2PTCE

The geometry of the reactive site and of the peptide groups in trypsin, trypsinogen and its complexes with inhibitors
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title The Geometry of the Reactive Site and of the Peptide Groups in Trypsin, Trypsinogen and its Complexes with Inhibitors
pubmed rcsb
source organism Bos taurus
molecule tags Complex (proteinase/inhibitor)
total genus 52
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1982-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2ptcE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2ptcE02
1YYY1 1XUIA 3TJNA 1QB1A 4RN6A 3E3TA 3M37A 3OYPA 2Y5GA 3PMBB 4CHAC 4RSPA 1SHYA 3F6UH 2XTTB 4NFEA 1BA8B 5GXPA 2ZU3A 2A1DB 3K6YA 2VIVA 3UUZA 1ZHPA 2ZC9H 3BTHE 1YGCH 7ESTE 2EI6A 1F0TA 1WQVH 1C4Y2 3PLBA 1AVXA 1F5LA 1KXDA 1PQAA 1O35A 2FI5E 1GBJA 1CA0B 1VZQH 1ELBA 3PM3A 3RDZA 4AGKA 1TMBH 1SOTA 2WUCA 3RXLA 4YLQH 1C5SA 1G9IE 4U30A 1BBRH 3EGKH 1H1BA 1ZJKA 1IQEA 2BD2A 1GBIA 2UWLA 2V3HH 1C2EA 1VJ9U 2BY7X 2VINA 3ZZ5A 2C93B 3NZIA 1V2JT 1P8VC 5I25A 2OC1A 1O30A 1PPEE 3KCGH 2A7CA 1P0SH 1O2QA 1H4WA 1ZSKA 1B7XB 1YLCA 2A45B 3F9GA 4Q7YA 1S6HA 1C5OH 1FY4A 1Y59T 2SGFE 8GCHF 2FESH 4CBNA 3L3TA 4K60A 1SLUB 1TX6A 4E05H 2NU3E 2FOEA 4WMFA 3ZVCA 3M5OA 1T4UH 1ZHMA 2VU8E 2G55A 1LHFH 1WOFA 1GBCA 2STAE 1VCQA 3PMHB 1MKXH 3OY6U 2ZGXH 3C27B 3Q77A 3S0NA 1BTZA 4B74A 2XBVA 1UMAH 2Y82A 2XRCA 3ZZDA 1CT0E 2I6QA 3LJJA 3M7UA 4K8YA 1GMCG 2ZQ2A 2EC9H 1E38B 2G8TA 1GBAA 1TNGA 1AFQC 1MH0A 2OD3B 4IBLH 3SGBE 1ESTA 1UK3A 1NRRH 1W7GH 1DWDH 5IDKA 3LJOA 2ULLA 3QTVH 1H9LB 3GY5A 2BM2A 1EJNA 3UOPA 1GCTC 1THSH 2C8ZB 4FXGH 1TABE 1UCYK 2JH6D 2Y7XA 3RXPA 1SGIB 3T62A 1MQ5A 1O2XA 2F83A 4WWYA 3SV8A 1H8IH 3LC5A 4F4OC 1RIWC 1HGTH 1ESBA 1TIOA 2Z6BD 1C4U2 1ZJDA 1OXGA 1L4ZA 4ISLA 4J1YA 1C2KA 6GCHG 4LXBH 2F3CE 1T4VH 4YESB 1ELCA 1HNEE 1MCTA 2PKSC 1RRKA 1DWCH 2BDAA 2F9VA 2TBSA 4Y0ZE 4A1TA 4X2YA 1QL9A 3B8JA 3RM2H 1EOLA 1DS2E 1O2HA 2XW9A 2H2ZA 1SBWA 3E8LA 1GMHF 6CHAC 2GZ9A 2HLCA 1TGSZ 2FP7B 1QA0A 3QWCH 4ZHMU 1PJPA 5EU8A 1RJXB 3S9BA 5FBEA 1TRMA 2YNAA 3SNBA 4LOYH 1BHXB 3KGPA 1GBFA 5E8EH 1C2LA 1G3EA 4Y0YE 1S84A 3QO6A 5CHAB 3OSYA 3VB7A 2ZGBH 4KGAA 1LQDB 2WYJA 2VIQA 2XBYA 3GY4A 3HK6B 2ZTXA 4TWYA 1Z1IA 1TAWA 3GOVB 1VITG 3BTEE 3KQCA 1FY1A 3PROA 3MO3A 2ZDKA 4E7NA 4FUCA 3PMAB 1A0HB 4NGAH 1NFUA 4U01A 3TIUA 1NO9H 1ZPBA 2H9HA 4UFDH 1HYLA 1AUJA 1D6WA 3AASA 5HMAA 8LPRA 1X7AC 2BDHA 3PV4A 2OBQA 2G5VA 4Y8XA 2SGDE 1LKAA 4AG2A 1GJBB 3RMNH 2QF3A 4YM9A 2QY0B 2RA3A 3UIRA 5T6FA 1ELVA 1SGFA 4B71A 1WV7H 3ESTA 4ISIH 5EPYA 1L1NA 4YT6H 1EJAA 3SNAA 5JB9S 1SGNE 3I29A 1PPGE 1O0DH 3GDUA 5JBTA 1A61H 1A1RA 3FANA 3RXTA 5LPRA 3LH3A 1ARBA 3K2UA 1BT7A 3SV7A 1GHXH 1AWHB 2D26C 1KXEA 4X6OA 4U2WA 1W7XH 1AWFH 3F9HA 4ZUHA 3SHAH 4CRDA 5J4SA 1SLVB 1O2UA 1IQNA 2OTVA 3CENA 1IHSH 3KEEA 3SW2B 1ZTKA 1GJ9B 9LPRA 3ZZAA 3PO1C 1SFIA 5IYTA 2C8XB 5H4IB 1KLIH 3S7HB 2RDLA 3QGJA 1BB0B 1XUGA 1QRWA 1XKBC 1EP6A 2ZI2H 4FUEA 3TK5A 3MI4A 3Q3KA 2PGQB 1K1OA 5EQQA 5F8XA 4LK4A 1HCGA 1UHBA 2NU4E 2Z9KA 4VGCB 1O2ZA 1GHWH 2OQ5A 3MU1A 5JDUB 3O8BA 3KNXA 1UCYE 2TPIZ 1C5RA 3IWMA 4I8KA 4NSYA 2QA9E 1SGDE 5GCHF 1O31A 2ZGJA 2FX4A 1TYNA 1OWHA 1D3PB 1KTTB 5T6GA 1WCZA 3GCNA 3A87A 4K1TA 3MU0A 1SGTA 5HM2A 3ZZ7A 1OWDA 1C1UH 1JRTA 1D6RA 2PGBB 1Q2WA 3ZVBA 3SU5A 2FMJA 1GGDC 2R3UA 3AW1A 1D4PB 1C1MA 4SGBE 2OP9A 2STBE 2W3IA 5A0CA 2ZTYA 4J2YB 4K2YA 4ABGA 4AG1A 3U69H 4AN7A 1HJ8A 3VB4A 5DGJA 2Q1JA 1IQIA 5T3HA 2BY6X 1UTQA 1C1QA 1GBMA 5DP9A 5C1YA 1AZZA 3P8OA 2A4QA 3F1SB 1MCVA 4ZHLU 9ESTA 2PSYA 4YOJA 3RC6A 1WU1A 1F0SA 1OWEA 4X2WA 3A7TA 4WMEA 2G5NA 2FTLE 1AU8A 2FI3E 4YTAA 1GI5A 2OCVB 1KIGH 1UK2A 5EW1H 4F49A 4K3JA 1GJDB 4OS7A 4WF8A 1QB9A 3P8NA 1L4DA 2GCTB 3BN9A 2NU2E 1BTPA 1VJAU 3RXFA 5A8ZA 1O37A 1GL1A 1RTFB 5JBCS 1EJMA 2ODPA 1B0FA 1DX5M 2WPLS 2FOMB 4X1QU 5EXNA 3UOUA 3SJOA 1YCPK 1BITA 1ANDA 1GG6B 4O3TA 2Y80A 1O34A 4JYUH 4NZQA 5E0HA 2XC0A 1ZSJA 3CS7A 3RC5A 3QGNB 3VEQB 1TALA 3RXDA 3UWIA 4Y71A 4CRGA 4I32A 2A7JA 1S5SA 2Y7ZA 1OWKA 1NESE 3UQVA 1AVWA 2KAIA 2QF0A 1SGEE 2ZFPH 3TPIZ 1NFXA 2XC4A 1W8BH 3HK3B 1FY5A 1ORFA 2BDIA 4GVUA 1D3DB 1JXPA 4FUFA 1AQ7A 1Y5UT 3S69A 2A4RA 1MTSA 2SGPE 1CGJE 1J9CH 2ZA5A 1NRSH 2PWXA 2ZIQH 3BIUH 1YCPM 1TPPA 3T2NA 1G2LA 3H7OA 3A7WA 1PYTD 2ODQA 3UR6A 5JBAS 2VVUA 1GMCF 1BJUA 1YPGH 3K6ZA 3BV9B 3STIA 4FUGA 3SUDA 1HUTH 3TGIE 3UNSA 4CH8B 2A5AA 2BDCA 2HPPH 1V2LT 2ZEBA 1JBUH 1LVBA 1C5PA 1NU7B 3ATWA 5AFYH 4H6TA 3ZVFA 2ZWLH 4DT7B 1Y3YA 5L30H 3KQDA 3KHVA 1GHAG 2C8YB 1QB6A 1HAVA 2HRVA 1XXDA 2UUJB 5C3NA 2F9PA 3LH1A 1QBVH 5B6OA 5LGOA 1XUJA 3T28A 4ABBA 1VR1H 1MU8B 1GHYH 1BTHH 3RU4E 1ANEA 2GP9B 4K1SA 5DP7A 6GCHF 2AIQA 5CE1A 1QHRB 1HJAB 1O38A 2GMTC 1S82A 1Z1JA 3KF2A 1C9TA 5FCRA 4IMZA 5AF9H 3ODFA 1V2VT 1AIXH 1V3XA 1YC0A 2BLWA 4YO9A 3RXGA 1C2HA 2EI8A 3OY5U 1YLDA 4X6NA 1AGJA 2RA0A 5TCAA 5GWZA 3A80A 1C1VH 4XSKU 3RU4T 1FAXA 1KXCA 1LMWB 1GJ4H 2VGCB 2XWAA 4Y7BA 3T5FH 2BD9A 1PFXC 1C5WB 3NCLA 1FN6A 1QR3E 1K1PA 1S81A 1OWJA 2HGTH 1INCA 1C1PA 4YT7H 3RLYH 3SJIA 3TJVA 1SLXB 1L0ZA 1BMAA 1BQYA 3M5NA 4XE4A 1Z6JH 3KIDU 2B0FA 4A7IB 4AYYB 1Y3UA 3SJ9A 1K1IA 2GCHG 1VCPA 4D9QA 3Q3XA 4MPVA 1W0ZU 1A0LA 2J4IA 1NZQH 1VITF 2D1JA 3E0PB 1GBEA 4I8LA 3MFJA 2QC2A 1O2MA 1UTMA 2WPJS 1O2NA 1Z8JB 1LHGH 1AI8H 2VIWA 4JZEH 1P12E 1BOQA 1JIRA 4TPIZ 2THFB 2WINI 1JRSA 3OTJE 4NIVA 1Y8TA 2ODYB 1YPEH 1UVSH 3R3GB 2P59A 1MMJN 4DIHH 3BTWE 3MNCA 2JETB 1IQMA 1V2ST 3EA7A 4Y7AA 1QRXA 3QLPH 2BD5A 1BDAA 3BTTE 1C5XB 1BRAA 2Q6GA 3HPTB 3BF6H 3N7OA 2BD8A 4WJG2 1PQ7A 1CQQA 3RXOA 1K1JA 5FX5A 1HIAB 2ZDAH 3QZRA 2PV9B 2V3OH 3P8GA 3I77A 4INHA 1E36B 1C4V2 1UVOA 2BLVA 2VH0A 1C5VA 4JYTA 1TWXB 2BZAA 3O8DA 4OS2A 1Z6EA 1VGCB 2ZHQH 2XBWA 1UJ1A 3EAJA 3U8RH 2VVCA 1S85A 1N8OB 3T26A 1Y5BT 4MDSA 4FU8A 1O3MA 2VVVA 3Q3YA 2ZECA 1G37A 1YP9A 2BDBA 3BG4B 4D9RA 1AE8H 1WTHD 2FOBA 4ESTE 2Z9JA 1CT2E 2FEQH 1FNIA 3C1KA 1F5RA 4INLA 2A2XH 2C3SA 3LDXH 2VH6A 4WH6A 3ZZ6A 1FXYA 1W2KH 4TY7A 1V2MT 1SL3A 4NIYA 2J94A 2ZNKH 1BTWA 2ZTZA 4Y76A 1C2FA 1P10A 1HV7A 4DCDA 3Q76A 2FPZA 1OPHB 2PTNA 1GJCB 2Y5FA 3UWJH 2AMPA 4DJZB 3FAOA 4THNH 1NN6A 2FTMA 1F7ZA 3TJOA 3ZVAA 3ZZCA 2ANYA 5FAHA 2SGQE 1FMGA 4X8SH 2A7HA 1GI1A 2W7UA 1FJSA 3LU9B 1ZZZA 1CT4E 3RP2A 1SLWB 2FLBH 5A09A 1YPLH 2P94A 4K5ZA 1HLTH 1QQ4A 1BBRK 1G32B 4HGCA 1P3CA 3PLPA 4JZIA 4XFQA 4DY7B 4DURA 3VGCB 3HGNA 3P8FA 1DXWA 1BHXF 1FY3A 4FVBA 1GVKB 2VWLA 2QN5T 3VPKA 3LT3A 1EASA 4I8HA 1C5TA 3BTDE 3M61U 5LH8A 2ZU2A 3VB6A 1EB2A 1BRBE 1K1MA 4RKJB 2XWBI 4X0WU 1NRQH 1H8DH 4CHAB 1O32A 4IS5A 5JB8S 1SFQB 2ZU1A 3AVZA 3E6PH 3GY7A 3A84A 5AHGH 3M5LA 3NUMA 1O5GH 1HJ9A 1PPHE 4UFGH 2A5KA 1M9UA 3HKJB 4IW4E 1MKXK 4B2BA 2V35A 2JH5D 1KDQA 2SGEE 3TJUA 2A5IA 3A85A 1EZXC 2UUKB 2VWMA 1EB1H 3AAVA 2ILNA 3LONA 1C5MD 5C2ZA 2Q6DA 2R9PA 5FPYA 4OS6A 2H6MA 1V2RT 5F6MA 1AN1E 4BXWA 1SQOA 2VB0A 2BDYA 3EYDA 4I7YH 1IQJA 1TGBA 5CHAC 2R0LA 3VFEA 2PLXA 4D7GA 3GCHC 1QQUA 1L1JA 1SGYE 3CP7A 3TK9A 1ZTLA 4ZH8A 1WSSH 3LGUA 1SI5H 1KY9A 3U1JB 3GDSA 1DUEA 3ZVEA 2PUQH 2Z7FE 1TONA 4TY6A 1A0JA 1F2SE 1S6FA 4XBBA 4HI3A 1C2IA 1SGRE 1TNJA 3ATIA 3W95A 1ACBE 3S9CA 3TNSA 4CRAA 3RXUA 2GD4B 3SU0A 1GBBA 4LZ1H 1IQGA 1CO7E 4Z6AH 3GICB 2ALPA 4LZ4B 3DFJA 4BOHA 2ZFFH 1ZTJA 4ZHAA 2BD3A 2VNTA 4OS5A 1C1TA 3SHCH 1J14A 1W3CA 1JIMA 1O5CB 1AB9C 4YLUA 1HFDA 2XCNA 2HPQH 3B9FH 5FPTA 1BRCE 1OP0A 2ANMH 1AFQB 4ISOA 3FFGA 3TGKE 1ETSH 1RXPA 2BD4A 2Z9IA 4H6SB 5C1XA 1NC6A 3U8TH 2BZ6H 1GJ7B 1GHAF 4XOJA 4OS4A 2ESTE 1UVPA 2W3KA 4GHTA 2FS9A 1G3CA 2FYQA 2FOGA 2R0KA 3BTGE 4ZXXH 1OWIA 4FUJA 4XBDA 1Y3XA 1KTSB 1KXAA 1XVOA 1NROH 1DSUA 3D65E 2EI7A 4X2XA 4AX9H 1O2YA 1LO6A 1E0FD 1V2WT 2BX3A 4ISNA 1Y3WA 5K7RA 1C2MA 1GHBG 1L2EA 4UEHH 2Z94A 4YOIA 1JWTA 1RD3B 2PKSB 1K2I1 3QUMP 2XXLA 3A8AA 4KTSA 2BQWB 2BTCE 4AFZA 1DITH 4IN2A 2QV1A 1ZOMA 6CHAB 1W13U 1BBRE 1HAGE 2VWNA 1J17T 3A7ZA 2ZHFH 5PTPA 4VGCC 1T31A 3P6ZB 1TGTA 1UHBB 2ZDLA 1GBLA 1PPFE 2BY5X 3QTOH 2I6SA 4OGYA 3VXFH 1OS8A 4MVNA 3SI3H 1HAPH 3PTNA 4R8TB 2QXIA 2A4GA 3IG6B 1SMFE 1CGIE 3SNEA 1MQ6A 3U9AH 3RXMA 3T27A 2TIOA 1BMMH 1TQ7B 3U1IB 1IOEA 1FLEE 3VXEH 1NFYA 2ZGHA 1ZPZA 3UNQA 1NM6A 3QK1A 1IQLA 1E34B 2GCHF 3E16B 4Y8YA 3M7QA 1DT2A 1O2VA 2P8OC 1O2TA 5DG6A 1DVAH 2A0QB 3SI4H 4NA9H 3SGAE 1V2KT 2VIOA 2BMGB 1GI3A 1GJ6A 1CE5A 5SGAE 1C2JA 4B1TA 5F03A 4BTTB 1HAZB 3MH6A 4IN1A 1EAUA 2K1QA 2D8WA 3OX7U 4GLYA 5F8ZA 1IQKA 3RMOH 3MWIU 2BVSH 1TNLA 3ODDA 3BIVH 1O5FH 4WMDA 4JZDH 3UFAA 1O2WA 4X6MA 1YBWA 1PYTC 5DJ7A 2WPIS 2AFQB 1FIWA 2J92A 3PTBA 1GPZA 1HRTH 7GCHG 1GI7B 1EAIA 2P3TB 1RTKA 3SU4A 1TNIA 1LVOA 3A8CA 1W11U 5EW2H 2F9BH 1GG6C 1TLDA 2BDGA 1O33A 3GY3A 2PTCE 3K9XB 5BRRE 1TBZH 1ZMJA 1B0EA 3TK6A 2F9OA 3NK8A 2TGPZ 1FIZA 4Y8ZA 2G4UA 1O5BB 1UTLM 3PWCA 1OKXA 4NZLA 3D23A 3BEIB 4UFFH 4MNVA 3U8OH 2KAIB 5C5NA 5A8YA 1O2KA 4BAHB 4DW2U 3RXHA 2GGVB 2IJOB 5HGGA 2GTBA 1HAHH 4AOQA 1Y3VA 5E0JA 3RU4D 1O2OA 1CA8B 3LOXA 5ABWA 1QJ6B 1ZGIA 1L1GA 3EA9A 2CGAA 3AAUA 1YKTA 1QJ7B 3RXCA 2P93A 1KYNA 1WAYB 1FI8A 2W26A 2GDEH 2SNVA 4OS1A 4WXIA 5C5OA 4Z0KA 2WPKS 4AB9A 2AGIX 5EQRA 1BTXA 1O2JA 4A6LA 2GV6A 4IMQA 1AO5A 1QL8A 3GCTG 4R0IA 4AYVB 1NS3A 1LPZB 5ESBA 4Y10E 4DG4A 2XNIA 3ZV8A 1LHCH 2ZU4A 1DANH 1QURH 3E91A 1P02A 4KKDA 1FY8E 4X1PU 5DP5A 4WVPE 4O3UA 2HOBA 4XBCA 1D3TB 1MKWH 2BX4A 2XC5A 4AFUA 1W10U 3MH5A 1C1WH 1EKBB 1P9UA 2F9UA 2ZPQA 1HAVB 2PKAA 1EPTC 1N6YA 1P2OA 1UO6A 2VIPA 3SUEA 2BOHB 3ZZ4A 5C1UA 1FZZA 1WYKA 2RG3A 2NWNA 4HFPB 3RC4A 1UTNA 4NG9H 4DGJA 1MBQA 2YNBA 1XUFA 1HPGA 2Q6FA 1C1NA 3FP8E 2OC0A 2H9EH 4AFSA 2TGDA 4AZ2B 1TPSA 4BAKB 2HNTE 3DUXH 4MNYA 1GBHA 3A83A 3TITA 1LCYA 5FCKA 4CR5A 5HYOA 2OC7A 1V2UT 4B73A 1GBDA 1QTFA 3KQBA 1V2TT 1CHOG 1EXFA 1GVLA 1N1LA 4RKOB 1P2JA 4JK6A 1XVMA 1TE0A 1GDUA 3FP7E 3SU3A 1T7CA 3F9FA 3L33A 1YF4A 4ZROA 1D9IA 3A89A 2CF8H 1T8MA 2G81E 1CHGA 1O3AA 3RXBA 3UREA 2QXGA 4BTIB 3MO6A 1C5QA 1AKSA 4GUXA 4AB8A 5JBBS 1BMLA 1T32A 3UTUH 4D8NA 2IOTA 1MZDA 1AMHA 1GMDG 1K1LA 5I46H 2J34A 4NA7A 2J9NA 1UTOA 3MH7A 3W94A 3GYMA 2UWOA 1ZRBA 2OINA 1E35B 1O39A 3DD2H 4QT8C 1BMNH 1DLKB 1ELAA 1AE5A 4ASHA 1CBWB 1LPKB 5EPNA 1EATA 1QFKH 3LKWA 1O2RA 1A7SA 2ZFQH 4XDEA 1QGFA 1O2IA 1ABIH 1JMOH 2A32A 1DE7H 3P70B 2BQ6B 1OOKB 2FLRH 4HTCH 1KXBA 2G52A 4FUBA 4Q7XA 1PPCE 1Z7KA 3BTFE 1PPBH 1OYQA 4INKA 2FDAA 2Z9GA 1O3OA 1F0UA 3RMLH 3DT0H 2O8TA 3QX5H 5EOKA 1NPMA 1QJ1B 4GCHG 1SQAA 4CR9A 1LVMA 2Y6TA 4Y11E 4FU9A 3BTME 1Q31A 1BIOA 1DWEH 4M7GA 4A92A 2BVRH 2AMDA 1EPTA 1SGQE 1YM0A 2ZCLP 3GY8A 1THRH 2W7SA 4E06H 4JK5A 3E90B 1CU1A 3V7TA 2O8UA 1TOCB 3BG8A 1J15A 3WY8A 2BB4A 2Y5HA 5DO4H 2FZZA 1O5EH 1RFNA 2Y81A 1XXFA 3TH2H 1GJAB 3E1XB 4MNWA 1FV9A 1GHBF 2P16A 1NRNH 1TNHA 3A82A 1A4WH 2H5CA 2M5TA 4WH8A 1MZAA 4GPGA 1HDTH 4JYVH 1HXFH 1UTKA 1CA0C 2H1UA 3A7XA 1BRUP 3P17H 4AORA 5CMXH 3EDXB 4GHQA 1MTNB 2ZGCA 2AEIH 3SV2H 1TBRH 5TCCA 3HGPA 1TOMH 1V2NT 2ZF0H 1FN8A 5FPSA 4X1RU 3QN7A 1AFEH 1GHVH 2WUBA 1FPCH 4K1EA 1EP5A 1BUIA 1C2GA 1MTWA 2DE8A 3D49H 1O3PB 3VGCC 4ZXYH 3K65B 1MUEB 3RXVA 1CVWH 1G3BA 1C2DA 3T25A 1VCWA 2ANKH 3SBKA 4Y6DA 2FM2A 1UTJA 2G4TA 2HWLB 4NWLA 1NRPH 1SPJA 3URCA 4X8VH 4ABHA 2AH4X 1KLTA 2CHAB 1EZSC 2GT7A 4Y79A 4ABFA 5DP4A 3MOCA 5T6DA 2GV7A 3TLOA 3A86A 4B76A 3TGJE 3SJ8A 2ZU5A 2ZPRA 4CBOA 4KP0A 2OC8A 3BTQE 3CS0A 4MPXA 3E0NB 3Q00A 1ANBA 5A0AE 2BXTH 1VITH 1FPHH 2OBOA 4CRCA 4BXSA 1A46H 4ABEA 1TFXA 2HVXA 1T8OA 1G30B 3TVJB 1HIAA 1A5GH 1XUHA 1ETRH 2OQUA 2OUAA 4ZAEA 1P06A 2AS9A 1BTUA 1EZQA 1KDQB 1W12U 3GISB 5A8XA 1HB0B 1AY6H 2YOLA 3KQEA 7GCHF 5GJ4B 1ESAA 1GWAA 4X2VA 4TWWA 3ZZ3A 5L2YH 4BAMB 2V6NA 1LHDH 2C4FH 1QBOA 1EAXA 3EQ0H 1Q3XA 1YPJH 3FP6E 1O3IA 1XMNB 1LQEA 3MHWU 4I31A 5L2ZH 3MNSA 2J2UA 1O5DH 3SOSA 1HAXB 2FIRH 2ZFRH 3SO3A 3GDVA 3KL6A 2ZDNA 4Q7ZA 2ZHDA 4UDWH 1P05A 4JMYA 3SUFA 2NU1E 1IQHA 2WV4A 1NFWA 3OU0A 4BAQB 2F9NA 2SFAA 5E0GA 4GAWA 1GI2A 1RS0A 3QZQA 1UTPA 5EODA 4UD9H 3O8RA 3GCTF 3UY9A 1TQ0B 2G00A 1P57B 3ZV9A 4A5TS 2A4OA 1ELDE 1CSOE 1BTYA 1UCYH 3SN8A 3M3TA 4BTUB 4NWKA 3GCOA 4MLFB 2GT8A 1O2SA 2B9LA 1LDTT 1A3EH 2TGTA 3NWUA 3MU5A 1C5YB 4JZ1A 3MO9A 3PLKA 1TBQH 3MH4A 1N6XA 5ETXA 2FWWA 3P92A 6LPRA 1O3DA 2PUXB 2A2QH 2HNTF 3F68H 3LGTA 3GY6A 3PYHA 3MNBA 2PSXA 2IN2A 2OLGA 4A1XA 1TB6H 1NY22 4MG3A 5EG4A 5FHTA 4CH2B 3P95A 3V3MA 3ZZ8A 1UVTH 1YPHE 1LTOA 3STJA 3H5CB 3ZYDA 3ITIA 4IGDA 1SQTA 1ELEE 4TPYA 5G4BA 5GIBA 2O8WA 2ZCKP 3LPRA 3SGQE 1RGQA 1AD8H 2XBXA 1DUAA 1TGCA 5AFZH 1A5IA 1MU6B 1CHOF 2RCEA 3ATMA 5EXLA 1O3LA 3A7YA 1A2CH 3RUOA 2GVFA 2QXJA 4MPUA 1EZUC 1DLEA 1P9SA 2QXHA 1SHHB 5C20A 1GL0E 1TX7A 1GCTB 6ESTA 1TMTH 5DP6A 2HNTC 3BEUA 2DE9A 1MTUA 1GI0A 2V0BA 1F5KU 3ENSB 1XUKA 1G2MA 1XKAC 4ABJA 1EQ9A 3GCHB 1RIWB 1GMDF 2JH0D 3SNCA 1QIXB 2PW8H 3ZYEA 2JKHA 1DWBH 3MU8A 1T8LA 4U32A 2ANWA 1HAYB 1ID5H 3SQHE 1ZPCA 4I33A 3S7KB 2VIDA 3F9EA 4Q2KA 1U6QA 1TRNA 1SGPE 2H9TH 2QCYA 4NSVA 1DICA 1O3BA 2LNCA 2PFEA 3NKKA 3BEFB 1ANCA 2CV3A 2AIPA 3L6PA 5DK1A 3S9AA 2J38A 1EX3A 1QBNA 1S0QA 4MNXA 4X1SU 2BHGA 1LPGB 1OX1A 1OP8A 1ZLRA 1C5ZB 2AGEX 5C67A 1GI8B 2BQ7B 3VB3A 3SNDA 1O3NA 4I8JA 2FO9A 1AB9B 3SV6A 4ABIA 2ZO3H 5EGMA 4FUHA 1SG8B 2UWPA 1FAKH 1ZYOA 3M5MA 1YPMH 2GDDA 2WPHS 3EE0B 1ARCA 3SV9A 3RXSA 2CN0H 1ZR0A 3EA8A 3UPEA 1W0YH 3RXKA 3ELAH 2VWOA 1P04A 1O3JA 2QAAA 1AHTH 2XCFA 1J16A 2PHBA 2P3UB 3BTKE 4GCHF 4PROA 1AZ8A 4E7RG 1DXPA 3MMGA 5FBIA 1HBTH 1AVGH 1FUJA 1EOJA 2BY9X 1P01A 2UUFB 1F92A 4HZHA 1S0RA 2FX6A 3AW0A 4ABDA 4AFQA 4ZKOU 1J8AA 1O3KA 3G01A 5FXLA 3ZVDA 4BAOB 1ELGA 1O36A 1OYTH 3FZZA 1GI9B 3NPSA 2QYIA 4ABAA 3RXRA 1Y5AT 2Z3EA 1CGHA 1TA6A 1MD8A 3JZ1B 1AUTC 2Z3CA 3PB1E 3BSQA 3M3VA 4K8BA 1E37B 1GDQA 1TGNA 1SR5C 1ZRKA 3HKIB 2UUYA 1LKBA 2BLOA 1WUNH 1DSTA 4MPWA 1P03A 3O8CA 2GCTC 4FVDA 1EUFA 1O5AB 2EA3A 2QGRA 3PWBA 2GX4A 4UE7H 3R0FA 3LGVA 2R2MB 1MTVA 2C90B 1ZSLA 1SGFG 2CJIA 2DUCA 3SJKA 2A31A 3M36A 4UONA 2ZHEH 1P2MA 4X6PA 2C8WB 3UNRA 1TA2A 4K69A 1SGCA 5A0BA 1YPKH 3GY2A 3SU1A 1O3GA 1QCPA 2FYRA 1C5UA 2CXVA 1WQSA 1KLJH 3DFLA 8GCHG 4ISHH 2FOHA 5EXMA 4SGAE 2AYWA 1Z8IB 1GI6A 1GCDA 1RTLA 3PO1B 2F91A 5GPIB 2P8OB 1TNKA 1V2OT 2B5TB 3MTYA 2TGAA 5BPEA 3SQEE 3KN2A 3SU2A 1HAIH 1OP2A 1IHTH 1SOZA 1ZMLA 1ZMNA 2PKAB 1FQ3A 4B2CA 2O8LA 4D76A 3MYWA 2WPMS 3TNTA 4KTUA 2ZCHP 3RXIA 5DPAA 1P3EA 1QRZA 3M3SA 3RXQA 3TU7H 1Z8GA 1DM4B 1A5HA 2BD7A 5GDSH 4A1VA 3URDA 2P95A 1SC8U 2ZDVH 4X8UH 5DP3A 3RXEA 7LPRA 1MBMA 8KME2 4BNRA 1GJ8B 1YCPH 2FOCA 3MNXA 2QIQA 8ESTE 2WV5A 4ZKSU 1SSXA 1O3FA 1GJ5H 1TRYA 2EEKA 3RXAA 1F0RA 3ZZ9A 4IC6A 1QA7A 1SVPA 3UR9A 3A8BA 3A7VA 5FX6A 3RM0H 1ZGVA 1GBTA 3RLWH 2TRMA 3FVFB 1MAXA 1ELFA 2R2WU 1GGDB 2R3YA 2NU0E 5LPFA 3QDZB 2P3FH 2VJ1A 2BVXH 3PMJA 4O9VA 4GSOA 3SORA 1AKSB 1WTGH 2WYGA 4X8TH 1W14U 4FUDA 1MKWK 1O2PA 1P09A 2W5EA 1NT1A 1Z8RA 3D62A 5K0HA 1PPZA 1G36A 1HJAC 3DHKH 4CRFA 3I78A 3LGWA 3LC3A 1C1OA 2CF9H 2PR3A 2ALVA 2ZHWH 1C1SA 2OXSA 3FZDA 2G51A 2ZFTA 2BYAX 1O2LA 1CBWC 1TPOA 1OSSA 2ZFSA 4H4FA 5DP8A 2ZDMA 2GZ7A 1GMHG 1C5LH 1H9HE 1ELTA 3UQOA 1WBGB 1IQFA 1GDNA 1LVYA 1O3CA 2AERH 4JZFH 2VGCC 5J4QA 2O9QA 4CREA 2B7DH 1DPOA 3H7TA 1B5GH 4MTBA 4TYDA 1FONA 1HAOH 1GHZA 5JYIA 4AGJA 4UFEH 1GI4A 3M35A 5E2OA 5JPMH 2BOKA 1Z71A 4NCYA 2GKVE 4H42U 1DFPA 1TPAE 2D2DA 4FUIA 1PQ8A 2ZKSA 3MU4A 1A3BH 3V0XA 3RXJA 4ZKNU 2BXUH 2O8MA 2BLQA 2FI4E 4Q80A 1EAWA 4YZUA 3B23B 4KTCA 1ETTH 3V12A 4NFFA 5L6NH 1TMUH 4KELA 1EPTB 3IITA 3SZNA 1P2KA 1T8NA 3TH4H 1K28D 4CRBA 2Z3DA 1KXFA 4DIIH 1ABJH 4FU7A 2XYAA 1LHEH 3DA9B 1O3HA 4DVAU 4NA8A 2JETC 1BJVA 2FOAA 2AMQA 1GBKA 2ASUB 1V2PT 7KMEH 1O3EA 1C9PA 2ZG0H 1C5NH 1GVZA 1QNJA 2AGGX 3NXPA 1C1RA 3V13A 3LGIA 1THPB 1UK4A 4B75A 1SB1H 1TX8A 1MTNC 1QL7A 3TH3H 2B8OH 3ATLA 3T29A 2SGAA 1YPHC 4WXVA 1VGCC 2BY8X 2ZQ1A 2LPRA 3A81A 5TJXA 4NIWA 2J95A 1K21H 1HXEH 1N8OC 1NTPA 5DKMA 3VB5A 2ZPSA 4O97A 2FOFA 3ZVGA 5LPEA 3JZ2B 4O03A 2FS8A 2HALA 2IPHA 5HXFA 1G3DA 4I8GA 3LIWA 1DY9A 3BG4C 3SU6A 4X1NU 1P2NA 1K9OE 1BCUH 1K22H 4YOGA 5ESTE 5F8TA 3ATKA 3SUGA 2GMTB 1ZHRA 1K1NA 1UVUH 5EQSA 4ZKRU 2ZP0H 4BANB 1KSNA 2ZZUH 3A88A 2CHAC 3U98H 4B2AA 2GZ8A 2SNWA 1DDJA 1DOJA 3ZZBA 5E2PA 1JOUB 1NU9A 1D3QB 2FODA 2FXRA 3HATH 1V2QT 2Z9LA 1V6DA 4NIXA 1MAYA 3M7TA 1PQ5A 5AVDA 5HM9A 1P11E 1QY6A 4IC5A 5GCHG 1P2IA 2H5DA 4D7FA 1S83A 1XM1A 5A2MH 4DOQA 3GYLB 4JCNA 4ZMAH 1P2QA 1FDPA 1H9IE 4WY3A 3LGYA 1XX9A 4MQAA 1DY8A 4OGXA 1BZXE 1MD7A 3A8DA 3RMMH 1O2GH 1IAUA 2CMYA
chains in the Genus database with same CATH superfamily
1YYY1 1XUIA 3TJNA 1QB1A 4RN6A 3E3TA 3M37A 3OYPA 2Y5GA 3PMBB 4CHAC 4RSPA 1SHYA 3F6UH 2XTTB 4NFEA 1BA8B 5GXPA 2ZU3A 2A1DB 3K6YA 1YWUA 2VIVA 3UUZA 1ZHPA 2ZC9H 3BTHE 1YGCH 7ESTE 2EI6A 1F0TA 1WQVH 1C4Y2 3PLBA 1AVXA 1F5LA 1KXDA 1PQAA 1O35A 2FI5E 1GBJA 1CA0B 1VZQH 1ELBA 3PM3A 3RDZA 4AGKA 1TMBH 1SOTA 2WUCA 3RXLA 4YLQH 1C5SA 1G9IE 4U30A 1BBRH 5EJZA 3EGKH 1H1BA 1ZJKA 1IQEA 2BD2A 1GBIA 3PV2A 2UWLA 2V3HH 1C2EA 1VJ9U 2BY7X 2VINA 3ZZ5A 2C93B 3NZIA 1V2JT 1P8VC 5I25A 2OC1A 2YMSD 1O30A 1PPEE 3KCGH 2A7CA 1P0SH 1O2QA 3AK5A 1H4WA 1ZSKA 1B7XB 1YLCA 2A45B 3F9GA 4Q7YA 1S6HA 1C5OH 1FY4A 1Y59T 2SGFE 8GCHF 2FESH 4CBNA 3L3TA 4K60A 1SLUB 1TX6A 4E05H 2NU3E 2FOEA 4WMFA 3ZVCA 3M5OA 3UB0A 3WW7A 1T4UH 1ZHMA 2VU8E 2G55A 1LHFH 1WOFA 1GBCA 2STAE 2KCPA 1VCQA 3PMHB 1MKXH 3OY6U 2ZGXH 3C27B 3Q77A 3S0NA 1BTZA 4B74A 2XBVA 3CNRA 3NRLA 1UMAH 2Y82A 2XRCA 3ZZDA 1CT0E 2I6QA 3LJJA 3M7UA 4K8YA 1GMCG 2ZQ2A 2EC9H 1E38B 2G8TA 1GBAA 1TNGA 1AFQC 1MH0A 2OD3B 4IBLH 5FL7D 3SGBE 1ESTA 1UK3A 1NRRH 1W7GH 1DWDH 5IDKA 3LJOA 2ULLA 3QTVH 1H9LB 3GY5A 2BM2A 1W0JD 1EJNA 3UOPA 1GCTC 1THSH 2C8ZB 4FXGH 1TABE 1UCYK 2JH6D 2Y7XA 3RXPA 1SGIB 3T62A 1MQ5A 1O2XA 2F83A 4WWYA 3SV8A 1H8IH 3LC5A 4F4OC 1RIWC 1HGTH 1ESBA 1TIOA 2Z6BD 1C4U2 1ZJDA 1OXGA 1L4ZA 4ISLA 4J1YA 1C2KA 6GCHG 4LXBH 2F3CE 1T4VH 4YESB 1ELCA 1HNEE 3N7EA 1MCTA 2PKSC 1RRKA 1DWCH 2BDAA 2F9VA 2TBSA 4Y0ZE 5HIYA 4A1TA 4X2YA 1QL9A 3B8JA 3RM2H 1EOLA 1DS2E 1O2HA 2XW9A 2H2ZA 1SBWA 3E8LA 1GMHF 6CHAC 2GZ9A 2HLCA 1TGSZ 2FP7B 1QA0A 3QWCH 4ZHMU 1PJPA 5EU8A 1RJXB 3U28C 3S9BA 5FBEA 1TRMA 2YNAA 1E79D 3SNBA 3OEHD 4LOYH 1BHXB 3KGPA 1GBFA 5E8EH 1C2LA 1G3EA 4Y0YE 1S84A 3QO6A 5CHAB 3OSYA 3VB7A 2LELA 2ZGBH 4KGAA 1LQDB 2WYJA 5CHBA 2VIQA 2XBYA 3GY4A 3HK6B 2ZTXA 3PRDA 4TWYA 1Z1IA 1TAWA 3GOVB 1VITG 3BTEE 3KQCA 1FY1A 3PROA 3MO3A 2ZDKA 4E7NA 4FUCA 3PMAB 1A0HB 4NGAH 1NFUA 4U01A 3TIUA 1NO9H 1ZPBA 2H9HA 4UFDH 1HYLA 1AUJA 1D6WA 3AASA 5HMAA 8LPRA 1X7AC 2BDHA 3PV4A 2OBQA 2G5VA 4Y8XA 2SGDE 5EJ1A 1LKAA 4AG2A 5HKKD 1GJBB 3RMNH 2QF3A 4YM9A 2QY0B 2RA3A 3UIRA 5T6FA 1ELVA 1SGFA 4B71A 1SQRA 3SZEA 1WV7H 3ESTA 4ISIH 5EPYA 1L1NA 4YT6H 1EJAA 3SNAA 2J98B 5JB9S 1SGNE 3I29A 1PPGE 1O0DH 3GDUA 5JBTA 1A61H 1A1RA 3FANA 3RXTA 5LPRA 3LH3A 1ARBA 3K2UA 1BT7A 3SV7A 1GHXH 3SYJA 1AWHB 2D26C 1KXEA 4X6OA 4U2WA 1W7XH 1AWFH 1SKYE 3F9HA 4ZUHA 3SHAH 4CRDA 5J4SA 1SLVB 1O2UA 1IQNA 2OTVA 3CENA 1IHSH 2WZQA 3KEEA 3SW2B 1ZTKA 1GJ9B 9LPRA 3ZZAA 3PO1C 1SFIA 5IYTA 2C8XB 5H4IB 5EJLA 1KLIH 3S7HB 2RDLA 3QGJA 1BB0B 1XUGA 1QRWA 1XKBC 1EP6A 2ZI2H 4FUEA 3TK5A 3MI4A 3Q3KA 2PGQB 1K1OA 5EQQA 5F8XA 4LK4A 1HCGA 1YLNA 1UHBA 2NU4E 2Z9KA 4VGCB 1O2ZA 1GHWH 2OQ5A 3MU1A 5JDUB 3O8BA 3KNXA 1UCYE 2TPIZ 1C5RA 3IWMA 4I8KA 4NSYA 2QA9E 1SGDE 5GCHF 1O31A 2ZGJA 2FX4A 1TYNA 1OWHA 1D3PB 1KTTB 3DCLA 5T6GA 1WCZA 3GCNA 3A87A 4K1TA 3MU0A 1SGTA 5HM2A 3ZZ7A 1OWDA 1C1UH 1JRTA 3EE7A 1D6RA 2PGBB 1Q2WA 3ZVBA 3SU5A 2FMJA 1GGDC 2R3UA 3AW1A 1D4PB 1C1MA 4SGBE 2OP9A 2STBE 2W3IA 5A0CA 2K0QA 2ZTYA 4J2YB 4K2YA 4ABGA 4AG1A 3U69H 4AN7A 1HJ8A 4RT1A 3VB4A 5DGJA 2Q1JA 1IQIA 5T3HA 2BY6X 1UTQA 1C1QA 1GBMA 5DP9A 5C1YA 1AZZA 3P8OA 5KECA 2A4QA 3F1SB 1MCVA 4ZHLU 9ESTA 2PSYA 4YOJA 3RC6A 1WU1A 1F0SA 1OWEA 4X2WA 2JJ1D 3A7TA 4WMEA 2G5NA 2FTLE 1AU8A 2FI3E 4YTAA 1GI5A 2OCVB 1KIGH 1UK2A 1WXRA 5EW1H 4F49A 4K3JA 1GJDB 4OS7A 4WF8A 3H09A 1QB9A 3P8NA 3OTPA 1L4DA 2GCTB 4M9FA 3BN9A 4YXWD 2NU2E 2L6OA 1BTPA 1VJAU 3RXFA 5CDFE 5A8ZA 1O37A 1GL1A 1RTFB 5JBCS 2WPDD 1EJMA 2ODPA 1B0FA 1DX5M 2WPLS 2FOMB 4X1QU 5EXNA 3UOUA 3SJOA 1YCPK 1BITA 1ANDA 1GG6B 4O3TA 2Y80A 1O34A 4JYUH 4NZQA 5E0HA 2XC0A 1ZSJA 3CS7A 3RC5A 3QGNB 3VEQB 1TALA 3RXDA 3UWIA 4Y71A 4CRGA 4I32A 2A7JA 1S5SA 2Y7ZA 1OWKA 1NESE 3UQVA 1AVWA 2KAIA 2QF0A 1SGEE 2ZFPH 3TPIZ 1NFXA 2XC4A 1W8BH 3HK3B 1FY5A 3DSPA 1ORFA 3KQ5A 2BDIA 4GVUA 1D3DB 1JXPA 4FUFA 1AQ7A 1Y5UT 3S69A 2A4RA 3PV5A 1MTSA 2SGPE 1CGJE 1J9CH 2ZA5A 1NRSH 2PWXA 2ZIQH 1E1QD 3BIUH 1YCPM 1TPPA 3T2NA 1G2LA 3H7OA 3A7WA 1PYTD 2ODQA 3UR6A 5JBAS 2VVUA 1GMCF 1BJUA 1YPGH 3K6ZA 3BV9B 3STIA 4FUGA 3SUDA 1HUTH 3TGIE 3UNSA 4CH8B 2A5AA 2BDCA 2HPPH 1V2LT 2ZEBA 1JBUH 1LVBA 1C5PA 1NU7B 3ATWA 5AFYH 4H6TA 3ZVFA 2ZWLH 4DT7B 1Y3YA 5L30H 3KQDA 3KHVA 1GHAG 2C8YB 1QB6A 1HAVA 5F53A 2HRVA 1XXDA 2UUJB 5C3NA 2F9PA 3LH1A 1QBVH 5B6OA 5LGOA 1XUJA 5C17A 3T28A 4ABBA 1VR1H 1MU8B 1GHYH 1BTHH 3RU4E 1ANEA 2GP9B 4K1SA 5DP7A 6GCHF 2AIQA 5CE1A 1QHRB 1HJAB 1O38A 2GMTC 1S82A 1Z1JA 3KF2A 1C9TA 5FCRA 4IMZA 5AF9H 3ODFA 1V2VT 1AIXH 1V3XA 1YC0A 2BLWA 4YO9A 3RXGA 1C2HA 2EI8A 4DT4A 5KGOA 3OY5U 1YLDA 4X6NA 1AGJA 2RA0A 5TCAA 5GWZA 3A80A 1C1VH 4XSKU 3RU4T 1FAXA 1KXCA 1LMWB 1GJ4H 2VGCB 2XWAA 4Y7BA 3FO8D 3T5FH 2BD9A 1PFXC 1C5WB 3NCLA 1FN6A 1QR3E 1K1PA 1S81A 1OWJA 2HGTH 1INCA 1C1PA 4YT7H 3RLYH 3SJIA 3TJVA 1SLXB 1L0ZA 1BMAA 1BQYA 3M5NA 4XE4A 1Z6JH 2RDEA 3F0OA 3KIDU 2B0FA 4A7IB 4AYYB 1Y3UA 3SJ9A 1K1IA 2GCHG 1VCPA 2QE7D 4D9QA 3Q3XA 4MPVA 1W0ZU 1A0LA 2J4IA 1NZQH 1VITF 2D1JA 3E0PB 1GBEA 4I8LA 2IPQX 3MFJA 2QC2A 1O2MA 1UTMA 2WPJS 1O2NA 1Z8JB 1LHGH 1AI8H 2VIWA 4JZEH 2HLDD 1P12E 1BOQA 1JIRA 4TPIZ 2THFB 5GNDA 2WINI 1JRSA 3OTJE 4NIVA 1Y8TA 2ODYB 1YPEH 1UVSH 3R3GB 2P59A 1MMJN 4DIHH 3BTWE 3MNCA 2JETB 1IQMA 1V2ST 3EA7A 4Y7AA 1QRXA 3QLPH 2BD5A 1BDAA 3BTTE 1C5XB 1BRAA 2Q6GA 3HPTB 3BF6H 3N7OA 2BD8A 4WJG2 1PQ7A 1CQQA 4Q63A 3RXOA 1K1JA 2W6ID 5FX5A 1HIAB 2ZDAH 3QZRA 2PV9B 2V3OH 3P8GA 3I77A 4INHA 1E36B 1C4V2 1UVOA 2BLVA 2VH0A 1C5VA 4JYTA 2K8IA 1TWXB 2BZAA 3O8DA 4OS2A 1Z6EA 1VGCB 2ZHQH 2XBWA 1UJ1A 1W0KD 3EAJA 3U8RH 2VVCA 1S85A 1N8OB 4Q4LA 1Y5BT 3T26A 2AHME 4MDSA 4FU8A 1O3MA 2VVVA 3Q3YA 2ZECA 1G37A 1YP9A 2BDBA 3BG4B 4D9RA 1AE8H 1WTHD 2FOBA 4ESTE 2Z9JA 1CT2E 2FEQH 1FNIA 3C1KA 1F5RA 4INLA 2A2XH 2C3SA 3LDXH 2VH6A 4WH6A 3ZZ6A 1FXYA 1W2KH 4TY7A 1V2MT 1SL3A 4NIYA 2J94A 2ZNKH 1BTWA 2ZTZA 4Y76A 1C2FA 1P10A 1HV7A 2KZ4A 4DCDA 3Q76A 2FPZA 1OPHB 2PTNA 1GJCB 2Y5FA 3UWJH 2AMPA 4DJZB 3FAOA 4THNH 1NN6A 2FTMA 1F7ZA 3TJOA 3ZVAA 3ZZCA 2ANYA 5FAHA 2SGQE 1FMGA 4X8SH 2A7HA 1GI1A 2W7UA 1FJSA 3LU9B 1ZZZA 1CT4E 3RP2A 1SLWB 2FLBH 5A09A 1YPLH 2P94A 4K5ZA 1HLTH 1QQ4A 1BBRK 1G32B 4HGCA 1P3CA 3PLPA 4JZIA 4XFQA 4DY7B 4DURA 3VGCB 3HGNA 3P8FA 1DXWA 1BHXF 1FY3A 4FVBA 1GVKB 2VWLA 2QN5T 3VPKA 3LT3A 1EASA 4I8HA 1C5TA 3BTDE 3M61U 5LH8A 2ZU2A 3VB6A 1EB2A 2JJ2D 1BRBE 1K1MA 4RKJB 2XWBI 4X0WU 1NRQH 1H8DH 4CHAB 3OE7D 1O32A 4IS5A 5JB8S 1SFQB 2ZU1A 3AVZA 3E6PH 3GY7A 3A84A 5AHGH 3M5LA 3NUMA 1O5GH 1HJ9A 4OM9A 1PPHE 4UFGH 2A5KA 1M9UA 3HKJB 4IW4E 1MKXK 4B2BA 2V35A 1H8HD 2JH5D 1KDQA 2SGEE 3TJUA 2A5IA 3A85A 1EZXC 2UUKB 2VWMA 1EB1H 3AAVA 2ILNA 3LONA 1C5MD 5C2ZA 2Q6DA 2R9PA 5FPYA 4OS6A 2H6MA 1V2RT 4I86A 5F6MA 1AN1E 4BXWA 1SQOA 2VB0A 2BDYA 3EYDA 4I7YH 1IQJA 1TGBA 5CHAC 2R0LA 3VFEA 2PLXA 4D7GA 3GCHC 1QQUA 1L1JA 1SGYE 3CP7A 3TK9A 1ZTLA 4ZH8A 1WSSH 3LGUA 1SI5H 5C94A 1KY9A 3U1JB 3GDSA 1DUEA 3ZVEA 2PUQH 2Z7FE 1TONA 4TY6A 1A0JA 1F2SE 1S6FA 4XBBA 4HI3A 1C2IA 1SGRE 1TNJA 3ATIA 3W95A 1ACBE 3S9CA 3TNSA 4CRAA 3RXUA 2GD4B 3SU0A 1GBBA 4LZ1H 1IQGA 1CO7E 4Z6AH 3GICB 2ALPA 4LZ4B 3DFJA 4BOHA 2ZFFH 1ZTJA 4ZHAA 2BD3A 2VNTA 4OS5A 1C1TA 3SHCH 1J14A 1W3CA 1JIMA 1O5CB 1AB9C 4P02A 1COWD 4YLUA 1HFDA 2XCNA 2HPQH 3B9FH 5FPTA 1BRCE 1OP0A 2ANMH 1AFQB 4ISOA 3FFGA 3TGKE 1ETSH 1RXPA 2BD4A 2Z9IA 4H6SB 5C1XA 1NC6A 2M2AA 3U8TH 2F43B 2BZ6H 1GJ7B 1GHAF 4XOJA 4OS4A 2ESTE 1UVPA 2W3KA 4GHTA 2FS9A 1G3CA 2FYQA 2FOGA 2R0KA 3BTGE 4ZXXH 1OWIA 4FUJA 4XBDA 1Y3XA 1KTSB 1KXAA 1XVOA 1NROH 1DSUA 3D65E 2EI7A 4X2XA 4AX9H 1O2YA 1LO6A 1E0FD 1V2WT 2BX3A 4ISNA 1Y3WA 5K7RA 1C2MA 5DN6D 1GHBG 1L2EA 4UEHH 2Z94A 4YOIA 1JWTA 1RD3B 2PKSB 1K2I1 3QUMP 3OFND 4B6FA 2XXLA 3A8AA 4KTSA 2BQWB 2BTCE 4AFZA 1DITH 4IN2A 2QV1A 1ZOMA 6CHAB 1W13U 1BBRE 1HAGE 2VWNA 1J17T 3A7ZA 2ZHFH 5PTPA 4VGCC 1T31A 3P6ZB 1TGTA 1UHBB 2ZDLA 1GBLA 1PPFE 2BY5X 3QTOH 2I6SA 4OGYA 3VXFH 1OS8A 4MVNA 3SI3H 1HAPH 3PTNA 4R8TB 2QXIA 2A4GA 3IG6B 1SMFE 1CGIE 3SNEA 1MQ6A 3U9AH 3RXMA 3T27A 2TIOA 1BMMH 1TQ7B 3KYFA 3U1IB 1IOEA 1FLEE 3VXEH 1NFYA 2ZGHA 1ZPZA 3UNQA 1NM6A 3QK1A 1IQLA 1E34B 2GCHF 4XD7D 3E16B 2EY4C 4Y8YA 3M7QA 1DT2A 1O2VA 2P8OC 1O2TA 5DG6A 1DVAH 1S6LA 2A0QB 3SI4H 4NA9H 3SGAE 1V2KT 2VIOA 2BMGB 1GI3A 1GJ6A 1CE5A 5SGAE 1C2JA 4B1TA 5F03A 2KR7A 4BTTB 2GJGA 1HAZB 3MH6A 4IN1A 1EAUA 2K1QA 2D8WA 3OX7U 4GLYA 5F8ZA 1IQKA 3RMOH 3MWIU 2BVSH 1TNLA 3ODDA 3BIVH 1O5FH 4WMDA 3FN8A 4JZDH 3UFAA 1O2WA 4X6MA 1YBWA 1PYTC 5DJ7A 2WPIS 2AFQB 1FIWA 2J92A 3PTBA 1GPZA 1HRTH 7GCHG 1GI7B 1EAIA 2P3TB 1RTKA 3SU4A 1TNIA 1LVOA 3A8CA 1W11U 4TT3D 2F9BH 5EW2H 1GG6C 1TLDA 2BDGA 1O33A 3GY3A 2PTCE 3K9XB 5BRRE 1TBZH 1ZMJA 1B0EA 3TK6A 2F9OA 3NK8A 2TGPZ 1FIZA 4Y8ZA 2G4UA 1O5BB 1UTLM 3PWCA 1OKXA 4NZLA 3D23A 3BEIB 4UFFH 4MNVA 3U8OH 2KAIB 5C5NA 5A8YA 1O2KA 4BAHB 4DW2U 3RXHA 2GGVB 2IJOB 1VKYA 2GTBA 1HAHH 5HGGA 4AOQA 1Y3VA 5E0JA 3RU4D 1O2OA 1CA8B 3LOXA 5ABWA 1QJ6B 1ZGIA 1L1GA 3EA9A 2CGAA 3AAUA 1YKTA 1QJ7B 4P00A 3RXCA 2P93A 1KYNA 1WAYB 1FI8A 2W26A 2GDEH 2SNVA 4OS1A 4WXIA 5C5OA 4Z0KA 2WPKS 4AB9A 2AGIX 5EQRA 1BTXA 1O2JA 4A6LA 2GV6A 4IMQA 1AO5A 1MABB 1QL8A 3GCTG 4R0IA 4AYVB 1NS3A 1LPZB 5ESBA 4Y10E 3WWFA 4DG4A 2XNIA 3ZV8A 1LHCH 2ZU4A 1DANH 3F0PA 1QURH 2JIZD 3E91A 1P02A 4KKDA 1FY8E 4X1PU 5DP5A 4WVPE 4O3UA 2HOBA 4XBCA 1D3TB 1MKWH 2BX4A 4RT0A 2XC5A 4AFUA 1W10U 3MH5A 1C1WH 1EKBB 1P9UA 2F9UA 1NBME 2ZPQA 1HAVB 1UO6A 1EPTC 1N6YA 1P2OA 2PKAA 2VIPA 3SUEA 2BOHB 3ZZ4A 5C1UA 1FZZA 1WYKA 2RG3A 1EFRD 2NWNA 4HFPB 3RC4A 1UTNA 4NG9H 4DGJA 1MBQA 3MQKC 2YNBA 1XUFA 1HPGA 2Q6FA 1E1RD 1C1NA 3FP8E 2OC0A 2H9EH 4AFSA 5C0UA 2TGDA 4AZ2B 1TPSA 4BAKB 2HNTE 3DUXH 4MNYA 1GBHA 3A83A 3TITA 1LCYA 5FCKA 4CR5A 5HYOA 2OC7A 1V2UT 4B73A 1GBDA 1QTFA 1UW7A 3KQBA 1V2TT 1CHOG 1EXFA 1GVLA 1N1LA 4RKOB 1P2JA 4JK6A 1XVMA 1TE0A 1GDUA 3FP7E 3SU3A 1T7CA 3F9FA 3L33A 1YF4A 4ZROA 1D9IA 3A89A 2CF8H 1T8MA 2G81E 1CHGA 1O3AA 3N7DA 3RXBA 3UREA 2QXGA 4BTIB 3MO6A 1C5QA 1AKSA 4GUXA 4AB8A 5JBBS 1BMLA 1T32A 3UTUH 4D8NA 2IOTA 1MZDA 2F4LA 1AMHA 1GMDG 1K1LA 3F2GA 2J34A 4NA7A 5I46H 2J9NA 1UTOA 3MH7A 3W94A 3GYMA 2UWOA 1ZRBA 2OINA 2QF4A 1E35B 1O39A 3DD2H 4QT8C 1BMNH 1DLKB 1ELAA 1AE5A 4ASHA 1CBWB 1LPKB 5EPNA 1EATA 3PRBA 1QFKH 2KX4A 3LKWA 1O2RA 4RI0A 1A7SA 2ZFQH 4XDEA 1QGFA 1O2IA 1ABIH 1JMOH 2A32A 1DE7H 3P70B 2BQ6B 1OOKB 2FLRH 4HTCH 1KXBA 2G52A 4FUBA 4Q7XA 1PPCE 1Z7KA 3BTFE 4ACBA 1PPBH 1OYQA 3ZIAD 4INKA 5KEDA 2FDAA 2Z9GA 1O3OA 1F0UA 3RMLH 3DT0H 2O8TA 3QX5H 5EOKA 1NPMA 1QJ1B 4GCHG 1SQAA 4CR9A 2YMSC 1LVMA 2Y6TA 4Y11E 4FU9A 3BTME 1Q31A 1BIOA 1DWEH 4M7GA 2XNDD 4A92A 2BVRH 2AMDA 1EPTA 1SGQE 1YM0A 2ZCLP 3GY8A 1THRH 3GS9A 2W7SA 4E06H 4JK5A 3E90B 1CU1A 3V7TA 2O8UA 1TOCB 3BG8A 1J15A 3WY8A 4XRNA 2BB4A 2Y5HA 5DO4H 2FZZA 1O5EH 1RFNA 2Y81A 1XXFA 3TH2H 1GJAB 3E1XB 4MNWA 1FV9A 1GHBF 2P16A 1NRNH 1TNHA 3A82A 1A4WH 2H5CA 2M5TA 4WH8A 1MZAA 4GPGA 1HDTH 4JYVH 1HXFH 1UTKA 1CA0C 2H1UA 3A7XA 1BRUP 3P17H 3W1EA 4AORA 5CMXH 3EDXB 4GHQA 1MTNB 2ZGCA 2AEIH 3SV2H 1TBRH 5TCCA 3HGPA 1TOMH 1V2NT 2ZF0H 1FN8A 5FPSA 4X1RU 3N99A 3QN7A 1AFEH 1GHVH 2WUBA 1FPCH 4K1EA 1EP5A 1BUIA 1C2GA 1MTWA 2DE8A 3D49H 1O3PB 3VGCC 4ZXYH 3K65B 1MUEB 3RXVA 1CVWH 1G3BA 1C2DA 3T25A 1VCWA 2ANKH 3SBKA 4Y6DA 2FM2A 1UTJA 2G4TA 2HWLB 4NWLA 2WHXA 1NRPH 1SPJA 4HG6A 3URCA 4X8VH 4ABHA 2AH4X 1KLTA 2CHAB 1EZSC 2GT7A 4Y79A 4ABFA 5DP4A 3MOCA 5T6DA 2GV7A 3TLOA 3A86A 4B76A 3TGJE 3SJ8A 2ZU5A 2ZPRA 4CBOA 4KP0A 2OC8A 3BTQE 3CS0A 4MPXA 3E0NB 3Q00A 1ANBA 5A0AE 2BXTH 1VITH 1FPHH 2OBOA 4CRCA 4BXSA 1A46H 4ABEA 1TFXA 2HVXA 1T8OA 1G30B 3TVJB 1HIAA 1H8ED 1A5GH 1XUHA 1ETRH 2OQUA 2KCYA 2OUAA 4ZAEA 1P06A 2AS9A 1BTUA 1EZQA 1KDQB 1W12U 3GISB 5A8XA 1HB0B 1AY6H 2YOLA 3KQEA 7GCHF 5GJ4B 1ESAA 4Z1MD 1GWAA 4X2VA 4TWWA 3ZZ3A 5L2YH 4BAMB 2V6NA 1LHDH 2C4FH 1QBOA 1EAXA 3EQ0H 1Q3XA 4ASUD 1YPJH 3FP6E 1O3IA 1XMNB 1LQEA 3MHWU 4I31A 5L2ZH 3MNSA 2J2UA 1YY3A 1O5DH 3SOSA 1HAXB 2PP6A 2FIRH 2ZFRH 3SO3A 3GDVA 3KL6A 2ZDNA 4Q7ZA 2ZHDA 4UDWH 1P05A 3UAIC 4JMYA 3SUFA 2NU1E 1IQHA 2WV4A 1NFWA 3OU0A 4BAQB 2F9NA 2SFAA 5E0GA 4GAWA 5IK2D 1GI2A 1RS0A 3QZQA 1UTPA 5EODA 4UD9H 3O8RA 3GCTF 3UY9A 1TQ0B 2G00A 1P57B 3ZV9A 4A5TS 2A4OA 1ELDE 1CSOE 1BTYA 1UCYH 3SN8A 3M3TA 4BTUB 4NWKA 3GCOA 4MLFB 2GT8A 1O2SA 1WDIA 2B9LA 1LDTT 3F2FA 2WV9A 1A3EH 2TGTA 3NWUA 3MU5A 1C5YB 4JZ1A 3MO9A 3PLKA 1TBQH 3KYGA 1N6XA 3MH4A 5ETXA 2FWWA 3P92A 6LPRA 3FKSD 1O3DA 2PUXB 2A2QH 2HNTF 3F68H 3LGTA 3GY6A 3PYHA 1FX0B 3MNBA 2PSXA 2IN2A 2OLGA 4A1XA 2EQNA 1TB6H 1NY22 4MG3A 5EG4A 5FHTA 4CH2B 3P95A 3V3MA 3ZZ8A 1UVTH 1YPHE 1LTOA 3STJA 3H5CB 3ZYDA 3ITIA 4IGDA 1SQTA 1ELEE 2XOKD 4TPYA 5G4BA 5GIBA 2O8WA 2ZCKP 3LPRA 5T1VA 3SGQE 1RGQA 1AD8H 2XBXA 1DUAA 1TGCA 5AFZH 1A5IA 1MU6B 1CHOF 2RCEA 3ATMA 5EXLA 1O3LA 3A7YA 1A2CH 3RUOA 2GVFA 2QXJA 3OAAD 4MPUA 1EZUC 1DLEA 1P9SA 2QXHA 1SHHB 5C20A 1GL0E 1TX7A 1GCTB 6ESTA 1TMTH 5DP6A 2HNTC 3BEUA 2DE9A 3VG8A 1MTUA 1GI0A 2V0BA 1F5KU 3ENSB 1XUKA 1G2MA 1XKAC 2J5UA 1EQ9A 4ABJA 3GCHB 1RIWB 1GMDF 2JH0D 3SNCA 1QIXB 2PW8H 4F48B 3ZYEA 2JKHA 2V7QD 1DWBH 3MU8A 1T8LA 2KM0A 4U32A 2ANWA 1HAYB 1ID5H 3SQHE 1ZPCA 4I33A 3S7KB 2VIDA 3F9EA 4Q2KA 1U6QA 1TRNA 1SGPE 2H9TH 2QCYA 4NSVA 3WWBA 1DICA 1O3BA 2LNCA 2PFEA 3NKKA 3BEFB 1ANCA 2CV3A 2AIPA 3L6PA 5DK1A 3S9AA 2J38A 1EX3A 1QBNA 1S0QA 4MNXA 4X1SU 2BHGA 1LPGB 1OX1A 1OP8A 1ZLRA 1C5ZB 2AGEX 5C67A 1GI8B 2BQ7B 3VB3A 3SNDA 1O3NA 4I8JA 2FO9A 1AB9B 3SV6A 4ABIA 2ZO3H 5EGMA 4FUHA 1SG8B 2UWPA 1FAKH 1ZYOA 3M5MA 1YPMH 2GDDA 2WPHS 3EE0B 1ARCA 3SV9A 3RXSA 5C0TA 2CN0H 1ZR0A 3EA8A 4TSFD 4F55A 3UPEA 1W0YH 3RXKA 3ELAH 2VWOA 1P04A 1O3JA 2QAAA 1AHTH 2XCFA 1J16A 2PHBA 2P3UB 3BTKE 4GCHF 4PROA 2KCOA 1AZ8A 4E7RG 1DXPA 3MMGA 5FBIA 1HBTH 1AVGH 1FUJA 1EOJA 2BY9X 1P01A 2UUFB 1F92A 4HZHA 1S0RA 2FX6A 3AW0A 4ABDA 4AFQA 4ZKOU 1J8AA 1O3KA 3G01A 2LP6A 5EIYA 5FXLA 3ZVDA 4BAOB 1ELGA 1O36A 1OYTH 3FZZA 1GI9B 3NPSA 2QYIA 4ABAA 3RXRA 1NBMD 1Y5AT 2Z3EA 1CGHA 1TA6A 1MD8A 3JZ1B 1AUTC 2Z3CA 3PB1E 3BSQA 3M3VA 4K8BA 1E37B 1GDQA 1TGNA 2W6JD 1SR5C 1ZRKA 3HKIB 2UUYA 1LKBA 2BLOA 2KFWA 1WUNH 1DSTA 2J98A 4MPWA 1P03A 3O8CA 2GCTC 4FVDA 5HIZA 1EUFA 1O5AB 2EA3A 2KCAA 2QGRA 3PWBA 2GX4A 4UE7H 3R0FA 3FOAA 2V3MA 3LGVA 2R2MB 1MTVA 2C90B 1ZSLA 1SGFG 2CJIA 2DUCA 4ACAA 4B6EA 3SJKA 2A31A 3M36A 4UONA 2ZHEH 1P2MA 4X6PA 2C8WB 3UNRA 1TA2A 4K69A 1SGCA 5A0BA 1YPKH 1BMFD 3GY2A 3SU1A 1O3GA 1QCPA 2FYRA 1C5UA 2CXVA 1WQSA 1KLJH 3DFLA 8GCHG 4ISHH 2FOHA 5EXMA 4SGAE 2AYWA 1Z8IB 1GI6A 1GCDA 1RTLA 2IJD1 3PO1B 2F91A 5GPIB 2P8OB 1TNKA 1V2OT 2B5TB 3MTYA 2TGAA 5BPEA 3SQEE 3KN2A 3SU2A 1HAIH 1OP2A 2JDID 1IHTH 1SOZA 1ZMLA 1ZMNA 2PKAB 1FQ3A 4B2CA 2O8LA 4D76A 3MYWA 2WPMS 3TNTA 4KTUA 2ZCHP 3RXIA 5DPAA 1P3EA 1QRZA 3M3SA 3RXQA 3TU7H 1Z8GA 1DM4B 1A5HA 2BD7A 3DSGA 5GDSH 4A1VA 3URDA 2P95A 1SC8U 2ZDVH 4X8UH 5DP3A 3RXEA 4AC9A 7LPRA 1MBMA 8KME2 2WSSD 4BNRA 1GJ8B 1YCPH 2FOCA 3MNXA 2QIQA 8ESTE 2WV5A 4ZKSU 1SSXA 1O3FA 1GJ5H 1TRYA 2EEKA 3RXAA 1F0RA 3ZZ9A 4IC6A 1QA7A 1SVPA 2QF5A 3UR9A 3A8BA 3A7VA 5FX6A 3RM0H 1ZGVA 1GBTA 3RLWH 2TRMA 3FVFB 1MAXA 1ELFA 2R2WU 1GGDB 2R3YA 2NU0E 5LPFA 3QDZB 2P3FH 2VJ1A 2BVXH 3PMJA 4O9VA 4GSOA 3SORA 1AKSB 1WTGH 2WYGA 4X8TH 1W14U 4FUDA 1MKWK 1O2PA 1P09A 2W5EA 1NT1A 1Z8RA 3D62A 5K0HA 1PPZA 1G36A 1HJAC 3DHKH 4CRFA 3I78A 3LGWA 3LC3A 1C1OA 2CF9H 2PR3A 2ALVA 2ZHWH 1C1SA 2OXSA 3FZDA 2G51A 2ZFTA 2BYAX 1O2LA 1CBWC 1TPOA 1OSSA 2ZFSA 4H4FA 5DP8A 2ZDMA 2GZ7A 1GMHG 1C5LH 1H9HE 1ELTA 3UQOA 1WBGB 1IQFA 1GDNA 1LVYA 1O3CA 2AERH 4JZFH 2VGCC 5J4QA 2O9QA 4CREA 2B7DH 1DPOA 3H7TA 1B5GH 4MTBA 4TYDA 1FONA 1HAOH 1GHZA 1QZ8A 5JYIA 4AGJA 4UFEH 1GI4A 3M35A 5E2OA 5JPMH 2BOKA 1Z71A 4NCYA 2GKVE 4H42U 1DFPA 1TPAE 2D2DA 4FUIA 1PQ8A 2ZKSA 3MU4A 1A3BH 3V0XA 3RXJA 4ZKNU 2BXUH 2O8MA 2BLQA 2FI4E 4Q80A 1EAWA 4YZUA 3B23B 4KTCA 1ETTH 3V12A 4NFFA 5L6NH 1TMUH 4KELA 1EPTB 3IITA 2VBCA 3SZNA 1P2KA 1T8NA 3TH4H 1K28D 4CRBA 2Z3DA 1KXFA 4DIIH 1ABJH 2OK5A 4FU7A 2XYAA 1LHEH 3DA9B 1O3HA 4DVAU 4NA8A 2JETC 5DSFA 1BJVA 2FOAA 2J97A 2AMQA 1GBKA 2ASUB 3F2HA 1V2PT 7KMEH 1O3EA 1C9PA 2ZG0H 1K0HA 1C5NH 1GVZA 1QNJA 2AGGX 3NXPA 1C1RA 1KMHB 3V13A 3LGIA 1THPB 1UK4A 4B75A 4FETA 1SB1H 1TX8A 1MTNC 1QL7A 3TH3H 2B8OH 3ATLA 3T29A 4ZCNA 2SGAA 1YPHC 5B6LA 4WXVA 1VGCC 2BY8X 2ZQ1A 2LPRA 3A81A 5TJXA 4NIWA 2J95A 2RFKC 1K21H 1HXEH 1N8OC 1NTPA 5DKMA 3VB5A 2ZPSA 4O97A 2FOFA 3ZVGA 5LPEA 3JZ2B 4O03A 2FS8A 2HALA 2IPHA 5HXFA 1G3DA 4I8GA 3LIWA 1DY9A 3BG4C 3SU6A 4X1NU 1P2NA 1K9OE 1BCUH 1K22H 2CK3D 4YOGA 5ESTE 5F8TA 3ATKA 3SUGA 2GMTB 1ZHRA 1K1NA 1UVUH 5EQSA 1OHHD 4ZKRU 2ZP0H 4BANB 1KSNA 2ZZUH 3A88A 2CHAC 3U98H 4B2AA 2GZ8A 2SNWA 1DDJA 1DOJA 3ZZBA 5E2PA 1JOUB 2HVYB 1NU9A 1D3QB 2FODA 2FXRA 3HATH 1V2QT 4FOUC 2Z9LA 1V6DA 4NIXA 1MAYA 3M7TA 1PQ5A 5AVDA 5HM9A 1P11E 1QY6A 4IC5A 3F3BA 5GCHG 1P2IA 2H5DA 3OEED 2L74A 4D7FA 1S83A 1XM1A 5A2MH 4DOQA 3GYLB 4JCNA 4ZMAH 1P2QA 1FDPA 1H9IE 4WY3A 3LGYA 1XX9A 4MQAA 1DY8A 4OGXA 1BZXE 1MD7A 3A8DA 2YMSB 3DSOA 3RMMH 1O2GH 1IAUA 2CMYA
chains in the Genus database with same CATH topology
1YYY1 1XUIA 3TJNA 1QB1A 4RN6A 3E3TA 3M37A 3OYPA 2Y5GA 3PMBB 4CHAC 4RSPA 1SHYA 3F6UH 2XTTB 4NFEA 1BA8B 5GXPA 2ZU3A 2A1DB 3K6YA 2VIVA 3UUZA 1ZHPA 2ZC9H 3BTHE 1YGCH 7ESTE 2EI6A 1F0TA 1WQVH 1C4Y2 3PLBA 1AVXA 1F5LA 1KXDA 1PQAA 1O35A 2FI5E 1GBJA 1CA0B 1VZQH 1ELBA 3PM3A 3RDZA 4AGKA 1TMBH 1SOTA 2WUCA 3RXLA 4YLQH 1C5SA 1G9IE 4U30A 1BBRH 3EGKH 1H1BA 1ZJKA 1IQEA 2BD2A 1GBIA 2UWLA 2V3HH 1C2EA 1VJ9U 2BY7X 2VINA 3ZZ5A 2C93B 3NZIA 1V2JT 1P8VC 5I25A 2OC1A 1O30A 1PPEE 3KCGH 2A7CA 1P0SH 1O2QA 1H4WA 1ZSKA 1B7XB 1YLCA 2A45B 3F9GA 4Q7YA 1S6HA 1C5OH 1FY4A 1Y59T 2SGFE 8GCHF 2FESH 4CBNA 3L3TA 4K60A 1SLUB 1TX6A 4E05H 2NU3E 2FOEA 4WMFA 3ZVCA 3M5OA 1T4UH 1ZHMA 2VU8E 2G55A 1LHFH 1WOFA 1GBCA 2STAE 1VCQA 3PMHB 1MKXH 3OY6U 2ZGXH 3C27B 3Q77A 3S0NA 1BTZA 4B74A 2XBVA 1UMAH 2Y82A 2XRCA 3ZZDA 1CT0E 2I6QA 3LJJA 3M7UA 4K8YA 1GMCG 2ZQ2A 2EC9H 1E38B 2G8TA 1GBAA 1TNGA 1AFQC 1MH0A 2OD3B 4IBLH 3SGBE 1ESTA 1UK3A 1NRRH 1W7GH 1DWDH 5IDKA 3LJOA 2ULLA 3QTVH 1H9LB 3GY5A 2BM2A 1EJNA 3UOPA 1GCTC 1THSH 2C8ZB 4FXGH 1TABE 1UCYK 2JH6D 2Y7XA 3RXPA 1SGIB 3T62A 1MQ5A 1O2XA 2F83A 4WWYA 3SV8A 1H8IH 3LC5A 4F4OC 1RIWC 1HGTH 1ESBA 1TIOA 2Z6BD 1C4U2 1ZJDA 1OXGA 1L4ZA 4ISLA 4J1YA 1C2KA 6GCHG 4LXBH 2F3CE 1T4VH 4YESB 1ELCA 1HNEE 1MCTA 2PKSC 1RRKA 1DWCH 2BDAA 2F9VA 2TBSA 4Y0ZE 4A1TA 4X2YA 1QL9A 3B8JA 3RM2H 1EOLA 1DS2E 1O2HA 2XW9A 2H2ZA 1SBWA 3E8LA 1GMHF 6CHAC 2GZ9A 2HLCA 1TGSZ 2FP7B 1QA0A 3QWCH 4ZHMU 1PJPA 5EU8A 1RJXB 3S9BA 5FBEA 1TRMA 2YNAA 3SNBA 4LOYH 1BHXB 3KGPA 1GBFA 5E8EH 1C2LA 1G3EA 4Y0YE 1S84A 3QO6A 5CHAB 3OSYA 3VB7A 2ZGBH 4KGAA 1LQDB 2WYJA 2VIQA 2XBYA 3GY4A 3HK6B 2ZTXA 4TWYA 1Z1IA 1TAWA 3GOVB 1VITG 3BTEE 3KQCA 1FY1A 3PROA 3MO3A 2ZDKA 4E7NA 4FUCA 3PMAB 1A0HB 4NGAH 1NFUA 4U01A 3TIUA 1NO9H 1ZPBA 2H9HA 4UFDH 1HYLA 1AUJA 1D6WA 3AASA 5HMAA 8LPRA 1X7AC 2BDHA 3PV4A 2OBQA 2G5VA 4Y8XA 2SGDE 1LKAA 4AG2A 1GJBB 3RMNH 2QF3A 4YM9A 2QY0B 2RA3A 3UIRA 5T6FA 1ELVA 1SGFA 4B71A 1WV7H 3ESTA 4ISIH 5EPYA 1L1NA 4YT6H 1EJAA 3SNAA 5JB9S 1SGNE 3I29A 1PPGE 1O0DH 3GDUA 5JBTA 1A61H 1A1RA 3FANA 3RXTA 5LPRA 3LH3A 1ARBA 3K2UA 1BT7A 3SV7A 1GHXH 1AWHB 2D26C 1KXEA 4X6OA 4U2WA 1W7XH 1AWFH 3F9HA 4ZUHA 3SHAH 4CRDA 5J4SA 1SLVB 1O2UA 1IQNA 2OTVA 3CENA 1IHSH 3KEEA 3SW2B 1ZTKA 1GJ9B 9LPRA 3ZZAA 3PO1C 1SFIA 5IYTA 2C8XB 5H4IB 1KLIH 3S7HB 2RDLA 3QGJA 1BB0B 1XUGA 1QRWA 1XKBC 1EP6A 2ZI2H 4FUEA 3TK5A 3MI4A 3Q3KA 2PGQB 1K1OA 5EQQA 5F8XA 4LK4A 1HCGA 1UHBA 2NU4E 2Z9KA 4VGCB 1O2ZA 1GHWH 2OQ5A 3MU1A 5JDUB 3O8BA 3KNXA 1UCYE 2TPIZ 1C5RA 3IWMA 4I8KA 4NSYA 2QA9E 1SGDE 5GCHF 1O31A 2ZGJA 2FX4A 1TYNA 1OWHA 1D3PB 1KTTB 5T6GA 1WCZA 3GCNA 3A87A 4K1TA 3MU0A 1SGTA 5HM2A 3ZZ7A 1OWDA 1C1UH 1JRTA 1D6RA 2PGBB 1Q2WA 3ZVBA 3SU5A 2FMJA 1GGDC 2R3UA 3AW1A 1D4PB 1C1MA 4SGBE 2OP9A 2STBE 2W3IA 5A0CA 2ZTYA 4J2YB 4K2YA 4ABGA 4AG1A 3U69H 4AN7A 1HJ8A 3VB4A 5DGJA 2Q1JA 1IQIA 5T3HA 2BY6X 1UTQA 1C1QA 1GBMA 5DP9A 5C1YA 1AZZA 3P8OA 2A4QA 3F1SB 1MCVA 4ZHLU 9ESTA 2PSYA 4YOJA 3RC6A 1WU1A 1F0SA 1OWEA 4X2WA 3A7TA 4WMEA 2G5NA 2FTLE 1AU8A 2FI3E 4YTAA 1GI5A 2OCVB 1KIGH 1UK2A 5EW1H 4F49A 4K3JA 1GJDB 4OS7A 4WF8A 1QB9A 3P8NA 1L4DA 2GCTB 3BN9A 2NU2E 1BTPA 1VJAU 3RXFA 5A8ZA 1O37A 1GL1A 1RTFB 5JBCS 1EJMA 2ODPA 1B0FA 1DX5M 2WPLS 2FOMB 4X1QU 5EXNA 3UOUA 3SJOA 1YCPK 1BITA 1ANDA 1GG6B 4O3TA 2Y80A 1O34A 4JYUH 4NZQA 5E0HA 2XC0A 1ZSJA 3CS7A 3RC5A 3QGNB 3VEQB 1TALA 3RXDA 3UWIA 4Y71A 4CRGA 4I32A 2A7JA 1S5SA 2Y7ZA 1OWKA 1NESE 3UQVA 1AVWA 2KAIA 2QF0A 1SGEE 2ZFPH 3TPIZ 1NFXA 2XC4A 1W8BH 3HK3B 1FY5A 1ORFA 2BDIA 4GVUA 1D3DB 1JXPA 4FUFA 1AQ7A 1Y5UT 3S69A 2A4RA 1MTSA 2SGPE 1CGJE 1J9CH 2ZA5A 1NRSH 2PWXA 2ZIQH 3BIUH 1YCPM 1TPPA 3T2NA 1G2LA 3H7OA 3A7WA 1PYTD 2ODQA 3UR6A 5JBAS 2VVUA 1GMCF 1BJUA 1YPGH 3K6ZA 3BV9B 3STIA 4FUGA 3SUDA 1HUTH 3TGIE 3UNSA 4CH8B 2A5AA 2BDCA 2HPPH 1V2LT 2ZEBA 1JBUH 1LVBA 1C5PA 1NU7B 3ATWA 5AFYH 4H6TA 3ZVFA 2ZWLH 4DT7B 1Y3YA 5L30H 3KQDA 3KHVA 1GHAG 2C8YB 1QB6A 1HAVA 2HRVA 1XXDA 2UUJB 5C3NA 2F9PA 3LH1A 1QBVH 5B6OA 5LGOA 1XUJA 3T28A 4ABBA 1VR1H 1MU8B 1GHYH 1BTHH 3RU4E 1ANEA 2GP9B 4K1SA 5DP7A 6GCHF 2AIQA 5CE1A 1QHRB 1HJAB 1O38A 2GMTC 1S82A 1Z1JA 3KF2A 1C9TA 5FCRA 4IMZA 5AF9H 3ODFA 1V2VT 1AIXH 1V3XA 1YC0A 2BLWA 4YO9A 3RXGA 1C2HA 2EI8A 3OY5U 1YLDA 4X6NA 1AGJA 2RA0A 5TCAA 5GWZA 3A80A 1C1VH 4XSKU 3RU4T 1FAXA 1KXCA 1LMWB 1GJ4H 2VGCB 2XWAA 4Y7BA 3T5FH 2BD9A 1PFXC 1C5WB 3NCLA 1FN6A 1QR3E 1K1PA 1S81A 1OWJA 2HGTH 1INCA 1C1PA 4YT7H 3RLYH 3SJIA 3TJVA 1SLXB 1L0ZA 1BMAA 1BQYA 3M5NA 4XE4A 1Z6JH 3KIDU 2B0FA 4A7IB 4AYYB 1Y3UA 3SJ9A 1K1IA 2GCHG 1VCPA 4D9QA 3Q3XA 4MPVA 1W0ZU 1A0LA 2J4IA 1NZQH 1VITF 2D1JA 3E0PB 1GBEA 4I8LA 3MFJA 2QC2A 1O2MA 1UTMA 2WPJS 1O2NA 1Z8JB 1LHGH 1AI8H 2VIWA 4JZEH 1P12E 1BOQA 1JIRA 4TPIZ 2THFB 2WINI 1JRSA 3OTJE 4NIVA 1Y8TA 2ODYB 1YPEH 1UVSH 3R3GB 2P59A 1MMJN 4DIHH 3BTWE 3MNCA 2JETB 1IQMA 1V2ST 3EA7A 4Y7AA 1QRXA 3QLPH 2BD5A 1BDAA 3BTTE 1C5XB 1BRAA 2Q6GA 3HPTB 3BF6H 3N7OA 2BD8A 4WJG2 1PQ7A 1CQQA 3RXOA 1K1JA 5FX5A 1HIAB 2ZDAH 3QZRA 2PV9B 2V3OH 3P8GA 3I77A 4INHA 1E36B 1C4V2 1UVOA 2BLVA 2VH0A 1C5VA 4JYTA 1TWXB 2BZAA 3O8DA 4OS2A 1Z6EA 1VGCB 2ZHQH 2XBWA 1UJ1A 3EAJA 3U8RH 2VVCA 1S85A 1N8OB 3T26A 1Y5BT 4MDSA 4FU8A 1O3MA 2VVVA 3Q3YA 2ZECA 1G37A 1YP9A 2BDBA 3BG4B 4D9RA 1AE8H 1WTHD 2FOBA 4ESTE 2Z9JA 1CT2E 2FEQH 1FNIA 3C1KA 1F5RA 4INLA 2A2XH 2C3SA 3LDXH 2VH6A 4WH6A 3ZZ6A 1FXYA 1W2KH 4TY7A 1V2MT 1SL3A 4NIYA 2J94A 2ZNKH 1BTWA 2ZTZA 4Y76A 1C2FA 1P10A 1HV7A 4DCDA 3Q76A 2FPZA 1OPHB 2PTNA 1GJCB 2Y5FA 3UWJH 2AMPA 4DJZB 3FAOA 4THNH 1NN6A 2FTMA 1F7ZA 3TJOA 3ZVAA 3ZZCA 2ANYA 5FAHA 2SGQE 1FMGA 4X8SH 2A7HA 1GI1A 2W7UA 1FJSA 3LU9B 1ZZZA 1CT4E 3RP2A 1SLWB 2FLBH 5A09A 1YPLH 2P94A 4K5ZA 1HLTH 1QQ4A 1BBRK 1G32B 4HGCA 1P3CA 3PLPA 4JZIA 4XFQA 4DY7B 4DURA 3VGCB 3HGNA 3P8FA 1DXWA 1BHXF 1FY3A 4FVBA 1GVKB 2VWLA 2QN5T 3VPKA 3LT3A 1EASA 4I8HA 1C5TA 3BTDE 3M61U 5LH8A 2ZU2A 3VB6A 1EB2A 1BRBE 1K1MA 4RKJB 2XWBI 4X0WU 1NRQH 1H8DH 4CHAB 1O32A 4IS5A 5JB8S 1SFQB 2ZU1A 3AVZA 3E6PH 3GY7A 3A84A 5AHGH 3M5LA 3NUMA 1O5GH 1HJ9A 1PPHE 4UFGH 2A5KA 1M9UA 3HKJB 4IW4E 1MKXK 4B2BA 2V35A 2JH5D 1KDQA 2SGEE 3TJUA 2A5IA 3A85A 1EZXC 2UUKB 2VWMA 1EB1H 3AAVA 2ILNA 3LONA 1C5MD 5C2ZA 2Q6DA 2R9PA 5FPYA 4OS6A 2H6MA 1V2RT 5F6MA 1AN1E 4BXWA 1SQOA 2VB0A 2BDYA 3EYDA 4I7YH 1IQJA 1TGBA 5CHAC 2R0LA 3VFEA 2PLXA 4D7GA 3GCHC 1QQUA 1L1JA 1SGYE 3CP7A 3TK9A 1ZTLA 4ZH8A 1WSSH 3LGUA 1SI5H 1KY9A 3U1JB 3GDSA 1DUEA 3ZVEA 2PUQH 2Z7FE 1TONA 4TY6A 1A0JA 1F2SE 1S6FA 4XBBA 4HI3A 1C2IA 1SGRE 1TNJA 3ATIA 3W95A 1ACBE 3S9CA 3TNSA 4CRAA 3RXUA 2GD4B 3SU0A 1GBBA 4LZ1H 1IQGA 1CO7E 4Z6AH 3GICB 2ALPA 4LZ4B 3DFJA 4BOHA 2ZFFH 1ZTJA 4ZHAA 2BD3A 2VNTA 4OS5A 1C1TA 3SHCH 1J14A 1W3CA 1JIMA 1O5CB 1AB9C 4YLUA 1HFDA 2XCNA 2HPQH 3B9FH 5FPTA 1BRCE 1OP0A 2ANMH 1AFQB 4ISOA 3FFGA 3TGKE 1ETSH 1RXPA 2BD4A 2Z9IA 4H6SB 5C1XA 1NC6A 3U8TH 2BZ6H 1GJ7B 1GHAF 4XOJA 4OS4A 2ESTE 1UVPA 2W3KA 4GHTA 2FS9A 1G3CA 2FYQA 2FOGA 2R0KA 3BTGE 4ZXXH 1OWIA 4FUJA 4XBDA 1Y3XA 1KTSB 1KXAA 1XVOA 1NROH 1DSUA 3D65E 2EI7A 4X2XA 4AX9H 1O2YA 1LO6A 1E0FD 1V2WT 2BX3A 4ISNA 1Y3WA 5K7RA 1C2MA 1GHBG 1L2EA 4UEHH 2Z94A 4YOIA 1JWTA 1RD3B 2PKSB 1K2I1 3QUMP 2XXLA 3A8AA 4KTSA 2BQWB 2BTCE 4AFZA 1DITH 4IN2A 2QV1A 1ZOMA 6CHAB 1W13U 1BBRE 1HAGE 2VWNA 1J17T 3A7ZA 2ZHFH 5PTPA 4VGCC 1T31A 3P6ZB 1TGTA 1UHBB 2ZDLA 1GBLA 1PPFE 2BY5X 3QTOH 2I6SA 4OGYA 3VXFH 1OS8A 4MVNA 3SI3H 1HAPH 3PTNA 4R8TB 2QXIA 2A4GA 3IG6B 1SMFE 1CGIE 3SNEA 1MQ6A 3U9AH 3RXMA 3T27A 2TIOA 1BMMH 1TQ7B 3U1IB 1IOEA 1FLEE 3VXEH 1NFYA 2ZGHA 1ZPZA 3UNQA 1NM6A 3QK1A 1IQLA 1E34B 2GCHF 3E16B 4Y8YA 3M7QA 1DT2A 1O2VA 2P8OC 1O2TA 5DG6A 1DVAH 2A0QB 3SI4H 4NA9H 3SGAE 1V2KT 2VIOA 2BMGB 1GI3A 1GJ6A 1CE5A 5SGAE 1C2JA 4B1TA 5F03A 4BTTB 1HAZB 3MH6A 4IN1A 1EAUA 2K1QA 2D8WA 3OX7U 4GLYA 5F8ZA 1IQKA 3RMOH 3MWIU 2BVSH 1TNLA 3ODDA 3BIVH 1O5FH 4WMDA 4JZDH 3UFAA 1O2WA 4X6MA 1YBWA 1PYTC 5DJ7A 2WPIS 2AFQB 1FIWA 2J92A 3PTBA 1GPZA 1HRTH 7GCHG 1GI7B 1EAIA 2P3TB 1RTKA 3SU4A 1TNIA 1LVOA 3A8CA 1W11U 5EW2H 2F9BH 1GG6C 1TLDA 2BDGA 1O33A 3GY3A