2PTCE

The geometry of the reactive site and of the peptide groups in trypsin, trypsinogen and its complexes with inhibitors
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title The Geometry of the Reactive Site and of the Peptide Groups in Trypsin, Trypsinogen and its Complexes with Inhibitors
pubmed rcsb
source organism Bos taurus
molecule tags Complex (proteinase/inhibitor)
total genus 52
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1982-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2ptcE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2ptcE02
2BY6X 4ABEA 2A5KA 1LVMA 1O2LA 4JZFH 4JZDH 5DGJA 4IW4E 3GYMA 3SW2B 1HRTH 3VGCC 5DK1A 1OXGA 1QRWA 4RSPA 2BD9A 1P05A 1KSNA 1O3KA 4UEHH 3TH3H 2ZZUH 3HKIB 3EA7A 2BOHB 4WY3A 3OX7U 2VIOA 3MU0A 3GY5A 1UTQA 2ZC9H 5EW1H 3BG4C 1RFNA 3UR9A 1Y3VA 1C5OH 2XBYA 2P3TB 1QURH 1DWDH 1UJ1A 3QZQA 2OC7A 3I29A 1O37A 1W0YH 4Q80A 2H5CA 4O3UA 3EE0B 3GY6A 2XWAA 1C9PA 1C2DA 3M5NA 1BTZA 2HVXA 3BSQA 1CA8B 2PKAB 3FZDA 1GBLA 5E0JA 1UK4A 1TA6A 5EGMA 4DW2U 3K6ZA 5DP5A 2EEKA 3GDUA 3FFGA 3S9CA 3UQOA 4D7FA 1KDQA 1AZ8A 5LPRA 2HNTC 3PTBA 2OLGA 1C2FA 3LPRA 2EI7A 1TLDA 1A0JA 3RXQA 5B6OA 1SGIB 3QDZB 1O3PB 2JETB 5C1UA 3VGCB 1KDQB 4Q7YA 1TGSZ 1EPTA 1C1UH 1WOFA 3IWMA 1NC6A 1FY4A 4CRDA 1GBEA 2F9PA 1OWJA 3SO3A 4WMEA 3GISB 2FX4A 1NU7B 3PTNA 3T2NA 1AFQB 1XKBC 1HAVB 1UCYH 2V6NA 3E16B 5L6NH 1AIXH 1NRPH 3DA9B 3M7TA 3DUXH 3M5LA 1CGJE 1ZJDA 4JZ1A 1GHAF 4RN6A 2O9QA 3ZZ3A 5JBTA 2FOAA 1F0RA 1GBIA 4ZUHA 1BMLA 3A83A 2P95A 1F5KU 2PR3A 3RXSA 1O5GH 1DT2A 1H1BA 3BTQE 1V2OT 1QL7A 3RXJA 1A5GH 5TJXA 1O30A 1BRUP 1NFUA 1TB6H 2VWNA 2PHBA 1G3EA 2O8TA 4FUFA 1LQEA 1VJ9U 1TMUH 3LJOA 3SN8A 4AOQA 1GI1A 1VZQH 1DFPA 1G2MA 4FVBA 1F5RA 1WBGB 1EZQA 1O2XA 3T25A 3SQHE 4IS5A 5A8XA 1IAUA 1YYY1 4X2WA 1O32A 1GHVH 4Y6DA 1GHZA 2UWLA 1OP0A 1QL8A 1SGTA 1SLXB 1HAXB 3LONA 3PM3A 2F3CE 3RXPA 3TH4H 1P02A 1RIWB 1BOQA 1EP6A 3K9XB 1EAIA 3A86A 2AMPA 3A7ZA 2ZA5A 4CRFA 2A31A 2UUFB 2KAIA 2GV6A 5EPYA 5IYTA 1P3CA 2PV9B 3QWCH 3UNQA 1O34A 1LHDH 4INLA 6ESTA 1O2VA 1C5YB 1A0LA 2PGQB 1B0EA 1D6WA 3D23A 1PYTC 2O8LA 1TQ7B 2BD5A 5JBBS 3ATMA 1NPMA 2FTMA 2HNTE 2NU1E 1LVBA 2BXUH 1AMHA 1RGQA 3PLKA 3EQ0H 1HIAA 3LGYA 4K8YA 1INCA 2HWLB 4B2AA 3E8LA 3BEFB 1ABIH 1EATA 2G52A 3B23B 1O3HA 4BTIB 3PV4A 1O2NA 2Q6GA 1S5SA 4B71A 4O03A 1TFXA 1P0SH 2ILNA 4AB8A 4AZ2B 2ODYB 4TPYA 1UK3A 4ABJA 3ZZ5A 4AB9A 2GTBA 1P9SA 5HMAA 1O2JA 1ZRBA 2VWMA 3C27B 2WPMS 4TWWA 1A61H 5DP6A 2QYIA 1KTTB 2F9VA 2ZHQH 4KTSA 1CHGA 3NKKA 1D3PB 2CHAC 1KIGH 1NESE 3M3SA 3QX5H 1ANEA 1Y3XA 2VVVA 5CE1A 4A6LA 1YPGH 5T6GA 2Z3EA 1G30B 1SGEE 9LPRA 1UTJA 3DD2H 4ZH8A 1LO6A 3A7VA 5GIBA 4F49A 5C2ZA 1AFEH 3HK3B 5DPAA 4DCDA 1YPEH 5ESTE 1BTYA 1SB1H 3SNAA 3MNCA 1FZZA 2NWNA 1H9HE 4UFDH 1V2KT 4LOYH 3O8DA 4OGXA 1FDPA 1GDNA 1ACBE 1N6YA 1G37A 3GDVA 1HAYB 3SJIA 4YOJA 4A7IB 1K9OE 3L6PA 4GCHF 1TMBH 3ZV8A 1VITF 4GVUA 1ZLRA 2ZFQH 3ZVBA 4WF8A 3MH6A 2G51A 1C2JA 3V7TA 1C4Y2 2BQ6B 1TNJA 4LK4A 3STJA 3SGAE 2VIWA 4MNVA 1ZPZA 1TPAE 3R3GB 1ANDA 1S83A 2AIPA 3TK9A 3RMOH 1WYKA 2VB0A 5C67A 3MOCA 1P2NA 2JH5D 2ZECA 1YKTA 1GBBA 2ODQA 2UWOA 5F8ZA 3KF2A 2CMYA 1B7XB 2BY5X 3DFLA 1KTSB 1QNJA 3GY2A 4AORA 2YNBA 1DANH 1FIZA 4Y0YE 5LH8A 3DHKH 5FPTA 5T6DA 1P8VC 2OP9A 3RXEA 2BY8X 1P09A 1VGCC 5A2MH 2SNVA 1MD8A 1UTLM 2QXJA 1Y5BT 4K1EA 1GBJA 2XYAA 1BBRE 1ETRH 5ESBA 1EJNA 1ZMJA 4DG4A 1OWIA 2V3OH 6GCHG 3A80A 2ZCKP 2FX6A 1C1MA 1P2MA 2G4TA 1EUFA 2FPZA 3RC6A 1VCPA 1WQVH 2ZTZA 1GBFA 1QB9A 1HYLA 1LTOA 1O38A 2M5TA 1PPZA 3E6PH 1O3JA 3HPTB 1ESTA 2OD3B 1RTLA 1JMOH 1SLUB 4X2YA 2BD3A 2P8OB 5BPEA 4ABGA 4Y7BA 2ZHDA 1O2QA 8LPRA 1O5BB 3TGJE 1SGRE 1Y5UT 5FCKA 1SLWB 2ULLA 1BB0B 2ZGCA 2BX3A 1U6QA 1TX8A 3GOVB 2ASUB 2ZHEH 4OS4A 1GI0A 2C8YB 1ELFA 3SU3A 1IQGA 3H5CB 3URDA 2F91A 1HXFH 1L0ZA 2EA3A 1GJ9B 1HXEH 1H8DH 1MBMA 4FXGH 4JK5A 5C1XA 2WPHS 5JDUB 3D49H 1TNGA 1YPLH 4HZHA 4I31A 2R9PA 1CSOE 5F03A 2A2QH 2IPHA 4X1SU 4BXWA 6CHAB 2QXIA 3FZZA 2BXTH 1QIXB 1EP5A 3KQCA 2FODA 1CGIE 3KQEA 1Z71A 1NU9A 4X8TH 4KTCA 1S6HA 4WH8A 1WTGH 3KNXA 4J1YA 4KKDA 3UOPA 4UE7H 1GBKA 1HAOH 1PPEE 2AEIH 1AY6H 5E0GA 3VB4A 1O2KA 4A1TA 1FPHH 1V2NT 1ZTJA 1SBWA 3U8TH 1K1OA 2VVUA 1SQTA 5DP4A 1LPKB 1DY9A 3SU1A 1THPB 4NIYA 1LVYA 5E2OA 2FESH 4IBLH 3LGTA 3RC5A 4BAKB 1C2HA 3SV7A 2Z7FE 5EPNA 1DICA 1FXYA 2D8WA 4MTBA 3RC4A 8GCHF 1EAWA 4DIHH 1DLEA 1KXAA 1GG6B 3DFJA 1UO6A 2G81E 3QK1A 2BVSH 3S9AA 1C2GA 7KMEH 4A5TS 1P11E 3A82A 1LMWB 4UFFH 5T6FA 1MAYA 1S0RA 1Z8JB 2OTVA 1V6DA 4OGYA 1WQSA 1SOTA 2ZU2A 4B1TA 3STIA 4CRAA 2EI8A 1RTKA 4ZMAH 1Y3WA 2FOBA 3BTGE 4JYUH 1FJSA 2OBOA 5FBEA 2R3YA 3QGNB 1LKBA 5EQRA 3ATWA 4CRGA 2BDAA 4PROA 4SGAE 2ZPRA 1UCYK 2QV1A 1EKBB 3U1IB 3U1JB 1Y59T 1KLIH 1O3MA 2BLQA 1LHCH 4FU7A 3MHWU 1H8IH 2ZDLA 4FUHA 3S9BA 4ZKOU 5JBAS 1EX3A 1GCTC 3O8BA 5HXFA 2W3IA 3K65B 1TAWA 2VJ1A 1RJXB 3SV9A 3MTYA 1P12E 4YO9A 4WXIA 5JBCS 2G5VA 4X8SH 3M3VA 2PW8H 3ZZ8A 3KL6A 1AN1E 1ZSJA 3MMGA 2VH6A 1WCZA 4CBNA 1C2IA 2BX4A 1C1SA 4NA7A 4IMQA 3HATH 1DWEH 3BG8A 3PB1E 1AHTH 1D9IA 4XFQA 1DM4B 3ELAH 3VFEA 1WU1A 2ALVA 2F83A 2AGIX 2FWWA 3M37A 3NWUA 2IOTA 1JIRA 4XBDA 3RU4D 2PSYA 3W95A 4E7RG 1V2WT 3PWBA 4ESTE 1K1JA 4B74A 1MTNB 3BTWE 1F2SE 1EB1H 1KYNA 1DWBH 2BOKA 1FPCH 1V2MT 1P03A 1YGCH 2HOBA 4NGAH 3ODDA 2YOLA 3SV6A 3M36A 1HV7A 4Z0KA 3ZYDA 3P8GA 2ZTYA 2BHGA 2R0LA 2VNTA 1G3BA 1PPFE 2LPRA 1BJUA 1GBMA 1L4DA 1TGCA 3QLPH 3CP7A 3LC3A 1AWFH 1HLTH 4KELA 1BCUH 4B2BA 5HYOA 3B8JA 1GCTB 1YPJH 2ZFTA 1MU8B 1ELTA 4ZXYH 1XUFA 2R2WU 2AH4X 4HTCH 2XCNA 5DP7A 1SI5H 1ZGIA 4E05H 2PKSC 4K1SA 3M7QA 2ANWA 1YM0A 2RDLA 3MI4A 1OKXA 1SVPA 1TBQH 2Y7ZA 1KXDA 6GCHF 3A8BA 2XNIA 2VGCB 3TGKE 1A4WH 1S0QA 1W7GH 3PMBB 5GXPA 1QBVH 3RMLH 1QJ6B 5AFYH 2UUKB 1G3CA 3VB7A 2ZEBA 2XBVA 3SU5A 4GLYA 4D76A 1EQ9A 1A1RA 4WMDA 3SZNA 2BVXH 1DX5M 4HGCA 4GUXA 1G3DA 2RA0A 4B2CA 4OS6A 3AAVA 3LOXA 3ZVGA 4XDEA 3A7WA 5CHAB 1GJ4H 2GCTB 4ZHLU 2ZHFH 1DITH 1BTHH 1TOMH 4JZEH 2GDDA 3GY3A 1Z1JA 1FI8A 1GI2A 5GCHG 3TJNA 4NWLA 4GCHG 4NSYA 1BTUA 3ZVDA 1VITG 4K8BA 5F6MA 3SU2A 1QA0A 1S85A 2BYAX 1FV9A 2A4GA 2O8UA 1EJAA 1FN8A 4H6SB 2Y80A 2BDHA 1UVTH 4CH8B 2PKAA 1T8NA 4KGAA 4ISNA 1O2OA 2I6SA 4X6OA 2G4UA 2AS9A 3DT0H 5EXLA 1IQKA 3RXFA 2PKSB 2CGAA 1AVWA 1P2JA 3BTEE 3SNEA 1XVOA 4THNH 1QFKH 1D3DB 2ZWLH 4B73A 1TABE 1H9IE 1O2HA 3SNDA 1FY3A 1O5AB 1UHBB 1ESAA 3E0NB 4X0WU 1ZTLA 1C1RA 1FONA 1P2KA 3FP6E 1QJ7B 3ZZBA 1SL3A 4NIVA 2BD4A 1MTWA 3FVFB 1PPCE 1A3BH 1DXWA 3MH7A 1F0UA 1DUEA 1HAVA 4LZ1H 3JZ2B 4ZKRU 2FTLE 3M61U 1WV7H 2HLCA 1HUTH 2ZU5A 4SGBE 3ZVFA 1UTPA 3PMJA 1TNIA 4UDWH 1AVGH 1V2QT 3NUMA 2GDEH 1LPZB 4GHQA 5HM9A 5AFZH 2FOMB 5ETXA 5H4IB 1OP8A 1ABJH 1ARBA 3C1KA 3BG4B 4Y76A 2ZCHP 2ZIQH 1K1LA 2FIRH 3TNTA 4ABIA 1C4U2 2IN2A 2OBQA 4CBOA 5SGAE 4U32A 2UUYA 4IC6A 3BTHE 3LJJA 2J94A 1AVXA 2PWXA 2FOHA 1O5DH 3EDXB 4FU8A 1A5HA 2B5TB 2AIQA 1O5EH 3BV9B 5FXLA 4GPGA 4Q7ZA 3RXIA 4UONA 4MPXA 4FUEA 3UWJH 5EG4A 1Y3UA 1GBDA 4NA9H 2R0KA 3EGKH 4BNRA 1GI7B 1SPJA 1C9TA 1XXFA 2TGTA 3G01A 1QR3E 3ENSB 1E38B 2WINI 3GYLB 2VWOA 2OC1A 2XCFA 4BAMB 1CHOG 1GDQA 5K0HA 3UUZA 1QL9A 1L1JA 3QTVH 3ZZ9A 3SV8A 3UWIA 2BQWB 3HKJB 4CR5A 1ZOMA 2W7UA 1C5TA 2HGTH 2Q6FA 3FANA 2FOEA 1W0ZU 2H5DA 3A87A 1KXEA 1T4VH 3LGVA 1O2RA 5J4SA 1T4UH 4JMYA 8GCHG 3R0FA 5BRRE 1GJDB 1TALA 3VB6A 1GJBB 3SNCA 3BTDE 2FYQA 1O2GH 4KP0A 2AYWA 1VJAU 4NFEA 1O33A 2RCEA 3SHCH 1B0FA 1A46H 3Q76A 1C2MA 1TONA 1BRBE 4E06H 4JCNA 2FOCA 3ITIA 2BD2A 4AN7A 4CH2B 1P04A 2ZPSA 3P8NA 1EZXC 1CGHA 2QC2A 4GHTA 4ZHMU 2R2MB 3UOUA 2C4FH 4Y79A 2P94A 4TPIZ 3GCTG 4MNYA 1IQNA 1FAXA 1OOKB 1TX6A 4NWKA 1W8BH 1GJ6A 1TPOA 1ZHRA 1NFYA 1ZMNA 2VWLA 2W3KA 4Z6AH 1OYQA 1RD3B 2CXVA 1P2IA 3SUGA 4BANB 2Q6DA 4Y11E 1AU8A 1P57B 1N8OC 3ZZDA 2OUAA 3GCHC 1KLJH 1J8AA 2J95A 1AE5A 3F9HA 1THSH 2Z9GA 1MBQA 1Q2WA 2OQUA 1TMTH 2ZF0H 3URCA 4MPUA 1S84A 1GVKB 1ELBA 5FBIA 4CRBA 1MAXA 1TGNA 2FI3E 1OS8A 3RXTA 5HM2A 1LHGH 1QRXA 1QQUA 3D65E 1PPGE 3A89A 1IHSH 2ANKH 3PMHB 2J92A 5A8YA 2GVFA 1NROH 4AFUA 1OWKA 4ZXXH 1HJ8A 2F9NA 1CA0C 1ELCA 1VITH 2A4RA 3TH2H 4DOQA 2BVRH 1Z1IA 2GX4A 3MNXA 5GCHF 3A88A 3LIWA 2F9OA 1ETSH 2WPLS 1EXFA 1JRSA 1QQ4A 2ZDMA 1V2VT 2Y7XA 4Y71A 4AFSA 1SHYA 3OY5U 5C5OA 1K1IA 5IDKA 1LCYA 4YT6H 1TIOA 2ZDAH 1BA8B 4BTTB 4AYVB 1C5LH 2F9UA 2FLBH 3RXRA 2G8TA 2VIVA 1AO5A 2O8WA 1L2EA 1O2PA 1UTKA 3TJUA 1TPSA 4MVNA 1Q3XA 1T8MA 3MFJA 2H9HA 1O3GA 1XUJA 2QF0A 3IG6B 2CHAB 4NIWA 1EOLA 2DUCA 1YLDA 3LGUA 2ZDKA 2FO9A 1BTXA 2Q1JA 1J9CH 4U01A 3ZVAA 3I78A 5EOKA 1QA7A 5E8EH 1ORFA 4UD9H 1GVZA 2BDGA 4Y8YA 3SUFA 3PWCA 4MLFB 2VVCA 1XX9A 4ISLA 2ZNKH 2HNTF 3GY8A 2CV3A 4Q2KA 1SGQE 4TWYA 1GI8B 2WYJA 3UFAA 2NU3E 1XMNB 2H9EH 4WVPE 1C5RA 5AVDA 1HBTH 3VEQB 5TCAA 5EU8A 2Z9LA 3LGIA 4ZKSU 4FVDA 3EA9A 3RXOA 3BIUH 1K22H 1L4ZA 2XXLA 1AKSB 1DE7H 3P6ZB 1GJ5H 3E90B 1HNEE 1AUJA 4RKJB 1HFDA 1BT7A 1DLKB 2VU8E 2CF9H 2FP7B 2FOFA 3GICB 4U30A 1HAGE 2FZZA 2GMTC 1MKXH 3CS0A 1S81A 1MMJN 3KCGH 1GL0E 5I25A 4U2WA 5E2PA 4B75A 3MYWA 1IQEA 2QY0B 1G9IE 3UPEA 5I46H 2WUBA 5JB8S 5A0AE 1C5ZB 1BHXB 1LQDB 3SOSA 2ZU3A 1OP2A 5GPIB 1J17T 2XC5A 5FPSA 1O5CB 2OQ5A 1FAKH 1GWAA 2C8WB 3HGPA 4K69A 4JYVH 1ZMLA 5FHTA 2R3UA 3OTJE 1ELAA 1TNHA 4GSOA 4H4FA 1ELGA 3TGIE 3LU9B 5C3NA 1DSTA 1E35B 3MH4A 3P95A 2F9BH 1TOCB 1GHWH 3S7KB 1VGCB 1SG8B 1CHOF 3O8CA 2QAAA 2ZGXH 2Z3CA 1JIMA 1GMHG 4TY7A 3RU4T 2DE8A 1HB0B 4H6TA 2QXHA 1YC0A 1YPHC 1O36A 1HAPH 3A85A 3MU4A 1BZXE 4JK6A 1AB9C 4MQAA 1O3FA 5EXNA 1C2LA 4ABHA 1GBTA 1ESBA 2VH0A 1YLCA 1UVUH 3BTKE 1S6FA 3FP7E 4ZROA 4OS5A 3GY7A 3HK6B 1GMDG 1IQLA 1BJVA 1ZHPA 2GMTB 1UTNA 2CJIA 3LC5A 4X6PA 3U8RH 4INHA 1C5XB 2PUQH 4D9RA 1O3EA 2CN0H 2O8MA 1RTFB 2ANMH 1C1WH 2BTCE 3SU4A 1BRAA 1KY9A 5LPFA 3KHVA 2A1DB 4I8LA 1BBRH 4Y8ZA 2P59A 2Y6TA 2GZ7A 2XC4A 3A84A 3GCTF 3MU1A 1GI6A 4NG9H 3BIVH 1MTSA 1O2UA 1D4PB 5DP3A 1ZR0A 1O0DH 1EASA 1Y8TA 1V2LT 3QO6A 1C5NH 3SI4H 2J34A 1NRRH 2Y82A 1ZSLA 1W14U 2RA3A 1IHTH 2EI6A 1MCVA 3QGJA 2WV4A 1SOZA 5EQSA 1MKWH 1IQIA 3OY6U 4ISHH 1E34B 3SBKA 3RXCA 7ESTE 1DUAA 1XUGA 1OWEA 1ZGVA 3ZZCA 3OU0A 2TPIZ 2TBSA 2ZGBH 1O2ZA 1BMAA 1C5WB 3RLWH 1XKAC 3HGNA 5C20A 1AB9B 4X2XA 1TYNA 1ELEE 1DWCH 1FQ3A 2XTTB 5JB9S 4NZQA 3PO1C 1PQAA 2ZPQA 3KGPA 2FDAA 2UWPA 2NU4E 1K21H 1PQ7A 2BQ7B 3PMAB 2B9LA 2ZDNA 1C4V2 1F5LA 3P92A 4AG1A 2AMDA 1PQ5A 1HAHH 1AWHB 1T8LA 3TLOA 2VIQA 2GCHG 2JH6D 2PLXA 1DPOA 1MTVA 2SGAA 1KXBA 1F0SA 2J9NA 1P9UA 2NU0E 1GI9B 2A7JA 5GWZA 1BMMH 1O3NA 1GGDC 2FOGA 1QCPA 4AFQA 1A3EH 1SGPE 1N6XA 1K1PA 4NFFA 2Z6BD 1NFXA 3VB5A 2P16A 4Y10E 1G2LA 3Q3KA 4YLQH 8ESTE 1BHXF 4IN1A 2Z9KA 1DVAH 1HPGA 1QB6A 1UMAH 1ZSKA 1ZYOA 2BLVA 3SU6A 1SFQB 4Q7XA 1SGCA 2PTCE 2C90B 1MZDA 4MPWA 1GHYH 2GP9B 4LXBH 3A8CA 2EC9H 2P3UB 4R8TB 3LDXH 1GBCA 2XC0A 1QBOA 1GBAA 4YM9A 4XBCA 1P01A 2K1QA 3SGQE 1K2I1 7GCHG 1Z7KA 1GMCG 4DGJA 1O3BA 5FAHA 3SJ9A 4BAHB 2FS8A 2BLOA 3ATKA 3BEUA 5PTPA 3U9AH 4K60A 1IQJA 6LPRA 4AX9H 2ZQ2A 4E7NA 1ZRKA 3V0XA 1BQYA 2WYGA 3F6UH 1P06A 1YP9A 3MNSA 3WY8A 1ANCA 1BMNH 2PSXA 5K7RA 3KQBA 1AZZA 1TX7A 4ISIH 4AG2A 1O3OA 4FUIA 2WPKS 2ESTE 1NM6A 2FM2A 1YF4A 4I32A 4WH6A 2FI4E 4ASHA 2A4QA 1CQQA 3KN2A 2QN5T 1SLVB 2GV7A 2FXRA 2C8XB 3SI3H 1GGDB 2D26C 1LDTT 4FUCA 1C5UA 3BF6H 4WXVA 4IC5A 1A7SA 3Q3XA 4I8HA 3Q3YA 4K1TA 4AYYB 5J4QA 2W5EA 2OC8A 3ESTA 1DS2E 3SORA 5LGOA 1TNKA 2JETC 1NN6A 1HDTH 1GHBF 2ZU4A 1MUEB 4TYDA 2FEQH 5DKMA 5EXMA 1V2JT 1FN6A 5ABWA 1T8OA 2HRVA 4BTUB 3SU0A 1AFQC 2WUCA 3RM2H 1EZUC 1O2YA 2OXSA 1LVOA 2AFQB 4ISOA 1EPTC 1GMHF 1XUIA 4X1NU 1UHBA 4MPVA 4YESB 3Q77A 3NK8A 4XSKU 1OX1A 1GCDA 1TPPA 3D62A 3MH5A 4WJG2 5DG6A 3RXMA 1ZPCA 4K3JA 3E1XB 1FLEE 2WPIS 1V2UT 1C5MD 3FP8E 2BDCA 2TGPZ 3P70B 2C8ZB 1D3QB 4X1RU 1TGBA 5FX6A 3T29A 4IN2A 2P3FH 2ODPA 2GT8A 1CT2E 1C5SA 1GMDF 3NPSA 1YCPH 1XUHA 1IQMA 2J4IA 1AD8H 2D1JA 3JZ1B 2XBXA 1V2PT 1NO9H 3SJOA 1SC8U 3LH3A 4X6NA 1BIOA 2PTNA 3W94A 3TITA 4R0IA 1O2SA 1EZSC 5A09A 4YZUA 3RM0H 4J2YB 2WPJS 2FLRH 1HCGA 3RXLA 3UY9A 1DOJA 2BDBA 1GI5A 4UFGH 3L3TA 3H7OA 3RXAA 4HI3A 4YOGA 2PGBB 3O8RA 1VR1H 1RIWC 1VCQA 1TA2A 4WMFA 4D7GA 1TE0A 1WTHD 4ABFA 2W7SA 1GL1A 2ZI2H 2STBE 3TJVA 1H9LB 1KLTA 2BLWA 1P3EA 2TGDA 1HGTH 3TIUA 1MCTA 1MKXK 1VCWA 5A0BA 2GGVB 1GVLA 1QY6A 1EPTB 4FU9A 2ZCLP 4RKOB 1G32B 5HGGA 5AHGH 2QGRA 3P8FA 5DJ7A 1WAYB 3AVZA 1C5QA 3H7TA 3CENA 2Y5HA 1TBZH 1LPGB 3RXVA 1BDAA 2I6QA 4AGJA 1HAIH 1T7CA 1GBHA 1SMFE 5L2ZH 1IQFA 1PJPA 2ZO3H 3TK5A 2A7CA 2BZAA 1E36B 1Z6JH 2RG3A 2STAE 2VINA 4B76A 1AUTC 1O3AA 2ZG0H 3KIDU 4CRCA 1CE5A 2ZFRH 2V35A 5C1YA 1YPKH 5GJ4B 1EJMA 1MD7A 5FCRA 4DT7B 2H1UA 1J14A 5F8XA 1QB1A 1OPHB 1T32A 4FUBA 1FUJA 1CT0E 2GCHF 2G5NA 1ZZZA 1YPMH 3QUMP 2OCVB 1D6RA 1TRYA 4NA8A 1TRNA 1C2KA 2ANYA 3AW0A 1NS3A 1D3TB 1MZAA 1WSSH 1QHRB 1O2WA 4Y8XA 2GZ9A 1ELDE 4K2YA 2C93B 3A7TA 4DJZB 2HALA 1O2TA 2A0QB 3ZV9A 1SQAA 1Z8GA 3V13A 1NFWA 4FUDA 1HJ9A 3MO9A 4ABAA 3M35A 2XBWA 4VGCC 4D9QA 3EYDA 2BDIA 3K2UA 1C1OA 2JKHA 1TNLA 1C1NA 1Z8IB 1A5IA 3RXGA 3Q00A 2A2XH 2AGEX 1HJAC 1ZHMA 5A8ZA 2KAIB 1BRCE 2HPPH 1C1QA 2OINA 3RXDA 7GCHF 1W11U 1SGNE 3ZZ7A 1BBRK 2A7HA 3E0PB 1GMCF 3TU7H 5EODA 3NCLA 3RDZA 4HFPB 3CS7A 2QF3A 3V12A 1Y5AT 1HIAB 1PFXC 1SFIA 3B9FH 3UNSA 4ABBA 2A4OA 1FY5A 3EA8A 2ZQ1A 4IGDA 1NT1A 2H6MA 1MKWK 1NZQH 4CHAC 4A1XA 3F9FA 1E0FD 2THFB 2ALPA 1O3IA 1XM1A 1F0TA 2GT7A 4I8GA 4CREA 1RS0A 3S69A 1SR5C 1J16A 2BDYA 2GD4B 2ZTXA 1MTUA 3MO3A 4MG3A 1O2MA 3S0NA 1ZPBA 3KEEA 1EAUA 3A81A 5DO4H 5FPYA 1H4WA 4XOJA 4BAOB 1JWTA 2AERH 4XBBA 1SGFG 2SGQE 5EW2H 1RXPA 3IITA 1ZTKA 1CVWH 3RU4E 4VGCB 3M3TA 4JZIA 3ZYEA 1UTMA 1TGTA 2LNCA 4O97A 3VXFH 3M7UA 3TK6A 1UVOA 3UIRA 1HJAB 3PLPA 2BM2A 1ID5H 2ZU1A 2SGDE 4YTAA 1O3DA 2P8OC 1L1NA 3MU8A 3OYPA 3AASA 3T5FH 1GHXH 2NU2E 1GI3A 1P2QA 2IJOB 1UVPA 3PLBA 4TY6A 3BEIB 1S82A 3ZZ4A 3AAUA 4NSVA 1MU6B 4OS1A 1N8OB 1C5PA 1X7AC 2SGFE 4H42U 3GCHB 4I8JA 3GCOA 2BD7A 1GPZA 1QJ1B 1IOEA 4X8UH 3U8OH 2D2DA 4DURA 2J38A 3BN9A 1O3LA 4LZ4B 1MH0A 3SV2H 1DDJA 2FYRA 3T27A 4ZHAA 4CHAB 1C5VA 9ESTA 3RXHA 5G4BA 1AKSA 1SGFA 2CF8H 1C2EA 1W13U 6CHAC 1PQ8A 1W3CA 1NY22 4FUJA 3A8AA 4F4OC 3GY4A 1CA0B 1GDUA 4FUGA 2VIPA 4NZLA 5EQQA 3RLYH 1THRH 1V2TT 4BXSA 3ATLA 5DP8A 2DE9A 2PUXB 1SHHB 2H2ZA 2BZ6H 1GJAB 4BAQB 1SGYE 2Z3DA 5T3HA 2FS9A 3TNSA 4ZKNU 3K6YA 2Z9IA 4YT7H 1ANBA 4DY7B 3MU5A 3RXBA 3P8OA 1W7XH 2ZGJA 2TGAA 4OS2A 3QZRA 1KXFA 1SQOA 8KME2 3RP2A 4WWYA 4Y7AA 4DVAU 1GG6C 1OWHA 2ZFPH 2PFEA 1Z8RA 3L33A 5CMXH 2B8OH 3SUDA 3S7HB 2WV5A 1NRQH 2XRCA 1GHBG 1P10A 2TRMA 1PPHE 1Z6EA 3MNBA 4XE4A 3UTUH 1AQ7A 2BB4A 1JXPA 4DIIH 3SJ8A 2ZP0H 2OC0A 1YCPM 4ABDA 3ZZAA 2JH0D 4YLUA 4I7YH 3T28A 1C1VH 1OSSA 1CU1A 2ZFFH 3LKWA 3U69H 3ZVEA 4X2VA 1PPBH 2XWBI 3UREA 3VXEH 1AI8H 2SFAA 5L2YH 1TRMA 1NRNH 2UUJB 4QT8C 3SJKA 1CT4E 4MDSA 1QGFA 1IQHA 1FIWA 5TCCA 3MWIU 1C1PA 2H9TH 1FY8E 1W10U 2AGGX 1E37B 1KXCA 1B5GH 2B7DH 1Y3YA 1JOUB 4INKA 3BTME 3N7OA 3OSYA 1ETTH 1JBUH 2P93A 3F68H 4X1QU 1K1MA 3SUEA 1RRKA 5JYIA 1LHFH 1YBWA 1YCPK 3RMMH 1M9UA 2SGPE 2A32A 5FX5A 3PROA 1O2IA 1O31A 1OWDA 2A5IA 1SSXA 4KTUA 2SGEE 1XVMA 1QRZA 1JRTA 2ZHWH 1L1GA 2W26A 3U98H 4UFEH 3SGBE 1A0HB 1MTNC 3UR6A 2BY7X 4A1VA 3F9GA 1K1NA 2A45B 3UNRA 1A2CH 3RUOA 1EAXA 4K5ZA 3RXKA 1HAZB 3KQDA 4D8NA 1GJCB 1OYTH 2G55A 2QXGA 3GDSA 3RMNH 1V3XA 4M7GA 1WUNH 4O9VA 5A0CA 1GHAG 2BMGB 3TPIZ 1UVSH 1C1TA 3BTFE 3F9EA 4CR9A 4MNWA 3PYHA 3P17H 2B0FA 1MQ5A 1CBWC 1XUKA 3NZIA 4JYTA 2FI5E 1V2RT 1T31A 1NRSH 1LHEH 1FMGA 2ZFSA 3ZVCA 1DSUA 1DY8A 1O5FH 2ZDVH 4NIXA 1GJ7B 3T62A 5DP9A 4I33A 2Z94A 1ZJKA 1P2OA 4X1PU 1LKAA 2SNWA 3LH1A 4A92A 4NCYA 4YOIA 1GJ8B 4IMZA 1CO7E 4AFZA 1YPHE 2GZ8A 2ZGHA 5F8TA 1GI4A 2VGCC 1O35A 3FAOA 5LPEA 1QTFA 3GCNA 2ZKSA 3MO6A 4OS7A 3EAJA 1AGJA 1BTWA 4I8KA 3I77A 1J15A 2VIDA 3A7XA 2HPQH 1TBRH 3E3TA 3TVJB 3SNBA 1DXPA 3QN7A 4MNXA 3NXPA 4GAWA 3RXUA 1AE8H 3BTTE 4X6MA 1PYTD 5CHAC 1F7ZA 3ZZ6A 2FMJA 2GCTC 3VB3A 5L30H 1O3CA 2QCYA 2AMQA 2BD8A 4BOHA 1NTPA 2J2UA 2Z9JA 3LGWA 3SQEE 1TWXB 3SHAH 3T26A 1UK2A 1Q31A 2A5AA 1BITA 2BY9X 3QTOH 5AF9H 4ZAEA 1O39A 3AW1A 2XW9A 1W12U 5JPMH 1BUIA 2Y5FA 1CBWB 1ARCA 3E91A 1K28D 3PO1B 1TQ0B 1F92A 2V3HH 1XXDA 1ELVA 1EOJA 1FY1A 1SGDE 3F1SB 3A8DA 2YNAA 3UQVA 1W2KH 1V2ST 3M5MA 3A7YA 2QIQA 2QA9E 2TIOA 3VPKA 3ODFA 7LPRA 1MQ6A 2C3SA 1QBNA 4X8VH 1N1LA 3M5OA 4O3TA 3ATIA 2G00A 1UTOA 2Y5GA 1UCYE 3TJOA 1EB2A 4Y0ZE 5C5NA 2Y81A 3V3MA 1BTPA 2V0BA 1FNIA 4AGKA 3LT3A 5E0HA 1G36A 5GDSH 2GKVE
chains in the Genus database with same CATH superfamily
2BY6X 4ABEA 2A5KA 1LVMA 1O2LA 4JZFH 4JZDH 5DGJA 4IW4E 3GYMA 3SW2B 4P00A 1HRTH 3VGCC 5DK1A 2HLDD 1OXGA 1QRWA 4RSPA 2BD9A 1P05A 1KSNA 1O3KA 4UEHH 3TH3H 2ZZUH 3HKIB 3EA7A 2BOHB 4WY3A 3VG8A 3OX7U 2VIOA 3MU0A 3GY5A 1UTQA 2ZC9H 5EW1H 3BG4C 1RFNA 3UR9A 1Y3VA 1C5OH 2XBYA 2P3TB 1QURH 1DWDH 1UJ1A 2HVYB 3QZQA 2OC7A 3I29A 1O37A 1W0YH 4Q80A 2H5CA 4O3UA 3EE0B 3GY6A 2XWAA 1C9PA 1C2DA 3M5NA 1BTZA 2HVXA 3BSQA 1CA8B 2PKAB 3FZDA 1GBLA 5E0JA 1UK4A 3FN8A 1TA6A 5EGMA 4DW2U 3K6ZA 5DP5A 2EEKA 3GDUA 3FFGA 3S9CA 3UQOA 4D7FA 1KDQA 1AZ8A 5LPRA 2HNTC 3PTBA 2OLGA 1C2FA 3LPRA 2EI7A 1TLDA 1A0JA 3KYFA 3RXQA 5B6OA 1SGIB 5C0TA 3QDZB 1O3PB 2JETB 5C94A 5C1UA 3VGCB 1KDQB 4Q7YA 1TGSZ 1EPTA 1C1UH 1WOFA 3IWMA 1NC6A 1FY4A 3OAAD 1GBEA 2F9PA 4CRDA 1OWJA 3SO3A 4WMEA 3GISB 2FX4A 1NU7B 3PTNA 3T2NA 1AFQB 1XKBC 1HAVB 1UCYH 2V6NA 3E16B 5L6NH 1AIXH 1NRPH 3DA9B 3M7TA 3DUXH 3M5LA 1WDIA 1CGJE 1ZJDA 4JZ1A 1GHAF 4RN6A 2O9QA 3ZZ3A 5JBTA 2FOAA 1F0RA 1GBIA 4ZUHA 1BMLA 3A83A 2P95A 1F5KU 2PR3A 3RXSA 1O5GH 1DT2A 1H1BA 3BTQE 1V2OT 1QL7A 3RXJA 1A5GH 5TJXA 1O30A 1BRUP 1NFUA 1TB6H 4XD7D 2VWNA 2PHBA 1G3EA 2O8TA 4FUFA 1LQEA 1VJ9U 1TMUH 3LJOA 3SN8A 4AOQA 1GI1A 1VZQH 5HIZA 1DFPA 1G2MA 4FVBA 3N7EA 1F5RA 1WBGB 1EZQA 1O2XA 3T25A 3SQHE 4IS5A 5A8XA 1IAUA 1YYY1 4X2WA 1O32A 1GHVH 4Y6DA 1GHZA 2UWLA 1OP0A 1QL8A 1SGTA 1SLXB 1HAXB 3LONA 3PM3A 2F3CE 3RXPA 3TH4H 1P02A 2QF5A 1RIWB 1BOQA 1EP6A 3K9XB 1EAIA 3A86A 2AMPA 3A7ZA 3EE7A 2ZA5A 4CRFA 2A31A 2UUFB 2KAIA 2GV6A 5EPYA 5IYTA 1P3CA 2PV9B 3QWCH 3UNQA 1O34A 1LHDH 4INLA 6ESTA 1O2VA 1C5YB 1A0LA 2PGQB 3DSOA 1B0EA 1D6WA 3D23A 1PYTC 2O8LA 1TQ7B 2BD5A 5JBBS 3ATMA 1NPMA 2KCOA 2FTMA 2HNTE 2NU1E 1LVBA 2BXUH 1AMHA 1RGQA 3PLKA 3EQ0H 1HIAA 3LGYA 4K8YA 1INCA 2GJGA 2HWLB 4B2AA 3E8LA 3BEFB 1ABIH 1EATA 2G52A 3B23B 1O3HA 4BTIB 1QZ8A 3PV4A 1O2NA 2Q6GA 1S5SA 4B71A 4O03A 1TFXA 1P0SH 2ILNA 4AB8A 4AZ2B 2ODYB 4TPYA 1UK3A 4ABJA 3ZZ5A 4AB9A 2YMSC 2GTBA 1P9SA 5HMAA 1O2JA 1ZRBA 2VWMA 3C27B 2WPMS 3DSGA 1A61H 4TWWA 5DP6A 2QYIA 1KTTB 2F9VA 2ZHQH 4KTSA 1CHGA 3NKKA 1D3PB 2CHAC 1KIGH 1NESE 3M3SA 1E79D 3QX5H 1ANEA 1Y3XA 2VVVA 5CE1A 4A6LA 1YPGH 5T6GA 2Z3EA 1G30B 1SGEE 9LPRA 1UTJA 3DD2H 4ZH8A 1LO6A 3A7VA 1YWUA 5GIBA 4F49A 5C2ZA 1AFEH 3HK3B 5DPAA 4DCDA 1YPEH 5ESTE 1BTYA 1SB1H 3SNAA 3MNCA 1FZZA 2NWNA 3F2HA 1H9HE 4UFDH 1V2KT 4LOYH 3O8DA 4OGXA 1FDPA 1GDNA 1ACBE 1N6YA 1G37A 3GDVA 1HAYB 3NRLA 3SJIA 4YOJA 4A7IB 1K9OE 3L6PA 4GCHF 1TMBH 2W6ID 3ZV8A 1VITF 4GVUA 1ZLRA 2ZFQH 3ZVBA 5GNDA 4WF8A 3MH6A 2G51A 5IK2D 1C2JA 3V7TA 1C4Y2 2BQ6B 3AK5A 1TNJA 4LK4A 3STJA 3SGAE 2VIWA 4MNVA 1ZPZA 1TPAE 3R3GB 1ANDA 1S83A 2AIPA 2KZ4A 3TK9A 3RMOH 1WYKA 2VB0A 5C67A 3MOCA 1P2NA 2JH5D 2ZECA 1YKTA 1GBBA 2ODQA 2UWOA 5F8ZA 4XRNA 3KF2A 2CMYA 4TT3D 1B7XB 2BY5X 3DFLA 1KTSB 1QNJA 3GY2A 4AORA 2YNBA 1DANH 1FIZA 4Y0YE 5LH8A 3DHKH 5FPTA 5T6DA 1P8VC 2OP9A 3RXEA 2BY8X 1P09A 1VGCC 5A2MH 2SNVA 1MD8A 1UTLM 2QXJA 1Y5BT 4K1EA 1GBJA 2XYAA 1BBRE 1ETRH 5ESBA 1EJNA 1ZMJA 4DG4A 1OWIA 2V3OH 6GCHG 3A80A 2ZCKP 2FX6A 1C1MA 1P2MA 2G4TA 1EUFA 2FPZA 3RC6A 1VCPA 1WQVH 2ZTZA 1GBFA 1QB9A 1HYLA 1LTOA 1O38A 2M5TA 1PPZA 3E6PH 1O3JA 1OHHD 1ESTA 2OD3B 1RTLA 1JMOH 1SLUB 3HPTB 2BD3A 2P8OB 5BPEA 4ABGA 4Y7BA 2ZHDA 1O2QA 8LPRA 1O5BB 3TGJE 1SGRE 1Y5UT 5FCKA 2RFKC 1SLWB 2ULLA 1BB0B 2ZGCA 2BX3A 1U6QA 1TX8A 3GOVB 2ASUB 2ZHEH 4OS4A 1GI0A 2C8YB 1ELFA 3SU3A 2KCPA 1IQGA 3H5CB 3URDA 2F91A 1HXFH 3FOAA 1L0ZA 2EA3A 1GJ9B 1HXEH 1H8DH 1MBMA 4FXGH 4JK5A 5C1XA 2WPHS 5JDUB 3D49H 1TNGA 1YPLH 3F0OA 4HZHA 4I31A 2R9PA 1CSOE 5F03A 2A2QH 2IPHA 2J5UA 4X1SU 4BXWA 6CHAB 2QXIA 3FZZA 2BXTH 1QIXB 1EP5A 3KQCA 2FODA 1CGIE 3KQEA 1Z71A 1NU9A 4X8TH 4KTCA 1S6HA 4WH8A 3SYJA 1WTGH 3KNXA 4J1YA 4KKDA 3UOPA 4UE7H 1GBKA 1HAOH 1PPEE 2AEIH 1AY6H 5E0GA 3VB4A 1O2KA 4A1TA 1FPHH 1V2NT 1ZTJA 1SBWA 3U8TH 1K1OA 2VVUA 1SQTA 5DP4A 1LPKB 1DY9A 3SU1A 1THPB 4NIYA 1LVYA 5E2OA 2FESH 4IBLH 3LGTA 3RC5A 4BAKB 1C2HA 3SV7A 2Z7FE 5EPNA 1DICA 1FXYA 2D8WA 4MTBA 3RC4A 8GCHF 1EAWA 4DIHH 1DLEA 5HIYA 1KXAA 1GG6B 3DFJA 4B6FA 1UO6A 2G81E 3QK1A 2BVSH 3S9AA 1C2GA 7KMEH 4A5TS 1P11E 3A82A 1LMWB 4UFFH 5T6FA 1MAYA 1S0RA 1Z8JB 2OTVA 1V6DA 4OGYA 1WQSA 1SOTA 2ZU2A 4B1TA 3STIA 4CRAA 2EI8A 1RTKA 4ZMAH 1Y3WA 2FOBA 3BTGE 4JYUH 1FJSA 2OBOA 5FBEA 2R3YA 3QGNB 1LKBA 5EQRA 3ATWA 4CRGA 2BDAA 4PROA 4SGAE 2ZPRA 1UCYK 2QV1A 1EKBB 3U1IB 3U1JB 1Y59T 1KLIH 1O3MA 2BLQA 1LHCH 4FU7A 3MHWU 1H8IH 2ZDLA 4FUHA 3S9BA 4ZKOU 5JBAS 1EX3A 1GCTC 3O8BA 5HXFA 2L74A 2W3IA 3K65B 1TAWA 2VJ1A 1RJXB 3SV9A 3MTYA 1P12E 4YO9A 4WXIA 5JBCS 2G5VA 4X8SH 3M3VA 2PW8H 3ZZ8A 3KL6A 1AN1E 1ZSJA 3MMGA 2VH6A 1WCZA 2KFWA 4CBNA 1C2IA 2BX4A 1C1SA 1VKYA 4NA7A 4IMQA 3HATH 1DWEH 3BG8A 4Q4LA 4P02A 3PB1E 1AHTH 1D9IA 4XFQA 1DM4B 3ELAH 2VBCA 3VFEA 1WU1A 2ALVA 2F83A 2AGIX 2FWWA 3M37A 3NWUA 2J97A 2IOTA 1JIRA 2LELA 4XBDA 3RU4D 2PSYA 3W95A 4E7RG 1V2WT 3PWBA 4ESTE 1H8HD 1K1JA 4B74A 1MTNB 3BTWE 4RT1A 1F2SE 1EB1H 1KYNA 1DWBH 2BOKA 1FPCH 1V2MT 1P03A 1YGCH 2HOBA 4NGAH 3ODDA 2YOLA 3SV6A 3M36A 1HV7A 4Z0KA 3ZYDA 3P8GA 2V7QD 2ZTYA 2BHGA 5CDFE 2R0LA 2VNTA 1G3BA 1PPFE 2LPRA 1BJUA 1GBMA 1L4DA 1TGCA 3QLPH 2CK3D 3CP7A 3LC3A 1AWFH 1HLTH 2LP6A 1BCUH 4KELA 4B2BA 5HYOA 3B8JA 1GCTB 1YPJH 2ZFTA 1MU8B 1ELTA 4ZXYH 1XUFA 2R2WU 2AH4X 4HTCH 3KYGA 2XCNA 5DP7A 1SI5H 1ZGIA 4E05H 2PKSC 4K1SA 3M7QA 2WHXA 2ANWA 1YM0A 2RDLA 3MI4A 1OKXA 1SVPA 2KX4A 1TBQH 2Y7ZA 1KXDA 6GCHF 3A8BA 2XNIA 4X2YA 2VGCB 3TGKE 1A4WH 1S0QA 1W7GH 3PMBB 5GXPA 1QBVH 3RMLH 1QJ6B 5AFYH 2UUKB 1G3CA 2AHME 3VB7A 4F55A 5KEDA 1COWD 2EY4C 2ZEBA 2XBVA 3SU5A 4GLYA 4D76A 1EQ9A 1A1RA 4WMDA 3SZNA 2BVXH 1DX5M 4HGCA 4GUXA 1G3DA 2RA0A 4B2CA 1SKYE 4OS6A 3AAVA 3LOXA 3ZVGA 4XDEA 3A7WA 5CHAB 1GJ4H 2GCTB 4ZHLU 2ZHFH 1DITH 1BTHH 1TOMH 4JZEH 2GDDA 3GY3A 1Z1JA 2WZQA 1FI8A 1GI2A 5GCHG 3TJNA 4NWLA 4GCHG 4NSYA 1BTUA 3ZVDA 1VITG 4K8BA 5F6MA 3SU2A 1QA0A 1S85A 2BYAX 1FV9A 3PV2A 2A4GA 2O8UA 1EJAA 1FN8A 4H6SB 2Y80A 2BDHA 1UVTH 4CH8B 2PKAA 5KGOA 1T8NA 4KGAA 4ISNA 1O2OA 2I6SA 4X6OA 2G4UA 2AS9A 3DT0H 5EXLA 1IQKA 3RXFA 2PKSB 2CGAA 1AVWA 1P2JA 3BTEE 3SNEA 1XVOA 3KQ5A 4THNH 1FX0B 1QFKH 1D3DB 2ZWLH 4B73A 1TABE 1H9IE 1O2HA 3SNDA 1FY3A 1O5AB 1UHBB 1ESAA 3E0NB 4X0WU 1ZTLA 1C1RA 1FONA 1P2KA 3FP6E 1QJ7B 3ZZBA 1SL3A 4NIVA 1BMFD 2BD4A 1MTWA 3FVFB 1PPCE 1A3BH 1DXWA 3MH7A 1F0UA 1DUEA 1HAVA 4LZ1H 2J98B 3JZ2B 4ZKRU 1NBMD 2FTLE 3M61U 1WV7H 2HLCA 1HUTH 2ZU5A 4SGBE 3ZVFA 1UTPA 3PMJA 1TNIA 4UDWH 1AVGH 1V2QT 3NUMA 2GDEH 1LPZB 4GHQA 5HM9A 5AFZH 2FOMB 1W0KD 5ETXA 5H4IB 1OP8A 1ABJH 1ARBA 3C1KA 3BG4B 1EFRD 4Y76A 2ZCHP 2ZIQH 1K1LA 2FIRH 3TNTA 4ABIA 1C4U2 2IN2A 2OBQA 4CBOA 5SGAE 4U32A 2UUYA 4IC6A 3BTHE 3LJJA 2J94A 2JJ1D 1AVXA 2PWXA 2FOHA 1O5DH 3EDXB 4FU8A 1A5HA 2B5TB 2AIQA 1O5EH 3BV9B 5FXLA 4GPGA 4Q7ZA 1MABB 3RXIA 4UONA 4MPXA 4FUEA 3UWJH 5EG4A 1Y3UA 1GBDA 4NA9H 2R0KA 3EGKH 2WPDD 4BNRA 1GI7B 1SPJA 1C9TA 1XXFA 2TGTA 3H09A 3G01A 1QR3E 3ENSB 1E38B 2WINI 3GYLB 2VWOA 2OC1A 2XCFA 4BAMB 3MQKC 1CHOG 1GDQA 5K0HA 3UUZA 1QL9A 1L1JA 3QTVH 3ZZ9A 3SV8A 3UWIA 2BQWB 3HKJB 4CR5A 1ZOMA 2W7UA 1C5TA 2QE7D 2HGTH 2Q6FA 3FANA 2FOEA 1W0ZU 2H5DA 3A87A 1KXEA 1T4VH 3LGVA 1O2RA 5J4SA 1T4UH 4JMYA 8GCHG 3R0FA 5BRRE 1GJDB 1TALA 3VB6A 1GJBB 3SNCA 3BTDE 2FYQA 1O2GH 4KP0A 2AYWA 1VJAU 4NFEA 1O33A 2RCEA 3SHCH 1B0FA 1A46H 3OTPA 3Q76A 1C2MA 1TONA 1BRBE 4E06H 4JCNA 2FOCA 3ITIA 2BD2A 4AN7A 4CH2B 1P04A 2ZPSA 3P8NA 1EZXC 1CGHA 2QC2A 4GHTA 4ZHMU 2R2MB 3UOUA 2C4FH 4Y79A 2P94A 4TPIZ 3GCTG 4MNYA 1IQNA 4F48B 1FAXA 2KM0A 1OOKB 1TX6A 4NWKA 1W8BH 1GJ6A 1TPOA 1ZHRA 1NFYA 1ZMNA 2VWLA 2W3KA 4Z6AH 3F2GA 1OYQA 1RD3B 2CXVA 1P2IA 3SUGA 4BANB 2Q6DA 4Y11E 1AU8A 1P57B 1N8OC 3ZZDA 3UAIC 2OUAA 3GCHC 1KLJH 4ACAA 1J8AA 2J95A 1AE5A 3F9HA 1THSH 2Z9GA 1MBQA 1Q2WA 2OQUA 1TMTH 2ZF0H 3URCA 5C0UA 4MPUA 1S84A 2F43B 1GVKB 1ELBA 5FBIA 4CRBA 1MAXA 1TGNA 2FI3E 1OS8A 3RXTA 5HM2A 1LHGH 1QRXA 1QQUA 3D65E 1PPGE 3A89A 1IHSH 2ANKH 3PMHB 2J92A 5A8YA 2GVFA 1NROH 4AFUA 1OWKA 4ZXXH 1HJ8A 2OK5A 2KCAA 2F9NA 1CA0C 1ELCA 1VITH 2A4RA 3TH2H 3PRBA 4DOQA 2BVRH 1Z1IA 2GX4A 3MNXA 5GCHF 3A88A 3LIWA 2F9OA 1ETSH 2WPLS 1EXFA 1JRSA 1QQ4A 2K8IA 2ZDMA 1V2VT 2Y7XA 4Y71A 4AFSA 1SHYA 3OY5U 5C5OA 1K1IA 5IDKA 3DSPA 1LCYA 4YT6H 1TIOA 2ZDAH 1BA8B 4BTTB 4AYVB 2EQNA 1C5LH 2F9UA 2FLBH 3RXRA 2G8TA 2VIVA 2PP6A 1AO5A 2YMSB 2O8WA 1L2EA 1O2PA 1UTKA 3TJUA 2KCYA 2KR7A 1TPSA 4MVNA 1Q3XA 1T8MA 3MFJA 2H9HA 1O3GA 1XUJA 2QF0A 3IG6B 2CHAB 4NIWA 1EOLA 2DUCA 1YLDA 3LGUA 2ZDKA 2FO9A 1BTXA 2Q1JA 1J9CH 4U01A 3ZVAA 3I78A 5EOKA 1QA7A 5E8EH 1ORFA 4UD9H 1GVZA 2BDGA 4Y8YA 3SUFA 3PWCA 4MLFB 2VVCA 1XX9A 4ISLA 2ZNKH 2HNTF 3GY8A 2CV3A 4Q2KA 1SGQE 4TWYA 1GI8B 2WYJA 3UFAA 1UW7A 1XMNB 2H9EH 2NU3E 4WVPE 1C5RA 5AVDA 1HBTH 3VEQB 5TCAA 5EU8A 3WWFA 2Z9LA 3LGIA 4ZKSU 4FVDA 3EA9A 3RXOA 3BIUH 1K22H 1L4ZA 2XXLA 1AKSB 1DE7H 3P6ZB 1GJ5H 3E90B 1HNEE 1AUJA 4RKJB 1HFDA 1BT7A 1DLKB 2VU8E 2CF9H 2FP7B 2FOFA 3GICB 4U30A 1HAGE 2FZZA 2GMTC 1MKXH 3CS0A 1S81A 1MMJN 3KCGH 1GL0E 5I25A 4U2WA 4FETA 5E2PA 4B75A 3MYWA 1IQEA 2QY0B 1G9IE 3UPEA 5I46H 2WUBA 5JB8S 5A0AE 1C5ZB 1BHXB 1LQDB 3SOSA 2ZU3A 1OP2A 5GPIB 1J17T 2XC5A 5FPSA 1O5CB 2OQ5A 1FAKH 1GWAA 2C8WB 3HGPA 4K69A 4JYVH 1ZMLA 5FHTA 2R3UA 1YY3A 3OTJE 1ELAA 1TNHA 4GSOA 4H4FA 1ELGA 3TGIE 3LU9B 5C3NA 1DSTA 1E35B 3MH4A 3P95A 2F9BH 5EJLA 1TOCB 1GHWH 3CNRA 3S7KB 1VGCB 1SG8B 1CHOF 3O8CA 2QAAA 2ZGXH 2Z3CA 1JIMA 1GMHG 4TY7A 3RU4T 2DE8A 1HB0B 4H6TA 2QXHA 1YC0A 1YPHC 1O36A 1HAPH 3A85A 3MU4A 1BZXE 4JK6A 1AB9C 4MQAA 1W0JD 1O3FA 5EXNA 1C2LA 4ABHA 1GBTA 1ESBA 2VH0A 1YLCA 3FKSD 1UVUH 3BTKE 1S6FA 3FP7E 4ZROA 4OS5A 3GY7A 3HK6B 1GMDG 1IQLA 1BJVA 1ZHPA 2GMTB 1UTNA 2CJIA 3LC5A 4X6PA 3U8RH 4INHA 1C5XB 2PUQH 4D9RA 1O3EA 2CN0H 2O8MA 1RTFB 2ANMH 1C1WH 2BTCE 3SU4A 1BRAA 3OE7D 1KY9A 2W6JD 5LPFA 3KHVA 4I86A 2A1DB 4I8LA 1BBRH 4Y8ZA 2P59A 2Y6TA 2GZ7A 2XC4A 3A84A 3GCTF 3MU1A 3N99A 1GI6A 4NG9H 3BIVH 1MTSA 1O2UA 1D4PB 5DP3A 1ZR0A 1O0DH 1EASA 1Y8TA 1V2LT 3QO6A 1C5NH 3SI4H 2J34A 1NRRH 2Y82A 1ZSLA 1W14U 2RA3A 1IHTH 2EI6A 1MCVA 3QGJA 2WV4A 1SOZA 5EQSA 1MKWH 1IQIA 3OY6U 4ISHH 1E34B 3SBKA 3W1EA 3RXCA 7ESTE 1DUAA 1XUGA 1OWEA 1ZGVA 3ZZCA 3OU0A 2TPIZ 2TBSA 2ZGBH 1O2ZA 1BMAA 1C5WB 3RLWH 1XKAC 3HGNA 5C17A 5C20A 1AB9B 2WSSD 4X2XA 1TYNA 1ELEE 1DWCH 1FQ3A 2XTTB 5JB9S 4NZQA 3PO1C 1PQAA 2ZPQA 3KGPA 5B6LA 2FDAA 2UWPA 2NU4E 1K21H 1PQ7A 2BQ7B 3PMAB 2B9LA 2ZDNA 1C4V2 1F5LA 3P92A 4AG1A 2AMDA 1PQ5A 1HAHH 1AWHB 1T8LA 3TLOA 2VIQA 2GCHG 2JH6D 2PLXA 4RT0A 1DPOA 1MTVA 2SGAA 1KXBA 1F0SA 2F4LA 1P9UA 2J9NA 2NU0E 4ASUD 1GI9B 2A7JA 5GWZA 1BMMH 1O3NA 1GGDC 2FOGA 1QCPA 4AFQA 1A3EH 1SGPE 1N6XA 1K1PA 4NFFA 2Z6BD 1NFXA 3VB5A 2P16A 4Y10E 1G2LA 3Q3KA 4YLQH 8ESTE 1BHXF 4IN1A 2Z9KA 1DVAH 1HPGA 1QB6A 1UMAH 1ZSKA 1ZYOA 2BLVA 3SU6A 1SFQB 4Q7XA 1SGCA 2PTCE 2C90B 3WWBA 1MZDA 4MPWA 1GHYH 2GP9B 4LXBH 3A8CA 2EC9H 2P3UB 4R8TB 3LDXH 1GBCA 2XC0A 1QBOA 1GBAA 4YM9A 4XBCA 1P01A 2K1QA 3SGQE 1K2I1 7GCHG 1Z7KA 1GMCG 4DGJA 1O3BA 5FAHA 3SJ9A 3UB0A 4BAHB 2FS8A 2BLOA 3ATKA 3BEUA 5PTPA 3U9AH 4K60A 1IQJA 6LPRA 4AX9H 2ZQ2A 4E7NA 1ZRKA 3V0XA 1BQYA 2WYGA 3F6UH 1P06A 1YP9A 3MNSA 3WY8A 1ANCA 3F0PA 1BMNH 2PSXA 5K7RA 3KQBA 1AZZA 1TX7A 4ISIH 4AG2A 1O3OA 3OEED 4FUIA 5EJZA 2WPKS 2ESTE 1NM6A 2FM2A 1YF4A 4I32A 4WH6A 2FI4E 4ASHA 2A4QA 1CQQA 3KN2A 2QN5T 1SLVB 4ACBA 2GV7A 2FXRA 3DCLA 2C8XB 2QF4A 3SI3H 1GGDB 2D26C 1LDTT 4FUCA 1C5UA 3BF6H 4WXVA 4IC5A 1A7SA 3Q3XA 4I8HA 3Q3YA 4K1TA 4AYYB 5J4QA 2W5EA 2OC8A 3ESTA 1DS2E 3SORA 5LGOA 1TNKA 2JETC 1NN6A 1HDTH 5T1VA 1GHBF 2ZU4A 2M2AA 1MUEB 4TYDA 2FEQH 5DKMA 5EXMA 1V2JT 4HG6A 1FN6A 5ABWA 1T8OA 2HRVA 4BTUB 3SU0A 1AFQC 2WUCA 3RM2H 1EZUC 1O2YA 1LVOA 2OXSA 2AFQB 4ISOA 1EPTC 1GMHF 1XUIA 4X1NU 1UHBA 4MPVA 4YESB 3Q77A 3NK8A 4TSFD 4XSKU 1OX1A 1GCDA 1TPPA 3D62A 3MH5A 4WJG2 5DG6A 3RXMA 1ZPCA 4K3JA 3E1XB 1FLEE 2WPIS 1V2UT 1C5MD 3FP8E 2BDCA 2J98A 2TGPZ 3P70B 2C8ZB 1D3QB 4X1RU 1TGBA 5FX6A 3T29A 4IN2A 2P3FH 2ODPA 2GT8A 1CT2E 1C5SA 1GMDF 3NPSA 1YCPH 1XUHA 1IQMA 2J4IA 1AD8H 2D1JA 3JZ1B 2XBXA 1V2PT 1YLNA 1NO9H 3SJOA 1SC8U 3LH3A 4X6NA 3SZEA 1BIOA 2PTNA 3W94A 3TITA 4R0IA 1O2SA 1EZSC 5A09A 4YZUA 3RM0H 4J2YB 2WPJS 2FLRH 1HCGA 3RXLA 3UY9A 1DOJA 2BDBA 1GI5A 4UFGH 3L3TA 3H7OA 3RXAA 4HI3A 2XNDD 4YOGA 2PGBB 3O8RA 1VR1H 1RIWC 1VCQA 1TA2A 4WMFA 4D7GA 1TE0A 1WTHD 4ABFA 2W7SA 1GL1A 2ZI2H 2STBE 1E1RD 3TJVA 1H9LB 1KLTA 2BLWA 1P3EA 2TGDA 1HGTH 3TIUA 1MCTA 1MKXK 1VCWA 5A0BA 2GGVB 1GVLA 1QY6A 1EPTB 4FU9A 2ZCLP 4RKOB 4AC9A 1G32B 5HGGA 5AHGH 2QGRA 3P8FA 5DJ7A 1WAYB 3AVZA 1C5QA 4Z1MD 3H7TA 3CENA 2Y5HA 1TBZH 1LPGB 3RXVA 1BDAA 2I6QA 4AGJA 1HAIH 1T7CA 1GBHA 1SMFE 5L2ZH 1IQFA 1PJPA 2ZO3H 3TK5A 2A7CA 2BZAA 1E36B 1Z6JH 2RG3A 2STAE 2VINA 4B76A 1AUTC 1O3AA 2ZG0H 3KIDU 4CRCA 1CE5A 2ZFRH 2V35A 5C1YA 1YPKH 5GJ4B 1EJMA 1MD7A 5FCRA 4DT7B 2H1UA 1J14A 5F8XA 1QB1A 1OPHB 1T32A 4FUBA 1FUJA 1CT0E 2GCHF 2G5NA 1ZZZA 1YPMH 3QUMP 2OCVB 1D6RA 1TRYA 4NA8A 1TRNA 1C2KA 2ANYA 3AW0A 1NS3A 1D3TB 1MZAA 1WSSH 2JDID 3PRDA 1QHRB 1O2WA 2L6OA 4Y8XA 2GZ9A 1ELDE 4K2YA 2C93B 3A7TA 4DJZB 2HALA 1O2TA 2A0QB 3ZV9A 1SQAA 1Z8GA 3V13A 1NFWA 4FUDA 1HJ9A 3MO9A 4ABAA 3M35A 2XBWA 4VGCC 4D9QA 3EYDA 2BDIA 3K2UA 1C1OA 2JKHA 1TNLA 1C1NA 1Z8IB 1A5IA 3RXGA 3U28C 3Q00A 4B6EA 2A2XH 2AGEX 1HJAC 1ZHMA 5A8ZA 2KAIB 1BRCE 2HPPH 1C1QA 2OINA 3RXDA 7GCHF 1W11U 1SGNE 3ZZ7A 1BBRK 2A7HA 3E0PB 1GMCF 3TU7H 5EODA 3NCLA 3RDZA 4HFPB 3CS7A 2QF3A 3V12A 1Y5AT 4YXWD 1HIAB 1PFXC 1SFIA 3B9FH 3UNSA 4ABBA 2A4OA 1FY5A 3EA8A 2ZQ1A 4IGDA 1NT1A 2H6MA 1MKWK 1NZQH 4CHAC 4A1XA 3F9FA 1E0FD 2THFB 2ALPA 1O3IA 1XM1A 1F0TA 2GT7A 4I8GA 4CREA 1RS0A 3S69A 1SR5C 1J16A 2BDYA 2GD4B 2ZTXA 1MTUA 3MO3A 4MG3A 1O2MA 2RDEA 3S0NA 1ZPBA 3KEEA 1EAUA 3ZIAD 3A81A 5DO4H 5FPYA 1H4WA 3OFND 4XOJA 4BAOB 1JWTA 2AERH 4XBBA 1SGFG 2SGQE 5EW2H 1RXPA 3IITA 1ZTKA 1CVWH 3RU4E 4VGCB 3M3TA 4JZIA 3ZYEA 3GS9A 1UTMA 1TGTA 2LNCA 4O97A 3VXFH 2K0QA 3M7UA 3TK6A 1UVOA 3UIRA 1HJAB 3PLPA 2BM2A 1ID5H 2ZU1A 2SGDE 2V3MA 4YTAA 1O3DA 2P8OC 1L1NA 3MU8A 3OYPA 3AASA 2WV9A 3T5FH 1GHXH 2NU2E 1GI3A 1P2QA 2IJOB 1UVPA 3PLBA 4TY6A 3BEIB 4ZCNA 1S82A 3ZZ4A 3AAUA 4NSVA 1MU6B 4OS1A 1N8OB 1C5PA 1X7AC 2SGFE 4H42U 3GCHB 4I8JA 3GCOA 2BD7A 1GPZA 1QJ1B 1IOEA 4X8UH 3U8OH 2D2DA 4DURA 2J38A 3BN9A 5EIYA 1O3LA 4LZ4B 1MH0A 3SV2H 1DDJA 2FYRA 3T27A 4ZHAA 4CHAB 1C5VA 9ESTA 3RXHA 5G4BA 1AKSA 1SGFA 2CF8H 1C2EA 1W13U 6CHAC 1PQ8A 1SQRA 1W3CA 1NY22 4FUJA 3A8AA 4F4OC 3GY4A 1CA0B 1GDUA 4FUGA 2VIPA 4NZLA 5EQQA 3RLYH 1THRH 1V2TT 4BXSA 4OM9A 3ATLA 5DP8A 2DE9A 2PUXB 1SHHB 2H2ZA 2BZ6H 3WW7A 1GJAB 4BAQB 1SGYE 2Z3DA 5T3HA 2FS9A 3TNSA 4ZKNU 3K6YA 2Z9IA 4YT7H 1ANBA 4DY7B 3MU5A 3RXBA 3P8OA 1W7XH 2ZGJA 2TGAA 4OS2A 3QZRA 1KXFA 1SQOA 3FO8D 8KME2 3RP2A 4WWYA 4Y7AA 4DVAU 1GG6C 1OWHA 4M9FA 2ZFPH 2PFEA 1Z8RA 3L33A 5CMXH 2B8OH 3SUDA 3S7HB 2WV5A 1NRQH 2XRCA 1GHBG 1P10A 2TRMA 1PPHE 1Z6EA 3MNBA 3PV5A 4XE4A 3UTUH 1AQ7A 2BB4A 1JXPA 4FOUC 4DIIH 3SJ8A 2ZP0H 2OC0A 1YCPM 4ABDA 3ZZAA 2JH0D 3F3BA 4YLUA 4I7YH 3T28A 1C1VH 1E1QD 1OSSA 1CU1A 2ZFFH 3LKWA 3U69H 3ZVEA 4X2VA 1PPBH 2XWBI 3UREA 3VXEH 1AI8H 2SFAA 5L2YH 1TRMA 5DN6D 1NRNH 2UUJB 4QT8C 5F53A 3SJKA 1CT4E 4MDSA 1QGFA 1IQHA 1FIWA 5TCCA 3MWIU 1C1PA 2H9TH 1FY8E 1W10U 2AGGX 1E37B 1KXCA 1B5GH 2B7DH 1Y3YA 5FL7D 1JOUB 4INKA 3BTME 3N7OA 3OSYA 1ETTH 1JBUH 2P93A 3F68H 5DSFA 4X1QU 1K1MA 3SUEA 1RRKA 5JYIA 1LHFH 1YBWA 1YCPK 3RMMH 1M9UA 2SGPE 1NBME 3N7DA 2A32A 5FX5A 3PROA 1O2IA 1O31A 1OWDA 2A5IA 1SSXA 4KTUA 2SGEE 2XOKD 1XVMA 1QRZA 1JRTA 2ZHWH 1L1GA 2W26A 3U98H 4UFEH 3SGBE 1A0HB 1MTNC 3UR6A 2BY7X 2JIZD 4A1VA 3F9GA 1K1NA 2A45B 3UNRA 5EJ1A 1A2CH 3RUOA 1EAXA 4K5ZA 3RXKA 1HAZB 3KQDA 4D8NA 1GJCB 1OYTH 2G55A 2QXGA 3GDSA 3RMNH 1V3XA 4M7GA 1WUNH 2JJ2D 4O9VA 5A0CA 1GHAG 2BMGB 3TPIZ 1UVSH 1C1TA 3BTFE 3F9EA 4CR9A 4MNWA 3PYHA 3P17H 2B0FA 1MQ5A 1CBWC 1XUKA 3NZIA 4JYTA 2FI5E 1V2RT 1T31A 5HKKD 1NRSH 1LHEH 1FMGA 2ZFSA 3ZVCA 1DSUA 1DY8A 1O5FH 2ZDVH 4NIXA 1GJ7B 3T62A 4DT4A 5DP9A 4I33A 2Z94A 1ZJKA 1P2OA 4X1PU 1LKAA 2SNWA 3LH1A 4A92A 4NCYA 4YOIA 1GJ8B 4IMZA 1CO7E 4AFZA 1S6LA 1YPHE 2GZ8A 2ZGHA 2IPQX 5F8TA 1GI4A 2VGCC 1O35A 3FAOA 5LPEA 1QTFA 3GCNA 2ZKSA 3MO6A 4OS7A 3EAJA 5CHBA 1AGJA 1BTWA 4I8KA 3I77A 1H8ED 1J15A 2VIDA 3A7XA 2HPQH 1TBRH 3E3TA 3TVJB 3SNBA 1DXPA 3QN7A 4MNXA 3NXPA 4GAWA 3RXUA 1AE8H 3BTTE 1KMHB 4X6MA 1PYTD 5CHAC 2IJD1 1F7ZA 3ZZ6A 2FMJA 2GCTC 3VB3A 5L30H 1O3CA 2QCYA 2AMQA 2BD8A 4BOHA 1NTPA 2J2UA 2Z9JA 3LGWA 3SQEE 4RI0A 1TWXB 3SHAH 3T26A 1UK2A 1Q31A 2A5AA 1BITA 2BY9X 3QTOH 5AF9H 4ZAEA 1O39A 3AW1A 2XW9A 1W12U 5JPMH 1BUIA 2Y5FA 1CBWB 1ARCA 3E91A 1K28D 3PO1B 1TQ0B 1F92A 2V3HH 1XXDA 1ELVA 1EOJA 1FY1A 1SGDE 3F1SB 3A8DA 2YNAA 3UQVA 1W2KH 1V2ST 1WXRA 3OEHD 3M5MA 2YMSD 3A7YA 2QIQA 2QA9E 2TIOA 3VPKA 3ODFA 7LPRA 1MQ6A 2C3SA 1QBNA 4X8VH 1N1LA 3M5OA 4O3TA 3ATIA 2G00A 1UTOA 2Y5GA 1UCYE 3TJOA 5KECA 1EB2A 4Y0ZE 5C5NA 2Y81A 3V3MA 3F2FA 1BTPA 2V0BA 1FNIA 4Q63A 4AGKA 3LT3A 5E0HA 1G36A 5GDSH 1K0HA 2GKVE
chains in the Genus database with same CATH topology
2BY6X 4ABEA 2A5KA 1LVMA 1O2LA 4JZFH 4JZDH 5DGJA 4IW4E 3GYMA 3SW2B 1HRTH 3VGCC 5DK1A 1OXGA 1QRWA 4RSPA 2BD9A 1P05A 1KSNA 1O3KA 4UEHH 3TH3H 2ZZUH 3HKIB 3EA7A 2BOHB 4WY3A 3OX7U 2VIOA 3MU0A 3GY5A 1UTQA 2ZC9H 5EW1H 3BG4C 1RFNA 3UR9A 1Y3VA 1C5OH 2XBYA 2P3TB 1QURH 1DWDH 1UJ1A 3QZQA 2OC7A 3I29A 1O37A 1W0YH 4Q80A 2H5CA 4O3UA 3EE0B 3GY6A 2XWAA 1C9PA 1C2DA 3M5NA 1BTZA 2HVXA 3BSQA 1CA8B 2PKAB 3FZDA 1GBLA 5E0JA 1UK4A 1TA6A 5EGMA 4DW2U 3K6ZA 5DP5A 2EEKA 3GDUA 3FFGA 3S9CA 3UQOA 4D7FA 1KDQA 1AZ8A 5LPRA 2HNTC 3PTBA 2OLGA 1C2FA 3LPRA 2EI7A 1TLDA 1A0JA 3RXQA 5B6OA 1SGIB 3QDZB 1O3PB 2JETB 5C1UA 3VGCB 1KDQB 4Q7YA 1TGSZ 1EPTA 1C1UH 1WOFA 3IWMA 1NC6A 1FY4A 4CRDA 1GBEA 2F9PA 1OWJA 3SO3A 4WMEA 3GISB 2FX4A 1NU7B 3PTNA 3T2NA 1AFQB 1XKBC 1HAVB 1UCYH 2V6NA 3E16B 5L6NH 1AIXH 1NRPH 3DA9B 3M7TA 3DUXH 3M5LA 1CGJE 1ZJDA 4JZ1A 1GHAF 4RN6A 2O9QA 3ZZ3A 5JBTA 2FOAA 1F0RA 1GBIA 4ZUHA 1BMLA 3A83A 2P95A 1F5KU 2PR3A 3RXSA 1O5GH 1DT2A 1H1BA 3BTQE 1V2OT 1QL7A 3RXJA 1A5GH 5TJXA 1O30A 1BRUP 1NFUA 1TB6H 2VWNA 2PHBA 1G3EA 2O8TA 4FUFA 1LQEA 1VJ9U 1TMUH 3LJOA 3SN8A 4AOQA 1GI1A 1VZQH 1DFPA 1G2MA 4FVBA 1F5RA 1WBGB 1EZQA 1O2XA 3T25A 3SQHE 4IS5A 5A8XA 1IAUA 1YYY1 4X2WA 1O32A 1GHVH 4Y6DA 1GHZA 2UWLA 1OP0A 1QL8A 1SGTA 1SLXB 1HAXB 3LONA 3PM3A 2F3CE 3RXPA 3TH4H 1P02A 1RIWB 1BOQA 1EP6A 3K9XB 1EAIA 3A86A 2AMPA 3A7ZA 2ZA5A 4CRFA 2A31A 2UUFB 2KAIA 2GV6A 5EPYA 5IYTA 1P3CA 2PV9B 3QWCH 3UNQA 1O34A 1LHDH 4INLA 6ESTA 1O2VA 1C5YB 1A0LA 2PGQB 1B0EA 1D6WA 3D23A 1PYTC 2O8LA 1TQ7B 2BD5A 5JBBS 3ATMA 1NPMA 2FTMA 2HNTE 2NU1E 1LVBA 2BXUH 1AMHA 1RGQA 3PLKA 3EQ0H 1HIAA 3LGYA 4K8YA 1INCA 2HWLB 4B2AA 3E8LA 3BEFB 1ABIH 1EATA 2G52A 3B23B 1O3HA 4BTIB 3PV4A 1O2NA 2Q6GA 1S5SA 4B71A 4O03A 1TFXA 1P0SH 2ILNA 4AB8A 4AZ2B 2ODYB 4TPYA 1UK3A 4ABJA 3ZZ5A 4AB9A 2GTBA 1P9SA 5HMAA 1O2JA 1ZRBA 2VWMA 3C27B 2WPMS 4TWWA 1A61H 5DP6A 2QYIA 1KTTB 2F9VA 2ZHQH 4KTSA 1CHGA 3NKKA 1D3PB 2CHAC 1KIGH 1NESE 3M3SA 3QX5H 1ANEA 1Y3XA 2VVVA 5CE1A 4A6LA 1YPGH 5T6GA 2Z3EA 1G30B 1SGEE 9LPRA 1UTJA 3DD2H 4ZH8A 1LO6A 3A7VA 5GIBA 4F49A 5C2ZA 1AFEH 3HK3B 5DPAA 4DCDA 1YPEH 5ESTE 1BTYA 1SB1H 3SNAA 3MNCA 1FZZA 2NWNA 1H9HE 4UFDH 1V2KT 4LOYH 3O8DA 4OGXA 1FDPA 1GDNA 1ACBE 1N6YA 1G37A 3GDVA 1HAYB 3SJIA 4YOJA 4A7IB 1K9OE 3L6PA 4GCHF 1TMBH 3ZV8A 1VITF 4GVUA 1ZLRA 2ZFQH 3ZVBA 4WF8A 3MH6A 2G51A 1C2JA 3V7TA 1C4Y2 2BQ6B 1TNJA 4LK4A 3STJA 3SGAE 2VIWA 4MNVA 1ZPZA 1TPAE 3R3GB 1ANDA 1S83A 2AIPA 3TK9A 3RMOH 1WYKA 2VB0A 5C67A 3MOCA 1P2NA 2JH5D 2ZECA 1YKTA 1GBBA 2ODQA 2UWOA 5F8ZA 3KF2A 2CMYA 1B7XB 2BY5X 3DFLA 1KTSB 1QNJA 3GY2A 4AORA 2YNBA 1DANH 1FIZA 4Y0YE 5LH8A 3DHKH 5FPTA 5T6DA 1P8VC 2OP9A 3RXEA 2BY8X 1P09A 1VGCC 5A2MH 2SNVA 1MD8A 1UTLM 2QXJA 1Y5BT 4K1EA 1GBJA 2XYAA 1BBRE 1ETRH 5ESBA 1EJNA 1ZMJA 4DG4A 1OWIA 2V3OH 6GCHG 3A80A 2ZCKP 2FX6A 1C1MA 1P2MA 2G4TA 1EUFA 2FPZA 3RC6A 1VCPA 1WQVH 2ZTZA 1GBFA 1QB9A 1HYLA 1LTOA 1O38A 2M5TA 1PPZA 3E6PH 1O3JA 3HPTB 1ESTA 2OD3B 1RTLA 1JMOH 1SLUB 4X2YA 2BD3A 2P8OB 5BPEA 4ABGA 4Y7BA 2ZHDA 1O2QA 8LPRA 1O5BB 3TGJE 1SGRE 1Y5UT 5FCKA 1SLWB 2ULLA 1BB0B 2ZGCA 2BX3A 1U6QA 1TX8A 3GOVB 2ASUB 2ZHEH 4OS4A 1GI0A 2C8YB 1ELFA 3SU3A 1IQGA 3H5CB 3URDA 2F91A 1HXFH 1L0ZA 2EA3A 1GJ9B 1HXEH 1H8DH 1MBMA 4FXGH 4JK5A 5C1XA 2WPHS 5JDUB 3D49H 1TNGA 1YPLH 4HZHA 4I31A 2R9PA 1CSOE 5F03A 2A2QH 2IPHA 4X1SU 4BXWA 6CHAB 2QXIA 3FZZA 2BXTH 1QIXB 1EP5A 3KQCA 2FODA 1CGIE 3KQEA 1Z71A 1NU9A 4X8TH 4KTCA 1S6HA 4WH8A 1WTGH 3KNXA 4J1YA 4KKDA 3UOPA 4UE7H 1GBKA 1HAOH 1PPEE 2AEIH 1AY6H 5E0GA 3VB4A 1O2KA 4A1TA 1FPHH 1V2NT 1ZTJA 1SBWA 3U8TH 1K1OA 2VVUA 1SQTA 5DP4A 1LPKB 1DY9A 3SU1A 1THPB 4NIYA 1LVYA 5E2OA 2FESH 4IBLH 3LGTA 3RC5A 4BAKB 1C2HA 3SV7A 2Z7FE 5EPNA 1DICA 1FXYA 2D8WA 4MTBA 3RC4A 8GCHF 1EAWA 4DIHH 1DLEA 1KXAA 1GG6B 3DFJA 1UO6A 2G81E 3QK1A 2BVSH 3S9AA 1C2GA 7KMEH 4A5TS 1P11E 3A82A 1LMWB 4UFFH 5T6FA 1MAYA 1S0RA 1Z8JB 2OTVA 1V6DA 4OGYA 1WQSA 1SOTA 2ZU2A 4B1TA 3STIA 4CRAA 2EI8A 1RTKA 4ZMAH 1Y3WA 2FOBA 3BTGE 4JYUH 1FJSA 2OBOA 5FBEA 2R3YA 3QGNB 1LKBA 5EQRA 3ATWA 4CRGA 2BDAA 4PROA 4SGAE 2ZPRA 1UCYK 2QV1A 1EKBB 3U1IB 3U1JB 1Y59T 1KLIH 1O3MA 2BLQA 1LHCH 4FU7A 3MHWU 1H8IH 2ZDLA 4FUHA 3S9BA 4ZKOU 5JBAS 1EX3A 1GCTC 3O8BA 5HXFA 2W3IA 3K65B 1TAWA 2VJ1A 1RJXB 3SV9A 3MTYA 1P12E 4YO9A 4WXIA 5JBCS 2G5VA 4X8SH 3M3VA 2PW8H 3ZZ8A 3KL6A 1AN1E 1ZSJA 3MMGA 2VH6A 1WCZA 4CBNA 1C2IA 2BX4A 1C1SA 4NA7A 4IMQA 3HATH 1DWEH 3BG8A 3PB1E 1AHTH 1D9IA 4XFQA 1DM4B 3ELAH 3VFEA 1WU1A 2ALVA 2F83A 2AGIX 2FWWA 3M37A 3NWUA 2IOTA 1JIRA 4XBDA 3RU4D 2PSYA 3W95A 4E7RG 1V2WT 3PWBA 4ESTE 1K1JA 4B74A 1MTNB 3BTWE 1F2SE 1EB1H 1KYNA 1DWBH 2BOKA 1FPCH 1V2MT 1P03A 1YGCH 2HOBA 4NGAH 3ODDA 2YOLA 3SV6A 3M36A 1HV7A 4Z0KA 3ZYDA 3P8GA 2ZTYA 2BHGA 2R0LA 2VNTA 1G3BA 1PPFE 2LPRA 1BJUA 1GBMA 1L4DA 1TGCA 3QLPH 3CP7A 3LC3A 1AWFH 1HLTH 4KELA 1BCUH 4B2BA 5HYOA 3B8JA 1GCTB 1YPJH 2ZFTA 1MU8B 1ELTA 4ZXYH 1XUFA 2R2WU 2AH4X 4HTCH 2XCNA 5DP7A 1SI5H 1ZGIA 4E05H 2PKSC 4K1SA 3M7QA 2ANWA 1YM0A 2RDLA 3MI4A 1OKXA 1SVPA 1TBQH 2Y7ZA 1KXDA 6GCHF 3A8BA 2XNIA 2VGCB 3TGKE 1A4WH 1S0QA 1W7GH 3PMBB 5GXPA 1QBVH 3RMLH 1QJ6B 5AFYH 2UUKB 1G3CA 3VB7A 2ZEBA 2XBVA 3SU5A 4GLYA 4D76A 1EQ9A 1A1RA 4WMDA 3SZNA 2BVXH 1DX5M 4HGCA 4GUXA 1G3DA 2RA0A 4B2CA 4OS6A 3AAVA 3LOXA 3ZVGA 4XDEA 3A7WA 5CHAB 1GJ4H 2GCTB 4ZHLU 2ZHFH 1DITH 1BTHH 1TOMH 4JZEH 2GDDA 3GY3A 1Z1JA 1FI8A 1GI2A 5GCHG 3TJNA 4NWLA 4GCHG 4NSYA 1BTUA 3ZVDA 1VITG 4K8BA 5F6MA 3SU2A 1QA0A 1S85A 2BYAX 1FV9A 2A4GA 2O8UA 1EJAA 1FN8A 4H6SB 2Y80A 2BDHA 1UVTH 4CH8B 2PKAA 1T8NA 4KGAA 4ISNA 1O2OA 2I6SA 4X6OA 2G4UA 2AS9A 3DT0H 5EXLA 1IQKA 3RXFA 2PKSB 2CGAA 1AVWA 1P2JA 3BTEE 3SNEA 1XVOA 4THNH 1QFKH 1D3DB 2ZWLH 4B73A 1TABE 1H9IE 1O2HA 3SNDA 1FY3A 1O5AB 1UHBB 1ESAA 3E0NB 4X0WU 1ZTLA 1C1RA 1FONA 1P2KA 3FP6E 1QJ7B 3ZZBA 1SL3A 4NIVA 2BD4A 1MTWA 3FVFB 1PPCE 1A3BH 1DXWA 3MH7A 1F0UA 1DUEA 1HAVA 4LZ1H 3JZ2B 4ZKRU 2FTLE 3M61U 1WV7H 2HLCA 1HUTH 2ZU5A 4SGBE 3ZVFA 1UTPA 3PMJA 1TNIA 4UDWH 1AVGH 1V2QT 3NUMA 2GDEH 1LPZB 4GHQA 5HM9A 5AFZH 2FOMB 5ETXA 5H4IB 1OP8A 1ABJH 1ARBA 3C1KA 3BG4B 4Y76A 2ZCHP 2ZIQH 1K1LA 2FIRH 3TNTA 4ABIA 1C4U2 2IN2A 2OBQA 4CBOA 5SGAE 4U32A 2UUYA 4IC6A 3BTHE 3LJJA 2J94A 1AVXA 2PWXA 2FOHA 1O5DH 3EDXB 4FU8A 1A5HA 2B5TB 2AIQA 1O5EH 3BV9B 5FXLA 4GPGA 4Q7ZA 3RXIA 4UONA 4MPXA 4FUEA 3UWJH 5EG4A 1Y3UA 1GBDA 4NA9H 2R0KA 3EGKH 4BNRA 1GI7B 1SPJA 1C9TA 1XXFA 2TGTA 3G01A 1QR3E 3ENSB 1E38B 2WINI 3GYLB 2VWOA 2OC1A 2XCFA 4BAMB 1CHOG 1GDQA 5K0HA 3UUZA 1QL9A 1L1JA 3QTVH 3ZZ9A 3SV8A 3UWIA 2BQWB 3HKJB 4CR5A 1ZOMA 2W7UA 1C5TA 2HGTH 2Q6FA 3FANA 2FOEA 1W0ZU 2H5DA 3A87A 1KXEA 1T4VH 3LGVA 1O2RA 5J4SA 1T4UH 4JMYA 8GCHG 3R0FA 5BRRE 1GJDB 1TALA 3VB6A 1GJBB 3SNCA 3BTDE 2FYQA 1O2GH 4KP0A 2AYWA 1VJAU 4NFEA 1O33A 2RCEA 3SHCH 1B0FA 1A46H 3Q76A 1C2MA 1TONA 1BRBE 4E06H 4JCNA 2FOCA 3ITIA 2BD2A 4AN7A 4CH2B 1P04A 2ZPSA 3P8NA 1EZXC 1CGHA 2QC2A 4GHTA 4ZHMU 2R2MB 3UOUA 2C4FH 4Y79A 2P94A 4TPIZ 3GCTG 4MNYA 1IQNA 1FAXA 1OOKB 1TX6A 4NWKA 1W8BH 1GJ6A 1TPOA 1ZHRA 1NFYA 1ZMNA 2VWLA 2W3KA 4Z6AH 1OYQA 1RD3B 2CXVA 1P2IA 3SUGA 4BANB 2Q6DA 4Y11E 1AU8A 1P57B 1N8OC 3ZZDA 2OUAA 3GCHC 1KLJH 1J8AA 2J95A 1AE5A 3F9HA 1THSH 2Z9GA 1MBQA 1Q2WA 2OQUA 1TMTH 2ZF0H 3URCA 4MPUA 1S84A 1GVKB 1ELBA 5FBIA 4CRBA 1MAXA 1TGNA 2FI3E 1OS8A 3RXTA 5HM2A 1LHGH 1QRXA 1QQUA 3D65E 1PPGE 3A89A 1IHSH 2ANKH 3PMHB 2J92A 5A8YA 2GVFA 1NROH 4AFUA 1OWKA 4ZXXH 1HJ8A 2F9NA 1CA0C 1ELCA 1VITH 2A4RA 3TH2H 4DOQA 2BVRH 1Z1IA 2GX4A 3MNXA 5GCHF 3A88A 3LIWA 2F9OA 1ETSH 2WPLS 1EXFA 1JRSA 1QQ4A 2ZDMA 1V2VT 2Y7XA 4Y71A 4AFSA 1SHYA 3OY5U 5C5OA 1K1IA 5IDKA 1LCYA 4YT6H 1TIOA 2ZDAH 1BA8B 4BTTB 4AYVB 1C5LH 2F9UA 2FLBH 3RXRA 2G8TA 2VIVA 1AO5A 2O8WA 1L2EA 1O2PA 1UTKA 3TJUA 1TPSA 4MVNA 1Q3XA 1T8MA 3MFJA 2H9HA 1O3GA 1XUJA 2QF0A 3IG6B 2CHAB 4NIWA 1EOLA 2DUCA 1YLDA 3LGUA 2ZDKA 2FO9A 1BTXA 2Q1JA 1J9CH 4U01A 3ZVAA 3I78A 5EOKA 1QA7A 5E8EH 1ORFA 4UD9H 1GVZA 2BDGA 4Y8YA 3SUFA 3PWCA 4MLFB 2VVCA 1XX9A 4ISLA 2ZNKH 2HNTF 3GY8A 2CV3A 4Q2KA 1SGQE 4TWYA 1GI8B 2WYJA 3UFAA 2NU3E