1BJUA

Beta-trypsin complexed with acpu
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Oxyanion-mediated inhibition of serine proteases.
pubmed doi rcsb
molecule tags Serine protease
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1998-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1bjuA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1bjuA02
1HV7A 3U69H 3MYWA 1V2UT 3PMHB 3SQEE 1V2QT 1P3EA 4CHAB 1GBEA 4JCNA 1Z6JH 4SGBE 1C2LA 2Z9LA 2GDDA 1P2NA 2TIOA 2OD3B 2H6MA 1IQMA 5FBIA 1Y5BT 1HAYB 3SHAH 2OLGA 3ZZAA 2YNAA 3UWJH 2ZDVH 4HI3A 1D3PB 4MVNA 1FMGA 4X6OA 5ESTE 1S83A 5E0GA 4BAKB 4XBCA 4CHAC 4RKOB 4IN1A 2BDHA 1O5CB 1HBTH 3K6YA 3QGJA 3WY8A 3VFEA 2A7HA 1QNJA 3LJOA 1FY1A 4Z6AH 2J95A 1HGTH 1NFXA 1DWEH 1ZSLA 1DE7H 3C27B 1AKSB 3BSQA 1C1RA 7GCHG 1TNLA 3TH3H 3KHVA 3LGTA 5JPMH 2QXHA 4NSYA 1C1MA 5FXLA 1NO9H 3MH5A 4FUFA 1RFNA 4MLFB 4ZXYH 1GMCF 2C8WB 3PROA 1VCPA 2O9QA 1QL8A 1E36B 1QGFA 1HPGA 3Q77A 3LGUA 3K2UA 3RU4E 1QRXA 2C3SA 1F5LA 4NFEA 1BT7A 1VGCB 2KAIB 3RUOA 3MTYA 4U2WA 1O2IA 2R0KA 2FLRH 3A7TA 3VXFH 1HAZB 5ESBA 4BNRA 1FXYA 2FESH 1P2MA 4B71A 3P17H 3KQEA 2GDEH 3RXJA 1MD7A 5C1UA 1J9CH 1EAXA 2J4IA 3D62A 3ZZCA 4NIYA 1GI4A 4OS4A 2TGAA 4WY3A 1V6DA 1C2JA 2PKSB 4HGCA 1KLIH 1SFQB 1VGCC 1Z71A 3SNBA 2GVFA 4K5ZA 3EA7A 3A7XA 1H9HE 4MQAA 3Q76A 1IQLA 3BEIB 4NA7A 6GCHF 1TNHA 4OGYA 3DFLA 1DY9A 5A8ZA 3SORA 2V3OH 4MNWA 1QA7A 1ZRKA 4Y71A 1T31A 1PFXC 1ZTLA 5EXLA 4DW2U 3KF2A 2EI8A 2GCHF 3HK3B 5LGOA 3NWUA 1JRSA 3RXOA 2A5IA 2VH0A 3OTJE 3PMBB 1MCVA 1O3NA 4ZMAH 1MKXH 2A2QH 3GY6A 1O31A 5FCRA 2DUCA 2BDIA 1ANCA 1SGQE 2ZDMA 3P8GA 1EJNA 2ZEBA 1A61H 1LHEH 3RXKA 2VU8E 2ZHQH 1CHOF 1QRWA 4WMEA 2XCNA 2HRVA 3A8DA 1K1LA 5DJ7A 2ZTYA 1QL9A 1SMFE 1DUAA 1O2NA 4GAWA 1FIZA 2GTBA 3EE0B 2WUBA 9LPRA 1V2VT 2A4RA 3RXUA 3PM3A 2Y82A 1EAWA 2A0QB 3PLPA 2BYAX 1PPHE 5K7RA 3LC3A 3L3TA 2A31A 1ABJH 1GI5A 4AX9H 3VPKA 4FUHA 1C5WB 5C3NA 1SFIA 3KQDA 4I31A 3VGCB 1C1OA 6ESTA 1GWAA 5AVDA 1U6QA 5FX6A 4A1XA 2FS9A 3GICB 1C4U2 3SBKA 3QDZB 1AWHB 1LHDH 4B76A 4J2YB 1CA0C 1RTKA 1MTSA 2CHAC 2H9TH 3NCLA 1OWDA 1GBMA 2CXVA 2UUJB 1C2DA 1H8DH 1RJXB 4OS7A 1O3OA 1KTSB 1O2UA 2FOHA 5HYOA 4KTSA 1AMHA 4F49A 4UFFH 2G00A 3VGCC 4OS1A 2H5CA 3DA9B 3TIUA 1TABE 3MOCA 1IQGA 4NCYA 3TNSA 1OP2A 2WINI 1V2KT 1L2EA 1O3MA 1HJ9A 1C5UA 2W26A 1VCQA 1K1OA 4H42U 2HPPH 3A86A 3M3TA 1LHGH 5J4SA 2Z9GA 1NESE 3MH7A 3TK9A 4OS6A 3RMMH 1DS2E 3SU0A 1EZSC 4D7FA 3C1KA 4CH2B 1PPFE 3S0NA 3E0PB 2HGTH 2IOTA 2B9LA 1SGDE 5C2ZA 2OCVB 1SBWA 1A2CH 4IW4E 5LPEA 1N8OB 1C5QA 2FTMA 3TH2H 2JH6D 2ZFSA 2D2DA 1DFPA 2XTTB 1BQYA 5F8XA 3E1XB 2ZGBH 1GI8B 1LDTT 1AE8H 1KTTB 5ABWA 1GJDB 2WPMS 3B8JA 1GCTB 1GJ9B 3LH1A 1XUIA 2LNCA 2ZG0H 1OP0A 2BY6X 1DXPA 2Y7ZA 3ENSB 5EG4A 2BD5A 3SJIA 4XFQA 1ZSKA 3BTGE 2FXRA 1C1TA 2O8WA 5F8ZA 1LVMA 3JZ1B 4GHQA 1BTZA 1VITH 1UTLM 9ESTA 1E38B 2A5KA 2FYRA 1O2RA 3ZVCA 3VXEH 1IHSH 1C2IA 1B0EA 4YTAA 1ESBA 1T32A 4FU9A 2CF9H 3AW1A 4MG3A 3QTVH 1KLJH 3UOUA 2GCTC 3UTUH 1BHXB 1UTOA 1IHTH 3MU8A 2NU1E 2ZGJA 3KGPA 5DP8A 4ZAEA 3S7KB 4AOQA 5TJXA 4D7GA 1ELCA 1ZTJA 3GY4A 4CRDA 1GJ4H 4ZKRU 1PYTD 2R3YA 3T26A 1GJ5H 4ZHMU 1G3EA 1O3BA 2FI3E 2B5TB 2TGTA 1O2PA 2W7UA 3SGQE 1A5IA 4Y8XA 2P59A 1KXCA 1HJAB 4JYTA 1ELBA 1KXFA 3O8RA 4RKJB 1YP9A 1BMNH 3M7TA 1J8AA 3BIUH 5GCHG 1OXGA 1O3CA 3ZZ6A 1EX3A 1TX8A 3ODDA 3BTFE 1EZQA 1BRCE 2VIQA 5E2PA 3RU4T 4IBLH 4NZQA 3RLYH 2BVXH 2R2MB 2PR3A 1YPLH 2SGFE 1NT1A 2G4TA 2QC2A 8GCHG 1RTLA 1FV9A 2GZ7A 1DSUA 1YPGH 4CR9A 4ZH8A 2SGPE 2F9VA 1SG8B 4ABEA 1ZMJA 4ABIA 1BBRE 2UWOA 1FAKH 3MU4A 2UUFB 2ZU4A 1XXFA 2JETB 3M3VA 4O3UA 3ZZBA 1CBWC 4X1SU 1TALA 1JXPA 1QHRB 1TBRH 1W2KH 1EAUA 1HNEE 1NZQH 2JH0D 1ARCA 4FVDA 1DSTA 3H7OA 3T28A 4BXWA 2J38A 3AVZA 3UQOA 4K3JA 3ZVFA 1VJ9U 1FNIA 1QQUA 5FPTA 1ESAA 3BN9A 3MHWU 3TU7H 3HPTB 1SGFA 4ABBA 3O8DA 1A46H 5E2OA 1Y3UA 4IMQA 4O03A 4TY6A 1AQ7A 3M5OA 1B0FA 3UR6A 3HGPA 1NRNH 3FP6E 2EA3A 1N6YA 4Y8YA 2QIQA 1TX7A 4H6SB 1UTNA 4R8TB 1QB9A 1EP6A 3ZYDA 2Y5GA 3ATMA 3LT3A 4DGJA 1O36A 1RRKA 2EEKA 2AMPA 1HRTH 2BY7X 5EW1H 2ALVA 2ZF0H 3RM0H 2XW9A 1Y3VA 5EU8A 2VINA 1TA2A 1TONA 1EB1H 5FPSA 3SOSA 1SSXA 3T2NA 2BLVA 2Q1JA 5FBEA 4A92A 1F5KU 4H4FA 1NS3A 4KKDA 2A1DB 4GCHG 1CGJE 1KXEA 1GVZA 2FOCA 3E91A 5EW2H 5DKMA 4KTCA 1O3IA 7ESTE 2ZCKP 5BPEA 3MFJA 3P6ZB 1AFEH 2KAIA 2QGRA 1Y3WA 1TBZH 1TOMH 1JWTA 1THSH 1P2JA 1AN1E 4D9QA 5PTPA 1ZLRA 2ZC9H 4B1TA 2XC4A 2Y7XA 3A83A 1A7SA 2XXLA 4D76A 1O5FH 1NRQH 2TBSA 4K1EA 2QY0B 5A8XA 3RXEA 1O2GH 3GY8A 5AFZH 4ZROA 5L6NH 3E8LA 1O30A 1D6WA 4YLQH 1CQQA 1IQIA 1GHYH 3QZQA 3GY2A 1GHBG 1Z7KA 3UR9A 2BOKA 1S84A 1SQAA 4K8BA 8LPRA 4NA8A 3RXLA 1XVMA 1C9TA 1MTUA 4MPXA 3PO1B 1MU8B 3I77A 3ZVEA 2BD2A 2VIDA 3A84A 5EPNA 2VIOA 1KXAA 3HKIB 1SGFG 1Y3XA 4FVBA 4X2WA 1TNJA 1ZMLA 2A4QA 4LZ1H 4ZKNU 1O3DA 4AFUA 4OS2A 1N1LA 3KN2A 4D9RA 1BJVA 1LPGB 3PO1C 1YCPK 2H9EH 2PHBA 1DUEA 1T4UH 2FOMB 1WOFA 2SGDE 4Q80A 3ZZ8A 1GJ7B 1FN6A 1OYTH 1SLWB 4JZDH 1O3FA 3CENA 1O33A 1GBTA 1ZR0A 1KXDA 1P2QA 1HB0B 3OX7U 4X1QU 1PQ8A 1GHZA 2AH4X 1HLTH 1V2JT 2CN0H 2FOEA 1A3EH 3RXDA 1GBCA 2H5DA 1Y5UT 5JB8S 1TB6H 2AEIH 2Z3EA 1C2GA 3RP2A 1O5AB 3U8RH 1GBDA 4B2AA 1V2ST 5GDSH 1OWHA 1ZHMA 4FUGA 1FZZA 3OU0A 2XBXA 4BOHA 3SZNA 1SGTA 1RXPA 1FN8A 1NU7B 3ZZ7A 5GCHF 5HXFA 1UVUH 2GD4B 1K1IA 3MH4A 2OBOA 3LONA 3P8NA 1ETTH 4DT7B 7LPRA 2ZGHA 3F9GA 2OBQA 1C2HA 1UVOA 4LK4A 4WJG2 1YPEH 2P93A 1DM4B 8GCHF 6LPRA 3O8CA 1DY8A 1G2MA 3V13A 1HJ8A 3Q3YA 4MPWA 2OQ5A 2FOFA 3SU1A 1PPCE 4BAMB 4M7GA 4JZIA 4NZLA 1T7CA 3SV6A 1QB6A 3MNXA 1O2TA 4YOGA 1FPCH 5GWZA 3STIA 4X1NU 1S5SA 1XKAC 1O2MA 2ZTXA 3D49H 1K9OE 3MMGA 1WTHD 2BQ6B 2D1JA 2FWWA 1ZPCA 3MWIU 3GCTF 1A1RA 3UFAA 2R0LA 5C20A 3M5NA 2PKAB 2ZGXH 3IITA 3FZZA 1NFYA 1SGRE 3OY5U 3RC6A 4MNVA 1TPSA 5CMXH 4DOQA 3NXPA 2ZIQH 2GP9B 4DJZB 1O2KA 5C5OA 4CRBA 2HNTC 2OINA 2J2UA 3Q3KA 5JBBS 3ZV8A 1E0FD 3TVJB 1K1JA 2F9UA 1F0RA 2A5AA 1DLEA 2XC0A 3HATH 2P3FH 1ANEA 1CHGA 3UWIA 5HM2A 1TX6A 2XBYA 1QBNA 3GCOA 3FP7E 3M5LA 4YT7H 2XCFA 1SHHB 2GKVE 4CRAA 5GJ4B 2F9BH 1UTJA 1Z8JB 1EZXC 1W7GH 1AVXA 1P3CA 4XDEA 1HAIH 1UMAH 1IOEA 1GI6A 1V2MT 3SNCA 4GPGA 1TNKA 3SV7A 3EYDA 1CT0E 1TA6A 1YPHC 1ANDA 1O5DH 2QA9E 3TJUA 3LDXH 1BZXE 3VB6A 1RD3B 1L1NA 1Q31A 2R2WU 2Y80A 4GCHF 2BY5X 3SJ9A 3SU5A 1HAGE 5I25A 2PTCE 1GBAA 1SI5H 1AI8H 1P2KA 3A87A 1KY9A 4B75A 1JRTA 1TE0A 1Y5AT 1LPKB 1AIXH 2BM2A 4I33A 1O38A 5DP4A 2Z9JA 1QIXB 4YT6H 3MO6A 3OYPA 4X1RU 1PPBH 3QUMP 1T8NA 3UIRA 3GCNA 1TIOA 4BAQB 2QXIA 3SU4A 2PKSC 1SL3A 1TYNA 1MTNB 1PPGE 1O3AA 1XKBC 1SB1H 2G51A 1C4V2 1K1NA 2Y5HA 4AZ2B 3MO3A 4ASHA 3A85A 3VB4A 3LPRA 1RTFB 1GHBF 2ZGCA 4MNYA 3A7YA 4FUDA 1H1BA 1QJ1B 2ESTE 2GV7A 3K6ZA 3PMAB 4BTUB 4FUIA 1HUTH 1ZHRA 4K8YA 3A81A 1P9SA 5EOKA 1ELDE 4CRFA 3A7WA 1BTXA 2D8WA 4WXIA 1MTNC 5DP7A 2C8YB 2VWOA 3M36A 3CP7A 2VIWA 3M5MA 1OX1A 3ZZ4A 2H1UA 1GBBA 3VB3A 1VCWA 1CU1A 4ABHA 2PFEA 5L2YH 2Q6FA 2I6SA 2OQUA 4IC6A 1C5XB 1P03A 5HMAA 3U9AH 4A1VA 1ZRBA 2AMDA 4FU7A 1XMNB 2ZQ2A 2A32A 1NY22 2HNTF 2FS8A 1FLEE 1GHAF 2UWPA 3A7ZA 1BCUH 2SGAA 3L33A 1P01A 2BDYA 3A8AA 2SGQE 2BLOA 1YBWA 3N7OA 3GY5A 2R3UA 2Z9KA 2XC5A 1EATA 2ZPRA 2WPJS 4CRGA 2FPZA 5EQQA 1ARBA 1S81A 2A4GA 3FAOA 2HPQH 3I78A 5K0HA 1V2NT 2BDBA 5DPAA 3QK1A 1QURH 2WYGA 3RXSA 2GT7A 3KQCA 4Y7BA 4GLYA 3F1SB 4NWKA 1N6XA 1CGIE 2W3IA 2FM2A 3NPSA 4AG2A 3SV8A 2BLWA 3SHCH 4DY7B 5A09A 1BTWA 1H8IH 3SJ8A 3QLPH 1H9LB 2O8MA 1O3KA 1DWCH 1MUEB 2FIRH 2ZU2A 4ESTE 2P16A 4KELA 3AASA 4MNXA 1O3PB 2AFQB 1V3XA 2QN5T 2O8TA 4NSVA 3UREA 1D3TB 3A7VA 2VGCB 3FFGA 4O3TA 2HWLB 2ZTZA 3U98H 1A0LA 1SOTA 4I32A 3P70B 1TRYA 1FQ3A 4ZKSU 3H7TA 3S9BA 4I8KA 1TGNA 2Y6TA 2QF0A 1WBGB 3EQ0H 4YOJA 5IDKA 1BMMH 1GJBB 2HNTE 1HDTH 1L4DA 5E8EH 2WPHS 5FPYA 2BQ7B 2BD7A 1TGCA 3W95A 4WMFA 1C5YB 3RXAA 1O2HA 3M35A 1F0UA 4ISOA 4HTCH 2VGCC 3ODFA 2FO9A 3EAJA 2NU3E 2ANMH 2V3HH 2WPIS 3BEFB 1TNGA 1TMBH 5I46H 1BA8B 2FOAA 3S9CA 2RA3A 5EXNA 1AUJA 1C5ZB 1EOJA 3NUMA 3UUZA 1O3GA 3E16B 1MKXK 1UK4A 4Y0ZE 1FONA 1N8OC 1VJAU 2P95A 1XUFA 2YOLA 3SGBE 3GDUA 4CBOA 1C9PA 1S85A 1MD8A 2STAE 1BRAA 1BITA 1YPHE 3QTOH 4TYDA 4O9VA 2ZWLH 3T29A 1GI7B 1GCTC 4TPYA 1A4WH 1AE5A 2GGVB 3B9FH 3NK8A 7GCHF 4ABFA 2Y81A 4LZ4B 4YO9A 1BRBE 1GCDA 2M5TA 1ZGVA 1FY5A 1MTVA 1CVWH 1K28D 1XM1A 1CT2E 1C2KA 1ZJKA 4NWLA 1ZSJA 1ORFA 4BANB 2Z6BD 1ELAA 1F92A 5IYTA 3TJNA 1S82A 1WQVH 3AAUA 1DDJA 4WVPE 3DFJA 5L30H 3ITIA 3UQVA 3A8CA 4DIIH 1ZJDA 2GMTB 3U8OH 5HGGA 1QR3E 1AFQB 1EASA 1GVKB 3QO6A 1UVSH 3BTEE 2QYIA 4FXGH 4YLUA 2ILNA 4MPVA 3HKJB 2FYQA 3SU6A 1K1PA 1C5NH 2ANWA 4AB9A 1W10U 4FUEA 5FCKA 2J9NA 3LGYA 1OYQA 1OWJA 4X8SH 4INKA 4K60A 1NFWA 2C90B 1F7ZA 2ASUB 1OWIA 2VJ1A 1O32A 4YZUA 1DICA 2GMTC 1O3JA 3TITA 2GZ9A 1W8BH 1T8LA 1AFQC 2EI6A 1HJAC 1UHBA 3LGWA 2ZKSA 2BD9A 3RXFA 4WXVA 1TGSZ 4R0IA 1MH0A 3RXVA 1ETRH 2EI7A 1QJ7B 2AYWA 4NFFA 1OPHB 5EODA 5FX5A 1KSNA 1TFXA 1TWXB 4Y79A 2W7SA 5F03A 1LMWB 1QY6A 2BDAA 1GG6B 1S0RA 1Y8TA 2C8ZB 4JZEH 1DANH 1AB9B 1SLVB 1MBQA 1Z8GA 8ESTE 1Y3YA 3CS7A 3DD2H 1EP5A 1L1GA 2ZDAH 1GVLA 1D3DB 1YKTA 5H4IB 3ZVBA 1MKWH 4DIHH 1O2VA 5JBTA 1F2SE 3UOPA 4FU8A 2PTNA 3UY9A 2BVSH 5LPFA 1J16A 1UK2A 3F9HA 1GI0A 1YYY1 1P8VC 3AAVA 3OY6U 2Z3DA 1QFKH 1P02A 2YNBA 5ETXA 4IS5A 4IMZA 1AB9C 5F6MA 2JETC 1DVAH 1KXBA 1TPOA 5DGJA 4A6LA 2CV3A 1LO6A 5A2MH 1SR5C 2Z3CA 1C1QA 1UVPA 2O8LA 1A0HB 1NRSH 1SHYA 2VNTA 2IPHA 1ZMNA 4AGKA 4ISNA 2CJIA 3RXQA 4ABGA 1MTWA 3KEEA 3RDZA 3S7HB 5B6OA 5GIBA 2FOGA 2Z9IA 1ACBE 1SQTA 3TLOA 2NU0E 1T8MA 2PWXA 2PGQB 2PKAA 1FY3A 1AVWA 1UVTH 3SUEA 3BG8A 4Y10E 3SV2H 3PB1E 1J15A 3MO9A 4Y6DA 1LTOA 1OSSA 1Z6EA 3HK6B 2DE9A 2VH6A 1E35B 1GGDB 2HALA 4Y8ZA 5C1YA 1G37A 1UTQA 2OP9A 1GMCG 4XOJA 5T6DA 4B73A 2NWNA 5DO4H 4K1TA 1Q2WA 2ALPA 2SNWA 1CE5A 3VEQB 1UTMA 1TPPA 1BHXF 1GL1A 4INHA 2OTVA 2VWNA 1QCPA 4WF8A 2G5NA 1SQOA 1GGDC 3A80A 3TJOA 2VB0A 1X7AC 2RDLA 4H6TA 3ATWA 3AW0A 1T4VH 2ZO3H 1AY6H 3ZVGA 2QXJA 4NA9H 1DT2A 1G30B 2H2ZA 1CGHA 1OWKA 3TK6A 5GPIB 1CSOE 2NU4E 4OS5A 1PQ7A 1XUHA 4TWWA 1GHWH 3M3SA 1EKBB 3BTTE 1DPOA 1C1VH 1D6RA 3SNAA 1GBFA 1A0JA 1M9UA 4E7NA 1SGNE 4CR5A 1C5TA 4XSKU 5EXMA 4BAHB 3QX5H 1GJAB 1LQDB 1V2TT 1C5OH 1TRNA 1C1PA 2AERH 3SUFA 3H5CB 4X2XA 3GY7A 4I8GA 3ZYEA 1Z1IA 3R0FA 3RXCA 4JK6A 5JBAS 1K22H 1EZUC 3EA9A 1AVGH 4AFSA 4DVAU 1E34B 2UUYA 4QT8C 3KIDU 1FAXA 1XXDA 2ZFPH 1OP8A 1WYKA 4NGAH 1ELFA 1MKWK 5CHAB 2P3UB 3ATLA 3RLWH 2BVRH 1AZZA 1K2I1 1MU6B 2FEQH 1LVOA 2PGBB 3TK5A 3GOVB 3U1JB 2P3TB 3GISB 1ZHPA 4I8JA 1LKBA 4E05H 1C5RA 1XVOA 1PQAA 3BTKE 2F83A 4GUXA 3GCHB 1TMTH 1OKXA 4YOIA 4VGCB 2ZNKH 1ZPBA 1C5VA 1LKAA 1DOJA 1PJPA 4Q7YA 5CHAC 1WSSH 2OC1A 4O97A 3SJKA 1BOQA 5TCCA 4E7RG 3HGNA 4THNH 8KME2 1UHBB 2G5VA 2FZZA 1O2ZA 1A5HA 4NIXA 3SQHE 1YCPM 3GCHC 1SGIB 3S69A 5JB9S 1PPZA 4PROA 5JYIA 2BXTH 3MNBA 1YC0A 3TNTA 2ZPQA 1AHTH 1WU1A 1B5GH 3MI4A 1IQKA 3P95A 2JH5D 1C5LH 3SV9A 1BTYA 5T6GA 1O2WA 1W3CA 5JDUB 1EOLA 4Y7AA 1HAHH 3F68H 5FHTA 1LHCH 1JOUB 1YM0A 1C5MD 1V2WT 2Z94A 2ZP0H 3DT0H 3F9FA 1QA0A 1W13U 2XWAA 1ELEE 4GSOA 1O0DH 1O3HA 2ZCHP 1A3BH 3SI4H 5DP6A 1SGEE 2GZ8A 1ZOMA 2ZA5A 4SGAE 3E3TA 2BD8A 3TGKE 2B8OH 1GL0E 1FPHH 1P10A 1O2XA 2BX3A 1MMJN 3T5FH 4UEHH 1XUJA 3ZVDA 1HAXB 1SGPE 2SFAA 1O35A 4AORA 1G3CA 2BD4A 5AHGH 2THFB 3RXGA 1L1JA 1GJ6A 2AS9A 3S9AA 1AWFH 2G52A 2J92A 4AB8A 4E06H 1BIOA 3TGJE 1WV7H 4J1YA 1AU8A 1JIRA 1C1UH 1HYLA 1K1MA 2FOBA 3A88A 1C4Y2 2OC8A 1T8OA 3RMNH 2H9HA 1O5GH 2V35A 2FX6A 1C5PA 1SOZA 3T25A 3LOXA 1FI8A 3GYLB 2OXSA 2PSXA 2UWLA 4AYVB 3SN8A 2G81E 2ODYB 4AFZA 3MU5A 3K9XB 3GDSA 1ZPZA 4DCDA 1TGBA 5LH8A 1B7XB 3KL6A 2VVUA 2ODQA 1QJ6B 1DXWA 1K21H 1Z8RA 1NN6A 2ZDNA 3BTHE 3MU1A 5TCAA 3B23B 1TAWA 4WH8A 4CBNA 5T6FA 3CS0A 4XBDA 1F5RA 5J4QA 2PUXB 3L6PA 1KDQA 2PLXA 4A1TA 2BHGA 1W12U 3GYMA 3MU0A 1BBRH 1P9UA 1WAYB 3RXIA 3MNCA 1ETSH 4U01A 3NZIA 2DE8A 3V12A 1C1NA 1QTFA 3IG6B 1OWEA 3V0XA 3V3MA 4ZUHA 1O5EH 2TGDA 2ZFTA 1ELTA 1GPZA 4AG1A 1BUIA 2ZDLA 1UCYE 3F9EA 2ZPSA 4UFEH 3SW2B 1TNIA 1QB1A 1JIMA 3EGKH 1TRMA 1A5GH 1NRPH 1SPJA 4UD9H 5EQSA 4Y0YE 3NKKA 2A7JA 1WUNH 2B7DH 1EPTA 4X8UH 5C67A 2BMGB 1WCZA 1AUTC 4BXSA 1XUGA 1J17T 2OC0A 1P57B 3TGIE 2ODPA 4NIVA 2A2XH 1O37A 1G36A 5A8YA 4Z0KA 3M7QA 1EJMA 3URCA 2QF3A 1HXFH 4TY7A 1S6HA 4ZHLU 3ZV9A 3A82A 3SUGA 2O8UA 1C2FA 3PLBA 4X8VH 4MTBA 4X2YA 2ZU3A 3RC5A 1LHFH 1LCYA 1HXEH 2QV1A 4JK5A 3BIVH 3RXBA 1MBMA 2Y5FA 3QZRA 5GXPA 1MZDA 2AMQA 4OGXA 2P94A 1C5SA 1UTPA 1C1WH 4HFPB 4BAOB 1LVYA 1NM6A 3RXPA 2ULLA 4MPUA 1AZ8A 2B0FA 3VB5A 1IQEA 1GMHG 1HIAA 3G01A 3U8TH 3KQBA 3VB7A 1CA0B 1GBLA 4DG4A 2CHAB 1YPKH 4UDWH 2A45B 4I8HA 2HVXA 3OSYA 4MDSA 1XUKA 1QBVH 4FUJA 2BB4A 2P8OB 2ZECA 3A89A 1NFUA 1GMDG 2FMJA 1H4WA 3UPEA 1ZTKA 2GV6A 2UUKB 1IQNA 4K2YA 3ATIA 3ATKA 3SO3A 4UE7H 2XNIA 2RCEA 3T62A 7KMEH 1GHXH 3ZZDA 4Q7ZA 2VVVA 1O2SA 1EB2A 1AGJA 2P8OC 1C2MA 1HAVA 1L4ZA 2PV9B 1BMLA 1ZYOA 3BTDE 1SVPA 3UNRA 1FDPA 2IJOB 4JZFH 1H9IE 1QQ4A 1VR1H 1THRH 2J94A 1BBRK 3PLKA 1D9IA 1S0QA 1P2IA 3GDVA 3LGVA 4JYVH 3FANA 3LGIA 2VWLA 5F8TA 2BZAA 1W0ZU 1V2PT 5CE1A 2V6NA 3EDXB 3ESTA 4AN7A 2PSYA 3P8OA 3I29A 4ZHAA 1GDUA 1VITG 1GI9B 1YGCH 2WPKS 3SU3A 1TLDA 2J34A 4BTIB 2VWMA 1BDAA 1ELGA 1O2JA 2XBWA 1DLKB 2Q6DA 1BRUP 1O34A 1LQEA 2I6QA 1DWDH 3BF6H 2VIPA 1GBIA 1NC6A 1SLXB 4ABDA 4A5TS 3DUXH 2CF8H 1ABIH 4X0WU 2IN2A 5A0AE 2QAAA 3URDA 3V7TA 1E37B 1RGQA 4X6NA 4CRCA 2BLQA 3RXHA 2A7CA 3P92A 1W11U 1YPMH 5E0HA 1FY4A 4IC5A 2W5EA 3QN7A 6CHAB 2GCTB 5DP9A 1W0YH 1JMOH 4A7IB 1NRRH 2RG3A 4ZKOU 1EUFA 2ZDKA 1KDQB 4WH6A 2LPRA 5E0JA 5EPYA 3RXMA 2WV4A 3RMOH 1LPZB 3BTQE 2Q6GA 1AO5A 4KP0A 1INCA 2ZFFH 4X2VA 1QL7A 4IN2A 1ID5H 4NG9H 4CREA 4ISLA 3FVFB 1O2OA 4JMYA 2ZQ1A 4WWYA 2OUAA 3E6PH 1HAOH 1TMUH 3PV4A 6CHAC 3ZZ3A 3W94A 1BTPA 3M37A 1MZAA 2BDGA 1RS0A 4Q7XA 3T27A 2C4FH 4U32A 4XBBA 3RM2H 4ZXXH 1G3BA 3RXRA 4DURA 3TPIZ 1BJUA 2CMYA 4AFQA 2BD3A 4X8TH 4JZ1A 1UJ1A 1CT4E 2HOBA 5LPRA 1EPTB 4B74A 4F4OC 3BTWE 4X6PA 5C1XA 1BMAA 1DWBH 3Q3XA 3BG4B 4INLA 3Q00A 1G9IE 2CGAA 1BTHH 2Z7FE 3FP8E 4HZHA 1TQ0B 2BOHB 2STBE 1ESTA 3LU9B 1SGYE 3LJJA 1D4PB 3PWCA 2TRMA 3SNEA 2FI5E 1O3EA 4B2BA 1OOKB 2ZFQH 4Q2KA 1CBWB 1SGCA 2ZU5A 4KGAA 4U30A 1EPTC 1SLUB 1TBQH 1UK3A 2F9PA 4X6MA 2TPIZ 1JBUH 1F0SA 1MAXA 1GI2A 1QRZA 2XBVA 1BB0B 2ZZUH 1PYTC 4RN6A 1GBKA 3BG4C 3BV9B 3LC5A 1YLDA 2SNVA 3E0NB 2QXGA 2FODA 1HFDA 2BY8X 2ZU1A 2BDCA 3D65E 4I8LA 2A4OA 5BRRE 1O3LA 3GY3A 1GG6C 1BTUA 1P0SH 3LKWA 1NU9A 3SNDA 4KTUA 1F0TA 5C5NA 4K1SA 1O2QA 1FY8E 2WPLS 3SU2A 1GJCB 2D26C 1HIAB 1KYNA 2SGEE 3R3GB 2VIVA 1ELVA 2JKHA 5HM9A 2F3CE 1EAIA 3GCTG 1CA8B 5EGMA 4CH8B 1IAUA 2C8XB 1YCPH 1GI3A 3UNQA 1DITH 3EA8A 2ZHFH 5L2ZH 3RC4A 2AGEX 4ISHH 2ZHWH 3ZZ5A 4I7YH 4GHTA 3IWMA 1DX5M 3RMLH 3RU4D 1Y59T 2EC9H 4Y76A 1V2OT 3SUDA 1GMHF 1AD8H 1V2RT 1EXFA 2FI4E 2ZI2H 1MQ6A 1Q3XA 4Y11E 1HAVB 1IQFA 2R9PA 3PYHA 2BY9X 2AGIX 1UCYH 2NU2E 4LOYH 1Z8IB 5JBCS 1GBHA 2GT8A 1XX9A 3PTNA 1THPB 3PWBA 1GMDF 2WUCA 2ZCLP 2ZFRH 3ZVAA 1AKSA 5EQRA 2BZ6H 1G2LA 3TH4H 1NPMA 2FX4A 2PUQH 1P2OA 1WTGH 1O2LA 1EJAA 1FJSA 2F9NA 1EQ9A 1GHVH 3F6UH 1Z1JA 3LIWA 1HCGA 1ZGIA 2AIQA 4TWYA 1IQHA 2FP7B 4ABAA 5A0BA 2VVCA 3QWCH 2ZHEH 2V0BA 1SC8U 4JYUH 3MNSA 1G3DA 5DG6A 2ANYA 2XYAA 1GI1A 1KLTA 2F9OA 4YM9A 5DP5A 2RA0A 3M61U 1YLCA 1J14A 1LVBA 1MCTA 6GCHG 3DHKH 5DP3A 2F91A 3O8BA 2HLCA 1L0ZA 1VITF 3QGNB 1P04A 1OS8A 2ANKH 1WQSA 2GCHG 3RXTA 4YESB 1PPEE 5FAHA 2WV5A 1UO6A 3SJOA 1RIWB 2W3KA 1VZQH 2XRCA 1IQJA 1V2LT 1YF4A 4LXBH 1CHOG 3LH3A 4XE4A 1P11E 2K1QA 4K69A 1O2YA 3KCGH 3BTME 2G8TA 3KNXA 2G55A 3JZ2B 4IGDA 1D3QB 1NTPA 3U1IB 2PW8H 1GDNA 2BXUH 3UNSA 1P05A 1RIWC 3PMJA 1TGTA 1ANBA 3TJVA 1MAYA 1W14U 3D23A 5T3HA 4ISIH 1HAPH 1MQ5A 4FUCA 2GX4A 1GDQA 5G4BA 5SGAE 2BTCE 3SGAE 1GHAG 2AGGX 1CO7E 1YPJH 1TQ7B 2FLBH 1W7XH 3PTBA 2G4UA 2OC7A 1FIWA 1P09A 1O39A 5DK1A 3SI3H 4VGCC 4UFGH 3ELAH 1GBJA 1P12E 1C1SA 4UFDH 3FZDA 1C2EA 4AGJA 4TPIZ 1NROH 2XWBI 3STJA 4BTTB 2AIPA 4AYYB 4FUBA 2WYJA 1QBOA 1S6FA 3ZZ9A 4B2CA 3BEUA 2TGPZ 2BX4A 2BQWB 5AF9H 1ZZZA 1GJ8B 1PQ5A 3A8BA 3E90B 2FDAA 1UCYK 5A0CA 2FTLE 4ABJA 1O5BB 1KIGH 4X1PU 2C93B 3K65B 3P8FA 1TPAE 5AFYH 1TOCB 2ZHDA 4NIWA 1UTKA 2QCYA 1P06A 4GVUA 1G32B 1FUJA 4UONA 4WMDA 3MH6A 3M7UA 4RSPA 4D8NA
chains in the Genus database with same CATH superfamily
1HV7A 3U69H 3MYWA 1V2UT 3PMHB 3SQEE 1V2QT 1P3EA 4CHAB 1GBEA 4Z1MD 4JCNA 1Z6JH 4SGBE 1C2LA 2Z9LA 2GDDA 1P2NA 1NBMD 2TIOA 2OD3B 2KZ4A 2H6MA 1IQMA 5FBIA 1Y5BT 1HAYB 3SHAH 2OLGA 3ZZAA 2YNAA 3UWJH 2ZDVH 4HI3A 1D3PB 4MVNA 1FMGA 4X6OA 5ESTE 1S83A 5E0GA 4BAKB 4XBCA 4CHAC 4RKOB 4IN1A 2BDHA 1O5CB 3OEED 1HBTH 3K6YA 3QGJA 3SZEA 3WY8A 3VFEA 2A7HA 1QNJA 3LJOA 1FY1A 4Z6AH 2J95A 1HGTH 2IPQX 1NFXA 1DWEH 1ZSLA 1DE7H 3C27B 1AKSB 3BSQA 3F0PA 4F48B 1C1RA 7GCHG 1TNLA 3TH3H 3KHVA 3LGTA 5JPMH 2QXHA 4NSYA 1C1MA 5FXLA 1NO9H 3MH5A 4FUFA 1RFNA 4MLFB 4ZXYH 1GMCF 2C8WB 3PROA 5DN6D 1VCPA 2O9QA 2JJ2D 1QL8A 1E36B 1QGFA 1HPGA 2QF4A 3Q77A 3LGUA 3K2UA 3RU4E 1QRXA 2C3SA 1F5LA 4NFEA 1BT7A 1VGCB 2KAIB 3RUOA 3MTYA 4U2WA 1O2IA 2R0KA 2FLRH 3A7TA 3VXFH 1HAZB 5ESBA 4BNRA 1FXYA 2FESH 1P2MA 4B71A 3P17H 3KQEA 2GDEH 3RXJA 1MD7A 5C1UA 1KMHB 1J9CH 1EAXA 2J4IA 3OTPA 3D62A 4ZCNA 3ZZCA 4NIYA 1GI4A 4OS4A 2TGAA 4WY3A 1V6DA 1C2JA 2PKSB 4HGCA 2OK5A 1KLIH 1SFQB 1VGCC 1Z71A 3SNBA 2GVFA 4K5ZA 3EA7A 3A7XA 1H9HE 4MQAA 3Q76A 1IQLA 3BEIB 5KGOA 4NA7A 3PV5A 6GCHF 1TNHA 4OGYA 3DFLA 1DY9A 5A8ZA 2LP6A 3SORA 2V3OH 4MNWA 1QA7A 1ZRKA 4Y71A 1T31A 1PFXC 1ZTLA 5EXLA 4DW2U 3KF2A 2EI8A 2GCHF 3HK3B 5LGOA 3NWUA 1JRSA 3RXOA 2A5IA 2VH0A 3OTJE 3PMBB 1MCVA 1O3NA 4ZMAH 1MKXH 2A2QH 3GY6A 1O31A 4FOUC 5FCRA 2DUCA 2BDIA 1ANCA 1SGQE 2ZDMA 3P8GA 1EJNA 2ZEBA 1A61H 1LHEH 3RXKA 2VU8E 2ZHQH 1CHOF 1QRWA 4WMEA 2XCNA 2HRVA 3A8DA 3WW7A 1K1LA 2W6JD 5DJ7A 2ZTYA 1QL9A 5EJZA 1SMFE 1DUAA 1O2NA 4GAWA 1FIZA 2GTBA 3EE0B 2WUBA 9LPRA 1V2VT 2J5UA 2A4RA 3RXUA 3PM3A 2Y82A 1EAWA 2A0QB 3PLPA 2BYAX 1PPHE 5K7RA 3LC3A 3L3TA 2A31A 1ABJH 1GI5A 4AX9H 3VPKA 4FUHA 1C5WB 5C3NA 1SFIA 3KQDA 4I31A 1SKYE 1C1OA 2W6ID 3EE7A 1GWAA 3VGCB 6ESTA 2XOKD 5AVDA 1U6QA 5FX6A 4A1XA 2FS9A 3GICB 1C4U2 4XRNA 3SBKA 3QDZB 2XNDD 1AWHB 1LHDH 4B76A 4J2YB 1CA0C 1RTKA 1MTSA 2CHAC 2H9TH 3NCLA 1OWDA 1GBMA 2CXVA 2UUJB 1C2DA 1H8DH 1RJXB 1YY3A 1O3OA 4OS7A 1KTSB 1O2UA 2FOHA 5HYOA 4KTSA 1AMHA 4F49A 4UFFH 2G00A 3VGCC 5HIYA 3DSOA 4OS1A 2H5CA 3DA9B 3TIUA 1TABE 3MOCA 1IQGA 4NCYA 3TNSA 1OP2A 2WINI 1V2KT 1L2EA 1O3MA 1HJ9A 1C5UA 2W26A 1VCQA 4M9FA 1K1OA 4H42U 2HPPH 3A86A 3M3TA 1LHGH 5J4SA 2Z9GA 1NESE 3MH7A 3TK9A 4OS6A 3RMMH 1DS2E 3SU0A 1EZSC 4D7FA 2GJGA 3C1KA 4CH2B 1PPFE 3S0NA 3E0PB 2HGTH 2IOTA 2V7QD 2B9LA 4TSFD 1SGDE 5C2ZA 2OCVB 1SBWA 1A2CH 4IW4E 4P02A 1N8OB 1C5QA 2FTMA 3TH2H 2JH6D 2ZFSA 5LPEA 2D2DA 1DFPA 2XTTB 1BQYA 5F8XA 3E1XB 2ZGBH 1GI8B 1LDTT 1AE8H 1KTTB 5ABWA 1GJDB 2VBCA 2WPMS 1GCTB 3B8JA 1GJ9B 3LH1A 1XUIA 2LNCA 2ZG0H 1OP0A 2BY6X 1DXPA 2Y7ZA 3ENSB 5EG4A 2BD5A 3SJIA 4XFQA 1ZSKA 3BTGE 2FXRA 1C1TA 2O8WA 4TT3D 5F8ZA 1LVMA 3JZ1B 4GHQA 1BTZA 1VITH 1UTLM 9ESTA 1E38B 2A5KA 2FYRA 1O2RA 3ZVCA 3VXEH 1IHSH 1C2IA 1B0EA 4YTAA 1ESBA 1T32A 4FU9A 2CF9H 3OAAD 3AW1A 4MG3A 3QTVH 1KLJH 3UOUA 2GCTC 3UTUH 1BHXB 1UTOA 1IHTH 3MU8A 2NU1E 2ZGJA 3KGPA 5DP8A 4ZAEA 3S7KB 4AOQA 5TJXA 4D7GA 1ELCA 1ZTJA 3GY4A 4CRDA 1GJ4H 4ZKRU 3UAIC 1PYTD 2R3YA 3T26A 1GJ5H 4ZHMU 1G3EA 1O3BA 2FI3E 2YMSC 2B5TB 2TGTA 1O2PA 2W7UA 3SGQE 1A5IA 4Y8XA 2P59A 1KXCA 1HJAB 4JYTA 1ELBA 1KXFA 3O8RA 4RKJB 1YP9A 2M2AA 2AHME 1BMNH 3M7TA 1J8AA 3BIUH 5GCHG 1OXGA 1O3CA 3ZZ6A 1EX3A 1TX8A 3ODDA 3BTFE 1EZQA 1BRCE 2VIQA 5E2PA 3RU4T 4IBLH 4NZQA 3RLYH 2BVXH 4YXWD 2R2MB 2PR3A 1YPLH 2SGFE 1NT1A 2G4TA 2QC2A 8GCHG 1RTLA 1FV9A 2GZ7A 1DSUA 1YPGH 4CR9A 4ZH8A 2SGPE 2F9VA 1SG8B 4ABEA 1ZMJA 4ABIA 1BBRE 2UWOA 1FAKH 3MU4A 2UUFB 2ZU4A 1XXFA 2JETB 3M3VA 4O3UA 3ZZBA 1CBWC 4X1SU 1TALA 1JXPA 1QHRB 1TBRH 1W2KH 1EAUA 1HNEE 1NZQH 2JH0D 1ARCA 4FVDA 1DSTA 4P00A 3H7OA 3T28A 4BXWA 3F2GA 2J38A 3AVZA 3UQOA 4K3JA 3ZVFA 1VJ9U 1FNIA 1QQUA 5FPTA 1ESAA 3BN9A 3MHWU 3TU7H 3HPTB 1SGFA 4ABBA 3O8DA 1A46H 5E2OA 1Y3UA 4IMQA 4O03A 4TY6A 1AQ7A 3M5OA 2KX4A 1B0FA 3UR6A 3HGPA 1NRNH 3FP6E 2EA3A 1N6YA 4Y8YA 2QIQA 1TX7A 4H6SB 1UTNA 4R8TB 1QB9A 1EP6A 3ZYDA 2Y5GA 3ATMA 3LT3A 4DGJA 1O36A 1RRKA 2EEKA 2AMPA 1HRTH 2BY7X 5EW1H 2ALVA 2ZF0H 3RM0H 2XW9A 1Y3VA 5EU8A 2VINA 1TA2A 1TONA 1EB1H 5FPSA 3SOSA 1SSXA 3T2NA 2BLVA 2Q1JA 5FBEA 4A92A 1F5KU 4H4FA 1NS3A 4KKDA 3UB0A 2A1DB 4GCHG 1OHHD 1CGJE 1KXEA 1GVZA 2FOCA 3E91A 5EW2H 5DKMA 4KTCA 1O3IA 7ESTE 2ZCKP 5BPEA 3MFJA 3P6ZB 1AFEH 2KAIA 2QGRA 1Y3WA 1TBZH 1TOMH 1JWTA 1THSH 1P2JA 1AN1E 4D9QA 5PTPA 1COWD 1ZLRA 2ZC9H 4B1TA 2XC4A 2Y7XA 3A83A 1A7SA 2XXLA 4D76A 1O5FH 1NRQH 2TBSA 4K1EA 2QY0B 5A8XA 3RXEA 1O2GH 3GY8A 5AFZH 4ZROA 5L6NH 3E8LA 1O30A 1D6WA 4YLQH 1CQQA 1IQIA 1GHYH 3QZQA 3GY2A 1GHBG 1Z7KA 3UR9A 2RDEA 2BOKA 1S84A 1SQAA 4K8BA 8LPRA 4NA8A 3RXLA 1XVMA 1C9TA 1MTUA 4MPXA 3PO1B 1MU8B 3I77A 3ZVEA 2BD2A 2VIDA 3A84A 5EPNA 2VIOA 1KXAA 3HKIB 1SGFG 1Y3XA 4FVBA 4X2WA 1TNJA 1ZMLA 2A4QA 4LZ1H 4ZKNU 1O3DA 4AFUA 4OS2A 1N1LA 1W0KD 3KN2A 4D9RA 1BJVA 1LPGB 3NRLA 3PO1C 1YCPK 2H9EH 2PHBA 1DUEA 1T4UH 2FOMB 1WOFA 2SGDE 4Q80A 3ZZ8A 1GJ7B 1FN6A 1OYTH 1SLWB 4JZDH 1O3FA 2HLDD 3CENA 1O33A 1GBTA 1ZR0A 1KXDA 1P2QA 1HB0B 3OX7U 4X1QU 1PQ8A 1GHZA 2AH4X 1HLTH 1V2JT 2CN0H 2FOEA 1A3EH 3RXDA 1GBCA 2H5DA 1Y5UT 5JB8S 1TB6H 2AEIH 2Z3EA 1C2GA 2HVYB 3RP2A 1O5AB 3U8RH 1GBDA 4B2AA 1V2ST 5GDSH 1OWHA 1ZHMA 4FUGA 1FZZA 3OU0A 2XBXA 4BOHA 3SZNA 1SGTA 5KEDA 1RXPA 1FN8A 1NU7B 2CK3D 3ZZ7A 5GCHF 5HXFA 1UVUH 2GD4B 1K1IA 3MH4A 4Q63A 2OBOA 3LONA 3P8NA 1ETTH 4DT7B 7LPRA 2ZGHA 3F9GA 2OBQA 1C2HA 1UVOA 4LK4A 3KQ5A 4WJG2 1YPEH 2P93A 1DM4B 8GCHF 6LPRA 3O8CA 1DY8A 1G2MA 3V13A 1HJ8A 3Q3YA 4MPWA 2OQ5A 2FOFA 3SU1A 5FL7D 1PPCE 4BAMB 4M7GA 4JZIA 4NZLA 1T7CA 1YLNA 3SV6A 1QB6A 3MNXA 1WDIA 1O2TA 4YOGA 1FPCH 5GWZA 3STIA 4X1NU 1S5SA 1XKAC 1O2MA 2ZTXA 3PRDA 3D49H 1K9OE 3MMGA 1WTHD 2BQ6B 5EJLA 2D1JA 2FWWA 1ZPCA 3MWIU 3GCTF 1A1RA 3UFAA 2R0LA 5C20A 3M5NA 2PKAB 2ZGXH 3IITA 3FZZA 1NFYA 1SGRE 3OY5U 3RC6A 4MNVA 1TPSA 5CMXH 4DOQA 3NXPA 2ZIQH 2GP9B 4DJZB 1O2KA 5C5OA 4CRBA 2HNTC 2OINA 2J2UA 3Q3KA 5JBBS 3ZV8A 1E0FD 3TVJB 1K1JA 2F9UA 1F0RA 2A5AA 1DLEA 2XC0A 3HATH 2P3FH 1ANEA 1CHGA 3UWIA 5HM2A 1TX6A 2XBYA 1QBNA 3GCOA 3FP7E 3M5LA 4YT7H 2XCFA 1SHHB 2GKVE 4CRAA 5GJ4B 2F9BH 1UTJA 1Z8JB 1EZXC 1W7GH 1SQRA 1AVXA 1P3CA 4XDEA 1HAIH 1UMAH 1IOEA 1GI6A 1V2MT 3SNCA 5HIZA 4GPGA 1TNKA 3SV7A 3EYDA 1CT0E 1TA6A 1YPHC 1ANDA 1O5DH 2QA9E 3TJUA 3LDXH 1BZXE 3VB6A 1RD3B 1L1NA 1Q31A 2R2WU 2Y80A 4GCHF 2BY5X 3SJ9A 3SU5A 1HAGE 5I25A 2PTCE 1GBAA 1SI5H 1AI8H 1P2KA 3A87A 1KY9A 4B75A 1JRTA 4I86A 1TE0A 1Y5AT 1LPKB 1AIXH 2BM2A 4I33A 1O38A 4HG6A 5DP4A 1FX0B 2Z9JA 1QIXB 4YT6H 3MO6A 3OYPA 4X1RU 1PPBH 3QUMP 1T8NA 2K0QA 3UIRA 3GCNA 1TIOA 4BAQB 2QXIA 3SU4A 2PKSC 5DSFA 4DT4A 1SL3A 1TYNA 1MTNB 1PPGE 3MQKC 1O3AA 1XKBC 1SB1H 2G51A 1C4V2 1K1NA 2Y5HA 4AZ2B 3WWBA 3MO3A 4ASHA 3A85A 3VB4A 3LPRA 1RTFB 1GHBF 2ZGCA 4MNYA 3A7YA 4FUDA 1H1BA 1QJ1B 2ESTE 2GV7A 3K6ZA 3PMAB 4BTUB 4FUIA 1HUTH 1ZHRA 4K8YA 5CDFE 3A81A 1P9SA 5EOKA 1ELDE 4CRFA 3A7WA 1BTXA 2D8WA 4WXIA 1MTNC 5DP7A 2C8YB 2VWOA 3M36A 3CP7A 2VIWA 3M5MA 1OX1A 3ZZ4A 2H1UA 1GBBA 3VB3A 1VCWA 1CU1A 4ABHA 2PFEA 5L2YH 2Q6FA 2I6SA 2OQUA 4IC6A 1C5XB 1P03A 5HMAA 3U9AH 4A1VA 1ZRBA 2AMDA 4B6EA 4FU7A 1UW7A 1XMNB 2ZQ2A 2A32A 1NY22 2HNTF 2FS8A 1FLEE 1GHAF 2UWPA 3A7ZA 1BCUH 5B6LA 2SGAA 3L33A 1P01A 2BDYA 3A8AA 2SGQE 2BLOA 1YBWA 3N7OA 3GY5A 2R3UA 2Z9KA 2XC5A 1EATA 2ZPRA 2WPJS 3SYJA 4CRGA 2FPZA 5EQQA 1ARBA 1S81A 2A4GA 3FAOA 2HPQH 3I78A 3N99A 1V2NT 2J97A 5K0HA 2BDBA 5DPAA 3QK1A 1QURH 2WYGA 3RXSA 3KYFA 2GT7A 3KQCA 4Y7BA 4GLYA 3F1SB 4NWKA 1N6XA 1CGIE 2W3IA 2FM2A 3NPSA 4AG2A 3SV8A 2BLWA 3SHCH 4DY7B 5C94A 5A09A 1BTWA 1H8IH 3SJ8A 3QLPH 1H9LB 2O8MA 1O3KA 1DWCH 1MUEB 2FIRH 2ZU2A 4ESTE 2P16A 4KELA 3AASA 4MNXA 1O3PB 2AFQB 1V3XA 2QN5T 2O8TA 4NSVA 3UREA 1D3TB 4Q4LA 3A7VA 2VGCB 3FFGA 4O3TA 2HWLB 2ZTZA 3U98H 1A0LA 1SOTA 4I32A 3P70B 1TRYA 1FQ3A 4ZKSU 3H7TA 3S9BA 4I8KA 1TGNA 2Y6TA 2QF0A 1WBGB 3EQ0H 4YOJA 5IDKA 1BMMH 1GJBB 2HNTE 1HDTH 1L4DA 5E8EH 2WPHS 5FPYA 2BQ7B 2BD7A 1TGCA 3W95A 4WMFA 1C5YB 3RXAA 1O2HA 3M35A 1F0UA 4ISOA 4HTCH 2VGCC 3ODFA 2FO9A 3EAJA 2NU3E 2ANMH 2V3HH 2WPIS 3BEFB 2WSSD 1TNGA 1TMBH 5GNDA 5I46H 1BA8B 5IK2D 2FOAA 3S9CA 2RA3A 1NBME 5EXNA 1AUJA 1C5ZB 1EOJA 3NUMA 3OFND 3UUZA 1O3GA 3E16B 1MKXK 1UK4A 4Y0ZE 1FONA 1N8OC 1VJAU 2P95A 1XUFA 2YOLA 3KYGA 3SGBE 3GDUA 4CBOA 1C9PA 1S85A 1MD8A 2STAE 1BRAA 1BITA 1YPHE 3QTOH 4TYDA 4O9VA 2ZWLH 3FN8A 3T29A 1GI7B 1GCTC 4TPYA 1A4WH 1AE5A 2GGVB 3B9FH 3NK8A 7GCHF 1E1QD 4ABFA 2Y81A 4LZ4B 4YO9A 1BRBE 1GCDA 2M5TA 1ZGVA 1FY5A 1MTVA 1CVWH 1K28D 1XM1A 1CT2E 1C2KA 1ZJKA 4NWLA 1ZSJA 1ORFA 4BANB 2Z6BD 4XD7D 1ELAA 1F92A 5IYTA 3TJNA 1S82A 1WQVH 3AAUA 1DDJA 4WVPE 3DFJA 5L30H 3ITIA 3UQVA 3A8CA 4DIIH 1ZJDA 2GMTB 3U8OH 5HGGA 1QR3E 1AFQB 1EASA 1GVKB 3QO6A 1UVSH 3BTEE 2QYIA 4FXGH 4YLUA 2ILNA 4MPVA 3HKJB 2FYQA 3SU6A 1K1PA 1C5NH 2ANWA 4AB9A 1W10U 4FUEA 5FCKA 2J9NA 3LGYA 5CHBA 1OYQA 1OWJA 4X8SH 4INKA 4K60A 1NFWA 2C90B 1F7ZA 2ASUB 1OWIA 2VJ1A 1O32A 4YZUA 1DICA 2GMTC 3CNRA 1O3JA 3TITA 2GZ9A 1W8BH 1T8LA 1AFQC 2EI6A 1HJAC 1UHBA 3LGWA 2ZKSA 2BD9A 3RXFA 4WXVA 1TGSZ 4R0IA 1MH0A 3RXVA 1ETRH 2EI7A 1QJ7B 2AYWA 4NFFA 1OPHB 5EODA 5FX5A 1KSNA 1TFXA 1TWXB 4Y79A 2W7SA 5F03A 1LMWB 1QY6A 2BDAA 1GG6B 1S0RA 1Y8TA 2C8ZB 4JZEH 1DANH 1AB9B 1SLVB 1MBQA 1Z8GA 8ESTE 1Y3YA 3CS7A 3DD2H 1EP5A 1L1GA 2ZDAH 1GVLA 1D3DB 1YKTA 5H4IB 3ZVBA 1MKWH 4DIHH 1MABB 1O2VA 5JBTA 1F2SE 3UOPA 4FU8A 2PTNA 3UY9A 2BVSH 5LPFA 1J16A 1UK2A 3F9HA 1GI0A 1YYY1 1P8VC 3AAVA 3OY6U 2Z3DA 1QFKH 1P02A 2YNBA 5C17A 5ETXA 4IS5A 4IMZA 1AB9C 5F6MA 2JETC 1DVAH 3PRBA 1KXBA 1TPOA 5DGJA 4A6LA 2CV3A 1LO6A 5A2MH 1SR5C 2Z3CA 1C1QA 1UVPA 2O8LA 1A0HB 1NRSH 1SHYA 2VNTA 2IPHA 1ZMNA 4AGKA 2F43B 4ISNA 2CJIA 3RXQA 4ABGA 1MTWA 3KEEA 3RDZA 3S7HB 5B6OA 5GIBA 2FOGA 2Z9IA 1ACBE 1SQTA 3TLOA 2NU0E 1T8MA 2PWXA 2PGQB 4RT0A 2PKAA 1FY3A 1AVWA 1UVTH 3SUEA 3BG8A 4Y10E 3SV2H 3PB1E 1J15A 3MO9A 4Y6DA 2L74A 1LTOA 1OSSA 1Z6EA 3HK6B 2DE9A 2VH6A 1E35B 1GGDB 2HALA 4Y8ZA 5C1YA 3F2HA 1G37A 1UTQA 2OP9A 1GMCG 4XOJA 5T6DA 4B73A 2NWNA 5DO4H 4K1TA 1Q2WA 2ALPA 2SNWA 1CE5A 3VEQB 1UTMA 1TPPA 1BHXF 1GL1A 4INHA 2OTVA 2VWNA 1QCPA 3DSPA 4WF8A 2G5NA 1SQOA 1GGDC 3A80A 3TJOA 2VB0A 1X7AC 2RDLA 1WXRA 4H6TA 3ATWA 3AW0A 1T4VH 2ZO3H 1AY6H 3ZVGA 3OEHD 2QXJA 4NA9H 1DT2A 1G30B 2H2ZA 1CGHA 1OWKA 3TK6A 5GPIB 1CSOE 2NU4E 4OS5A 5EIYA 1PQ7A 1XUHA 4TWWA 1GHWH 3M3SA 1EKBB 3BTTE 1DPOA 1C1VH 1D6RA 1S6LA 3SNAA 1GBFA 1A0JA 1M9UA 4E7NA 1SGNE 4CR5A 1C5TA 4XSKU 5EXMA 4BAHB 3QX5H 1GJAB 1LQDB 1V2TT 2QE7D 1C5OH 1TRNA 1C1PA 2AERH 3SUFA 3H5CB 4X2XA 3GY7A 4I8GA 3ZYEA 1Z1IA 3R0FA 3RXCA 4JK6A 5JBAS 1K22H 1EZUC 3EA9A 1AVGH 4AFSA 4DVAU 1E34B 2UUYA 4QT8C 3KIDU 1FAXA 1XXDA 2ZFPH 1OP8A 1WYKA 4NGAH 1ELFA 1MKWK 5CHAB 2P3UB 2K8IA 3ATLA 3RLWH 2BVRH 1AZZA 1K2I1 1MU6B 2FEQH 1LVOA 2PGBB 3TK5A 3GOVB 3U1JB 2P3TB 3GISB 1ZHPA 4I8JA 1LKBA 4E05H 1C5RA 1XVOA 1PQAA 3BTKE 2F83A 4GUXA 3GCHB 1TMTH 1OKXA 4YOIA 4VGCB 2ZNKH 1ZPBA 3OE7D 1C5VA 1LKAA 1DOJA 1PJPA 4Q7YA 5CHAC 1WSSH 2OC1A 4O97A 3SJKA 1BOQA 5TCCA 4E7RG 3HGNA 4THNH 8KME2 1UHBB 2G5VA 2FZZA 1O2ZA 1A5HA 4NIXA 3SQHE 1YCPM 3GCHC 1SGIB 3S69A 5JB9S 1PPZA 4PROA 5JYIA 2BXTH 3MNBA 1YC0A 3TNTA 2ZPQA 1AHTH 1WU1A 1B5GH 2RFKC 3MI4A 1IQKA 3P95A 2JH5D 1C5LH 3SV9A 1BTYA 5T6GA 1O2WA 1W3CA 5JDUB 1EOLA 4Y7AA 1HAHH 3F68H 5FHTA 1LHCH 1JOUB 1YM0A 1C5MD 1V2WT 2Z94A 2ZP0H 3DT0H 3F9FA 1QA0A 1W13U 2XWAA 1ELEE 4GSOA 1O0DH 1O3HA 2ZCHP 1A3BH 3SI4H 5DP6A 1SGEE 2GZ8A 1ZOMA 2ZA5A 4SGAE 3E3TA 2BD8A 3TGKE 1K0HA 2B8OH 1GL0E 1FPHH 1P10A 1O2XA 2BX3A 1MMJN 3T5FH 4UEHH 1XUJA 2KR7A 3ZVDA 1HAXB 2KM0A 1SGPE 2SFAA 1O35A 4AORA 1G3CA 2BD4A 5AHGH 2THFB 2JIZD 3RXGA 1L1JA 1GJ6A 2AS9A 3FOAA 3S9AA 1AWFH 2G52A 2J92A 4AB8A 4E06H 1BIOA 3TGJE 1WV7H 4J1YA 1AU8A 1JIRA 4B6FA 1C1UH 1HYLA 1K1MA 2FOBA 3A88A 1C4Y2 2OC8A 1T8OA 3RMNH 5C0UA 2H9HA 1O5GH 2V35A 2FX6A 1C5PA 1SOZA 3T25A 3LOXA 1FI8A 3GYLB 2OXSA 2PSXA 4ASUD 2UWLA 4AYVB 3SN8A 2G81E 2ODYB 4AFZA 3MU5A 3K9XB 3GDSA 1ZPZA 4DCDA 1TGBA 5LH8A 1B7XB 3KL6A 2VVUA 2ODQA 3DCLA 1QJ6B 1DXWA 1K21H 2V3MA 1Z8RA 1NN6A 2ZDNA 3BTHE 3MU1A 5TCAA 3B23B 1TAWA 4WH8A 4CBNA 5T6FA 3CS0A 4XBDA 1F5RA 5J4QA 2PUXB 3L6PA 1KDQA 2PLXA 4A1TA 2BHGA 1W12U 3GYMA 2WV9A 3MU0A 1BBRH 1P9UA 1WAYB 3RXIA 3MNCA 1ETSH 4U01A 3NZIA 2DE8A 3V12A 1C1NA 1QTFA 3IG6B 1OWEA 3V0XA 3V3MA 4ZUHA 1O5EH 2TGDA 2ZFTA 3GS9A 1ELTA 1GPZA 4AG1A 1BUIA 2ZDLA 1UCYE 3F9EA 2ZPSA 4UFEH 3SW2B 1TNIA 1QB1A 1JIMA 3EGKH 1TRMA 1A5GH 1NRPH 1SPJA 4ACAA 4UD9H 5EQSA 2EQNA 4Y0YE 3NKKA 2A7JA 1WUNH 2B7DH 1EPTA 4X8UH 5C67A 2BMGB 1WCZA 1AUTC 4BXSA 1XUGA 1J17T 2OC0A 1P57B 3TGIE 2ODPA 4NIVA 2A2XH 1O37A 1G36A 5A8YA 4Z0KA 3M7QA 1EJMA 3URCA 2QF3A 1HXFH 4TY7A 1S6HA 4ZHLU 3ZV9A 3A82A 2L6OA 3SUGA 2O8UA 1C2FA 3PLBA 4X8VH 1W0JD 4MTBA 4X2YA 2ZU3A 3RC5A 1LHFH 4AC9A 1LCYA 1HXEH 2QV1A 4JK5A 3BIVH 3RXBA 1MBMA 2Y5FA 3QZRA 5GXPA 1MZDA 2AMQA 4OGXA 2P94A 1C5SA 1UTPA 1C1WH 4HFPB 4BAOB 1LVYA 1NM6A 3RXPA 2ULLA 4MPUA 1AZ8A 2B0FA 3VB5A 1IQEA 1GMHG 1HIAA 3G01A 3U8TH 3PV2A 3KQBA 3VB7A 1CA0B 1GBLA 4DG4A 2JDID 2CHAB 1YPKH 4UDWH 2A45B 4I8HA 2HVXA 3OSYA 4MDSA 1XUKA 1QBVH 4FUJA 2BB4A 2P8OB 2ZECA 3A89A 1NFUA 1GMDG 2FMJA 2KCOA 1H4WA 3UPEA 1ZTKA 2GV6A 2UUKB 1IQNA 4K2YA 3ATIA 3ATKA 3SO3A 4UE7H 2XNIA 2RCEA 3T62A 7KMEH 1GHXH 3ZZDA 4Q7ZA 2VVVA 1O2SA 1EB2A 1AGJA 2P8OC 1C2MA 1HAVA 1L4ZA 2PV9B 1BMLA 1ZYOA 3BTDE 1SVPA 3UNRA 1FDPA 2IJOB 4JZFH 1H9IE 1QQ4A 1VR1H 1THRH 2J94A 1BBRK 3PLKA 1D9IA 1S0QA 1P2IA 3GDVA 2EY4C 3LGVA 3FANA 4JYVH 3LGIA 2VWLA 5F8TA 2BZAA 1W0ZU 1V2PT 5CE1A 2V6NA 5F53A 3EDXB 3ESTA 4AN7A 2PSYA 3P8OA 3I29A 4ZHAA 1GDUA 1VITG 2KCAA 1GI9B 1YGCH 2WPKS 3SU3A 1TLDA 2J34A 4BTIB 2VWMA 1BDAA 1ELGA 1O2JA 2XBWA 1DLKB 2Q6DA 1BRUP 1O34A 1LQEA 2I6QA 2YMSD 1DWDH 3BF6H 2VIPA 1GBIA 3H09A 5T1VA 1NC6A 1SLXB 4ABDA 4A5TS 3DUXH 2CF8H 1ABIH 4X0WU 2IN2A 5A0AE 2QAAA 3URDA 3V7TA 1E37B 1RGQA 4X6NA 4CRCA 2BLQA 3RXHA 2A7CA 3P92A 1W11U 1YPMH 5E0HA 1FY4A 4IC5A 2W5EA 3QN7A 6CHAB 2GCTB 5DP9A 1W0YH 1JMOH 3DSGA 4A7IB 1NRRH 2RG3A 3W1EA 4ZKOU 1EUFA 2ZDKA 1KDQB 1BMFD 2LPRA 4WH6A 5E0JA 5EPYA 3RXMA 2WV4A 3RMOH 1LPZB 3BTQE 2Q6GA 1AO5A 4KP0A 1INCA 2ZFFH 4X2VA 1QL7A 4IN2A 1ID5H 4NG9H 4CREA 4ISLA 3FVFB 1O2OA 2YMSB 4JMYA 2ZQ1A 4WWYA 2OUAA 3E6PH 1HAOH 1TMUH 3PV4A 6CHAC 3ZZ3A 3W94A 1BTPA 3M37A 1MZAA 2BDGA 1RS0A 2KCYA 4Q7XA 3T27A 2C4FH 4U32A 4XBBA 3RM2H 4ZXXH 1G3BA 3RXRA 3VG8A 4DURA 3TPIZ 1BJUA 2CMYA 4AFQA 2BD3A 4X8TH 4JZ1A 1UJ1A 2J98A 1CT4E 2HOBA 5LPRA 1EPTB 4B74A 4F4OC 3BTWE 4X6PA 5C1XA 1BMAA 1E79D 1DWBH 3Q3XA 3BG4B 4INLA 3Q00A 1G9IE 1VKYA 2CGAA 1BTHH 2Z7FE 3FP8E 4HZHA 3N7EA 1TQ0B 2BOHB 2STBE 1ESTA 3LU9B 1SGYE 3LJJA 1D4PB 3PWCA 2TRMA 3ZIAD 3SNEA 2FI5E 5HKKD 1O3EA 4B2BA 1OOKB 2ZFQH 4Q2KA 1CBWB 1SGCA 2ZU5A 4KGAA 4U30A 3U28C 1EPTC 1SLUB 1TBQH 1UK3A 2F9PA 4X6MA 2TPIZ 1JBUH 1F0SA 1MAXA 4RT1A 1GI2A 1QRZA 2XBVA 1BB0B 2ZZUH 1PYTC 4RN6A 1GBKA 3BG4C 3BV9B 3LC5A 1YLDA 2SNVA 3E0NB 2QXGA 2FODA 1HFDA 2BY8X 2ZU1A 2BDCA 3D65E 4I8LA 2A4OA 3FO8D 5BRRE 1O3LA 3GY3A 1GG6C 1BTUA 1P0SH 3LKWA 1NU9A 3SNDA 2F4LA 4KTUA 1F0TA 5C5NA 4K1SA 1O2QA 1FY8E 2WPLS 3SU2A 1GJCB 1H8ED 2D26C 1HIAB 1KYNA 2SGEE 3R3GB 2VIVA 1ELVA 2JKHA 5HM9A 1QZ8A 2F3CE 1EAIA 3GCTG 1CA8B 5EGMA 4CH8B 1IAUA 2C8XB 3F3BA 1YCPH 3F0OA 1GI3A 3UNQA 1DITH 3EA8A 4FETA 2ZHFH 5L2ZH 3RC4A 2AGEX 4ISHH 2ZHWH 3ZZ5A 4I7YH 4GHTA 3IWMA 1DX5M 2WHXA 3RMLH 3RU4D 3N7DA 1Y59T 2EC9H 4Y76A 1V2OT 3SUDA 1GMHF 4ACBA 1AD8H 1V2RT 1EXFA 2FI4E 2ZI2H 1MQ6A 1Q3XA 4Y11E 1HAVB 1IQFA 2R9PA 3PYHA 2BY9X 2AGIX 1UCYH 2NU2E 4LOYH 1Z8IB 5JBCS 1GBHA 2GT8A 1H8HD 1XX9A 3PTNA 1THPB 3PWBA 1GMDF 2WUCA 2ZCLP 2ZFRH 3ZVAA 1AKSA 5EQRA 2BZ6H 1G2LA 3TH4H 1NPMA 2FX4A 2PUQH 1P2OA 1WTGH 1O2LA 1EJAA 1FJSA 2F9NA 1EQ9A 1GHVH 2WZQA 3F6UH 1Z1JA 3LIWA 1HCGA 1ZGIA 2AIQA 4TWYA 1IQHA 2FP7B 2KCPA 4ABAA 5A0BA 2VVCA 3QWCH 2ZHEH 2V0BA 1SC8U 4JYUH 3MNSA 1G3DA 5DG6A 2ANYA 2XYAA 1GI1A 1KLTA 2QF5A 2F9OA 4YM9A 1EFRD 5DP5A 2RA0A 3M61U 1YLCA 1J14A 1LVBA 1MCTA 6GCHG 1E1RD 3DHKH 5DP3A 2F91A 3O8BA 2HLCA 1L0ZA 1VITF 3QGNB 1P04A 1OS8A 2ANKH 1WQSA 2GCHG 3RXTA 4YESB 1PPEE 5FAHA 2WV5A 1YWUA 1UO6A 3SJOA 1RIWB 2W3KA 1VZQH 2XRCA 1IQJA 1V2LT 1YF4A 4LXBH 1CHOG 3LH3A 4XE4A 3WWFA 1P11E 2K1QA 5EJ1A 4K69A 1O2YA 3KCGH 3BTME 2G8TA 3KNXA 2G55A 3JZ2B 4IGDA 1D3QB 1NTPA 3U1IB 2PW8H 1GDNA 2BXUH 3UNSA 1P05A 1RIWC 3PMJA 1TGTA 2LELA 1ANBA 2J98B 3TJVA 1MAYA 1W14U 3D23A 5T3HA 4ISIH 1HAPH 1MQ5A 4FUCA 2GX4A 1GDQA 2IJD1 5G4BA 5SGAE 2BTCE 3SGAE 1GHAG 4F55A 2AGGX 1CO7E 1YPJH 1TQ7B 2FLBH 1W7XH 3PTBA 2G4UA 2PP6A 2OC7A 1FIWA 1P09A 1O39A 5DK1A 3SI3H 4VGCC 4UFGH 3ELAH 1GBJA 1P12E 1C1SA 4UFDH 3FZDA 1C2EA 4AGJA 3F2FA 1NROH 4TPIZ 2XWBI 3STJA 4BTTB 2AIPA 4AYYB 4FUBA 2WYJA 1QBOA 1S6FA 3ZZ9A 3AK5A 4B2CA 3BEUA 2TGPZ 3FKSD 2BX4A 2BQWB 5AF9H 5KECA 1ZZZA 1GJ8B 1PQ5A 3A8BA 3E90B 2KFWA 2FDAA 1UCYK 5A0CA 2FTLE 4ABJA 1O5BB 1KIGH 4X1PU 2C93B 2WPDD 3K65B 3P8FA 1TPAE 5AFYH 1TOCB 2ZHDA 4NIWA 4OM9A 1UTKA 2QCYA 1P06A 4GVUA 5C0TA 1G32B 1FUJA 4UONA 4WMDA 3MH6A 2JJ1D 3M7UA 4RI0A 4RSPA 4D8NA
chains in the Genus database with same CATH topology
1HV7A 3U69H 3MYWA 1V2UT 3PMHB 3SQEE 1V2QT 1P3EA 4CHAB 1GBEA 4JCNA 1Z6JH 4SGBE 1C2LA 2Z9LA 2GDDA 1P2NA 2TIOA 2OD3B 2H6MA 1IQMA 5FBIA 1Y5BT 1HAYB 3SHAH 2OLGA 3ZZAA 2YNAA 3UWJH 2ZDVH 4HI3A 1D3PB 4MVNA 1FMGA 4X6OA 5ESTE 1S83A 5E0GA 4BAKB 4XBCA 4CHAC 4RKOB 4IN1A 2BDHA 1O5CB 1HBTH 3K6YA 3QGJA 3WY8A 3VFEA 2A7HA 1QNJA 3LJOA 1FY1A 4Z6AH 2J95A 1HGTH 1NFXA 1DWEH 1ZSLA 1DE7H 3C27B 1AKSB 3BSQA 1C1RA 7GCHG 1TNLA 3TH3H 3KHVA 3LGTA 5JPMH 2QXHA 4NSYA 1C1MA 5FXLA 1NO9H 3MH5A 4FUFA 1RFNA 4MLFB 4ZXYH 1GMCF 2C8WB 3PROA 1VCPA 2O9QA 1QL8A 1E36B 1QGFA 1HPGA 3Q77A 3LGUA 3K2UA 3RU4E 1QRXA 2C3SA 1F5LA 4NFEA 1BT7A 1VGCB 2KAIB 3RUOA 3MTYA 4U2WA 1O2IA 2R0KA 2FLRH 3A7TA 3VXFH 1HAZB 5ESBA 4BNRA 1FXYA 2FESH 1P2MA 4B71A 3P17H 3KQEA 2GDEH 3RXJA 1MD7A 5C1UA 1J9CH 1EAXA 2J4IA 3D62A 3ZZCA 4NIYA 1GI4A 4OS4A 2TGAA 4WY3A 1V6DA 1C2JA 2PKSB 4HGCA 1KLIH 1SFQB 1VGCC 1Z71A 3SNBA 2GVFA 4K5ZA 3EA7A 3A7XA 1H9HE 4MQAA 3Q76A 1IQLA 3BEIB 4NA7A 6GCHF 1TNHA 4OGYA 3DFLA 1DY9A 5A8ZA 3SORA 2V3OH 4MNWA 1QA7A 1ZRKA 4Y71A 1T31A 1PFXC 1ZTLA 5EXLA 4DW2U 3KF2A 2EI8A 2GCHF 3HK3B 5LGOA 3NWUA 1JRSA 3RXOA 2A5IA 2VH0A 3OTJE 3PMBB 1MCVA 1O3NA 4ZMAH 1MKXH 2A2QH 3GY6A 1O31A 5FCRA 2DUCA 2BDIA 1ANCA 1SGQE 2ZDMA 3P8GA 1EJNA 2ZEBA 1A61H 1LHEH 3RXKA 2VU8E 2ZHQH 1CHOF 1QRWA 4WMEA 2XCNA 2HRVA 3A8DA 1K1LA 5DJ7A 2ZTYA 1QL9A 1SMFE 1DUAA 1O2NA 4GAWA 1FIZA 2GTBA 3EE0B 2WUBA 9LPRA 1V2VT 2A4RA 3RXUA 3PM3A 2Y82A 1EAWA 2A0QB 3PLPA 2BYAX 1PPHE 5K7RA 3LC3A 3L3TA 2A31A 1ABJH 1GI5A 4AX9H 3VPKA 4FUHA 1C5WB 5C3NA 1SFIA 3KQDA 4I31A 3VGCB 1C1OA 6ESTA 1GWAA 5AVDA 1U6QA 5FX6A 4A1XA 2FS9A 3GICB 1C4U2 3SBKA 3QDZB 1AWHB 1LHDH 4B76A 4J2YB 1CA0C 1RTKA 1MTSA 2CHAC 2H9TH 3NCLA 1OWDA 1GBMA 2CXVA 2UUJB 1C2DA 1H8DH 1RJXB 4OS7A 1O3OA 1KTSB 1O2UA 2FOHA 5HYOA 4KTSA 1AMHA 4F49A 4UFFH 2G00A 3VGCC 4OS1A 2H5CA 3DA9B 3TIUA 1TABE 3MOCA 1IQGA 4NCYA 3TNSA 1OP2A 2WINI 1V2KT 1L2EA 1O3MA 1HJ9A 1C5UA 2W26A 1VCQA 1K1OA 4H42U 2HPPH 3A86A 3M3TA 1LHGH 5J4SA 2Z9GA 1NESE 3MH7A 3TK9A 4OS6A 3RMMH 1DS2E 3SU0A 1EZSC 4D7FA 3C1KA 4CH2B 1PPFE 3S0NA 3E0PB 2HGTH 2IOTA 2B9LA 1SGDE 5C2ZA 2OCVB 1SBWA 1A2CH 4IW4E 5LPEA 1N8OB 1C5QA 2FTMA 3TH2H 2JH6D 2ZFSA 2D2DA 1DFPA 2XTTB 1BQYA 5F8XA 3E1XB 2ZGBH 1GI8B 1LDTT 1AE8H 1KTTB 5ABWA 1GJDB 2WPMS 3B8JA 1GCTB 1GJ9B 3LH1A 1XUIA 2LNCA 2ZG0H 1OP0A 2BY6X 1DXPA 2Y7ZA 3ENSB 5EG4A 2BD5A 3SJIA 4XFQA 1ZSKA 3BTGE 2FXRA 1C1TA 2O8WA 5F8ZA 1LVMA 3JZ1B 4GHQA 1BTZA 1VITH 1UTLM 9ESTA 1E38B 2A5KA 2FYRA 1O2RA 3ZVCA 3VXEH 1IHSH 1C2IA 1B0EA 4YTAA 1ESBA 1T32A 4FU9A 2CF9H 3AW1A 4MG3A 3QTVH 1KLJH 3UOUA 2GCTC 3UTUH 1BHXB 1UTOA 1IHTH 3MU8A 2NU1E 2ZGJA 3KGPA 5DP8A 4ZAEA 3S7KB 4AOQA 5TJXA 4D7GA 1ELCA 1ZTJA 3GY4A 4CRDA 1GJ4H 4ZKRU 1PYTD 2R3YA 3T26A 1GJ5H 4ZHMU 1G3EA 1O3BA 2FI3E 2B5TB 2TGTA 1O2PA 2W7UA 3SGQE 1A5IA 4Y8XA 2P59A 1KXCA 1HJAB 4JYTA 1ELBA 1KXFA 3O8RA 4RKJB 1YP9A 1BMNH 3M7TA 1J8AA 3BIUH 5GCHG 1OXGA 1O3CA 3ZZ6A 1EX3A 1TX8A 3ODDA 3BTFE 1EZQA 1BRCE 2VIQA 5E2PA 3RU4T 4IBLH 4NZQA 3RLYH 2BVXH 2R2MB 2PR3A 1YPLH 2SGFE 1NT1A 2G4TA 2QC2A 8GCHG 1RTLA 1FV9A 2GZ7A 1DSUA 1YPGH 4CR9A 4ZH8A 2SGPE 2F9VA 1SG8B 4ABEA 1ZMJA 4ABIA 1BBRE 2UWOA 1FAKH 3MU4A 2UUFB 2ZU4A 1XXFA 2JETB 3M3VA 4O3UA 3ZZBA 1CBWC 4X1SU 1TALA 1JXPA 1QHRB 1TBRH 1W2KH 1EAUA 1HNEE 1NZQH 2JH0D 1ARCA 4FVDA 1DSTA 3H7OA 3T28A 4BXWA 2J38A 3AVZA 3UQOA 4K3JA 3ZVFA 1VJ9U 1FNIA 1QQUA 5FPTA 1ESAA 3BN9A 3MHWU 3TU7H 3HPTB 1SGFA 4ABBA 3O8DA 1A46H 5E2OA 1Y3UA 4IMQA 4O03A 4TY6A 1AQ7A 3M5OA 1B0FA 3UR6A 3HGPA 1NRNH 3FP6E 2EA3A 1N6YA 4Y8YA 2QIQA 1TX7A 4H6SB 1UTNA 4R8TB 1QB9A 1EP6A 3ZYDA 2Y5GA 3ATMA 3LT3A 4DGJA 1O36A 1RRKA 2EEKA 2AMPA 1HRTH 2BY7X 5EW1H 2ALVA 2ZF0H 3RM0H 2XW9A 1Y3VA 5EU8A 2VINA 1TA2A 1TONA 1EB1H 5FPSA 3SOSA 1SSXA 3T2NA 2BLVA 2Q1JA 5FBEA 4A92A 1F5KU 4H4FA 1NS3A 4KKDA 2A1DB 4GCHG 1CGJE 1KXEA 1GVZA 2FOCA 3E91A 5EW2H 5DKMA 4KTCA 1O3IA 7ESTE 2ZCKP 5BPEA 3MFJA 3P6ZB 1AFEH 2KAIA 2QGRA 1Y3WA 1TBZH 1TOMH 1JWTA 1THSH 1P2JA 1AN1E 4D9QA 5PTPA 1ZLRA 2ZC9H 4B1TA 2XC4A 2Y7XA 3A83A 1A7SA 2XXLA 4D76A 1O5FH 1NRQH 2TBSA 4K1EA 2QY0B 5A8XA 3RXEA 1O2GH 3GY8A 5AFZH 4ZROA 5L6NH 3E8LA 1O30A 1D6WA 4YLQH 1CQQA 1IQIA 1GHYH 3QZQA 3GY2A 1GHBG 1Z7KA 3UR9A 2BOKA 1S84A 1SQAA 4K8BA 8LPRA 4NA8A 3RXLA 1XVMA 1C9TA 1MTUA 4MPXA 3PO1B 1MU8B 3I77A 3ZVEA 2BD2A 2VIDA 3A84A 5EPNA 2VIOA 1KXAA 3HKIB 1SGFG 1Y3XA 4FVBA 4X2WA 1TNJA 1ZMLA 2A4QA 4LZ1H 4ZKNU 1O3DA 4AFUA 4OS2A 1N1LA 3KN2A 4D9RA 1BJVA 1LPGB 3PO1C 1YCPK 2H9EH 2PHBA 1DUEA 1T4UH 2FOMB 1WOFA 2SGDE 4Q80A 3ZZ8A 1GJ7B 1FN6A 1OYTH 1SLWB 4JZDH 1O3FA 3CENA 1O33A 1GBTA 1ZR0A 1KXDA 1P2QA 1HB0B 3OX7U 4X1QU 1PQ8A 1GHZA 2AH4X 1HLTH 1V2JT 2CN0H 2FOEA 1A3EH 3RXDA 1GBCA 2H5DA 1Y5UT 5JB8S 1TB6H 2AEIH 2Z3EA 1C2GA 3RP2A 1O5AB 3U8RH 1GBDA 4B2AA 1V2ST 5GDSH 1OWHA 1ZHMA 4FUGA 1FZZA 3OU0A 2XBXA 4BOHA 3SZNA 1SGTA 1RXPA 1FN8A 1NU7B 3ZZ7A 5GCHF 5HXFA 1UVUH 2GD4B 1K1IA 3MH4A 2OBOA 3LONA 3P8NA 1ETTH 4DT7B 7LPRA 2ZGHA 3F9GA 2OBQA 1C2HA 1UVOA 4LK4A 4WJG2 1YPEH 2P93A 1DM4B 8GCHF 6LPRA 3O8CA 1DY8A 1G2MA 3V13A 1HJ8A 3Q3YA 4MPWA 2OQ5A 2FOFA 3SU1A 1PPCE 4BAMB 4M7GA 4JZIA 4NZLA 1T7CA 3SV6A 1QB6A 3MNXA 1O2TA 4YOGA 1FPCH 5GWZA 3STIA 4X1NU 1S5SA 1XKAC 1O2MA 2ZTXA 3D49H 1K9OE 3MMGA 1WTHD 2BQ6B 2D1JA 2FWWA 1ZPCA 3MWIU 3GCTF 1A1RA 3UFAA 2R0LA 5C20A 3M5NA 2PKAB 2ZGXH 3IITA 3FZZA 1NFYA 1SGRE 3OY5U 3RC6A 4MNVA 1TPSA 5CMXH 4DOQA 3NXPA 2ZIQH 2GP9B 4DJZB 1O2KA 5C5OA 4CRBA 2HNTC 2OINA 2J2UA 3Q3KA 5JBBS 3ZV8A 1E0FD 3TVJB 1K1JA 2F9UA 1F0RA 2A5AA 1DLEA 2XC0A 3HATH 2P3FH 1ANEA 1CHGA 3UWIA 5HM2A 1TX6A 2XBYA 1QBNA 3GCOA 3FP7E 3M5LA 4YT7H 2XCFA 1SHHB 2GKVE 4CRAA 5GJ4B 2F9BH 1UTJA 1Z8JB 1EZXC 1W7GH 1AVXA 1P3CA 4XDEA 1HAIH 1UMAH 1IOEA 1GI6A 1V2MT 3SNCA 4GPGA 1TNKA 3SV7A 3EYDA 1CT0E 1TA6A 1YPHC 1ANDA 1O5DH 2QA9E 3TJUA 3LDXH 1BZXE 3VB6A 1RD3B 1L1NA 1Q31A 2R2WU 2Y80A 4GCHF 2BY5X 3SJ9A 3SU5A 1HAGE 5I25A 2PTCE 1GBAA 1SI5H 1AI8H 1P2KA 3A87A 1KY9A 4B75A 1JRTA 1TE0A 1Y5AT 1LPKB 1AIXH 2BM2A 4I33A 1O38A 5DP4A 2Z9JA 1QIXB 4YT6H 3MO6A 3OYPA 4X1RU 1PPBH 3QUMP 1T8NA 3UIRA 3GCNA 1TIOA 4BAQB 2QXIA 3SU4A 2PKSC 1SL3A 1TYNA 1MTNB 1PPGE 1O3AA 1XKBC 1SB1H 2G51A 1C4V2 1K1NA 2Y5HA 4AZ2B 3MO3A 4ASHA 3A85A 3VB4A 3LPRA 1RTFB 1GHBF 2ZGCA 4MNYA 3A7YA 4FUDA 1H1BA 1QJ1B 2ESTE 2GV7A 3K6ZA 3PMAB 4BTUB 4FUIA 1HUTH 1ZHRA 4K8YA 3A81A 1P9SA 5EOKA 1ELDE 4CRFA 3A7WA 1BTXA 2D8WA 4WXIA 1MTNC 5DP7A 2C8YB 2VWOA 3M36A 3CP7A 2VIWA 3M5MA 1OX1A 3ZZ4A 2H1UA 1GBBA 3VB3A 1VCWA 1CU1A 4ABHA 2PFEA 5L2YH 2Q6FA 2I6SA 2OQUA 4IC6A 1C5XB 1P03A 5HMAA 3U9AH 4A1VA 1ZRBA 2AMDA 4FU7A 1XMNB 2ZQ2A 2A32A 1NY22 2HNTF 2FS8A 1FLEE 1GHAF 2UWPA 3A7ZA 1BCUH 2SGAA 3L33A 1P01A 2BDYA 3A8AA 2SGQE 2BLOA 1YBWA 3N7OA 3GY5A 2R3UA 2Z9KA 2XC5A 1EATA 2ZPRA 2WPJS 4CRGA 2FPZA 5EQQA 1ARBA 1S81A 2A4GA 3FAOA 2HPQH 3I78A 5K0HA 1V2NT 2BDBA 5DPAA 3QK1A 1QURH 2WYGA 3RXSA 2GT7A 3KQCA 4Y7BA 4GLYA 3F1SB 4NWKA 1N6XA 1CGIE 2W3IA 2FM2A 3NPSA 4AG2A 3SV8A 2BLWA 3SHCH 4DY7B 5A09A 1BTWA 1H8IH 3SJ8A 3QLPH 1H9LB 2O8MA 1O3KA 1DWCH 1MUEB 2FIRH 2ZU2A 4ESTE 2P16A 4KELA 3AASA 4MNXA 1O3PB 2AFQB 1V3XA 2QN5T 2O8TA 4NSVA 3UREA 1D3TB 3A7VA 2VGCB 3FFGA 4O3TA 2HWLB 2ZTZA 3U98H 1A0LA 1SOTA 4I32A 3P70B 1TRYA 1FQ3A 4ZKSU 3H7TA 3S9BA 4I8KA 1TGNA 2Y6TA 2QF0A 1WBGB 3EQ0H 4YOJA 5IDKA 1BMMH 1GJBB 2HNTE 1HDTH 1L4DA 5E8EH 2WPHS 5FPYA 2BQ7B 2BD7A 1TGCA 3W95A 4WMFA 1C5YB 3RXAA 1O2HA 3M35A 1F0UA 4ISOA 4HTCH 2VGCC 3ODFA 2FO9A 3EAJA 2NU3E 2ANMH 2V3HH 2WPIS 3BEFB 1TNGA 1TMBH 5I46H 1BA8B 2FOAA 3S9CA 2RA3A 5EXNA 1AUJA 1C5ZB 1EOJA 3NUMA 3UUZA 1O3GA 3E16B 1MKXK 1UK4A 4Y0ZE 1FONA 1N8OC 1VJAU 2P95A 1XUFA 2YOLA 3SGBE 3GDUA 4CBOA 1C9PA 1S85A 1MD8A 2STAE 1BRAA 1BITA 1YPHE 3QTOH 4TYDA 4O9VA 2ZWLH 3T29A 1GI7B 1GCTC 4TPYA 1A4WH 1AE5A 2GGVB 3B9FH 3NK8A 7GCHF 4ABFA 2Y81A 4LZ4B 4YO9A 1BRBE 1GCDA 2M5TA 1ZGVA 1FY5A 1MTVA 1CVWH 1K28D 1XM1A 1CT2E 1C2KA 1ZJKA 4NWLA 1ZSJA 1ORFA 4BANB 2Z6BD 1ELAA 1F92A 5IYTA 3TJNA 1S82A 1WQVH 3AAUA 1DDJA 4WVPE 3DFJA 5L30H 3ITIA 3UQVA 3A8CA 4DIIH 1ZJDA 2GMTB 3U8OH 5HGGA 1QR3E 1AFQB 1EASA 1GVKB 3QO6A 1UVSH