2PTCE

The geometry of the reactive site and of the peptide groups in trypsin, trypsinogen and its complexes with inhibitors
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Geometry of the Reactive Site and of the Peptide Groups in Trypsin, Trypsinogen and its Complexes with Inhibitors
pubmed rcsb
source organism Bos taurus
molecule tags Complex (proteinase/inhibitor)
molecule keywords BETA-TRYPSIN
total genus 52
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1982-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2ptcE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2ptcE02
2NU0E 2WPHS 1IQHA 4YT6H 3KQEA 4X2WA 1AZZA 2OUAA 1JMOH 1QGFA 1EZXC 4TPIZ 2ZDKA 1LDTT 2PLXA 2ANYA 2ZU3A 1PYTC 2BZ6H 2Y6TA 4X8SH 2H6MA 2H9EH 4Z6AH 5JB9S 2AGGX 1NC6A 3UPEA 4NZQA 2IJOB 5K0HA 1THSH 3PB1E 3QDZB 1NU7B 1MBQA 2UWPA 1O3PB 3SU5A 3SUFA 3VXFH 2THFB 5JBAS 1KLTA 3QX5H 2AMPA 1C2KA 5F8TA 3ENSB 3BTHE 1YCPH 4X2VA 1UTKA 3R0FA 1G3BA 2BY6X 2O8LA 1W12U 2VIVA 2QYIA 2HALA 1PPZA 3BTGE 4FUCA 1QY6A 2OXSA 1LQEA 2TGTA 1G37A 1GBMA 1IQMA 3M61U 2OTVA 3UR9A 1D4PB 3KQBA 2IPHA 1DXWA 1WUNH 1HFDA 1DOJA 4CHAB 1AVXA 2FOGA 1FDPA 2XRCA 1SGNE 2H1UA 2BX3A 5IDKA 4VGCC 1VITG 2HPQH 5T3HA 3QO6A 4FUJA 5DPAA 3MU4A 1GHVH 4U32A 5L6NH 4DW2U 3GCTG 4H4FA 5FBIA 3T2NA 3BTEE 2UUYA 1GG6C 1W13U 4NWKA 2BLWA 3A88A 1O2HA 2G52A 1FN8A 2A5AA 2G81E 3QK1A 1V2NT 1TPPA 2WPMS 2GV7A 3A7VA 4IS5A 3EDXB 3M37A 4JMYA 2P59A 1LVOA 4WF8A 3D49H 1NM6A 1XUHA 1AFQC 1MUEB 1S81A 2G8TA 2VGCC 4Y76A 2ANMH 1SGTA 2ZFPH 3U8RH 1QBVH 1NESE 3BTME 3BIVH 2JETB 3URDA 4ZMAH 1TPOA 2PKSC 3U8TH 1QTFA 1NS3A 4I8HA 4B2BA 3E8LA 3SQEE 1ZYOA 2V0BA 1FY5A 3O8RA 2ZU1A 1F0SA 4AYYB 3LJJA 1K1JA 4X1QU 1AE5A 3GCNA 2B9LA 1CT0E 5TCCA 1BMLA 2B0FA 1HAVB 3SJ9A 4OS2A 1TPAE 1ZPCA 3HGNA 1C2JA 1MBMA 4GHQA 3ZV8A 3GDVA 1KSNA 4BAHB 1F7ZA 3F1SB 5EQRA 3ZVBA 1GHBG 4AGKA 6CHAB 1K9OE 2ULLA 5E0GA 5HMAA 1AMHA 1ZOMA 2EA3A 4ABHA 1W0YH 5FX5A 3MU1A 3AAVA 3H7TA 1ZLRA 1ZRKA 1T8LA 5F6MA 2Y80A 1TX7A 3LONA 2B5TB 1OOKB 3RM0H 1N8OB 3MTYA 2JKHA 3QN7A 1K22H 1P05A 1DWDH 1P2QA 2RDLA 4K8BA 3RP2A 2W7UA 1V2LT 3U1IB 3SORA 1GHXH 3E0NB 4OS6A 1GMHF 3O8CA 1GMDG 2A4OA 1ABIH 2OBOA 1NN6A 1TONA 1C5VA 5AFZH 1T4VH 1UTPA 1AWFH 3MWIU 1LKBA 2ZTYA 2FOMB 3PV4A 2ALPA 1TMBH 1CSOE 5ETXA 4AG2A 1QA0A 1GJ6A 4OS1A 3SV9A 2GD4B 1P8VC 2ZPQA 3TLOA 3K2UA 1GDUA 4ABDA 5AF9H 1BRAA 2ZWLH 2ZA5A 1O5CB 3FFGA 1YM0A 3P6ZB 4MPXA 1TBRH 1K2I1 3VFEA 1O3DA 3RDZA 1CT2E 1UCYK 1ZSKA 4OGYA 4X8TH 1K1IA 1GVKB 3SJ8A 2BY8X 1DS2E 2TIOA 1MMJN 1GL1A 2A5KA 1HJ8A 2UUKB 1MCVA 2BQ6B 1A7SA 1YPLH 3A8CA 1XUIA 2VVUA 1LPGB 1EPTB 1CHOF 1JOUB 5C5NA 5GXPA 3SGQE 3PLBA 1RGQA 3A7YA 4YO9A 1EZUC 1RXPA 1EKBB 3RXHA 3BN9A 2ZGHA 2GCTB 3ZZCA 5G4BA 1H8DH 3KQCA 3D65E 3UIRA 2AIPA 4CRAA 1LVMA 1O2WA 2K1QA 1C1SA 1ACBE 1J14A 4ZXXH 3GCHC 1TGSZ 3EQ0H 2VWMA 4B73A 2FXRA 1FY8E 2QIQA 1TE0A 1E0FD 1SG8B 3ZV9A 3SHCH 4Y6DA 1IAUA 2BD7A 1O3LA 2F9BH 4GPGA 4I32A 1UMAH 1VCWA 2Z3DA 3V7TA 1HLTH 6GCHF 2O8MA 4Y8YA 1FAKH 5HM2A 1ESAA 2J2UA 4YOGA 3UY9A 3TH3H 1YP9A 2ZECA 1QFKH 2NU2E 1GMCF 4Y8XA 2BYAX 4D9RA 2BD4A 3SJIA 1O3NA 4CRDA 4KTCA 5C1YA 4WH8A 1QQ4A 1SR5C 2VVCA 2PKAA 3U98H 3BTTE 2O8WA 1ANDA 1L4DA 4SGBE 1P9SA 1VJ9U 4B74A 3DHKH 1BTYA 1MH0A 2H9TH 4K1TA 1C5QA 1UJ1A 1V3XA 3VB4A 1O2UA 1E35B 1SGEE 1ESBA 3SJKA 1EOLA 1PPEE 2ZU5A 7ESTE 1G3EA 1ZR0A 5F8ZA 1Z8IB 4D7GA 5A0CA 5A0AE 1AI8H 1TNGA 3MH4A 4VGCB 2FS8A 1C9PA 1FPCH 5EW1H 4U2WA 1O32A 2A7CA 3A82A 1DICA 3TH4H 1G30B 2W3IA 2R2WU 1UVSH 5EPNA 1MCTA 3MU0A 1SB1H 4UFGH 1ZMNA 2CV3A 4Q7ZA 5C2ZA 4AG1A 2FM2A 5TJXA 4NA7A 1O3KA 1ZGIA 1ZSJA 1NTPA 5C20A 5DJ7A 1PPBH 1GJCB 1GHAG 1P2MA 1TNJA 1QB1A 1SGQE 3QTVH 3BG4B 1DWCH 3F9HA 1OP0A 2H5CA 1ORFA 1C1MA 1L1NA 1NRRH 4INKA 1SGRE 3UQOA 1SGPE 1GBIA 3MNXA 2HWLB 8GCHF 1HUTH 2AMQA 1DM4B 1UK4A 1MTUA 1V2TT 1A0HB 2W26A 3DT0H 2BY7X 2GMTC 2C8XB 1QR3E 1O3MA 1KXDA 1HJ9A 1AUTC 2G4UA 3KGPA 3P8GA 3VXEH 3ZYDA 1CHOG 2G51A 4XBCA 2ZDLA 1AN1E 1QHRB 2BB4A 1C2IA 1ZJDA 4IW4E 2VH6A 2BVSH 3ATLA 5DP7A 3UQVA 4AYVB 3EA9A 1O3BA 2FMJA 1GJAB 1OWHA 2FYRA 2BDGA 2H5DA 3LT3A 2SNWA 2XC5A 4LXBH 2QXIA 3AAUA 3TGJE 3P17H 2ZIQH 1H4WA 1MTVA 1O39A 4O03A 2VIDA 2CGAA 2NU3E 3NUMA 2WPKS 4AFZA 6ESTA 4MPUA 3V12A 1AQ7A 1B7XB 1Q31A 4BNRA 1T8OA 2DUCA 2FOHA 1MTWA 1EAUA 1WTGH 4JCNA 1BCUH 1DFPA 4J2YB 3BTWE 2RA0A 1TYNA 4I33A 3ZVFA 2SGPE 1GL0E 4WH6A 1A5GH 1C2LA 1OYQA 4XBBA 1ZHMA 1NFYA 1CQQA 2ZEBA 1J9CH 8KME2 2BD2A 1BTPA 3OY6U 1WBGB 3ODDA 3CS0A 4LK4A 1W10U 1CGJE 5EW2H 1SC8U 2QV1A 2XW9A 3RXJA 1V2WT 1KTTB 2FO9A 3EA7A 1BUIA 2GT8A 3HATH 3BSQA 1O2XA 1C2GA 3FVFB 3SN8A 4JZIA 2O9QA 3HPTB 1AVWA 1GI3A 1Y5BT 2BLOA 5AHGH 1GDNA 3ZZ3A 1P12E 1YLCA 1C5RA 1SL3A 2ZGBH 4JZDH 1GDQA 1TQ7B 3BTDE 3MOCA 2AEIH 4FXGH 2WUCA 5HXFA 2A31A 5CHAB 1TX6A 4NIWA 4FUFA 1AFEH 3UFAA 4AORA 1X7AC 3CENA 4RN6A 1SQAA 1DT2A 1TBZH 3KCGH 3P70B 3RU4D 4ESTE 7GCHF 3SBKA 1DY8A 1KXBA 1C5LH 3SNBA 1S0QA 3M36A 5FCRA 4I31A 1HXEH 1MTSA 1NU9A 1H8IH 4IBLH 8ESTE 2GDEH 5T6DA 3F68H 1O3FA 1IOEA 1B0EA 1ZPZA 3ZZDA 2Q6FA 1JWTA 4M7GA 2UUFB 4CRBA 3E3TA 3VB3A 2AIQA 1EAWA 3ZZBA 1SLUB 3P8NA 3RXRA 1TFXA 1CBWC 5F8XA 3BF6H 2VINA 1ELBA 1KXEA 1WCZA 4JZEH 3RC5A 2QF3A 4ZHLU 1C5UA 2GVFA 4KTSA 3E1XB 1BIOA 1F0UA 1O2LA 2GKVE 3M3VA 1BHXF 1EB2A 1G9IE 1TWXB 2KAIB 5K7RA 1O5GH 3NK8A 1THRH 3E91A 1C5XB 1VITH 2J34A 3ITIA 4X2YA 6LPRA 1GMDF 4Y7AA 1GI0A 1KDQB 3SUGA 2C8WB 2NWNA 1O2QA 1TLDA 2SGDE 4AFSA 2XC0A 4A5TS 1QIXB 1Y3VA 3TH2H 2VB0A 2BTCE 1CA0C 2VVVA 1PYTD 1Z8JB 1UVOA 1V2MT 1C5TA 3QZRA 4QT8C 4CRFA 3TK5A 2ZGJA 3GOVB 4O9VA 3I29A 4UFFH 3A81A 1AKSB 1Z6JH 2BX4A 1NFUA 4OS5A 2GT7A 1GJ9B 4X8UH 1ANEA 3QLPH 1QL8A 1Z1IA 3KHVA 3BIUH 4ZXYH 5FAHA 5BPEA 1PQ8A 4X6MA 2Y5HA 3KNXA 1KXAA 4WXVA 2HLCA 3MNCA 4UFEH 1GBBA 1O2OA 3FP6E 1YC0A 1SGCA 1LMWB 4NSYA 3A7WA 3GY3A 5A8ZA 3RXIA 4IMZA 1TRNA 1GHYH 1UTNA 2PGQB 1UVPA 3A85A 2Y81A 1GBHA 1BTZA 4YZUA 1O2MA 1C1WH 5FPSA 1MZDA 3M3SA 2FEQH 2RA3A 2G4TA 1DANH 3E0PB 3ZZ5A 4XOJA 1RJXB 3LGUA 4LZ1H 1CVWH 4ABIA 1BJUA 4MPWA 5LGOA 1J8AA 1B0FA 1J16A 1FAXA 2PKAB 3OY5U 1J17T 5GWZA 4YOJA 1EPTA 1MKWK 1KIGH 1L4ZA 4A1VA 1GCDA 4JYTA 3RXBA 1AUJA 3U1JB 3RXCA 4THNH 4WMDA 4WWYA 1O2VA 1OP8A 2H9HA 1V2RT 1RIWB 2BQWB 1TQ0B 1C2HA 1GBAA 3M5NA 2ODQA 4CH2B 2PHBA 1F5KU 1A3BH 2TBSA 1IQNA 3Q00A 2A5IA 3A80A 3IITA 3A8BA 3GY6A 1BZXE 4MNVA 3ATKA 2Z9JA 3TJOA 1OPHB 5E2PA 1AU8A 2ZC9H 2Z9LA 1HBTH 5EPYA 1XUFA 1YPMH 3MMGA 4A1XA 4GLYA 1A61H 1A0LA 3T62A 2F91A 1YLDA 4DY7B 1BBRK 1GHWH 4Y10E 1GI6A 5JBCS 1LHGH 1TB6H 3ZVDA 3D23A 2P3FH 1BA8B 4GUXA 5ESTE 1DLEA 3K65B 1N8OC 1YPEH 1AB9C 4MPVA 1O5EH 1ZTLA 2A4GA 1ANBA 2ODPA 2J9NA 2C8YB 3AW0A 4UONA 3HK3B 1L2EA 3RXUA 4E7RG 3RXQA 1AB9B 1JRTA 1Y5UT 2BDYA 3P95A 2ASUB 1P0SH 2GCHF 1SLVB 1FIZA 1DXPA 1AWHB 4O97A 5HGGA 4KTUA 3TPIZ 3RXLA 2IOTA 2BZAA 3T5FH 3M5LA 3RMNH 1F0TA 5J4QA 1OXGA 1EXFA 3BEUA 1N6XA 4IN2A 4ISHH 1TGNA 1TIOA 4I8GA 1KYNA 1FY3A 4AN7A 4Y79A 2M5TA 1K1LA 1SOTA 2ZPRA 3F6UH 2VIPA 1FJSA 3MFJA 3PLKA 1C2DA 1ZTJA 1UTLM 4FVDA 1GHZA 1WV7H 1QJ7B 1ZJKA 2JH5D 1JBUH 1HJAC 4DG4A 1SGFA 5EOKA 5CHAC 4NA9H 3GICB 1O3EA 1SQTA 3LGVA 4DVAU 1SFIA 4Y8ZA 2ZQ1A 3ZZ4A 1JXPA 1MKXK 3OSYA 3SUDA 1P2JA 5FX6A 2WV5A 1ELCA 3QGJA 2WYJA 1LKAA 1NT1A 1HDTH 1WU1A 3MI4A 1H9IE 4UE7H 3SO3A 1QL7A 3RU4E 1TMUH 1NFWA 4BAOB 4I7YH 1HAOH 2FOBA 1EP5A 2J95A 1EPTC 5DP8A 3T25A 1QJ6B 1CBWB 4F4OC 2HGTH 3T28A 4FU7A 1D3DB 1O2IA 5JYIA 1H1BA 2ZFFH 1OWIA 1ELFA 5L30H 5LH8A 1YYY1 4DCDA 3F9EA 1HRTH 1L0ZA 1O38A 1VJAU 2ZHFH 1TGCA 3GY8A 3O8DA 1CA0B 2ZTZA 4ABAA 1ETSH 2Y5GA 1ZSLA 2ANKH 2WPJS 1ZGVA 2FI4E 2D8WA 1O2RA 4O3UA 2R2MB 2PWXA 2FLRH 5FCKA 1O31A 3DFJA 5F03A 4Y0ZE 1DX5M 4NSVA 3T27A 1WQVH 3PO1B 3SU4A 1P10A 2SGQE 1ZMJA 2ALVA 1MZAA 1RS0A 4ISOA 2JETC 3CS7A 1Q2WA 1HIAB 1T4UH 4NWLA 5EXLA 3S7HB 2D1JA 1DWBH 2P16A 4D7FA 4PROA 4X2XA 1XXDA 1O3HA 1MU8B 2CHAC 2R9PA 3SV2H 3ZZ7A 4ABBA 1SGYE 3TNSA 1WTHD 1D6RA 1FXYA 1KY9A 1DVAH 4CH8B 3FANA 3S7KB 1DPOA 2OC8A 2ZHDA 3SNAA 1DE7H 5EG4A 1E34B 1PFXC 2ZDVH 1F5LA 1K28D 4GAWA 1PJPA 1Z71A 3QTOH 1LVYA 1SPJA 1IQKA 1T32A 2XCFA 2G5NA 2STBE 2WPLS 4X1NU 1O2KA 1A5IA 2DE8A 1LPZB 3IWMA 1D3QB 1C4V2 3FZZA 5I25A 2PUQH 4HZHA 5HYOA 1NRNH 1O5FH 2FESH 3SGAE 2SGEE 3TGKE 4K3JA 3UR6A 4NIVA 4B76A 4I8LA 1ABJH 1BMAA 1HAGE 1P11E 5C67A 1SHHB 3LPRA 2NU4E 3OTJE 1S83A 1Z6EA 4JZ1A 4U01A 5JDUB 1Y3XA 1AKSA 5DP9A 1H9HE 2BXUH 1XKAC 7KMEH 1FMGA 4DGJA 3EGKH 3RUOA 2VIQA 2QY0B 1XUJA 4FUGA 1O3IA 1W11U 2F3CE 2AS9A 2J92A 1QJ1B 3RXFA 1RIWC 7LPRA 1CGHA 1VCQA 2EI6A 4YM9A 4DIHH 3RU4T 2BXTH 3H7OA 3MH5A 1EJNA 2BDHA 2A0QB 1O2YA 4B71A 4ZHMU 3UWJH 3RXAA 5CE1A 1K1MA 2VNTA 1O2SA 4X6PA 3G01A 4X6OA 3UNSA 1C2MA 3UOPA 1IQIA 1HIAA 5DP6A 2TGAA 1CE5A 3F9GA 2D26C 3Q3YA 3PMAB 4OGXA 1G3DA 1Y8TA 4X1PU 3RMLH 2QC2A 4B75A 1GJ4H 3VPKA 3MH6A 4A92A 1FN6A 1W8BH 2BY5X 1P01A 3N7OA 1W7XH 2Z3EA 1TMTH 3MU5A 1GVZA 1O2ZA 2XNIA 4GCHG 1W2KH 2TPIZ 2W5EA 2BM2A 2Y82A 3KN2A 4D9QA 1A0JA 3BEIB 3RXKA 1ZMLA 3EAJA 2Z6BD 1UTJA 2V6NA 1QBOA 1BQYA 4B2CA 1LPKB 1SVPA 1AD8H 2C8ZB 3U8OH 2XWBI 2OQUA 1S6FA 1GJ7B 1FNIA 7GCHG 3H5CB 1CU1A 2CF8H 4AFUA 1GWAA 1NROH 1QURH 2OC0A 3LH3A 3OYPA 3A8DA 1GVLA 1TALA 4ZKNU 1LTOA 3KIDU 3ZVCA 2JH6D 3LC5A 4ZUHA 1V2QT 1NFXA 1GHBF 3GISB 1WQSA 3KF2A 2NU1E 2OCVB 3PM3A 2AFQB 3LDXH 3SV6A 1PQAA 3MYWA 3S9CA 1OWEA 1O3OA 2TRMA 2CF9H 1A4WH 1QCPA 2V3HH 4X6NA 5GIBA 4AB8A 2F83A 3GY2A 2VJ1A 3FP8E 1G3CA 4K60A 4R0IA 2Y7XA 4ZKOU 4NFFA 1EQ9A 3FZDA 3UOUA 3I77A 1EX3A 4AGJA 4WXIA 2PGBB 1P09A 1J15A 5A8YA 1O3AA 3GY4A 1NY22 3SHAH 3RXGA 4Y7BA 3HGPA 1DITH 1P9UA 4KP0A 1G2LA 2FOEA 1C1QA 2YNAA 3NPSA 3UUZA 2BD9A 1RTKA 1YF4A 2YNBA 2VWLA 3A8AA 3M7UA 3BG8A 1YCPK 2AGEX 5AVDA 5E2OA 1O5DH 2A4RA 3LGIA 2FX4A 3BTFE 3PTNA 4TYDA 3V3MA 5EGMA 4WMFA 1OWKA 3PWCA 1GGDC 4NZLA 4CRCA 1TNHA 1FZZA 1Y5AT 1PPFE 4XBDA 4I8KA 2BDBA 1BBRH 3NZIA 3RC6A 3VB7A 1TGTA 1TNKA 2P93A 4UEHH 1M9UA 1HV7A 3ATWA 1MU6B 1ELGA 1Y3UA 2ODYB 2GZ8A 4XDEA 1K1OA 5AFYH 1CGIE 2WV4A 1P3EA 4ISLA 5TCAA 2C90B 3GYMA 1C1VH 2FZZA 3RXOA 4J1YA 1DDJA 4DURA 3KEEA 1CA8B 2AERH 2UUJB 4U30A 5GCHF 4FU9A 4ZROA 1UTMA 2PTNA 4DIIH 1C1PA 1XVOA 1C1UH 2KAIA 2GX4A 4OS4A 2BD3A 4IN1A 4CRGA 3NKKA 1QRXA 1T8MA 2A1DB 2PKSB 5JBBS 4D8NA 1L1GA 2QGRA 2SGFE 1MKWH 4LOYH 3M5OA 3QZQA 1PPGE 1YPKH 1WSSH 4MNWA 3LU9B 2P3UB 3GYLB 4ISIH 5E0JA 4CHAC 2CHAB 1SLWB 2BY9X 9LPRA 1OSSA 1EOJA 1K1PA 1W7GH 3E90B 1FLEE 4XFQA 1K21H 1NRPH 1V2UT 1TA2A 1EJAA 1QA7A 1BRUP 3SV8A 2TGPZ 2ZPSA 2ZCHP 1DSUA 4B1TA 1UTQA 3I78A 1MQ5A 1GI5A 1N6YA 3MHWU 4SGAE 1ID5H 1C9TA 1SSXA 4IGDA 2Q6DA 4GVUA 1QRZA 3M35A 4GHTA 2ZU4A 1C5ZB 2Z7FE 3P8OA 1NRQH 4CR9A 3EA8A 3VB6A 2GGVB 5A8XA 1E38B 2Y5FA 4WMEA 1O37A 4ZKSU 1P06A 2P3TB 1SQOA 1W3CA 4MG3A 1OWDA 2WUBA 1D6WA 1BJVA 2ZZUH 3M7QA 3A87A 2AH4X 1V2KT 1O2PA 3S69A 4AB9A 4BAKB 4KKDA 4AOQA 3AW1A 8LPRA 3A89A 3MNSA 2V3OH 2F9VA 2DE9A 2VIOA 1GBEA 3GDSA 3V0XA 3PMJA 5T6GA 3SUEA 1GMHG 1AFQB 2A2QH 3UNQA 1SGDE 2BOKA 5C3NA 1GI4A 2BDIA 3RXPA 3LOXA 1YPJH 1YBWA 4JYVH 3L3TA 6GCHG 3RXVA 2PR3A 2BLQA 3E6PH 2FOAA 1BTHH 1HCGA 2BQ7B 2GZ7A 1FI8A 3RMMH 1SBWA 2VWNA 3UTUH 3DUXH 4JZFH 1V2JT 3P92A 4NFEA 1UCYH 2W7SA 3SU6A 2PW8H 1MTNC 1P2OA 1A46H 1ELAA 1DUEA 1TRYA 5EXMA 1FUJA 4RKJB 3SNDA 4BXSA 4K5ZA 1T7CA 4H6TA 1QL9A 1GBCA 1ESTA 2RCEA 4MNXA 6CHAC 3KQDA 3TIUA 1O3CA 2XYAA 5DK1A 1GBKA 1HB0B 2J4IA 2P95A 1EB1H 4YT7H 5E0HA 4Q7YA 2PSXA 5EU8A 1C2FA 1BRBE 4BTIB 1THPB 3UREA 2PFEA 4E06H 1HAZB 3AVZA 1AY6H 1GJ5H 4ABFA 2QAAA 1C1RA 1FONA 1LHCH 1TAWA 3ZZAA 1H9LB 1QQUA 3LGTA 4Y0YE 2FODA 2AGIX 1TABE 2ZF0H 3LKWA 3SI4H 1LHEH 2QXJA 5ESBA 3TGIE 1C1TA 1O2JA 5LPFA 4JK6A 1UK3A 1Q3XA 4DOQA 1C2EA 1UVUH 2XBWA 2GP9B 1RFNA 2H2ZA 4ASHA 3A86A 5JPMH 3NWUA 3VEQB 3ELAH 2HVXA 5EODA 1EZQA 5DP5A 3MO3A 1GBLA 2BD8A 4YLUA 4BAMB 1MD8A 3HK6B 3MNBA 1TX8A 3URCA 3Q3XA 5DGJA 1ELTA 4MQAA 1PQ5A 3SOSA 1GMCG 1AVGH 2Z3CA 1D9IA 1ETRH 3TVJB 2ZP0H 1V2OT 4YESB 1HAYB 4Y11E 3RXSA 1LCYA 4K8YA 2BDCA 3RXTA 3E16B 4NIXA 1IHSH 1XX9A 1XXFA 1ARCA 1EAIA 4ISNA 1D3TB 2GTBA 2FIRH 4TY6A 5A09A 1Y3WA 4INHA 4FUIA 1EJMA 2R3UA 2P8OC 1PQ7A 2LPRA 3M3TA 3OU0A 1GCTB 1MD7A 1YPHC 3TJUA 1Y59T 2J38A 4UFDH 2JH0D 1TOMH 3FP7E 1LHFH 1GCTC 2F9PA 3JZ2B 1ZRBA 1CT4E 3GCHB 2P94A 1XM1A 5JB8S 4HTCH 3L6PA 5EQSA 3FAOA 4UDWH 4MVNA 1EUFA 3MH7A 4K69A 1RTLA 2I6QA 4I8JA 4IMQA 4X1RU 2STAE 4O3TA 2FTLE 1C5PA 2G00A 1XVMA 2EC9H 1C4Y2 1P57B 2HNTE 3BG4C 1ETTH 4TWYA 4ABEA 2VU8E 4F49A 3GDUA 1VCPA 1ANCA 1CO7E 3B23B 2ZDMA 3TNTA 1YGCH 1RD3B 2A45B 1BHXB 1OX1A 3LJOA 1IQEA 2A4QA 5T6FA 4MNYA 1GGDB 2IN2A 1AIXH 2XWAA 2A32A 4JYUH 1S82A 1UTOA 2OC7A 4MDSA 4HGCA 4INLA 3UNRA 1MAYA 2AYWA 3LGWA 1QRWA 1W14U 2Y7ZA 2QCYA 1XUGA 2OLGA 4H42U 1Z8RA 5LPEA 4R8TB 2ZDAH 2SFAA 3B8JA 5EXNA 1ELEE 1WYKA 1F5RA 2O8TA 5C1UA 5FPTA 1YKTA 2ILNA 3HKJB 1GJBB 3BTQE 3SV7A 4NGAH 1JIRA 2ZCLP 3JZ1B 1GJDB 3PMBB 1P02A 1IHTH 3F9FA 2OQ5A 2ZDNA 3RXEA 2ZU2A 4X0WU 3T26A 2ZFSA 4FUHA 1HAIH 1HNEE 3PLPA 5C1XA 4BAQB 5L2YH 5FBEA 3RLWH 4ABGA 4AFQA 4NIYA 1DWEH 5B6OA 1Z8GA 1XMNB 2C3SA 1C5WB 5DP4A 1F2SE 1GI9B 3C27B 2BDAA 1N1LA 1V2ST 1OWJA 3CP7A 2BOHB 1AZ8A 3GCOA 1SFQB 1TNLA 2A2XH 3U69H 1HAXB 1KLJH 1DY9A 1KXFA 2HNTC 4IC5A 1WAYB 3VGCB 4YTAA 1EAXA 1C5SA 2BHGA 1RTFB 4YLQH 5A2MH 1S84A 2UWLA 1G32B 3TJNA 2VH0A 1BMNH 1BT7A 3RMOH 5FHTA 4Q7XA 3TITA 1WOFA 1UCYE 9ESTA 2FI5E 4JK5A 2AMDA 5I46H 2GDDA 2I6SA 1NO9H 2HPPH 3DFLA 1DUAA 1JIMA 1O33A 3EYDA 2O8UA 2R0KA 2PSYA 1O36A 2QXGA 3SW2B 1GJ8B 2HRVA 1S6HA 2FLBH 1P2IA 1V2VT 4BOHA 1C5MD 4ZH8A 2CN0H 1HJAB 2WINI 1MQ6A 3B9FH 2EI8A 4ZAEA 2G55A 4KELA 3A7XA 1P3CA 2FP7B 1KDQA 1GHAF 1GBFA 1S0RA 1MTNB 1AO5A 2BMGB 4YOIA 3DA9B 3P8FA 1FV9A 2SGAA 3ZVGA 2XC4A 2FYQA 5ABWA 1V6DA 2B8OH 3LC3A 3MO9A 2FOFA 3LGYA 1GI8B 1HAHH 4WY3A 3RXMA 2PTCE 2ZNKH 1TRMA 4HFPB 1TBQH 4D76A 4A7IB 2Z94A 5IYTA 1O3JA 3R3GB 4NA8A 3D62A 1UHBA 3BTKE 1BRCE 4K1EA 1SI5H 1OKXA 1OS8A 2PUXB 3SNEA 1RRKA 4AX9H 3IG6B 4K1SA 3S9AA 3EE0B 5A0BA 3AASA 3QUMP 3ZZ8A 2D2DA 4NG9H 1ZZZA 3BEFB 1ZPBA 3NXPA 1B5GH 2ZGXH 1BTWA 1EZSC 1NZQH 5DG6A 2ZI2H 1TGBA 4ABJA 2C4FH 1O2TA 1KTSB 4B2AA 1O5AB 1S5SA 3ZZ6A 1HPGA 3W95A 2OINA 4DT7B 2CMYA 1VGCC 3QWCH 1FY4A 1W0ZU 3A7ZA 4WVPE 3M7TA 3PO1C 3O8BA 3ZZ9A 2RG3A 3S0NA 3K6YA 1Z1JA 3ZVEA 3Q77A 2EI7A 3OX7U 1CHGA 2Q6GA 1VGCB 1BITA 3S9BA 1SHYA 1A2CH 1O0DH 2ESTE 5L2ZH 1O5BB 3A84A 1ARBA 2ZO3H 4E7NA 5J4SA 2QF0A 1C5NH 1TOCB 5GPIB 2F9NA 1E37B 4TPYA 3V13A 1O34A 4XSKU 2ZGCA 1P2KA 1ZHPA 3ZYEA 3PYHA 2QA9E 4XE4A 3TU7H 4DJZB 5LPRA 3WY8A 4Q80A 1BBRE 5PTPA 5DO4H 2ZFQH 2ZHEH 1EP6A 2G5VA 1L1JA 4MTBA 3W94A 1FY1A 1O30A 1FQ3A 1LQDB 1VR1H 3KL6A 1BTUA 3L33A 1HGTH 2YOLA 2ZHWH 1GG6B 1K1NA 1VITF 1T31A 2GZ9A 1JRSA 2XBXA 1OYTH 1ZTKA 4GSOA 3PTBA 1LHDH 4Q2KA 1ELDE 1Y3YA 3UWIA 2P8OB 3PWBA 4A1TA 1U6QA 5HM9A 2ZG0H 1F0RA 1NRSH 1IQLA 3ZVAA 1XUKA 2FS9A 3ESTA 2GMTB 1GBJA 4BANB 1AGJA 3NCLA 1SLXB 2BVRH 2V35A 3RLYH 4FUEA 5FPYA 4CBOA 1OP2A 3TJVA 1BB0B 1QNJA 2OD3B 2HOBA 1BOQA 4FUBA 4GCHF 4CR5A 4E05H 5DKMA 8GCHG 1O2GH 3TK9A 3ATIA 3RXDA 2BVXH 1SGFG 1XKBC 3SJOA 2VGCB 1A1RA 1O2NA 3GY5A 4TWWA 5EQQA 2F9OA 1SGIB 1YPHE 1AHTH 1KXCA 2OP9A 4CBNA 1MAXA 1BMMH 2Z9GA 3SNCA 4OS7A 2FI3E 4BTTB 1SOZA 3ATMA 2WPIS 3K6ZA 1PPCE 2QXHA 1A3EH 1GI1A 3ODFA 1GBTA 5CMXH 1FPHH 3SU2A 2FWWA 3Q3KA 2XTTB 3LIWA 4FVBA 1G36A 1QB6A 4WJG2 5H4IB 2Q1JA 1Z7KA 2OC1A 5C5OA 4X1SU 2VWOA 1D3PB 1O35A 2F9UA 2B7DH 1QBNA 5E8EH 1EATA 1V2PT 2BD5A 2ZTXA 5GDSH 1UVTH 1AE8H 2XBYA 1S85A 2HNTF 2R0LA 3A83A 1P04A 4UD9H 5DP3A 3T29A 2GCHG 1G2MA 3VGCC 2FOCA 3Q76A 4BTUB 2ANWA 1C5OH 5BRRE 4ZKRU 1C1OA 1QB9A 1TPSA 1UHBB 1GI7B 4IC6A 2QN5T 2C93B 2VIWA 2ZHQH 5JBTA 1LVBA 2CXVA 3STJA 1EASA 2Z9KA 3SGBE 2SNVA 4FU8A 4RSPA 1DSTA 3SQHE 3SU3A 2TGDA 1UK2A 3LH1A 3STIA 3SU1A 4NCYA 2OBQA 2FX6A 4RKOB 3PMHB 2J94A 5SGAE 1T8NA 1TA6A 3A7TA 2FTMA 4KGAA 1GBDA 3RC4A 3SU0A 4LZ4B 4X8VH 2R3YA 1SMFE 2XCNA 3MO6A 4HI3A 4TY7A 1GI2A 3C1KA 1KLIH 3DD2H 4FUDA 3MU8A 2ZFRH 2PV9B 1TNIA 1HXFH 1UO6A 1ZHRA 2Z9IA 4MLFB 1O3GA 4CREA 3TK6A 2ZKSA 1HAVA 1P03A 3RM2H 1VZQH 1DLKB 3GY7A 4AZ2B 1C5YB 4H6SB 4ZHAA 2ZQ2A 3GCTF 2UWOA 4BXWA 1BDAA 2GV6A 3U9AH 1E36B 3PROA 1LO6A 3M5MA 5GCHG 2FDAA 2W3KA 2LNCA 4Z0KA 1BTXA 3BV9B 5GJ4B 3SI3H 1ELVA 4Y71A 1YCPM 1IQGA 1PPHE 3K9XB 1HAPH 4K2YA 2ZFTA 4A6LA 2A7JA 2CJIA 1IQJA 2ZCKP 3HKIB 2BLVA 2XXLA 1C1NA 2EEKA 2XBVA 1C4U2 2WYGA 2FPZA 3SZNA 3QGNB 2A7HA 2GCTC 1F92A 1P2NA 1INCA 1IQFA 1MKXH 5FXLA 1HYLA 1YPGH 1GPZA 1A5HA 3VB5A 1NPMA 1FIWA
chains in the Genus database with same CATH superfamily
2NU0E 2WPHS 1IQHA 4YT6H 3KQEA 4X2WA 1AZZA 2OUAA 2XOKD 1JMOH 1QGFA 1EZXC 4TPIZ 2ZDKA 1LDTT 2JJ1D 2PLXA 2ANYA 2ZU3A 1PYTC 2BZ6H 2Y6TA 4X8SH 2H6MA 2J97A 2H9EH 4Z6AH 5JB9S 2AGGX 1NC6A 3UPEA 4NZQA 2IJOB 5K0HA 1THSH 3PB1E 3QDZB 1NU7B 2WZQA 1MBQA 2UWPA 1O3PB 3SU5A 3SUFA 3VXFH 2THFB 5JBAS 1KLTA 3QX5H 2AMPA 1C2KA 5F8TA 3ENSB 3BTHE 1YCPH 4X2VA 1UTKA 3R0FA 1G3BA 2BY6X 2O8LA 1W12U 2VIVA 2QYIA 2HALA 1PPZA 3BTGE 4FUCA 1QY6A 2OXSA 1LQEA 2TGTA 1G37A 1GBMA 1IQMA 3M61U 2OTVA 3UR9A 1D4PB 3KQBA 2IPHA 1DXWA 1WUNH 1HFDA 1DOJA 4CHAB 1AVXA 4B6FA 2FOGA 1FDPA 2XRCA 1SGNE 2H1UA 2BX3A 5IDKA 4VGCC 1VITG 4M9FA 2HPQH 5T3HA 3QO6A 4FUJA 5DPAA 3MU4A 1GHVH 4U32A 5L6NH 1YWUA 4DW2U 3GCTG 2KR7A 4H4FA 5FBIA 3T2NA 3BTEE 2UUYA 1GG6C 1W13U 4NWKA 4XRNA 2BLWA 3A88A 1O2HA 2G52A 1FN8A 4OM9A 2A5AA 2G81E 3QK1A 4TT3D 1V2NT 1TPPA 2WPMS 2GV7A 3A7VA 4IS5A 3EDXB 3M37A 4JMYA 2P59A 1LVOA 1NBMD 4WF8A 3D49H 2RDEA 1NM6A 1XUHA 1AFQC 1MUEB 1S81A 2G8TA 2VGCC 4Y76A 2ANMH 1SGTA 2ZFPH 3U8RH 1QBVH 1NESE 3BTME 3BIVH 2JETB 3URDA 4ZMAH 1TPOA 2PKSC 3U8TH 1QTFA 1NS3A 4I8HA 4B2BA 3E8LA 3SQEE 1ZYOA 2KCPA 1FY5A 2V0BA 3O8RA 2ZU1A 5CHBA 1F0SA 4AYYB 3LJJA 1K1JA 4X1QU 1AE5A 3GCNA 2B9LA 1CT0E 3CNRA 5TCCA 1BMLA 2B0FA 1HAVB 3SJ9A 4OS2A 1TPAE 1ZPCA 3HGNA 5F53A 1C2JA 1MBMA 4GHQA 3ZV8A 3GDVA 1KSNA 4BAHB 1F7ZA 3F1SB 5EQRA 3ZVBA 2QE7D 1GHBG 4AGKA 6CHAB 1K9OE 2ULLA 3FOAA 5E0GA 5HMAA 1AMHA 1ZOMA 2EA3A 4ABHA 1W0YH 5FX5A 3MU1A 3AAVA 3H7TA 1ZLRA 3OEHD 1ZRKA 1T8LA 5F6MA 2Y80A 1TX7A 3LONA 2B5TB 1OOKB 3RM0H 1N8OB 3MTYA 2JKHA 3QN7A 1K22H 1P05A 2F4LA 1DWDH 1P2QA 2RDLA 4K8BA 3RP2A 2W7UA 1V2LT 2KM0A 3U1IB 3SORA 1GHXH 3E0NB 4OS6A 1GMHF 3O8CA 1GMDG 2A4OA 1ABIH 2OBOA 1NN6A 1TONA 1C5VA 5AFZH 1T4VH 1UTPA 1AWFH 3MWIU 1LKBA 2ZTYA 2FOMB 3PV4A 2ALPA 1TMBH 1CSOE 5ETXA 4AG2A 1QA0A 1GJ6A 4OS1A 3SV9A 2GD4B 1P8VC 2ZPQA 3TLOA 3K2UA 1GDUA 4ABDA 5AF9H 1BRAA 2ZWLH 2ZA5A 1O5CB 3FFGA 1YM0A 3P6ZB 4MPXA 1TBRH 1K2I1 3VFEA 1O3DA 3RDZA 1CT2E 1UCYK 1ZSKA 1S6LA 4OGYA 4X8TH 1K1IA 1GVKB 3SJ8A 2BY8X 1DS2E 2TIOA 1MMJN 1GL1A 2A5KA 1HJ8A 2UUKB 1MCVA 2BQ6B 2HLDD 1A7SA 1YPLH 3A8CA 1XUIA 2VVUA 1LPGB 1EPTB 1CHOF 2EY4C 1JOUB 5C5NA 5GXPA 3WWBA 3SGQE 3PLBA 1RGQA 3A7YA 1E79D 5KECA 4YO9A 1EZUC 1RXPA 1EKBB 3RXHA 3BN9A 2ZGHA 2GCTB 3ZZCA 5G4BA 1H8DH 3KQCA 3D65E 3UIRA 2AIPA 4CRAA 1LVMA 1O2WA 2K1QA 1C1SA 1ACBE 1J14A 1SKYE 3F0PA 3GCHC 4ZXXH 1TGSZ 3EQ0H 2VWMA 4B73A 2FXRA 1FY8E 2QIQA 1TE0A 1E0FD 1SG8B 3ZV9A 3SHCH 4Y6DA 1IAUA 2BD7A 1O3LA 2F9BH 4GPGA 4I32A 1UMAH 1VCWA 2Z3DA 3V7TA 1HLTH 6GCHF 2O8MA 4Y8YA 1FAKH 5HM2A 1ESAA 2J2UA 5CDFE 4YOGA 3UY9A 3TH3H 1YP9A 2ZECA 1QFKH 2NU2E 1GMCF 4Y8XA 2BYAX 4D9RA 2BD4A 3SJIA 1O3NA 4CRDA 4KTCA 5C1YA 4WH8A 1QQ4A 1SR5C 3WW7A 2VVCA 2PKAA 3U98H 3BTTE 2O8WA 1ANDA 1L4DA 4SGBE 1P9SA 1VJ9U 4B74A 3DHKH 1BTYA 1MH0A 2H9TH 4K1TA 1C5QA 1UJ1A 1V3XA 3VB4A 1O2UA 1E35B 1SGEE 1ESBA 3SJKA 1EOLA 1PPEE 2ZU5A 7ESTE 1G3EA 1ZR0A 5F8ZA 1Z8IB 4D7GA 5A0CA 5A0AE 1AI8H 1TNGA 3MH4A 4VGCB 2FS8A 5C0UA 1C9PA 1FPCH 5EW1H 4U2WA 4ACAA 1O32A 2A7CA 3A82A 1DICA 3TH4H 1G30B 2W3IA 2R2WU 1UVSH 5EPNA 1MCTA 3MU0A 1SB1H 4UFGH 1ZMNA 2YMSB 2CV3A 4Q7ZA 5C2ZA 4AG1A 2FM2A 5TJXA 3FN8A 4NA7A 1O3KA 1ZGIA 1ZSJA 1NTPA 5C20A 5DJ7A 1PPBH 1GJCB 1GHAG 4ASUD 1P2MA 1TNJA 1K0HA 1QB1A 1SGQE 3QTVH 3BG4B 1DWCH 3F9HA 3F3BA 1OP0A 2H5CA 1ORFA 1C1MA 1L1NA 1NRRH 4INKA 1SGRE 3UQOA 1SGPE 1GBIA 3MNXA 2HWLB 8GCHF 1HUTH 2AMQA 1DM4B 1UK4A 1MTUA 1V2TT 1A0HB 2W26A 3DT0H 2BY7X 2GMTC 2C8XB 1QR3E 1O3MA 1MABB 1KXDA 1HJ9A 1AUTC 2G4UA 3KGPA 3P8GA 3VXEH 3ZYDA 1CHOG 2G51A 4XBCA 2ZDLA 4B6EA 1AN1E 1QHRB 2BB4A 1C2IA 1ZJDA 4IW4E 2VH6A 2BVSH 3ATLA 5DP7A 3UQVA 4AYVB 3EA9A 1O3BA 2FMJA 1GJAB 1OWHA 2FYRA 2BDGA 2H5DA 3LT3A 2SNWA 2XC5A 4LXBH 2QXIA 3AAUA 3TGJE 3P17H 2ZIQH 1H4WA 1MTVA 1O39A 4O03A 2VIDA 2CGAA 2EQNA 2NU3E 3NUMA 2WPKS 4AFZA 6ESTA 4MPUA 3V12A 1AQ7A 1B7XB 1Q31A 4BNRA 1T8OA 2DUCA 2FOHA 1MTWA 1EAUA 1WTGH 4JCNA 1BCUH 1DFPA 4J2YB 3BTWE 2RA0A 1TYNA 4I33A 3ZVFA 2SGPE 1GL0E 4WH6A 1A5GH 4FOUC 1C2LA 1OYQA 4XBBA 1ZHMA 1NFYA 1CQQA 2ZEBA 4ACBA 1YLNA 1J9CH 8KME2 2BD2A 1BTPA 3N99A 3OY6U 1WBGB 3ODDA 3CS0A 4LK4A 1W10U 1CGJE 5EW2H 1SC8U 2QV1A 2XW9A 5EJLA 3RXJA 1V2WT 2JDID 2V3MA 1KTTB 2FO9A 2IPQX 1BUIA 2GT8A 3EA7A 3HATH 3BSQA 1O2XA 1C2GA 3FVFB 3SN8A 4JZIA 2O9QA 3HPTB 1H8HD 1AVWA 1GI3A 1Y5BT 2BLOA 5AHGH 1GDNA 3ZZ3A 3UAIC 1P12E 1YLCA 1C5RA 1SL3A 2ZGBH 4JZDH 1GDQA 1TQ7B 3BTDE 3MOCA 2AEIH 4FXGH 2WUCA 5HXFA 2A31A 5CHAB 1TX6A 4NIWA 4FUFA 3AK5A 1AFEH 3UFAA 4AORA 1X7AC 3CENA 4RN6A 1SQAA 1DT2A 4F48B 1TBZH 3KCGH 3P70B 3RU4D 4ESTE 7GCHF 3SBKA 1DY8A 1KXBA 1C5LH 3SNBA 1S0QA 3M36A 5FCRA 4I31A 1HXEH 1MTSA 1NU9A 1H8IH 4IBLH 8ESTE 2GDEH 5T6DA 3F68H 1O3FA 2J98B 1IOEA 1B0EA 1ZPZA 3ZZDA 2Q6FA 1OHHD 1JWTA 4M7GA 2UUFB 4CRBA 3E3TA 3VB3A 2AIQA 1EAWA 3ZZBA 1SLUB 3P8NA 3RXRA 1TFXA 1CBWC 5F8XA 3BF6H 2VINA 1ELBA 1KXEA 1WCZA 4JZEH 3RC5A 2QF3A 4ZHLU 1C5UA 2GVFA 4KTSA 3W1EA 3E1XB 1BIOA 1F0UA 1O2LA 2GKVE 3M3VA 1BHXF 1EB2A 1G9IE 1TWXB 2KAIB 5K7RA 1O5GH 3NK8A 1THRH 3E91A 1C5XB 1VITH 2J34A 2K0QA 3ITIA 4X2YA 6LPRA 1GMDF 4Y7AA 1GI0A 1KDQB 3SUGA 2C8WB 2NWNA 1O2QA 1TLDA 2SGDE 4AFSA 2XC0A 4A5TS 4DT4A 1QIXB 1Y3VA 3TH2H 2VB0A 2BTCE 1CA0C 2VVVA 1PYTD 1Z8JB 1UVOA 1V2MT 1C5TA 3QZRA 4QT8C 1YY3A 4CRFA 3TK5A 2ZGJA 3GOVB 4O9VA 3I29A 4UFFH 3A81A 1AKSB 1Z6JH 2BX4A 1NFUA 4OS5A 2GT7A 1GJ9B 4X8UH 1ANEA 3QLPH 1QL8A 1Z1IA 3KHVA 3BIUH 4ZXYH 5FAHA 5BPEA 1PQ8A 4X6MA 2Y5HA 3KNXA 1KXAA 4WXVA 2HLCA 3MNCA 4UFEH 1GBBA 1O2OA 3FP6E 1YC0A 1SGCA 1LMWB 4NSYA 3A7WA 3GY3A 5A8ZA 3RXIA 4IMZA 1TRNA 1GHYH 1UTNA 2PGQB 1UVPA 2M2AA 2JIZD 3A85A 2JJ2D 2Y81A 3DSPA 1GBHA 1BTZA 4YZUA 2YMSD 1O2MA 1C1WH 5FPSA 1MZDA 3M3SA 2FEQH 2RA3A 2G4TA 1DANH 3E0PB 3ZZ5A 4XOJA 1RJXB 3LGUA 4LZ1H 1CVWH 4ABIA 1BJUA 4MPWA 5LGOA 3PRBA 1J8AA 5FL7D 1B0FA 1J16A 1FAXA 2PKAB 3OY5U 1J17T 5GWZA 4YOJA 1EPTA 1MKWK 1KIGH 1L4ZA 4A1VA 1GCDA 4JYTA 3RXBA 1AUJA 3U1JB 3RXCA 4THNH 4WMDA 4WWYA 1O2VA 1OP8A 2H9HA 1V2RT 1RIWB 2BQWB 1TQ0B 1C2HA 1GBAA 3M5NA 2ODQA 4CH2B 2PHBA 1F5KU 1A3BH 2TBSA 1IQNA 3Q00A 2A5IA 3A80A 3IITA 3A8BA 2L74A 3GY6A 1BZXE 3SZEA 4MNVA 3ATKA 2Z9JA 3TJOA 1OPHB 5E2PA 1AU8A 2ZC9H 2Z9LA 1HBTH 2LELA 5EPYA 1XUFA 2HVYB 1YPMH 3MMGA 1W0JD 4A1XA 4GLYA 1A61H 1A0LA 3T62A 2F91A 1YLDA 4DY7B 1BBRK 1GHWH 4Y10E 1GI6A 5JBCS 1LHGH 1TB6H 3ZVDA 3D23A 2P3FH 1BA8B 4GUXA 1QZ8A 5ESTE 1DLEA 3K65B 1N8OC 1YPEH 1AB9C 4MPVA 1O5EH 1ZTLA 2A4GA 1ANBA 2ODPA 2J9NA 2C8YB 3AW0A 4UONA 3HK3B 1L2EA 3RXUA 4E7RG 3RXQA 1AB9B 1JRTA 1Y5UT 2BDYA 3P95A 2ASUB 1P0SH 2GCHF 1SLVB 1FIZA 1DXPA 1AWHB 4O97A 5HGGA 1WXRA 4KTUA 3TPIZ 3RXLA 2IOTA 2BZAA 3T5FH 3M5LA 3RMNH 1F0TA 5J4QA 1OXGA 1EXFA 3BEUA 1N6XA 4IN2A 4ISHH 1TGNA 1TIOA 4I8GA 1KYNA 1FY3A 1VKYA 4AN7A 4Y79A 2M5TA 1K1LA 1SOTA 2ZPRA 3F6UH 2VIPA 1FJSA 3MFJA 3PLKA 1C2DA 1ZTJA 1UTLM 4FVDA 1GHZA 1WV7H 1ZJKA 1QJ7B 2JH5D 1JBUH 1HJAC 4DG4A 1SGFA 5EOKA 5CHAC 4NA9H 3GICB 1O3EA 1SQTA 3LGVA 4DVAU 1SFIA 4Y8ZA 2ZQ1A 4RT0A 3ZZ4A 1JXPA 1MKXK 3OSYA 3SUDA 2KCAA 1P2JA 5FX6A 2WV5A 4F55A 1ELCA 3QGJA 2WYJA 1LKAA 1NT1A 1HDTH 1WU1A 3MI4A 1H9IE 4UE7H 3SO3A 1QL7A 3RU4E 1TMUH 1NFWA 4BAOB 4I7YH 2PP6A 1HAOH 2FOBA 1EP5A 2J95A 1EPTC 5DP8A 3T25A 1QJ6B 1CBWB 4F4OC 2HGTH 3SYJA 3T28A 4FU7A 1D3DB 1O2IA 5JYIA 1H1BA 2ZFFH 1OWIA 1ELFA 5L30H 5LH8A 1YYY1 4DCDA 3F9EA 1HRTH 1L0ZA 1O38A 1VJAU 2ZHFH 1TGCA 3GY8A 3O8DA 1CA0B 2ZTZA 4ABAA 1ETSH 2Y5GA 1ZSLA 2K8IA 2ANKH 2WPJS 1ZGVA 2FI4E 2XNDD 2D8WA 1O2RA 4O3UA 2R2MB 2PWXA 2FLRH 5FCKA 1O31A 3DFJA 5F03A 4Y0ZE 1DX5M 4NSVA 3T27A 1WQVH 3PO1B 3SU4A 1P10A 2SGQE 1ZMJA 2ALVA 1MZAA 1RS0A 4ISOA 2JETC 3CS7A 1Q2WA 1HIAB 1T4UH 4NWLA 5EXLA 3S7HB 2D1JA 1DWBH 2P16A 4D7FA 4PROA 4X2XA 1XXDA 1O3HA 1MU8B 2CHAC 2R9PA 3SV2H 2RFKC 3ZZ7A 4ABBA 1SGYE 4RI0A 3TNSA 1WTHD 1D6RA 1FXYA 2KCYA 1KY9A 1DVAH 4FETA 4CH8B 3FANA 3S7KB 1DPOA 2OC8A 2ZHDA 3SNAA 4P02A 1DE7H 5EG4A 1E34B 1PFXC 2ZDVH 1F5LA 1K28D 4GAWA 1PJPA 1Z71A 3QTOH 1LVYA 1SPJA 1IQKA 1T32A 2XCFA 2G5NA 2STBE 2WPLS 4X1NU 1O2KA 1A5IA 2DE8A 1LPZB 3IWMA 1D3QB 1C4V2 3FZZA 5I25A 2PUQH 4HZHA 5HYOA 1NRNH 1O5FH 3PV2A 5EJ1A 2FESH 3SGAE 2SGEE 3TGKE 4K3JA 3UR6A 4NIVA 4B76A 4I8LA 1ABJH 1BMAA 1HAGE 1P11E 5C67A 1SHHB 3LPRA 2NU4E 3OTJE 1S83A 1Z6EA 4JZ1A 4U01A 1SQRA 5JDUB 1Y3XA 1AKSA 5DP9A 1H9HE 2BXUH 1XKAC 7KMEH 1FMGA 4DGJA 3EGKH 3RUOA 2VIQA 2QY0B 1XUJA 4FUGA 1O3IA 1W11U 2F3CE 2AS9A 2J92A 1QJ1B 3F2FA 1RIWC 3RXFA 7LPRA 1CGHA 1VCQA 2EI6A 4YM9A 4DIHH 3N7DA 3RU4T 2BXTH 3H7OA 3MH5A 1EJNA 2BDHA 2A0QB 1O2YA 4B71A 4ZHMU 3UWJH 3RXAA 5CE1A 1K1MA 2VNTA 1O2SA 4X6PA 3G01A 4X6OA 3UNSA 1C2MA 3UOPA 1IQIA 1HIAA 5DP6A 3PRDA 2TGAA 1CE5A 3F9GA 2D26C 3Q3YA 3PMAB 4OGXA 1G3DA 1Y8TA 4X1PU 3RMLH 2QC2A 4B75A 1GJ4H 3VPKA 3MH6A 4A92A 5HIYA 1FN6A 1W8BH 2BY5X 1P01A 3N7OA 1W7XH 2Z3EA 1TMTH 3MU5A 1GVZA 1O2ZA 2XNIA 4GCHG 1W2KH 2TPIZ 2W5EA 2BM2A 2WV9A 5DN6D 2Y82A 3KN2A 4D9QA 1A0JA 3BEIB 3RXKA 1ZMLA 3EAJA 2Z6BD 3OEED 1UTJA 2V6NA 1QBOA 1BQYA 4B2CA 1LPKB 1SVPA 1AD8H 2C8ZB 3U8OH 2XWBI 2OQUA 1S6FA 1GJ7B 2CK3D 1FNIA 7GCHG 3H5CB 1CU1A 2CF8H 4AFUA 1GWAA 1NROH 1QURH 2OC0A 3PV5A 3LH3A 3OYPA 3A8DA 4Z1MD 1GVLA 1TALA 4ZKNU 1LTOA 3KIDU 1EFRD 3ZVCA 2JH6D 3LC5A 4ZUHA 1V2QT 1NFXA 1GHBF 3GISB 1WQSA 3KF2A 2NU1E 2OCVB 3PM3A 2AFQB 3LDXH 3SV6A 1PQAA 3MYWA 3S9CA 1OWEA 1O3OA 3H09A 2TRMA 2CF9H 1A4WH 1QCPA 2V3HH 2KZ4A 4X6NA 5GIBA 4AB8A 2F83A 3GY2A 2VJ1A 3FP8E 1G3CA 4K60A 4R0IA 2Y7XA 4ZKOU 4NFFA 1EQ9A 3FZDA 3UOUA 3I77A 1EX3A 4HG6A 3KQ5A 4AGJA 4WXIA 2PGBB 1P09A 1J15A 5A8YA 1O3AA 3GY4A 1NY22 3SHAH 3RXGA 4Y7BA 3HGPA 1DITH 1P9UA 4KP0A 1G2LA 2FOEA 1C1QA 2YNAA 3NPSA 3UUZA 2BD9A 1RTKA 1YF4A 2YNBA 2VWLA 3A8AA 3M7UA 3BG8A 1YCPK 2AGEX 5AVDA 5E2OA 1O5DH 2A4RA 3LGIA 2FX4A 3BTFE 3PTNA 5GNDA 4TYDA 3V3MA 4ZCNA 5EGMA 4WMFA 1OWKA 3PWCA 1GGDC 4NZLA 4CRCA 1TNHA 1FZZA 1Y5AT 1PPFE 4XBDA 5C94A 4I8KA 4TSFD 2BDBA 1BBRH 3NZIA 3RC6A 3VB7A 1TGTA 3F0OA 1TNKA 2P93A 4UEHH 1M9UA 1HV7A 3ATWA 1MU6B 1ELGA 1Y3UA 2ODYB 2GZ8A 3KYFA 4XDEA 1K1OA 5AFYH 1CGIE 2WV4A 1P3EA 4ISLA 5TCAA 2C90B 3GYMA 1C1VH 2FZZA 3RXOA 4J1YA 1DDJA 4DURA 3KEEA 1CA8B 2AERH 2IJD1 2UUJB 4U30A 5GCHF 4FU9A 4ZROA 1UTMA 2PTNA 4DIIH 1C1PA 1XVOA 2L6OA 1C1UH 2KAIA 2GX4A 4OS4A 2BD3A 5B6LA 4IN1A 4CRGA 3NKKA 1QRXA 1T8MA 2A1DB 2PKSB 5JBBS 4D8NA 1L1GA 2QGRA 2SGFE 1MKWH 4LOYH 3M5OA 3QZQA 1PPGE 1YPKH 1WSSH 4MNWA 3LU9B 2P3UB 3GYLB 4ISIH 5E0JA 4CHAC 2CHAB 1SLWB 2BY9X 3OFND 9LPRA 1OSSA 1EOJA 1K1PA 1W7GH 4AC9A 3E90B 1FLEE 2GJGA 2QF4A 1K21H 1NRPH 1V2UT 4XFQA 1TA2A 1EJAA 1QA7A 1BRUP 3SV8A 2TGPZ 2ZPSA 2ZCHP 1DSUA 4B1TA 1UTQA 3I78A 1MQ5A 1COWD 1GI5A 1N6YA 3MHWU 4SGAE 1ID5H 2W6ID 1C9TA 1SSXA 4IGDA 2Q6DA 2VBCA 4GVUA 1QRZA 3M35A 4GHTA 2ZU4A 1C5ZB 2Z7FE 3P8OA 1NRQH 4CR9A 3EA8A 3VB6A 3NRLA 2GGVB 5A8XA 1E38B 2Y5FA 4WMEA 1O37A 4ZKSU 1P06A 2P3TB 1SQOA 1W3CA 4MG3A 1OWDA 2WUBA 1D6WA 1BJVA 2ZZUH 3M7QA 3A87A 2AH4X 1V2KT 1O2PA 3S69A 4AB9A 4BAKB 4KKDA 4AOQA 3AW1A 8LPRA 3A89A 1BMFD 3MNSA 2V3OH 2F9VA 2DE9A 2VIOA 1GBEA 3GDSA 3V0XA 3PMJA 5T6GA 3SUEA 1GMHG 1AFQB 2A2QH 3UNQA 1SGDE 2BOKA 5C3NA 1GI4A 2BDIA 3RXPA 1H8ED 3LOXA 1YPJH 1YBWA 4JYVH 3L3TA 6GCHG 3RXVA 2PR3A 2BLQA 3E6PH 5DSFA 2FOAA 1BTHH 1HCGA 2BQ7B 2GZ7A 1FI8A 3RMMH 1SBWA 2VWNA 3UTUH 3DUXH 4JZFH 1V2JT 3P92A 4NFEA 1UCYH 2W7SA 2WSSD 3SU6A 2PW8H 1MTNC 1P2OA 1A46H 1ELAA 1DUEA 1TRYA 5EXMA 1FUJA 4RKJB 3SNDA 4BXSA 4K5ZA 1T7CA 4H6TA 1QL9A 1GBCA 1ESTA 2RCEA 4MNXA 6CHAC 3KQDA 3TIUA 1O3CA 2XYAA 5DK1A 1GBKA 1HB0B 2J4IA 2P95A 1EB1H 4YT7H 5E0HA 4Q7YA 2PSXA 5EU8A 1C2FA 1BRBE 4BTIB 1THPB 3UREA 2PFEA 4E06H 1HAZB 3AVZA 1AY6H 1GJ5H 4ABFA 2QAAA 1C1RA 1FONA 1LHCH 1TAWA 3ZZAA 1H9LB 1QQUA 3LGTA 4Y0YE 2FODA 2AGIX 1TABE 2ZF0H 3LKWA 3SI4H 1LHEH 2QXJA 5ESBA 3TGIE 5IK2D 1C1TA 1O2JA 5LPFA 4JK6A 1UK3A 1Q3XA 5C17A 4DOQA 3ZIAD 1C2EA 1UVUH 2XBWA 2GP9B 1RFNA 2H2ZA 4ASHA 3A86A 5JPMH 3NWUA 3VEQB 3ELAH 2HVXA 5EODA 1EZQA 5DP5A 3MO3A 1WDIA 1GBLA 2BD8A 4YLUA 4BAMB 1MD8A 3HK6B 3MNBA 1TX8A 3URCA 3Q3XA 5DGJA 1ELTA 4MQAA 1PQ5A 3SOSA 1GMCG 1AVGH 2Z3CA 1D9IA 1ETRH 3TVJB 2ZP0H 1V2OT 4YESB 1HAYB 4Y11E 3RXSA 1LCYA 4K8YA 2BDCA 3RXTA 3E16B 4NIXA 1IHSH 1XX9A 1XXFA 1ARCA 1EAIA 4ISNA 1D3TB 2GTBA 2FIRH 4TY6A 5A09A 1Y3WA 4INHA 4FUIA 1EJMA 2R3UA 2P8OC 1PQ7A 2LPRA 3M3TA 3OU0A 1GCTB 1MD7A 1YPHC 3TJUA 1Y59T 2J38A 2AHME 2V7QD 4UFDH 2YMSC 2JH0D 1TOMH 3FP7E 1LHFH 1GCTC 2F9PA 3JZ2B 1ZRBA 1CT4E 3GCHB 2P94A 1XM1A 5JB8S 4HTCH 3L6PA 5EQSA 3FAOA 4UDWH 4MVNA 1EUFA 3MH7A 4K69A 1RTLA 2I6QA 4I8JA 4IMQA 4X1RU 2STAE 4O3TA 2FTLE 1C5PA 2G00A 1XVMA 2EC9H 1C4Y2 1P57B 2HNTE 3BG4C 1ETTH 4TWYA 4ABEA 2VU8E 4F49A 3GDUA 1VCPA 1ANCA 1CO7E 3B23B 2ZDMA 3TNTA 1YGCH 1RD3B 2A45B 1BHXB 1OX1A 3LJOA 1IQEA 2A4QA 5T6FA 4MNYA 1GGDB 2IN2A 1AIXH 2XWAA 2A32A 4JYUH 1S82A 1UTOA 2OC7A 4MDSA 4HGCA 5HIZA 4INLA 3UNRA 1MAYA 2AYWA 3LGWA 1QRWA 1W14U 5EJZA 1W0KD 2Y7ZA 2QCYA 1XUGA 2OLGA 2J98A 4H42U 1Z8RA 5LPEA 4R8TB 2ZDAH 2SFAA 3B8JA 5EXNA 1ELEE 1WYKA 1F5RA 2O8TA 5C1UA 5FPTA 1YKTA 2ILNA 3HKJB 1GJBB 3BTQE 3SV7A 4NGAH 2QF5A 1JIRA 2KX4A 2ZCLP 3JZ1B 1GJDB 3PMBB 1P02A 1IHTH 3F9FA 2OK5A 2OQ5A 2ZDNA 5C0TA 3RXEA 2ZU2A 4X0WU 3T26A 2ZFSA 4FUHA 1HAIH 1HNEE 3PLPA 5C1XA 4BAQB 5L2YH 3DSOA 5FBEA 3OE7D 3RLWH 4ABGA 4AFQA 4NIYA 1DWEH 5B6OA 1Z8GA 1XMNB 2C3SA 1C5WB 5DP4A 1F2SE 1GI9B 3C27B 2BDAA 1N1LA 1V2ST 1OWJA 3CP7A 2BOHB 1AZ8A 3U28C 3GCOA 1SFQB 1TNLA 2A2XH 3U69H 1HAXB 1KLJH 1DY9A 1KXFA 2HNTC 4IC5A 1WAYB 3VGCB 4YTAA 1EAXA 1C5SA 2BHGA 1RTFB 4YLQH 5A2MH 3UB0A 1S84A 2UWLA 1G32B 3TJNA 2VH0A 1BMNH 1BT7A 3RMOH 5FHTA 4Q7XA 3TITA 1WOFA 1UCYE 9ESTA 3FKSD 2FI5E 4JK5A 2AMDA 5I46H 2GDDA 2I6SA 1NO9H 2HPPH 3DFLA 1DUAA 1JIMA 1O33A 3EYDA 2O8UA 2R0KA 5KEDA 2PSYA 1O36A 2QXGA 3SW2B 1GJ8B 2HRVA 1S6HA 2FLBH 1FX0B 1P2IA 1V2VT 4BOHA 1C5MD 4ZH8A 2CN0H 1HJAB 2WINI 1MQ6A 3B9FH 2EI8A 4ZAEA 2G55A 4KELA 3A7XA 1P3CA 2FP7B 1KDQA 1GHAF 1GBFA 1S0RA 1MTNB 1AO5A 2BMGB 3VG8A 4YOIA 3DA9B 3P8FA 1FV9A 2SGAA 3ZVGA 2XC4A 2FYQA 5ABWA 1V6DA 2B8OH 3LC3A 3MO9A 2FOFA 3LGYA 1GI8B 2KFWA 1HAHH 4WY3A 3RXMA 2PTCE 2KCOA 1TRMA 2ZNKH 1TBQH 4HFPB 4D76A 4A7IB 2Z94A 3N7EA 3FO8D 5IYTA 1O3JA 3R3GB 4NA8A 3D62A 1UHBA 3BTKE 1BRCE 4K1EA 1SI5H 1OKXA 1OS8A 2PUXB 3SNEA 1RRKA 5HKKD 4AX9H 3IG6B 4K1SA 3S9AA 3EE0B 3KYGA 5A0BA 3AASA 3QUMP 3ZZ8A 2D2DA 4NG9H 1ZZZA 3BEFB 1ZPBA 3NXPA 1B5GH 2ZGXH 1BTWA 1EZSC 1NZQH 4RT1A 5DG6A 2ZI2H 1TGBA 4ABJA 2C4FH 1O2TA 1KTSB 4B2AA 1O5AB 1S5SA 3ZZ6A 1HPGA 3W95A 2OINA 4DT7B 2CMYA 1VGCC 3QWCH 1FY4A 1W0ZU 3A7ZA 4WVPE 3M7TA 3PO1C 3O8BA 3ZZ9A 2RG3A 3S0NA 3K6YA 1Z1JA 4P00A 3ZVEA 3Q77A 2EI7A 3OX7U 1CHGA 2Q6GA 1VGCB 1KMHB 1BITA 3S9BA 1SHYA 1A2CH 1O0DH 2ESTE 5L2ZH 1O5BB 3A84A 1ARBA 2ZO3H 4E7NA 5J4SA 2QF0A 1C5NH 1TOCB 3OTPA 5GPIB 2F9NA 1E37B 4TPYA 3MQKC 3V13A 1O34A 4XSKU 2ZGCA 1P2KA 1ZHPA 1NBME 3ZYEA 3PYHA 2QA9E 4XE4A 3TU7H 4DJZB 5LPRA 3WY8A 4Q80A 1BBRE 3OAAD 5PTPA 2ZFQH 5DO4H 2ZHEH 1EP6A 2G5VA 1L1JA 4MTBA 3W94A 1FY1A 1O30A 1FQ3A 1LQDB 1VR1H 3KL6A 1BTUA 3L33A 1HGTH 1UW7A 2WPDD 2YOLA 2ZHWH 2F43B 1GG6B 1K1NA 1VITF 1T31A 2GZ9A 1JRSA 2XBXA 1OYTH 1ZTKA 4GSOA 5KGOA 3PTBA 1LHDH 4Q2KA 1ELDE 1Y3YA 3UWIA 2P8OB 3PWBA 4A1TA 1U6QA 5HM9A 2ZG0H 1F0RA 1NRSH 1IQLA 3ZVAA 1XUKA 2FS9A 3ESTA 2GMTB 1GBJA 4BANB 1AGJA 3NCLA 1SLXB 2BVRH 2V35A 3RLYH 4FUEA 5T1VA 5FPYA 4CBOA 1OP2A 3F2GA 3TJVA 1BB0B 3GS9A 1QNJA 2OD3B 2HOBA 1BOQA 4FUBA 4GCHF 2LP6A 4CR5A 4E05H 3F2HA 5DKMA 3WWFA 8GCHG 1O2GH 3TK9A 1E1QD 3ATIA 3RXDA 2BVXH 1SGFG 1XKBC 3SJOA 2VGCB 1A1RA 1O2NA 3GY5A 4TWWA 5EQQA 2F9OA 1SGIB 1YPHE 1AHTH 1KXCA 2OP9A 2W6JD 4Q4LA 4CBNA 1MAXA 1BMMH 2Z9GA 3SNCA 4OS7A 2FI3E 4BTTB 1SOZA 3ATMA 2WPIS 3K6ZA 1PPCE 2QXHA 1A3EH 1GI1A 4Q63A 3ODFA 1GBTA 2J5UA 1FPHH 5CMXH 3SU2A 2FWWA 3Q3KA 2XTTB 3LIWA 4FVBA 1G36A 1QB6A 4WJG2 5H4IB 2Q1JA 1Z7KA 2OC1A 5C5OA 4X1SU 2VWOA 1D3PB 1O35A 2F9UA 2B7DH 1QBNA 5E8EH 1EATA 3EE7A 1V2PT 2BD5A 2ZTXA 5GDSH 1UVTH 1AE8H 2XBYA 1S85A 2HNTF 2R0LA 3A83A 1P04A 4UD9H 5DP3A 3T29A 2GCHG 1G2MA 3VGCC 2FOCA 3Q76A 4BTUB 2ANWA 1C5OH 5BRRE 4XD7D 4ZKRU 1C1OA 1QB9A 1TPSA 1UHBB 1GI7B 4IC6A 2QN5T 2C93B 2VIWA 2ZHQH 5JBTA 1LVBA 2CXVA 4I86A 3STJA 1EASA 1E1RD 2Z9KA 3SGBE 2SNVA 4FU8A 4RSPA 1DSTA 3SQHE 3SU3A 4YXWD 2TGDA 1UK2A 3LH1A 3STIA 3SU1A 4NCYA 2OBQA 2FX6A 4RKOB 3PMHB 2J94A 5SGAE 1T8NA 1TA6A 3A7TA 2FTMA 4KGAA 1GBDA 3RC4A 3SU0A 4LZ4B 4X8VH 2R3YA 1SMFE 2XCNA 3DSGA 3MO6A 4HI3A 4TY7A 1GI2A 3C1KA 1KLIH 3DD2H 4FUDA 3MU8A 2ZFRH 2PV9B 1TNIA 1HXFH 1UO6A 1ZHRA 2Z9IA 4MLFB 1O3GA 4CREA 3TK6A 2ZKSA 1HAVA 1P03A 3RM2H 3DCLA 1VZQH 1DLKB 3GY7A 4AZ2B 1C5YB 4H6SB 4ZHAA 2ZQ2A 3GCTF 2UWOA 4BXWA 1BDAA 2GV6A 3U9AH 1E36B 3PROA 1LO6A 3M5MA 5GCHG 2FDAA 2W3KA 2LNCA 4Z0KA 1BTXA 3BV9B 5GJ4B 3SI3H 1ELVA 4Y71A 1YCPM 1IQGA 1PPHE 3K9XB 1HAPH 4K2YA 2ZFTA 4A6LA 2A7JA 2CJIA 1IQJA 2ZCKP 3HKIB 2BLVA 2XXLA 1C1NA 2EEKA 2XBVA 1C4U2 2WYGA 2FPZA 3SZNA 3QGNB 2A7HA 2GCTC 1F92A 1P2NA 1INCA 1IQFA 1MKXH 5FXLA 1HYLA 1YPGH 2WHXA 5EIYA 1GPZA 1A5HA 3VB5A 1NPMA 1FIWA
chains in the Genus database with same CATH topology
2NU0E 2WPHS 1IQHA 4YT6H 3KQEA 4X2WA 1AZZA 2OUAA 1JMOH 1QGFA 1EZXC 4TPIZ 2ZDKA 1LDTT 2PLXA 2ANYA 2ZU3A 1PYTC 2BZ6H 2Y6TA 4X8SH 2H6MA 2H9EH 4Z6AH 5JB9S 2AGGX 1NC6A 3UPEA 4NZQA 2IJOB 5K0HA 1THSH 3PB1E 3QDZB 1NU7B 1MBQA 2UWPA 1O3PB 3SU5A 3SUFA 3VXFH 2THFB 5JBAS 1KLTA 3QX5H 2AMPA 1C2KA 5F8TA 3ENSB 3BTHE 1YCPH 4X2VA 1UTKA 3R0FA 1G3BA 2BY6X 2O8LA 1W12U 2VIVA 2QYIA 2HALA 1PPZA 3BTGE 4FUCA 1QY6A 2OXSA 1LQEA 2TGTA 1G37A 1GBMA 1IQMA 3M61U 2OTVA 3UR9A 1D4PB 3KQBA 2IPHA 1DXWA 1WUNH 1HFDA 1DOJA 4CHAB 1AVXA 2FOGA 1FDPA 2XRCA 1SGNE 2H1UA 2BX3A 5IDKA 4VGCC 1VITG 2HPQH 5T3HA 3QO6A 4FUJA 5DPAA 3MU4A 1GHVH 4U32A 5L6NH 4DW2U 3GCTG 4H4FA 5FBIA 3T2NA 3BTEE 2UUYA 1GG6C 1W13U 4NWKA 2BLWA 3A88A 1O2HA 2G52A 1FN8A 2A5AA 2G81E 3QK1A 1V2NT 1TPPA 2WPMS 2GV7A 3A7VA 4IS5A 3EDXB 3M37A 4JMYA 2P59A 1LVOA 4WF8A 3D49H 1NM6A 1XUHA 1AFQC 1MUEB 1S81A 2G8TA 2VGCC 4Y76A 2ANMH 1SGTA 2ZFPH 3U8RH 1QBVH 1NESE 3BTME 3BIVH 2JETB 3URDA 4ZMAH 1TPOA 2PKSC 3U8TH 1QTFA 1NS3A 4I8HA 4B2BA 3E8LA 3SQEE 1ZYOA 2V0BA 1FY5A 3O8RA 2ZU1A 1F0SA 4AYYB 3LJJA 1K1JA 4X1QU 1AE5A 3GCNA 2B9LA 1CT0E 5TCCA 1BMLA 2B0FA 1HAVB 3SJ9A 4OS2A 1TPAE 1ZPCA 3HGNA 1C2JA 1MBMA 4GHQA 3ZV8A 3GDVA 1KSNA 4BAHB 1F7ZA 3F1SB 5EQRA 3ZVBA 1GHBG 4AGKA 6CHAB 1K9OE 2ULLA 5E0GA 5HMAA 1AMHA 1ZOMA 2EA3A 4ABHA 1W0YH 5FX5A 3MU1A 3AAVA 3H7TA 1ZLRA 1ZRKA 1T8LA 5F6MA 2Y80A 1TX7A 3LONA 2B5TB 1OOKB 3RM0H 1N8OB 3MTYA 2JKHA 3QN7A 1K22H 1P05A 1DWDH 1P2QA 2RDLA 4K8BA 3RP2A 2W7UA 1V2LT 3U1IB 3SORA 1GHXH 3E0NB 4OS6A 1GMHF 3O8CA 1GMDG 2A4OA 1ABIH 2OBOA 1NN6A 1TONA 1C5VA 5AFZH 1T4VH 1UTPA 1AWFH 3MWIU 1LKBA 2ZTYA 2FOMB 3PV4A 2ALPA 1TMBH 1CSOE 5ETXA 4AG2A 1QA0A 1GJ6A 4OS1A 3SV9A 2GD4B 1P8VC 2ZPQA 3TLOA 3K2UA 1GDUA 4ABDA 5AF9H 1BRAA 2ZWLH 2ZA5A 1O5CB 3FFGA 1YM0A 3P6ZB 4MPXA 1TBRH 1K2I1 3VFEA 1O3DA 3RDZA 1CT2E 1UCYK 1ZSKA 4OGYA 4X8TH 1K1IA 1GVKB 3SJ8A 2BY8X 1DS2E 2TIOA 1MMJN 1GL1A 2A5KA 1HJ8A 2UUKB 1MCVA 2BQ6B 1A7SA 1YPLH 3A8CA 1XUIA 2VVUA 1LPGB 1EPTB 1CHOF 1JOUB 5C5NA 5GXPA 3SGQE 3PLBA 1RGQA 3A7YA 4YO9A 1EZUC 1RXPA 1EKBB 3RXHA 3BN9A 2ZGHA 2GCTB 3ZZCA 5G4BA 1H8DH 3KQCA 3D65E 3UIRA 2AIPA 4CRAA 1LVMA 1O2WA 2K1QA 1C1SA 1ACBE 1J14A 4ZXXH 3GCHC 1TGSZ 3EQ0H 2VWMA 4B73A 2FXRA 1FY8E 2QIQA 1TE0A 1E0FD 1SG8B 3ZV9A 3SHCH 4Y6DA 1IAUA 2BD7A 1O3LA 2F9BH 4GPGA 4I32A 1UMAH 1VCWA 2Z3DA 3V7TA 1HLTH 6GCHF 2O8MA 4Y8YA 1FAKH 5HM2A 1ESAA 2J2UA 4YOGA 3UY9A 3TH3H 1YP9A 2ZECA 1QFKH 2NU2E 1GMCF 4Y8XA 2BYAX 4D9RA 2BD4A 3SJIA 1O3NA 4CRDA 4KTCA 5C1YA 4WH8A 1QQ4A 1SR5C 2VVCA 2PKAA 3U98H 3BTTE 2O8WA 1ANDA 1L4DA 4SGBE 1P9SA 1VJ9U 4B74A 3DHKH 1BTYA 1MH0A 2H9TH 4K1TA 1C5QA 1UJ1A 1V3XA 3VB4A 1O2UA 1E35B 1SGEE 1ESBA 3SJKA 1EOLA 1PPEE 2ZU5A 7ESTE 1G3EA 1ZR0A 5F8ZA 1Z8IB 4D7GA 5A0CA 5A0AE 1AI8H 1TNGA 3MH4A 4VGCB 2FS8A 1C9PA 1FPCH 5EW1H 4U2WA 1O32A 2A7CA 3A82A 1DICA 3TH4H 1G30B 2W3IA 2R2WU 1UVSH 5EPNA 1MCTA 3MU0A 1SB1H 4UFGH 1ZMNA 2CV3A 4Q7ZA 5C2ZA 4AG1A 2FM2A 5TJXA 4NA7A 1O3KA 1ZGIA 1ZSJA 1NTPA 5C20A 5DJ7A 1PPBH 1GJCB 1GHAG 1P2MA 1TNJA 1QB1A 1SGQE 3QTVH 3BG4B 1DWCH 3F9HA 1OP0A 2H5CA 1ORFA 1C1MA 1L1NA 1NRRH 4INKA 1SGRE 3UQOA 1SGPE 1GBIA 3MNXA 2HWLB 8GCHF 1HUTH 2AMQA 1DM4B 1UK4A 1MTUA 1V2TT 1A0HB 2W26A 3DT0H 2BY7X 2GMTC 2C8XB 1QR3E 1O3MA 1KXDA 1HJ9A 1AUTC 2G4UA 3KGPA 3P8GA 3VXEH 3ZYDA 1CHOG 2G51A 4XBCA 2ZDLA 1AN1E 1QHRB 2BB4A 1C2IA 1ZJDA 4IW4E 2VH6A 2BVSH 3ATLA 5DP7A 3UQVA 4AYVB 3EA9A 1O3BA 2FMJA 1GJAB 1OWHA 2FYRA 2BDGA 2H5DA 3LT3A 2SNWA 2XC5A 4LXBH 2QXIA 3AAUA 3TGJE 3P17H 2ZIQH 1H4WA 1MTVA 1O39A 4O03A 2VIDA 2CGAA 2NU3E 3NUMA 2WPKS 4AFZA 6ESTA 4MPUA 3V12A 1AQ7A 1B7XB 1Q31A 4BNRA 1T8OA 2DUCA 2FOHA 1MTWA 1EAUA 1WTGH 4JCNA 1BCUH 1DFPA 4J2YB 3BTWE 2RA0A 1TYNA 4I33A 3ZVFA 2SGPE 1GL0E 4WH6A 1A5GH 1C2LA 1OYQA 4XBBA 1ZHMA 1NFYA 1CQQA 2ZEBA 1J9CH 8KME2 2BD2A 1BTPA 3OY6U 1WBGB 3ODDA 3CS0A 4LK4A 1W10U 1CGJE 5EW2H 1SC8U 2QV1A 2XW9A 3RXJA 1V2WT 1KTTB 2FO9A 3EA7A 1BUIA 2GT8A 3HATH 3BSQA 1O2XA 1C2GA 3FVFB 3SN8A 4JZIA 2O9QA 3HPTB 1AVWA 1GI3A 1Y5BT 2BLOA 5AHGH 1GDNA 3ZZ3A 1P12E 1YLCA 1C5RA 1SL3A 2ZGBH 4JZDH 1GDQA 1TQ7B 3BTDE 3MOCA 2AEIH 4FXGH 2WUCA 5HXFA 2A31A 5CHAB 1TX6A 4NIWA 4FUFA 1AFEH 3UFAA 4AORA 1X7AC 3CENA 4RN6A 1SQAA 1DT2A 1TBZH 3KCGH 3P70B 3RU4D 4ESTE 7GCHF 3SBKA 1DY8A 1KXBA 1C5LH 3SNBA 1S0QA 3M36A 5FCRA 4I31A 1HXEH 1MTSA 1NU9A 1H8IH 4IBLH 8ESTE 2GDEH 5T6DA 3F68H 1O3FA 1IOEA 1B0EA 1ZPZA 3ZZDA 2Q6FA 1JWTA 4M7GA 2UUFB 4CRBA 3E3TA 3VB3A 2AIQA 1EAWA 3ZZBA 1SLUB 3P8NA 3RXRA 1TFXA 1CBWC 5F8XA 3BF6H 2VINA 1ELBA 1KXEA 1WCZA 4JZEH 3RC5A 2QF3A 4ZHLU 1C5UA 2GVFA 4KTSA 3E1XB 1BIOA 1F0UA 1O2LA 2GKVE 3M3VA 1BHXF 1EB2A 1G9IE 1TWXB 2KAIB 5K7RA 1O5GH 3NK8A 1THRH 3E91A 1C5XB 1VITH 2J34A 3ITIA 4X2YA 6LPRA 1GMDF 4Y7AA 1GI0A 1KDQB 3SUGA 2C8WB 2NWNA 1O2QA 1TLDA 2SGDE 4AFSA 2XC0A 4A5TS 1QIXB 1Y3VA 3TH2H 2VB0A 2BTCE 1CA0C 2VVVA 1PYTD 1Z8JB 1UVOA 1V2MT 1C5TA 3QZRA 4QT8C 4CRFA 3TK5A 2ZGJA 3GOVB 4O9VA 3I29A 4UFFH 3A81A 1AKSB 1Z6JH 2BX4A 1NFUA 4OS5A 2GT7A 1GJ9B 4X8UH 1ANEA 3QLPH 1QL8A 1Z1IA 3KHVA 3BIUH 4ZXYH 5FAHA 5BPEA 1PQ8A 4X6MA 2Y5HA 3KNXA 1KXAA 4WXVA 2HLCA 3MNCA 4UFEH 1GBBA 1O2OA 3FP6E 1YC0A 1SGCA 1LMWB 4NSYA 3A7WA 3GY3A 5A8ZA 3RXIA 4IMZA 1TRNA 1GHYH 1UTNA 2PGQB 1UVPA 3A85A 2Y81A 1GBHA 1BTZA 4YZUA 1O2MA 1C1WH 5FPSA 1MZDA 3M3SA 2FEQH 2RA3A 2G4TA 1DANH 3E0PB 3ZZ5A 4XOJA 1RJXB 3LGUA 4LZ1H 1CVWH 4ABIA 1BJUA 4MPWA 5LGOA 1J8AA 1B0FA 1J16A 1FAXA 2PKAB 3OY5U 1J17T 5GWZA 4YOJA 1EPTA 1MKWK 1KIGH 1L4ZA 4A1VA 1GCDA 4JYTA 3RXBA 1AUJA 3U1JB 3RXCA 4THNH 4WMDA 4WWYA 1O2VA 1OP8A 2H9HA 1V2RT 1RIWB 2BQWB 1TQ0B 1C2HA 1GBAA 3M5NA 2ODQA 4CH2B 2PHBA 1F5KU 1A3BH 2TBSA 1IQNA 3Q00A 2A5IA 3A80A 3IITA 3A8BA 3GY6A 1BZXE 4MNVA 3ATKA 2Z9JA 3TJOA 1OPHB 5E2PA 1AU8A 2ZC9H 2Z9LA 1HBTH 5EPYA 1XUFA 1YPMH 3MMGA 4A1XA 4GLYA 1A61H 1A0LA 3T62A 2F91A 1YLDA 4DY7B 1BBRK 1GHWH 4Y10E 1GI6A 5JBCS 1LHGH 1TB6H 3ZVDA 3D23A 2P3FH 1BA8B 4GUXA 5ESTE 1DLEA 3K65B 1N8OC 1YPEH 1AB9C 4MPVA 1O5EH 1ZTLA 2A4GA 1ANBA 2ODPA 2J9NA 2C8YB 3AW0A 4UONA 3HK3B 1L2EA 3RXUA 4E7RG 3RXQA 1AB9B 1JRTA 1Y5UT 2BDYA 3P95A 2ASUB 1P0SH 2GCHF 1SLVB 1FIZA 1DXPA 1AWHB 4O97A 5HGGA 4KTUA 3TPIZ 3RXLA 2IOTA 2BZAA 3T5FH 3M5LA 3RMNH 1F0TA 5J4QA 1OXGA 1EXFA 3BEUA 1N6XA 4IN2A 4ISHH 1TGNA 1TIOA 4I8GA 1KYNA 1FY3A 4AN7A 4Y79A 2M5TA 1K1LA 1SOTA 2ZPRA 3F6UH 2VIPA 1FJSA 3MFJA 3PLKA 1C2DA 1ZTJA 1UTLM 4FVDA 1GHZA 1WV7H 1QJ7B 1ZJKA 2JH5D 1JBUH 1HJAC 4DG4A 1SGFA 5EOKA 5CHAC 4NA9H 3GICB 1O3EA 1SQTA 3LGVA 4DVAU 1SFIA 4Y8ZA 2ZQ1A 3ZZ4A 1JXPA 1MKXK 3OSYA 3SUDA 1P2JA 5FX6A 2WV5A 1ELCA 3QGJA 2WYJA 1LKAA 1NT1A 1HDTH 1WU1A 3MI4A 1H9IE 4UE7H 3SO3A 1QL7A 3RU4E 1TMUH 1NFWA 4BAOB 4I7YH 1HAOH 2FOBA 1EP5A 2J95A 1EPTC 5DP8A 3T25A 1QJ6B 1CBWB 4F4OC 2HGTH 3T28A 4FU7A 1D3DB 1O2IA 5JYIA 1H1BA 2ZFFH 1OWIA 1ELFA 5L30H 5LH8A 1YYY1 4DCDA 3F9EA 1HRTH 1L0ZA 1O38A 1VJAU 2ZHFH 1TGCA 3GY8A 3O8DA 1CA0B 2ZTZA 4ABAA 1ETSH 2Y5GA 1ZSLA 2ANKH 2WPJS 1ZGVA 2FI4E 2D8WA 1O2RA 4O3UA 2R2MB 2PWXA 2FLRH 5FCKA 1O31A 3DFJA 5F03A 4Y0ZE 1DX5M 4NSVA 3T27A 1WQVH 3PO1B 3SU4A 1P10A 2SGQE 1ZMJA 2ALVA 1MZAA 1RS0A 4ISOA 2JETC 3CS7A 1Q2WA 1HIAB 1T4UH 4NWLA 5EXLA 3S7HB 2D1JA 1DWBH 2P16A 4D7FA 4PROA 4X2XA 1XXDA 1O3HA 1MU8B 2CHAC 2R9PA 3SV2H 3ZZ7A 4ABBA 1SGYE 3TNSA 1WTHD 1D6RA 1FXYA 1KY9A 1DVAH 4CH8B 3FANA 3S7KB 1DPOA 2OC8A 2ZHDA 3SNAA 1DE7H 5EG4A 1E34B 1PFXC 2ZDVH 1F5LA 1K28D 4GAWA 1PJPA 1Z71A 3QTOH 1LVYA 1SPJA 1IQKA 1T32A 2XCFA 2G5NA 2STBE 2WPLS 4X1NU 1O2KA 1A5IA 2DE8A 1LPZB 3IWMA 1D3QB 1C4V2 3FZZA 5I25A 2PUQH 4HZHA 5HYOA 1NRNH 1O5FH 2FESH 3SGAE 2SGEE 3TGKE 4K3JA 3UR6A 4NIVA 4B76A 4I8LA 1ABJH 1BMAA 1HAGE 1P11E 5C67A 1SHHB 3LPRA 2NU4E 3OTJE 1S83A 1Z6EA 4JZ1A 4U01A 5JDUB 1Y3XA 1AKSA 5DP9A 1H9HE 2BXUH 1XKAC 7KMEH 1FMGA 4DGJA 3EGKH 3RUOA 2VIQA 2QY0B 1XUJA 4FUGA 1O3IA 1W11U 2F3CE 2AS9A 2J92A 1QJ1B 3RXFA 1RIWC 7LPRA 1CGHA 1VCQA 2EI6A 4YM9A 4DIHH 3RU4T 2BXTH 3H7OA 3MH5A 1EJNA 2BDHA 2A0QB 1O2YA 4B71A 4ZHMU 3UWJH 3RXAA 5CE1A 1K1MA 2VNTA 1O2SA 4X6PA 3G01A 4X6OA 3UNSA 1C2MA 3UOPA 1IQIA 1HIAA 5DP6A 2TGAA 1CE5A