1BJUA

Beta-trypsin complexed with acpu
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Oxyanion-mediated inhibition of serine proteases.
pubmed doi rcsb
molecule tags Serine protease
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1998-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1bjuA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1bjuA02
1ZGIA 1GHBF 1SOTA 2WPHS 4AYYB 2XC4A 4IW4E 1O5DH 4KTCA 3ZZ3A 1CHOG 2ZDNA 2FYQA 2UUYA 3SV8A 3K2UA 4X1RU 4O97A 3SJ9A 2AMQA 3GISB 4DVAU 2GV6A 4JZDH 4CR9A 1P02A 4IGDA 1NRNH 1W0YH 5FBIA 3RMMH 2GMTB 1PQ5A 1TLDA 2A2XH 3A80A 4KTUA 1FV9A 3U1IB 2A7JA 3W95A 1O37A 3JZ2B 3D23A 4K2YA 1TNIA 2QCYA 1AFQC 4QT8C 1AB9C 4H4FA 1MBQA 5E0HA 2F3CE 1TA6A 5EQQA 3TK5A 3DHKH 3M36A 2GT8A 5T6DA 1AN1E 3BIVH 2G4UA 2XW9A 1IQKA 3RXOA 1EP6A 1CA0C 4X6NA 1GJDB 1AO5A 1MQ5A 1BITA 2BB4A 2EI7A 1C5RA 1T31A 3NXPA 4IC6A 2KAIA 2WUCA 4ZKSU 3OTJE 4UD9H 2G81E 5CE1A 3VB6A 1OWJA 1U6QA 1WTGH 1UCYK 4B71A 5DP8A 3SV7A 3ZV8A 4FU7A 1H4WA 1K21H 4GAWA 2SGDE 3BTQE 2JETC 3SU2A 5A0BA 5A2MH 4ISOA 2Z9GA 3RMOH 2GP9B 3ESTA 3PTNA 2FOCA 3P8FA 1DWBH 5A8ZA 2J4IA 3FP8E 1RGQA 1XUGA 3EA7A 1Q3XA 1Z71A 1K1OA 1SQAA 4B74A 1BOQA 1J15A 1TRYA 1RTKA 1GHVH 2F91A 3FVFB 1NU7B 1P3CA 1THPB 2ZCHP 5DPAA 2H5CA 2FIRH 2OXSA 3KGPA 2ZU5A 3F9GA 3FANA 3EYDA 3DD2H 4ABGA 1UCYE 3CS7A 3SNEA 3MWIU 1A0HB 5FXLA 5HYOA 3LGTA 4X1SU 2FLBH 1G32B 3BTKE 4NA9H 1W3CA 3V0XA 1Y8TA 3K6YA 3MH4A 2P8OC 3RXPA 4Y8XA 1AD8H 2OUAA 1W13U 4H6SB 1YPHE 1OP8A 1AZZA 1OPHB 5C5OA 5JB8S 2PKSB 3UNSA 5FPYA 1ZJKA 3ZZ5A 2R2MB 2A4OA 3GCNA 1LHEH 3PO1B 4CREA 4B75A 4WH6A 4XE4A 1ZPZA 4YOGA 3RXLA 3FAOA 1G3EA 2STAE 1TMUH 4ZROA 1F0RA 2OCVB 3UR9A 1SB1H 2P3UB 1ETTH 4M7GA 5GDSH 2BMGB 2P93A 1DWEH 2UWOA 2ZU4A 5JBAS 3TH4H 1LVMA 2BX3A 5DJ7A 3UWIA 1C1OA 2R3UA 4X8UH 3NPSA 1BB0B 1TGBA 1TRNA 2NU0E 3PV4A 4ESTE 2FM2A 2GDDA 2ZI2H 4A5TS 2ZHFH 3QZRA 1J16A 1GJ7B 2Y6TA 1XUJA 1MKWH 3A83A 2RA0A 1GDQA 1L0ZA 1K2I1 4MQAA 1W2KH 4JYVH 1OOKB 3HK6B 1E0FD 1P2KA 4NGAH 3S69A 1QTFA 1CQQA 1V3XA 2BVRH 2Q1JA 1O2ZA 3SV9A 4BTIB 1Y3VA 2C4FH 1SFIA 2ZQ1A 5T6GA 3BIUH 2Q6FA 3PROA 1J14A 2PSYA 1S83A 1QY6A 1XUIA 3RXUA 1C2KA 3GDVA 2ZC9H 3D62A 2GGVB 1HDTH 1YM0A 3ZVDA 1MTNB 2O9QA 2ZG0H 1Y5BT 3LGIA 2F9PA 3FFGA 1FN6A 3A84A 4ZXXH 5F8ZA 1ANEA 2GZ8A 4OS1A 1C2HA 3LC3A 1ZHRA 1V2TT 5FPSA 2CXVA 1FZZA 1Z1IA 3NWUA 2O8LA 1ZZZA 1CGIE 3GY8A 3AASA 3SJIA 3F9FA 4NIYA 4NSYA 1UHBA 5GIBA 4GPGA 2D1JA 2GVFA 1S84A 2BXTH 2ZHQH 2AYWA 1FAKH 1PYTD 3SW2B 3STIA 1TMBH 1GWAA 1WBGB 3F68H 4MPUA 2SNVA 1M9UA 1TGCA 2D8WA 1MUEB 1E35B 1AQ7A 1IQMA 2YNBA 1GG6C 1HAVA 1SR5C 4K3JA 4OGYA 4IC5A 3MNBA 1TAWA 2BZ6H 1F5LA 1P0SH 2OD3B 1LHFH 2BDGA 3DA9B 1ACBE 2OBOA 1O31A 1TX8A 1SGQE 1AWFH 1CA8B 1C2IA 2ZFQH 2BXUH 1A46H 3KCGH 1HJ8A 1PJPA 1CT0E 4ZMAH 5JBTA 2FOGA 2PLXA 3SGQE 2PFEA 2AH4X 3ATWA 7GCHG 5EGMA 5A0CA 4MPXA 1YPJH 3DFLA 2ZGJA 2BY7X 4AG2A 2XWBI 3UQVA 1FXYA 3HGNA 1HAVB 1NFXA 1BIOA 1GBDA 3SQHE 1FY4A 1MAYA 2FOHA 1O2YA 1TQ7B 2NWNA 1GVZA 4DG4A 1S6HA 3HKIB 3VXFH 4I8GA 1W11U 3PLKA 3BTFE 1MTSA 3ZZ9A 1RJXB 2W5EA 1J8AA 1D4PB 2FWWA 4GVUA 2CN0H 4CH8B 3SBKA 4NCYA 3TK6A 1AFQB 1K1PA 1O2SA 1EZXC 5C1UA 2JH5D 1JOUB 3Q00A 3CENA 1GBHA 2O8TA 1Z6JH 1C2JA 1LQDB 1QHRB 3FZZA 4NFEA 1WU1A 2WUBA 2OTVA 4GCHF 1HBTH 1PPBH 1GBAA 4CBOA 2ZFFH 4RKJB 2GCHF 4NIWA 4GSOA 4OS5A 5JBBS 5DP4A 1TNLA 2P3TB 3P8OA 1KLJH 2GMTC 1WOFA 4AFQA 2PUQH 1DOJA 1RTFB 1GBKA 1P57B 2UWLA 3PLPA 4H6TA 1K1NA 2ASUB 1SLWB 1NFUA 2BLOA 4IN1A 1QRXA 4D76A 2QF3A 1ZSJA 3ZV9A 1SGYE 1GHAG 4Y0ZE 2ZTZA 3MMGA 1INCA 1T8MA 4OS7A 4NZQA 1H1BA 2ZGCA 2W7UA 4UFFH 4BXSA 2VWLA 1IAUA 3HKJB 4J1YA 2VVUA 1C9PA 2ZNKH 1K1IA 2V3HH 3M37A 3KIDU 2RDLA 2C8ZB 1TOCB 3A7VA 1H8IH 4U32A 1DLEA 1ZSKA 2A31A 3Q3KA 4Y7AA 3RXRA 4VGCB 2IOTA 5J4SA 1CO7E 3ATMA 3CP7A 4R0IA 1BBRH 2QV1A 3SNBA 1ELFA 1K28D 3RU4D 1V2NT 1A1RA 1NRQH 1UTLM 1EKBB 4Y71A 1RRKA 1GBBA 2FESH 1GJCB 1DM4B 1E34B 3LJOA 4KGAA 1IQNA 1MAXA 5GPIB 4Y7BA 4ZKRU 3V12A 4D8NA 3A7ZA 2TBSA 3ZYDA 2VIDA 3IITA 7GCHF 1V2RT 2PUXB 1UVUH 2W26A 3AVZA 4IMQA 3PMAB 1EZUC 3MH5A 4AORA 3U9AH 2BD2A 2FZZA 1D9IA 3KQDA 1MQ6A 1TA2A 2ZIQH 1C5TA 4A6LA 5T3HA 4BAMB 1ID5H 1JIRA 3GYMA 1TGNA 2C8XB 2C93B 2H5DA 2CF9H 1GMDG 1FMGA 3SQEE 1A0JA 2SNWA 4TWYA 3A7WA 1CE5A 4D7FA 2ZFPH 2HOBA 4RN6A 3VB4A 8GCHG 1MKWK 1HAOH 1C2FA 3W94A 1C2LA 1W8BH 1KDQA 4AFZA 4JZ1A 3SJ8A 1VR1H 3TH3H 2FS8A 4DY7B 5C20A 3RXHA 2J38A 4AB9A 5E0JA 5ETXA 1EPTA 2AGEX 1BHXF 2PKSC 1P10A 1EJAA 1MZDA 1XMNB 3MU5A 1GMCF 2WV5A 2UUKB 1TBZH 3DT0H 3PM3A 2ZP0H 4FXGH 1GJ4H 3LGVA 3PO1C 1TX6A 1Z8JB 2XTTB 3A87A 3GY4A 1ELTA 1OS8A 1LVOA 1ZRKA 3E90B 1B0EA 1WYKA 2BLQA 1KXCA 2FO9A 4NA8A 3URDA 3TJOA 1QBNA 3GDUA 3MTYA 1KYNA 1SGFA 2A4QA 1D3TB 1FUJA 4FUEA 3U1JB 1KDQB 1LQEA 2QY0B 1OX1A 2FEQH 2R0KA 1ZTKA 3TJUA 2F9NA 4SGBE 1UTOA 1P01A 4O3UA 4I7YH 1GJAB 3MU4A 4FUIA 4YOJA 2AEIH 1EPTB 3A8DA 1DT2A 2NU4E 1ZRBA 3P8NA 2ODQA 4YTAA 3GICB 3V7TA 1ZMJA 1O3CA 4JK6A 4I31A 4FUFA 4IMZA 1HB0B 1LKAA 1BJUA 3TK9A 1O2WA 4Y79A 1SGPE 3D49H 1V2OT 3U8RH 1ZHMA 3BEFB 1NU9A 1TALA 3Q3XA 3RU4T 2O8MA 2WYJA 3PYHA 1YLDA 5ESBA 4ZUHA 3OX7U 3VB5A 2FX6A 4ZAEA 4ASHA 1C1VH 6GCHF 3QZQA 1EZSC 1DY8A 4LZ1H 4NWLA 5TJXA 3FP6E 1GI1A 4FUGA 2A4RA 2FTLE 1MTNC 2P3FH 2FI3E 1HPGA 1ZYOA 4X8SH 1GG6B 1HAIH 1P2OA 1UVTH 4YT6H 1BQYA 5TCAA 1A3EH 2WPKS 1J17T 4BAHB 1ANCA 1TYNA 2EI8A 4JK5A 1UTMA 1C1NA 2A5KA 2ZDVH 1GI8B 4GLYA 1LPGB 1GDUA 1YCPM 4KELA 1BTUA 1DANH 3M3SA 1YP9A 3RU4E 5A09A 3EE0B 1XUFA 3TGJE 1L1GA 1XKBC 1EOJA 1G30B 3QO6A 5AF9H 3ZZBA 2BDCA 1LTOA 1AHTH 1CT2E 1IQIA 3SN8A 2QXJA 3M7UA 4K60A 3TU7H 3B9FH 2AS9A 1QBVH 1ZMLA 3ELAH 2AIQA 4Y10E 2SFAA 3MHWU 1ZTJA 3LU9B 3KEEA 2Y80A 5HM2A 2PTNA 3VPKA 2F83A 5DKMA 3TJVA 1ESBA 1P9UA 1V2QT 1G2MA 2OQ5A 3KHVA 3RDZA 1QL7A 1ESAA 2HLCA 2ZDAH 3QWCH 5AVDA 1LVYA 1UTNA 3MH6A 2UUFB 1O3LA 2F9UA 5EXNA 5LPFA 1O39A 4GHQA 2Z9LA 4KKDA 1EJMA 3E6PH 1HUTH 2WPMS 4XDEA 2BY5X 1GI6A 5FPTA 1GBFA 2NU3E 1TB6H 1TABE 1PPFE 2BDYA 3ZZDA 3PWCA 1QCPA 1X7AC 3UREA 1O2TA 2Q6DA 3OU0A 3RXAA 3UWJH 3BN9A 2VJ1A 1ESTA 1WCZA 4BTTB 4XBDA 2ZECA 1QB1A 2ZGXH 1AI8H 1HXFH 1YGCH 1HFDA 1BBRK 1TWXB 1Y3WA 4AZ2B 2ZO3H 1GBLA 2ODPA 5C2ZA 1TNGA 1YLCA 1XM1A 5DK1A 3UFAA 2C3SA 3B8JA 5DO4H 1YPGH 1TRMA 1RXPA 3EQ0H 1OXGA 1GI0A 3DUXH 2EC9H 1PQ7A 1F2SE 4XBCA 1SBWA 4WMFA 1C5WB 1ZHPA 1RS0A 3OSYA 2V0BA 2VIWA 3P8GA 1SL3A 2A0QB 1LHDH 1O2IA 1BBRE 2ZZUH 2TGPZ 1GHZA 1XUKA 1GBTA 2OC8A 3KQBA 1Z8RA 1DWDH 3KL6A 1C5PA 5HXFA 1A4WH 2KAIB 1MD8A 2SGQE 5PTPA 4YO9A 1ELCA 5EQRA 4TYDA 1QL8A 4VGCC 2QGRA 2EA3A 2AFQB 1BJVA 2PKAA 4JZIA 1HIAA 5FX5A 4TY6A 2ESTE 1O2HA 1UO6A 2H1UA 1P12E 4MG3A 4CHAB 3KNXA 4IS5A 3NZIA 3T25A 4YM9A 4LK4A 1N8OB 1GI5A 1O3FA 4WY3A 2ANWA 1Z8IB 5EQSA 1RIWB 1VJ9U 5CMXH 2HVXA 1AY6H 1C2GA 1ZPBA 1SGDE 4FVDA 4PROA 1Y3XA 5C1YA 3RMNH 1ELAA 3KQCA 3UUZA 1OWHA 2BDBA 3UY9A 1DE7H 3QTVH 5EXMA 1HIAB 5L2ZH 2A7HA 4TWWA 1P9SA 1AUJA 3MO6A 2GX4A 3M5OA 5E8EH 3BSQA 1KXFA 1LPKB 1OYTH 1P2NA 1ARBA 4TPIZ 3C27B 4I32A 3PB1E 3NKKA 3E8LA 2XBXA 2GCTC 5EOKA 1LCYA 1IQEA 2OBQA 1GBJA 4NG9H 3S7KB 3RC5A 3SU3A 3E0PB 4IBLH 1GHXH 1C5QA 4A1VA 4DURA 1GBIA 2DUCA 5CHAB 2TGTA 3TITA 4U30A 3SOSA 5A8YA 3BTEE 1CU1A 3LOXA 1GJ5H 3LKWA 2ANYA 3VB3A 1C5NH 4CRGA 1G3DA 1G36A 4XFQA 4YZUA 3H7OA 4GCHG 5FCRA 1YPMH 1D3QB 1GMHF 1WSSH 1TMTH 2FX4A 3RXJA 5BPEA 1BMAA 1F0SA 2VWOA 5A0AE 5B6OA 1QJ1B 2GCHG 3HGPA 1HAYB 1GL0E 1EPTC 3T28A 3SV2H 3MOCA 1P04A 4HGCA 4MVNA 3G01A 2J95A 4XOJA 1O5CB 2WPIS 1CGJE 4TY7A 1O2MA 1UMAH 3GY6A 1HYLA 3FP7E 4DJZB 1TPOA 2BM2A 1HGTH 8KME2 1PPCE 3PLBA 1FIZA 1O2UA 1BTPA 4MNYA 2FOAA 5AHGH 3T27A 4INHA 2C8WB 2Y5FA 1TE0A 2ANKH 1VCPA 3LH1A 2OP9A 1AVXA 1DDJA 1O2KA 3QGJA 1SGEE 2P94A 5F8TA 1FY5A 2HPQH 1O2VA 2PR3A 4X1QU 4BOHA 1DY9A 3M5NA 1SQTA 4CR5A 2ZHEH 1FAXA 3M3VA 2ZFRH 1ANDA 2HGTH 5C3NA 3MU1A 4AYVB 2FI5E 2ZGBH 1BRBE 5EPNA 1OWDA 3C1KA 1QBOA 4A7IB 3P6ZB 3GCTF 3RC6A 1YCPH 4INKA 1MTUA 1F5RA 1UHBB 1C1PA 2QIQA 1ELDE 3ATKA 3M5LA 1V2MT 7LPRA 1O2GH 1KXDA 3HK3B 2BD8A 2TPIZ 3LGYA 4ISNA 4MPWA 1YPEH 4ISIH 5JDUB 5FX6A 2K1QA 3GY7A 3ZZ4A 3STJA 1EX3A 3MNXA 3RXFA 3BG4B 1SGRE 2QXGA 2XNIA 2Z3CA 1SGIB 4H42U 3L3TA 1P2MA 1XXDA 1SGNE 1Y59T 4XSKU 4K1EA 2H9EH 1PQ8A 1QA7A 2AMPA 1OP0A 1EP5A 2VNTA 2A4GA 2BY8X 4BAQB 5GXPA 1CBWC 3LT3A 3AW1A 4LZ4B 2H2ZA 4AN7A 5DP9A 1E36B 5F03A 3MO3A 4B2BA 1FPCH 3A88A 3QK1A 1MBMA 1FY8E 4ZH8A 3A7XA 1TBRH 2HRVA 1YPHC 3LC5A 2DE8A 1C5MD 2Z9IA 1GMCG 1BDAA 4AGJA 1KXAA 2W3KA 2Y7ZA 5DP5A 3E0NB 2Z3DA 1TPAE 4X2VA 3VGCB 1DSUA 1DPOA 2TGDA 2ZKSA 3V3MA 1SQOA 1T8OA 4AGKA 3A82A 1QRZA 1PPEE 2BVXH 1NS3A 1FLEE 3BTDE 3RXGA 1W14U 1ELVA 2VU8E 1C2DA 1G3BA 1A0LA 1FN8A 2ZTYA 1XVOA 3F6UH 4AFSA 1H8DH 3SJKA 2FXRA 1Q2WA 3UOPA 2FDAA 4JZFH 1UTQA 2J92A 2V35A 1Y3UA 1IQHA 4HZHA 4OGXA 5EODA 1IQGA 4Y6DA 3NUMA 4ABIA 2A32A 3VXEH 5JYIA 5FAHA 1NESE 1SOZA 1BTWA 2ZDKA 3H7TA 3D65E 1S0QA 2B7DH 3SO3A 1IHSH 4O03A 3SU5A 1IQFA 1A7SA 1EASA 1H9HE 3OYPA 1AKSA 1ZGVA 1O32A 1GBEA 2OC7A 1UTKA 4R8TB 3M5MA 4B73A 4F49A 4ABEA 5LH8A 1P2QA 1LHCH 3LONA 2ZHDA 1NRRH 3EAJA 4Y76A 1MH0A 6GCHG 3SHCH 1BTXA 2V3OH 1O30A 3CS0A 2ZFTA 3TGKE 2ZEBA 2PGBB 1O0DH 1VCWA 4DIHH 1QB9A 4K5ZA 2FYRA 2BHGA 4Q7YA 3SU1A 1Z7KA 1EZQA 5K7RA 3VB7A 5AFYH 1A5IA 4UONA 1XXFA 1O3PB 2TGAA 1S5SA 3M7QA 1LVBA 2WINI 4WXVA 3O8CA 1Y5AT 1QL9A 1OKXA 2UWPA 2STBE 1DUEA 4DGJA 5G4BA 2RCEA 4CHAC 5C1XA 1TNHA 1V2WT 1GJ9B 1O3GA 2AIPA 1ANBA 1V2VT 2LPRA 4K1SA 4Q80A 1QJ7B 1P3EA 1W0ZU 2H9TH 2GKVE 4A1TA 1N8OC 1G2LA 3ZZ6A 3QLPH 1RIWC 1Y3YA 4Y8ZA 1DXWA 1SI5H 3RXEA 3S9AA 1DWCH 2GCTB 2XBYA 1O5GH 4E7NA 1AWHB 1JXPA 1QR3E 2BDIA 1DX5M 1SSXA 4X1NU 1EB1H 3TIUA 4ABFA 5DP7A 1PPGE 1V2PT 3HPTB 2H6MA 3DFJA 2JKHA 3TGIE 2FLRH 2CGAA 2F9VA 3ZZ8A 1L1JA 3GDSA 1NY22 1THRH 3ODDA 2FOEA 3RXQA 3MH7A 2FS9A 3TLOA 1N6YA 1BTHH 1DSTA 1HAPH 3RMLH 1GPZA 1E38B 2ILNA 1BUIA 2XWAA 2GV7A 1AE5A 2J94A 2XBVA 5IYTA 3SJOA 3ZVCA 1VGCB 1QQ4A 1O3HA 1O2NA 4I33A 6ESTA 3O8BA 2FOFA 4HFPB 1D6WA 3BF6H 3A86A 2J2UA 5CHAC 1MTVA 2XXLA 1F0UA 1OYQA 4X1PU 2F9BH 4ISHH 1BMMH 3PTBA 2CHAB 1NFWA 1OSSA 4BANB 1NRPH 2G5NA 2R3YA 1P09A 2A1DB 2A7CA 4K8YA 3VFEA 1O3IA 3U98H 2XC0A 1FJSA 4YLUA 4B76A 1ZMNA 1GJ8B 4MNWA 4NIVA 5EW1H 1A5HA 2P59A 1AGJA 4FU8A 3S9CA 4I8KA 5EW2H 2G00A 1YCPK 2VIVA 1SLXB 3PMHB 2ULLA 1QFKH 3MU8A 1YC0A 4ZXYH 1A2CH 1GJBB 4Q7ZA 1GVKB 2ZPQA 3ZZCA 1B7XB 3P92A 1P05A 1UK3A 3SUFA 4AG1A 2Y5GA 3EA9A 4X8TH 1TPPA 4U2WA 4CBNA 8ESTE 2WYGA 4ABAA 2I6QA 4UEHH 1H9IE 1QRWA 2BLVA 4JCNA 1Y5UT 2RG3A 2ZHWH 4ABDA 1DITH 4BNRA 1CSOE 3SU0A 4WVPE 1KIGH 5GCHF 1T32A 4FUJA 1YYY1 1K22H 1NFYA 1UTJA 4LOYH 1O3AA 3S7HB 1K9OE 3K9XB 2FMJA 1AMHA 4INLA 3LIWA 3BEUA 1ETRH 1C9TA 3A8AA 2CF8H 1S85A 2QXHA 1LPZB 4O3TA 5HM9A 3O8DA 1O5BB 1TNKA 4K1TA 5HGGA 3QX5H 2VB0A 2PWXA 1XKAC 1T4UH 1DS2E 3GCHB 1E37B 1WTHD 1CBWB 4I8LA 1V2LT 3ZVFA 3V13A 4YOIA 1GJ6A 1FY1A 2A45B 5E2OA 3O8RA 2I6SA 1C5LH 2HPPH 3OY5U 1L4ZA 1C4Y2 2BY9X 3BG4C 1JRSA 3BTTE 2A2QH 4CRAA 1FPHH 4ZKOU 3PWBA 2VWNA 1QA0A 3GYLB 3URCA 6CHAB 3RXBA 2HALA 2M5TA 1P8VC 3BTGE 2VH0A 1UTPA 5DP3A 1GI9B 2GD4B 1D6RA 2YNAA 2BDAA 1KY9A 4J2YB 1G3CA 2D26C 1EJNA 3ENSB 1C1MA 2AMDA 2BD5A 3OY6U 1NTPA 1GI4A 1Z1JA 1C1SA 2O8WA 3VGCC 1S0RA 2P16A 1F5KU 1KLIH 2EI6A 4DT7B 4Y8YA 3I29A 4NFFA 4X2WA 1H9LB 1NZQH 5DGJA 1C1RA 2CMYA 2EEKA 1GBCA 3E91A 1C2EA 4OS2A 4RKOB 2OC1A 9LPRA 3RXIA 2PV9B 4FVBA 1GMHG 1MZAA 4X2XA 3RC4A 1D3PB 1P11E 1NN6A 5LPEA 3FZDA 1P2JA 2QN5T 3KN2A 2P95A 1C5ZB 3U8OH 2J9NA 3PMJA 5ESTE 3IWMA 1KXBA 3RP2A 1MCTA 3SORA 2F9OA 3Q3YA 2QC2A 1O2QA 1O3JA 1C2MA 3QN7A 1IOEA 1HV7A 4UDWH 1FONA 4D7GA 1HAGE 2WPLS 4WF8A 4ZHAA 4JMYA 3ATLA 3VEQB 4Z6AH 2RA3A 1O2XA 1FDPA 1DVAH 3TNTA 3H5CB 1PPHE 1GBMA 4DCDA 1Q31A 3EDXB 1SGCA 2Z94A 1BRUP 3SU6A 2H9HA 2ODYB 3UPEA 1CHGA 3BTME 3UR6A 1BT7A 2Y7XA 3SNCA 5L30H 4D9RA 1FQ3A 1BMNH 2OQUA 2SGPE 3T29A 1GCTB 5SGAE 1UK4A 1V2KT 5C67A 3RLYH 1O2LA 4K69A 1GGDB 3MI4A 1PQAA 4OS4A 1MCVA 2WV4A 2XYAA 2ZGHA 1TOMH 1AVWA 1A61H 1O2PA 2YOLA 4AX9H 4X8VH 1V2ST 3R0FA 1DXPA 3GCTG 1S81A 2PKAB 2G5VA 2OINA 1V6DA 1Z8GA 4JYTA 2Y82A 4HTCH 5E0GA 2VGCB 3SNDA 4NZLA 4WWYA 3RXVA 4AOQA 5AFZH 2WPJS 1NM6A 1EOLA 1VCQA 5FBEA 4UFGH 4X6PA 2ZA5A 3GOVB 1SMFE 3WY8A 1CHOF 3MFJA 3BTWE 1C4V2 1CVWH 1AE8H 1LDTT 4ABHA 3LGWA 1VITH 4MNVA 4JYUH 3LGUA 3Q77A 1WUNH 5A8XA 2BQWB 1F0TA 2XRCA 2QAAA 1O5FH 3UNRA 2ZQ2A 1TX7A 1ZLRA 1GHYH 1VITG 1ZOMA 1TPSA 4Q2KA 2W3IA 3RLWH 2HNTC 4B2AA 4X6MA 4Z0KA 1F7ZA 2LNCA 2VWMA 4NSVA 4X0WU 5H4IB 1JWTA 4NA7A 1HAZB 1ABIH 1MU8B 2B5TB 2W7SA 5IDKA 3RUOA 1UVSH 1UVPA 4LXBH 1C5VA 1XVMA 1VGCC 2CV3A 3A7TA 3NCLA 1HLTH 4MNXA 4BXWA 1TQ0B 1G9IE 1LHGH 1KLTA 1LO6A 4F4OC 3ZVBA 4WJG2 3S0NA 1GI2A 1LMWB 3A81A 1MMJN 1O3EA 2CHAC 4Y11E 3TNSA 1HAHH 1SG8B 3SI4H 1C5OH 3TH2H 3TPIZ 1TIOA 1IQJA 1MKXH 2BQ7B 1YPLH 1TONA 1ABJH 3P17H 2ZDLA 4MTBA 1HJAB 4BTUB 1L4DA 1O34A 4THNH 5L2YH 4FUBA 3LPRA 3F9HA 2BD4A 1SHHB 4ZHMU 2ANMH 4NWKA 3ZVEA 3MYWA 1HCGA 3R3GB 1FIWA 1ZPCA 4CRCA 4UE7H 1BTZA 1SFQB 2THFB 5F8XA 3LJJA 1SPJA 2ZCKP 3S9BA 1O5EH 1OWEA 4WMDA 2A5AA 2BTCE 3A8BA 3GCOA 1BRCE 1B0FA 2XCNA 1A3BH 3TJNA 1N6XA 1NC6A 1YPKH 1FI8A 4E06H 1D3DB 4ZHLU 5E2PA 3SUDA 3JZ1B 4DW2U 2VVVA 3RXSA 5I46H 1WV7H 4U01A 1LKBA 3U8TH 4O9VA 2JH6D 4Y0YE 4DIIH 1JRTA 2BOHB 4D9QA 1EXFA 2ZU1A 1C1QA 3SUGA 1PFXC 4GUXA 1YBWA 1N1LA 1O3NA 2ZF0H 2Z3EA 3T62A 4FUDA 4ZKNU 2B8OH 1SGTA 1O3DA 3U69H 1FNIA 1UJ1A 2XCFA 1S6FA 2B9LA 3B23B 3BTHE 1BTYA 4GHTA 1TGTA 4X6OA 2JH0D 3GCHC 3RM0H 1C5UA 2Z7FE 2TRMA 5DG6A 5LPRA 1QB6A 4MPVA 1V2UT 1VITF 2ZFSA 1TNJA 3ITIA 1O3BA 1JBUH 1MD7A 2SGFE 3UNQA 4BAKB 3A89A 3A8CA 1Z6EA 3QTOH 2Z6BD 3ZZAA 3F9EA 2FODA 1AUTC 3AW0A 1ELBA 2PSXA 1KTTB 5HMAA 3SGBE 4AB8A 4AFUA 2ZCLP 6CHAC 1K1MA 4YESB 3SHAH 2PGQB 1AB9B 1V2JT 3GY5A 8LPRA 3LH3A 1KTSB 4WH8A 1CA0B 3UOUA 3NK8A 1SVPA 2BY6X 2IJOB 1QNJA 1HRTH 1J9CH 1MTWA 3K6ZA 2VIOA 2O8UA 3KF2A 2DE9A 3L33A 1IQLA 1C5XB 4JZEH 4K8BA 4B1TA 1P2IA 1AU8A 4UFDH 3AAVA 1TFXA 2QXIA 1O3MA 1G37A 1EAXA 3MU0A 2C90B 5K0HA 1O35A 1OWIA 3EGKH 2GTBA 2G52A 2SGAA 2JETB 5GJ4B 1BRAA 5C5NA 1SGFG 1F92A 1NO9H 3T5FH 1XUHA 2Z9KA 1TGSZ 2ALPA 2FOMB 5EG4A 2BD7A 1KXEA 1QGFA 1GCDA 1MU6B 2VIQA 1QIXB 5ABWA 2BD3A 5EU8A 2BVSH 2GZ9A 2OC0A 1BA8B 1SLUB 1UVOA 1K1LA 1O38A 1UK2A 2BZAA 1O2RA 2UUJB 3T2NA 2J34A 2GZ7A 1AIXH 2D2DA 2G4TA 4KP0A 1O3OA 4RSPA 3ATIA 3I77A 1W12U 1C1UH 1AKSB 5JPMH 2XBWA 2P8OB 2VIPA 3BEIB 4A1XA 2PTCE 2B0FA 5GCHG 1ZSLA 1TBQH 4NIXA 2ZDMA 3GY3A 2FTMA 3ODFA 2TIOA 1NT1A 1UCYH 2ZWLH 1EQ9A 3M3TA 6LPRA 9ESTA 1VZQH 2Z9JA 3N7OA 4I8JA 2OLGA 1DUAA 1GCTC 1P03A 5T6FA 2BQ6B 3SI3H 5F6MA 1O33A 1GL1A 2QA9E 4YT7H 1BZXE 1GGDC 2FOBA 2BLWA 3ZVGA 3QUMP 2BYAX 5I25A 4SGAE 1A5GH 2ZU3A 3UIRA 4FUHA 1EUFA 3E16B 3EA8A 5JBCS 1HAXB 1WQSA 4UFEH 1NRSH 1VJAU 1CGHA 2ZTXA 3MO9A 2VGCC 1W10U 1ETSH 1O36A 1L1NA 2G55A 2HNTF 1T7CA 1HJ9A 1GHWH 2PHBA 5J4QA 1BHXB 2AERH 1OWKA 5GWZA 2GT7A 4KTSA 4YLQH 3UTUH 2V6NA 4CRBA 1BCUH 2FPZA 4MLFB 1MKXK 4XBBA 1EAUA 4HI3A 1GVLA 1GDNA 1OP2A 3I78A 3HATH 4TPYA 1O3KA 2FP7B 2CJIA 4MDSA 2FI4E 3SU4A 2QF0A 4ABJA 5EPYA 2BDHA 1O2JA 1GHBG 1T4VH 1ZJDA 3ZZ7A 4CRDA 5TCCA 1EB2A 1QQUA 3UQOA 4DOQA 4BAOB 3P95A 2PW8H 2Y81A 1C1TA 3E3TA 3L6PA 1SHYA 1HXEH 5BRRE 1ARCA 1ZTLA 1GHAF 2R2WU 2ZPRA 7KMEH 3QGNB 3KQEA 3A85A 3AAUA 2ZPSA 4I8HA 3SZNA 3P70B 5JB9S 1RFNA 1FY3A 1C1WH 4CRFA 3M35A 5FHTA 2R0LA 5L6NH 2A5IA 1WQVH 4B2CA 2NU1E 3RXCA 2NU2E 1W7XH 2ALVA 1DFPA 1O5AB 4OS6A 1ORFA 1C4U2 2GDEH 3RXKA 1AZ8A 1AFEH 5LGOA 2IN2A 1CT4E 1JMOH 1L2EA 1QURH 3LDXH 4Q7XA 3PMBB 4X2YA 3M61U 3RXDA 3IG6B 2VINA 1RD3B 4ISLA 2R9PA 1SLVB 2BX4A 7ESTE 1GI7B 1HJAC 1ELEE 1PPZA 4WXIA 1DICA 4E7RG 2IPHA 1BMLA 4A92A 2BOKA 4E05H 1NPMA 1B5GH 2Q6GA 5FCKA 1HNEE 4IN2A 3K65B 1RTLA 2G8TA 3A7YA 1GMDF 3QDZB 1EAIA 2BD9A 1C5YB 1QJ6B 1YKTA 4ABBA 1IHTH 1THSH 3RM2H 3T26A 2XC5A 1T8NA 2VH6A 2Y5HA 3M7TA 3MNCA 1K1JA 1XX9A 8GCHF 3GY2A 3ZVAA 4FUCA 1W7GH 1GI3A 4WMEA 1DLKB 1ELGA 2ZU2A 5EXLA 3SGAE 2C8YB 2QYIA 3SNAA 1EAWA 4CH2B 1NROH 1KSNA 1WAYB 3BG8A 1EATA 3TVJB 3RXTA 3ZYEA 1ZR0A 1PYTC 3MNSA 4FU9A 3F1SB 1P06A 1YF4A 1AVGH 3BV9B 3E1XB 2VVCA 1O2OA 2SGEE 2AGGX 3SUEA 1S82A 2HNTE 2G51A 1SC8U 1C5SA 3Q76A 2AGIX 1JIMA 3RXMA 5DP6A 1T8LA 2HWLB 3SV6A
chains in the Genus database with same CATH superfamily
1ZGIA 1GHBF 1SOTA 2WPHS 4AYYB 2XC4A 4IW4E 1O5DH 4KTCA 3ZZ3A 1CHOG 2ZDNA 2FYQA 2UUYA 3SV8A 3OEHD 3K2UA 4X1RU 3UB0A 4O97A 3SJ9A 2AMQA 3GISB 4DVAU 2GV6A 4JZDH 4CR9A 1FX0B 1P02A 4IGDA 1NRNH 4Q63A 1W0YH 5FBIA 3RMMH 2GMTB 3F2FA 1PQ5A 1TLDA 2A2XH 3A80A 4KTUA 1FV9A 3U1IB 2A7JA 3W95A 1O37A 3JZ2B 3D23A 4K2YA 1TNIA 2QCYA 1AFQC 4QT8C 1AB9C 4H4FA 1MBQA 5E0HA 2F3CE 1TA6A 5EQQA 3TK5A 3DHKH 3M36A 2GT8A 4P02A 5T6DA 1AN1E 3BIVH 3CNRA 2G4UA 2XW9A 1IQKA 3RXOA 1EP6A 1CA0C 4X6NA 1GJDB 1AO5A 1MQ5A 1BITA 2BB4A 2EI7A 1C5RA 1T31A 3NXPA 4IC6A 2KAIA 2WUCA 4ZKSU 2VBCA 3OTJE 4UD9H 2G81E 5CE1A 3VB6A 1OWJA 1U6QA 1WTGH 1UCYK 4B71A 5DP8A 3SV7A 3ZV8A 4FU7A 4B6EA 1H4WA 1K21H 4GAWA 2SGDE 3BTQE 2JETC 3SU2A 5A0BA 5A2MH 2XOKD 4ISOA 2Z9GA 3RMOH 5DSFA 2L74A 2GP9B 3ESTA 3PTNA 2FOCA 3P8FA 1DWBH 5A8ZA 2J4IA 3FP8E 1RGQA 1XUGA 3EA7A 1Q3XA 1Z71A 1K1OA 1SQAA 3DSOA 4B74A 1BOQA 1J15A 1TRYA 1RTKA 1MABB 1GHVH 2F91A 3FVFB 1NU7B 1P3CA 1THPB 2M2AA 2ZCHP 5DPAA 2H5CA 2FIRH 2OXSA 4RT0A 3KGPA 2ZU5A 3F9GA 3FANA 3EYDA 3DD2H 4ABGA 1UCYE 3CS7A 3SNEA 3MWIU 1A0HB 5FXLA 5HYOA 3LGTA 4X1SU 2FLBH 1G32B 3BTKE 4NA9H 1W3CA 3V0XA 1Y8TA 3K6YA 3MH4A 2P8OC 3RXPA 4Y8XA 1AD8H 2OUAA 1W13U 4H6SB 1YPHE 1OP8A 1AZZA 1OPHB 5C5OA 5JB8S 2PKSB 3UNSA 2J98A 5FPYA 1ZJKA 3ZZ5A 2R2MB 2A4OA 3GCNA 1LHEH 3PO1B 4CREA 4B75A 2JIZD 4WH6A 4XE4A 1ZPZA 3FKSD 4YOGA 3RXLA 3FAOA 1G3EA 5HIYA 2STAE 1TMUH 1K0HA 4ZROA 1F0RA 2OCVB 3UR9A 1SB1H 2P3UB 1ETTH 2J5UA 4M7GA 5GDSH 2BMGB 2P93A 1DWEH 2UWOA 2ZU4A 5JBAS 3TH4H 1LVMA 2BX3A 5DJ7A 3UWIA 1C1OA 2R3UA 4X8UH 3NPSA 3OFND 1BB0B 1TGBA 1TRNA 2NU0E 3PV4A 4ESTE 2FM2A 2GDDA 2ZI2H 4A5TS 2ZHFH 3QZRA 1J16A 2J98B 1GJ7B 2Y6TA 1XUJA 1MKWH 3A83A 2RA0A 1GDQA 1L0ZA 1K2I1 4MQAA 1W2KH 4JYVH 1OOKB 3HK6B 1E0FD 1P2KA 4NGAH 3S69A 1QTFA 1CQQA 1V3XA 2BVRH 3AK5A 2Q1JA 1O2ZA 3DCLA 3SV9A 4BTIB 1Y3VA 2C4FH 1SFIA 2ZQ1A 5T6GA 3BIUH 2Q6FA 3PROA 1J14A 2PSYA 1S83A 1QY6A 1XUIA 4YXWD 3RXUA 1C2KA 3GDVA 2ZC9H 3D62A 2GGVB 1HDTH 1YM0A 3ZVDA 1MTNB 2O9QA 2ZG0H 1Y5BT 3LGIA 2F9PA 3FFGA 3FO8D 1FN6A 3A84A 4ZXXH 5F8ZA 1ANEA 2GZ8A 4OS1A 1C2HA 3LC3A 1ZHRA 1V2TT 5FPSA 2CXVA 1FZZA 1Z1IA 3NWUA 2O8LA 1ZZZA 1CGIE 3GY8A 3AASA 3SJIA 3F9FA 4NIYA 4NSYA 1UHBA 5GIBA 4GPGA 2D1JA 2GVFA 1S84A 2BXTH 2ZHQH 2AYWA 1FAKH 1PYTD 3SW2B 3STIA 1TMBH 1GWAA 1WBGB 3F68H 4MPUA 2SNVA 1M9UA 1TGCA 2D8WA 1MUEB 1E35B 1AQ7A 1IQMA 2YNBA 1GG6C 1HAVA 1SR5C 4K3JA 4OGYA 4IC5A 3MNBA 1TAWA 2BZ6H 1F5LA 1P0SH 2OD3B 1LHFH 3OAAD 2BDGA 3DA9B 1ACBE 1O31A 1TX8A 2OBOA 1SGQE 1AWFH 1CA8B 1C2IA 2ZFQH 2BXUH 1A46H 3KCGH 1HJ8A 1PJPA 5EJLA 1CT0E 4ZMAH 5JBTA 2FOGA 2PLXA 3SGQE 2PFEA 2AH4X 3ATWA 7GCHG 4XD7D 5EGMA 5A0CA 4MPXA 1YPJH 3DFLA 2ZGJA 2BY7X 4AG2A 2XWBI 3UQVA 1FXYA 3HGNA 1HAVB 1NFXA 1BIOA 1GBDA 3SQHE 1FY4A 1MAYA 2FOHA 1O2YA 1TQ7B 5EIYA 2NWNA 1GVZA 4DG4A 1S6HA 3HKIB 3VXFH 4I8GA 1W11U 3PLKA 3BTFE 1MTSA 3ZZ9A 1RJXB 2W5EA 1J8AA 1D4PB 2FWWA 4GVUA 2CN0H 4CH8B 3SBKA 4NCYA 3TK6A 1AFQB 1K1PA 1O2SA 1EZXC 5C1UA 2JH5D 1JOUB 3Q00A 3CENA 1GBHA 2O8TA 1Z6JH 1C2JA 1LQDB 1QHRB 3FZZA 4NFEA 1WU1A 2WUBA 2OTVA 4GCHF 1HBTH 1PPBH 1GBAA 4CBOA 3F2HA 2ZFFH 4RKJB 2GCHF 4NIWA 4GSOA 4OS5A 5JBBS 5DP4A 1TNLA 2P3TB 3P8OA 1KLJH 2GMTC 1WOFA 4AFQA 2PUQH 1DOJA 1RTFB 1GBKA 1P57B 2UWLA 3PLPA 4H6TA 1K1NA 2ASUB 1SLWB 1NFUA 2BLOA 4IN1A 1QRXA 4D76A 2QF3A 1ZSJA 3ZV9A 1SGYE 2WPDD 1GHAG 4Y0ZE 2ZTZA 3MMGA 1INCA 1T8MA 4OS7A 4NZQA 1H1BA 2ZGCA 2W7UA 4UFFH 4BXSA 2VWLA 1IAUA 3HKJB 4J1YA 2VVUA 1C9PA 2ZNKH 1K1IA 2V3HH 3M37A 1EFRD 3KIDU 2RDLA 2C8ZB 1TOCB 3A7VA 1H8IH 4U32A 1DLEA 1ZSKA 2A31A 3Q3KA 4Y7AA 3RXRA 4VGCB 2IOTA 5J4SA 1CO7E 3OTPA 3ATMA 3CP7A 4R0IA 1BBRH 2QV1A 3SNBA 1ELFA 1K28D 3RU4D 1V2NT 1A1RA 1NRQH 1UTLM 1EKBB 4Y71A 1RRKA 1GBBA 2FESH 1GJCB 1DM4B 1E34B 3LJOA 4KGAA 1IQNA 1MAXA 5GPIB 4Y7BA 4ZKRU 3V12A 4D8NA 3A7ZA 2TBSA 3ZYDA 2VIDA 3IITA 4P00A 7GCHF 1V2RT 2PUXB 1UVUH 2W26A 3AVZA 4IMQA 3PMAB 1EZUC 3MH5A 4AORA 3U9AH 2BD2A 2FZZA 1D9IA 2WHXA 3KQDA 1MQ6A 1TA2A 2ZIQH 1C5TA 4A6LA 5T3HA 4BAMB 1ID5H 1JIRA 3GYMA 1TGNA 2C8XB 2C93B 2H5DA 2CF9H 1GMDG 3OEED 1FMGA 3SQEE 1A0JA 2SNWA 4TWYA 3A7WA 1CE5A 4D7FA 2ZFPH 2HOBA 4RN6A 3VB4A 8GCHG 1MKWK 1HAOH 1C2FA 3W94A 1C2LA 1W8BH 1KDQA 4AFZA 4JZ1A 3SJ8A 1VR1H 3TH3H 2FS8A 4DY7B 5C20A 3RXHA 2J38A 4AB9A 5E0JA 5ETXA 1EPTA 2AGEX 1BHXF 2PKSC 1P10A 1EJAA 1MZDA 1XMNB 3MU5A 1GMCF 2WV5A 2UUKB 1TBZH 3DT0H 3PM3A 2ZP0H 4FXGH 1GJ4H 3LGVA 3PO1C 1TX6A 1Z8JB 2XTTB 3A87A 3GY4A 1ELTA 1OS8A 1LVOA 1ZRKA 3E90B 1B0EA 1WYKA 2BLQA 1KXCA 2FO9A 4NA8A 3URDA 3TJOA 1QBNA 3GDUA 3MTYA 1KYNA 1SGFA 5KECA 2A4QA 1D3TB 1FUJA 4FUEA 3U1JB 1KDQB 1LQEA 2QY0B 1OX1A 2FEQH 2R0KA 1ZTKA 3TJUA 2F9NA 4SGBE 1UTOA 1P01A 4O3UA 4I7YH 1GJAB 2KCAA 3MU4A 4FUIA 4YOJA 2AEIH 1EPTB 3A8DA 1DT2A 2NU4E 1ZRBA 3P8NA 2ODQA 4YTAA 3GICB 3V7TA 1ZMJA 1O3CA 4JK6A 2YMSB 4I31A 4FUFA 4IMZA 1HB0B 1LKAA 1BJUA 2KCOA 3TK9A 3ZIAD 1O2WA 4Y79A 1SGPE 3D49H 1V2OT 3U8RH 1ZHMA 3BEFB 1NU9A 1TALA 3Q3XA 3RU4T 4B6FA 2O8MA 2WYJA 3PYHA 1YLDA 5ESBA 4ZUHA 3OX7U 3VB5A 2FX6A 4ZAEA 4ASHA 1C1VH 6GCHF 3QZQA 1EZSC 1DY8A 4LZ1H 4NWLA 5TJXA 3FP6E 1GI1A 4FUGA 4XRNA 3UAIC 2A4RA 2FTLE 1MTNC 2P3FH 2FI3E 1HPGA 1ZYOA 4X8SH 1GG6B 1HAIH 1P2OA 1UVTH 4YT6H 2PP6A 1BQYA 5TCAA 1A3EH 2WPKS 1J17T 4BAHB 1ANCA 4DT4A 1TYNA 2EI8A 4JK5A 1UTMA 4FETA 1C1NA 2A5KA 2ZDVH 1GI8B 4GLYA 1LPGB 1GDUA 1YCPM 4KELA 4OM9A 1BTUA 4RT1A 3SYJA 1DANH 3M3SA 1YP9A 3RU4E 5A09A 3EE0B 1XUFA 3TGJE 1L1GA 1XKBC 1EOJA 1G30B 3QO6A 2IPQX 3ZZBA 5AF9H 2BDCA 3WWFA 1LTOA 1AHTH 1CT2E 1IQIA 3SN8A 2QXJA 3M7UA 4K60A 3TU7H 3B9FH 2AS9A 1QBVH 1ZMLA 3ELAH 2AIQA 4Y10E 2SFAA 3MHWU 1ZTJA 3LU9B 3KEEA 2Y80A 5HM2A 2PTNA 1H8HD 3VPKA 2F83A 5DKMA 3TJVA 1ESBA 1P9UA 1V2QT 1G2MA 2OQ5A 3KHVA 3RDZA 4ZCNA 1QL7A 1ESAA 2HLCA 2ZDAH 3QWCH 5AVDA 1LVYA 1UTNA 3MH6A 2UUFB 1O3LA 2F9UA 5EXNA 5LPFA 2OK5A 1QZ8A 1O39A 4GHQA 2Z9LA 4KKDA 1EJMA 3E6PH 3F0PA 1HUTH 2WPMS 4XDEA 2BY5X 1GI6A 5FPTA 1GBFA 2NU3E 1TB6H 1TABE 1PPFE 2BDYA 3ZZDA 3PWCA 1QCPA 1X7AC 3UREA 1O2TA 2Q6DA 3OU0A 3RXAA 3UWJH 3BN9A 2VJ1A 1ESTA 3WWBA 1WCZA 4BTTB 4XBDA 2QF5A 2ZECA 1QB1A 2ZGXH 1AI8H 1HXFH 1YGCH 1HFDA 1BBRK 1TWXB 1Y3WA 4AZ2B 2ZO3H 1GBLA 2ODPA 5C2ZA 1TNGA 1YLCA 1XM1A 4RI0A 5DK1A 3UFAA 2C3SA 3B8JA 5DO4H 1YPGH 1TRMA 1RXPA 3EQ0H 2LELA 1OXGA 1GI0A 3DUXH 2EC9H 1PQ7A 1F2SE 4XBCA 1SBWA 4WMFA 1C5WB 1ZHPA 1RS0A 3OSYA 2V0BA 2VIWA 3GS9A 3P8GA 1SL3A 2A0QB 1LHDH 1O2IA 1BBRE 2ZZUH 2TGPZ 1GHZA 5HIZA 1XUKA 1GBTA 2OC8A 3KQBA 1Z8RA 1DWDH 3KL6A 1C5PA 5HXFA 1A4WH 2KAIB 1MD8A 2SGQE 5PTPA 4YO9A 1ELCA 5EQRA 4TYDA 1QL8A 4VGCC 2QGRA 2EA3A 2AFQB 1BJVA 2PKAA 4JZIA 1HIAA 5FX5A 4TY6A 2ESTE 1O2HA 1UO6A 2H1UA 1P12E 4MG3A 4CHAB 3KNXA 4IS5A 3NZIA 3T25A 5GNDA 4YM9A 4LK4A 1N8OB 1GI5A 1BMFD 1O3FA 4WY3A 2ANWA 1Z8IB 5EQSA 1RIWB 1VJ9U 5CMXH 2HVXA 1AY6H 1C2GA 1ZPBA 1SGDE 4FVDA 1NBMD 4PROA 1Y3XA 5C1YA 3RMNH 1ELAA 3KQCA 3UUZA 1OWHA 2BDBA 3UY9A 1DE7H 3QTVH 5EXMA 1HIAB 5L2ZH 2A7HA 4TWWA 5T1VA 1P9SA 1AUJA 1SKYE 2GX4A 3M5OA 3MO6A 3BSQA 5E8EH 1KXFA 1LPKB 1OYTH 1P2NA 1ARBA 4TPIZ 3C27B 4I32A 3PB1E 3NKKA 3E8LA 2XBXA 2GCTC 5EOKA 1LCYA 1IQEA 2OBQA 1GBJA 2V7QD 4NG9H 3S7KB 3VG8A 3RC5A 3SU3A 3E0PB 4IBLH 1GHXH 1C5QA 4A1VA 4DURA 1GBIA 2DUCA 5CHAB 2TGTA 3TITA 4F48B 4U30A 3SOSA 5A8YA 3BTEE 1CU1A 3LOXA 1GJ5H 3LKWA 2ANYA 3VB3A 1C5NH 4CRGA 1G3DA 1G36A 4XFQA 4YZUA 3H7OA 4GCHG 5FCRA 1YPMH 1D3QB 1GMHF 1WSSH 1TMTH 2FX4A 5EJZA 3RXJA 5BPEA 1BMAA 1F0SA 2VWOA 5A0AE 5B6OA 1QJ1B 2GCHG 3HGPA 1HAYB 1GL0E 1EPTC 3T28A 3SV2H 3MOCA 1P04A 4HGCA 4MVNA 3G01A 2J97A 2J95A 4XOJA 1O5CB 2WPIS 1CGJE 4TY7A 1O2MA 1UMAH 3GY6A 1HYLA 3FP7E 3N7DA 4DJZB 1COWD 1TPOA 2BM2A 2YMSC 1E79D 1HGTH 8KME2 1PPCE 3PLBA 1YY3A 1FIZA 1O2UA 1BTPA 4MNYA 2FOAA 5AHGH 3T27A 4INHA 2C8WB 2JDID 2Y5FA 1TE0A 2ANKH 1VCPA 3LH1A 2OP9A 3KYGA 1AVXA 1DDJA 1O2KA 2QF4A 3QGJA 1SGEE 2K0QA 2P94A 5F8TA 1FY5A 2HPQH 1O2VA 1W0KD 2PR3A 4X1QU 4BOHA 1DY9A 3M5NA 1SQTA 4CR5A 5FL7D 2ZHEH 1FAXA 2WSSD 3M3VA 3U28C 2ZFRH 1ANDA 2HGTH 5C3NA 3MU1A 4AYVB 2FI5E 2ZGBH 1BRBE 2CK3D 1OWDA 5EPNA 3C1KA 1QBOA 4A7IB 4ASUD 3P6ZB 3GCTF 3RC6A 1YCPH 4INKA 1MTUA 1F5RA 1UHBB 1C1PA 2QIQA 1ELDE 3ATKA 3M5LA 1V2MT 7LPRA 1O2GH 1KXDA 3HK3B 2BD8A 2TPIZ 3LGYA 4ISNA 4MPWA 1YPEH 4ISIH 5JDUB 5FX6A 2K1QA 2JJ2D 3GY7A 3STJA 3ZZ4A 1EX3A 3MNXA 3RXFA 3SZEA 3BG4B 1SGRE 2QXGA 5F53A 2XNIA 2Z3CA 1SGIB 4H42U 3L3TA 1P2MA 1XXDA 1SGNE 5C94A 1Y59T 1NBME 4XSKU 4AC9A 4K1EA 2H9EH 1PQ8A 1QA7A 2AMPA 1KMHB 1OP0A 1EP5A 2VNTA 2A4GA 2BY8X 4BAQB 5GXPA 1CBWC 3LT3A 3AW1A 4LZ4B 2H2ZA 4AN7A 5DP9A 1E36B 5F03A 3MO3A 4B2BA 1FPCH 3A88A 3QK1A 1MBMA 1FY8E 4ZH8A 3A7XA 1TBRH 2HRVA 1YPHC 3LC5A 2DE8A 1C5MD 2Z9IA 1GMCG 1BDAA 2EY4C 2KCYA 4AGJA 1KXAA 2W3KA 2Y7ZA 5DP5A 3E0NB 2Z3DA 1TPAE 4X2VA 3VGCB 1DSUA 1DPOA 2TGDA 2ZKSA 2WV9A 3V3MA 1SQOA 1T8OA 4AGKA 3A82A 1QRZA 1PPEE 2BVXH 1NS3A 1FLEE 3BTDE 3RXGA 1W14U 1ELVA 2VU8E 1C2DA 1G3BA 1A0LA 1FN8A 2ZTYA 1XVOA 3F6UH 4AFSA 1H8DH 3SJKA 2FXRA 1Q2WA 3UOPA 2FDAA 4JZFH 1UTQA 2J92A 2V35A 1Y3UA 1IQHA 4HZHA 4OGXA 5EODA 1IQGA 4Y6DA 3NUMA 4ABIA 2A32A 3VXEH 5JYIA 5FAHA 1NESE 1SOZA 1BTWA 2ZDKA 3H7TA 3D65E 1SQRA 1S0QA 2B7DH 3SO3A 1IHSH 4O03A 3SU5A 1IQFA 1A7SA 1EASA 1H9HE 3OYPA 1AKSA 1ZGVA 1O32A 1GBEA 2OC7A 1UTKA 3F0OA 1VKYA 3M5MA 4R8TB 4B73A 4F49A 4ABEA 5LH8A 1P2QA 1LHCH 3LONA 2ZHDA 1NRRH 3EAJA 4Y76A 1MH0A 6GCHG 3SHCH 1BTXA 2V3OH 1O30A 3CS0A 2ZFTA 3TGKE 2ZEBA 2KZ4A 2PGBB 1O0DH 1VCWA 4DIHH 1QB9A 4K5ZA 2FYRA 4Q4LA 2BHGA 4Q7YA 3SU1A 1Z7KA 1EZQA 5K7RA 3VB7A 5AFYH 1A5IA 4UONA 1XXFA 1O3PB 2TGAA 1S5SA 3M7QA 1LVBA 2WINI 4WXVA 3O8CA 1Y5AT 1QL9A 1OKXA 2UWPA 2STBE 1DUEA 4DGJA 5G4BA 2RCEA 4CHAC 5C1XA 1TNHA 1V2WT 1GJ9B 1O3GA 2AIPA 1ANBA 1V2VT 2LPRA 4K1SA 4Q80A 1QJ7B 1P3EA 1W0ZU 2H9TH 2GKVE 4A1TA 1N8OC 1G2LA 3ZZ6A 3QLPH 1UW7A 1RIWC 1Y3YA 4Y8ZA 1DXWA 1SI5H 3RXEA 3S9AA 1DWCH 2GCTB 3KYFA 2XBYA 1O5GH 3FN8A 4E7NA 1AWHB 1JXPA 1QR3E 2BDIA 1DX5M 1SSXA 4X1NU 1EB1H 3TIUA 4ABFA 5DP7A 1PPGE 1V2PT 3HPTB 2H6MA 3DFJA 2JKHA 3TGIE 2FLRH 2CGAA 2F9VA 3ZZ8A 1L1JA 3GDSA 1NY22 1THRH 3ODDA 2FOEA 2KFWA 3RXQA 3MH7A 2FS9A 3TLOA 1N6YA 1BTHH 1DSTA 1W0JD 1HAPH 3RMLH 1GPZA 1E38B 2ILNA 1BUIA 2XWAA 2GV7A 1AE5A 2YMSD 5C0TA 5C0UA 2J94A 2XBVA 5IYTA 3SJOA 3ZVCA 1VGCB 1QQ4A 1O3HA 1O2NA 4I33A 6ESTA 3O8BA 2FOFA 4HFPB 1D6WA 3BF6H 3A86A 2J2UA 5CHAC 1MTVA 2XXLA 1F0UA 1OYQA 4X1PU 2F9BH 4ISHH 1BMMH 3PTBA 2CHAB 1NFWA 1OSSA 3N7EA 5KEDA 4BANB 2WZQA 1NRPH 2G5NA 2R3YA 1P09A 2A1DB 2A7CA 4K8YA 3VFEA 1O3IA 3U98H 2XC0A 1FJSA 4YLUA 4B76A 1ZMNA 1GJ8B 4MNWA 4NIVA 5EW1H 1A5HA 2P59A 1AGJA 4FU8A 3S9CA 4I8KA 5EW2H 2G00A 1YCPK 2VIVA 1E1RD 1SLXB 3PMHB 2ULLA 1QFKH 3MU8A 1YC0A 4ZXYH 1A2CH 1GJBB 4Q7ZA 1GVKB 2ZPQA 3ZZCA 1B7XB 3W1EA 3P92A 1P05A 1UK3A 3SUFA 4AG1A 2Y5GA 2V3MA 3EA9A 4X8TH 1TPPA 4U2WA 4CBNA 8ESTE 2WYGA 4ABAA 2I6QA 4UEHH 1YLNA 1H9IE 1QRWA 2BLVA 4JCNA 1Y5UT 2RG3A 2ZHWH 2XNDD 4ABDA 1DITH 5EJ1A 4BNRA 1CSOE 3SU0A 4WVPE 1KIGH 5GCHF 1T32A 4FUJA 1YYY1 1K22H 1NFYA 1UTJA 4LOYH 1O3AA 3S7HB 1K9OE 3K9XB 2FMJA 1AMHA 4INLA 3LIWA 3BEUA 1ETRH 1C9TA 4ACAA 3A8AA 2CF8H 2GJGA 1S85A 2QXHA 1LPZB 4O3TA 5HM9A 3O8DA 1O5BB 1TNKA 4F55A 4K1TA 5HGGA 3QX5H 2VB0A 2PWXA 1XKAC 1T4UH 1DS2E 3GCHB 1E37B 1WTHD 1CBWB 4I8LA 1V2LT 3ZVFA 3V13A 4YOIA 3PV5A 1GJ6A 2KCPA 1FY1A 2A45B 5E2OA 5B6LA 2I6SA 3O8RA 1C5LH 2HPPH 3OY5U 1L4ZA 1C4Y2 2BY9X 3H09A 3BG4C 1JRSA 3BTTE 2A2QH 4CRAA 1FPHH 4ZKOU 3PWBA 2VWNA 1QA0A 3GYLB 5CHBA 3URCA 6CHAB 3RXBA 2HALA 2JJ1D 1P8VC 2M5TA 3BTGE 2VH0A 1UTPA 5DP3A 1GI9B 2GD4B 1D6RA 2YNAA 2BDAA 1KY9A 4J2YB 1G3CA 2D26C 1EJNA 1OHHD 3ENSB 1C1MA 2AMDA 2BD5A 3OY6U 1NTPA 1GI4A 1Z1JA 1C1SA 2KX4A 2O8WA 3VGCC 1S0RA 2P16A 1F5KU 2K8IA 3KQ5A 1KLIH 2EI6A 2KR7A 4DT7B 4Y8YA 3I29A 4NFFA 4X2WA 1H9LB 5CDFE 1NZQH 5DGJA 1C1RA 2CMYA 2EEKA 1GBCA 3E91A 1C2EA 4OS2A 4RKOB 2OC1A 9LPRA 3RXIA 2PV9B 4FVBA 1GMHG 1MZAA 4X2XA 3RC4A 1D3PB 1P11E 1NN6A 5LPEA 3FZDA 1P2JA 2QN5T 3KN2A 2P95A 1C5ZB 3U8OH 2J9NA 3PMJA 5ESTE 3IWMA 1KXBA 3RP2A 1MCTA 3SORA 2F9OA 3Q3YA 2QC2A 3EE7A 1O2QA 1O3JA 1C2MA 3QN7A 1IOEA 1HV7A 4UDWH 1FONA 4D7GA 1HAGE 2WPLS 4WF8A 4ZHAA 1E1QD 4JMYA 3ATLA 3VEQB 4Z6AH 2RA3A 1O2XA 1FDPA 1DVAH 3TNTA 3H5CB 1PPHE 1GBMA 4DCDA 1Q31A 3EDXB 1SGCA 2Z94A 1BRUP 3SU6A 2H9HA 2ODYB 3UPEA 1CHGA 3BTME 3UR6A 5C17A 1BT7A 2Y7XA 3SNCA 5L30H 4D9RA 1FQ3A 1BMNH 2OQUA 2SGPE 3T29A 1GCTB 5SGAE 1UK4A 1V2KT 5C67A 2HLDD 1O2LA 3RLYH 4K69A 1GGDB 3MI4A 1PQAA 4OS4A 1MCVA 2WV4A 2XYAA 2ZGHA 1TOMH 1AVWA 1A61H 1O2PA 2YOLA 4AX9H 4X8VH 1V2ST 3R0FA 1DXPA 3GCTG 1S81A 2PKAB 2G5VA 2OINA 1V6DA 1Z8GA 4JYTA 2Y82A 4HTCH 5E0GA 2VGCB 3SNDA 4NZLA 4WWYA 3RXVA 4AOQA 5AFZH 2WPJS 1YWUA 1NM6A 1EOLA 1VCQA 5HKKD 5FBEA 4UFGH 4X6PA 3FOAA 2ZA5A 3GOVB 1SMFE 3WY8A 1CHOF 3MFJA 3BTWE 1C4V2 1CVWH 1AE8H 1LDTT 4TT3D 4ABHA 3LGWA 1VITH 4MNVA 4JYUH 3LGUA 3Q77A 4Z1MD 1WUNH 5A8XA 2BQWB 1F0TA 2XRCA 2QAAA 1O5FH 3UNRA 2ZQ2A 1TX7A 1ZLRA 1GHYH 1VITG 1ZOMA 1TPSA 4Q2KA 2W3IA 3RLWH 2HNTC 4B2AA 4X6MA 4Z0KA 1F7ZA 2LNCA 2VWMA 4NSVA 4X0WU 5H4IB 1JWTA 4NA7A 1HAZB 1ABIH 1MU8B 2B5TB 2W7SA 5IDKA 3RUOA 1UVSH 1UVPA 4LXBH 1C5VA 1XVMA 1VGCC 2CV3A 3A7TA 3NCLA 1HLTH 4MNXA 4BXWA 1TQ0B 1G9IE 1LHGH 1KLTA 1LO6A 4F4OC 2IJD1 2EQNA 4WJG2 3ZVBA 3S0NA 1GI2A 1LMWB 3A81A 1MMJN 1O3EA 2CHAC 4Y11E 3TNSA 1HAHH 1SG8B 3SI4H 1C5OH 3TH2H 3TPIZ 1TIOA 1IQJA 1MKXH 2BQ7B 1YPLH 1TONA 1ABJH 3P17H 2ZDLA 4MTBA 1HJAB 4BTUB 1L4DA 1O34A 4THNH 5L2YH 1WXRA 4FUBA 3LPRA 3F9HA 2BD4A 1SHHB 4ZHMU 3DSGA 2ANMH 4NWKA 3ZVEA 3MYWA 1HCGA 3R3GB 1FIWA 1ZPCA 4CRCA 4UE7H 1BTZA 1SFQB 2THFB 5F8XA 3LJJA 1SPJA 2ZCKP 3S9BA 1O5EH 3WW7A 1OWEA 5IK2D 4WMDA 2A5AA 2BTCE 3A8BA 3GCOA 1BRCE 1B0FA 2XCNA 1A3BH 3TJNA 1N6XA 3OE7D 1NC6A 1YPKH 1FI8A 4E06H 1D3DB 4ZHLU 5E2PA 3SUDA 3JZ1B 4DW2U 2VVVA 3RXSA 5I46H 1WV7H 4U01A 1LKBA 3U8TH 4O9VA 2JH6D 3NRLA 4Y0YE 4DIIH 1JRTA 2BOHB 4D9QA 1EXFA 2ZU1A 1C1QA 3SUGA 1PFXC 4GUXA 1YBWA 1N1LA 1O3NA 2ZF0H 2Z3EA 3T62A 4FUDA 4ZKNU 2B8OH 1H8ED 1SGTA 1O3DA 3U69H 1FNIA 1UJ1A 2XCFA 1S6FA 2B9LA 3B23B 3BTHE 1BTYA 4GHTA 1TGTA 4X6OA 2JH0D 3GCHC 3RM0H 3N99A 1C5UA 2Z7FE 2TRMA 5DG6A 3F3BA 5LPRA 1QB6A 4MPVA 1V2UT 1VITF 2ZFSA 1TNJA 3ITIA 1O3BA 1JBUH 1MD7A 2SGFE 3UNQA 4BAKB 3A89A 2W6ID 3A8CA 1Z6EA 3QTOH 2Z6BD 3ZZAA 3F9EA 2F4LA 2FODA 1AUTC 3AW0A 1ELBA 2PSXA 1KTTB 5HMAA 3SGBE 4AB8A 4AFUA 2ZCLP 6CHAC 1K1MA 4YESB 3SHAH 2PGQB 1AB9B 1V2JT 3GY5A 8LPRA 3LH3A 1KTSB 4WH8A 1CA0B 3UOUA 2LP6A 3NK8A 1SVPA 2BY6X 2IJOB 1QNJA 1HRTH 1J9CH 1MTWA 3K6ZA 2VIOA 2O8UA 3KF2A 2DE9A 3L33A 1IQLA 1C5XB 4JZEH 4K8BA 5KGOA 4B1TA 4M9FA 1P2IA 1AU8A 4UFDH 3AAVA 1TFXA 2QXIA 1O3MA 1G37A 1EAXA 3MU0A 2C90B 5K0HA 1O35A 1OWIA 3EGKH 2GTBA 2G52A 2SGAA 2JETB 5GJ4B 1BRAA 5C5NA 1SGFG 1F92A 1NO9H 3T5FH 1XUHA 2Z9KA 1TGSZ 2ALPA 2FOMB 4ACBA 5EG4A 2BD7A 1KXEA 1QGFA 1GCDA 1MU6B 2VIQA 1QIXB 5ABWA 2BD3A 5EU8A 2BVSH 2GZ9A 2OC0A 1BA8B 1SLUB 1UVOA 1K1LA 1O38A 1UK2A 2BZAA 1O2RA 2UUJB 3T2NA 2J34A 1S6LA 2GZ7A 1AIXH 2D2DA 2G4TA 4KP0A 1O3OA 4RSPA 3ATIA 3I77A 1W12U 1C1UH 1AKSB 5JPMH 2XBWA 2P8OB 2VIPA 3BEIB 4A1XA 2PTCE 2B0FA 5GCHG 1ZSLA 1TBQH 4NIXA 2ZDMA 3GY3A 2FTMA 3ODFA 2TIOA 1NT1A 1UCYH 2ZWLH 1EQ9A 3M3TA 6LPRA 9ESTA 1VZQH 2HVYB 2Z9JA 3N7OA 4I8JA 2OLGA 1DUAA 1GCTC 1P03A 2KM0A 2BQ6B 2RDEA 5T6FA 3SI3H 5F6MA 1O33A 3PRDA 2F43B 1GL1A 2QA9E 2W6JD 4YT7H 1BZXE 1GGDC 2FOBA 2BLWA 3ZVGA 4TSFD 3QUMP 2BYAX 5I25A 4SGAE 1A5GH 2ZU3A 3UIRA 4FUHA 1EUFA 3E16B 3EA8A 3PRBA 5JBCS 1HAXB 2AHME 1WQSA 3DSPA 4UFEH 1NRSH 1VJAU 1CGHA 2ZTXA 3MO9A 2VGCC 1W10U 1ETSH 1O36A 2L6OA 1L1NA 2G55A 2HNTF 1T7CA 1HJ9A 1GHWH 2PHBA 5J4QA 1BHXB 2AERH 1OWKA 5GWZA 2GT7A 2QE7D 4KTSA 4YLQH 3UTUH 2V6NA 4CRBA 1BCUH 2FPZA 4MLFB 1MKXK 4XBBA 1EAUA 4HI3A 1GVLA 1GDNA 1OP2A 3I78A 3HATH 4TPYA 1O3KA 2FP7B 2CJIA 4MDSA 2FI4E 3SU4A 2QF0A 4ABJA 5EPYA 2BDHA 1O2JA 1GHBG 1T4VH 1ZJDA 3ZZ7A 4CRDA 4FOUC 5TCCA 1EB2A 1QQUA 3UQOA 4DOQA 4BAOB 3P95A 2PW8H 4I86A 2Y81A 1C1TA 3E3TA 3L6PA 1SHYA 1HXEH 5BRRE 1ARCA 1ZTLA 1GHAF 2R2WU 2ZPRA 7KMEH 3QGNB 3KQEA 3A85A 3AAUA 2ZPSA 4I8HA 3SZNA 3P70B 5DN6D 5JB9S 1RFNA 1FY3A 1C1WH 4CRFA 3M35A 5FHTA 2R0LA 5L6NH 2A5IA 1WQVH 4B2CA 2NU1E 3RXCA 2NU2E 3PV2A 1W7XH 2ALVA 1DFPA 1O5AB 4OS6A 2RFKC 1ORFA 1C4U2 2GDEH 3RXKA 1AZ8A 1AFEH 5LGOA 2IN2A 1CT4E 1JMOH 1L2EA 1QURH 3LDXH 4Q7XA 3PMBB 4X2YA 3M61U 3RXDA 3IG6B 2VINA 1RD3B 4HG6A 4ISLA 2R9PA 1SLVB 2BX4A 7ESTE 1GI7B 3MQKC 1HJAC 1ELEE 1PPZA 4WXIA 1DICA 4E7RG 2IPHA 1BMLA 4A92A 2BOKA 4E05H 1NPMA 1B5GH 2Q6GA 5FCKA 1HNEE 4IN2A 3K65B 1RTLA 2G8TA 3A7YA 1GMDF 3QDZB 1EAIA 2BD9A 1C5YB 1QJ6B 1YKTA 4ABBA 1IHTH 1THSH 3RM2H 3T26A 2XC5A 1T8NA 2VH6A 2Y5HA 3M7TA 3MNCA 1K1JA 1XX9A 8GCHF 3GY2A 3ZVAA 4FUCA 1W7GH 1GI3A 4WMEA 1DLKB 1ELGA 2ZU2A 5EXLA 3SGAE 2C8YB 2QYIA 3SNAA 1EAWA 4CH2B 1NROH 1KSNA 1WAYB 3BG8A 1EATA 3TVJB 3RXTA 3ZYEA 1ZR0A 1PYTC 3MNSA 4FU9A 3F1SB 1WDIA 1P06A 1YF4A 1AVGH 3BV9B 3E1XB 2VVCA 1O2OA 2SGEE 2AGGX 3SUEA 1S82A 2HNTE 2G51A 3F2GA 1SC8U 1C5SA 3Q76A 2AGIX 1JIMA 3RXMA 5DP6A 1T8LA 2HWLB 3SV6A
chains in the Genus database with same CATH topology
1ZGIA 1GHBF 1SOTA 2WPHS 4AYYB 2XC4A 4IW4E 1O5DH 4KTCA 3ZZ3A 1CHOG 2ZDNA 2FYQA 2UUYA 3SV8A 3K2UA 4X1RU 4O97A 3SJ9A 2AMQA 3GISB 4DVAU 2GV6A 4JZDH 4CR9A 1P02A 4IGDA 1NRNH 1W0YH 5FBIA 3RMMH 2GMTB 1PQ5A 1TLDA 2A2XH 3A80A 4KTUA 1FV9A 3U1IB 2A7JA 3W95A 1O37A 3JZ2B 3D23A 4K2YA 1TNIA 2QCYA 1AFQC 4QT8C 1AB9C 4H4FA 1MBQA 5E0HA 2F3CE 1TA6A 5EQQA 3TK5A 3DHKH 3M36A 2GT8A 5T6DA 1AN1E 3BIVH 2G4UA 2XW9A 1IQKA 3RXOA 1EP6A 1CA0C 4X6NA 1GJDB 1AO5A 1MQ5A 1BITA 2BB4A 2EI7A 1C5RA 1T31A 3NXPA 4IC6A 2KAIA 2WUCA 4ZKSU 3OTJE 4UD9H 2G81E 5CE1A 3VB6A 1OWJA 1U6QA 1WTGH 1UCYK 4B71A 5DP8A 3SV7A 3ZV8A 4FU7A 1H4WA 1K21H 4GAWA 2SGDE 3BTQE 2JETC 3SU2A 5A0BA 5A2MH 4ISOA 2Z9GA 3RMOH 2GP9B 3ESTA 3PTNA 2FOCA 3P8FA 1DWBH 5A8ZA 2J4IA 3FP8E 1RGQA 1XUGA 3EA7A 1Q3XA 1Z71A 1K1OA 1SQAA 4B74A 1BOQA 1J15A 1TRYA 1RTKA 1GHVH 2F91A 3FVFB 1NU7B 1P3CA 1THPB 2ZCHP 5DPAA 2H5CA 2FIRH 2OXSA 3KGPA 2ZU5A 3F9GA 3FANA 3EYDA 3DD2H 4ABGA 1UCYE 3CS7A 3SNEA 3MWIU 1A0HB 5FXLA 5HYOA 3LGTA 4X1SU 2FLBH 1G32B 3BTKE 4NA9H 1W3CA 3V0XA 1Y8TA 3K6YA 3MH4A 2P8OC 3RXPA 4Y8XA 1AD8H 2OUAA 1W13U 4H6SB 1YPHE 1OP8A 1AZZA 1OPHB 5C5OA 5JB8S 2PKSB 3UNSA 5FPYA 1ZJKA 3ZZ5A 2R2MB 2A4OA 3GCNA 1LHEH 3PO1B 4CREA 4B75A 4WH6A 4XE4A 1ZPZA 4YOGA 3RXLA 3FAOA 1G3EA 2STAE 1TMUH 4ZROA 1F0RA 2OCVB 3UR9A 1SB1H 2P3UB 1ETTH 4M7GA 5GDSH 2BMGB 2P93A 1DWEH 2UWOA 2ZU4A 5JBAS 3TH4H 1LVMA 2BX3A 5DJ7A 3UWIA 1C1OA 2R3UA 4X8UH 3NPSA 1BB0B 1TGBA 1TRNA 2NU0E 3PV4A 4ESTE 2FM2A 2GDDA 2ZI2H 4A5TS 2ZHFH 3QZRA 1J16A 1GJ7B 2Y6TA 1XUJA 1MKWH 3A83A 2RA0A 1GDQA 1L0ZA 1K2I1 4MQAA 1W2KH 4JYVH 1OOKB 3HK6B 1E0FD 1P2KA 4NGAH 3S69A 1QTFA 1CQQA 1V3XA 2BVRH 2Q1JA 1O2ZA 3SV9A 4BTIB 1Y3VA 2C4FH 1SFIA 2ZQ1A 5T6GA 3BIUH 2Q6FA 3PROA 1J14A 2PSYA 1S83A 1QY6A 1XUIA 3RXUA 1C2KA 3GDVA 2ZC9H 3D62A 2GGVB 1HDTH 1YM0A 3ZVDA 1MTNB 2O9QA 2ZG0H 1Y5BT 3LGIA 2F9PA 3FFGA 1FN6A 3A84A 4ZXXH 5F8ZA 1ANEA 2GZ8A 4OS1A 1C2HA 3LC3A 1ZHRA 1V2TT 5FPSA 2CXVA 1FZZA 1Z1IA 3NWUA 2O8LA 1ZZZA 1CGIE 3GY8A 3AASA 3SJIA 3F9FA 4NIYA 4NSYA 1UHBA 5GIBA 4GPGA 2D1JA 2GVFA 1S84A 2BXTH 2ZHQH 2AYWA 1FAKH 1PYTD 3SW2B 3STIA 1TMBH 1GWAA 1WBGB 3F68H 4MPUA 2SNVA 1M9UA 1TGCA 2D8WA 1MUEB 1E35B 1AQ7A 1IQMA 2YNBA 1GG6C 1HAVA 1SR5C 4K3JA 4OGYA 4IC5A 3MNBA 1TAWA 2BZ6H 1F5LA 1P0SH 2OD3B 1LHFH 2BDGA 3DA9B 1ACBE 2OBOA 1O31A 1TX8A 1SGQE 1AWFH 1CA8B 1C2IA 2ZFQH 2BXUH 1A46H 3KCGH 1HJ8A 1PJPA 1CT0E 4ZMAH 5JBTA 2FOGA 2PLXA 3SGQE 2PFEA 2AH4X 3ATWA 7GCHG 5EGMA 5A0CA 4MPXA 1YPJH 3DFLA 2ZGJA 2BY7X 4AG2A 2XWBI 3UQVA 1FXYA 3HGNA 1HAVB 1NFXA 1BIOA 1GBDA 3SQHE 1FY4A 1MAYA 2FOHA 1O2YA 1TQ7B 2NWNA 1GVZA 4DG4A 1S6HA 3HKIB 3VXFH 4I8GA 1W11U 3PLKA 3BTFE 1MTSA 3ZZ9A 1RJXB 2W5EA 1J8AA 1D4PB 2FWWA 4GVUA 2CN0H 4CH8B 3SBKA 4NCYA 3TK6A 1AFQB 1K1PA 1O2SA 1EZXC 5C1UA 2JH5D 1JOUB 3Q00A 3CENA 1GBHA 2O8TA 1Z6JH 1C2JA 1LQDB 1QHRB 3FZZA 4NFEA 1WU1A 2WUBA 2OTVA 4GCHF 1HBTH 1PPBH 1GBAA 4CBOA 2ZFFH 4RKJB 2GCHF 4NIWA 4GSOA 4OS5A 5JBBS 5DP4A 1TNLA 2P3TB 3P8OA 1KLJH 2GMTC 1WOFA 4AFQA 2PUQH 1DOJA 1RTFB 1GBKA 1P57B 2UWLA 3PLPA 4H6TA 1K1NA 2ASUB 1SLWB 1NFUA 2BLOA 4IN1A 1QRXA 4D76A 2QF3A 1ZSJA 3ZV9A 1SGYE 1GHAG 4Y0ZE 2ZTZA 3MMGA 1INCA 1T8MA 4OS7A 4NZQA 1H1BA 2ZGCA 2W7UA 4UFFH 4BXSA 2VWLA 1IAUA 3HKJB 4J1YA 2VVUA 1C9PA 2ZNKH 1K1IA 2V3HH 3M37A 3KIDU 2RDLA 2C8ZB 1TOCB 3A7VA 1H8IH 4U32A 1DLEA 1ZSKA 2A31A 3Q3KA 4Y7AA 3RXRA 4VGCB 2IOTA 5J4SA 1CO7E 3ATMA 3CP7A 4R0IA 1BBRH 2QV1A 3SNBA 1ELFA 1K28D 3RU4D 1V2NT 1A1RA 1NRQH 1UTLM 1EKBB 4Y71A 1RRKA 1GBBA 2FESH 1GJCB 1DM4B 1E34B 3LJOA 4KGAA 1IQNA 1MAXA 5GPIB 4Y7BA 4ZKRU 3V12A 4D8NA 3A7ZA 2TBSA 3ZYDA 2VIDA 3IITA 7GCHF 1V2RT 2PUXB 1UVUH 2W26A 3AVZA 4IMQA 3PMAB 1EZUC 3MH5A 4AORA 3U9AH 2BD2A 2FZZA 1D9IA 3KQDA 1MQ6A 1TA2A 2ZIQH 1C5TA 4A6LA 5T3HA 4BAMB 1ID5H 1JIRA 3GYMA 1TGNA 2C8XB 2C93B 2H5DA 2CF9H 1GMDG 1FMGA 3SQEE 1A0JA 2SNWA 4TWYA 3A7WA 1CE5A 4D7FA 2ZFPH 2HOBA 4RN6A 3VB4A 8GCHG 1MKWK 1HAOH 1C2FA 3W94A 1C2LA 1W8BH 1KDQA 4AFZA 4JZ1A 3SJ8A 1VR1H 3TH3H 2FS8A 4DY7B 5C20A 3RXHA 2J38A 4AB9A 5E0JA 5ETXA 1EPTA 2AGEX 1BHXF 2PKSC 1P10A 1EJAA 1MZDA 1XMNB 3MU5A 1GMCF 2WV5A 2UUKB 1TBZH 3DT0H 3PM3A 2ZP0H 4FXGH 1GJ4H 3LGVA 3PO1C 1TX6A 1Z8JB 2XTTB 3A87A 3GY4A 1ELTA 1OS8A 1LVOA 1ZRKA 3E90B 1B0EA 1WYKA 2BLQA 1KXCA 2FO9A 4NA8A 3URDA 3TJOA 1QBNA 3GDUA 3MTYA 1KYNA 1SGFA 2A4QA 1D3TB 1FUJA 4FUEA 3U1JB 1KDQB 1LQEA 2QY0B 1OX1A 2FEQH 2R0KA 1ZTKA 3TJUA 2F9NA 4SGBE 1UTOA 1P01A 4O3UA 4I7YH 1GJAB 3MU4A 4FUIA 4YOJA 2AEIH 1EPTB 3A8DA 1DT2A 2NU4E 1ZRBA 3P8NA 2ODQA 4YTAA 3GICB 3V7TA 1ZMJA 1O3CA 4JK6A 4I31A 4FUFA 4IMZA 1HB0B 1LKAA 1BJUA 3TK9A 1O2WA 4Y79A 1SGPE 3D49H 1V2OT 3U8RH 1ZHMA 3BEFB 1NU9A 1TALA 3Q3XA 3RU4T 2O8MA 2WYJA 3PYHA 1YLDA 5ESBA 4ZUHA 3OX7U 3VB5A 2FX6A 4ZAEA 4ASHA 1C1VH 6GCHF 3QZQA 1EZSC 1DY8A 4LZ1H 4NWLA 5TJXA 3FP6E 1GI1A 4FUGA 2A4RA 2FTLE 1MTNC 2P3FH 2FI3E 1HPGA 1ZYOA 4X8SH 1GG6B 1HAIH 1P2OA 1UVTH 4YT6H 1BQYA 5TCAA 1A3EH 2WPKS 1J17T 4BAHB 1ANCA 1TYNA 2EI8A 4JK5A 1UTMA 1C1NA 2A5KA 2ZDVH 1GI8B 4GLYA 1LPGB 1GDUA 1YCPM 4KELA 1BTUA 1DANH 3M3SA 1YP9A 3RU4E 5A09A 3EE0B 1XUFA 3TGJE 1L1GA 1XKBC 1EOJA 1G30B 3QO6A 5AF9H 3ZZBA 2BDCA 1LTOA 1AHTH 1CT2E 1IQIA 3SN8A 2QXJA 3M7UA 4K60A 3TU7H 3B9FH 2AS9A 1QBVH 1ZMLA 3ELAH 2AIQA 4Y10E 2SFAA 3MHWU 1ZTJA 3LU9B 3KEEA 2Y80A 5HM2A 2PTNA 3VPKA 2F83A 5DKMA 3TJVA 1ESBA 1P9UA 1V2QT 1G2MA 2OQ5A 3KHVA 3RDZA 1QL7A 1ESAA 2HLCA 2ZDAH 3QWCH 5AVDA 1LVYA 1UTNA 3MH6A 2UUFB 1O3LA 2F9UA 5EXNA 5LPFA 1O39A 4GHQA 2Z9LA 4KKDA 1EJMA 3E6PH 1HUTH 2WPMS 4XDEA 2BY5X 1GI6A 5FPTA 1GBFA 2NU3E 1TB6H 1TABE 1PPFE 2BDYA 3ZZDA 3PWCA 1QCPA 1X7AC 3UREA 1O2TA 2Q6DA 3OU0A 3RXAA 3UWJH 3BN9A 2VJ1A 1ESTA 1WCZA 4BTTB 4XBDA 2ZECA 1QB1A 2ZGXH 1AI8H 1HXFH 1YGCH 1HFDA 1BBRK 1TWXB 1Y3WA 4AZ2B 2ZO3H 1GBLA 2ODPA 5C2ZA 1TNGA 1YLCA 1XM1A 5DK1A 3UFAA 2C3SA 3B8JA 5DO4H 1YPGH 1TRMA 1RXPA 3EQ0H 1OXGA 1GI0A 3DUXH 2EC9H 1PQ7A 1F2SE 4XBCA 1SBWA 4WMFA 1C5WB 1ZHPA 1RS0A 3OSYA 2V0BA 2VIWA 3P8GA 1SL3A 2A0QB 1LHDH 1O2IA 1BBRE 2ZZUH 2TGPZ 1GHZA 1XUKA 1GBTA 2OC8A 3KQBA 1Z8RA 1DWDH 3KL6A 1C5PA 5HXFA 1A4WH 2KAIB 1MD8A 2SGQE 5PTPA 4YO9A 1ELCA 5EQRA 4TYDA 1QL8A 4VGCC 2QGRA 2EA3A 2AFQB 1BJVA 2PKAA 4JZIA 1HIAA 5FX5A 4TY6A 2ESTE 1O2HA 1UO6A 2H1UA 1P12E 4MG3A 4CHAB 3KNXA 4IS5A 3NZIA 3T25A 4YM9A 4LK4A 1N8OB 1GI5A 1O3FA 4WY3A 2ANWA 1Z8IB 5EQSA 1RIWB 1VJ9U 5CMXH 2HVXA 1AY6H 1C2GA 1ZPBA 1SGDE 4FVDA 4PROA 1Y3XA 5C1YA 3RMNH 1ELAA 3KQCA 3UUZA 1OWHA 2BDBA 3UY9A 1DE7H 3QTVH 5EXMA 1HIAB 5L2ZH 2A7HA 4TWWA 1P9SA 1AUJA 3MO6A 2GX4A 3M5OA 5E8EH 3BSQA 1KXFA 1LPKB 1OYTH 1P2NA 1ARBA 4TPIZ 3C27B 4I32A 3PB1E 3NKKA 3E8LA 2XBXA 2GCTC 5EOKA 1LCYA 1IQEA 2OBQA 1GBJA 4NG9H 3S7KB 3RC5A 3SU3A 3E0PB 4IBLH 1GHXH 1C5QA 4A1VA 4DURA 1GBIA 2DUCA 5CHAB 2TGTA 3TITA 4U30A 3SOSA 5A8YA 3BTEE 1CU1A 3LOXA 1GJ5H 3LKWA 2ANYA 3VB3A 1C5NH 4CRGA 1G3DA 1G36A 4XFQA 4YZUA 3H7OA 4GCHG 5FCRA 1YPMH 1D3QB 1GMHF 1WSSH 1TMTH 2FX4A 3RXJA 5BPEA 1BMAA 1F0SA 2VWOA 5A0AE 5B6OA 1QJ1B 2GCHG 3HGPA 1HAYB 1GL0E 1EPTC 3T28A 3SV2H 3MOCA 1P04A 4HGCA 4MVNA 3G01A 2J95A 4XOJA 1O5CB 2WPIS 1CGJE 4TY7A 1O2MA 1UMAH 3GY6A 1HYLA 3FP7E 4DJZB 1TPOA 2BM2A 1HGTH 8KME2 1PPCE 3PLBA 1FIZA 1O2UA 1BTPA 4MNYA 2FOAA 5AHGH 3T27A 4INHA 2C8WB 2Y5FA 1TE0A 2ANKH 1VCPA 3LH1A 2OP9A 1AVXA 1DDJA 1O2KA 3QGJA 1SGEE 2P94A 5F8TA 1FY5A 2HPQH 1O2VA 2PR3A 4X1QU 4BOHA 1DY9A 3M5NA 1SQTA 4CR5A 2ZHEH 1FAXA 3M3VA 2ZFRH 1ANDA 2HGTH 5C3NA 3MU1A 4AYVB 2FI5E 2ZGBH 1BRBE 5EPNA 1OWDA 3C1KA 1QBOA 4A7IB 3P6ZB 3GCTF 3RC6A 1YCPH 4INKA 1MTUA 1F5RA 1UHBB 1C1PA 2QIQA 1ELDE 3ATKA 3M5LA 1V2MT 7LPRA 1O2GH 1KXDA 3HK3B 2BD8A 2TPIZ 3LGYA 4ISNA 4MPWA 1YPEH 4ISIH 5JDUB 5FX6A 2K1QA 3GY7A 3ZZ4A 3STJA 1EX3A 3MNXA 3RXFA 3BG4B 1SGRE 2QXGA 2XNIA 2Z3CA 1SGIB 4H42U 3L3TA 1P2MA 1XXDA 1SGNE 1Y59T 4XSKU 4K1EA 2H9EH 1PQ8A 1QA7A 2AMPA 1OP0A 1EP5A 2VNTA 2A4GA 2BY8X 4BAQB 5GXPA 1CBWC 3LT3A 3AW1A 4LZ4B 2H2ZA 4AN7A 5DP9A 1E36B 5F03A 3MO3A 4B2BA 1FPCH 3A88A 3QK1A 1MBMA 1FY8E 4ZH8A 3A7XA 1TBRH 2HRVA 1YPHC 3LC5A 2DE8A 1C5MD 2Z9IA 1GMCG 1BDAA 4AGJA 1KXAA 2W3KA 2Y7ZA 5DP5A 3E0NB