1C2EA

Recruiting zinc to mediate potent, specific inhibition of serine proteases
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Design of potent selective zinc-mediated serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c2eA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c2eA02
1WQVH 1QJ7B 3ELAH 1UTLM 4NZQA 3Q3KA 1HAHH 2Y80A 3R3GB 1Q31A 1BTHH 1QIXB 1UMAH 2BD3A 2J95A 2TRMA 1SHHB 3M3VA 2STAE 2QXJA 2ZCLP 3F6UH 1MU6B 3EDXB 1RRKA 1XX9A 1GJ9B 2GVFA 5DP5A 1QRZA 3RXDA 1CVWH 1INCA 1F7ZA 2FXRA 1GHAG 1P05A 3BEUA 1VJAU 1SGPE 3T26A 3GY6A 3V7TA 5T6DA 1N8OC 3GY4A 3P95A 4AB9A 1UCYH 1TPAE 4B2BA 1ZMNA 2Q1JA 2AMDA 1ETRH 1C2LA 1LPZB 1ZZZA 2WV5A 1GGDC 2BQ6B 3G01A 3M5LA 1QQUA 1ZOMA 3A86A 1IQKA 1YBWA 1GI0A 2ANYA 2STBE 4AG1A 1HXFH 1OWKA 3ZVCA 3MU4A 1THSH 1FQ3A 1FV9A 2GV6A 1XUFA 1F0SA 2PR3A 2Y7XA 1O35A 3DFLA 1FLEE 4D8NA 1FAKH 1GL0E 1AI8H 1GBIA 4FUCA 2VGCB 2FP7B 1GG6B 2PSYA 5E2OA 1QCPA 1SGEE 3OU0A 4X1SU 1ZTLA 2Z3EA 1C2IA 2PTCE 1YCPH 3BTDE 1C2DA 1W3CA 2FYQA 1VJ9U 3LOXA 1LHEH 3VB6A 1ELGA 1HAXB 3URCA 4ZXXH 1ANEA 4Y0YE 1EJMA 2W26A 3QX5H 3MO9A 1P3CA 1ELCA 1SLVB 1A2CH 3VB4A 1GHBG 1PPCE 1EKBB 3AAVA 5F8ZA 1NY22 2WPIS 2BXTH 1O30A 5DG6A 1XUGA 4KTUA 3I29A 3EE0B 1GI1A 4KELA 1XVMA 4ISLA 1GBLA 3TJUA 1BT7A 2TBSA 2QV1A 2YOLA 1FJSA 1QBVH 2IPHA 5A09A 1IAUA 3NZIA 3SW2B 5EQSA 4XBDA 2W3IA 2ZU3A 1P06A 1PJPA 3PTNA 1TOMH 3AW1A 3BTHE 3T25A 4DVAU 4NSVA 2H6MA 4K3JA 1HAVB 4YM9A 1ZRKA 1TGBA 4NCYA 2IJOB 2F9BH 2ZGJA 4R0IA 3TPIZ 1O2SA 2OBQA 1M9UA 2QXIA 3ZZ9A 1GBBA 4ABBA 3BEFB 1MD8A 3PMHB 3PLBA 1C9TA 4B2AA 1UVPA 2ANMH 1O32A 4WMEA 1QL7A 1B7XB 2UUYA 4YLUA 4K69A 3M7UA 3A81A 4NZLA 3SU0A 1T31A 1TB6H 2WPLS 2CHAC 2FOGA 1MTNB 1QNJA 1PQ7A 1LO6A 2R0KA 3KIDU 1MUEB 1B5GH 4Y8ZA 1LHCH 3P8GA 3RM0H 1P11E 2FESH 3RC4A 5E0JA 3PMBB 3E16B 1RXPA 3U9AH 5E0HA 1SBWA 2G4UA 1PYTC 3SV7A 2ZEBA 1UTPA 4JYUH 4ZAEA 4X1PU 2FEQH 2BM2A 1BTWA 3SUFA 4X8TH 2A2XH 2G8TA 1YPHE 5F03A 2ZU1A 3SNDA 2ZFQH 2IOTA 3UTUH 2XBWA 1TWXB 3GDUA 4Y71A 3RXHA 1FN6A 2F9PA 2GDDA 1VITG 1AWFH 1LTOA 1QA7A 2ZKSA 3MO6A 2BD8A 3ZYDA 2A7HA 1T8OA 3K65B 1GBAA 3SGBE 3ZZ7A 4D7GA 4BAOB 1W2KH 1AU8A 2XCNA 4D9RA 3ATIA 4LXBH 4UONA 1WTGH 8KME2 3NKKA 3LGTA 5DJ7A 3VB7A 5L30H 1TALA 2OD3B 2B5TB 4CRFA 1O3FA 2Q6DA 1GVZA 3L33A 4J2YB 3E1XB 2XTTB 1G3DA 3F1SB 5L2ZH 4M7GA 4ABFA 3A85A 1YPJH 2EA3A 1TMTH 2XWBI 3EA7A 1OSSA 5T6FA 1H8IH 3RU4D 2O8TA 1MKWH 4NIVA 4X2XA 2Z9LA 3A8DA 1C5SA 1O2HA 1KXCA 1UCYE 4ZKSU 1Y3UA 4WWYA 1DICA 3TGIE 1S85A 2ZFRH 1FMGA 1NFUA 1OX1A 1MQ5A 4I32A 3TH3H 1UTQA 1CO7E 5T3HA 1N1LA 2A32A 2F91A 3SU6A 1PPGE 3B8JA 2ZGBH 4WY3A 1C1SA 2HGTH 1AGJA 4DURA 2A7JA 1V2JT 2ZDVH 4DGJA 2BOHB 2SFAA 3M5MA 4ABAA 1P03A 4AG2A 2W3KA 3ENSB 3SJOA 2P94A 3SJ9A 3V3MA 1NT1A 1S0QA 1C1NA 3ZVAA 3RXSA 6CHAC 1O39A 2VIVA 3BTQE 1BBRK 3ESTA 2OP9A 2P95A 3UOUA 2XW9A 5TCCA 1SR5C 2SGEE 4VGCB 5FPYA 1CBWC 1HAPH 3VGCC 4B2CA 4AFUA 2AIPA 4E05H 4O9VA 1MTUA 4GUXA 1XUJA 1O2TA 2ALVA 3SU5A 3H7TA 1K21H 2QGRA 2OQUA 1QJ6B 2ZF0H 5PTPA 2BDHA 1SB1H 1EP6A 1SGYE 3A7ZA 2ZG0H 1AUJA 1TX8A 1ARCA 4A92A 5IDKA 1MKXK 4RKJB 2A4OA 4A6LA 1BA8B 1BDAA 3A7VA 2NU2E 3F9HA 1K1LA 1GJ8B 4FUEA 1VGCC 1UTKA 6LPRA 4H6TA 2P8OC 4FU8A 1P2NA 2O8LA 1NFXA 3BG4B 1C1RA 3GCTG 3MH5A 3OY5U 1GVLA 1UK4A 1H9IE 1XMNB 1S6FA 2UWOA 1AMHA 1E38B 4BAQB 1SGDE 3BTFE 3SQHE 1C5MD 2P59A 1FONA 1GCTC 1ZYOA 1G30B 5JB8S 1O36A 1GWAA 1A5IA 2VIDA 1ZTKA 5EPNA 5FAHA 1QB1A 1KLIH 1PFXC 1P8VC 2R2MB 1VCQA 1QBOA 1F5RA 1S5SA 3PB1E 4E06H 1CA0B 1DY8A 1HDTH 2GZ8A 2ZDMA 3GDVA 1O3BA 1A46H 1CHGA 1HFDA 3GCOA 1V6DA 5F6MA 1FIWA 5DP6A 2A2QH 1ORFA 1O3EA 2PUXB 1YCPM 3HK3B 1UVOA 3KEEA 1YPKH 3MH7A 1C9PA 4FUIA 3DT0H 3F9GA 2AERH 1G3CA 1MTVA 3S9BA 5A2MH 3QO6A 2DE9A 1MBQA 1AFEH 1J14A 3SUEA 1K1NA 4GCHF 8GCHF 1UO6A 1BMAA 3RU4E 2XYAA 4FUFA 4DT7B 1C5VA 4DW2U 2BLVA 3BTEE 2FZZA 2GT7A 1NU7B 4YT6H 1T8LA 1C5YB 1QGFA 1NRPH 1PPBH 1QR3E 2XC5A 1GJ5H 1TA2A 3MU8A 4A1TA 1ABJH 4WVPE 3FAOA 1WCZA 5AVDA 5EW2H 3P70B 2OTVA 3RUOA 1N6XA 4YZUA 3SV8A 2OC0A 2VU8E 3GCHC 1TOCB 4NA9H 1CQQA 1O5FH 5C1UA 1JRTA 2GT8A 8LPRA 4MPXA 4BTTB 2H9TH 1DFPA 3LU9B 1O3MA 3QUMP 1DUAA 1GI3A 2FI3E 4GPGA 1EAXA 1OPHB 2BMGB 1RIWB 1OWEA 4ISOA 1C4U2 3NWUA 1IHTH 3T29A 3S9CA 1SLXB 2VWMA 4Y11E 4B76A 2ZI2H 3MNBA 1JBUH 1K9OE 4CREA 4WH6A 1P09A 1KXAA 1NFWA 3ZZDA 3RMLH 3SJ8A 4ABGA 2BD2A 1MAXA 1PPEE 1TMBH 4A5TS 1TNHA 2HWLB 5T6GA 2ZGXH 4X2WA 1P01A 1EUFA 2XRCA 1DT2A 3QGNB 4X6PA 2V35A 1GDUA 1IQMA 1AFQB 2NU4E 1P2MA 3N7OA 1D4PB 5FCKA 1OYQA 4Y7AA 1C5WB 5TJXA 2G5NA 4JCNA 4R8TB 3GYMA 4YESB 1H9LB 4JZEH 5GPIB 1O38A 4IN1A 1EJAA 2WPMS 1GMDF 1P2OA 1Y5AT 1HJAB 2NU1E 3RMOH 4XFQA 2PKSB 2V6NA 3O8BA 3U69H 1GMCF 2CMYA 2YNAA 3U1IB 1GI2A 1QRXA 2FIRH 2PSXA 2BY7X 3GICB 3JZ1B 4JZDH 1LVMA 1O5AB 2Z94A 3LT3A 1P9UA 1C1QA 1IOEA 2JKHA 2JETB 4OS5A 5FXLA 1NO9H 2FOHA 5C5OA 2ZDNA 3FFGA 1O2MA 3AAUA 4K1TA 2Y5FA 1YM0A 1V2ST 3QTOH 1SQOA 5AHGH 4CH8B 5CHAB 1TX6A 1P2QA 1L4ZA 1ELFA 3LKWA 1BMNH 5EU8A 3RXRA 2J2UA 1P3EA 2PTNA 3TH2H 1NPMA 1ZPZA 3UNSA 1K1PA 1SFQB 4ZHAA 5JBAS 1WV7H 1P2KA 3IG6B 4JZFH 2RCEA 2VIQA 2GDEH 1O2UA 3ZZCA 2BLQA 4YOGA 2H5CA 1TQ7B 1UTJA 3UR9A 1QHRB 4IMZA 1AKSA 1Z8GA 4A1VA 3LJOA 2H9HA 1A4WH 2QN5T 1Y3VA 4OS1A 2ILNA 1DVAH 1OWDA 1DOJA 4B74A 4X6OA 1BOQA 2EI8A 3EGKH 4GHQA 3VFEA 2FLBH 3SQEE 4MQAA 5I25A 1KIGH 1BMLA 3MU0A 2F9OA 1WOFA 2FYRA 4CH2B 3CS7A 5EQRA 3RXQA 2ZP0H 3T62A 1A0LA 4WMDA 2BY9X 1BJVA 1TNGA 1OWJA 1C1TA 1CA8B 2G52A 1WUNH 2ZDLA 1T8NA 3M5NA 1FZZA 3F9EA 3SNAA 1DUEA 4INKA 1HIAA 1GBFA 1N6YA 1ZSJA 2J9NA 4NWLA 4MDSA 5DP7A 4YTAA 3K9XB 1TRYA 3M3TA 4LK4A 1ZRBA 2WUCA 1THPB 2BY6X 1ZHPA 1N8OB 2G81E 2B8OH 1AE8H 1GGDB 3HPTB 1GMHF 1PYTD 1DXPA 5TCAA 4TYDA 1ZMLA 2HLCA 1P02A 2SNVA 2FMJA 6GCHF 1NZQH 2PGBB 4FU7A 3RXBA 1AY6H 4LZ4B 1P0SH 2GGVB 2Z6BD 2VH0A 2QY0B 1L1NA 1IQHA 4OGXA 1RFNA 4NA7A 1ANBA 1GBCA 4AX9H 5LPEA 2M5TA 1ZTJA 3A84A 4Y0ZE 3KQDA 3L6PA 2AMPA 3C27B 1HXEH 2C90B 3CP7A 1ELTA 2CF8H 3LC3A 1ZLRA 5HYOA 4WH8A 3ZZ3A 1T32A 2WPHS 2Z7FE 2C8YB 2FOCA 1UTNA 3NK8A 1IQEA 3PLKA 5EOKA 5DKMA 1UTOA 3DFJA 1ESTA 3RU4T 1KXBA 2Y81A 1GI6A 5K0HA 3M7TA 1GJ6A 1SGQE 2Z9JA 2G00A 1C1VH 2BX3A 3PMJA 4WMFA 3A83A 3ZVGA 4ZMAH 1CE5A 1KYNA 1ZHRA 1MBMA 1TYNA 4FU9A 2C8XB 1YP9A 1AB9C 1TRNA 2A4GA 1TGSZ 2J92A 3M61U 2ASUB 4I7YH 1BBRH 3ZV8A 3M36A 4DOQA 1Z1IA 4O3UA 4ABJA 2ZFSA 1CSOE 1O3KA 3ZVDA 2BD7A 2ZQ2A 1AD8H 1K1JA 2JH5D 3EQ0H 3ODDA 1W7XH 3EA9A 1ACBE 1S83A 4BXWA 3UWJH 1TNKA 3SV2H 1EPTC 1K22H 3P6ZB 2GX4A 1C5UA 4IC5A 2NU0E 2CJIA 1AE5A 1RGQA 1AZZA 2HPQH 1G2LA 2AGGX 1IQJA 4ISHH 2AGEX 1MKXH 4GVUA 3FANA 2KAIB 2ZTYA 3FP8E 2DE8A 4K1SA 2CHAB 3E0PB 3ODFA 1HAGE 3MOCA 4HTCH 1ETTH 4K5ZA 1D6RA 1O3DA 1HB0B 2Q6FA 3PO1C 4I8GA 3LGYA 1ZGVA 3H7OA 1XUHA 2HNTC 1HNEE 3Q76A 1C2HA 3KQBA 4Y6DA 4UFFH 2O9QA 1OP0A 1AN1E 1C1MA 1LKBA 3VB5A 1ELDE 1J8AA 5A8XA 1NU9A 5GIBA 1EATA 4INLA 1DM4B 7KMEH 1BITA 1JMOH 4Q7YA 1GVKB 3GOVB 3TJNA 2ESTE 4K8YA 1BRAA 1AVXA 1SFIA 4XBBA 1A1RA 3QGJA 2P3UB 4GCHG 2ZU4A 3ZVBA 8GCHG 1W13U 2ODQA 1TPSA 2VH6A 2QXHA 4B71A 2ZIQH 3UPEA 2KAIA 3GCNA 2FO9A 3GY8A 1V2MT 2BHGA 5K7RA 5EPYA 1EX3A 1MZAA 4CHAC 4JK6A 1J9CH 1G36A 2WUBA 1CHOF 2BYAX 5F8XA 5EXNA 3VB3A 1FDPA 3IITA 3E6PH 1SMFE 1A7SA 1PPZA 1DWBH 1GBEA 1NRNH 1P04A 4D76A 3SU1A 1BHXB 1W0ZU 3MO3A 1GHWH 2NWNA 3R0FA 1O2WA 2Z9IA 1RD3B 1LKAA 3KHVA 1TPPA 1HCGA 4J1YA 1O2XA 3ATLA 1HV7A 3PROA 1D6WA 3D65E 3UWIA 1C2JA 4WXVA 3LJJA 1DSTA 3QK1A 1F0TA 5JB9S 5GDSH 1V2VT 5H4IB 3WY8A 4MPWA 3AASA 4X8VH 1HYLA 1QL8A 1SHYA 3HKIB 1SGFA 1MH0A 1SQAA 5A8ZA 1SGFG 3SJIA 4CBNA 5LPRA 1TIOA 3K2UA 3U8OH 4BAHB 2TGPZ 4X1NU 5LH8A 4Q2KA 4OS2A 2BLWA 2BVXH 1MTWA 1QJ1B 5FCRA 4I33A 4NG9H 1NFYA 2QA9E 3MFJA 2ZHWH 3FVFB 4MG3A 6CHAB 2ZHDA 4K60A 4HI3A 3TK5A 3SZNA 4NSYA 1OOKB 5HMAA 1O3IA 2FS9A 4AFQA 1CBWB 3VGCB 2FTLE 4YLQH 2BB4A 1KDQB 1TBRH 1V2TT 3A8BA 2A1DB 3UOPA 1C1PA 1WBGB 2OINA 4FUBA 4AFSA 1F0UA 2J4IA 1GMCG 1C2EA 1ZPBA 4K8BA 4FVBA 2ZFPH 2Y6TA 3EA8A 4YOJA 2A0QB 2SGPE 4AGJA 2O8WA 4ZKNU 2QF0A 2C8ZB 1EAUA 3RXJA 4CRGA 1OS8A 1GCDA 4UFDH 3P92A 2QC2A 1RS0A 2UUFB 3ATKA 2K1QA 2BQWB 3C1KA 1E0FD 5A0CA 2ZCHP 1Y8TA 1P9SA 4KTCA 3A8AA 1NC6A 1D3PB 5AFYH 1RTKA 1VGCB 5ESBA 1AVWA 2P8OB 1ARBA 4XDEA 5A0AE 5SGAE 1V2RT 3UFAA 3AVZA 3GY7A 4Z6AH 2ZC9H 1W12U 1O2OA 5CMXH 3RC5A 3LGUA 1GCTB 1F0RA 1FXYA 3F68H 1SG8B 1KDQA 3TVJB 5ETXA 3EYDA 3MNXA 1KSNA 5ABWA 2WYJA 1C4V2 3W95A 4WXIA 5JYIA 1EZUC 2QYIA 1O3LA 5G4BA 3EAJA 2B7DH 1H4WA 5EGMA 4IMQA 3TJVA 1L4DA 1EAIA 1TBQH 2JH6D 2W5EA 3A87A 1NRSH 5I46H 3LGWA 1HAYB 1WU1A 1SQTA 1K1MA 3PV4A 1FY1A 1H9HE 1K1OA 2GMTC 1B0EA 1LHDH 2AH4X 2RDLA 3KN2A 3HGPA 3SNCA 4CR9A 3A89A 1TRMA 2OC1A 1GI4A 2ZCKP 4CRCA 4XBCA 5A8YA 2XBVA 1Z6JH 1W11U 3SO3A 1UK3A 4IBLH 4ZXYH 3SU4A 2V3OH 1OWIA 3D49H 4FVDA 4TWWA 3Q00A 3I77A 2ZFFH 1Q2WA 1Z6EA 1GBDA 3PLPA 3VXEH 2QXGA 2XBYA 3SV6A 3URDA 3T27A 1DPOA 4TWYA 2VIOA 2WINI 1SSXA 1O3JA 1QL9A 3D62A 4U2WA 2ZPSA 2TIOA 1TNIA 4F4OC 2PLXA 3MNCA 1GMHG 1S0RA 2HNTF 1EOLA 3GCHB 1MU8B 1AIXH 5FBEA 1QA0A 3ZZ8A 4BTIB 2EI7A 1WAYB 5LGOA 2C4FH 1VITF 1JOUB 3AW0A 1O5CB 1IQFA 3SU2A 4UDWH 6GCHG 4WF8A 3E90B 1V2OT 4X8UH 1C2MA 1EB1H 1WTHD 1JXPA 3A8CA 4U32A 4RSPA 3VEQB 1Z1JA 4BNRA 1NRQH 4JMYA 3T28A 4NFFA 4DG4A 1S82A 2GCHF 1GJ7B 4O97A 3TLOA 5JBTA 1MD7A 4KTSA 1ETSH 4UFGH 4FUGA 1P10A 1AHTH 1KXEA 2VINA 1KXFA 4WJG2 1HBTH 5HM9A 1LPGB 5DK1A 1A5GH 3A88A 2AFQB 1SGRE 3TK6A 4LOYH 1MZDA 4B1TA 1YLDA 4JZ1A 5DP9A 3RXAA 1W10U 3SBKA 1G2MA 3S7KB 1C5RA 1ELVA 1O5DH 1T4VH 5GCHF 3UNRA 2RG3A 1V3XA 1ESBA 1FIZA 4YO9A 4DIIH 3E0NB 3KGPA 3K6ZA 3ZZ4A 5C3NA 2H9EH 1DE7H 1HLTH 2A7CA 1W8BH 3E3TA 1KLTA 1QQ4A 2W7UA 3UUZA 1O2JA 3T5FH 1O0DH 2Z9KA 1FY8E 4ZUHA 1V2LT 1TGNA 4YOIA 1QFKH 1O3OA 1CGIE 1DWDH 1SGNE 4X8SH 4I8JA 1GBJA 5EXLA 4E7RG 1AKSB 1BB0B 2OLGA 3RP2A 2OCVB 2R9PA 2R3UA 3DA9B 3KQEA 2I6QA 2ZTZA 3SORA 1SC8U 3JZ2B 3PM3A 1G3EA 2WYGA 2F3CE 1BRBE 2FWWA 3U1JB 2GZ7A 1BIOA 2QCYA 7LPRA 4IN2A 3MWIU 2TGAA 1G9IE 2PFEA 1B0FA 3FP6E 2WPJS 1C2GA 1SGTA 4NIXA 4U01A 1CU1A 1NTPA 2FLRH 2FOBA 3NPSA 3ITIA 4Y7BA 1GDNA 4ABDA 3TGJE 2LPRA 3SGQE 4PROA 2WV4A 1D3TB 4AORA 1SGCA 1UTMA 3GYLB 2GTBA 3BTKE 4CBOA 1LMWB 2PKAA 1MQ6A 2D26C 4NFEA 4MNYA 7ESTE 3GY2A 1SVPA 1ZSKA 1HIAB 2BXUH 1K1IA 3BV9B 1YLCA 4X2VA 1RJXB 1G37A 1K28D 2PUQH 3U98H 1DLKB 5GXPA 5LPFA 1HAOH 1OP8A 5C2ZA 3MH4A 5J4SA 5JPMH 1U6QA 5FPSA 1VITH 1O3AA 2BVRH 3A7WA 2VVCA 3D23A 4MPUA 3TGKE 2AS9A 2GCTC 3NCLA 1O2IA 2UUJB 1FY4A 1J17T 2BDIA 3P8NA 4X1QU 1KTTB 1O3HA 2XXLA 4ZH8A 3MMGA 1F5LA 3M5OA 2A4QA 4TY7A 1YKTA 2THFB 5DGJA 5BRRE 1GBKA 3RXTA 1E36B 2SGAA 1TONA 5C5NA 3FZZA 1PPHE 1GJCB 3ZV9A 3BTGE 5E8EH 3NUMA 2ZO3H 2FOAA 4ZKOU 2A31A 1DANH 4DY7B 3QZRA 1Y3XA 1CHOG 1C4Y2 1G3BA 5AFZH 2UWPA 1VCPA 2W7SA 1QRWA 3M7QA 1A5HA 3SI3H 1QTFA 1Z8RA 2P3FH 2ZGHA 3A7XA 2P93A 3B23B 4GAWA 1Q3XA 3HGNA 1X7AC 1DX5M 5DP8A 2XCFA 5EODA 1GBHA 3RDZA 3RMMH 1O2PA 1GI8B 3DD2H 3BF6H 5B6OA 3MTYA 4UFEH 1TGTA 1HJ9A 5HXFA 4AFZA 4Y8YA 2EI6A 5L6NH 3PTBA 1JRSA 1BTYA 1IQGA 2BZAA 2C93B 5JDUB 1E37B 1AO5A 4MNWA 2SGFE 4OS4A 2FX6A 1ZJKA 2BD9A 2XC4A 1QB9A 1EZXC 5E0GA 4BAKB 5FHTA 1V2UT 2FI4E 3PWBA 4B73A 2G55A 1Z71A 2ZGCA 4Q7XA 1ID5H 2ZTXA 2CV3A 4JYTA 3RXUA 3GY3A 4NIWA 4AZ2B 4OS6A 4D7FA 1MAYA 2PHBA 3QLPH 1FUJA 1A61H 4CRBA 1O2ZA 2D8WA 3Q77A 1JIRA 4ABHA 5FX5A 3UREA 3UR6A 3BTWE 1HUTH 4Y8XA 3KF2A 4UE7H 1SPJA 3H5CB 4HZHA 4X0WU 4NIYA 2G4TA 3LGVA 2Q6GA 1CT2E 3OSYA 2VGCC 1AB9B 1GI7B 2UUKB 4H6SB 4A1XA 1GG6C 2XC0A 4DCDA 1A3BH 1C1WH 4BXSA 2WPKS 2H2ZA 1SL3A 2Z9GA 1RTLA 3ZVFA 3ZZ5A 3V12A 1IHSH 1LPKB 1S6HA 1QB6A 2EC9H 3MU5A 1P12E 1Z7KA 1DITH 1QURH 3GDSA 1O2NA 2C3SA 5BPEA 1EPTB 3O8DA 3SGAE 5L2YH 2XBXA 3GY5A 2ALPA 3SU3A 1C5OH 3KQCA 1TNLA 2SGQE 1O2QA 3U8RH 4K2YA 1SLUB 1BRUP 3U8TH 2BQ7B 2AEIH 2ZU2A 3P8FA 1W14U 2BDAA 3VXFH 1NESE 3OX7U 2AIQA 5A0BA 2XNIA 1OP2A 2BVSH 4FUDA 2VIWA 4Q7ZA 1O37A 1AUTC 3MH6A 4GHTA 9LPRA 1TABE 3PO1B 1V2NT 4Y79A 3MI4A 4CR5A 4TPIZ 3SOSA 1H8DH 1DWEH 1MMJN 2FS8A 3UNQA 3TH4H 1HRTH 1XKBC 2ANWA 5DO4H 1D9IA 1AVGH 2D1JA 3ZZ6A 1UVTH 4RKOB 3TNSA 1C5XB 4AOQA 3SHCH 1VCWA 3QWCH 3ZZAA 1EPTA 2HPPH 4ZHMU 3V0XA 4AGKA 1YC0A 4HGCA 2HNTE 3BIVH 3QDZB 2V0BA 3NXPA 2QAAA 1J16A 1YPGH 4DJZB 1F5KU 1GI9B 1LQEA 1P2IA 1MTNC 1Z8IB 4MPVA 3KNXA 4IS5A 1YPHC 1IQIA 1K2I1 1YYY1 2ZPQA 1DS2E 3RXFA 3P8OA 4BANB 1HAVA 4CHAB 1HAZB 3RLWH 4IGDA 2H5DA 2NU3E 1JWTA 3B9FH 1D3QB 2Y82A 3K6YA 4JYVH 3STJA 1TMUH 1DDJA 3TIUA 1EB2A 4INHA 1C2KA 4Q80A 1O3GA 3E91A 4X6NA 1E34B 3M35A 1C1OA 1EXFA 3LC5A 4JK5A 1UVSH 2VJ1A 4JZIA 1S81A 1KTSB 4O03A 1NROH 3LONA 1T4UH 2FOFA 1LHGH 3LIWA 4AYYB 7GCHF 1QBNA 3BG8A 3BTME 1UCYK 3I78A 1RTFB 2D2DA 4MVNA 4KGAA 4AN7A 1Y3YA 1LDTT 1V2WT 3O8CA 2Y7ZA 1GPZA 2GD4B 2OUAA 1NM6A 1H1BA 1ZR0A 4I8HA 2GCHG 4UEHH 4HFPB 1O2RA 2PV9B 5FPTA 1UVUH 4ZKRU 1GHAF 4BTUB 5FX6A 2OC8A 2UWLA 2RA0A 1YF4A 2CN0H 2J38A 1O5BB 2ZDAH 3SJKA 3ATWA 3QZQA 2HVXA 1FPHH 3HATH 3MHWU 4X2YA 4IW4E 4ASHA 2VVVA 2CXVA 4GLYA 1EASA 4ZHLU 1BMMH 3MYWA 3STIA 3F9FA 3OY6U 4MLFB 1KXDA 2C8WB 1TNJA 1OWHA 1BQYA 1FY3A 4ESTE 5EXMA 2F9UA 5GCHG 1C2FA 1YCPK 3SI4H 2ZHQH 1BTZA 1YPLH 4Y10E 2GV7A 1O2VA 3BSQA 2FODA 3KCGH 1O34A 1GHYH 2H1UA 1EOJA 1NS3A 2YNBA 1GMDG 1HPGA 1ZGIA 2ZHEH 1UJ1A 1C5ZB 3RXLA 2A45B 1GBMA 3L3TA 1TAWA 1ZSLA 2QF3A 3RXGA 1O3CA 2ZDKA 2ODPA 1LVOA 1Z8JB 2A5IA 2R0LA 1PPFE 4SGAE 3SN8A 9ESTA 2VIPA 3RM2H 1C5PA 3ZZBA 1Y3WA 1GL1A 4THNH 1XKAC 2B0FA 1BUIA 2VWOA 1ZHMA 2AGIX 4MNXA 2ZHFH 3RC6A 1YGCH 4UD9H 3RXMA 2F9VA 3PYHA 1ANDA 2G51A 4TY6A 1GHBF 1PQ5A 4VGCC 1FNIA 3A7TA 4SGBE 1AZ8A 3QN7A 5DP3A 3OYPA 1BBRE 4FUJA 1UHBB 5JBBS 3RLYH 1PQAA 3BN9A 1T8MA 2J34A 1LQDB 4BOHA 5IYTA 1TLDA 1TPOA 4F49A 2BDYA 1KLJH 1ZJDA 4Y76A 3S0NA 5AF9H 2ZNKH 1J15A 1C1UH 8ESTE 1A0HB 1C5QA 1YPMH 3SUDA 2A4RA 3PMAB 4RN6A 1BRCE 5F8TA 2VVUA 4D9QA 3PWCA 3ZVEA 1XVOA 1C5LH 1A3EH 3RXPA 2AYWA 3M37A 3CS0A 3A80A 1F2SE 3A7YA 3BEIB 1YPEH 3BG4C 5DPAA 2GMTB 4TPYA 1LCYA 1CT4E 1EZQA 1O5EH 2RA3A 1ABIH 1L0ZA 3FZDA 2VB0A 3OTJE 4CRAA 1TGCA 4U30A 1UHBA 5HGGA 2VNTA 1V2PT 1GDQA 2HALA 4NGAH 2B9LA 2ZFTA 4XOJA 2DUCA 4ABEA 2TPIZ 4LZ1H 1SGIB 2FOEA 2BY5X 1CA0C 1DY9A 1O2YA 1MCVA 4DIHH 1SOZA 4H42U 1Y5BT 1MTSA 4OS7A 3CENA 3RXEA 1ZMJA 3Q3YA 1FN8A 5CE1A 2BD5A 2BX4A 5C20A 1BZXE 1HJ8A 3DHKH 4OGYA 5FBIA 1HAIH 4AYVB 1O31A 2BLOA 1C5TA 1MCTA 2AMQA 2A5KA 3A82A 3V13A 1Y59T 2IN2A 2OQ5A 1ELBA 1OKXA 2ZU5A 1VZQH 2EEKA 3TU7H 2BZ6H 1KY9A 1LHFH 2FX4A 2BDCA 3RXCA 3SV9A 3RXOA 1O2GH 1O2KA 2LNCA 1G32B 1DXWA 5EW1H 2O8UA 1L1GA 1MKWK 4KP0A 1BJUA 2TGDA 4I8LA 2HOBA 1D3DB 1SLWB 1L1JA 2QIQA 1PQ8A 2FOMB 1TX7A 5J4QA 1EJNA 3IWMA 1XXDA 3VPKA 4FXGH 2ZECA 2F9NA 3RXIA 1WQSA 2FI5E 1ELAA 1O3PB 1EP5A 3SNEA 1TQ0B 5HM2A 4XE4A 1CGJE 4ISIH 5ESTE 1FAXA 1ELEE 2OXSA 3UQVA 6ESTA 3E8LA 2GKVE 3RXVA 1LVYA 2SNWA 4NA8A 1RIWC 2A5AA 2GP9B 5DP4A 1C5NH 3BIUH 3P17H 1O3NA 2Y5GA 3DUXH 1ESAA 4I8KA 1TA6A 1L2EA 1GHZA 2BTCE 1EZSC 2PKAB 2ANKH 5GWZA 1DLEA 1OXGA 2BDGA 4GSOA 4BAMB 2OC7A 2ULLA 5C1XA 3MU1A 1AQ7A 1W7GH 1O5GH 2Y5HA 2SGDE 1NN6A 1A0JA 2ZQ1A 2BD4A 1ZPCA 2HRVA 4A7IB 1Y5UT 1W0YH 1UK2A 4MTBA 4Z0KA 1GI5A 1AFQC 3LPRA 1BHXF 1CGHA 1SI5H 2J94A 2OBOA 1GHVH 1O2LA 2CGAA 5C1YA 3RMNH 4E7NA 4ZROA 1XUKA 2VWNA 1EQ9A 1GJAB 3ATMA 1LVBA 4K1EA 2JH0D 4B75A 1SOTA 1TFXA 1FPCH 2R3YA 3ZYEA 3FP7E 1HJAC 2Z3CA 3TNTA 3TITA 2PKSC 4FUHA 4KKDA 2FPZA 4AB8A 4XSKU 2P3TB 4CRDA 1QY6A 2G5VA 4O3TA 3LDXH 2R2WU 3LH3A 3HKJB 5JBCS 3M3SA 1S84A 2JETC 1THRH 3T2NA 3O8RA 1NRRH 4ISNA 2BOKA 2O8MA 1BCUH 2P16A 1WSSH 1JIMA 1BTPA 1P57B 4YT7H 1IQNA 2XWAA 5C67A 1E35B 1V2KT 2PGQB 3UY9A 1T7CA 3RXKA 3S7HB 2GCTB 4IC6A 5CHAC 3S69A 3GCTF 2I6SA 4QT8C 1P2JA 5GJ4B 2FTMA 1XM1A 2PWXA 4NWKA 1HGTH 3HK6B 1F92A 1WYKA 1EAWA 2CF9H 2FM2A 3UQOA 2BY8X 1GJBB 2F83A 1TE0A 1GJ4H 2ZA5A 1DWCH 5EG4A 1DSUA 2PW8H 1XXFA 2ZPRA 3Q3XA 3MNSA 3W94A 3LH1A 1O33A 2ZZUH 1V2QT 4X6MA 1BTXA 1GJDB 2V3HH 3GISB 1FY5A 4I31A 1GHXH 1VR1H 3TJOA 3SHAH 2VWLA 3UIRA 3SUGA 1CT0E 4H4FA 1ANCA 4MNVA 1XUIA 1GBTA 3TK9A 2ZWLH 3S9AA 4ABIA 1AWHB 3SNBA 2TGTA 1FI8A 2FDAA 2Z3DA 2GZ9A 1OYTH 3LGIA 1IQLA 1TBZH 2BDBA 4X1RU 3BTTE 3QTVH 3KL6A 2ODYB 5EQQA 7GCHG 1BTUA 5E2PA
chains in the Genus database with same CATH superfamily
1WQVH 1QJ7B 3ELAH 1UTLM 4NZQA 3Q3KA 1HAHH 2Y80A 3R3GB 1Q31A 4Z1MD 1BTHH 1QIXB 1UMAH 2BD3A 2J95A 2TRMA 1SHHB 3M3VA 2STAE 2QXJA 2ZCLP 3F6UH 1MU6B 3EDXB 1RRKA 1XX9A 1GJ9B 2GVFA 5DP5A 1QRZA 3RXDA 1CVWH 1INCA 1F7ZA 2FXRA 1GHAG 1P05A 3BEUA 1VJAU 1SGPE 3T26A 3GY6A 3V7TA 5T6DA 1N8OC 2RFKC 3GY4A 3P95A 4AB9A 1UCYH 1TPAE 4B2BA 1ZMNA 2Q1JA 2KCOA 2AMDA 1ETRH 1C2LA 1LPZB 1ZZZA 2WV5A 1GGDC 2BQ6B 3G01A 3M5LA 1QQUA 1ZOMA 3A86A 1IQKA 1YBWA 1GI0A 2ANYA 2STBE 4AG1A 1HXFH 1OWKA 3ZVCA 3MU4A 1THSH 1FQ3A 1FV9A 2GV6A 1XUFA 1F0SA 2PR3A 2Y7XA 1O35A 3DFLA 1FLEE 4D8NA 1FAKH 1GL0E 1AI8H 1GBIA 2YMSC 4FUCA 2VGCB 2FP7B 1GG6B 2PSYA 5E2OA 1QCPA 1SGEE 3OU0A 4X1SU 1ZTLA 2Z3EA 1C2IA 2OK5A 2PTCE 1YCPH 3BTDE 1C2DA 5HKKD 1W3CA 2FYQA 1VJ9U 3LOXA 1LHEH 3VB6A 1ELGA 1HAXB 3URCA 4ZXXH 1ANEA 4Y0YE 1EJMA 2W26A 3QX5H 3MO9A 1P3CA 1ELCA 1SLVB 1A2CH 3VB4A 3WW7A 1GHBG 1PPCE 1EKBB 3AAVA 5F8ZA 1NY22 2IJD1 2WPIS 2BXTH 1O30A 5DG6A 1XUGA 4KTUA 3I29A 3EE0B 1GI1A 4RT0A 4KELA 1XVMA 4ISLA 1GBLA 3TJUA 1BT7A 2TBSA 2QV1A 2YOLA 1FJSA 1QBVH 2IPHA 5A09A 1IAUA 3NZIA 3SW2B 5EQSA 4XBDA 2W3IA 2ZU3A 1P06A 1PJPA 3PTNA 1TOMH 3AW1A 3WWBA 3BTHE 3T25A 4DVAU 4NSVA 2H6MA 4K3JA 1HAVB 4YM9A 1ZRKA 1TGBA 4NCYA 2IJOB 2F9BH 2ZGJA 4R0IA 3TPIZ 1O2SA 2OBQA 1M9UA 2QXIA 3ZZ9A 1GBBA 4ABBA 3BEFB 1MD8A 3PMHB 3FO8D 5C0UA 3PLBA 1C9TA 4B2AA 1UVPA 2ANMH 1O32A 4WMEA 1QL7A 1B7XB 2UUYA 4YLUA 4K69A 3M7UA 3A81A 4NZLA 3SU0A 1T31A 1TB6H 2WPLS 2CHAC 2FOGA 1MTNB 1QNJA 1PQ7A 1LO6A 2R0KA 1SKYE 3KIDU 1MUEB 1B5GH 4Y8ZA 1LHCH 3P8GA 2WV9A 1P11E 2FESH 3RC4A 3RM0H 5E0JA 3PMBB 3E16B 1RXPA 3U9AH 5E0HA 1SBWA 2G4UA 2J5UA 1PYTC 3SV7A 2ZEBA 1UTPA 4JYUH 4ZAEA 4X1PU 2FEQH 2BM2A 1BTWA 2RDEA 3SUFA 4X8TH 2A2XH 2G8TA 1YPHE 5F03A 2ZU1A 3SNDA 2ZFQH 2IOTA 3UTUH 2XBWA 1TWXB 3GDUA 4Y71A 3RXHA 1FN6A 2F9PA 2GDDA 1VITG 1AWFH 1LTOA 1QA7A 2ZKSA 3MO6A 2BD8A 3ZYDA 2A7HA 1T8OA 3F0OA 1GBAA 3K65B 3SGBE 3ZZ7A 4BAOB 1W2KH 1AU8A 2XCNA 4D7GA 4D9RA 3ATIA 4LXBH 4UONA 1WTGH 8KME2 3NKKA 3LGTA 5DJ7A 3VB7A 5L30H 1TALA 2OD3B 2B5TB 4CRFA 1O3FA 3DSOA 2Q6DA 1GVZA 3L33A 4J2YB 3E1XB 2XTTB 1G3DA 3F1SB 5L2ZH 5FL7D 4M7GA 4ABFA 3A85A 1YPJH 2EA3A 1TMTH 2XWBI 3EA7A 1OSSA 5T6FA 1H8IH 3RU4D 2O8TA 1MKWH 4NIVA 4X2XA 2Z9LA 3A8DA 1C5SA 1O2HA 1KXCA 1UCYE 4ZKSU 1Y3UA 4M9FA 4WWYA 1DICA 3TGIE 1S85A 2ZFRH 1FMGA 1NFUA 1OX1A 1MQ5A 4I32A 3TH3H 1UTQA 1CO7E 5T3HA 1N1LA 2A32A 2F91A 3SU6A 1PPGE 4YXWD 3B8JA 2ZGBH 4WY3A 1C1SA 2HGTH 1AGJA 4DURA 3GS9A 2A7JA 1V2JT 2ZDVH 4DGJA 2BOHB 2SFAA 3M5MA 4ABAA 1P03A 2KFWA 4AG2A 2W3KA 3ENSB 3SJOA 2P94A 3SJ9A 3V3MA 1NT1A 1S0QA 1C1NA 3ZVAA 3RXSA 6CHAC 2W6JD 1O39A 2PP6A 2VIVA 3BTQE 1BBRK 3ESTA 2OP9A 2P95A 3UOUA 2XW9A 5TCCA 1SR5C 2SGEE 4VGCB 5FPYA 1CBWC 1HAPH 3VGCC 3N7EA 4B2CA 4AFUA 2AIPA 4E05H 4O9VA 1MTUA 4GUXA 1XUJA 1O2TA 2ALVA 3SU5A 2KCYA 5KGOA 3H7TA 1K21H 2QGRA 2OQUA 1QJ6B 2ZF0H 5PTPA 2BDHA 1SB1H 1EP6A 1SGYE 3A7ZA 1WXRA 2ZG0H 1AUJA 3OAAD 1TX8A 1ARCA 4A92A 5IDKA 1MKXK 4RKJB 2A4OA 4A6LA 1BA8B 1BDAA 3A7VA 2NU2E 3F9HA 1K1LA 3UAIC 1GJ8B 4FUEA 1VGCC 1UTKA 6LPRA 4H6TA 2P8OC 4FU8A 1P2NA 2O8LA 3F2GA 1NFXA 3BG4B 5HIYA 1C1RA 3GCTG 3MH5A 3OY5U 2XNDD 1GVLA 1UK4A 1H9IE 1XMNB 1S6FA 2UWOA 1AMHA 1E38B 4BAQB 1SGDE 3BTFE 1KMHB 1C5MD 3SQHE 2P59A 1FONA 1GCTC 1ZYOA 3FN8A 1G30B 5JB8S 1O36A 1GWAA 1A5IA 2V7QD 1YWUA 2VIDA 1ZTKA 5EPNA 5FAHA 1QB1A 1KLIH 1PFXC 1P8VC 2R2MB 4FETA 1VCQA 1QBOA 1F5RA 1S5SA 3PB1E 4E06H 1CA0B 1DY8A 1HDTH 2GZ8A 2ZDMA 3GDVA 1O3BA 1A46H 1CHGA 1HFDA 3GCOA 1V6DA 5F6MA 1FIWA 5DP6A 2A2QH 1ORFA 1O3EA 2PUXB 1YCPM 3HK3B 1UVOA 3KEEA 1YPKH 3MH7A 1C9PA 4FUIA 3DT0H 3F9GA 2HVYB 2AERH 1G3CA 1MTVA 3S9BA 5A2MH 3QO6A 2DE9A 1MBQA 1AFEH 1J14A 3SUEA 1K1NA 4GCHF 8GCHF 1UO6A 1BMAA 3RU4E 2XYAA 4FUFA 4DT7B 1C5VA 4DW2U 2BLVA 3BTEE 2FZZA 2GT7A 1NU7B 4YT6H 1T8LA 1C5YB 1QGFA 1NRPH 1PPBH 3PV2A 1QR3E 2XC5A 1GJ5H 3N99A 1TA2A 2W6ID 3MU8A 4A1TA 1ABJH 4WVPE 3FAOA 1WCZA 5AVDA 5EW2H 3P70B 2OTVA 3RUOA 1N6XA 4YZUA 3SV8A 2OC0A 3VG8A 5C0TA 2VU8E 3GCHC 1TOCB 4NA9H 1CQQA 1O5FH 5C1UA 1JRTA 2GT8A 8LPRA 4MPXA 4BTTB 2H9TH 1DFPA 3LU9B 1O3MA 3QUMP 1DUAA 1GI3A 2FI3E 4GPGA 1EAXA 1OPHB 2BMGB 1RIWB 1OWEA 4ISOA 1C4U2 3NWUA 1IHTH 3T29A 1W0KD 3S9CA 1SLXB 2VWMA 4Y11E 4B76A 2ZI2H 3MNBA 1JBUH 1K9OE 4CREA 4WH6A 1P09A 1KXAA 1NFWA 3ZZDA 3RMLH 3SJ8A 3ZIAD 4ABGA 2BD2A 1MAXA 1PPEE 1TMBH 3F0PA 4A5TS 1TNHA 2HWLB 5T6GA 2ZGXH 3OFND 4X2WA 1P01A 1EUFA 2XRCA 1H8ED 1DT2A 3QGNB 4X6PA 2V35A 1GDUA 1IQMA 1AFQB 2NU4E 1P2MA 3N7OA 1D4PB 5FCKA 1OYQA 4Y7AA 1C5WB 5TJXA 2G5NA 4JCNA 4R8TB 3GYMA 4YESB 1H9LB 4JZEH 5GPIB 3EE7A 1O38A 4IN1A 1EJAA 2WPMS 1GMDF 1P2OA 1Y5AT 1HJAB 2NU1E 3RMOH 4XFQA 2PKSB 2V6NA 3O8BA 3U69H 1GMCF 2CMYA 2YNAA 3U1IB 1GI2A 1QRXA 2FIRH 2PSXA 2BY7X 3GICB 3JZ1B 4JZDH 1LVMA 1O5AB 2Z94A 3LT3A 1P9UA 1C1QA 1IOEA 2JKHA 2YMSD 2JETB 4OS5A 5FXLA 1NO9H 2FOHA 5C5OA 2ZDNA 3FFGA 1O2MA 3AAUA 4K1TA 1H8HD 2Y5FA 1YM0A 1V2ST 3QTOH 1SQOA 5AHGH 4CH8B 1E1QD 4Q4LA 5CHAB 1TX6A 4I86A 1P2QA 1L4ZA 1ELFA 3LKWA 2J97A 1BMNH 5EU8A 3RXRA 2J2UA 1P3EA 2PTNA 3TH2H 1NPMA 1ZPZA 3UNSA 1K1PA 1SFQB 4ZHAA 5JBAS 1WV7H 1P2KA 2J98B 3IG6B 4JZFH 2RCEA 2VIQA 3PV5A 5IK2D 2GDEH 1O2UA 3ZZCA 2BLQA 4YOGA 2H5CA 1TQ7B 1UTJA 2L74A 3UR9A 1QHRB 4IMZA 1AKSA 1Z8GA 4A1VA 3LJOA 2H9HA 1A4WH 2QN5T 1Y3VA 4OS1A 2ILNA 1DVAH 1OWDA 1DOJA 1SQRA 4B74A 4X6OA 1BOQA 2EI8A 3EGKH 4GHQA 5DN6D 3VFEA 2FLBH 3SQEE 4MQAA 5I25A 1KIGH 1BMLA 3MU0A 2F9OA 1WOFA 2FYRA 4CH2B 3CS7A 5EQRA 3RXQA 2ZP0H 3T62A 1A0LA 4WMDA 2BY9X 1BJVA 1TNGA 1OWJA 1C1TA 1CA8B 2G52A 1S6LA 1WUNH 2ZDLA 1T8NA 3M5NA 1FZZA 3F9EA 3SNAA 1DUEA 4INKA 1HIAA 1GBFA 1N6YA 1ZSJA 2J98A 2J9NA 4NWLA 4MDSA 5DP7A 4YTAA 3K9XB 1TRYA 3M3TA 4LK4A 1ZRBA 2WUCA 1THPB 2BY6X 1ZHPA 1N8OB 4AC9A 2G81E 2B8OH 1AE8H 3FKSD 4B6EA 1GGDB 3HPTB 1GMHF 1PYTD 1DXPA 5TCAA 4TYDA 1ZMLA 3WWFA 2HLCA 1P02A 2SNVA 3OTPA 2FMJA 6GCHF 1NZQH 2PGBB 4FU7A 3RXBA 1AY6H 4LZ4B 1P0SH 2GGVB 2Z6BD 2VH0A 2QY0B 1L1NA 1IQHA 3PRDA 4OGXA 1RFNA 4NA7A 1ANBA 4XRNA 1GBCA 2YMSB 4AX9H 2M5TA 5LPEA 1ZTJA 4Q63A 3A84A 4Y0ZE 3KQDA 3L6PA 2AMPA 3C27B 1HXEH 2C90B 3CP7A 1ELTA 2CF8H 3LC3A 1ZLRA 5HYOA 4WH8A 3ZZ3A 1T32A 2WPHS 2Z7FE 2C8YB 2FOCA 1UTNA 3NK8A 1IQEA 3PLKA 5EOKA 5DKMA 1UTOA 3DFJA 1ESTA 3RU4T 1KXBA 2Y81A 1GI6A 5K0HA 3M7TA 1GJ6A 1SGQE 2Z9JA 2G00A 1C1VH 2BX3A 3PMJA 4WMFA 3A83A 3ZVGA 4ZMAH 1CE5A 1KYNA 1ZHRA 1MBMA 1TYNA 2EQNA 4FU9A 2C8XB 1YP9A 1AB9C 1TRNA 2A4GA 1TGSZ 2J92A 3M61U 2ASUB 4I7YH 1BBRH 3ZV8A 3M36A 4DOQA 1Z1IA 4O3UA 2WPDD 4ABJA 2ZFSA 1CSOE 1O3KA 3ZVDA 2BD7A 2ZQ2A 1AD8H 1K1JA 2JH5D 3EQ0H 3ODDA 1W7XH 3EA9A 1ACBE 1S83A 4BXWA 3UWJH 1TNKA 3SV2H 1EPTC 1K22H 3P6ZB 3CNRA 2GX4A 1C5UA 4IC5A 2NU0E 2CJIA 1AE5A 1RGQA 1UW7A 1AZZA 2HPQH 1G2LA 2AGGX 1IQJA 4ISHH 3H09A 1YLNA 2AGEX 1MKXH 4GVUA 3FANA 2KAIB 2ZTYA 3FP8E 2DE8A 4K1SA 2CHAB 3E0PB 3ODFA 1HAGE 3MOCA 4HTCH 1ETTH 4K5ZA 1D6RA 1O3DA 1HB0B 2Q6FA 3PO1C 4I8GA 3LGYA 1ZGVA 3H7OA 1XUHA 2HNTC 1HNEE 3Q76A 1C2HA 3KQBA 4Y6DA 4UFFH 1FX0B 2O9QA 1OP0A 1AN1E 1C1MA 1LKBA 3VB5A 1ELDE 1J8AA 5A8XA 1NU9A 5GIBA 3UB0A 1EATA 4INLA 1DM4B 7KMEH 1BITA 1JMOH 4Q7YA 1GVKB 3GOVB 3TJNA 2ESTE 4K8YA 1BRAA 1AVXA 5KEDA 1SFIA 4XBBA 1A1RA 3QGJA 2P3UB 4GCHG 2ZU4A 3ZVBA 8GCHG 1W13U 2ODQA 1TPSA 2VH6A 2QXHA 3U28C 4B71A 2ZIQH 3UPEA 2KAIA 3GCNA 2FO9A 3GY8A 1V2MT 2BHGA 5K7RA 5EPYA 1EX3A 1MZAA 4CHAC 4JK6A 1J9CH 1G36A 2WUBA 1CHOF 2BYAX 5F8XA 5EXNA 3VB3A 1FDPA 4RI0A 3IITA 3E6PH 1SMFE 1A7SA 1PPZA 1DWBH 1GBEA 1NRNH 1P04A 4D76A 3SU1A 1BHXB 1W0ZU 3MO3A 1GHWH 2NWNA 3R0FA 1O2WA 2Z9IA 1RD3B 1LKAA 3KHVA 1TPPA 1HCGA 4J1YA 1O2XA 3ATLA 1HV7A 3PROA 1D6WA 3D65E 3UWIA 1C2JA 4WXVA 3LJJA 1DSTA 3QK1A 1F0TA 5JB9S 5GDSH 1V2VT 5H4IB 3WY8A 5C17A 4MPWA 3AASA 4X8VH 1MABB 1HYLA 1QL8A 1SHYA 3HKIB 1SGFA 1MH0A 4ASUD 1SQAA 5A8ZA 1SGFG 3SJIA 4CBNA 5LPRA 1TIOA 3K2UA 3U8OH 3NRLA 4BAHB 2TGPZ 4X1NU 5LH8A 4Q2KA 4OS2A 2BLWA 2BVXH 1MTWA 1QJ1B 5FCRA 4I33A 4NG9H 1NFYA 2QA9E 3MFJA 2ZHWH 2EY4C 3FVFB 4MG3A 6CHAB 2ZHDA 4K60A 4HI3A 3TK5A 1EFRD 3SZNA 4NSYA 1OOKB 5HMAA 1O3IA 2FS9A 4AFQA 1CBWB 3VGCB 2WZQA 2FTLE 4YLQH 2BB4A 1KDQB 1TBRH 1V2TT 3A8BA 2A1DB 3UOPA 1C1PA 1WBGB 1YY3A 2OINA 4FUBA 4AFSA 1F0UA 2AHME 2J4IA 1GMCG 1C2EA 1ZPBA 4K8BA 4FVBA 2ZFPH 2Y6TA 3EA8A 4YOJA 2A0QB 2SGPE 4AGJA 2O8WA 4ZKNU 2QF0A 2C8ZB 1EAUA 3RXJA 4CRGA 1OS8A 3DSPA 1GCDA 4UFDH 3P92A 2QC2A 1RS0A 2QF4A 2UUFB 3ATKA 2K1QA 2BQWB 3C1KA 1E0FD 5A0CA 2ZCHP 1Y8TA 1P9SA 4KTCA 3A8AA 1NC6A 1D3PB 5AFYH 1RTKA 1VGCB 5ESBA 1AVWA 2P8OB 1ARBA 4XDEA 5A0AE 5SGAE 1V2RT 3UFAA 3AVZA 3GY7A 4Z6AH 2ZC9H 1W12U 1O2OA 5CMXH 3RC5A 3LGUA 1GCTB 1F0RA 1FXYA 3F68H 1SG8B 1KDQA 3TVJB 5ETXA 3EYDA 3MNXA 1KSNA 2JJ1D 5ABWA 2WYJA 1C4V2 3W95A 4WXIA 5JYIA 1EZUC 2QYIA 1O3LA 5G4BA 3EAJA 2B7DH 1H4WA 5EGMA 4IMQA 3TJVA 1L4DA 1EAIA 1TBQH 2JH6D 2W5EA 3A87A 1NRSH 5I46H 2KCPA 3LGWA 1HAYB 1WU1A 1SQTA 1K1MA 3PV4A 1FY1A 1H9HE 1K1OA 2GMTC 1B0EA 1LHDH 2AH4X 2RDLA 5EIYA 3KN2A 3HGPA 3SNCA 4CR9A 3A89A 1TRMA 2OC1A 1GI4A 2ZCKP 4CRCA 4XBCA 5A8YA 2XBVA 1Z6JH 1W11U 3SO3A 1UK3A 4IBLH 4ZXYH 3KYGA 3SU4A 2V3OH 1OWIA 3D49H 4FVDA 4TWWA 3Q00A 3I77A 2ZFFH 1Q2WA 1Z6EA 1GBDA 3PLPA 3VXEH 2QXGA 2XBYA 3SV6A 3URDA 2QF5A 3T27A 1DPOA 3F2FA 4TWYA 2VIOA 2WINI 2IPQX 1SSXA 1O3JA 1QL9A 3D62A 4U2WA 2ZPSA 2TIOA 1TNIA 4F4OC 2PLXA 3MNCA 5CDFE 1GMHG 1S0RA 2HNTF 1EOLA 3GCHB 1MU8B 1AIXH 5FBEA 1QA0A 3ZZ8A 4BTIB 2EI7A 1WAYB 5LGOA 2C4FH 1VITF 1JOUB 3AW0A 2QE7D 1O5CB 1IQFA 3SU2A 4UDWH 6GCHG 4WF8A 3E90B 1V2OT 4X8UH 1W0JD 1C2MA 1EB1H 1WTHD 1JXPA 3A8CA 4U32A 4RSPA 3VEQB 1Z1JA 4BNRA 1NRQH 4JMYA 3T28A 2M2AA 4NFFA 4DG4A 1S82A 2GCHF 1GJ7B 4O97A 3TLOA 5JBTA 1MD7A 4KTSA 1ETSH 4UFGH 4FUGA 1P10A 1VKYA 1AHTH 1KXEA 2VINA 1KXFA 4WJG2 3SYJA 1HBTH 5HM9A 3MQKC 1LPGB 5DK1A 1A5GH 3A88A 2AFQB 1SGRE 3TK6A 4LOYH 1MZDA 4B1TA 1YLDA 4ACBA 4JZ1A 5DP9A 3RXAA 1W10U 3SBKA 1G2MA 3S7KB 1C5RA 1ELVA 1O5DH 1T4VH 5GCHF 3UNRA 2RG3A 3KYFA 1V3XA 1ESBA 1FIZA 4YO9A 4DIIH 3E0NB 3KGPA 3K6ZA 3ZZ4A 5C3NA 2H9EH 1DE7H 1HLTH 2A7CA 1W8BH 3E3TA 1KLTA 1QQ4A 2W7UA 3UUZA 1O2JA 3T5FH 1O0DH 2Z9KA 1FY8E 4ZUHA 1V2LT 1TGNA 4YOIA 1QFKH 1O3OA 1CGIE 1DWDH 3FOAA 1SGNE 4X8SH 4I8JA 1GBJA 5EXLA 4E7RG 1AKSB 1BB0B 2OLGA 3RP2A 2OCVB 2R9PA 2R3UA 3DA9B 3KQEA 2I6QA 2ZTZA 3SORA 1SC8U 3JZ2B 3PM3A 1G3EA 2WYGA 2F3CE 1BRBE 2FWWA 3U1JB 2GZ7A 1BIOA 2QCYA 7LPRA 4IN2A 3MWIU 2TGAA 1G9IE 2PFEA 1B0FA 3FP6E 2WPJS 1C2GA 1SGTA 4NIXA 4U01A 5DSFA 1CU1A 1NTPA 2FLRH 2FOBA 2GJGA 3ITIA 3NPSA 1GDNA 4Y7BA 4ABDA 3TGJE 2LPRA 3SGQE 4PROA 2WV4A 1D3TB 4AORA 1SGCA 1UTMA 3GYLB 2GTBA 3BTKE 4CBOA 1LMWB 2PKAA 1MQ6A 2D26C 4NFEA 4MNYA 7ESTE 3GY2A 1SVPA 1ZSKA 1HIAB 2BXUH 1K1IA 3BV9B 1YLCA 4X2VA 1RJXB 1G37A 1K28D 2PUQH 3U98H 1DLKB 5GXPA 5LPFA 1HAOH 1OP8A 5C2ZA 3MH4A 5J4SA 5JPMH 1U6QA 5FPSA 1VITH 1O3AA 2BVRH 3KQ5A 3A7WA 2VVCA 3D23A 4MPUA 3TGKE 2AS9A 2GCTC 3NCLA 1O2IA 2UUJB 1FY4A 1J17T 2BDIA 3P8NA 4X1QU 1KTTB 1O3HA 2XXLA 3DSGA 3MMGA 4ZH8A 1F5LA 3M5OA 2A4QA 4TY7A 1YKTA 2THFB 5DGJA 1OHHD 5BRRE 1GBKA 3RXTA 1K0HA 1E36B 2SGAA 1TONA 5C5NA 3FZZA 1PPHE 1GJCB 5GNDA 3ZV9A 3BTGE 5E8EH 3NUMA 2ZO3H 2FOAA 2KR7A 4ZKOU 2A31A 1DANH 4DY7B 3QZRA 1Y3XA 1CHOG 4HG6A 1C4Y2 1COWD 3AK5A 1G3BA 2KX4A 2UWPA 5AFZH 1VCPA 2W7SA 1QRWA 3M7QA 1A5HA 3SI3H 1QTFA 1Z8RA 2P3FH 2ZGHA 3A7XA 2P93A 3B23B 4GAWA 1Q3XA 3HGNA 1X7AC 1DX5M 4XD7D 5DP8A 2XCFA 5EODA 3OEHD 1GBHA 3RDZA 3RMMH 1O2PA 1GI8B 4P02A 3DD2H 3BF6H 5B6OA 3MTYA 4UFEH 1TGTA 1HJ9A 5HXFA 4AFZA 4Y8YA 2EI6A 2VBCA 5L6NH 3PTBA 1JRSA 1BTYA 1IQGA 2BZAA 2C93B 5JDUB 2V3MA 1E37B 1AO5A 4MNWA 2SGFE 4OS4A 2FX6A 4FOUC 1ZJKA 2BD9A 2XC4A 1QB9A 1EZXC 5E0GA 4BAKB 5FHTA 1V2UT 2FI4E 3PWBA 4B73A 2G55A 1Z71A 1QZ8A 2ZGCA 4Q7XA 1ID5H 2ZTXA 2CV3A 4JYTA 3RXUA 3GY3A 3OEED 4NIWA 4AZ2B 4OS6A 4D7FA 1MAYA 2PHBA 5CHBA 3QLPH 1FUJA 1A61H 4CRBA 1O2ZA 2D8WA 3Q77A 1JIRA 4ABHA 5FX5A 3UREA 3UR6A 3BTWE 1HUTH 4Y8XA 3KF2A 4UE7H 1SPJA 3H5CB 4HZHA 4X0WU 4NIYA 2G4TA 3LGVA 2Q6GA 1CT2E 3OSYA 2VGCC 1AB9B 1GI7B 2F43B 2UUKB 4H6SB 4A1XA 1GG6C 2XC0A 4DCDA 1A3BH 1C1WH 4BXSA 2WPKS 2H2ZA 1SL3A 2Z9GA 1RTLA 3ZVFA 3ZZ5A 3V12A 1IHSH 1LPKB 1S6HA 1QB6A 2EC9H 3MU5A 1P12E 1Z7KA 1DITH 1QURH 3GDSA 1O2NA 2C3SA 5BPEA 1EPTB 3O8DA 3SGAE 5L2YH 2XBXA 3GY5A 2ALPA 3SU3A 1C5OH 3KQCA 1TNLA 2SGQE 1O2QA 3U8RH 4K2YA 1SLUB 1BRUP 3U8TH 2BQ7B 1E79D 2AEIH 2ZU2A 3P8FA 1W14U 2BDAA 3VXFH 1NESE 3OX7U 2AIQA 5A0BA 5B6LA 2XNIA 1OP2A 2BVSH 4FUDA 2VIWA 4Q7ZA 1O37A 1AUTC 3MH6A 4GHTA 9LPRA 1TABE 3PO1B 1V2NT 4Y79A 3MI4A 4CR5A 1BMFD 4TPIZ 3SOSA 1H8DH 1DWEH 1MMJN 2FS8A 3UNQA 3TH4H 1HRTH 4ACAA 1XKBC 2ANWA 5DO4H 1D9IA 1AVGH 2D1JA 3ZZ6A 2JJ2D 1UVTH 4RKOB 3TNSA 1C5XB 4AOQA 3SHCH 1VCWA 3QWCH 3ZZAA 1EPTA 2HPPH 4ZHMU 3V0XA 4AGKA 1YC0A 4HGCA 2HNTE 3BIVH 3QDZB 2V0BA 3NXPA 2QAAA 1J16A 1YPGH 4DJZB 1F5KU 1GI9B 1LQEA 1P2IA 1MTNC 1Z8IB 4MPVA 3KNXA 4IS5A 1YPHC 1IQIA 1K2I1 1YYY1 2ZPQA 1DS2E 3RXFA 3P8OA 3N7DA 1HAVA 4BANB 4CHAB 1HAZB 3RLWH 2L6OA 4IGDA 2H5DA 2NU3E 5HIZA 1JWTA 3B9FH 1D3QB 2Y82A 3K6YA 4JYVH 3STJA 1TMUH 1DDJA 3TIUA 1EB2A 4INHA 1C2KA 4Q80A 2WSSD 1O3GA 2CK3D 3E91A 4X6NA 1E34B 3M35A 1C1OA 1EXFA 3LC5A 4JK5A 1UVSH 2VJ1A 4JZIA 1S81A 1KTSB 4O03A 1NROH 3LONA 1T4UH 2FOFA 1LHGH 3LIWA 2LELA 4AYYB 7GCHF 1QBNA 3BG8A 3BTME 1UCYK 3I78A 1RTFB 2D2DA 2LP6A 4MVNA 4KGAA 2K0QA 4AN7A 1Y3YA 1LDTT 1V2WT 3O8CA 2Y7ZA 1GPZA 2GD4B 2OUAA 1NM6A 1H1BA 1ZR0A 4I8HA 2GCHG 4UEHH 4HFPB 1O2RA 2PV9B 5FPTA 1UVUH 4ZKRU 1GHAF 4BTUB 5FX6A 2OC8A 2UWLA 2RA0A 1YF4A 2CN0H 2J38A 1O5BB 2ZDAH 3SJKA 3ATWA 3QZQA 2HVXA 1FPHH 1E1RD 3HATH 3MHWU 4X2YA 4IW4E 4ASHA 2VVVA 2CXVA 2WHXA 4F48B 4GLYA 1EASA 4ZHLU 1BMMH 3MYWA 3STIA 3F9FA 3OY6U 4MLFB 3SZEA 1KXDA 2C8WB 1TNJA 1OWHA 1BQYA 1FY3A 4ESTE 5EXMA 2F9UA 5GCHG 1C2FA 2K8IA 1YCPK 3SI4H 2ZHQH 1BTZA 4TSFD 1YPLH 4Y10E 2GV7A 1O2VA 3BSQA 2FODA 3KCGH 1O34A 1GHYH 2H1UA 1EOJA 2JIZD 1NS3A 2YNBA 1GMDG 1HPGA 1ZGIA 2ZHEH 1UJ1A 1C5ZB 3RXLA 2A45B 1GBMA 3L3TA 1TAWA 2XOKD 1ZSLA 2QF3A 3RXGA 1O3CA 2ZDKA 2ODPA 1LVOA 1Z8JB 2A5IA 2R0LA 1PPFE 4SGAE 3SN8A 9ESTA 2VIPA 3RM2H 5EJLA 1C5PA 3ZZBA 1Y3WA 1GL1A 4THNH 1XKAC 2B0FA 1BUIA 2VWOA 1ZHMA 2AGIX 4MNXA 2ZHFH 3RC6A 1YGCH 4UD9H 3RXMA 2F9VA 3PYHA 1ANDA 2G51A 4TY6A 1GHBF 1PQ5A 4VGCC 1FNIA 3A7TA 4SGBE 1AZ8A 2JDID 3QN7A 5DP3A 3OYPA 1BBRE 4FUJA 1UHBB 5JBBS 3RLYH 1PQAA 3BN9A 3F2HA 1T8MA 2J34A 1LQDB 4BOHA 4F55A 5IYTA 1TLDA 1TPOA 4F49A 2BDYA 5T1VA 1KLJH 1ZJDA 4Y76A 3S0NA 5AF9H 2ZNKH 1J15A 5EJ1A 1C1UH 8ESTE 1A0HB 1C5QA 1YPMH 3SUDA 2A4RA 3PMAB 4RN6A 1BRCE 5F8TA 3W1EA 2VVUA 4D9QA 5KECA 3PWCA 3ZVEA 1XVOA 2KM0A 1C5LH 1A3EH 3RXPA 3PRBA 2AYWA 3M37A 3CS0A 3A80A 1F2SE 3A7YA 3BEIB 1YPEH 3BG4C 5DPAA 2GMTB 4TPYA 1LCYA 1CT4E 1EZQA 1O5EH 2RA3A 1ABIH 1L0ZA 3FZDA 2VB0A 3OTJE 4CRAA 1TGCA 4U30A 1UHBA 5HGGA 2VNTA 1V2PT 1GDQA 2HALA 3DCLA 4NGAH 2B9LA 2ZFTA 4XOJA 2DUCA 4ABEA 2TPIZ 4LZ1H 1SGIB 2FOEA 2BY5X 1CA0C 1DY9A 1O2YA 1MCVA 4OM9A 4DIHH 1SOZA 4H42U 1Y5BT 1MTSA 4OS7A 3CENA 3RXEA 1ZMJA 3Q3YA 1FN8A 5CE1A 2BD5A 2BX4A 5C20A 1BZXE 3OE7D 1HJ8A 3DHKH 4OGYA 5FBIA 1HAIH 4AYVB 1O31A 2BLOA 1C5TA 1MCTA 2AMQA 2A5KA 3A82A 3V13A 1Y59T 2IN2A 2OQ5A 1ELBA 1OKXA 2ZU5A 1VZQH 2EEKA 3TU7H 2BZ6H 1KY9A 1LHFH 2FX4A 2BDCA 3RXCA 3SV9A 3RXOA 1O2GH 1O2KA 2LNCA 1NBMD 1G32B 1DXWA 5EW1H 2O8UA 1L1GA 1MKWK 4KP0A 1BJUA 2TGDA 4I8LA 2HOBA 1D3DB 1SLWB 1L1JA 2QIQA 1PQ8A 2FOMB 1TX7A 5J4QA 4P00A 1EJNA 3IWMA 1XXDA 3VPKA 4FXGH 2ZECA 2F9NA 4RT1A 3RXIA 1WQSA 2FI5E 1ELAA 1O3PB 1EP5A 3SNEA 1TQ0B 5HM2A 4XE4A 1CGJE 4ISIH 5ESTE 1FAXA 1ELEE 2OXSA 3UQVA 6ESTA 3E8LA 2GKVE 3RXVA 1LVYA 2SNWA 4NA8A 1RIWC 2F4LA 2A5AA 2GP9B 5DP4A 1C5NH 3BIUH 3P17H 1O3NA 2Y5GA 3DUXH 1ESAA 4I8KA 1TA6A 1L2EA 1GHZA 2BTCE 1EZSC 2PKAB 2ANKH 5GWZA 1DLEA 1OXGA 2BDGA 4GSOA 5EJZA 2OC7A 4BAMB 2ULLA 5C1XA 3MU1A 1AQ7A 1W7GH 1O5GH 2Y5HA 2SGDE 1NN6A 1A0JA 2ZQ1A 2BD4A 1ZPCA 2HRVA 4A7IB 1Y5UT 1W0YH 1UK2A 4MTBA 4Z0KA 1GI5A 1AFQC 3LPRA 4B6FA 1BHXF 1CGHA 1SI5H 2J94A 2OBOA 1GHVH 5C94A 1O2LA 2CGAA 5C1YA 3RMNH 5F53A 4E7NA 4ZROA 1XUKA 2VWNA 1EQ9A 1GJAB 3ATMA 1LVBA 4K1EA 2JH0D 4B75A 1SOTA 1TFXA 1FPCH 2R3YA 4DT4A 3ZYEA 3FP7E 4TT3D 1HJAC 2HLDD 2Z3CA 3TNTA 3TITA 2PKSC 4FUHA 4KKDA 2FPZA 4AB8A 4XSKU 2P3TB 4CRDA 2KZ4A 1QY6A 2G5VA 4O3TA 3LDXH 2R2WU 3LH3A 3HKJB 5JBCS 3M3SA 1S84A 2JETC 1THRH 3T2NA 3O8RA 3F3BA 1NRRH 4ISNA 2BOKA 2O8MA 1BCUH 2P16A 1WSSH 1JIMA 1BTPA 1P57B 4YT7H 1IQNA 2XWAA 5C67A 1E35B 1V2KT 2PGQB 3UY9A 1T7CA 3RXKA 3S7HB 2GCTB 4IC6A 5CHAC 3S69A 3GCTF 2I6SA 4QT8C 1P2JA 5GJ4B 2FTMA 1XM1A 2PWXA 4NWKA 1HGTH 3HK6B 1F92A 1WYKA 1EAWA 2CF9H 2FM2A 3UQOA 2BY8X 1GJBB 2F83A 1TE0A 1GJ4H 2ZA5A 2KCAA 1DWCH 5EG4A 1DSUA 2PW8H 1XXFA 2ZPRA 3Q3XA 4ZCNA 3MNSA 3W94A 3LH1A 1O33A 2ZZUH 1V2QT 4X6MA 1BTXA 1GJDB 2V3HH 3GISB 1FY5A 4I31A 1GHXH 1VR1H 3TJOA 3SHAH 2VWLA 3UIRA 3SUGA 1CT0E 1NBME 4H4FA 1ANCA 4MNVA 1XUIA 1GBTA 3TK9A 2ZWLH 1WDIA 3S9AA 4ABIA 1AWHB 3SNBA 2TGTA 1FI8A 2FDAA 2Z3DA 2GZ9A 1OYTH 3LGIA 1IQLA 1TBZH 2BDBA 4X1RU 3BTTE 3QTVH 3KL6A 2ODYB 5EQQA 7GCHG 1BTUA 5E2PA
chains in the Genus database with same CATH topology
1WQVH 1QJ7B 3ELAH 1UTLM 4NZQA 3Q3KA 1HAHH 2Y80A 3R3GB 1Q31A 1BTHH 1QIXB 1UMAH 2BD3A 2J95A 2TRMA 1SHHB 3M3VA 2STAE 2QXJA 2ZCLP 3F6UH 1MU6B 3EDXB 1RRKA 1XX9A 1GJ9B 2GVFA 5DP5A 1QRZA 3RXDA 1CVWH 1INCA 1F7ZA 2FXRA 1GHAG 1P05A 3BEUA 1VJAU 1SGPE 3T26A 3GY6A 3V7TA 5T6DA 1N8OC 3GY4A 3P95A 4AB9A 1UCYH 1TPAE 4B2BA 1ZMNA 2Q1JA 2AMDA 1ETRH 1C2LA 1LPZB 1ZZZA 2WV5A 1GGDC 2BQ6B 3G01A 3M5LA 1QQUA 1ZOMA 3A86A 1IQKA 1YBWA 1GI0A 2ANYA 2STBE 4AG1A 1HXFH 1OWKA 3ZVCA 3MU4A 1THSH 1FQ3A 1FV9A 2GV6A 1XUFA 1F0SA 2PR3A 2Y7XA 1O35A 3DFLA 1FLEE 4D8NA 1FAKH 1GL0E 1AI8H 1GBIA 4FUCA 2VGCB 2FP7B 1GG6B 2PSYA 5E2OA 1QCPA 1SGEE 3OU0A 4X1SU 1ZTLA 2Z3EA 1C2IA 2PTCE 1YCPH 3BTDE 1C2DA 1W3CA 2FYQA 1VJ9U 3LOXA 1LHEH 3VB6A 1ELGA 1HAXB 3URCA 4ZXXH 1ANEA 4Y0YE 1EJMA 2W26A 3QX5H 3MO9A 1P3CA 1ELCA 1SLVB 1A2CH 3VB4A 1GHBG 1PPCE 1EKBB 3AAVA 5F8ZA 1NY22 2WPIS 2BXTH 1O30A 5DG6A 1XUGA 4KTUA 3I29A 3EE0B 1GI1A 4KELA 1XVMA 4ISLA 1GBLA 3TJUA 1BT7A 2TBSA 2QV1A 2YOLA 1FJSA 1QBVH 2IPHA 5A09A 1IAUA 3NZIA 3SW2B 5EQSA 4XBDA 2W3IA 2ZU3A 1P06A 1PJPA 3PTNA 1TOMH 3AW1A 3BTHE 3T25A 4DVAU 4NSVA 2H6MA 4K3JA 1HAVB 4YM9A 1ZRKA 1TGBA 4NCYA 2IJOB 2F9BH 2ZGJA 4R0IA 3TPIZ 1O2SA 2OBQA 1M9UA 2QXIA 3ZZ9A 1GBBA 4ABBA 3BEFB 1MD8A 3PMHB 3PLBA 1C9TA 4B2AA 1UVPA 2ANMH 1O32A 4WMEA 1QL7A 1B7XB 2UUYA 4YLUA 4K69A 3M7UA 3A81A 4NZLA 3SU0A 1T31A 1TB6H 2WPLS 2CHAC 2FOGA 1MTNB 1QNJA 1PQ7A 1LO6A 2R0KA 3KIDU 1MUEB 1B5GH 4Y8ZA 1LHCH 3P8GA 3RM0H 1P11E 2FESH 3RC4A 5E0JA 3PMBB 3E16B 1RXPA 3U9AH 5E0HA 1SBWA 2G4UA 1PYTC 3SV7A 2ZEBA 1UTPA 4JYUH 4ZAEA 4X1PU 2FEQH 2BM2A 1BTWA 3SUFA 4X8TH 2A2XH 2G8TA 1YPHE 5F03A 2ZU1A 3SNDA 2ZFQH 2IOTA 3UTUH 2XBWA 1TWXB 3GDUA 4Y71A 3RXHA 1FN6A 2F9PA 2GDDA 1VITG 1AWFH 1LTOA 1QA7A 2ZKSA 3MO6A 2BD8A 3ZYDA 2A7HA 1T8OA 3K65B 1GBAA 3SGBE 3ZZ7A 4D7GA 4BAOB 1W2KH 1AU8A 2XCNA 4D9RA 3ATIA 4LXBH 4UONA 1WTGH 8KME2 3NKKA 3LGTA 5DJ7A 3VB7A 5L30H 1TALA 2OD3B 2B5TB 4CRFA 1O3FA 2Q6DA 1GVZA 3L33A 4J2YB 3E1XB 2XTTB 1G3DA 3F1SB 5L2ZH 4M7GA 4ABFA 3A85A 1YPJH 2EA3A 1TMTH 2XWBI 3EA7A 1OSSA 5T6FA 1H8IH 3RU4D 2O8TA 1MKWH 4NIVA 4X2XA 2Z9LA 3A8DA 1C5SA 1O2HA 1KXCA 1UCYE 4ZKSU 1Y3UA 4WWYA 1DICA 3TGIE 1S85A 2ZFRH 1FMGA 1NFUA 1OX1A 1MQ5A 4I32A 3TH3H 1UTQA 1CO7E 5T3HA 1N1LA 2A32A 2F91A 3SU6A 1PPGE 3B8JA 2ZGBH 4WY3A 1C1SA 2HGTH 1AGJA 4DURA 2A7JA 1V2JT 2ZDVH 4DGJA 2BOHB 2SFAA 3M5MA 4ABAA 1P03A 4AG2A 2W3KA 3ENSB 3SJOA 2P94A 3SJ9A 3V3MA 1NT1A 1S0QA 1C1NA 3ZVAA 3RXSA 6CHAC 1O39A 2VIVA 3BTQE 1BBRK 3ESTA 2OP9A 2P95A 3UOUA 2XW9A 5TCCA 1SR5C 2SGEE 4VGCB 5FPYA 1CBWC 1HAPH 3VGCC 4B2CA 4AFUA 2AIPA 4E05H 4O9VA 1MTUA 4GUXA 1XUJA 1O2TA 2ALVA 3SU5A 3H7TA 1K21H 2QGRA 2OQUA 1QJ6B 2ZF0H 5PTPA 2BDHA 1SB1H 1EP6A 1SGYE 3A7ZA 2ZG0H 1AUJA 1TX8A 1ARCA 4A92A 5IDKA 1MKXK 4RKJB 2A4OA 4A6LA 1BA8B 1BDAA 3A7VA 2NU2E 3F9HA 1K1LA 1GJ8B 4FUEA 1VGCC 1UTKA 6LPRA 4H6TA 2P8OC 4FU8A 1P2NA 2O8LA 1NFXA 3BG4B 1C1RA 3GCTG 3MH5A 3OY5U 1GVLA 1UK4A 1H9IE 1XMNB 1S6FA 2UWOA 1AMHA 1E38B 4BAQB 1SGDE 3BTFE 3SQHE 1C5MD 2P59A 1FONA 1GCTC 1ZYOA 1G30B 5JB8S 1O36A 1GWAA 1A5IA 2VIDA 1ZTKA 5EPNA 5FAHA 1QB1A 1KLIH 1PFXC 1P8VC 2R2MB 1VCQA 1QBOA 1F5RA 1S5SA 3PB1E 4E06H 1CA0B 1DY8A 1HDTH 2GZ8A 2ZDMA 3GDVA 1O3BA 1A46H 1CHGA 1HFDA 3GCOA 1V6DA 5F6MA 1FIWA 5DP6A 2A2QH 1ORFA 1O3EA 2PUXB 1YCPM 3HK3B 1UVOA 3KEEA 1YPKH 3MH7A 1C9PA 4FUIA 3DT0H 3F9GA 2AERH 1G3CA 1MTVA 3S9BA 5A2MH 3QO6A 2DE9A 1MBQA 1AFEH 1J14A 3SUEA 1K1NA 4GCHF 8GCHF 1UO6A 1BMAA 3RU4E 2XYAA 4FUFA 4DT7B 1C5VA 4DW2U 2BLVA 3BTEE 2FZZA 2GT7A 1NU7B 4YT6H 1T8LA 1C5YB 1QGFA 1NRPH 1PPBH 1QR3E 2XC5A 1GJ5H 1TA2A 3MU8A 4A1TA 1ABJH 4WVPE 3FAOA 1WCZA 5AVDA 5EW2H 3P70B 2OTVA 3RUOA 1N6XA 4YZUA 3SV8A 2OC0A 2VU8E 3GCHC 1TOCB 4NA9H 1CQQA 1O5FH 5C1UA 1JRTA 2GT8A 8LPRA 4MPXA 4BTTB 2H9TH 1DFPA 3LU9B 1O3MA 3QUMP 1DUAA 1GI3A 2FI3E 4GPGA 1EAXA 1OPHB 2BMGB 1RIWB 1OWEA 4ISOA 1C4U2 3NWUA 1IHTH 3T29A 3S9CA 1SLXB 2VWMA 4Y11E 4B76A 2ZI2H 3MNBA 1JBUH 1K9OE 4CREA 4WH6A 1P09A 1KXAA 1NFWA 3ZZDA 3RMLH 3SJ8A 4ABGA 2BD2A 1MAXA 1PPEE 1TMBH 4A5TS 1TNHA 2HWLB 5T6GA 2ZGXH 4X2WA 1P01A 1EUFA 2XRCA 1DT2A 3QGNB 4X6PA 2V35A 1GDUA 1IQMA 1AFQB 2NU4E 1P2MA 3N7OA 1D4PB 5FCKA 1OYQA 4Y7AA 1C5WB 5TJXA 2G5NA 4JCNA 4R8TB 3GYMA 4YESB 1H9LB 4JZEH 5GPIB 1O38A 4IN1A 1EJAA 2WPMS 1GMDF 1P2OA 1Y5AT 1HJAB 2NU1E 3RMOH 4XFQA 2PKSB 2V6NA 3O8BA 3U69H 1GMCF 2CMYA 2YNAA 3U1IB 1GI2A 1QRXA 2FIRH 2PSXA 2BY7X 3GICB 3JZ1B 4JZDH 1LVMA 1O5AB 2Z94A 3LT3A 1P9UA 1C1QA 1IOEA 2JKHA 2JETB 4OS5A 5FXLA 1NO9H 2FOHA 5C5OA 2ZDNA 3FFGA 1O2MA 3AAUA 4K1TA 2Y5FA 1YM0A 1V2ST 3QTOH 1SQOA 5AHGH 4CH8B 5CHAB 1TX6A 1P2QA 1L4ZA 1ELFA 3LKWA 1BMNH 5EU8A 3RXRA 2J2UA 1P3EA 2PTNA 3TH2H 1NPMA 1ZPZA 3UNSA 1K1PA 1SFQB 4ZHAA 5JBAS 1WV7H 1P2KA 3IG6B 4JZFH 2RCEA 2VIQA 2GDEH 1O2UA 3ZZCA 2BLQA 4YOGA 2H5CA 1TQ7B 1UTJA 3UR9A 1QHRB 4IMZA 1AKSA 1Z8GA 4A1VA 3LJOA 2H9HA 1A4WH 2QN5T 1Y3VA 4OS1A 2ILNA 1DVAH 1OWDA 1DOJA 4B74A 4X6OA 1BOQA 2EI8A 3EGKH 4GHQA 3VFEA 2FLBH 3SQEE 4MQAA 5I25A 1KIGH 1BMLA 3MU0A 2F9OA 1WOFA 2FYRA 4CH2B 3CS7A 5EQRA 3RXQA 2ZP0H 3T62A 1A0LA 4WMDA 2BY9X 1BJVA 1TNGA 1OWJA 1C1TA 1CA8B 2G52A 1WUNH 2ZDLA 1T8NA 3M5NA 1FZZA 3F9EA 3SNAA 1DUEA 4INKA 1HIAA 1GBFA 1N6YA 1ZSJA 2J9NA 4NWLA 4MDSA 5DP7A 4YTAA 3K9XB 1TRYA 3M3TA 4LK4A 1ZRBA 2WUCA 1THPB 2BY6X 1ZHPA 1N8OB 2G81E 2B8OH 1AE8H 1GGDB 3HPTB 1GMHF 1PYTD 1DXPA 5TCAA 4TYDA 1ZMLA 2HLCA 1P02A 2SNVA 2FMJA 6GCHF 1NZQH 2PGBB 4FU7A 3RXBA 1AY6H 4LZ4B 1P0SH 2GGVB 2Z6BD 2VH0A 2QY0B 1L1NA 1IQHA 4OGXA 1RFNA 4NA7A 1ANBA 1GBCA 4AX9H 5LPEA 2M5TA 1ZTJA 3A84A 4Y0ZE 3KQDA 3L6PA 2AMPA 3C27B 1HXEH 2C90B 3CP7A 1ELTA 2CF8H 3LC3A 1ZLRA 5HYOA 4WH8A 3ZZ3A 1T32A 2WPHS 2Z7FE 2C8YB 2FOCA 1UTNA 3NK8A 1IQEA 3PLKA 5EOKA 5DKMA 1UTOA 3DFJA 1ESTA 3RU4T 1KXBA 2Y81A 1GI6A 5K0HA 3M7TA 1GJ6A 1SGQE 2Z9JA 2G00A 1C1VH 2BX3A 3PMJA 4WMFA 3A83A 3ZVGA 4ZMAH 1CE5A 1KYNA 1ZHRA 1MBMA 1TYNA 4FU9A 2C8XB 1YP9A 1AB9C 1TRNA 2A4GA 1TGSZ 2J92A 3M61U 2ASUB 4I7YH 1BBRH 3ZV8A 3M36A 4DOQA 1Z1IA 4O3UA 4ABJA 2ZFSA 1CSOE 1O3KA 3ZVDA 2BD7A 2ZQ2A 1AD8H 1K1JA 2JH5D 3EQ0H 3ODDA 1W7XH 3EA9A 1ACBE 1S83A 4BXWA 3UWJH 1TNKA 3SV2H 1EPTC 1K22H 3P6ZB 2GX4A 1C5UA 4IC5A 2NU0E 2CJIA 1AE5A 1RGQA 1AZZA 2HPQH 1G2LA 2AGGX 1IQJA 4ISHH 2AGEX 1MKXH 4GVUA 3FANA 2KAIB 2ZTYA 3FP8E 2DE8A 4K1SA 2CHAB 3E0PB 3ODFA 1HAGE 3MOCA 4HTCH 1ETTH 4K5ZA 1D6RA 1O3DA 1HB0B 2Q6FA 3PO1C 4I8GA 3LGYA 1ZGVA 3H7OA 1XUHA 2HNTC 1HNEE 3Q76A 1C2HA 3KQBA 4Y6DA 4UFFH 2O9QA 1OP0A 1AN1E 1C1MA 1LKBA 3VB5A 1ELDE 1J8AA 5A8XA 1NU9A 5GIBA 1EATA 4INLA 1DM4B 7KMEH 1BITA 1JMOH 4Q7YA 1GVKB 3GOVB 3TJNA 2ESTE 4K8YA 1BRAA 1AVXA 1SFIA 4XBBA 1A1RA 3QGJA 2P3UB 4GCHG 2ZU4A 3ZVBA 8GCHG 1W13U 2ODQA 1TPSA 2VH6A 2QXHA 4B71A 2ZIQH 3UPEA 2KAIA 3GCNA 2FO9A 3GY8A 1V2MT 2BHGA 5K7RA 5EPYA 1EX3A 1MZAA 4CHAC 4JK6A 1J9CH 1G36A 2WUBA 1CHOF 2BYAX 5F8XA 5EXNA 3VB3A 1FDPA 3IITA 3E6PH 1SMFE 1A7SA 1PPZA 1DWBH 1GBEA 1NRNH 1P04A 4D76A 3SU1A 1BHXB 1W0ZU 3MO3A 1GHWH 2NWNA 3R0FA 1O2WA 2Z9IA 1RD3B 1LKAA 3KHVA 1TPPA 1HCGA 4J1YA 1O2XA 3ATLA 1HV7A 3PROA 1D6WA 3D65E 3UWIA 1C2JA 4WXVA 3LJJA 1DSTA 3QK1A 1F0TA 5JB9S 5GDSH 1V2VT 5H4IB 3WY8A 4MPWA 3AASA 4X8VH 1HYLA 1QL8A 1SHYA 3HKIB 1SGFA 1MH0A 1SQAA 5A8ZA 1SGFG 3SJIA 4CBNA 5LPRA 1TIOA 3K2UA 3U8OH 4BAHB 2TGPZ 4X1NU 5LH8A 4Q2KA 4OS2A 2BLWA 2BVXH 1MTWA 1QJ1B 5FCRA 4I33A 4NG9H 1NFYA 2QA9E 3MFJA 2ZHWH 3FVFB 4MG3A 6CHAB 2ZHDA 4K60A 4HI3A 3TK5A 3SZNA 4NSYA 1OOKB 5HMAA 1O3IA 2FS9A 4AFQA 1CBWB 3VGCB 2FTLE 4YLQH 2BB4A 1KDQB 1TBRH 1V2TT 3A8BA 2A1DB 3UOPA 1C1PA 1WBGB 2OINA 4FUBA 4AFSA 1F0UA 2J4IA 1GMCG 1C2EA 1ZPBA 4K8BA 4FVBA 2ZFPH 2Y6TA 3EA8A 4YOJA 2A0QB 2SGPE 4AGJA 2O8WA 4ZKNU 2QF0A 2C8ZB 1EAUA 3RXJA 4CRGA 1OS8A 1GCDA 4UFDH 3P92A 2QC2A 1RS0A 2UUFB 3ATKA 2K1QA 2BQWB 3C1KA 1E0FD 5A0CA 2ZCHP 1Y8TA 1P9SA 4KTCA 3A8AA 1NC6A 1D3PB 5AFYH 1RTKA 1VGCB 5ESBA 1AVWA 2P8OB 1ARBA 4XDEA 5A0AE 5SGAE 1V2RT 3UFAA 3AVZA 3GY7A 4Z6AH 2ZC9H 1W12U 1O2OA 5CMXH 3RC5A 3LGUA 1GCTB 1F0RA 1FXYA 3F68H 1SG8B 1KDQA 3TVJB 5ETXA 3EYDA 3MNXA 1KSNA 5ABWA 2WYJA 1C4V2 3W95A 4WXIA 5JYIA