOA 3ZIAD 1NFWA 1GBIA 2DE8A 1UK2A 1KDQB 3T2NA 1Y3XA 1QRWA 2NU0E 1UCYE 3PLBA 1O3NA 4DW2U 2BVRH 2Q6DA 2D2DA 1YCPM 2NU4E 2XRCA 3S7HB 3SI4H 3STIA 3F9GA 4K1TA 5DP9A 3ZZ7A 5L2YH 8GCHG 1SGNE 1W0YH 3PV4A 3FVFB 1JIRA 1P2QA 2XCFA 7LPRA 4ABIA 4YM9A 2FDAA 1S85A 3WY8A 4X8SH 5FL7D 1FN8A 1ELBA 3ATKA 3LOXA 3MNBA 1J14A 3RXRA 3E1XB 3BTEE 5GDSH 1QQUA 3ZVAA 1Y5AT 1P2OA 1PYTC 3M3VA 5A8ZA 2FYRA 2EC9H 1P04A 2HOBA 3RDZA 4FUEA 2P3TB 2GD4B 1BTWA 1E38B 3P8OA 2UUYA 4A1VA 1HJ8A 2FESH 3M61U 4BXWA 1C2FA 3RXSA 1WXRA 3M5OA 1SFIA 1EP6A 1DS2E 3PV5A 4IN2A 4E05H 4RT0A 1CBWC 1TNGA 3U8OH 2KAIA 2ZZUH 3SV9A 1EPTC 1SLWB 3UREA 1NC6A 4RT1A 4AC9A 4J1YA 2KCPA 1DLEA 4ZKOU 4XDEA 2R2WU 4HFPB 2C8ZB 5EODA 5A0BA 1QGFA 1C5RA 2ANWA 5C1XA 3PMAB 2OD3B 2FMJA 2OBOA 3RMMH 3MH6A 2SGPE 2HNTE 3LH1A 1C5MD 1MUEB 3A8DA 4BANB 5H4IB 3TGKE 3PLPA 1HRTH 3RMLH 1LVMA 2Q6FA 5AFZH 1GI5A 2FX6A 5E8EH 4BAQB 3T25A 1G3DA 2ZQ2A 1O3EA 3MU0A 3IITA 5DO4H 1EPTB 1LCYA 1V2JT 1EB2A 1TYNA 1O3LA 4YLQH 4AB9A 1C4U2 3KHVA 1S84A 3QX5H 1A3EH 2STAE 1P09A 3IWMA 2QC2A 4O3TA 3MMGA 4Y11E 2F3CE 1TMTH 1PQ7A 1ZR0A 1C5LH 4XFQA 1OS8A 2R0LA 4ASHA 2ANMH 1SHHB 1ZMLA 4X6PA 3E6PH 3QGJA 3RXBA 1GHAF 1UTPA 3TH4H 1G3BA 1PJPA 2G55A 1NRPH 1VR1H 1JIMA 2BM2A 3ATLA 3C1KA 3OY6U 6CHAC 4DCDA 5EXNA 1C2HA 2GDEH 5ABWA 1O2SA 5CDFE 1C1UH 4XBCA 3UTUH 3PLKA 2R3YA 2CF9H 3FZDA 1O2GH 3UOPA 3ZVEA 3SJ9A 2QGRA 3GDVA 3VGCC 1LKAA 1XUHA 3TITA 3UIRA 4ABFA 1HAZB 1YPGH 4ZXXH 2VB0A 1INCA 1C5TA 4BAHB 2JH5D 1SGYE 1TWXB 1MZDA 4NIWA 1BTYA 1DLKB 1XVMA 1SFQB 4FU8A 5I25A 1ZOMA 5AVDA 1S6HA 2TRMA 3FO8D 2XC5A 4F4OC 1K9OE 3T62A 1VCPA 2XBWA 4UFEH 4ZUHA 3Q00A 3TPIZ 5LPEA 1O2UA 4ZKRU 3LC3A 2WPJS 3E3TA 1YY3A 3U1IB 1SQTA 1GMCF 4FU9A 1CVWH 3VGCB 2WPDD 3H7OA 3SJIA 1BTHH 2KCAA 1W0ZU 2G4UA 2Y81A 1IHTH 3SV7A 1P06A 4INLA 4U30A 2QYIA 1DSUA 1GMHG 3AW0A 1IQMA 2EI6A 4B2BA 4CRGA 5FBEA 3RXLA 4ABEA 3WWFA 3P92A 5C20A 2O8UA 1RIWB 3H5CB 1QBVH 1T4UH 3D62A 2AH4X 1TX8A 2A7HA 1YC0A 1EASA 1LTOA 3KN2A 2RCEA 4KGAA 2H9HA 3UAIC 2BQ7B 4I8KA 1ELDE 1D4PB 1IQNA 1V6DA 1O32A 5AHGH 3VB5A 1BMAA 1Q31A 3H09A 1EZXC 1BTZA 2Y6TA 2J4IA 2WV4A 1T8NA 1QY6A 2BD2A 2YMSD 1CT2E 2Y80A 3RU4T 4UE7H 2ZKSA 4B74A 1YF4A 1BTXA 3SU0A 3M7TA 3NKKA 1IAUA 3GYLB 4BAMB 3F2HA 1THPB 1HLTH 1O3GA 1UTKA 2BDIA 3LC5A 1MABB 1QL9A 2XBYA 1EAUA 2ZHDA 3ZVBA 4JK5A 3FFGA 2PW8H 1BTPA 4E7NA 1O5GH 1A3BH 5F53A 2QXHA 1V2NT 2ZU1A 3BTFE 2XBXA 5HM2A 1C5QA 1AMHA 1VGCC 2Z94A 4Y0YE 1C5UA 1OWIA 2CHAB 2G4TA 2WYJA 4TPYA 1QCPA 1WU1A 1ZTJA 2V3HH 1KXBA 2FX4A 7KMEH 4Z0KA 1C1SA 1BBRH 1BHXF 2BHGA 4ABBA 1UVSH 2AGEX 3BTTE 3TJVA 3CNRA 6GCHG 1KSNA 4ZHLU 1K1MA 2PKAA 1FUJA 3ODFA 1MKXK 1BT7A 1UK3A 1VITG 2JIZD 2R0KA 2RFKC 2XC0A 1ZHRA 1O3AA 4NWLA 4OS5A 1V2ST 3ZYDA 2ALPA 2AMPA 3LGIA 3D23A 4FUHA 1TB6H 1IHSH 1MAXA 1Q3XA 1G30B 3GY5A 1VGCB 1WV7H 3BG4B 1Z1JA 1W7XH 1HYLA 2PFEA 1AVXA 2GT8A 3P70B 2QA9E 3CS0A 2QV1A 4F55A 4I8JA 3V7TA 3TGIE 1GCDA 1P2NA 1GJ6A 1A4WH 2J98B 1FN6A 1K28D 2GT7A 1SGDE 2W7UA 1KXAA 4NSVA 2XWBI 2ESTE 3BEUA 1ZSKA 3LJOA 3GY3A 4GHTA 1H8DH 3SU4A 1K1NA 2FIRH 1ZGIA 1N6YA 4MPWA 3U8TH 5EPYA 2OBQA 1T8MA 3Q3XA 2RA0A 3KIDU 3MTYA 1GVLA 1PQAA 1GI8B 3PWCA 4K3JA 3URDA 1H9HE 4ZAEA 5HMAA 1C5PA 4JMYA 5C5OA 5TJXA 2BD7A 2SGAA 1FJSA 5EGMA 1MKWK 4BXSA 3SU6A 2ZGCA 3BF6H 2EI8A 5DP4A 5F8TA 1P2IA 2P3FH 3SOSA 3OY5U 2BY9X 5JBAS 1NZQH 1ARCA 1P3CA 1FI8A 1TGNA 1W14U 1XX9A 1DDJA 1SOTA 1NESE 3P8GA 2HNTF 4H4FA 2ZNKH 1LDTT 6ESTA 1H8HD 3CENA 1YCPH 3GY6A 2FOGA 3M7QA 2GV6A 3SUDA 3TJNA 2H9EH 4I8GA 2IOTA 1A5IA 4JYVH 1FY8E 1NO9H 3SUGA 3MOCA 5GJ4B 1C1VH 4XRNA 3UQVA 1C5SA 1UCYH 3TJUA 1ELVA 2ASUB 1DVAH 2GCHF 2Z3DA 4HGCA 1C2JA 1L1GA 1L4DA 1XKBC 1DWEH 3UPEA 5DP8A 2BYAX 5DP5A 2H5DA 1SG8B 2KCOA 2UUFB 3F0PA 2BMGB 1P57B 5LPRA 3PTNA 1FPHH 1LVYA 1NU7B 1AFQB 1TBZH 2R3UA 4ZMAH 4Y7AA 3PMBB 3F2FA 1MBQA 1Z8IB 1P01A 3SU3A 2QF3A 1E79D 5E0JA 2O8MA 2OQ5A 1H1BA 1ZMNA 1ZZZA 1K2I1 4GUXA 1AKSA 1GBAA 2FOEA 5DP7A 2F9UA 2BOHB 4K2YA 2VWNA 2QN5T 1H9LB 1ZJDA 1AWFH 1S0QA 2THFB 3PM3A 1GJCB 3NPSA 5HIYA 1GL1A 2W6ID 3MNSA 4X1QU 1JOUB 1ARBA 4D7FA 3BTGE 3DUXH 2F83A 1KXCA 3LIWA 2OXSA 1ESBA 2ZDLA 4B73A 3A88A 1ANBA 1EZQA 5EXMA 1NTPA 3SGBE 5C17A 2KM0A 3KYFA 1C2GA 1YPLH 4M7GA 4I7YH 3ZVDA 1C2DA 5HIZA 2BLQA 1PPCE 2CK3D 2OTVA 8KME2 3F68H 1Z1IA 1P8VC 4H6TA 3BSQA 5F6MA 1ESAA 2Z9GA 1LO6A 5DJ7A 3UNSA 2PUQH 1YBWA 3D65E 1GG6B 1C5XB 1V2LT 1A1RA 1TE0A 4YZUA 4ESTE 2VVUA 3KL6A 2HRVA 4X8UH 1BUIA 2Z9LA 1GPZA 4VGCC 3SV6A 2K8IA 1UJ1A 2AFQB 4FUJA 1A5GH 1Y8TA 2DUCA 3KQCA 1T32A 3RXCA 4DT7B 5GWZA 4AFQA 1Y5UT 3VB4A 3KCGH 3P17H 2BDYA 2J97A 4NA7A 1O35A 2GV7A 5FHTA 1JMOH 5BRRE 2AMQA 1J15A 2VIPA 3SGQE 1F0RA 2L74A 2Q6GA 4UDWH 3SNDA 3KGPA 2PSYA 3HK6B 1LHEH 1GI1A 1QRZA 1OPHB 4AN7A 1QQ4A 1IQLA 3SUEA 1P12E 1H8IH 1BITA 5C0UA 1XKAC 3HGNA 1L4ZA 2PTNA 2CV3A 4VGCB 3KQDA 3A7XA 1DWBH 1GI2A 3RP2A 4IMZA 5HKKD 1RTKA 3BG8A 4UEHH 5GCHG 5PTPA 1XUKA 2IJOB 1KXFA 2ZCHP 1KXDA 4OGYA 3OEHD 4GCHG 3OYPA 1H8ED 3BTWE 1GBBA 3MO6A 3TNTA 4A7IB 8ESTE 1VJ9U 4X2WA 1O33A 2GJGA 1O3HA 4JK6A 1GBFA 2H5CA 2EQNA 4RSPA 1DT2A 1O3PB 4X1SU 1M9UA 2C8YB 2ZQ1A 1OWHA 3DSOA 3RXMA 1LHCH 1BOQA 1EQ9A 1N8OC 2AEIH 1BMMH 1EZUC 1MU8B 2OUAA 1DICA 3GY4A 4XE4A 4CH8B 2YMSC 1F92A 4SGAE 3RXIA 5GPIB 4K8BA 4UONA 1SR5C 2TGDA 3F6UH 1WQVH 2FTLE 2VNTA 1YPEH 3U28C 1QZ8A 1W12U 3OSYA 1HUTH 1DXPA 1T4VH 4OM9A 1FQ3A 3VB6A 2A4QA 3M37A 3QUMP 3AK5A 3SV8A 1F2SE 2GMTC 1N8OB 1SL3A 4ABHA 2FOHA 5ESBA 1CA0C 1F7ZA 4UFDH 1GGDC 3A84A 3NCLA 1E0FD 2ZO3H 2LELA 4YLUA 1K1OA 2QXJA 1NFYA 3I29A 3GDSA 1K1IA 2VINA 5T6FA 3SW2B 4F49A 4AG2A 5LH8A 3O8BA 4I33A 3JZ2B 1LVOA 2SNWA 2XW9A 2G52A 2BDAA 5CMXH 2BD8A 2LNCA 1U6QA 1GJDB 1LPZB 4FUDA 1O37A 3L33A 4HTCH 2J38A 3DD2H 1OP8A 2BDGA 2PUXB 2TGPZ 1HPGA 5A09A 3SJKA 1XUFA 1ELTA 4WWYA 3ATMA 3H7TA 1V2QT 1V2WT 4OS1A 1E35B 2FI4E 3PWBA 5E0HA 4DG4A 2SGEE 1GMDF 2CF8H 1ANEA 1PPZA 5DP6A 1KLIH 3ATWA 1EXFA 4AORA 1C5VA 1NBMD 2WPKS 1O36A 1MTWA 4WVPE 1NBME 1C2IA 1GVZA 1COWD 3RXGA 1ZHMA 1TGCA 2XOKD 3GCNA 4LZ4B 1Z6JH 1EAXA 1XMNB 3BTHE 3A8AA 1O2JA 3P6ZB 3N99A 2P8OC 2A45B 1JBUH 1MCTA 1TMBH 2NU3E 1FY4A 4X0WU 1EZSC 1QFKH 1EJAA 3RLYH 4CRFA 1C1RA 1NN6A 3EGKH 1NFXA 5EQRA 2VWOA 3SV2H 2NWNA 1K1PA 1GHXH 1HAVA 3HATH 2HPQH 3A89A 4CRCA 1GDUA 2F91A 2LP6A 4U2WA 4WY3A 1C1NA 3V3MA 3UY9A 1C4Y2 1G32B 1V2MT 3P95A 1RGQA 3PMHB 3LGYA 3MU4A 5E0GA 2P8OB 4FETA 1TQ0B 1UVOA 1GDQA 3T29A 1GI0A 2H2ZA 3UNQA 1AWHB 2P59A 3NRLA 1FZZA 4Q7XA 4BAKB 2BVXH 1YM0A 5FX6A 4OGXA 4DIHH 4SGBE 2FOAA 5AF9H 1QB9A 1FY3A 2KCYA 4NGAH 1SPJA 1GHAG 2AYWA 4NIVA 1L1JA 4JZDH 1SGIB 2ZDNA 1DSTA 4CREA 4A92A 3BTME 2HVXA 1YGCH 1O3OA 2XWAA 4NG9H 3KQ5A 1WDIA 5HYOA 4YTAA 4Z1MD 1BA8B 4X2XA 4KKDA 2ZFFH 5EQSA 4TT3D 5C94A 4A6LA 1CBWB 3EYDA 3B8JA 3M35A 4NIXA 3F9HA 1SGQE 1O0DH 1O2VA 5CHAC 2A31A 4B6EA 1O5EH 2GZ9A 2R9PA 1T8LA 3EAJA 1D3QB 1GHVH 4IW4E 1TOMH 1SGRE 5HGGA 3U1JB 1Y3WA 1E1RD 1UTMA 2BOKA 1XUIA 1GDNA 2BZAA 3EA9A 1PPBH 4X6MA 4UFFH 3K2UA 1ELGA 1YPKH 3MFJA 1IQIA 1WCZA 4ZH8A 2ZPRA 4AZ2B 5F8XA 2I6SA 3P8NA 1Z8GA 2I6QA 5FCRA 2BQ6B 3QZQA 1YLDA 3RUOA 1QBNA 1BBRK 2PSXA 3UB0A 3E91A 2AIPA 1YYY1 5DP3A 2QY0B 1UVTH 1DITH 1QIXB 3F1SB 2F4LA 1Q2WA 4CRAA 1GMCG 1P9UA 3SQEE 2AMDA 2BLOA 2FEQH 1OXGA 3RXHA 5B6OA 2WUCA 1AKSB 1O2HA 1PQ8A 1SGEE 2BLWA 4MNVA 3DCLA 1AFEH 1DANH 4MPVA 3A85A 1A0HB 1AY6H 1Z71A 1ANCA 2O8LA 1GHYH 1MAYA 2VIDA 1YPMH 4D9QA 3E90B 2A4GA 3QO6A 4U01A 3PYHA 4LXBH 2A7CA 5J4SA 5A8YA 2FPZA 3N7EA 2ZEBA 3AW1A 6CHAB 2P94A 2PWXA 4WMEA 1WAYB 5DGJA 3S7KB 2ZC9H 4K8YA 1QA7A 1EJNA 1FY1A 3OE7D 1TGSZ 3RU4E 1SLVB 2PR3A 2VBCA 5HM9A 5JB9S 5L30H 1L1NA 3SORA 3TU7H 3A80A 1ELFA 1ZRKA 4LK4A 3UWIA 4AFSA 1PPHE 3S9CA 1FY5A 1EKBB 1J8AA 4X2YA 3RXTA 3TK9A 4ABAA 1A0JA 2F9BH 1NPMA 2BDHA 1MCVA 4LZ1H 2IJD1 2C93B 4NZQA 5FPSA 2V6NA 1NM6A 2GP9B 3EA8A 1AO5A 4CHAC 4OS4A 3LGWA 1YPHC 1UVUH 2BY6X 1SLUB 1O3FA 2WPMS 1SVPA 4NFFA 3ZVFA 4X8VH 3UOUA 4XBDA 4DURA 1QR3E 1TNJA 3TIUA 1OYTH 1THRH 4LOYH 3PRDA 1SQAA 3SNAA 3SO3A 1YCPK 3JZ1B 1WBGB 1NRNH 3PROA 1TA6A 4FVBA 2ZHQH 2ZP0H 3UR6A 1GWAA 1QA0A 1O2PA 2ODYB 3ELAH 1C1MA 2XTTB 1B7XB 1ETSH 9ESTA 2F9OA 7GCHF 3FZZA 4CHAB 3B9FH 1BMFD 1UCYK 1C1WH 3S69A 4AB8A 4NA9H 1GJ7B 1EAIA 5LGOA 3A8BA 3OU0A 4KTUA 2SGFE 5B6LA 1P2MA 3A83A 4ZCNA 2ZFRH 2W7SA 3EQ0H 1G2MA 4J2YB 3MNXA 2RA3A 3N7OA 1N1LA 1C5WB 3HPTB 1O3CA 3ZZ8A 4ZHAA 2NU2E 1F5RA 1DUAA 1ORFA 1RD3B 1LMWB 2PKSC 4X6NA 1P2JA 3WWBA 1C2EA 1O2RA 1DX5M 1CGIE 4D7GA 2ZDAH 1CHOF 2A4RA 1DY8A 1C5NH 1V2TT 3GCHC 5AFYH 4NZLA 1AD8H 2PGBB 1FV9A 2ZU3A 1E34B 2QE7D 1AVGH 1TPAE 4WH6A 4XSKU 5A0CA 1EOJA 1BQYA 1BDAA 2PP6A 1F0TA 4CBOA 2OINA 3L3TA 3SI3H 3LKWA 4KTCA 2ZIQH 1W7GH 3BEIB 2G00A 3GCOA 1CHGA 1AB9C 2GKVE 2QXGA 4R0IA 3ZZBA 1CGJE 2VIVA 3DT0H 2PKSB 1TAWA 3EA7A 1OYQA 2QAAA 2OC7A 1RS0A 2FLBH 2WV5A 1O39A 4WH8A 4F48B 1MTVA 3GCHB 1UVPA 1GBTA 1V2PT 3SZNA 3FP8E 4X6OA 1ZHPA 3A7ZA 4ZXYH 1QURH 3NZIA 1TA2A 2KX4A 4GHQA 1O3JA 3VXEH 5JDUB 4K69A 1G36A 1OWJA 1KY9A 4D9RA 1YWUA 1ZPZA 3RLWH 4FU7A 3TK6A 2GCTC 1BJVA 2GCHG 3SHCH 4ZROA 1HAHH 2V3OH 2FP7B 2BZ6H 1A0LA 1TBRH 5GIBA 5GXPA 1HV7A 1Y3VA 2G5VA 3VB3A 4FUCA 3E0NB 1KIGH 3ZZ4A 2B7DH 4TWYA 3O8DA 3ODDA 1GI9B 2WHXA 3MU5A 5EXLA 1MTSA 2G51A 1QBOA 3SU5A 4Y71A 4DVAU 1GBCA 3BIVH 5CE1A 1F0SA 1SMFE 2ZECA 2UUJB 2W5EA 4O97A 1BRCE 3DHKH 2QF0A 1ELAA 1ELEE 2GCTB 1PYTD 1DM4B 2UWLA 1C4V2 1TOCB 1LVBA 2ZFPH 1UO6A 4XBBA 1L2EA 2FOFA 3SZEA 1RJXB 2AGGX 2HNTC 1YLCA 3AVZA 4X1PU 1WSSH 1NS3A 3QTOH 2ZU5A 1J9CH 3HKIB 2ANYA 1P11E 3KNXA 4FUGA 1NROH 2ALVA 2J94A 2Y7ZA 1LHGH 3KYGA 1O2YA 1VCWA 3OTPA 3MYWA 5JBTA 1UMAH 2KAIB 1TABE 4IMQA 5DN6D 1MU6B 2OQUA 1PPEE 2BD4A 3ITIA 1YLNA 3OEED 9LPRA 4ASUD 2A2QH 3GDUA 2GDDA 4AYYB 2VVCA 3TH2H 1JRTA 2OK5A 5C67A 2BY7X 1O2IA 3A7YA 2OC0A 1P02A 1HXFH 2M5TA 4TSFD 1KTTB 1O2MA 4ISOA 3OX7U 1VITH 1LPGB 3DFJA 2FOBA 1P10A 1IQEA 2ODQA 3LU9B 1CT0E 1FNIA 1WOFA 1O5AB 4B76A 1O2QA 1G37A 1ZYOA 2BX4A 4IBLH 4FOUC 4BTIB 1AGJA 1FMGA 1O2TA 1LPKB 1W11U 1BTUA 1DFPA 2B0FA 1MQ5A 1C5ZB 1T31A 1O3BA 2H1UA 2FLRH 3ZV8A 2GVFA 1F0UA 1Y3YA 1O5BB 2TGTA 1P03A 1W0KD 3OAAD 1QJ6B 3ZZ6A 2KR7A 1O2KA 1S83A 4FUIA 3GY7A 2ZDKA 3A81A 3A86A 3F0OA 4YT6H 3SUFA 1GBEA 1TIOA 3VXFH 4GPGA 1IQJA 1QTFA 3R0FA 1GBHA 3BEFB 4R8TB 1TNLA 4YOJA 2AHME 2OC8A 3U98H 3U8RH 1SOZA 1SQRA 1K1LA 2JDID 1GHZA 4ISNA 3MWIU 6LPRA 1C2LA 1KTSB 4ISIH 4MVNA 3E8LA 4KP0A 1UTJA 3N7DA 5IK2D 3SU2A 1ANDA 3GY2A 1JRSA 4MNXA 2FXRA 3RXVA 1BB0B 2AS9A 4Y8YA 2J95A 2F9NA 1GVKB 3OTJE 3QLPH 4FUBA 3R3GB 4B1TA 5EOKA 1EATA 1S82A 1QB1A 1GJ9B 1L0ZA 1O5DH 3DA9B 2BD5A 2CXVA 3NK8A 1SQOA 4I31A 1LQEA 1AN1E 2FODA 1S5SA 4OS7A 4RKOB 3PRBA 1ZPCA 2ILNA 4YESB 3TLOA 1A61H 2A0QB 1HCGA 1CE5A 3RC5A 2GGVB 3GICB 3S9BA 3LDXH 1G9IE 4WXIA 1KXEA 1HAGE 2AIQA 3OFND 3F9EA 1NU9A 5C5NA 8LPRA 1GBJA 4JYUH 1OWDA 1ZPBA 4AOQA 5T6DA 1WTGH 2O8WA 2ZDMA 1GBLA 2ZDVH 3MH7A 4RN6A 3SYJA 4B75A 4ABDA 3W94A 1NFUA 1XVOA 2FI3E 1HAYB 2D26C 3CP7A 4X1RU 1C9TA 4UD9H 1FIWA 5A2MH 4H42U 3DSGA 2XYAA 1GMDG 2FI5E 5EQQA 2YMSB 2WV9A 4M9FA 2ZFQH 1ELCA 2VVVA 3RC6A 1D3PB 3VB7A 1SLXB 1BJUA 2FS8A 3MHWU 4JZFH 1SC8U 3GISB 3T27A 4O9VA 3FANA 3BIUH 4Q80A 4CRDA 2WSSD 1A46H 1AE5A 1ZMJA 1RXPA 1C5OH 1W0JD 1IQKA 2GMTB 1NRRH 1MD8A 2TBSA 2Z9IA 4D76A 4JZ1A 1UHBA 3FOAA 4QT8C 1CA0B 3F2GA 1AUJA 4I8HA 1C2KA 1GGDB 1VKYA 2JJ2D 2YNAA 2BLVA 2ZCKP 1C1OA 4YXWD 1VZQH 1NRQH 3EE7A 5EJLA 1MH0A 4DJZB 4A5TS 4X8TH 3AAVA 1K22H 2W3IA 3VPKA 2IN2A 4P00A 4K5ZA 1F5LA 1XM1A 1E1QD 4K1SA 2PKAB 4Y0ZE 1H9IE 2J2UA 3KF2A 2HVYB 2PLXA 1TGBA 4GAWA 1DY9A 4I86A 2BDBA 3V0XA 2YNBA 1O30A 1ETRH 2OCVB 1BCUH 2EY4C 3VFEA 2A1DB 1SGFA 4Y6DA 2ZPQA 2WZQA 2CMYA 1OWKA 2FO9A 3Q77A 2WINI 3HK3B 4JZIA 1AI8H 4X2VA 3S9AA 1AVWA 2DE9A 2A5IA 1EOLA 1CGHA 3EDXB 1G3CA 1XXDA 1GBKA 1EX3A 2UUKB 1MZAA 1GHBF 2A5KA 1TX6A 2IPQX 3GCTF 3K65B 1P3EA 4YO9A 3IG6B 3RM2H 2R2MB 1HNEE 1DUEA 4PROA 5A0AE 3CS7A 2JJ1D 2HLDD 1BRBE 1A2CH 2KZ4A 3SHAH 3ZZAA 5FX5A 4E06H 1N6XA 1NY22 3SJOA 1TRMA 3MU1A 2Z9JA 4Q63A 3D49H 1LQDB 3LGTA 2Z9KA 2VWMA 5JB8S 8GCHF 5TCAA 4DOQA 2V35A 3NWUA 3TGJE 1A7SA 2BY5X 1C1PA 3VEQB 4KELA 4B2AA 1DWDH 2GZ8A 2JKHA 5KEDA 1V2OT 1O2ZA 1ETTH 1EUFA 3BV9B 5FCKA 2RDEA 5KGOA 5KECA 1K21H 5F03A 5EW1H 1FAKH 1ESTA 5EIYA 1HDTH 1YPJH 2ZFSA 3GOVB 4DT4A 5J4QA 1GBDA 2KFWA 4ZKNU 2QCYA 3MO3A 1SKYE 3I77A 3MNCA 1RFNA 4AGKA 1DXWA 1J17T 1P9SA 3RXUA 2WYGA 4INKA 3MI4A 2Y5GA 1QJ1B 4B2CA 2O9QA 3RC4A 2ZGXH 1HIAA 2FOMB 2JETC 3STJA 2ZFTA 2C8XB 1QRXA 2RDLA 4KTSA 1Y59T 2Z7FE 4CR5A 1GBMA 2QF5A 1MTNC 2XBVA 1C2MA 1TX7A 3F3BA 1AU8A 2ZG0H 4NIYA 3AASA 4FUFA 5CHAB 1IQFA 2UWOA 5L6NH 3FAOA 3PB1E 2PV9B 4AFUA 1DOJA 1SGPE 4RKJB 4TPIZ 3B23B 4ACBA 4U32A 1SI5H 4WMFA 5TCCA 2W3KA 3ZZ5A 1SB1H 3A7TA 1TPPA 2JETB 4MPXA 3M3TA 1E37B 1ZTKA 5E2OA 3V13A 4FVDA 3M7UA 2UWPA 3T5FH 1QNJA 2ZTXA 3G01A 3ATIA 5C0TA 1MTNB 2VH0A 2C8WB 1S81A 3RU4D 3T26A 2Z3EA 5C2ZA 2A5AA 2YOLA 3RXAA 5JBBS 2G81E 2STBE 3GY8A 3RXOA 5DG6A 4ZKSU 4ABJA 1AHTH 2VU8E 5JYIA 3QK1A 5C1YA 2SGQE 2VIOA 3VG8A 1BMNH 4INHA 1RIWC 1O5CB 4IC6A 2W26A 4GSOA 3A7WA 7GCHG 2P95A 2Z3CA 1E36B 2BXUH 1SHYA 4BTUB 1V2KT 1XXFA 1O2OA 3RXKA 4BAOB 3ENSB 2ODPA 1FLEE 2J92A 1QHRB 1RRKA 2BVSH 3UFAA 3Q76A 1CSOE 4JCNA 3BTKE 2HWLB 3U69H 5EU8A 2GX4A 3MQKC 1KMHB 2IPHA 4MDSA 4Y10E 1BRAA 5G4BA 5T1VA 1P05A 3MH5A 4CRBA 2WUBA 2H9TH 1XUGA 1K1JA 3RMNH 5SGAE 4GVUA 1BZXE 3HKJB 1CHOG 2Y7XA 3NUMA 3Q3KA 3QN7A 4DGJA 5IDKA 1GL0E 4OS2A 2V3MA 1WQSA 4YT7H 1MD7A 1YP9A 1O34A 1TRYA 2CHAC 3W1EA 1GI3A 2JH6D 1X7AC 4RI0A 4THNH 3ZZ3A 1LHFH 5CHBA 4IC5A 2FOCA 2L6OA 2VH6A 4XOJA 1ZSLA 3M5LA 2H6MA 1OOKB 1AQ7A 1JWTA 1XUJA 4UFGH 1W3CA 1W8BH 1GMHF 2Y82A 3LGVA 2JH0D 1O5FH 1SGFG 5DPAA 3S0NA 3O8RA 1OP2A 2VIQA 2A32A 3QZRA 4K1EA 4I8LA 3RXJA
chains in the Genus database with same CATH topology
4MLFB 2CGAA 1D6RA 2BD9A 1RTLA 1IQHA 5HXFA 3BG4C 2BQWB 3V12A 3P8FA 1OSSA 2BTCE 1T8OA 5A8XA 1B5GH 2AGIX 1C9PA 1F5KU 4Y79A 1KDQA 3A82A 3SNEA 4B71A 2ZTYA 3ZVCA 1FONA 4YOIA 1ZLRA 5BPEA 1GJ4H 1AZZA 3ZVGA 1V2RT 3LH3A 2XCNA 1BIOA 1QB6A 3LPRA 1CT4E 2F9PA 1TMUH 1MMJN 3HGPA 4MNWA 1HFDA 2QIQA 3MO9A 2BX3A 5F8ZA 2CJIA 3MH4A 2WPHS 3PMJA 5JPMH 2Q1JA 1ZSJA 1CA8B 1ZGVA 1QJ7B 1OP0A 1ABIH 1OX1A 1O2XA 2OC1A 1BHXB 1OWEA 2BD3A 2QXIA 3ZZCA 2J9NA 1V2UT 2G8TA 1UHBB 4BNRA 1ZRBA 2VGCC 6GCHF 4O03A 1C1QA 1TNIA 1O2WA 1AB9B 1P2KA 3TK5A 4D8NA 1HAOH 1VCQA 2P3UB 1VITF 2XNIA 5FPYA 3LJJA 3FP6E 1TFXA 2C4FH 2V0BA 1GI7B 1SBWA 4Y8ZA 2D1JA 3E16B 2Y5HA 1KYNA 4Q7YA 4CH2B 1O2NA 3BN9A 4Q7ZA 1MBMA 7ESTE 4NCYA 4A1TA 2GTBA 3TVJB 1AE8H 1FXYA 4FXGH 2WPIS 5IYTA 2WPLS 3U9AH 1VJAU 2ZI2H 1CU1A 5E2PA 2ZGJA 1HAXB 2ANKH 1TRNA 2XXLA 2ZHEH 2VGCB 3A87A 1IQGA 5L2ZH 2FYQA 3M5NA 3SJ8A 3EE0B 2TPIZ 5T3HA 1ACBE 4O3UA 1C1TA 1W10U 4YOGA 1TPSA 1O3MA 2FS9A 2ZWLH 1AFQC 1ZJKA 3PTBA 4IN1A 4JYTA 4Y76A 5I46H 2G5NA 2P16A 1UTOA 1GCTC 1IOEA 1HXEH 3W95A 1G3EA 2HPPH 1UK4A 3ESTA 2ZF0H 3QGNB 1EPTA 1JXPA 1HAVB 1A5HA 2A7JA 2A4OA 1FDPA 1H4WA 5T6GA 3MU8A 1T7CA 3Q3YA 1D3TB 3FP7E 4NA8A 4IGDA 3SBKA 1AZ8A 1KLJH 3A8CA 1PPFE 3RMOH 1CQQA 3TJOA 1AUTC 4TY7A 3LONA 4MPUA 1MTUA 4NWKA 4IS5A 3RXPA 1HAIH 1EB1H 4H6SB 1FPCH 1GCTB 1S6FA 3ZYEA 2RG3A 1BMLA 2EA3A 2SNVA 1MKXH 1TQ7B 2ZHFH 3ZZDA 4BTTB 4CBNA 1TNHA 1V3XA 2ZGBH 1GJBB 3UWJH 2BB4A 2EI7A 1D3DB 4AYVB 2C3SA 3GYMA 1Z7KA 2BY8X 4MTBA 3QTVH 1Z6EA 2FZZA 1Y5BT 1G2LA 2VIWA 3KEEA 4E7RG 1GG6C 3BTDE 1O3KA 1TGTA 1UTQA 1ID5H 1W2KH 4K60A 2ZCLP 2B8OH 5FAHA 2P93A 1DE7H 3O8CA 1ZTLA 4MQAA 1EJMA 4TWWA 5K7RA 3SU1A 4X1NU 1HBTH 1TNKA 4Z6AH 4CR9A 1WUNH 2FM2A 1TALA 4DY7B 1UTLM 1KLTA 1HIAB 3RXQA 3KQBA 2BXTH 2ZA5A 3SQHE 3ZZ9A 1LHDH 1D6WA 1QL8A 1UTNA 3TNSA 5EW2H 2SFAA 3SNBA 1PFXC 1WTHD 1Z8JB 1MKWH 4BOHA 2OP9A 3SN8A 2BDCA 2LPRA 5ETXA 3NXPA 2F9VA 2HGTH 1MQ6A 1OKXA 2FWWA 3A7VA 5EPNA 2HLCA 4GLYA 3UQOA 3SGAE 4TYDA 3RXFA 4TY6A 3LT3A 4WXVA 2OLGA 1CO7E 1P0SH 1GJAB 3M5MA 1O3IA 2TGAA 2SGDE 1PQ5A 3I78A 2EEKA 2PTCE 5ESTE 3F9FA 2K1QA 2AERH 1EP5A 1ABJH 1HGTH 3TH3H 1S0RA 1AIXH 1W13U 5FXLA 4Q2KA 1SSXA 1BBRE 1HJAC 5C1UA 4MNYA 5C3NA 5DK1A 4ABGA 4ISLA 1Y3UA 4WF8A 1NT1A 1FAXA 2VWLA 1EAWA 4Y7BA 2B5TB 4AG1A 2O8TA 1O2LA 1TBQH 2A2XH 1HJ9A 2TIOA 3UR9A 1YPHE 1TPOA 4NFEA 5DKMA 1GJ5H 4MG3A 2ZHWH 2FTMA 5EG4A 1D9IA 1B0FA 1PPGE 5FBIA 4Y8XA 1GHWH 3ZV9A 3PO1C 5FPTA 1B0EA 1HJAB 1J16A 3M3SA 3M36A 4ZHMU 3RM0H 4AX9H 1WYKA 1GJ8B 5LPFA 2Z6BD 2PHBA 4NSYA 5GCHF 3RXEA 3KQEA 2Y5FA 2ZU2A 2C90B 3SNCA 4HZHA 3UNRA 4GCHF 2XC4A 1O31A 3K6ZA 5JBCS 1TONA 5K0HA 4JZEH 3C27B 2ZGHA 3UUZA 1O38A 1SGTA 1DWCH 2NU1E 1V2VT 4WMDA 1TLDA 4AFZA 2VJ1A 3PO1B 2ZPSA 1LKBA 1HB0B 4I32A 4OS6A 2GZ7A 2J34A 3BTQE 4DIIH 1QL7A 4AGJA 2HALA 1YKTA 3QWCH 4WJG2 1HAPH 1SGCA 4HI3A 3URCA 3DFLA 3K6YA 3T28A 3E0PB 2ZTZA 3AAUA 1O3DA 2D8WA 1GHBG 3K9XB 2ULLA 1GI6A 3GCTG 3QDZB 2B9LA 1GI4A 2ZU4A 3LGUA 4A1XA 1NRSH 2CN0H 3L6PA 1C5YB 2PGQB 3RXDA 4ISHH 1FIZA 1THSH 1BRUP 1RTFB 1Z8RA 1DPOA 1NFWA 1GBIA 2DE8A 1UK2A 1KDQB 3T2NA 1Y3XA 1QRWA 2NU0E 1UCYE 3PLBA 1O3NA 4DW2U 2BVRH 2Q6DA 2D2DA 1YCPM 2NU4E 2XRCA 3S7HB 3SI4H 3STIA 3F9GA 4K1TA 5DP9A 3ZZ7A 5L2YH 8GCHG 1SGNE 1W0YH 3PV4A 3FVFB 1JIRA 1P2QA 2XCFA 7LPRA 4ABIA 4YM9A 2FDAA 1S85A 3WY8A 4X8SH 1FN8A 1ELBA 3ATKA 3LOXA 3MNBA 1J14A 3RXRA 3E1XB 3BTEE 5GDSH 1QQUA 3ZVAA 1Y5AT 1P2OA 1PYTC 3M3VA 5A8ZA 2FYRA 2EC9H 1P04A 2HOBA 3RDZA 4FUEA 2P3TB 2GD4B 1BTWA 1E38B 3P8OA 2UUYA 4A1VA 1HJ8A 2FESH 3M61U 4BXWA 1C2FA 3RXSA 3M5OA 1SFIA 1EP6A 1DS2E 4IN2A 4E05H 1CBWC 1TNGA 3U8OH 2KAIA 2ZZUH 3SV9A 1EPTC 1SLWB 3UREA 1NC6A 4J1YA 1DLEA 4ZKOU 4XDEA 2R2WU 4HFPB 2C8ZB 5EODA 5A0BA 1QGFA 1C5RA 2ANWA 5C1XA 3PMAB 2OD3B 2FMJA 2OBOA 3RMMH 3MH6A 2SGPE 2HNTE 3LH1A 1C5MD 1MUEB 3A8DA 4BANB 5H4IB 3TGKE 3PLPA 1HRTH 3RMLH 1LVMA 2Q6FA 5AFZH 1GI5A 2FX6A 5E8EH 4BAQB 3T25A 1G3DA 2ZQ2A 1O3EA 3MU0A 3IITA 5DO4H 1EPTB 1LCYA 1V2JT 1EB2A 1TYNA 1O3LA 4YLQH 4AB9A 1C4U2 3KHVA 1S84A 3QX5H 1A3EH 2STAE 1P09A 3IWMA 2QC2A 4O3TA 3MMGA 4Y11E 2F3CE 1TMTH 1PQ7A 1ZR0A 1C5LH 4XFQA 1OS8A 2R0LA 4ASHA 2ANMH 1SHHB 1ZMLA 4X6PA 3E6PH 3QGJA 3RXBA 1GHAF 1UTPA 3TH4H 1G3BA 1PJPA 2G55A 1NRPH 1VR1H 1JIMA 2BM2A 3ATLA 3C1KA 3OY6U 6CHAC 4DCDA 5EXNA 1C2HA 2GDEH 5ABWA 1O2SA 1C1UH 4XBCA 3UTUH 3PLKA 2R3YA 2CF9H 3FZDA 1O2GH 3UOPA 3ZVEA 3SJ9A 2QGRA 3GDVA 3VGCC 1LKAA 1XUHA 3TITA 3UIRA 4ABFA 1HAZB 1YPGH 4ZXXH 2VB0A 1INCA 1C5TA 4BAHB 2JH5D 1SGYE 1TWXB 1MZDA 4NIWA 1BTYA 1DLKB 1XVMA 1SFQB 4FU8A 5I25A 1ZOMA 5AVDA 1S6HA 2TRMA 2XC5A 4F4OC 1K9OE 3T62A 1VCPA 2XBWA 4UFEH 4ZUHA 3Q00A 3TPIZ 5LPEA 1O2UA 4ZKRU 3LC3A 2WPJS 3E3TA 3U1IB 1SQTA 1GMCF 4FU9A 1CVWH 3VGCB 3H7OA 3SJIA 1BTHH 1W0ZU 2G4UA 2Y81A 1IHTH 3SV7A 1P06A 4INLA 4U30A 2QYIA 1DSUA 1GMHG 3AW0A 1IQMA 2EI6A 4B2BA 4CRGA 5FBEA 3RXLA 4ABEA 3P92A 5C20A 2O8UA 1RIWB 3H5CB 1QBVH 1T4UH 3D62A 2AH4X 1TX8A 2A7HA 1YC0A 1EASA 1LTOA 3KN2A 2RCEA 4KGAA 2H9HA 2BQ7B 4I8KA 1ELDE 1D4PB 1IQNA 1V6DA 1O32A 5AHGH 3VB5A 1BMAA 1Q31A 1EZXC 1BTZA 2Y6TA 2J4IA 2WV4A 1T8NA 1QY6A 2BD2A 1CT2E 2Y80A 3RU4T 4UE7H 2ZKSA 4B74A 1YF4A 1BTXA 3SU0A 3M7TA 3NKKA 1IAUA 3GYLB 4BAMB 1THPB 1HLTH 1O3GA 1UTKA 2BDIA 3LC5A 1QL9A 2XBYA 1EAUA 2ZHDA 3ZVBA 4JK5A 3FFGA 2PW8H 1BTPA 4E7NA 1O5GH 1A3BH 2QXHA 1V2NT 2ZU1A 3BTFE 2XBXA 5HM2A 1C5QA 1AMHA 1VGCC 2Z94A 4Y0YE 1C5UA 1OWIA 2CHAB 2G4TA 2WYJA 4TPYA 1QCPA 1WU1A 1ZTJA 2V3HH 1KXBA 2FX4A 7KMEH 4Z0KA 1C1SA 1BBRH 1BHXF 2BHGA 4ABBA 1UVSH 2AGEX 3BTTE 3TJVA 6GCHG 1KSNA 4ZHLU 1K1MA 2PKAA 1FUJA 3ODFA 1MKXK 1BT7A 1UK3A 1VITG 2R0KA 2XC0A 1ZHRA 1O3AA 4NWLA 4OS5A 1V2ST 3ZYDA 2ALPA 2AMPA 3LGIA 3D23A 4FUHA 1TB6H 1IHSH 1MAXA 1Q3XA 1G30B 3GY5A 1VGCB 1WV7H 3BG4B 1Z1JA 1W7XH 1HYLA 2PFEA 1AVXA 2GT8A 3P70B 2QA9E 3CS0A 2QV1A 4I8JA 3V7TA 3TGIE 1GCDA 1P2NA 1GJ6A 1A4WH 1FN6A 1K28D 2GT7A 1SGDE 2W7UA 1KXAA 4NSVA 2XWBI 2ESTE 3BEUA 1ZSKA 3LJOA 3GY3A 4GHTA 1H8DH 3SU4A 1K1NA 2FIRH 1ZGIA 1N6YA 4MPWA 3U8TH 5EPYA 2OBQA 1T8MA 3Q3XA 2RA0A 3KIDU 3MTYA 1GVLA 1PQAA 1GI8B 3PWCA 4K3JA 3URDA 1H9HE 4ZAEA 5HMAA 1C5PA 4JMYA 5C5OA 5TJXA 2BD7A 2SGAA 1FJSA 5EGMA 1MKWK 4BXSA 3SU6A 2ZGCA 3BF6H 2EI8A 5DP4A 5F8TA 1P2IA 2P3FH 3SOSA 3OY5U 2BY9X 5JBAS 1NZQH 1ARCA 1P3CA 1FI8A 1TGNA 1W14U 1XX9A 1DDJA 1SOTA 1NESE 3P8GA 2HNTF 4H4FA 2ZNKH 1LDTT 6ESTA 3CENA 1YCPH 3GY6A 2FOGA 3M7QA 2GV6A 3SUDA 3TJNA 2H9EH 4I8GA 2IOTA 1A5IA 4JYVH 1FY8E 1NO9H 3SUGA 3MOCA 5GJ4B 1C1VH 3UQVA 1C5SA 1UCYH 3TJUA 1ELVA 2ASUB 1DVAH 2GCHF 2Z3DA 4HGCA 1C2JA 1L1GA 1L4DA 1XKBC 1DWEH 3UPEA 5DP8A 2BYAX 5DP5A 2H5DA 1SG8B 2UUFB 2BMGB 1P57B 5LPRA 3PTNA 1FPHH 1LVYA 1NU7B 1AFQB 1TBZH 2R3UA 4ZMAH 4Y7AA 3PMBB 1MBQA 1Z8IB 1P01A 3SU3A 2QF3A 5E0JA 2O8MA 2OQ5A 1H1BA 1ZMNA 1ZZZA 1K2I1 4GUXA 1AKSA 1GBAA 2FOEA 5DP7A 2F9UA 2BOHB 4K2YA 2VWNA 2QN5T 1H9LB 1ZJDA 1AWFH 1S0QA 2THFB 3PM3A 1GJCB 3NPSA 1GL1A 3MNSA 4X1QU 1JOUB 1ARBA 4D7FA 3BTGE 3DUXH 2F83A 1KXCA 3LIWA 2OXSA 1ESBA 2ZDLA 4B73A 3A88A 1ANBA 1EZQA 5EXMA 1NTPA 3SGBE 1C2GA 1YPLH 4M7GA 4I7YH 3ZVDA 1C2DA 2BLQA 1PPCE 2OTVA 8KME2 3F68H 1Z1IA 1P8VC 4H6TA 3BSQA 5F6MA 1ESAA 2Z9GA 1LO6A 5DJ7A 3UNSA 2PUQH 1YBWA 3D65E 1GG6B 1C5XB 1V2LT 1A1RA 1TE0A 4YZUA 4ESTE 2VVUA 3KL6A 2HRVA 4X8UH 1BUIA 2Z9LA 1GPZA 4VGCC 3SV6A 1UJ1A 2AFQB 4FUJA 1A5GH 1Y8TA 2DUCA 3KQCA 1T32A 3RXCA 4DT7B 5GWZA 4AFQA 1Y5UT 3VB4A 3KCGH 3P17H 2BDYA 4NA7A 1O35A 2GV7A 5FHTA 1JMOH 5BRRE 2AMQA 1J15A 2VIPA 3SGQE 1F0RA 2Q6GA 4UDWH 3SNDA 3KGPA 2PSYA 3HK6B 1LHEH 1GI1A 1QRZA 1OPHB 4AN7A 1QQ4A 1IQLA 3SUEA 1P12E 1H8IH 1BITA 1XKAC 3HGNA 1L4ZA 2PTNA 2CV3A 4VGCB 3KQDA 3A7XA 1DWBH 1GI2A 3RP2A 4IMZA 1RTKA 3BG8A 4UEHH 5GCHG 5PTPA 1XUKA 2IJOB 1KXFA 2ZCHP 1KXDA 4OGYA 4GCHG 3OYPA 3BTWE 1GBBA 3MO6A 3TNTA 4A7IB 8ESTE 1VJ9U 4X2WA 1O33A 1O3HA 4JK6A 1GBFA 2H5CA 4RSPA 1DT2A 1O3PB 4X1SU 1M9UA 2C8YB 2ZQ1A 1OWHA 3RXMA 1LHCH 1BOQA 1EQ9A 1N8OC 2AEIH 1BMMH 1EZUC 1MU8B 2OUAA 1DICA 3GY4A 4XE4A 4CH8B 1F92A 4SGAE 3RXIA 5GPIB 4K8BA 4UONA 1SR5C 2TGDA 3F6UH 1WQVH 2FTLE 2VNTA 1YPEH 1W12U