2PTCE

The geometry of the reactive site and of the peptide groups in trypsin, trypsinogen and its complexes with inhibitors
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (proteinase/inhibitor)
molecule keywords BETA-TRYPSIN
publication title The Geometry of the Reactive Site and of the Peptide Groups in Trypsin, Trypsinogen and its Complexes with Inhibitors
pubmed rcsb
source organism Bos taurus
total genus 52
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1982-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2ptcE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2ptcE02
1DX5M 2BD9A 1CO7E 2O9QA 3EGKH 1CVWH 1QBVH 2QGRA 3SUFA 2H5DA 2C93B 1ID5H 4XFQA 4J1YA 2FOBA 1P8VC 4ISHH 1HAYB 2G5NA 2QN5T 2STAE 5CE1A 4K8YA 4K8BA 4K1TA 3RXQA 3ZZ8A 1KTSB 4MVNA 2KAIA 1QJ6B 1QB9A 4MG3A 1YPGH 1JIMA 5L30H 1O5GH 1P9SA 1GVLA 1V2VT 1YPEH 1MTUA 1TGCA 4LOYH 1GJAB 1LVMA 1PPHE 3NPSA 6CHAB 1Y3VA 1THSH 1NTPA 1SLWB 4CRFA 2ZCLP 3V13A 2Q1JA 1GBHA 2GCTB 1K1NA 4R0IA 1NPMA 1O2NA 1W7GH 2R0KA 1GL0E 1O33A 4D9RA 1GHWH 1HAIH 1GCTC 3RXIA 1UVTH 3UWIA 1GBJA 2XBWA 1C5MD 1EKBB 1P2OA 1MKXK 1UTLM 1B7XB 1FUJA 4DT7B 1RTFB 1ZTJA 3RXAA 2ZGJA 5JB9S 3A88A 3E0PB 1P01A 1LVYA 5C1XA 2QXGA 2PGQB 1SOTA 2JKHA 4NSVA 5EODA 1QHRB 1XUFA 2XYAA 4LXBH 4GPGA 1YLDA 1NRNH 1MCTA 2O8WA 2QY0B 3A86A 3ODDA 4GHQA 3C1KA 4INKA 1C2KA 5FXLA 2P3UB 2A1DB 2RA0A 1G37A 1TA2A 1ZGVA 1TONA 5C2ZA 3A8AA 1O5CB 4I8KA 3I78A 5FAHA 1F0RA 1P2IA 4BAQB 1GHVH 1AE8H 3A7VA 1L4ZA 2A2QH 1C5YB 1GI5A 4F4OC 1TRYA 1KDQA 3A87A 1A2CH 3MYWA 3TNTA 1G9IE 1ZRKA 2ZDAH 2XRCA 1A0LA 1BMLA 1V2QT 3V0XA 1OS8A 1GJ9B 2WYJA 2J4IA 1WUNH 1YF4A 3TGKE 3DFLA 4SGBE 1GBCA 3ATMA 1O3MA 2ZDMA 1LHGH 1XUJA 2PUQH 3V3MA 4JZIA 3EA7A 4KP0A 5A0AE 2BY6X 2ULLA 1HXFH 1ZR0A 1GMDF 1QRZA 2Y6TA 2ZFSA 2M5TA 2GV6A 2H6MA 1YP9A 1C5LH 1O2XA 1GBMA 2PGBB 2VB0A 2XNIA 3QGNB 1SGPE 1C2LA 2GGVB 2ALVA 1G36A 2O8UA 1HRTH 1TGBA 9LPRA 1EZXC 1K1IA 1O3BA 4IN1A 1P12E 3DFJA 1EZQA 1NRQH 3MU8A 3IWMA 1OWKA 1P2NA 2HALA 1A5HA 1GI3A 2AGEX 4TPYA 1S85A 4ZMAH 4AYVB 3BSQA 3B23B 4UDWH 2J95A 1MTSA 3PO1C 4ABAA 5B6OA 4Y11E 4DGJA 1W12U 2EI8A 1EATA 1JRSA 3H5CB 3ATIA 3AAVA 3K6ZA 4OGXA 4I7YH 4FVBA 4Q7YA 4AZ2B 3PMBB 4CHAB 3BV9B 3URCA 1RFNA 3FAOA 3Q3KA 5T6FA 1SSXA 2BD5A 5C3NA 1AVWA 2BLQA 1P06A 4R8TB 1MZDA 2CHAB 2GZ9A 3GCHB 1DM4B 1NO9H 3MU1A 3ZVFA 5HGGA 1NRRH 3VB5A 5I25A 4NA9H 2QF0A 1MAXA 1NFXA 2SFAA 2UWOA 4YM9A 3GICB 3VB7A 4UFGH 1SGCA 4ZKSU 3PB1E 1EJNA 5AF9H 4X2VA 1L4DA 1O2HA 1K1PA 1TFXA 4NIVA 4A5TS 2W3IA 2ZF0H 2OBQA 3EQ0H 3A89A 1LPGB 3VXEH 1VCPA 5C20A 3U8RH 1Q31A 1TB6H 3BEFB 2C8WB 1DSTA 1Y59T 3MHWU 1DSUA 1UVUH 1V2LT 4GHTA 1TALA 1PPCE 2YNAA 4AORA 3E3TA 1NRSH 3O8DA 1F5LA 3AASA 5GCHF 1HAPH 1HB0B 2VIVA 2A45B 1AD8H 3A7ZA 5C1YA 3LGVA 1LPKB 1V3XA 3TK9A 2OC7A 5JBCS 2BQ7B 3SV2H 6CHAC 2PKAA 1V6DA 1YCPM 3M5OA 4Q2KA 1FMGA 1C1VH 1DOJA 2FX6A 2G81E 1LCYA 3W95A 2GCTC 5DP9A 1WBGB 3M37A 3ZZ6A 1CSOE 4B1TA 1CA0B 3SQHE 1GMHG 3E6PH 2QC2A 1G3CA 1H4WA 4Y10E 2Z9GA 1SBWA 3RXBA 1K1JA 1TPSA 1UTKA 3NUMA 4FUGA 2GD4B 1LHDH 3TLOA 1C1MA 2ZKSA 3PWCA 5A0BA 4I8GA 3DUXH 1VCWA 1XVOA 1GVZA 2ZGBH 4B2CA 1HDTH 2Y80A 1DWEH 3MU4A 1GCDA 1X7AC 1Y5AT 2ZTYA 4IW4E 1SHHB 1HJAB 2XBXA 5ETXA 1C5PA 2PWXA 5JPMH 2ODQA 3M7QA 2BLWA 5HMAA 1XUGA 2FXRA 1HIAB 1Q2WA 2A5IA 1GI9B 3LH3A 1IQHA 3ATKA 2VNTA 1XVMA 3LGTA 1IQGA 5FCKA 1EP5A 2A5AA 3ENSB 3KCGH 1QURH 1TGTA 2BDGA 2WV4A 1P3EA 1YYY1 5CHAC 1N6YA 4HZHA 3RXVA 4YT6H 3B8JA 5FHTA 1SHYA 4NG9H 4ABHA 2W7UA 1HAHH 2ANKH 1O5AB 5L2YH 1VGCC 1GJDB 2FEQH 3HKIB 3SQEE 1V2RT 1SG8B 2ILNA 1ABJH 1G3DA 2BD4A 1CHOF 2F3CE 2GZ7A 5TCAA 4YOGA 3QZRA 3KHVA 1TLDA 2A2XH 3URDA 5EGMA 3ZZ4A 4BAMB 4ASHA 4IC6A 4FUEA 1SC8U 3TK6A 5LPFA 1ZHPA 1O3GA 2WYGA 3BF6H 4BANB 1BMAA 1IQNA 2CV3A 1SOZA 1FIZA 1AB9C 3RU4T 3RXEA 1PPFE 1YM0A 2H9TH 3TU7H 4GVUA 3UFAA 4YLQH 5GCHG 2C3SA 3FANA 3ZVEA 3BTEE 4JYVH 1L1GA 2OD3B 2VIWA 3JZ2B 2HPQH 3ZVDA 4B71A 4AFUA 3TJVA 1QA0A 3TGJE 1K1MA 1ESTA 5L2ZH 3RMNH 3V7TA 1IQJA 2ZHFH 4X2WA 1VCQA 3Q76A 3BN9A 4JZ1A 2P3FH 1S5SA 2PLXA 4ABFA 4ABIA 1GJBB 3QX5H 1BUIA 4DCDA 2OINA 1F5KU 2AMQA 1TX7A 3SJ8A 4ZHLU 1HUTH 2GKVE 1W0ZU 1SGRE 1CQQA 3P8OA 2AYWA 1NZQH 1GJ8B 1WYKA 2VVVA 2Y81A 4CHAC 1NU9A 2VIDA 4OS7A 1SR5C 3LOXA 1V2MT 3UOPA 4Y6DA 2GCHF 2ZDLA 2A7CA 3FFGA 3CS7A 1H9LB 2FOGA 3SI3H 1SLVB 1EJMA 2XXLA 3SO3A 1Z1JA 2BDHA 2CHAC 1EP6A 2B9LA 1WSSH 1FY1A 3GCHC 1W11U 3T2NA 3SJKA 4U30A 1QNJA 4X6PA 1XUHA 5EXLA 2CGAA 5FBEA 5IDKA 1G3EA 3DA9B 2WPHS 3E0NB 1ZYOA 1BTHH 2YNBA 2PSYA 2J92A 1AQ7A 1LPZB 3LONA 1DY8A 4FUJA 3PM3A 4QT8C 2FESH 4AFZA 1UHBA 3ZV9A 4GAWA 3ZVCA 2EC9H 2FTMA 2VIOA 1C5NH 4UFEH 4Y0YE 1TRNA 3ZZ5A 1TMUH 4MDSA 1T4UH 1O38A 3KN2A 3A7XA 1TMBH 2UUYA 4FU8A 1W8BH 2FIRH 5EG4A 1AFEH 1RGQA 3GY4A 3U8TH 3GCOA 1UVOA 5CMXH 1O3JA 2ZU3A 3D62A 2FM2A 2H2ZA 4X6OA 1ZHRA 3LGUA 1ZPZA 3ZZ9A 2FI4E 3OY6U 2ANYA 3VB3A 5DO4H 3SOSA 1FONA 4D76A 1DS2E 4CRAA 7ESTE 1S81A 1EASA 4NIXA 3ODFA 1S6FA 4K60A 2VWLA 2RCEA 4NZLA 1IQLA 1G3BA 4B76A 1LKBA 1CA0C 1GBIA 1MTVA 2GZ8A 2QA9E 2WUBA 3BG4B 1OOKB 1OWIA 1KYNA 1UTPA 3I77A 5DJ7A 1ZJKA 3L3TA 1HAVA 2R2MB 4YZUA 3OU0A 4BTTB 1RRKA 4XBCA 3D49H 3C27B 4FUFA 1PYTD 2FMJA 1BTXA 2UWPA 4I31A 2PTCE 4B75A 1IQFA 3DHKH 7LPRA 7KMEH 3A8DA 2BZ6H 2ZQ1A 5E8EH 1HJ8A 1D3TB 1T7CA 2SNVA 4DY7B 1Y3UA 2FLBH 1B0EA 1TX6A 4UONA 1GHXH 5F8ZA 4AX9H 5A8ZA 1GVKB 1LVOA 4OS4A 3Q3YA 2XWAA 3LJJA 3HGNA 5HXFA 2FOCA 1V2WT 4Z0KA 3GISB 3FZDA 1OXGA 2GCHG 1J9CH 3T62A 3GYLB 3T25A 1NM6A 1DICA 3MU0A 1WOFA 2KAIB 2CF8H 1YBWA 3EAJA 4ZAEA 2QIQA 1UK4A 3RC5A 3GY6A 1GG6B 1A0HB 1DITH 4FU9A 1O39A 1CT4E 5JBAS 1ZPBA 2XC4A 4Q7XA 4RKOB 5PTPA 3PMHB 4MTBA 2ZO3H 1O2QA 2H9HA 5SGAE 1UTNA 1QCPA 2ZPRA 3ZYEA 3RXOA 1ABIH 1GBDA 2ZDNA 3M36A 3Q00A 1H1BA 1C1RA 1TPPA 2ZHEH 1UK3A 4A1XA 1N8OB 2Y82A 1GI2A 1C1SA 2TBSA 2Y7XA 1BITA 4NIWA 4A1VA 1W7XH 3SJ9A 2PTNA 5HM9A 2G4UA 1P05A 1XUIA 3S9CA 1O2SA 1WQSA 4YOJA 3P8FA 1OX1A 4CBOA 3RU4D 1BA8B 3SW2B 1C4U2 1HAZB 3KGPA 3MMGA 1C1OA 1O31A 1UVPA 4CRGA 1HV7A 2GMTB 2D1JA 1Z71A 3ATWA 5G4BA 4ZXYH 1BHXB 1LQEA 1CA8B 2QCYA 2IOTA 3M5MA 4WY3A 2GT8A 5FPTA 5AVDA 1L1JA 1ANCA 3LU9B 4BAKB 1HYLA 1Z8IB 4CRDA 3VXFH 1VR1H 3U8OH 4NFEA 3SGAE 2HRVA 1ELTA 1TA6A 2P94A 1P0SH 2ZA5A 2ZU2A 1O36A 4XOJA 1KSNA 5K0HA 5TJXA 1GJ6A 2HGTH 1W14U 1LO6A 2PSXA 1ZMJA 1SL3A 4HFPB 3SU3A 4LZ4B 5FX6A 2ZU5A 3DT0H 3I29A 1P2JA 2HLCA 3P92A 1VJ9U 2F9UA 4Y7AA 1BBRE 1O3PB 3ZZBA 8ESTE 1D4PB 2OUAA 2TRMA 3S69A 1KDQB 2FYRA 1UCYE 2FOMB 5C67A 3TIUA 4E06H 1W13U 2VIQA 1GGDB 1P10A 3QUMP 3RLWH 1GL1A 1GBEA 2B0FA 3U1IB 1KTTB 2BDBA 1A5GH 2P3TB 1O5BB 5FPYA 1O2LA 1K9OE 1ESBA 1K22H 4XE4A 3VB6A 3M35A 1D6RA 2Q6FA 4RKJB 3O8BA 2OQ5A 2ZC9H 4RN6A 2BB4A 1MU8B 4Y8XA 3RC6A 1ZRBA 5DP8A 3D65E 1XXFA 2FP7B 5IYTA 1ZJDA 2PFEA 2UUJB 2ZCHP 1YGCH 1MH0A 3RP2A 3RXCA 3PTNA 1YCPH 1FY4A 2JH0D 1C1NA 3SUGA 1K1OA 2AERH 2BY7X 5T3HA 1QRXA 5GIBA 2NU3E 1GBBA 4ZROA 3OY5U 1G30B 1L1NA 4ISIH 1PPGE 2ZFTA 2Z7FE 1J16A 3K2UA 4NGAH 4GUXA 3UNSA 1AVXA 5LH8A 1ELAA 1O3HA 1RTLA 4X1NU 1Z1IA 1O30A 3BIVH 1XMNB 1T31A 2ZU1A 2BVSH 3U9AH 7GCHF 1QGFA 1C2FA 2O8LA 2XC5A 2W7SA 1TNHA 4A92A 4K5ZA 2DE8A 1QBNA 1TAWA 2FOFA 1BRCE 1NFWA 3RXGA 4CH2B 2FLRH 3FP7E 3TK5A 1C5WB 2BY9X 4NSYA 4ABBA 3QTOH 3TGIE 1OSSA 2RA3A 1O3LA 2AGIX 4WXVA 4I33A 1T32A 4AOQA 1BZXE 2ZCKP 5K7RA 2HVXA 3K65B 1ACBE 3SV9A 1L2EA 4NA8A 1A0JA 1ELEE 3ZYDA 3BG4C 4Q7ZA 1FQ3A 2QXJA 1DANH 4GLYA 1GHBF 1TNKA 5FX5A 1DDJA 2AFQB 4CBNA 1O2ZA 1XKBC 3UQOA 5JYIA 1KXBA 3WY8A 2RG3A 4ISOA 2A0QB 3M5NA 1DUEA 1AWFH 3ATLA 4O03A 1ZGIA 1EUFA 1EQ9A 2D26C 4MNVA 2F91A 2ZFRH 2SNWA 1HNEE 1QB1A 2ZFQH 2CMYA 3U69H 2HNTC 1O2OA 1D3DB 4D7GA 2F9PA 1GI6A 5DP3A 2QF3A 2XBVA 1C5SA 3SNBA 2FOAA 2FDAA 1K1LA 2OBOA 2C8ZB 2QXIA 3KEEA 2ZPQA 1EX3A 4JK6A 4KTCA 1H9IE 5F03A 1WQVH 4NFFA 1GBKA 1AVGH 2BY5X 4DIIH 5AHGH 1MQ6A 1C9PA 1GG6C 3H7TA 5DP4A 8GCHF 4K3JA 2PHBA 4HI3A 1RTKA 2SGEE 2ZNKH 2PKAB 3UWJH 3W94A 2NU0E 3A84A 2I6SA 1A3BH 5DP6A 3A80A 2D2DA 3VB4A 1BTZA 1QY6A 5H4IB 1ELCA 3QN7A 1N8OC 2YOLA 1YCPK 1SGYE 2F9VA 2GV7A 2IPHA 2ZHDA 4AGJA 2A4RA 1C1QA 1FXYA 2ZIQH 4JYTA 1E35B 5C1UA 1ZTKA 4BAOB 4OS5A 2ZFFH 1PPBH 1DPOA 1HAXB 1MCVA 2LPRA 1GMDG 1QJ1B 1FY3A 2BDAA 4ZKNU 1ETRH 3L6PA 2RDLA 3VFEA 4CREA 2GMTC 3RDZA 1S0QA 4X1QU 3STIA 2BX3A 2ZHQH 2EEKA 3SNCA 4CR9A 2FS8A 1E37B 1VJAU 1W0YH 3QTVH 4E05H 1LTOA 3GY7A 3PMJA 1C2MA 2PR3A 5E0JA 2P16A 3OTJE 3GY3A 6LPRA 2ESTE 1W10U 2F9OA 2R3UA 4SGAE 1TQ7B 1C2DA 4D9QA 2AS9A 1OWEA 1TIOA 3T28A 1JOUB 2FX4A 1V2KT 4D7FA 1TBZH 2BD7A 1K21H 1MUEB 1H8IH 3ZZDA 1TPOA 2UUFB 4NWLA 2HOBA 1H9HE 4LZ1H 6ESTA 3P8NA 2BVRH 3NXPA 1UK2A 3E1XB 1GGDC 1IAUA 5FBIA 3VGCB 4JMYA 5EQRA 2QV1A 3PV4A 1YLCA 2BM2A 3CP7A 3OYPA 4UD9H 1D6WA 1ANEA 5EOKA 2VINA 1O3NA 2P8OB 2ZWLH 2OQUA 3P70B 4MNXA 1OYQA 1UO6A 3A83A 3SJIA 4I8LA 3SV7A 1MZAA 2A7HA 1BTPA 2J9NA 4FVDA 1BJUA 3E8LA 1QQUA 2VGCB 8GCHG 1RXPA 1B0FA 4MQAA 3FP8E 1PQ8A 5DP7A 3M3TA 5EU8A 1SFIA 1JIRA 5BPEA 2JH5D 4O3UA 4K1EA 1Y5UT 1PPEE 1TBQH 3P8GA 1JXPA 1HAOH 3PROA 2OC8A 1ELFA 3A8BA 4B2BA 1HAGE 3BTWE 1O3CA 1YPJH 1F7ZA 2FI5E 3MU5A 3A81A 1VITF 5DKMA 1GMCF 2GDEH 1E0FD 4JZEH 1H8DH 2H5CA 4J2YB 2BLVA 4ZXXH 1EAWA 3MNSA 3TPIZ 4X6NA 1IHSH 1AUJA 2FZZA 1O2GH 1ZSJA 1EPTA 3MO3A 3A85A 3P95A 3SV6A 3RXRA 2AGGX 1WV7H 1P2MA 1DLEA 3UREA 1SFQB 1QJ7B 3KIDU 3LC5A 1AE5A 1SVPA 4JYUH 3NZIA 1S84A 2C8YB 4TWYA 3SU2A 1GI7B 1A4WH 1GBLA 4K1SA 1P3CA 4JCNA 1GJ5H 5GJ4B 5EXMA 3V12A 3A7TA 1OWHA 3LH1A 1BOQA 1ANBA 1ZMNA 3PYHA 1SPJA 2CJIA 1WTHD 2ZQ2A 5EPYA 3FP6E 4MPUA 2VH6A 1J17T 1RS0A 2AEIH 1GWAA 1P11E 1QL8A 1UHBB 1MTNB 4X8TH 1WAYB 4U01A 3LIWA 4X2XA 1A7SA 1F92A 1BTUA 1OP8A 1GJCB 1LHFH 4FUIA 4WMDA 4Y8ZA 1EOJA 1OWJA 2Y5FA 1ELVA 3M5LA 4THNH 2QXHA 1YPHC 4ISNA 2G55A 1C5XB 2P93A 1NS3A 4YOIA 1AKSA 3UTUH 2BVXH 3SU0A 2H9EH 3K9XB 1SGEE 3O8CA 2G00A 2FO9A 3KL6A 1AO5A 4BTIB 3S9AA 2AIPA 5A8YA 1CHOG 1ETSH 3F9EA 1PPZA 4Y7BA 1W2KH 3ZV8A 4ABEA 2VWNA 1TBRH 4JZFH 1LDTT 2NU4E 5DPAA 4MNWA 2BD3A 1V2ST 1NFUA 2VVUA 8KME2 1K28D 1U6QA 2Z3DA 1CU1A 3LGWA 3STJA 1BMMH 4ZKOU 1HAVB 2G4TA 3TITA 5LPEA 1V2UT 3T26A 2H1UA 1SMFE 3E90B 5E0HA 1TRMA 4AFQA 3TJNA 1O3DA 2BZAA 4WMEA 2THFB 2AMDA 3KQDA 2J34A 1BTYA 4KTUA 4XDEA 1Q3XA 2XC0A 3M7TA 4GSOA 2BTCE 4WF8A 3RXDA 4AG1A 1TGSZ 1P03A 1YPMH 2AIQA 1GI1A 2PW8H 4Y0ZE 3BTQE 1C5TA 1C2IA 3PTBA 1QFKH 4A6LA 4YT7H 1YC0A 3MI4A 2WPKS 1BHXF 1E34B 3TJOA 4Z6AH 1G2LA 5GXPA 1RD3B 2V3HH 3OX7U 1FV9A 2SGAA 1LHEH 2TIOA 4AFSA 2WPIS 1KXCA 2UUKB 3F9FA 3DD2H 4GCHF 2OCVB 4JK5A 1CGIE 4MLFB 1KXFA 1HJAC 2DE9A 5DG6A 3GCTF 3A7YA 1O2PA 4RSPA 1C1UH 4OS6A 1O2IA 1XUKA 1SGDE 3MOCA 3KNXA 3QGJA 3BTFE 4PROA 1AFQB 1SQOA 1EAUA 1JMOH 2J2UA 5ABWA 3VGCC 5GWZA 4AGKA 3A8CA 3U98H 3ZZ3A 4FUHA 5EQQA 4FU7A 3F9HA 2P8OC 1BQYA 1IQMA 1GDNA 1Z8JB 1O2MA 4O3TA 1PJPA 2Y7ZA 4TWWA 1PYTC 4IN2A 2ALPA 3RXHA 2V6NA 3RXFA 2BXUH 1AIXH 1C5QA 2TGPZ 2VGCC 2BDYA 4BNRA 2R0LA 5BRRE 3UR9A 3GOVB 2ODPA 2OP9A 4Y71A 2R3YA 4ZUHA 2B5TB 1Y3XA 1ZZZA 1SGNE 5EW2H 1JRTA 2BHGA 2OTVA 3A7WA 4AYYB 1ELDE 3RXTA 1TNLA 2SGDE 4DVAU 2QAAA 1GDUA 2BDIA 2BMGB 1ETTH 1J15A 3EDXB 2EI7A 3HATH 1XX9A 4NZQA 5DGJA 3RXLA 1ELGA 3MTYA 1BTWA 2TPIZ 2D8WA 1MD7A 1TOMH 3QZQA 3F1SB 1O2WA 1MBMA 1V2OT 1F0UA 4KGAA 1TYNA 3M3SA 1YPKH 2F9BH 3SJOA 1IOEA 3RMOH 3BEUA 3Q77A 1QA7A 1S83A 3ZZAA 1C5UA 1O2UA 3MH4A 4IMZA 1LQDB 1AGJA 3UUZA 1G2MA 4X1SU 2PKSB 1GJ4H 1TNGA 3ELAH 3GDUA 5HYOA 3SNEA 1MKWH 1A46H 3MNXA 3ZVBA 1TWXB 2ZTZA 1EJAA 1NN6A 1PFXC 3HKJB 3QLPH 1AUTC 4KKDA 2VIPA 2Z3CA 2ZG0H 3KQBA 1PQ7A 4TY6A 3H7OA 3HK6B 4GCHG 3O8RA 3GCTG 1TNIA 3PMAB 2A5KA 4INLA 4Q80A 5F8XA 8LPRA 1MTNC 1B5GH 1F0SA 1UJ1A 1ZHMA 1ZOMA 1KIGH 1GBFA 1C5VA 1P9UA 2AMPA 3SNAA 1ESAA 3P17H 1MAYA 2O8MA 4Y8YA 3K6YA 1ZPCA 1THRH 4X2YA 1FPCH 3LPRA 1SGFG 1MQ5A 1AHTH 2NU2E 4DW2U 4U32A 1V2NT 1CT0E 1FZZA 3ZVAA 3HPTB 2FS9A 4FXGH 4X8UH 2Z9LA 3LJOA 3SNDA 5CHAB 1NFYA 2Z9KA 3CENA 1Z8GA 1BBRH 2ASUB 2NWNA 2WPMS 1UCYH 3GY5A 4HGCA 1MD8A 1BB0B 5DK1A 1FAXA 3E16B 3MO9A 2VH0A 2WPJS 4IMQA 2ANMH 1VGCB 3RM0H 3SHAH 3SU6A 2OC1A 1BJVA 1LVBA 1INCA 1SGFA 3KF2A 3ESTA 1E36B 2GVFA 1O35A 2HPPH 1YPLH 5J4SA 2ZZUH 2A4OA 1ANDA 2WV5A 3UY9A 4NA7A 1O2YA 2P95A 1A1RA 3GY2A 1BRUP 1DXWA 1TABE 4DURA 1O5DH 1AU8A 2ZGCA 1WU1A 3GDVA 3UR6A 3S7HB 1XXDA 3BG8A 4D8NA 1O2KA 2ZP0H 6GCHF 2BOHB 1RIWB 1DWBH 1NESE 1BRBE 3PLKA 4BAHB 4ZH8A 4CH8B 1AB9B 1UMAH 3SORA 1QBOA 1Z8RA 1FNIA 1PQAA 5EPNA 4WH6A 1FAKH 2QYIA 1OP0A 1D3PB 1O3IA 1AMHA 2Z9JA 3F9GA 1BCUH 1YPHE 5EXNA 2C4FH 4UEHH 1JWTA 1XM1A 1O5FH 2Q6DA 3S0NA 2G52A 1GI4A 3BTKE 4OS1A 1O32A 2NU1E 1GMHF 1HBTH 4DG4A 3B9FH 2GX4A 4B2AA 3GDSA 1FJSA 3VEQB 1MBQA 1O2VA 1T8NA 1SGIB 1AY6H 4E7NA 2SGQE 1UTOA 1MKWK 1NRPH 2PUXB 1AFQC 2WUCA 1IHTH 2W3KA 2FOEA 1NT1A 2JETB 4O9VA 1SQAA 2FPZA 3UQVA 1KXEA 3RM2H 3S7KB 1C5OH 2V0BA 1J14A 5A8XA 3BTTE 4MPWA 1QR3E 3SU4A 2DUCA 5I46H 1T4VH 1CBWB 3TJUA 3BTME 3RXMA 3R3GB 2GP9B 1EZSC 1HXEH 4VGCB 4CR5A 4KTSA 1DLKB 1LKAA 2VJ1A 4K69A 1ZSLA 4YTAA 3F6UH 1SGTA 4WJG2 5JDUB 5AFYH 2CF9H 1O5EH 1UTQA 1C4V2 1TMTH 5L6NH 3LGYA 4E7RG 3SV8A 4TPIZ 1ARCA 4IC5A 3TH4H 3UNQA 2J94A 1OKXA 1O2TA 3FVFB 1GI0A 3MH5A 4I8JA 3SBKA 2Y5GA 4WXIA 1W3CA 2SGPE 1NROH 1SB1H 1FIWA 1ELBA 5C5NA 4ESTE 1BBRK 2EA3A 3OSYA 2F9NA 2G51A 1UCYK 7GCHG 4X6MA 3ZZ7A 2OXSA 2XW9A 2ZGXH 3M3VA 1UVSH 5T6GA 3NK8A 2P59A 3QDZB 1EAIA 3CS0A 5ESBA 1Z7KA 5GDSH 1KLJH 1QL7A 6GCHG 2TGAA 1SLXB 4ISLA 1WCZA 2B8OH 3G01A 2Q6GA 1CE5A 1FY8E 3RUOA 2C90B 1TE0A 4U2WA 1GBAA 1HLTH 2PV9B 1P09A 2V3OH 1KXDA 4H6SB 2WINI 2VWOA 2PKSC 3S9BA 1Z6EA 5EQSA 1GHBG 1SI5H 1IQKA 1TQ0B 4XBBA 3GCNA 2Z94A 4K2YA 1A5IA 1EB1H 2BY8X 3AW1A 3BTDE 3SGQE 4AG2A 1A3EH 1TNJA 4WMFA 4BXWA 2R9PA 3MFJA 2BD2A 2ZFPH 1C5ZB 1P04A 2SGFE 4NIYA 3A82A 1OPHB 4BXSA 1C1TA 1C2JA 3QK1A 1QIXB 3TNSA 3NKKA 1S0RA 1G32B 2ZEBA 1ZLRA 1F5RA 2AH4X 4MPXA 3RC4A 4A7IB 5JBBS 1GHAF 1ARBA 1CGJE 1O3EA 2FOHA 1THPB 1C5RA 2G5VA 4IS5A 1TPAE 2HWLB 2Z6BD 3L33A 1FLEE 1O3AA 2ZI2H 3UOUA 1HCGA 2EI6A 3SZNA 3E91A 3TH2H 1GPZA 1FI8A 1SLUB 4F49A 2BOKA 1MU6B 3RXSA 3M61U 1O37A 1EPTB 1C2EA 1DVAH 1BMNH 2GTBA 3RXKA 1TGNA 3VPKA 1QRWA 4MNYA 4A1TA 2ZECA 1GDQA 4OGYA 2STBE 1LHCH 1BIOA 2ZU4A 4TYDA 1CHGA 3LT3A 2ZGHA 1HPGA 2BD8A 3AW0A 3N7OA 1QTFA 5F8TA 2WPLS 2XTTB 1WTGH 4IGDA 1HIAA 1BRAA 3RU4E 4DJZB 1SQTA 4HTCH 2XCNA 1OYTH 4DIHH 1YKTA 1Y3WA 2FI3E 1V2TT 2UWLA 5T6DA 3F68H 1L0ZA 1DUAA 1Y8TA 1C1WH 1RIWC 1AZZA 2W5EA 1KY9A 2ANWA 3PLBA 5C5OA 3BEIB 1D3QB 4Y76A 1EZUC 2VU8E 2A31A 5LGOA 3QO6A 1FY5A 3KQCA 1JBUH 3SU5A 2BYAX 3SGBE 4CRCA 3PWBA 2W26A 1KXAA 1T8MA 4ABJA 1UTMA 5JBTA 4X0WU 4M7GA 1DWCH 3BTHE 3MO6A 1GBTA 2Y5HA 1O0DH 1EOLA 4YESB 5LPRA 1C2HA 1Y5BT 4X8VH 1K2I1 2TGTA 1S6HA 3D23A 4LK4A 1QB6A 2BQ6B 4ABGA 2VVCA 3PLPA 4XBDA 5F6MA 2XWBI 2F83A 1M9UA 1AKSB 2O8TA 1GCTB 1N6XA 1C9TA 5E2OA 4H42U 1DE7H 2BLOA 1TOCB 4YO9A 1IQIA 1GHZA 1MTWA 1O34A 3JZ1B 4MPVA 3T29A 1F0TA 1ZTLA 1KLTA 2R2WU 5E0GA 1P02A 1ZSKA 4IBLH 2ZDVH 1C4Y2 2IJOB 1NC6A 1DXPA 2V35A 1MMJN 4H4FA 3ZVGA 2JETC 2HNTF 4H6TA 2OLGA 1LMWB 1OP2A 5E2PA 1FN6A 3MH7A 1DFPA 2FTLE 2IN2A 1TX8A 1HJ9A 5FCRA 2FWWA 1UTJA 1Z6JH 1EB2A 1GHAG 2CN0H 1CBWC 1N1LA 3SU1A 4ABDA 2BDCA 4UFDH 4VGCC 4ZHMU 1AZ8A 1FDPA 1FN8A 9ESTA 1V2PT 2Z3EA 5A0CA 2OC0A 2ZTXA 4OS2A 4Y79A 3IITA 3ZZCA 3LGIA 3T27A 3EYDA 2LNCA 3IG6B 1RJXB 3RMMH 5TCCA 1ZMLA 1T8LA 2FODA 1VITH 5ESTE 1AN1E 1AWHB 3RXUA 5A2MH 2GT7A 2Z9IA 1O3OA 3GY8A 1ORFA 3GYMA 3RLYH 5AFZH 5JB8S 2XCFA 1O3KA 3RXJA 3BIUH 3LC3A 1V2JT 4KELA 1OWDA 2J38A 2ZDKA 4CRBA 1DT2A 1VITG 3HK3B 1O3FA 4ZHAA 1O2RA 1F2SE 3P6ZB 2HNTE 1GMCG 2A32A 4X1PU 5DP5A 3BTGE 3AAUA 3TH3H 3KQEA 1KLIH 3EE0B 4O97A 1CT2E 4B74A 3MWIU 4BOHA 2I6QA 4AB8A 1C1PA 4X1RU 3TVJB 1HFDA 2XBYA 3UNRA 1Y3YA 3Q3XA 2VWMA 2ZPSA 3SN8A 5FPSA 1O2JA 3NCLA 5A09A 4B73A 1MKXH 1S82A 1VZQH 2B7DH 4X8SH 3M7UA 1QL9A 1XKAC 2A4GA 2C8XB 4FUBA 1QQ4A 4UFFH 1BDAA 2K1QA 4XSKU 2CXVA 2BX4A 2GDDA 2G8TA 3LDXH 1SGQE 3MNCA 2BXTH 4NWKA 1BT7A 2ODYB 4FUDA 1DWDH 2A4QA 1NU7B 3MH6A 4YLUA 5EW1H 2BQWB 4BTUB 1FPHH 1A61H 1C2GA 3SUDA 5GPIB 3PO1B 2FYQA 1P57B 4WVPE 4WWYA 3HGPA 1HGTH 4I32A 1P2KA 3EA9A 1D9IA 3SHCH 1AI8H 3EA8A 3SUEA 4DOQA 3FZZA 1E38B 3RMLH 4AB9A 2JH6D 1PQ5A 2A7JA 1T8OA 3UIRA 3NWUA 5J4QA 3R0FA 1P2QA 1GJ7B 3MNBA 1CGHA 4FUCA 3UPEA 2TGDA 3RXPA 3T5FH 2ZHWH 4JZDH 1EPTC 1J8AA 1EAXA 1NY22 1DY9A 3LKWA 4WH8A 5HM2A 4NCYA 4AN7A 4ZKRU 1GI8B 3QWCH 4I8HA 4INHA 1GHYH 4TY7A 3U1JB 1EXFA 3AVZA 4UE7H 1IQEA 3SI4H 3ITIA
chains in the Genus database with same CATH superfamily
1DX5M 2BD9A 3WWFA 1CO7E 2O9QA 3EGKH 1CVWH 1QBVH 2KZ4A 2QGRA 3SUFA 2H5DA 2C93B 1ID5H 4XFQA 4J1YA 2FOBA 1P8VC 4ISHH 1HAYB 2G5NA 2QN5T 2STAE 5CE1A 4K8YA 4K8BA 4K1TA 3RXQA 3ZZ8A 1KTSB 4MVNA 2KAIA 1QJ6B 1QB9A 4MG3A 1YPGH 1JIMA 5L30H 1O5GH 1P9SA 1GVLA 1V2VT 2KCAA 1YPEH 1MTUA 1TGCA 4LOYH 1GJAB 1LVMA 1PPHE 3NPSA 6CHAB 1Y3VA 1THSH 2XOKD 1NTPA 1SLWB 4CRFA 2ZCLP 3V13A 2Q1JA 1GBHA 2GCTB 2KM0A 1K1NA 4R0IA 1NPMA 1O2NA 1W7GH 2R0KA 1GL0E 1O33A 4D9RA 1GHWH 1HAIH 1GCTC 3NRLA 3RXIA 1UVTH 3UWIA 1GBJA 2XBWA 1C5MD 1EKBB 1P2OA 1MKXK 1UTLM 1B7XB 1FUJA 1OHHD 4DT7B 1RTFB 1ZTJA 3RXAA 5HIYA 2ZGJA 5JB9S 4HG6A 3DCLA 3A88A 3E0PB 1P01A 1LVYA 5C1XA 2QXGA 2PGQB 1SOTA 2JKHA 4NSVA 3KYGA 5EODA 1QHRB 1XUFA 1KMHB 2XYAA 4LXBH 4GPGA 1YLDA 1NRNH 1MCTA 2O8WA 2QY0B 3A86A 3ODDA 4GHQA 3C1KA 4INKA 1C2KA 5FXLA 2P3UB 2A1DB 2RA0A 1G37A 1TA2A 1ZGVA 1TONA 2W6ID 5C2ZA 3A8AA 1O5CB 4I8KA 3I78A 5FAHA 1F0RA 1P2IA 4BAQB 1GHVH 1AE8H 3A7VA 1L4ZA 2A2QH 1C5YB 1GI5A 4F4OC 1TRYA 1KDQA 3A87A 1A2CH 3MYWA 3TNTA 1G9IE 1ZRKA 2ZDAH 2XRCA 3EE7A 1A0LA 1BMLA 1V2QT 3V0XA 1OS8A 1GJ9B 2WYJA 2J4IA 1WUNH 1YF4A 3TGKE 3DFLA 4SGBE 2LELA 3WW7A 1GBCA 3ATMA 1O3MA 3FN8A 2ZDMA 1LHGH 1XUJA 2PUQH 3V3MA 4JZIA 3EA7A 4KP0A 5A0AE 2LP6A 2BY6X 2ULLA 1HXFH 1ZR0A 1GMDF 1QRZA 2Y6TA 2ZFSA 3FKSD 2M5TA 2GV6A 1E1RD 2H6MA 1YP9A 1C5LH 1NBME 1O2XA 1GBMA 2PGBB 2VB0A 2XNIA 3QGNB 2K8IA 1SGPE 1C2LA 2GGVB 2ALVA 1G36A 2O8UA 1HRTH 1TGBA 9LPRA 1EZXC 1K1IA 1O3BA 5EJ1A 4IN1A 3OEHD 1P12E 3DFJA 1EZQA 1NRQH 3MU8A 3IWMA 1OWKA 1P2NA 2HALA 1A5HA 1GI3A 2AGEX 4TPYA 1S85A 4ZMAH 4AYVB 3BSQA 3B23B 4UDWH 2J95A 1MTSA 3PO1C 4ABAA 5B6OA 4Y11E 4DGJA 1W12U 2EI8A 1EATA 1JRSA 3H5CB 3ATIA 3AAVA 2KR7A 3K6ZA 4OGXA 4I7YH 4FVBA 4Q7YA 3SYJA 4AZ2B 3PMBB 4CHAB 3BV9B 3URCA 1RFNA 3FAOA 3Q3KA 5T6FA 1SSXA 2BD5A 5C3NA 1AVWA 2BLQA 1P06A 4R8TB 1MZDA 2CHAB 2GZ9A 3GCHB 1DM4B 1NO9H 3MU1A 3ZVFA 5HGGA 1NRRH 3VB5A 5I25A 4NA9H 2WZQA 2QF0A 1MAXA 1NFXA 2SFAA 2UWOA 4YM9A 3GICB 3VB7A 4UFGH 1SGCA 4ZKSU 3PB1E 1EJNA 5AF9H 4X2VA 1L4DA 1O2HA 1K1PA 1TFXA 4NIVA 4A5TS 2W3IA 2ZF0H 2OBQA 3EQ0H 3A89A 1LPGB 3VXEH 1VCPA 5C20A 3U8RH 1Q31A 1TB6H 3BEFB 2C8WB 1DSTA 1Y59T 3MHWU 1DSUA 1UVUH 1V2LT 4GHTA 1TALA 1PPCE 2YNAA 4AORA 3E3TA 1NRSH 3O8DA 1F5LA 3AASA 5GCHF 1HAPH 1HB0B 2VIVA 2A45B 1AD8H 3A7ZA 5C1YA 3LGVA 1LPKB 1V3XA 3TK9A 2OC7A 5JBCS 2BQ7B 3SV2H 6CHAC 2PKAA 1V6DA 1YCPM 3M5OA 4Q2KA 1FMGA 1C1VH 1DOJA 2FX6A 2G81E 1LCYA 2WSSD 3W95A 2GCTC 5DP9A 1WBGB 3M37A 3ZZ6A 1CSOE 4B1TA 1CA0B 3SQHE 1GMHG 3E6PH 2QC2A 1G3CA 1H4WA 5C17A 4Y10E 2Z9GA 1SBWA 3RXBA 1K1JA 1TPSA 1UTKA 3NUMA 4FUGA 2GD4B 1LHDH 3TLOA 1C1MA 2ZKSA 3PWCA 5A0BA 4I8GA 3DUXH 1VCWA 1XVOA 1GVZA 2ZGBH 4B2CA 1HDTH 2Y80A 1DWEH 3MU4A 1GCDA 1X7AC 1Y5AT 2ZTYA 4IW4E 1SHHB 1HJAB 2XBXA 5ETXA 1C5PA 2PWXA 5JPMH 2ODQA 3M7QA 2BLWA 5HMAA 1XUGA 2FXRA 1HIAB 1Q2WA 2A5IA 1GI9B 3LH3A 1IQHA 3ATKA 2VNTA 1XVMA 3LGTA 1IQGA 5FCKA 1EP5A 2A5AA 3ENSB 3KCGH 1QURH 1TGTA 2BDGA 2WV4A 1P3EA 1YYY1 5CHAC 1N6YA 4HZHA 3RXVA 1E1QD 4YT6H 3B8JA 5FHTA 1SHYA 4NG9H 4ABHA 2W7UA 1HAHH 2ANKH 1O5AB 1E79D 5L2YH 1VGCC 1GJDB 2FEQH 3HKIB 3SQEE 1V2RT 1SG8B 2ILNA 1ABJH 1G3DA 2BD4A 1CHOF 2F3CE 2GZ7A 5TCAA 4YOGA 3QZRA 3KHVA 1TLDA 2A2XH 3URDA 5EGMA 3ZZ4A 4BAMB 4ASHA 4IC6A 4FUEA 1SC8U 3TK6A 5LPFA 1ZHPA 5IK2D 1O3GA 2WYGA 3BF6H 4BANB 1BMAA 1IQNA 2CV3A 1SOZA 1FIZA 1AB9C 2XNDD 3RU4T 1PPFE 3RXEA 1YM0A 2H9TH 3TU7H 4GVUA 3UFAA 4YLQH 5GCHG 2C3SA 3FANA 3ZVEA 3BTEE 4JYVH 1L1GA 2OD3B 2VIWA 3JZ2B 2HPQH 3ZVDA 4B71A 4AFUA 3TJVA 1QA0A 3TGJE 1K1MA 1ESTA 5L2ZH 3RMNH 3V7TA 1IQJA 2ZHFH 4X2WA 1VCQA 3Q76A 3BN9A 4JZ1A 2P3FH 1S5SA 2PLXA 4ABFA 4ABIA 1GJBB 3QX5H 1BUIA 4DCDA 1F5KU 2AMQA 2OINA 1TX7A 3SJ8A 4ZHLU 1HUTH 2GKVE 3FOAA 1W0ZU 1SGRE 1CQQA 3P8OA 2AYWA 1NZQH 1GJ8B 1WYKA 2VVVA 2JJ2D 2Y81A 4CHAC 1NU9A 2VIDA 4OS7A 1SR5C 3LOXA 4ACAA 1V2MT 2KCOA 3UOPA 4Y6DA 2GCHF 2ZDLA 2A7CA 3FFGA 3CS7A 1H9LB 2FOGA 3SI3H 1SLVB 1EJMA 2XXLA 3SO3A 1Z1JA 2BDHA 2CHAC 1EP6A 2B9LA 3PRBA 1WSSH 3N99A 1FY1A 3GCHC 1W11U 3T2NA 3SJKA 4U30A 1QNJA 4X6PA 1XUHA 5EXLA 2CGAA 5FBEA 5IDKA 1G3EA 3DA9B 2WPHS 3E0NB 1ZYOA 1BTHH 1SQRA 2J98B 2YNBA 2PSYA 2J92A 1AQ7A 1LPZB 3LONA 1DY8A 4FUJA 3PM3A 4QT8C 2FESH 4AFZA 1UHBA 3ZV9A 4GAWA 3ZVCA 2EC9H 2FTMA 2VIOA 1C5NH 4UFEH 4Y0YE 1TRNA 3ZZ5A 1TMUH 4MDSA 1T4UH 1O38A 3KN2A 3A7XA 4I86A 1TMBH 2UUYA 4FU8A 1W8BH 2FIRH 5EG4A 1AFEH 1RGQA 3GY4A 3U8TH 3GCOA 1UVOA 1YWUA 5CMXH 1O3JA 2ZU3A 3D62A 2FM2A 2H2ZA 2J97A 4X6OA 1ZHRA 4F55A 3LGUA 1ZPZA 3ZZ9A 2FI4E 3OY6U 2ANYA 4Q4LA 3VB3A 5DO4H 3SOSA 1FONA 4D76A 1DS2E 4CRAA 7ESTE 4F48B 1S81A 1EASA 4NIXA 3ODFA 1S6FA 4K60A 2VWLA 2RCEA 4NZLA 1IQLA 1G3BA 4B76A 1LKBA 3F2HA 1CA0C 1GBIA 1MTVA 2GZ8A 2QA9E 2WUBA 3BG4B 1OOKB 1OWIA 1KYNA 1UTPA 3I77A 5DJ7A 1ZJKA 2PP6A 3L3TA 1HAVA 2R2MB 4YZUA 3OU0A 4BTTB 1RRKA 4XBCA 3D49H 3C27B 4FUFA 1PYTD 2FMJA 1BTXA 2UWPA 4I31A 2PTCE 4B75A 1IQFA 3DHKH 7LPRA 7KMEH 3A8DA 2BZ6H 2ZQ1A 5E8EH 1HJ8A 1K0HA 1D3TB 1T7CA 1WDIA 2SNVA 4DY7B 1Y3UA 2FLBH 1B0EA 1TX6A 4UONA 1GHXH 5F8ZA 4AX9H 5A8ZA 1GVKB 1LVOA 4OS4A 3Q3YA 2XWAA 3LJJA 3HGNA 5HXFA 2FOCA 2QF4A 4XD7D 1V2WT 4Z0KA 2EQNA 1YLNA 3GISB 3FZDA 1OXGA 2GCHG 1J9CH 3T62A 3GYLB 3T25A 1NM6A 1DICA 3MU0A 1WOFA 2KAIB 2CF8H 1YBWA 3EAJA 4ZAEA 2QIQA 1UK4A 3RC5A 3GY6A 1GG6B 2V3MA 1A0HB 1DITH 4FU9A 1O39A 1CT4E 5JBAS 1ZPBA 2XC4A 4Q7XA 4RKOB 5PTPA 3PMHB 4MTBA 2ZO3H 1O2QA 2H9HA 5SGAE 1UTNA 1QCPA 2ZPRA 3ZYEA 3RXOA 1ABIH 1GBDA 2ZDNA 3M36A 3Q00A 1H1BA 1C1RA 1TPPA 2ZHEH 1UK3A 4A1XA 1N8OB 2Y82A 1GI2A 1C1SA 2TBSA 2Y7XA 1BITA 4NIWA 3ZIAD 4A1VA 1W7XH 3SJ9A 2PTNA 5HM9A 2G4UA 1P05A 1XUIA 3S9CA 1O2SA 5T1VA 1WQSA 4YOJA 3P8FA 1OX1A 4CBOA 3RU4D 1BA8B 3SW2B 1C4U2 1HAZB 3KGPA 3MMGA 1C1OA 1O31A 1UVPA 5CDFE 4CRGA 1HV7A 2GMTB 2D1JA 1Z71A 3ATWA 5G4BA 4ZXYH 1BHXB 1LQEA 1CA8B 2QCYA 2IOTA 3M5MA 4WY3A 2GT8A 5FPTA 5AVDA 3AK5A 1L1JA 2OK5A 1ANCA 3LU9B 4BAKB 1HYLA 1Z8IB 4CRDA 3VXFH 1VR1H 3U8OH 4NFEA 3SGAE 2HRVA 1ELTA 1TA6A 2P94A 1P0SH 2ZA5A 2ZU2A 1O36A 4XOJA 1KSNA 5K0HA 5TJXA 1GJ6A 2HGTH 1W14U 1LO6A 2PSXA 1ZMJA 1SL3A 4HFPB 3SU3A 4LZ4B 5FX6A 2ZU5A 3DT0H 2IJD1 3I29A 1P2JA 2HLCA 3P92A 1VJ9U 2F9UA 4Y7AA 1BBRE 1O3PB 3ZZBA 8ESTE 1D4PB 2OUAA 2TRMA 3S69A 1KDQB 5DN6D 2FYRA 1UCYE 2FOMB 3UB0A 5C67A 3TIUA 4E06H 1W13U 2VIQA 1GGDB 1P10A 3QUMP 3RLWH 1GL1A 1GBEA 2B0FA 3U1IB 1KTTB 2BDBA 1A5GH 2P3TB 1O5BB 5FPYA 1O2LA 1K9OE 1ESBA 1K22H 4XE4A 3VB6A 3M35A 1D6RA 2Q6FA 4RKJB 3O8BA 2OQ5A 2ZC9H 4RN6A 2BB4A 1MU8B 4Y8XA 3DSOA 3RC6A 1ZRBA 5DP8A 3D65E 1XXFA 2FP7B 5IYTA 1ZJDA 2PFEA 2UUJB 2ZCHP 1YGCH 1MH0A 3RP2A 3RXCA 3PTNA 1YCPH 1FY4A 2JH0D 1C1NA 3SUGA 1K1OA 2AERH 2BY7X 5T3HA 1QRXA 5GIBA 2NU3E 2WHXA 1GBBA 4ZROA 3OY5U 3GS9A 1G30B 1L1NA 4ISIH 1PPGE 2ZFTA 3W1EA 2Z7FE 1J16A 3K2UA 4NGAH 4GUXA 3UNSA 1AVXA 5LH8A 1ELAA 5KECA 1O3HA 1RTLA 4X1NU 1Z1IA 1O30A 3BIVH 1XMNB 1T31A 2ZU1A 4ZCNA 2BVSH 3U9AH 7GCHF 1QGFA 1C2FA 2O8LA 2XC5A 2W7SA 2F4LA 1TNHA 4A92A 4K5ZA 2RFKC 2DE8A 1QBNA 1TAWA 2FOFA 1BRCE 1NFWA 3RXGA 4CH2B 2FLRH 2WPDD 3FP7E 3TK5A 1C5WB 2BY9X 4NSYA 4ABBA 3QTOH 3TGIE 1OSSA 2RA3A 1O3LA 2AGIX 4WXVA 4I33A 1T32A 4AOQA 1BZXE 2ZCKP 5K7RA 2HVXA 3K65B 4P02A 1ACBE 3SV9A 1L2EA 4NA8A 1A0JA 1ELEE 3ZYDA 3BG4C 4Q7ZA 1FQ3A 2QXJA 1DANH 4GLYA 1GHBF 1TNKA 5FX5A 1DDJA 2AFQB 4CBNA 1O2ZA 1XKBC 3UQOA 5JYIA 1H8HD 1KXBA 3WY8A 2RG3A 4ISOA 2A0QB 3M5NA 1DUEA 1AWFH 3ATLA 3OEED 4O03A 1ZGIA 1EUFA 1EQ9A 2D26C 4MNVA 2F91A 2ZFRH 2SNWA 1HNEE 1QB1A 2ZFQH 2CMYA 3U69H 2HNTC 1O2OA 1D3DB 4D7GA 2F9PA 1GI6A 5DP3A 2QF3A 2XBVA 5C0UA 1C5SA 3SNBA 5B6LA 2FOAA 2FDAA 1K1LA 2OBOA 2C8ZB 2QXIA 3FO8D 3KEEA 2ZPQA 1EX3A 3F2GA 4JK6A 4KTCA 1H9IE 5F03A 1WQVH 4NFFA 1GBKA 1AVGH 2BY5X 4DIIH 5AHGH 1MQ6A 1C9PA 1GG6C 3H7TA 5DP4A 8GCHF 3H09A 4K3JA 2GJGA 2PHBA 4HI3A 1RTKA 2SGEE 2ZNKH 2KCPA 2PKAB 3UWJH 3W94A 2NU0E 3A84A 2I6SA 1A3BH 5DP6A 3A80A 2D2DA 3VB4A 1BTZA 1QY6A 5H4IB 1ELCA 3QN7A 1N8OC 2YOLA 1YCPK 4Z1MD 1SGYE 2F9VA 2GV7A 2IPHA 2ZHDA 4AGJA 2A4RA 1C1QA 1FXYA 2ZIQH 4JYTA 1E35B 5C1UA 1ZTKA 4BAOB 4OS5A 2M2AA 2ZFFH 1PPBH 1DPOA 1HAXB 1MCVA 2LPRA 1GMDG 1QJ1B 1FY3A 2BDAA 4ZKNU 1ETRH 3L6PA 2RDLA 3VFEA 4CREA 2GMTC 3RDZA 1S0QA 4X1QU 3STIA 2BX3A 2ZHQH 2EEKA 3SNCA 4CR9A 2FS8A 1E37B 1VJAU 1W0YH 3QTVH 4E05H 1LTOA 3GY7A 3PMJA 1C2MA 4FETA 2PR3A 5E0JA 2P16A 3OTJE 1SKYE 3GY3A 6LPRA 2ESTE 1W10U 2F9OA 2R3UA 4SGAE 1TQ7B 1C2DA 4D9QA 2AS9A 1OWEA 1TIOA 3T28A 1JOUB 2FX4A 1V2KT 4D7FA 1TBZH 2BD7A 1K21H 3OFND 1MUEB 1H8IH 3ZZDA 1TPOA 2UUFB 4NWLA 2HOBA 1H9HE 4LZ1H 6ESTA 3P8NA 2BVRH 3NXPA 1UK2A 3E1XB 1GGDC 1IAUA 5FBIA 3VGCB 4JMYA 5EQRA 2QV1A 3PV4A 1YLCA 2BM2A 3CP7A 3OYPA 4UD9H 1D6WA 1ANEA 3N7EA 5EOKA 2VINA 1O3NA 2P8OB 2ZWLH 2OQUA 3P70B 4MNXA 1OYQA 1UO6A 3A83A 3SJIA 4I8LA 3SV7A 1MZAA 2A7HA 1BTPA 2J9NA 4FVDA 1BJUA 3E8LA 1QQUA 2VGCB 8GCHG 1RXPA 1B0FA 4MQAA 3FP8E 1PQ8A 5DP7A 4FOUC 3M3TA 5EU8A 1SFIA 1JIRA 5BPEA 2JH5D 4O3UA 4K1EA 1Y5UT 1PPEE 1TBQH 3P8GA 1JXPA 1HAOH 3PROA 2OC8A 1ELFA 2YMSD 3A8BA 4B2BA 1HAGE 3BTWE 1O3CA 3U28C 1YPJH 1F7ZA 2FI5E 3MU5A 3A81A 1VITF 5DKMA 1GMCF 2GDEH 1E0FD 4JZEH 1H8DH 2H5CA 4J2YB 2BLVA 4ZXXH 3PV5A 1EAWA 3MNSA 3TPIZ 4X6NA 1IHSH 1AUJA 2FZZA 1O2GH 1ZSJA 1EPTA 3MO3A 3A85A 3P95A 3SV6A 3RXRA 2AGGX 1WV7H 1P2MA 1DLEA 3UREA 1SFQB 1QJ7B 3KIDU 3LC5A 2J5UA 1AE5A 1SVPA 4JYUH 4XRNA 3NZIA 1S84A 2C8YB 4TWYA 3SU2A 1GI7B 1NBMD 1A4WH 1GBLA 5EIYA 4K1SA 1QZ8A 1P3CA 4JCNA 1GJ5H 5GJ4B 5EXMA 3V12A 3A7TA 1OWHA 3LH1A 1BOQA 1ANBA 1ZMNA 3PYHA 1SPJA 2CJIA 1WTHD 1YY3A 2ZQ2A 5EPYA 3FP6E 4MPUA 2VH6A 1J17T 1RS0A 2AEIH 1GWAA 1P11E 1QL8A 1UHBB 1MTNB 4X8TH 1WAYB 4U01A 3LIWA 4X2XA 1A7SA 1F92A 1BTUA 1OP8A 1GJCB 1LHFH 4FUIA 4WMDA 4Y8ZA 1EOJA 1OWJA 2V7QD 2Y5FA 1ELVA 3M5LA 4THNH 2QXHA 1YPHC 4ISNA 2G55A 1C5XB 2P93A 1NS3A 4YOIA 4Q63A 1AKSA 3UTUH 2BVXH 2EY4C 3SU0A 2H9EH 3K9XB 1SGEE 3O8CA 2G00A 2FO9A 3KL6A 1AO5A 4BTIB 3S9AA 2AIPA 5A8YA 1CHOG 1ETSH 3F9EA 1PPZA 4Y7BA 1W2KH 3ZV8A 4ABEA 2VWNA 1TBRH 2L6OA 4JZFH 1LDTT 2NU4E 5DPAA 4MNWA 2BD3A 1V2ST 1NFUA 2VVUA 8KME2 5KEDA 1K28D 1U6QA 2KCYA 1CU1A 2Z3DA 3LGWA 3STJA 1BMMH 4ZKOU 1HAVB 2G4TA 3TITA 5LPEA 1V2UT 3T26A 2H1UA 1SMFE 3E90B 5E0HA 1TRMA 2QF5A 4AFQA 3TJNA 1O3DA 2BZAA 4WMEA 2THFB 2AMDA 3KQDA 2J34A 1BTYA 4KTUA 4XDEA 1Q3XA 2XC0A 3M7TA 4GSOA 2BTCE 4WF8A 3RXDA 4AG1A 1TGSZ 1P03A 1YPMH 3KQ5A 2AIQA 1GI1A 2PW8H 4Y0ZE 3BTQE 1C5TA 1C2IA 3PTBA 1QFKH 4A6LA 4YT7H 2AHME 1YC0A 3MI4A 2WPKS 1BHXF 1E34B 3TJOA 4Z6AH 1G2LA 5GXPA 1RD3B 2V3HH 1VKYA 3OX7U 5HKKD 1FV9A 2SGAA 1LHEH 2TIOA 4AFSA 2WPIS 1KXCA 2UUKB 3F9FA 3OTPA 3DD2H 4GCHF 2OCVB 4JK5A 1CGIE 4MLFB 1KXFA 1HJAC 2DE9A 5DG6A 3GCTF 3A7YA 1O2PA 4RSPA 1C1UH 4OS6A 1O2IA 1XUKA 1SGDE 3MOCA 1S6LA 3KNXA 3QGJA 3BTFE 4PROA 1AFQB 1SQOA 1EAUA 1JMOH 2J2UA 5ABWA 2JJ1D 3VGCC 5GWZA 4AGKA 3A8CA 3U98H 3ZZ3A 4FUHA 5EQQA 4FU7A 3F9HA 2P8OC 5FL7D 1BQYA 1IQMA 1GDNA 1Z8JB 1O2MA 4O3TA 1PJPA 2Y7ZA 4TWWA 5C94A 1PYTC 4IN2A 2ALPA 4DT4A 3RXHA 2V6NA 3RXFA 3F0PA 2BXUH 2KX4A 1AIXH 1C5QA 2TGPZ 2VGCC 2BDYA 4BNRA 2R0LA 2HLDD 5BRRE 3UR9A 3GOVB 2ODPA 2OP9A 4RT0A 4Y71A 2R3YA 4ZUHA 2B5TB 1Y3XA 1ZZZA 1SGNE 5EW2H 1JRTA 2BHGA 2OTVA 3A7WA 4AYYB 1ELDE 5EJLA 4OM9A 3RXTA 1TNLA 2SGDE 4DVAU 2QAAA 1GDUA 2BDIA 2BMGB 1ETTH 1J15A 3EDXB 2EI7A 3HATH 1XX9A 4NZQA 5DGJA 3RXLA 1ELGA 3MTYA 1BTWA 2TPIZ 2D8WA 1MD7A 1TOMH 3QZQA 3F1SB 1O2WA 1MBMA 1V2OT 1F0UA 4KGAA 1TYNA 3M3SA 1YPKH 2F9BH 3SJOA 1IOEA 4M9FA 3BEUA 3RMOH 3Q77A 1QA7A 1S83A 3ZZAA 1C5UA 1O2UA 3MH4A 4IMZA 1LQDB 1AGJA 3UUZA 1G2MA 4X1SU 2PKSB 4RI0A 1GJ4H 1TNGA 3ELAH 3GDUA 5HYOA 3SNEA 1MKWH 1A46H 3MNXA 3ZVBA 1TWXB 2ZTZA 1EJAA 1NN6A 1PFXC 3HKJB 2W6JD 3QLPH 1AUTC 4KKDA 5GNDA 2VIPA 2Z3CA 2ZG0H 3KQBA 1PQ7A 4TY6A 3H7OA 3HK6B 4GCHG 3O8RA 3GCTG 1TNIA 3PMAB 2A5KA 4INLA 4Q80A 5F8XA 8LPRA 1MTNC 1B5GH 1F0SA 1UJ1A 1ZHMA 1ZOMA 1KIGH 1GBFA 1C5VA 1P9UA 2AMPA 3SNAA 1ESAA 3P17H 1MAYA 2O8MA 4Y8YA 3K6YA 1ZPCA 1THRH 4X2YA 1FPCH 3LPRA 1SGFG 1MQ5A 1AHTH 3PRDA 2NU2E 4DW2U 4U32A 1V2NT 1CT0E 1FZZA 3ZVAA 3HPTB 3F2FA 2FS9A 4FXGH 4X8UH 2Z9LA 3LJOA 2QE7D 3SNDA 5CHAB 1NFYA 2Z9KA 3CENA 1Z8GA 1BBRH 2ASUB 2NWNA 2WPMS 1UCYH 3GY5A 4HGCA 1MD8A 1BB0B 5DK1A 1FAXA 3E16B 3MO9A 2VH0A 2WPJS 4IMQA 2ANMH 1VGCB 4TSFD 3RM0H 3SHAH 3SU6A 2OC1A 1BJVA 1LVBA 1INCA 1SGFA 3KF2A 3ESTA 1E36B 2GVFA 1O35A 2HPPH 1YPLH 5J4SA 2ZZUH 2A4OA 1ANDA 2WV5A 3UY9A 4B6EA 4NA7A 1O2YA 2P95A 1A1RA 3GY2A 1BRUP 1DXWA 1TABE 4DURA 1O5DH 1AU8A 2ZGCA 1WU1A 3GDVA 3UR6A 3S7HB 1XXDA 3BG8A 5DSFA 1O2KA 2ZP0H 4D8NA 6GCHF 2BOHB 1RIWB 1DWBH 1NESE 1BRBE 3PLKA 4BAHB 4ZH8A 4CH8B 1AB9B 1UMAH 3SORA 1QBOA 1Z8RA 1FNIA 1PQAA 5EPNA 4WH6A 1FAKH 2QYIA 3KYFA 2YMSB 1OP0A 1D3PB 1O3IA 1AMHA 2Z9JA 3F9GA 1BCUH 1YPHE 5EXNA 2C4FH 4UEHH 1JWTA 1XM1A 1O5FH 2Q6DA 3S0NA 2G52A 1GI4A 3BTKE 4OS1A 1O32A 1FX0B 1GMHF 2NU1E 1HBTH 4DG4A 3B9FH 3F0OA 2GX4A 4B2AA 3GDSA 5HIZA 1FJSA 3VEQB 1MBQA 1O2VA 1T8NA 3VG8A 1SGIB 1AY6H 4E7NA 4ACBA 2SGQE 1UTOA 1MKWK 1NRPH 2PUXB 1AFQC 3WWBA 2WUCA 1IHTH 2W3KA 2FOEA 1NT1A 2JETB 4O9VA 1SQAA 2FPZA 3UQVA 1KXEA 3RM2H 3S7KB 1C5OH 2V0BA 1J14A 5A8XA 3BTTE 4MPWA 1QR3E 3SU4A 2DUCA 5I46H 1T4VH 1EFRD 1CBWB 3TJUA 3BTME 3RXMA 3R3GB 2GP9B 1EZSC 1HXEH 4VGCB 4ASUD 4CR5A 4KTSA 1DLKB 1LKAA 5C0TA 2VJ1A 4K69A 2WV9A 1ZSLA 4YTAA 1H8ED 3F6UH 1SGTA 4WJG2 5JDUB 5AFYH 2CF9H 1O5EH 1UTQA 1C4V2 1TMTH 5L6NH 3LGYA 4E7RG 3SV8A 4TPIZ 1ARCA 4IC5A 3TH4H 3UNQA 2J94A 1OKXA 1O2TA 3FVFB 1GI0A 3MH5A 4I8JA 3SBKA 2Y5GA 4P00A 4WXIA 1W3CA 2SGPE 1NROH 1SB1H 1FIWA 1ELBA 4B6FA 5C5NA 4ESTE 1BBRK 2EA3A 3OSYA 2F9NA 2G51A 1UCYK 7GCHG 4X6MA 3ZZ7A 2OXSA 2XW9A 2ZGXH 2VBCA 3M3VA 1UVSH 5T6GA 3NK8A 2P59A 3QDZB 1EAIA 3CS0A 5ESBA 1Z7KA 5GDSH 1KLJH 1QL7A 6GCHG 2TGAA 1SLXB 5KGOA 1BMFD 4ISLA 1WCZA 2B8OH 3G01A 3N7DA 1CE5A 1FY8E 2Q6GA 3RUOA 2C90B 1TE0A 4U2WA 1GBAA 1HLTH 2PV9B 1P09A 2V3OH 1KXDA 4H6SB 2WINI 2VWOA 2PKSC 3S9BA 1Z6EA 5EQSA 1GHBG 3CNRA 1SI5H 1W0JD 1IQKA 1TQ0B 4XBBA 3GCNA 2Z94A 4K2YA 1A5IA 2KFWA 5F53A 1EB1H 3OAAD 2BY8X 3AW1A 3BTDE 3SGQE 4AG2A 1A3EH 1TNJA 4WMFA 4BXWA 2R9PA 3MFJA 2BD2A 2ZFPH 1C5ZB 1P04A 2SGFE 4NIYA 3A82A 1OPHB 4BXSA 1C1TA 1C2JA 3QK1A 1QIXB 3TNSA 3NKKA 1S0RA 1G32B 2ZEBA 1ZLRA 1F5RA 2AH4X 4MPXA 3RC4A 4A7IB 5JBBS 1GHAF 1ARBA 1CGJE 1O3EA 2FOHA 1THPB 1C5RA 2G5VA 4IS5A 3UAIC 1TPAE 2HWLB 2Z6BD 3L33A 1FLEE 1O3AA 2ZI2H 3UOUA 1HCGA 2EI6A 3SZNA 3E91A 3TH2H 1GPZA 1FI8A 1SLUB 4F49A 2BOKA 1MU6B 3RXSA 3M61U 1O37A 1EPTB 1C2EA 1DVAH 1BMNH 2GTBA 3RXKA 1TGNA 3VPKA 1QRWA 3DSGA 4MNYA 4A1TA 2ZECA 1GDQA 1MABB 4OGYA 2STBE 1LHCH 1BIOA 2ZU4A 4TYDA 1CHGA 3LT3A 2ZGHA 1HPGA 2BD8A 3AW0A 3N7OA 4YXWD 1QTFA 5F8TA 2WPLS 2XTTB 1WTGH 4IGDA 1HIAA 1BRAA 2RDEA 3RU4E 4DJZB 1SQTA 4HTCH 2XCNA 1OYTH 4DIHH 1YKTA 1Y3WA 2F43B 1V2TT 2FI3E 2UWLA 5T6DA 3F68H 1L0ZA 3DSPA 1DUAA 1Y8TA 1C1WH 1RIWC 1AZZA 4AC9A 2W5EA 1KY9A 2ANWA 3PLBA 5C5OA 3BEIB 1D3QB 4Y76A 1EZUC 2VU8E 2A31A 5LGOA 3QO6A 1FY5A 3KQCA 1JBUH 3SU5A 2BYAX 3SGBE 4CRCA 2YMSC 3PWBA 2W26A 2HVYB 1KXAA 1T8MA 4ABJA 1UTMA 5JBTA 4X0WU 4M7GA 1DWCH 3BTHE 3MO6A 1GBTA 2Y5HA 1O0DH 1EOLA 4YESB 5LPRA 1C2HA 1Y5BT 4X8VH 1K2I1 2TGTA 1S6HA 3D23A 4LK4A 1QB6A 2BQ6B 4ABGA 2VVCA 3PLPA 4XBDA 5F6MA 2XWBI 2F83A 1M9UA 1AKSB 2O8TA 1GCTB 1N6XA 1C9TA 5E2OA 4H42U 1DE7H 2BLOA 1TOCB 4YO9A 1IQIA 4TT3D 1GHZA 1MTWA 1O34A 3JZ1B 4MPVA 3T29A 1F0TA 1ZTLA 1KLTA 2R2WU 5E0GA 1P02A 1ZSKA 4IBLH 2ZDVH 1C4Y2 2IJOB 1NC6A 1DXPA 2V35A 1MMJN 4H4FA 3ZVGA 2JETC 2HNTF 4H6TA 2OLGA 1LMWB 1W0KD 1OP2A 5E2PA 1FN6A 3F3BA 3MH7A 1DFPA 2FTLE 2IN2A 1TX8A 1HJ9A 5FCRA 2FWWA 1UTJA 1Z6JH 1EB2A 1GHAG 2CN0H 1CBWC 1N1LA 3SU1A 4ABDA 2BDCA 4UFDH 4VGCC 4ZHMU 1AZ8A 1FDPA 1FN8A 9ESTA 1V2PT 2Z3EA 5A0CA 3MQKC 2OC0A 2ZTXA 4OS2A 4Y79A 3IITA 3ZZCA 3LGIA 3T27A 3OE7D 3EYDA 2LNCA 3IG6B 3PV2A 1RJXB 3RMMH 5TCCA 1ZMLA 1T8LA 2FODA 1VITH 5ESTE 1AN1E 2K0QA 1AWHB 3RXUA 5A2MH 2GT7A 2Z9IA 1O3OA 3GY8A 1ORFA 3GYMA 3RLYH 5AFZH 5JB8S 2XCFA 1O3KA 3RXJA 3BIUH 3LC3A 1V2JT 4KELA 1OWDA 2J38A 2ZDKA 4CRBA 1DT2A 1VITG 3HK3B 1O3FA 4ZHAA 1O2RA 1F2SE 3P6ZB 2HNTE 1GMCG 2A32A 4X1PU 5DP5A 3SZEA 3BTGE 3AAUA 3TH3H 3KQEA 1KLIH 3EE0B 4O97A 1CT2E 4B74A 3MWIU 4BOHA 2I6QA 4AB8A 1C1PA 4X1RU 3TVJB 1HFDA 2XBYA 3UNRA 1Y3YA 3Q3XA 2VWMA 2J98A 2ZPSA 3SN8A 5FPSA 1O2JA 3NCLA 5A09A 4B73A 1COWD 1MKXH 1S82A 1VZQH 2B7DH 4X8SH 4RT1A 1WXRA 3M7UA 1QL9A 1XKAC 2A4GA 2C8XB 4FUBA 1QQ4A 4UFFH 1BDAA 2L74A 2K1QA 4XSKU 2CXVA 2BX4A 2GDDA 2G8TA 3LDXH 1SGQE 3MNCA 2BXTH 4NWKA 1BT7A 2ODYB 4FUDA 1DWDH 2A4QA 1NU7B 3MH6A 4YLUA 5EW1H 2BQWB 4BTUB 1FPHH 1A61H 1C2GA 3SUDA 5GPIB 3PO1B 2FYQA 1P57B 4WVPE 4WWYA 3HGPA 1HGTH 4I32A 1P2KA 2JDID 3EA9A 1D9IA 3SHCH 2IPQX 1AI8H 3EA8A 3SUEA 4DOQA 3FZZA 1E38B 3RMLH 4AB9A 1UW7A 2JH6D 1PQ5A 2A7JA 1T8OA 3UIRA 5EJZA 3NWUA 5J4QA 3R0FA 1P2QA 1GJ7B 3MNBA 5CHBA 1CGHA 4FUCA 3UPEA 2TGDA 3RXPA 3T5FH 2ZHWH 4JZDH 1EPTC 1J8AA 1EAXA 1NY22 1DY9A 3LKWA 4WH8A 2CK3D 5HM2A 4NCYA 4AN7A 4ZKRU 2JIZD 1GI8B 3QWCH 4I8HA 4INHA 1GHYH 4TY7A 3U1JB 1EXFA 3AVZA 4UE7H 1IQEA 3SI4H 3ITIA
chains in the Genus database with same CATH topology
1DX5M 2BD9A 1CO7E 2O9QA 3EGKH 1CVWH 1QBVH 2QGRA 3SUFA 2H5DA 2C93B 1ID5H 4XFQA 4J1YA 2FOBA 1P8VC 4ISHH 1HAYB 2G5NA 2QN5T 2STAE 5CE1A 4K8YA 4K8BA 4K1TA 3RXQA 3ZZ8A 1KTSB 4MVNA 2KAIA 1QJ6B 1QB9A 4MG3A 1YPGH 1JIMA 5L30H 1O5GH 1P9SA 1GVLA 1V2VT 1YPEH 1MTUA 1TGCA 4LOYH 1GJAB 1LVMA 1PPHE 3NPSA 6CHAB 1Y3VA 1THSH 1NTPA 1SLWB 4CRFA 2ZCLP 3V13A 2Q1JA 1GBHA 2GCTB 1K1NA 4R0IA 1NPMA 1O2NA 1W7GH 2R0KA 1GL0E 1O33A 4D9RA 1GHWH 1HAIH 1GCTC 3RXIA 1UVTH 3UWIA 1GBJA 2XBWA 1C5MD 1EKBB 1P2OA 1MKXK 1UTLM 1B7XB 1FUJA 4DT7B 1RTFB 1ZTJA 3RXAA 2ZGJA 5JB9S 3A88A 3E0PB 1P01A 1LVYA 5C1XA 2QXGA 2PGQB 1SOTA 2JKHA 4NSVA 5EODA 1QHRB 1XUFA 2XYAA 4LXBH 4GPGA 1YLDA 1NRNH 1MCTA 2O8WA 2QY0B 3A86A 3ODDA 4GHQA 3C1KA 4INKA 1C2KA 5FXLA 2P3UB 2A1DB 2RA0A 1G37A 1TA2A 1ZGVA 1TONA 5C2ZA 3A8AA 1O5CB 4I8KA 3I78A 5FAHA 1F0RA 1P2IA 4BAQB 1GHVH 1AE8H 3A7VA 1L4ZA 2A2QH 1C5YB 1GI5A 4F4OC 1TRYA 1KDQA 3A87A 1A2CH 3MYWA 3TNTA 1G9IE 1ZRKA 2ZDAH 2XRCA 1A0LA 1BMLA 1V2QT 3V0XA 1OS8A 1GJ9B 2WYJA 2J4IA 1WUNH 1YF4A 3TGKE 3DFLA 4SGBE 1GBCA 3ATMA 1O3MA 2ZDMA 1LHGH 1XUJA 2PUQH 3V3MA 4JZIA 3EA7A 4KP0A 5A0AE 2BY6X 2ULLA 1HXFH 1ZR0A 1GMDF 1QRZA 2Y6TA 2ZFSA 2M5TA 2GV6A 2H6MA 1YP9A 1C5LH 1O2XA 1GBMA 2PGBB 2VB0A 2XNIA 3QGNB 1SGPE 1C2LA 2GGVB 2ALVA 1G36A 2O8UA 1HRTH 1TGBA 9LPRA 1EZXC 1K1IA 1O3BA 4IN1A 1P12E 3DFJA 1EZQA 1NRQH 3MU8A 3IWMA 1OWKA 1P2NA 2HALA 1A5HA 1GI3A 2AGEX 4TPYA 1S85A 4ZMAH 4AYVB 3BSQA 3B23B 4UDWH 2J95A 1MTSA 3PO1C 4ABAA 5B6OA 4Y11E 4DGJA 1W12U 2EI8A 1EATA 1JRSA 3H5CB 3ATIA 3AAVA 3K6ZA 4OGXA 4I7YH 4FVBA 4Q7YA 4AZ2B 3PMBB 4CHAB 3BV9B 3URCA 1RFNA 3FAOA 3Q3KA 5T6FA 1SSXA 2BD5A 5C3NA 1AVWA 2BLQA 1P06A 4R8TB 1MZDA 2CHAB 2GZ9A 3GCHB 1DM4B 1NO9H 3MU1A 3ZVFA 5HGGA 1NRRH 3VB5A 5I25A 4NA9H 2QF0A 1MAXA 1NFXA 2SFAA 2UWOA 4YM9A 3GICB 3VB7A 4UFGH 1SGCA 4ZKSU 3PB1E 1EJNA 5AF9H 4X2VA 1L4DA 1O2HA 1K1PA 1TFXA 4NIVA 4A5TS 2W3IA 2ZF0H 2OBQA 3EQ0H 3A89A 1LPGB 3VXEH 1VCPA 5C20A 3U8RH 1Q31A 1TB6H 3BEFB 2C8WB 1DSTA 1Y59T 3MHWU 1DSUA 1UVUH 1V2LT 4GHTA 1TALA 1PPCE 2YNAA 4AORA 3E3TA 1NRSH 3O8DA 1F5LA 3AASA 5GCHF 1HAPH 1HB0B 2VIVA 2A45B 1AD8H 3A7ZA 5C1YA 3LGVA 1LPKB 1V3XA 3TK9A 2OC7A 5JBCS 2BQ7B 3SV2H 6CHAC 2PKAA 1V6DA 1YCPM 3M5OA 4Q2KA 1FMGA 1C1VH 1DOJA 2FX6A 2G81E 1LCYA 3W95A 2GCTC 5DP9A 1WBGB 3M37A 3ZZ6A 1CSOE 4B1TA 1CA0B 3SQHE 1GMHG 3E6PH 2QC2A 1G3CA 1H4WA 4Y10E 2Z9GA 1SBWA 3RXBA 1K1JA 1TPSA 1UTKA 3NUMA 4FUGA 2GD4B 1LHDH 3TLOA 1C1MA 2ZKSA 3PWCA 5A0BA 4I8GA 3DUXH 1VCWA 1XVOA 1GVZA 2ZGBH 4B2CA 1HDTH 2Y80A 1DWEH 3MU4A 1GCDA 1X7AC 1Y5AT 2ZTYA 4IW4E 1SHHB 1HJAB 2XBXA 5ETXA 1C5PA 2PWXA 5JPMH 2ODQA 3M7QA 2BLWA 5HMAA 1XUGA 2FXRA 1HIAB 1Q2WA 2A5IA 1GI9B 3LH3A 1IQHA 3ATKA 2VNTA 1XVMA 3LGTA 1IQGA 5FCKA 1EP5A 2A5AA 3ENSB 3KCGH 1QURH 1TGTA 2BDGA 2WV4A 1P3EA 1YYY1 5CHAC 1N6YA 4HZHA 3RXVA 4YT6H 3B8JA 5FHTA 1SHYA 4NG9H 4ABHA 2W7UA 1HAHH 2ANKH 1O5AB 5L2YH 1VGCC 1GJDB 2FEQH 3HKIB 3SQEE 1V2RT 1SG8B 2ILNA 1ABJH 1G3DA 2BD4A 1CHOF 2F3CE 2GZ7A 5TCAA 4YOGA 3QZRA 3KHVA 1TLDA 2A2XH 3URDA 5EGMA 3ZZ4A 4BAMB 4ASHA 4IC6A 4FUEA 1SC8U 3TK6A 5LPFA 1ZHPA 1O3GA 2WYGA 3BF6H 4BANB 1BMAA 1IQNA 2CV3A 1SOZA 1FIZA 1AB9C 3RU4T 3RXEA 1PPFE 1YM0A 2H9TH 3TU7H 4GVUA 3UFAA 4YLQH 5GCHG 2C3SA 3FANA 3ZVEA 3BTEE 4JYVH 1L1GA 2OD3B 2VIWA 3JZ2B 2HPQH 3ZVDA 4B71A 4AFUA 3TJVA 1QA0A 3TGJE 1K1MA 1ESTA 5L2ZH 3RMNH 3V7TA 1IQJA 2ZHFH 4X2WA 1VCQA 3Q76A 3BN9A 4JZ1A 2P3FH 1S5SA 2PLXA 4ABFA 4ABIA 1GJBB 3QX5H 1BUIA 4DCDA 2OINA 1F5KU 2AMQA 1TX7A 3SJ8A 4ZHLU 1HUTH 2GKVE 1W0ZU 1SGRE 1CQQA 3P8OA 2AYWA 1NZQH 1GJ8B 1WYKA 2VVVA 2Y81A 4CHAC 1NU9A 2VIDA 4OS7A 1SR5C 3LOXA 1V2MT 3UOPA 4Y6DA 2GCHF 2ZDLA 2A7CA 3FFGA 3CS7A 1H9LB 2FOGA 3SI3H 1SLVB 1EJMA 2XXLA 3SO3A 1Z1JA 2BDHA 2CHAC 1EP6A 2B9LA 1WSSH 1FY1A 3GCHC 1W11U 3T2NA 3SJKA 4U30A 1QNJA 4X6PA 1XUHA 5EXLA 2CGAA 5FBEA 5IDKA 1G3EA 3DA9B 2WPHS 3E0NB 1ZYOA 1BTHH 2YNBA 2PSYA 2J92A 1AQ7A 1LPZB 3LONA 1DY8A 4FUJA 3PM3A 4QT8C 2FESH 4AFZA 1UHBA 3ZV9A 4GAWA 3ZVCA 2EC9H 2FTMA 2VIOA 1C5NH 4UFEH 4Y0YE 1TRNA 3ZZ5A 1TMUH 4MDSA 1T4UH 1O38A 3KN2A 3A7XA 1TMBH 2UUYA 4FU8A 1W8BH 2FIRH 5EG4A 1AFEH 1RGQA 3GY4A 3U8TH 3GCOA 1UVOA 5CMXH 1O3JA 2ZU3A 3D62A 2FM2A 2H2ZA 4X6OA 1ZHRA 3LGUA 1ZPZA 3ZZ9A 2FI4E 3OY6U 2ANYA 3VB3A 5DO4H 3SOSA 1FONA 4D76A 1DS2E 4CRAA 7ESTE 1S81A 1EASA 4NIXA 3ODFA 1S6FA 4K60A 2VWLA 2RCEA 4NZLA 1IQLA 1G3BA 4B76A 1LKBA 1CA0C 1GBIA 1MTVA 2GZ8A 2QA9E 2WUBA 3BG4B 1OOKB 1OWIA 1KYNA 1UTPA 3I77A 5DJ7A 1ZJKA 3L3TA 1HAVA 2R2MB 4YZUA 3OU0A 4BTTB 1RRKA 4XBCA 3D49H 3C27B 4FUFA 1PYTD 2FMJA 1BTXA 2UWPA 4I31A 2PTCE 4B75A 1IQFA 3DHKH 7LPRA 7KMEH 3A8DA 2BZ6H 2ZQ1A 5E8EH 1HJ8A 1D3TB 1T7CA 2SNVA 4DY7B 1Y3UA 2FLBH 1B0EA 1TX6A 4UONA 1GHXH 5F8ZA 4AX9H 5A8ZA 1GVKB 1LVOA 4OS4A 3Q3YA 2XWAA 3LJJA 3HGNA 5HXFA 2FOCA 1V2WT 4Z0KA 3GISB 3FZDA 1OXGA 2GCHG 1J9CH 3T62A 3GYLB 3T25A 1NM6A 1DICA 3MU0A 1WOFA 2KAIB 2CF8H 1YBWA 3EAJA 4ZAEA 2QIQA 1UK4A 3RC5A 3GY6A 1GG6B 1A0HB 1DITH 4FU9A 1O39A 1CT4E 5JBAS 1ZPBA 2XC4A 4Q7XA 4RKOB 5PTPA 3PMHB 4MTBA 2ZO3H 1O2QA 2H9HA 5SGAE 1UTNA 1QCPA 2ZPRA 3ZYEA 3RXOA 1ABIH 1GBDA 2ZDNA 3M36A 3Q00A 1H1BA 1C1RA 1TPPA 2ZHEH 1UK3A 4A1XA 1N8OB 2Y82A 1GI2A 1C1SA 2TBSA 2Y7XA 1BITA 4NIWA 4A1VA 1W7XH 3SJ9A 2PTNA 5HM9A 2G4UA 1P05A 1XUIA 3S9CA 1O2SA 1WQSA 4YOJA 3P8FA 1OX1A 4CBOA 3RU4D 1BA8B 3SW2B 1C4U2 1HAZB 3KGPA 3MMGA 1C1OA 1O31A 1UVPA 4CRGA 1HV7A 2GMTB 2D1JA 1Z71A 3ATWA 5G4BA 4ZXYH 1BHXB 1LQEA 1CA8B 2QCYA 2IOTA 3M5MA 4WY3A 2GT8A 5FPTA 5AVDA 1L1JA 1ANCA 3LU9B 4BAKB 1HYLA 1Z8IB 4CRDA 3VXFH 1VR1H 3U8OH 4NFEA 3SGAE 2HRVA 1ELTA 1TA6A 2P94A 1P0SH 2ZA5A 2ZU2A 1O36A 4XOJA 1KSNA 5K0HA 5TJXA 1GJ6A 2HGTH 1W14U 1LO6A 2PSXA 1ZMJA 1SL3A 4HFPB 3SU3A 4LZ4B 5FX6A 2ZU5A 3DT0H 3I29A 1P2JA 2HLCA 3P92A 1VJ9U 2F9UA 4Y7AA 1BBRE 1O3PB 3ZZBA 8ESTE 1D4PB 2OUAA 2TRMA 3S69A 1KDQB 2FYRA 1UCYE 2FOMB 5C67A 3TIUA 4E06H 1W13U 2VIQA 1GGDB 1P10A 3QUMP 3RLWH 1GL1A 1GBEA 2B0FA 3U1IB 1KTTB 2BDBA 1A5GH 2P3TB 1O5BB 5FPYA 1O2LA 1K9OE 1ESBA 1K22H 4XE4A 3VB6A 3M35A 1D6RA 2Q6FA 4RKJB 3O8BA 2OQ5A 2ZC9H 4RN6A 2BB4A 1MU8B 4Y8XA 3RC6A 1ZRBA 5DP8A 3D65E 1XXFA 2FP7B 5IYTA 1ZJDA 2PFEA 2UUJB 2ZCHP 1YGCH 1MH0A 3RP2A 3RXCA 3PTNA 1YCPH 1FY4A 2JH0D 1C1NA 3SUGA 1K1OA 2AERH 2BY7X 5T3HA 1QRXA 5GIBA 2NU3E 1GBBA 4ZROA 3OY5U 1G30B 1L1NA 4ISIH 1PPGE 2ZFTA 2Z7FE 1J16A 3K2UA 4NGAH 4GUXA 3UNSA 1AVXA 5LH8A 1ELAA 1O3HA 1RTLA 4X1NU 1Z1IA 1O30A 3BIVH 1XMNB 1T31A 2ZU1A 2BVSH 3U9AH 7GCHF 1QGFA 1C2FA 2O8LA 2XC5A 2W7SA 1TNHA 4A92A 4K5ZA 2DE8A 1QBNA 1TAWA 2FOFA 1BRCE 1NFWA 3RXGA 4CH2B 2FLRH 3FP7E 3TK5A 1C5WB 2BY9X 4NSYA 4ABBA 3QTOH 3TGIE 1OSSA 2RA3A 1O3LA 2AGIX 4WXVA 4I33A 1T32A 4AOQA 1BZXE 2ZCKP 5K7RA 2HVXA 3K65B 1ACBE 3SV9A 1L2EA 4NA8A 1A0JA 1ELEE 3ZYDA 3BG4C 4Q7ZA 1FQ3A 2QXJA 1DANH 4GLYA 1GHBF 1TNKA 5FX5A 1DDJA 2AFQB 4CBNA 1O2ZA 1XKBC 3UQOA 5JYIA 1KXBA 3WY8A 2RG3A 4ISOA 2A0QB 3M5NA 1DUEA 1AWFH 3ATLA 4O03A 1ZGIA 1EUFA 1EQ9A 2D26C 4MNVA 2F91A 2ZFRH 2SNWA 1HNEE 1QB1A 2ZFQH 2CMYA 3U69H 2HNTC 1O2OA 1D3DB 4D7GA 2F9PA 1GI6A 5DP3A 2QF3A 2XBVA 1C5SA 3SNBA 2FOAA 2FDAA 1K1LA 2OBOA 2C8ZB 2QXIA 3KEEA 2ZPQA 1EX3A 4JK6A 4KTCA 1H9IE 5F03A 1WQVH 4NFFA 1GBKA 1AVGH 2BY5X 4DIIH 5AHGH 1MQ6A 1C9PA 1GG6C 3H7TA 5DP4A 8GCHF 4K3JA 2PHBA 4HI3A 1RTKA 2SGEE 2ZNKH 2PKAB 3UWJH 3W94A 2NU0E 3A84A 2I6SA 1A3BH 5DP6A 3A80A 2D2DA 3VB4A 1BTZA 1QY6A 5H4IB 1ELCA 3QN7A 1N8OC 2YOLA 1YCPK 1SGYE 2F9VA 2GV7A 2IPHA 2ZHDA 4AGJA 2A4RA 1C1QA 1FXYA 2ZIQH 4JYTA 1E35B 5C1UA 1ZTKA 4BAOB 4OS5A 2ZFFH 1PPBH 1DPOA 1HAXB 1MCVA 2LPRA 1GMDG 1QJ1B 1FY3A 2BDAA 4ZKNU 1ETRH 3L6PA 2RDLA 3VFEA 4CREA 2GMTC 3RDZA 1S0QA 4X1QU 3STIA 2BX3A 2ZHQH 2EEKA 3SNCA 4CR9A 2FS8A 1E37B 1VJAU 1W0YH 3QTVH 4E05H 1LTOA 3GY7A 3PMJA 1C2MA 2PR3A 5E0JA 2P16A 3OTJE 3GY3A 6LPRA 2ESTE 1W10U 2F9OA 2R3UA 4SGAE 1TQ7B 1C2DA 4D9QA 2AS9A 1OWEA 1TIOA 3T28A 1JOUB 2FX4A 1V2KT 4D7FA 1TBZH 2BD7A 1K21H 1MUEB 1H8IH 3ZZDA 1TPOA 2UUFB 4NWLA 2HOBA 1H9HE 4LZ1H 6ESTA 3P8NA 2BVRH 3NXPA 1UK2A 3E1XB 1GGDC 1IAUA 5FBIA 3VGCB 4JMYA 5EQRA 2QV1A 3PV4A 1YLCA 2BM2A 3CP7A