1BJUA

Beta-trypsin complexed with acpu
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Serine protease
molecule keywords BETA-TRYPSIN
publication title Oxyanion-mediated inhibition of serine proteases.
pubmed doi rcsb
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1998-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1bjuA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1bjuA02
1ABJH 3EAJA 1DY8A 3LC5A 1TGCA 4OS7A 4GSOA 1A1RA 1MKXH 1UK3A 1A61H 4CRGA 4AFZA 1W7GH 2F9NA 5A8XA 1OOKB 1MTSA 1BJUA 4OGXA 4DGJA 4AZ2B 3E16B 2F9OA 1AE5A 1GCDA 3BV9B 5A0CA 1THRH 2FMJA 4YESB 2BLOA 1QJ6B 1ORFA 1O5GH 1MBQA 1TA2A 1V2VT 1SGFG 2BXUH 3GCNA 2H9HA 1BMNH 4B73A 1RIWB 3LU9B 2B8OH 2GTBA 1A3BH 2TGDA 2QXIA 1C1OA 1CGJE 3GCHB 1QJ7B 2BTCE 2J2UA 3VPKA 1AVWA 3ZZ4A 1O5AB 4RSPA 4ZHMU 2A4RA 1G3CA 1SGIB 1QFKH 3RXFA 4IMQA 1TX6A 3ZZ3A 3P95A 1K1NA 2OC0A 2ANYA 5DO4H 4DY7B 2OD3B 5T3HA 5C5NA 1EAIA 4X8VH 4AB8A 2C4FH 4JYVH 3U8TH 1TA6A 1CQQA 4GCHF 3QX5H 3E3TA 1ZSLA 1QY6A 2AMDA 3ZZAA 3PMHB 1SGRE 1O3FA 2ILNA 4HI3A 5CHAC 1BDAA 3L6PA 3UIRA 3ZVFA 1A0JA 1C2EA 3PLKA 3CS0A 4B76A 1TBRH 5BRRE 2OXSA 3RXKA 2BD7A 2BDBA 2VGCB 4CREA 3BN9A 5CMXH 5GJ4B 7LPRA 1TNGA 1TBZH 2GT8A 4SGBE 6CHAC 5L2ZH 1KDQB 3RLWH 1PPHE 5C1YA 3A85A 2J9NA 1JXPA 1SHYA 3SV9A 1G36A 4ZH8A 1VITF 2Z9IA 4HZHA 3SHCH 3LC3A 3RU4E 1UK2A 5DG6A 1ACBE 1EAUA 2CV3A 2ALPA 2A7HA 2B5TB 1GVKB 1OP0A 1W11U 1O37A 3Q3XA 2FX6A 2IPHA 2VIVA 3DUXH 3EA7A 2JH5D 5GXPA 4IN2A 1K1LA 2VU8E 4MLFB 1D6WA 2GGVB 3ZZ5A 4B75A 2ZFPH 4AN7A 2GD4B 3OYPA 3FP7E 3TH4H 2BZAA 2A7CA 1LHDH 3A8CA 1CBWC 3KQCA 1EX3A 1BZXE 1BTHH 3UWIA 1THSH 3LGWA 5A0BA 1L1NA 4ABJA 1FPCH 3ZZ9A 3EE0B 1GMDF 1TPPA 2GV7A 2RDLA 3GY6A 1WU1A 1S6FA 3DT0H 5TJXA 2ZQ1A 3FANA 5F03A 2XRCA 1NO9H 2G4TA 3BTFE 1G37A 1K1PA 4GHTA 1O3AA 3SV8A 1G2LA 2QF0A 1HIAB 1C4V2 1MKWH 3VB5A 4TYDA 2GDDA 3RXJA 1YPJH 1TX7A 4ABBA 3U9AH 2PLXA 1O2MA 2XC4A 1LTOA 1W13U 3F1SB 4RKJB 1N8OC 5T6FA 1GBBA 3RMMH 2PKSC 3P6ZB 2P3UB 3LH3A 5JYIA 1K1JA 4Z0KA 1EP6A 2VIPA 2PGQB 1C5WB 3DFJA 1ZPZA 4K1EA 1ELAA 5DP4A 3SJOA 2WUCA 3SNAA 3SGQE 4JZFH 4E05H 1DUEA 1C5SA 1UHBB 5A09A 1GHWH 2WYJA 2BXTH 3HKIB 2QY0B 3ATKA 2TBSA 2O8MA 4ZUHA 1RD3B 3ZZ8A 5JBTA 3S9AA 2ZWLH 4NWLA 3T62A 1LQEA 8LPRA 3SQEE 3ZVGA 1QBNA 4I7YH 5FCRA 2Y6TA 1IQMA 2P3FH 2PR3A 1C2HA 3OSYA 2GX4A 1O2YA 1TWXB 2Z9LA 4K69A 4A6LA 4K8BA 2J94A 1SLXB 3PMJA 1W8BH 2C3SA 3P8FA 1YPKH 4Y7AA 3MU1A 3E90B 1YGCH 4IN1A 1DXWA 1TNHA 2C8ZB 1OWEA 4JMYA 3SGBE 1QA7A 1GHYH 4BAMB 2A5IA 1V2LT 2XNIA 1DDJA 2FOMB 3V7TA 3TJVA 2VIWA 2A4GA 1XMNB 3FZDA 4UD9H 2ZDMA 2Z6BD 3E0PB 2O8TA 3RUOA 2GP9B 3URDA 4WH6A 5DKMA 1ID5H 1UO6A 1P09A 3ATMA 1BBRE 2GCTB 1G9IE 1O2KA 4WMDA 3QDZB 3MWIU 1AVXA 4YOGA 2F3CE 1RJXB 3ELAH 1JIMA 4U30A 1ANBA 3ATLA 1C1VH 4FUCA 2G81E 1Z8RA 4MTBA 3C27B 3CS7A 8GCHF 3H7TA 1GG6C 3BTGE 5FXLA 1C5TA 4YTAA 3T28A 2WPIS 1OKXA 3PV4A 3PTBA 1ZHMA 1CHGA 4IGDA 1KTSB 3F9EA 5A8ZA 1CGHA 1IQEA 2JKHA 2V3HH 1T32A 3MOCA 2NU2E 2F9PA 2FO9A 1KXEA 1PPZA 1Z1JA 4NG9H 1FQ3A 1E35B 3EQ0H 3BG4C 2FM2A 4INKA 2FTMA 1LDTT 5A8YA 2ZF0H 4X2YA 1DSUA 4JCNA 1O2SA 2YNBA 2FI4E 4O3UA 3MH7A 5L30H 1LQDB 2Y81A 2BVSH 1GJCB 3MU8A 4KELA 2R0LA 1DXPA 1XUGA 3V13A 1LPKB 2SNWA 5DP9A 2ZTXA 2C8WB 3U8RH 2UWLA 1C1UH 1QRZA 2BDYA 4KKDA 5ESBA 1YPGH 3TITA 3S7HB 5DK1A 4BNRA 4Y8ZA 1GBCA 1VR1H 2PW8H 1SG8B 1BTWA 1FMGA 1TRMA 1QHRB 2JETC 1ZTKA 3SU0A 1XUFA 2ZGXH 2ZU2A 2B7DH 2ZDNA 3S9BA 1HAXB 1YPLH 4TPIZ 2BB4A 1NRRH 1EUFA 2A2QH 3R3GB 5E0GA 4BXWA 1AUJA 2A5KA 2Y80A 4RKOB 4MPVA 7ESTE 4XBBA 1UTMA 1MTNC 2DE9A 3SUGA 2CHAB 1OP8A 1GBIA 3MNBA 1AFQC 2BX3A 1ZTLA 1FJSA 1FDPA 4MPXA 1TMUH 1BB0B 3MU4A 2QF3A 3A86A 8ESTE 2PTCE 1L2EA 3RMNH 1TAWA 1O3LA 4ABAA 3SU1A 1FY4A 5JDUB 2TRMA 1AZZA 1EZQA 2GCHG 2P16A 3M3SA 4TWWA 2ESTE 3QLPH 2P93A 3Q3KA 1CT2E 1EKBB 1ELBA 3EGKH 3TNSA 1L4ZA 4GUXA 4D76A 1GGDB 4DW2U 4WH8A 1BTPA 2UWOA 1LHCH 1OSSA 3HGNA 1C2DA 1PYTC 1KYNA 1Y3XA 4DIIH 1TGBA 1T4UH 4FVBA 5EPNA 2AYWA 1GHBG 4Y6DA 3LKWA 4MQAA 2BD4A 3H7OA 1CT0E 3A82A 5JB8S 5K0HA 2W3KA 1C2MA 1D3TB 1DX5M 1GBEA 1UK4A 1O31A 1SQAA 1IOEA 2IOTA 1V6DA 1GHVH 1DT2A 1JBUH 3HGPA 4D7FA 1O3DA 1C1TA 1KXCA 1XUHA 5JB9S 1QBVH 2OUAA 1GDNA 3RXQA 2XW9A 1F5LA 3D49H 3HK6B 4IC6A 1OWKA 1CA8B 3RXBA 4OS2A 2BY8X 1S0RA 4LZ4B 3B9FH 4JZEH 2ZTZA 4Q7YA 1BMLA 1P2KA 4MPWA 1Z7KA 1Z6JH 3E1XB 3KQBA 3SQHE 1SGPE 1UCYK 1GI3A 2THFB 2A2XH 2H5DA 3ZVAA 1LMWB 2ZHDA 1O0DH 1O2PA 2D2DA 1UVTH 2TIOA 4Q7ZA 1N1LA 1TQ7B 1GVZA 1TYNA 1G3EA 2P8OB 5EPYA 2ZGJA 4ZMAH 1GJ6A 3KL6A 1YCPM 3PLBA 2FYRA 4BAQB 2GT7A 3S7KB 2HVXA 2VINA 1DWCH 2VVCA 3PTNA 2VB0A 4XBDA 1K2I1 2OLGA 4OS5A 1K21H 1LHGH 1UJ1A 1HAHH 4CHAB 1ZMLA 2TGAA 1WYKA 5TCCA 3SOSA 5EG4A 2F9VA 2PUQH 1O33A 1NPMA 2G5VA 4I8JA 1A5HA 1KDQA 1MZAA 3ODFA 1QQUA 1GCTC 4JZ1A 1SQOA 2CGAA 1T8NA 1O38A 2ANMH 3TVJB 2Z3EA 3MO6A 2ZEBA 1O2WA 2AGEX 3P8GA 4IMZA 3PM3A 1BT7A 3R0FA 2Y7XA 3TGJE 1C2IA 1MCVA 1P04A 1ZGVA 2PWXA 4QT8C 1O36A 4MPUA 1WQSA 1O5FH 4ABIA 3ZVEA 1ARCA 5FBEA 3UUZA 1AIXH 1PQ5A 2BDIA 2EI6A 2EA3A 3BTEE 3RU4D 3K9XB 2WYGA 4VGCB 2OINA 4A1XA 3BTQE 2CF9H 4NIXA 1AU8A 1QB1A 4OS4A 2FYQA 4M7GA 6ESTA 1SGCA 4JK5A 2VWNA 3LIWA 1O2HA 1ZMJA 2F9UA 2BVRH 2FOGA 5ESTE 1GBLA 4X8UH 3KQEA 3K2UA 2ZHEH 1T7CA 1P9SA 3RXIA 1QR3E 3A7XA 2H2ZA 2P59A 3SNEA 1V2UT 5T6DA 2J95A 3M5MA 5E0JA 2ZIQH 1O2QA 3F9FA 1VJ9U 5PTPA 2ZKSA 2C8YB 1O2ZA 1K28D 1O2UA 1H1BA 1A5IA 1K1MA 1PQ7A 4E7NA 1ZGIA 3DHKH 4YZUA 3W94A 2ZI2H 1HIAA 3FAOA 2BLQA 4NSYA 2ZTYA 1A5GH 1KXAA 1Z8IB 1AWFH 4ZXXH 1TRNA 2J4IA 1QCPA 2QV1A 2A31A 3MTYA 3M7QA 1PJPA 3M37A 3M3VA 3MU5A 5ETXA 4O3TA 2ZA5A 1U6QA 1MCTA 1VITH 2SGFE 2STBE 4NA8A 3OU0A 1BITA 3PWCA 1A0LA 3P8OA 5DPAA 4B71A 1HBTH 1C2LA 2UUYA 5T6GA 2BQ6B 5DJ7A 1OP2A 2FI3E 1JWTA 1EB2A 3LDXH 1C2FA 2QYIA 3GY4A 2RA0A 4I8KA 5HM9A 2FOBA 1RTFB 1SGEE 2WPHS 1Y5AT 1ETTH 2DE8A 1OWJA 2A4OA 3DFLA 4GVUA 1P9UA 3M5LA 3PWBA 4NZQA 1EJNA 1FUJA 1C5OH 3T25A 1SVPA 1UTPA 5LPRA 3ZVDA 4HGCA 1Y59T 1O2RA 1ANDA 1TQ0B 2ZCHP 2H1UA 4I8GA 1Q3XA 3RM0H 1GMCG 3ZYDA 1IHSH 3RXPA 3A7ZA 4WMFA 1TABE 3T5FH 1W2KH 2HOBA 3UPEA 4WJG2 1GDQA 1EB1H 3LGIA 1P3EA 2W26A 1F5KU 1YM0A 1GI0A 1SI5H 1NRPH 1C5UA 3SNBA 1XVOA 1Z1IA 2PKAB 2SGAA 1C1MA 3LJOA 3SU3A 3VGCC 2QXJA 4ZKOU 2A0QB 2B0FA 1A2CH 1O3KA 1MMJN 3U1JB 4ZROA 1Y3WA 1HRTH 1YPEH 4KP0A 3AASA 4FU9A 5E2PA 4BXSA 3BEUA 1NRSH 4AGJA 1D3PB 1VJAU 4Y71A 1F92A 3GCTG 1EZXC 1YBWA 1CHOG 4JYUH 3QUMP 1SPJA 3SUDA 4ZAEA 2VWMA 4XOJA 1FN6A 4UFFH 1O3JA 1ZPBA 1BUIA 4IW4E 1M9UA 2BMGB 1O2NA 3NWUA 3UOUA 1VGCB 5FCKA 2Z3CA 1Y8TA 1D9IA 3BTKE 1GI8B 3RXAA 1C5XB 4DCDA 1O2XA 3RDZA 1P05A 1XUIA 1ZPCA 3TNTA 1RGQA 3BIUH 4ZXYH 1NC6A 3GDUA 2FOHA 2J34A 1ANCA 1V2KT 1GMHG 1E34B 4JYTA 1QRXA 2HNTC 2GMTC 3M3TA 2JH0D 1HJAC 2NWNA 5C67A 2ZECA 3E0NB 3M36A 3TGKE 1CO7E 1O5BB 1GJAB 1NESE 2RG3A 2D1JA 2HPQH 1GBFA 2ZU5A 3RXCA 1FAKH 1GI1A 2VIQA 3NPSA 3TH3H 3RXSA 1PPCE 4AG1A 3ESTA 4NA9H 1BHXF 1ZSKA 1HXFH 1MTUA 1TB6H 2FIRH 4Q7XA 5F8TA 4K5ZA 1Y5BT 1TGNA 1CSOE 2R9PA 1G30B 5AFZH 1GJ8B 3RU4T 1FPHH 1ZHPA 2NU0E 2FOAA 1MD8A 2GZ7A 1AVGH 2OC8A 1C2KA 1NTPA 1FN8A 3LONA 1G3DA 1JOUB 3M7UA 3LH1A 1AO5A 4Y8XA 2BYAX 4BTTB 1MH0A 2H9TH 2UUFB 2Z9JA 1QJ1B 1O2OA 4ISIH 4CRBA 1O3PB 1O35A 5JBAS 1CE5A 1YPMH 1XKBC 2PHBA 1HPGA 1HAVA 1GBKA 3RXUA 3A81A 2WPLS 1AWHB 1EPTA 2I6QA 3EDXB 1GJ7B 1P2NA 1BTUA 5EXLA 3GICB 1C5VA 4O97A 1XVMA 1SLVB 4X1PU 1V2QT 1ZR0A 4FUFA 2GCHF 1INCA 1CU1A 5JBCS 4JZDH 1MAYA 3UNQA 1H9LB 4AX9H 1F7ZA 2Z3DA 2Z7FE 4ESTE 1S84A 1J16A 1H8IH 1UCYE 4GAWA 1TRYA 3KCGH 3KEEA 1LPGB 3PO1C 3FP8E 2ZHQH 1GJ5H 3RXRA 1FLEE 3BEIB 3TH2H 4K1SA 2XCNA 1GI2A 1V2MT 2ANKH 2BY6X 2HNTE 1DWDH 1GHBF 2LPRA 3P92A 1N6YA 2NU1E 1E37B 3V3MA 1UTKA 2AGIX 1TBQH 4X2XA 1XUKA 1AHTH 1HNEE 3O8RA 1C5PA 2WPKS 1NFXA 3AAUA 3ZZ7A 2FOCA 4B2AA 4FUIA 3M7TA 3MO3A 2BOKA 1RS0A 2BQWB 1O3GA 2WV5A 2ZCLP 4B1TA 1LPZB 1O3NA 1K1OA 4Y7BA 3GY8A 1EPTC 4X2VA 2CHAC 3SV6A 5C1XA 1C5QA 1MZDA 2GZ8A 1C9TA 2NU4E 2WUBA 1YCPH 1HAIH 1Y3UA 2R2WU 4WXVA 1ELCA 3VXFH 4E06H 2CN0H 3RXOA 2EEKA 3JZ1B 2OC1A 4AFUA 1O3HA 1C9PA 3A7WA 4I31A 3SO3A 4YOJA 1MKXK 1SR5C 1VCWA 4LXBH 1HJ9A 2W7UA 4NCYA 1O2VA 2ZFFH 2GZ9A 4BTIB 3C1KA 1SMFE 3RXLA 3AW0A 1GBTA 2SGQE 2P94A 1EJMA 1BBRH 4U32A 4CR5A 1EOJA 1OWIA 5L6NH 3BG8A 1YLCA 2HRVA 2ZZUH 1DFPA 2O9QA 1BJVA 2AIPA 1F5RA 2Q6DA 3QTOH 4GHQA 4H42U 2ZCKP 4O03A 1O3CA 1DLKB 1Y3YA 4A5TS 1CBWB 1HV7A 4A1VA 2G52A 1B7XB 4OS6A 1GL0E 5E2OA 5EQRA 4UE7H 2A4QA 2AERH 7KMEH 3V0XA 2ANWA 4BAOB 4WWYA 1PPBH 1TNKA 2ULLA 1IQIA 1P03A 3SGAE 1C1PA 2ZFRH 2O8LA 2HNTF 3TLOA 2XBYA 1DWBH 4O9VA 1RTKA 2FOFA 1V2PT 2Q1JA 1OYQA 1O32A 4X1SU 5G4BA 2H9EH 1S5SA 2ZPSA 2PGBB 1JIRA 4A7IB 3A83A 1WCZA 3HK3B 1GBDA 1QBOA 2ZG0H 4F4OC 1ELFA 4Y8YA 5AVDA 3ZZCA 1PYTD 3SU6A 1V2JT 3STIA 1MAXA 1MU8B 1C5RA 4D9QA 1N8OB 4CBNA 3K6ZA 2BY9X 2RCEA 3UQOA 4X6OA 4ABEA 2PKSB 1VZQH 1NS3A 4KTUA 1ELVA 1O2IA 2QIQA 5DP6A 1NM6A 2QXGA 4X8TH 1CVWH 4D9RA 5I46H 1BTZA 1CA0C 4FUGA 2H6MA 2FODA 2ZQ2A 4MVNA 3MO9A 4I33A 1HUTH 2EI7A 9ESTA 1HDTH 1V2TT 4ABDA 1NU9A 1IQFA 4X0WU 1GMDG 1EP5A 3QGNB 5FPYA 2P95A 1AQ7A 1GHXH 1MD7A 3HPTB 1SOZA 3O8BA 1BRBE 2D8WA 1SOTA 1HB0B 2PTNA 2XC0A 1E0FD 3ZV9A 4K1TA 2ZHFH 3EA8A 1HJ8A 1GHAG 1BTXA 1QURH 3MNCA 4FXGH 1HYLA 5GDSH 2ZGHA 4MNVA 1ELTA 4CRAA 1KXFA 2A5AA 2ZC9H 2ZNKH 1UTJA 1BCUH 1W12U 3LGYA 3UTUH 1NY22 4CBOA 3LGUA 5DGJA 3BF6H 4CRFA 3TK5A 1QGFA 2ZFTA 3OY6U 4NFEA 2TGPZ 1C1RA 4J2YB 2CJIA 3F9HA 3TPIZ 1HAPH 2BLVA 1ZZZA 2F83A 1SLUB 4I8HA 1ZJDA 1AB9C 4TY7A 3TGIE 4UONA 4CH2B 3KHVA 3SJIA 2O8UA 2J38A 2G55A 3QN7A 2VNTA 4OS1A 1O3IA 1GMCF 2FS8A 1UVSH 1AE8H 2W7SA 1P57B 1H4WA 5H4IB 1SFQB 2OTVA 2OBQA 2EC9H 1O5CB 5FAHA 1NN6A 4DVAU 3DD2H 1ZTJA 1MKWK 1NFWA 2AMQA 2GV6A 5C20A 2VVUA 1BMAA 2FP7B 4DT7B 5DP5A 1O5DH 1SHHB 3Q76A 1C1NA 1V2OT 1YC0A 4ABGA 1LVBA 2FWWA 2C8XB 4ISLA 3GCTF 4NIYA 1NU7B 1X7AC 2PSYA 3SORA 1P11E 1ZJKA 1CHOF 2PKAA 1GG6B 2VIDA 3UFAA 3KGPA 5EGMA 3MH4A 2ODPA 3Q00A 4YT7H 1C5YB 5GCHG 1PQAA 1ZLRA 2FLBH 2GVFA 5FX5A 3P17H 4Y0ZE 2SGDE 1V2RT 3O8CA 3RLYH 1RIWC 5SGAE 1C5ZB 4ZKNU 5C3NA 6LPRA 1C5MD 1ESAA 1K9OE 1B5GH 4ISOA 1ANEA 1YPHC 1ELEE 3BG4B 3GCHC 1TFXA 3E6PH 2G51A 3ZVBA 1TPAE 3BTME 3RXVA 2Z94A 4NSVA 2DUCA 1VCPA 3GY7A 4ZHLU 1A0HB 5K7RA 1GMHF 5LGOA 1EAXA 4BOHA 1G3BA 2M5TA 2VH0A 4Q80A 1SSXA 1KIGH 1O2LA 1WUNH 1T31A 3SU5A 1P12E 1TE0A 3UWJH 1LVYA 3AW1A 2KAIB 1ETRH 1JMOH 4WF8A 2JETB 1DITH 2R0KA 3LGVA 3A7YA 1FY3A 1EJAA 2BM2A 2VIOA 3ZZDA 9LPRA 3SI3H 1GI4A 1ZYOA 1SFIA 1J17T 1NRNH 1QNJA 3GDVA 4NA7A 1HLTH 1FY8E 3V12A 1WSSH 3A7VA 1GI5A 1UTQA 2AS9A 1AFQB 3UQVA 2VGCC 3GYMA 4X1QU 1TX8A 5EQSA 2OQUA 4D7GA 1OXGA 4Z6AH 1O3MA 2WPMS 3D23A 4KTSA 2SNVA 1D4PB 5EOKA 5DP8A 4DG4A 1YKTA 3MU0A 4AB9A 3IWMA 3Q3YA 1AN1E 2D26C 2FPZA 5JPMH 2ZDLA 4JZIA 1AD8H 1L1JA 1BTYA 1JRSA 1KY9A 2FDAA 4AFSA 3KN2A 3BEFB 3URCA 4TWYA 2QAAA 1SGQE 1LHEH 2R2MB 3RXDA 1IQNA 3KNXA 1YPHE 1QL9A 2FS9A 8KME2 4IBLH 3RXMA 2G4UA 4NIWA 2A7JA 2EI8A 3LGTA 1BQYA 1RTLA 2Z9GA 1EXFA 1SGTA 3MNSA 1P02A 2RA3A 3LT3A 1HGTH 2Y5FA 3VB6A 1V3XA 3TIUA 2ZU3A 3RC6A 3M5NA 5FHTA 4AYYB 4UEHH 3JZ2B 4J1YA 4ABFA 4YLQH 1UHBA 1THPB 1C5LH 3SI4H 1E36B 5A2MH 3GY3A 3VB7A 2BDCA 1TMTH 1S81A 4DIHH 1DM4B 2PFEA 4TPYA 3L33A 2XBXA 2A45B 2HWLB 4HFPB 3ZV8A 2AGGX 4CRDA 1OYTH 1H9HE 5JBBS 4K2YA 3TK6A 3SN8A 2GDEH 3GOVB 3U98H 1TPSA 1W0ZU 2ZFSA 4Y11E 3H5CB 4ISNA 1C4Y2 1J15A 4IC5A 5AFYH 1RXPA 3I77A 3A87A 3QZRA 1MQ5A 5EODA 2XYAA 2WV4A 2SGPE 2J92A 3IITA 4BAHB 5L2YH 3A84A 3SUEA 1HAGE 2ZDAH 1SLWB 1ZHRA 2XTTB 2W3IA 3M35A 1RFNA 3U8OH 1GCTB 1T8LA 3VFEA 2CF8H 1UTLM 3GYLB 4A1TA 3ODDA 3QGJA 4YLUA 3F9GA 1T4VH 1Z6EA 1J14A 1GJBB 2BLWA 3S9CA 5F6MA 3ENSB 7GCHG 1FY5A 2ZP0H 1ZSJA 2OBOA 1BHXB 1NROH 3SW2B 2QA9E 3OX7U 2PV9B 1BRCE 1DE7H 1O3BA 2QGRA 1DANH 1KTTB 1HAZB 1QL8A 1JRTA 1W7XH 1NT1A 5HM2A 5C1UA 2JH6D 3A88A 2Q6FA 1MU6B 3QZQA 2VH6A 2BVXH 1KLIH 1TGSZ 1DLEA 1C1SA 2AEIH 5EW1H 1BIOA 5GPIB 1TMBH 2ZDVH 5EU8A 4AOQA 1ELDE 5BPEA 3I29A 3AAVA 1OWHA 3A8BA 2BD8A 1IQHA 1F0TA 1PPEE 3U69H 4AORA 1IQJA 4LK4A 3HKJB 4X6PA 2QC2A 2GCTC 3ZZBA 1FI8A 1GBMA 4K3JA 3M5OA 4UFDH 1AKSB 1SC8U 2PSXA 5HMAA 1Z8JB 3QO6A 1T8MA 3MH5A 2ZU4A 2OC7A 1ARBA 2NU3E 1DICA 1GJ9B 2FOEA 1BOQA 6GCHG 3RC4A 2XWBI 3L3TA 3NZIA 1GBAA 4FUHA 2ZGCA 2ZU1A 1Y3VA 4FUEA 1FXYA 1WV7H 1T8OA 3ATWA 3MFJA 1AGJA 5LH8A 1SGDE 3SBKA 1DVAH 4BTUB 5FX6A 2BD3A 1IQLA 1LCYA 1SGFA 4FU7A 1B0EA 1FIZA 1G32B 3HATH 3TJNA 4K8YA 3TK9A 1GBJA 2F91A 2FTLE 1MTWA 1W0YH 4Q2KA 3FFGA 3SNDA 2BX4A 1QL7A 3NCLA 1ELGA 2CMYA 3RXHA 3STJA 1GHAF 4ASHA 1GL1A 1LO6A 1P10A 3TJUA 3MHWU 2P3TB 1IHTH 4IS5A 4CR9A 2V35A 3MH6A 1AZ8A 1C1WH 1XXFA 3PMAB 4X8SH 1TNIA 3P8NA 1HCGA 2OQ5A 1W3CA 2Y82A 1O2GH 3FP6E 1UCYH 2G00A 1GDUA 1EOLA 1LVOA 1WTGH 5FBIA 3SNCA 1GHZA 1UVOA 3A80A 2K1QA 3RXTA 1AI8H 3VEQB 3T26A 3IG6B 3BTWE 3LOXA 4MNXA 2ZO3H 1AMHA 4X1RU 4H6TA 1KXDA 3VGCB 1FNIA 1TLDA 2VWOA 3GDSA 1UMAH 2BDGA 2Y7ZA 3S0NA 3OY5U 3SJKA 3GY2A 1V2NT 1BRAA 3RMOH 3GISB 4BAKB 2A32A 1IAUA 1P2QA 1YYY1 3SU2A 5CHAB 3ITIA 4YM9A 1HAOH 5DP3A 1CT4E 4Y76A 3NUMA 1VCQA 3PB1E 3O8DA 5EXNA 1OPHB 1SBWA 2QN5T 3FVFB 5C5OA 2ASUB 1N6XA 6CHAB 1GI6A 1SGNE 3MI4A 2GKVE 2BDHA 3K6YA 4SGAE 1FAXA 1KLTA 1F0RA 2V0BA 3S69A 1IQGA 1O2JA 2WINI 3GCOA 3VXEH 5GCHF 1O5EH 4H4FA 1GVLA 1FV9A 4FUJA 3BTDE 1GGDC 3ATIA 1EZUC 2OCVB 3N7OA 2VVVA 4XSKU 1W14U 2GMTB 5B6OA 4TY6A 1HJAB 1IQKA 3NK8A 2BHGA 3RXGA 2FLRH 3RC5A 2IN2A 2VWLA 3QWCH 1XXDA 1O34A 4FUBA 2G5NA 4GCHG 5C2ZA 1C2GA 4R8TB 2BD5A 1Q2WA 2AH4X 1QB6A 4YO9A 3RMLH 3UNSA 4NIVA 4INHA 3EYDA 5EQQA 3RM2H 4E7RG 1L1GA 1ESBA 1GI9B 4I8LA 2BY5X 4I32A 5AF9H 3B8JA 4X1NU 1H8DH 4XBCA 1TGTA 1S83A 5I25A 3LJJA 2O8WA 2P8OC 5E0HA 2KAIA 4NGAH 3E8LA 3D62A 4LZ1H 1G2MA 1GWAA 3PLPA 2ZPRA 4U2WA 4UFGH 1C5NH 1VITG 4CH8B 1D6RA 4AYVB 4FU8A 5LPFA 4ZHAA 4AFQA 3I78A 5CE1A 3UNRA 4MNYA 4XE4A 5F8XA 4R0IA 2R3UA 3RP2A 4XFQA 1P3CA 2Y5GA 1QIXB 1EASA 1TOMH 4CHAC 3OTJE 1ABIH 3SZNA 2B9LA 1SGYE 2BOHB 3U1IB 4D8NA 4Y0YE 5FPTA 1HAYB 1UTNA 1WAYB 2HLCA 1J8AA 1P2OA 4AG2A 3QK1A 1D3QB 3RXEA 3WY8A 1Z71A 3A7TA 2BQ7B 3UY9A 2AFQB 3F68H 2W5EA 1XKAC 2BD2A 3SHAH 4KTCA 4B74A 1CGIE 3PO1B 5EXMA 3T2NA 1S85A 3PROA 3BTTE 1DUAA 2FESH 2ZFQH 4FVDA 4ABHA 3UR9A 2V3OH 1D3DB 1LVMA 4THNH 4X2WA 4YT6H 1FY1A 2AIQA 5ABWA 3B23B 4INLA 1NRQH 5DP7A 1HAVB 2XCFA 3G01A 1EAWA 1EPTB 1TOCB 1S0QA 1PPFE 2CXVA 4VGCC 1MBMA 2ODYB 1EQ9A 2FEQH 4ZKRU 1DPOA 2UUKB 1ESTA 1O30A 1ZMNA 2XBWA 4MG3A 2AMPA 3DA9B 3F6UH 4GLYA 4XDEA 1Y5UT 3SV2H 4H6SB 3M61U 1NFYA 3QTVH 2Z9KA 1OS8A 3ZYEA 1HXEH 2UWPA 1YP9A 1C2JA 4HTCH 1HFDA 3CENA 1UTOA 3K65B 1BA8B 4NWKA 1L0ZA 2FX4A 5IDKA 4PROA 1NFUA 2QXHA 4FUDA 1GJDB 2LNCA 3AVZA 1GI7B 1ETSH 3A8AA 1A7SA 4DOQA 2XWAA 2ZDKA 1UVUH 3KQDA 4WVPE 2HALA 1XM1A 1BMMH 5F8ZA 3VB3A 1F2SE 1O39A 1XUJA 4GPGA 1W10U 4AGKA 3T27A 1P06A 1V2WT 2BY7X 1F0UA 2H5CA 2XBVA 5HGGA 1XX9A 1B0FA 1C1QA 3KF2A 1SL3A 1J9CH 1NZQH 1PPGE 1FONA 3P70B 2Y5HA 1TNJA 4ZKSU 2OP9A 1OWDA 3T29A 3TJOA 1DS2E 3VB4A 5GWZA 4Y79A 2PUXB 1DOJA 3EA9A 3E91A 1DSTA 7GCHF 1BRUP 5J4QA 1AUTC 2I6SA 1L4DA 2QCYA 2SGEE 2F9BH 4CRCA 5FPSA 3SUFA 4K60A 1DWEH 3MNXA 3BIVH 3CP7A 3SV7A 2FI5E 5EW2H 2V6NA 1S6HA 1O3EA 1FZZA 4UDWH 5TCAA 1ZRKA 4LOYH 1QA0A 2A1DB 4X6NA 2HPPH 1SQTA 5AHGH 3SJ9A 4Y10E 2Q6GA 5E8EH 4U01A 1O3OA 1LKBA 1P01A 2HGTH 5J4SA 1WQVH 1GPZA 1TIOA 2BD9A 2XXLA 3Q77A 4NZLA 5GIBA 4YOIA 2YOLA 1QRWA 1PFXC 5LPEA 3ZVCA 2WPJS 2ZGBH 2TPIZ 1YCPK 5HXFA 1CA0B 1ZOMA 1TNLA 3UREA 4DJZB 2BDAA 1P2IA 1MUEB 1V2ST 3A89A 3SJ8A 3ZZ6A 8GCHG 1A4WH 3SU4A 1ZRBA 1WBGB 3NKKA 1KLJH 1MTNB 3MYWA 4F49A 1EZSC 1H9IE 1WOFA 1QQ4A 3NXPA 4ISHH 4B2BA 1O2TA 2C93B 1S82A 4RN6A 1LHFH 1QB9A 1VGCC 6GCHF 1A46H 4JK6A 4UFEH 1KXBA 1P0SH 4X6MA 3UOPA 1TPOA 3D65E 1E38B 1P2JA 1BBRK 1F0SA 1AKSA 5HYOA 4DURA 2ALVA 1WTHD 1AY6H 1KSNA 1TONA 1UVPA 2YNAA 3PMBB 4A92A 3PYHA 3BSQA 1DY9A 4MDSA 2FZZA 1QTFA 1Z8GA 1TALA 2FXRA 3KIDU 1LKAA 2BZ6H 2G8TA 4B2CA 1GBHA 3LPRA 4KGAA 3A8DA 4BANB 1C4U2 1P2MA 5IYTA 2VJ1A 1OX1A 4MNWA 4WMEA 1PQ8A 1EATA 1SB1H 3W95A 1MTVA 1Q31A 3TU7H 1AB9B 2R3YA 2XC5A 1P8VC 1FIWA 4WY3A 4NFFA 1RRKA 4OGYA 5A0AE 3GY5A 1YLDA 2IJOB 2UUJB 3BTHE 1K1IA 1AFEH 4WXIA 2STAE 2ZHWH 3MMGA 1K22H 3FZZA 2C90B 2ODQA 1YF4A 2TGTA 1GJ4H 3UR6A 2SFAA 1MQ6A 2ZPQA 1A3EH
chains in the Genus database with same CATH superfamily
1ABJH 3EAJA 1DY8A 3LC5A 1TGCA 4OS7A 4GSOA 1A1RA 1MKXH 1UK3A 5EJZA 1A61H 4CRGA 4AFZA 1W7GH 2F9NA 5A8XA 1OOKB 1MTSA 1BJUA 4OGXA 1H8ED 4DGJA 4AZ2B 3E16B 2F9OA 1AE5A 1GCDA 3BV9B 5A0CA 1THRH 2FMJA 4YESB 2BLOA 1QJ6B 1ORFA 1O5GH 1MBQA 1TA2A 1V2VT 1SGFG 2BXUH 1NBMD 3GCNA 2H9HA 1BMNH 4B73A 1RIWB 2J98B 3LU9B 1WXRA 1WDIA 2B8OH 2GTBA 1A3BH 2TGDA 2QXIA 1C1OA 1CGJE 3GCHB 1QJ7B 2BTCE 2J2UA 3VPKA 1AVWA 3ZZ4A 1O5AB 2EQNA 4RSPA 4ZHMU 2A4RA 1G3CA 1SGIB 1QFKH 3RXFA 4IMQA 1TX6A 3ZZ3A 3P95A 1K1NA 2OC0A 2ANYA 5DO4H 4DY7B 2OD3B 5T3HA 5C5NA 4XD7D 1EAIA 1W0JD 4X8VH 4AB8A 2C4FH 4JYVH 3U8TH 1TA6A 1CQQA 4GCHF 3QX5H 1K0HA 3E3TA 4F48B 1ZSLA 1QY6A 2AMDA 3ZZAA 3PMHB 1SGRE 1O3FA 2ILNA 4HI3A 5CHAC 1BDAA 3L6PA 3UIRA 3ZVFA 1A0JA 1C2EA 3PLKA 3CS0A 4B76A 1TBRH 5BRRE 2OXSA 3RXKA 2BD7A 2BDBA 2VGCB 4CREA 2WSSD 3BN9A 5CMXH 5GJ4B 7LPRA 1TNGA 2VBCA 1TBZH 2GT8A 4SGBE 6CHAC 5L2ZH 1KDQB 3RLWH 1PPHE 5C1YA 3A85A 2J9NA 1JXPA 1SHYA 3SV9A 1G36A 4ZH8A 1VITF 2Z9IA 4HZHA 3SHCH 3LC3A 3RU4E 1UK2A 5DG6A 1ACBE 1EAUA 2CV3A 2ALPA 2A7HA 2B5TB 1GVKB 1OP0A 1W11U 1O37A 3Q3XA 2FX6A 2IPHA 2VIVA 3DUXH 3EA7A 2JH5D 5GXPA 4IN2A 1K1LA 2VU8E 4MLFB 1D6WA 1W0KD 2GGVB 3ZZ5A 4B75A 2ZFPH 4AN7A 2GD4B 3OYPA 3FP7E 3TH4H 2BZAA 2A7CA 1LHDH 3A8CA 1CBWC 3KQCA 5C0TA 1EX3A 1BZXE 1BTHH 3UWIA 1THSH 3LGWA 5A0BA 1L1NA 4ABJA 1FPCH 3ZZ9A 3EE0B 1GMDF 1TPPA 2GV7A 2RDLA 3GY6A 1WU1A 1S6FA 3DT0H 5TJXA 2ZQ1A 3FANA 2KCAA 5CHBA 5F03A 2XRCA 1NO9H 2G4TA 3BTFE 1G37A 1K1PA 2YMSD 4GHTA 1O3AA 3SV8A 1G2LA 2QF0A 1HIAB 1C4V2 1MKWH 3VB5A 3OFND 4TYDA 2GDDA 3RXJA 1MABB 1YPJH 1TX7A 4ABBA 3U9AH 2PLXA 3OTPA 1O2MA 2XC4A 1LTOA 1W13U 3F1SB 1NBME 4RKJB 1N8OC 1E1QD 5T6FA 1GBBA 3RMMH 2PKSC 3P6ZB 2P3UB 3LH3A 5JYIA 1K1JA 4Z0KA 1EP6A 2VIPA 2PGQB 1C5WB 3DFJA 3FOAA 1ZPZA 4K1EA 1ELAA 5DP4A 3SJOA 2WUCA 3SNAA 3AK5A 3SGQE 4JZFH 4E05H 1DUEA 1C5SA 1UHBB 5A09A 1GHWH 2WYJA 2BXTH 3HKIB 2QY0B 3ATKA 2JJ2D 2TBSA 2O8MA 4ZUHA 1RD3B 3ZZ8A 5JBTA 3S9AA 2ZWLH 4NWLA 3T62A 1LQEA 8LPRA 3SQEE 5C0UA 3ZVGA 1QBNA 4I7YH 5FCRA 2Y6TA 1IQMA 2P3FH 2PR3A 1C2HA 3OSYA 2GX4A 1O2YA 2YMSC 1TWXB 2Z9LA 4K69A 4A6LA 4K8BA 2J94A 1SLXB 3PMJA 1W8BH 2C3SA 3P8FA 1YPKH 4Y7AA 3MU1A 3E90B 1YGCH 4IN1A 1DXWA 1TNHA 2C8ZB 1OWEA 4JMYA 3SGBE 1QA7A 1GHYH 4BAMB 2A5IA 1V2LT 2XNIA 1DDJA 2FOMB 3V7TA 1YWUA 3TJVA 2VIWA 2A4GA 1XMNB 3FZDA 4UD9H 2ZDMA 2Z6BD 3E0PB 2O8TA 3RUOA 2GP9B 3URDA 4WH6A 5DKMA 2JDID 2LELA 1ID5H 1UO6A 1P09A 3ATMA 1BBRE 2GCTB 1G9IE 1O2KA 4WMDA 2IJD1 3QDZB 3MWIU 1AVXA 4YOGA 2F3CE 1RJXB 3ELAH 1JIMA 4U30A 1ANBA 3ATLA 1C1VH 4FUCA 2G81E 1Z8RA 4MTBA 3C27B 3CS7A 8GCHF 3PV2A 3H7TA 1GG6C 3BTGE 5FXLA 1C5TA 4YTAA 4ASUD 3T28A 2WPIS 1OKXA 3PV4A 3PTBA 1ZHMA 1CHGA 4IGDA 1KTSB 3F9EA 5A8ZA 1CGHA 1IQEA 2JKHA 2V3HH 1T32A 3MOCA 2NU2E 1COWD 2F9PA 2FO9A 1KXEA 1PPZA 1Z1JA 4NG9H 1FQ3A 1E35B 3EQ0H 3BG4C 2FM2A 4INKA 2FTMA 1LDTT 5A8YA 2ZF0H 4X2YA 1DSUA 4JCNA 1O2SA 2WPDD 2FI4E 2YNBA 1YLNA 3MH7A 4O3UA 5C17A 5L30H 1LQDB 2Y81A 2BVSH 1GJCB 3MU8A 4KELA 2R0LA 1DXPA 1XUGA 3V13A 1LPKB 2SNWA 5DP9A 2ZTXA 2C8WB 3U8RH 2UWLA 1C1UH 1QRZA 2BDYA 4KKDA 5ESBA 1YPGH 3TITA 3S7HB 5DK1A 4BNRA 4Y8ZA 1GBCA 1VR1H 2PW8H 1SG8B 1BTWA 1FMGA 1TRMA 1QHRB 2JETC 1ZTKA 3SU0A 1XUFA 2ZGXH 2ZU2A 2B7DH 2ZDNA 3S9BA 1HAXB 1YPLH 1YY3A 2BB4A 4TPIZ 1NRRH 1EUFA 2A2QH 3R3GB 5E0GA 4BXWA 1AUJA 2A5KA 2Y80A 4RKOB 4MPVA 7ESTE 4XBBA 1UTMA 1MTNC 2DE9A 3SUGA 2CHAB 1OP8A 1GBIA 3MNBA 1AFQC 2BX3A 1ZTLA 1FJSA 1FDPA 4MPXA 1TMUH 1BB0B 3MU4A 2J5UA 2QF3A 3A86A 8ESTE 2PTCE 1L2EA 2KFWA 3RMNH 2RDEA 1TAWA 1O3LA 4ABAA 3SU1A 1FY4A 5JDUB 2TRMA 1AZZA 1EZQA 2GCHG 2P16A 3M3SA 4TWWA 2ESTE 3QLPH 2P93A 3Q3KA 1CT2E 1EKBB 1ELBA 3EGKH 3TNSA 1L4ZA 4GUXA 4D76A 1GGDB 4DW2U 4WH8A 1BTPA 2UWOA 1LHCH 1OSSA 3HGNA 1C2DA 1PYTC 1KYNA 1Y3XA 4DIIH 1TGBA 1T4UH 4FVBA 2KX4A 5CDFE 5EPNA 2AYWA 1GHBG 4Y6DA 3LKWA 4MQAA 2BD4A 3H7OA 1CT0E 3A82A 5JB8S 5K0HA 2W3KA 1C2MA 1D3TB 1DX5M 1GBEA 1UK4A 1O31A 1SQAA 1IOEA 2IOTA 1V6DA 1GHVH 1DT2A 1JBUH 3HGPA 3WW7A 4D7FA 1O3DA 1C1TA 1KXCA 1XUHA 5JB9S 1QBVH 5HIZA 2OUAA 1GDNA 3RXQA 2XW9A 1F5LA 2XOKD 3D49H 3HK6B 4IC6A 1OWKA 1CA8B 3RXBA 4OS2A 2BY8X 1S0RA 4LZ4B 3B9FH 4JZEH 2ZTZA 4Q7YA 1BMLA 1P2KA 4MPWA 4ACBA 5KEDA 1Z7KA 1Z6JH 3E1XB 3KQBA 3SQHE 1SGPE 1UCYK 1GI3A 2THFB 2A2XH 3WWFA 2H5DA 3ZVAA 1LMWB 2ZHDA 1O0DH 1O2PA 2D2DA 1UVTH 2TIOA 4Q7ZA 1N1LA 1TQ7B 1GVZA 1TYNA 1G3EA 2P8OB 5EPYA 2ZGJA 4ZMAH 1GJ6A 3KL6A 1YCPM 3PLBA 2FYRA 4BAQB 2GT7A 3S7KB 2HVXA 2VINA 1DWCH 2VVCA 3PTNA 2VB0A 4XBDA 1K2I1 2OLGA 4OS5A 1K21H 1LHGH 1UJ1A 1HAHH 4CHAB 1ZMLA 2TGAA 1WYKA 5TCCA 3SOSA 5EG4A 2F9VA 2PUQH 1O33A 1NPMA 2G5VA 4I8JA 1A5HA 1KDQA 1MZAA 3ODFA 1QQUA 1GCTC 4JZ1A 1SQOA 2CGAA 1T8NA 4AC9A 1O38A 2ANMH 2KR7A 3TVJB 4DT4A 2Z3EA 3UAIC 3MO6A 3GS9A 2ZEBA 1O2WA 2AGEX 3P8GA 4IMZA 3DSOA 3PM3A 1BT7A 3R0FA 2Y7XA 3TGJE 1C2IA 1MCVA 1P04A 1ZGVA 2PWXA 4QT8C 1O36A 4MPUA 1WQSA 1O5FH 4ABIA 3ZVEA 1ARCA 5FBEA 3UUZA 1AIXH 1PQ5A 2BDIA 2EI6A 3KYGA 2EA3A 3BTEE 3RU4D 3K9XB 2J97A 2WYGA 4VGCB 2OINA 4A1XA 3BTQE 2CF9H 4NIXA 1AU8A 1QB1A 4OS4A 2FYQA 4M7GA 6ESTA 1SGCA 2KZ4A 4JK5A 2VWNA 3LIWA 1O2HA 1ZMJA 2F9UA 2BVRH 2FOGA 5ESTE 1GBLA 1OHHD 4X8UH 3KQEA 3K2UA 2ZHEH 1T7CA 1P9SA 3RXIA 1QR3E 3A7XA 2H2ZA 2P59A 3SNEA 1V2UT 5T6DA 2J95A 3M5MA 5E0JA 2ZIQH 1O2QA 3F9FA 1VJ9U 5PTPA 2ZKSA 2C8YB 1O2ZA 1K28D 1O2UA 4OM9A 1H1BA 1A5IA 1K1MA 1PQ7A 4E7NA 1ZGIA 3F2HA 3DHKH 4YZUA 3W94A 2ZI2H 1HIAA 5EJ1A 3FAOA 2BLQA 4NSYA 2ZTYA 1A5GH 1KXAA 1Z8IB 1AWFH 4ZXXH 2EY4C 1TRNA 2J4IA 1QCPA 2QV1A 2A31A 3MTYA 3PV5A 3M7QA 1PJPA 3M37A 3M3VA 3MU5A 5ETXA 4O3TA 2ZA5A 1U6QA 1MCTA 4F55A 1VITH 2SGFE 4FOUC 2STBE 4NA8A 3OU0A 1E1RD 1BITA 2KCPA 1A0LA 3PWCA 3P8OA 5DPAA 4B71A 1HBTH 1C2LA 2UUYA 5T6GA 2BQ6B 5DJ7A 1OP2A 2FI3E 1JWTA 1EB2A 3LDXH 1C2FA 2QYIA 3GY4A 2RA0A 1E79D 4I8KA 5HM9A 2FOBA 1RTFB 1SGEE 2WPHS 1Y5AT 1ETTH 2DE8A 1OWJA 2A4OA 3DFLA 4GVUA 1P9UA 3M5LA 3PWBA 4NZQA 1EJNA 1FUJA 1C5OH 3T25A 1SVPA 1UTPA 5LPRA 3ZVDA 4HGCA 1Y59T 1O2RA 1ANDA 1TQ0B 2ZCHP 2H1UA 4I8GA 1Q3XA 3RM0H 1GMCG 3ZYDA 1IHSH 3RXPA 3A7ZA 4WMFA 1TABE 3T5FH 1W2KH 2HOBA 3UPEA 4WJG2 1GDQA 1EB1H 3LGIA 1P3EA 2W26A 1F5KU 1YM0A 1GI0A 1SI5H 1NRPH 1C5UA 3SNBA 1XVOA 4P00A 1Z1IA 2PKAB 2SGAA 1C1MA 3LJOA 3SU3A 3VGCC 1VKYA 2QXJA 4ZKOU 2A0QB 2B0FA 1A2CH 1O3KA 1MMJN 2QF4A 3U1JB 4ZROA 1Y3WA 1HRTH 1YPEH 4KP0A 3AASA 3DCLA 4FU9A 5E2PA 3BEUA 4BXSA 1NRSH 4AGJA 1D3PB 1VJAU 4Y71A 1F92A 3GCTG 1EZXC 1YBWA 1CHOG 4JYUH 3QUMP 1SPJA 3SUDA 4ZAEA 2VWMA 4XOJA 1FN6A 4UFFH 1O3JA 1ZPBA 1BUIA 4IW4E 3KYFA 1M9UA 2BMGB 1O2NA 3NWUA 3UOUA 1VGCB 5FCKA 2Z3CA 1Y8TA 1D9IA 3BTKE 1GI8B 3RXAA 1C5XB 4DCDA 1O2XA 3RDZA 1P05A 1XUIA 1ZPCA 3TNTA 1RGQA 3BIUH 4ZXYH 1NC6A 3GDUA 2FOHA 2J34A 1ANCA 1V2KT 1GMHG 1E34B 4JYTA 1QRXA 2HNTC 2GMTC 3M3TA 2JH0D 1HJAC 2NWNA 5C67A 2ZECA 3E0NB 3M36A 3TGKE 1CO7E 1O5BB 4M9FA 1GJAB 1NESE 2RG3A 2D1JA 2L74A 2HPQH 1GBFA 2ZU5A 3RXCA 1FAKH 1GI1A 2M2AA 2VIQA 3NPSA 3TH3H 3RXSA 1PPCE 4AG1A 3ESTA 4NA9H 1BHXF 1ZSKA 1HXFH 1MTUA 1TB6H 2FIRH 4Q7XA 5F8TA 4K5ZA 1Y5BT 1TGNA 1CSOE 2R9PA 5B6LA 1G30B 5AFZH 1GJ8B 3RU4T 1FPHH 1ZHPA 2NU0E 2FOAA 1MD8A 2GZ7A 1AVGH 2OC8A 1C2KA 1NTPA 1FN8A 3LONA 1G3DA 1JOUB 3M7UA 3LH1A 1AO5A 4Y8XA 2BYAX 4BTTB 1MH0A 2H9TH 2UUFB 2Z9JA 1QJ1B 1O2OA 4ISIH 4CRBA 1O3PB 1O35A 5JBAS 1CE5A 1YPMH 1XKBC 2PHBA 1HPGA 1HAVA 1GBKA 3F3BA 3RXUA 3A81A 2AHME 2WPLS 1AWHB 1EPTA 2I6QA 3EDXB 1GJ7B 1P2NA 1BTUA 5EXLA 3GICB 1C5VA 3SYJA 4O97A 1XVMA 1SLVB 4X1PU 1V2QT 1ZR0A 4FUFA 2GCHF 1INCA 1CU1A 3FN8A 5JBCS 4JZDH 1MAYA 3UNQA 1H9LB 4AX9H 1F7ZA 2Z3DA 2Z7FE 4ESTE 1S84A 1J16A 1H8IH 1UCYE 4GAWA 1TRYA 3KCGH 3KEEA 1LPGB 3PO1C 3FP8E 4FETA 2ZHQH 1GJ5H 3RXRA 1FLEE 3BEIB 2V3MA 4K1SA 2XCNA 3TH2H 1GI2A 1V2MT 2ANKH 2BY6X 2HNTE 1DWDH 1GHBF 2LPRA 3P92A 1N6YA 2NU1E 1E37B 3V3MA 1UTKA 2AGIX 1TBQH 4X2XA 1XUKA 1AHTH 1HNEE 3O8RA 1C5PA 2WPKS 1NFXA 3AAUA 3ZZ7A 2FOCA 4B2AA 4FUIA 3M7TA 3MO3A 2BOKA 1RS0A 2BQWB 1O3GA 2WV5A 2ZCLP 4B1TA 1LPZB 1O3NA 1K1OA 4Y7BA 3GY8A 1EPTC 4X2VA 2CHAC 3SV6A 5C1XA 1C5QA 1MZDA 2GZ8A 5HIYA 1C9TA 2NU4E 2WUBA 1YCPH 1HAIH 1Y3UA 2R2WU 4WXVA 1ELCA 3VXFH 4E06H 2CN0H 3RXOA 2EEKA 3JZ1B 2OC1A 3MQKC 4AFUA 1O3HA 1C9PA 3A7WA 4I31A 3SO3A 4YOJA 1MKXK 1SR5C 1VCWA 4LXBH 2K8IA 1HJ9A 2W7UA 4NCYA 1O2VA 2ZFFH 2GZ9A 4BTIB 3C1KA 1SMFE 3RXLA 3AW0A 1GBTA 2SGQE 2P94A 1EJMA 1BBRH 4U32A 4CR5A 4Q63A 1EOJA 1OWIA 1S6LA 5L6NH 3BG8A 1YLCA 2HRVA 2ZZUH 1DFPA 2O9QA 1BJVA 2AIPA 1F5RA 2Q6DA 3QTOH 4GHQA 4H42U 3OEHD 2ZCKP 4O03A 1O3CA 1DLKB 1Y3YA 4A5TS 1CBWB 1HV7A 4A1VA 2G52A 1B7XB 4OS6A 1GL0E 5E2OA 5EQRA 4UE7H 3UB0A 2A4QA 3N7DA 2AERH 2QE7D 3V0XA 7KMEH 2ANWA 4BAOB 4WWYA 1PPBH 1TNKA 2ULLA 1IQIA 1P03A 3SGAE 1C1PA 2ZFRH 2O8LA 2HNTF 3TLOA 2XBYA 1DWBH 2W6JD 4O9VA 1RTKA 2FOFA 1V2PT 2Q1JA 1OYQA 1O32A 4X1SU 5G4BA 2H9EH 1S5SA 2ZPSA 2PGBB 3DSGA 1JIRA 4A7IB 3A83A 1WCZA 3HK3B 1GBDA 1QBOA 1FX0B 2ZG0H 4F4OC 1ELFA 4Y8YA 5AVDA 3ZZCA 1PYTD 3SU6A 1V2JT 3STIA 1MAXA 1MU8B 1C5RA 4D9QA 1N8OB 2WV9A 4CBNA 3K6ZA 2BY9X 2RCEA 3UQOA 4X6OA 4ABEA 2PKSB 1VZQH 1NS3A 4KTUA 1ELVA 1O2IA 2QIQA 5DP6A 1NM6A 2QXGA 4X8TH 1CVWH 4D9RA 5I46H 1BTZA 1CA0C 4FUGA 2H6MA 2FODA 2ZQ2A 4MVNA 3MO9A 4I33A 1HUTH 2EI7A 9ESTA 1HDTH 4RT0A 1V2TT 4ABDA 1NU9A 1IQFA 4X0WU 1GMDG 1EP5A 3QGNB 5FPYA 2P95A 1AQ7A 1GHXH 1MD7A 3HPTB 1SOZA 3O8BA 1BRBE 2D8WA 1SOTA 1HB0B 2PTNA 2XC0A 1E0FD 3ZV9A 4K1TA 2ZHFH 3EA8A 1HJ8A 1GHAG 1BTXA 1QURH 3MNCA 4FXGH 1HYLA 5GDSH 2ZGHA 4MNVA 1ELTA 4CRAA 1KXFA 2A5AA 2ZC9H 2YMSB 2ZNKH 1UTJA 1BCUH 1W12U 3LGYA 3UTUH 1NY22 4CBOA 3LGUA 5DGJA 3BF6H 3PRDA 4CRFA 3TK5A 1QGFA 2ZFTA 3OY6U 4NFEA 2TGPZ 1C1RA 4J2YB 2CJIA 3F9HA 3TPIZ 1SKYE 1HAPH 2BLVA 1ZZZA 2F83A 1SLUB 4I8HA 1ZJDA 1AB9C 4TY7A 3TGIE 4RI0A 4UONA 3W1EA 4CH2B 3KHVA 3OAAD 3SJIA 2O8UA 2J38A 2G55A 3QN7A 2VNTA 2J98A 4OS1A 1O3IA 1GMCF 2FS8A 1UVSH 1AE8H 2W7SA 1P57B 1H4WA 5H4IB 1SFQB 2OTVA 2OBQA 2EC9H 1O5CB 5FAHA 1NN6A 4DVAU 3DD2H 1ZTJA 1MKWK 1NFWA 2AMQA 2GV6A 5C20A 5HKKD 2VVUA 1BMAA 4Q4LA 2FP7B 4DT7B 5DP5A 1O5DH 1SHHB 3Q76A 1C1NA 1V2OT 1YC0A 4ABGA 1LVBA 2FWWA 2C8XB 4ISLA 2JIZD 3GCTF 4NIYA 1NU7B 1X7AC 2PSYA 3SORA 1P11E 1ZJKA 1CHOF 2PKAA 1GG6B 1SQRA 2VIDA 3KGPA 3UFAA 5EGMA 4ACAA 3MH4A 5DSFA 2ODPA 3Q00A 3NRLA 4YT7H 1C5YB 5GCHG 1PQAA 1ZLRA 2FLBH 2GVFA 5FX5A 3P17H 4Y0ZE 2L6OA 2SGDE 1V2RT 3O8CA 3RLYH 1RIWC 5SGAE 5F53A 1C5ZB 4ZKNU 5C3NA 6LPRA 1C5MD 1ESAA 1K9OE 1B5GH 4ISOA 1ANEA 1YPHC 1ELEE 3BG4B 3GCHC 1TFXA 3E6PH 2G51A 3ZVBA 1TPAE 3BTME 3RXVA 2Z94A 4NSVA 2DUCA 1VCPA 3N7EA 3GY7A 4ZHLU 1A0HB 5K7RA 1GMHF 5LGOA 1EAXA 4BOHA 1G3BA 2M5TA 2VH0A 4Q80A 1SSXA 1KIGH 1O2LA 1WUNH 1T31A 3SU5A 1P12E 5EIYA 1TE0A 3UWJH 1LVYA 3AW1A 2KAIB 1ETRH 1JMOH 4WF8A 2JETB 2F43B 1DITH 2R0KA 3LGVA 3A7YA 1FY3A 1EJAA 2BM2A 2VIOA 3ZZDA 9LPRA 3SI3H 1GI4A 1ZYOA 2OK5A 1SFIA 1J17T 1NRNH 1QNJA 3GDVA 4NA7A 1HLTH 1FY8E 3V12A 1WSSH 3A7VA 1GI5A 1UTQA 2IPQX 3VG8A 2AS9A 1AFQB 3UQVA 2VGCC 3GYMA 4X1QU 1TX8A 5EQSA 2OQUA 4D7GA 1OXGA 4Z6AH 1O3MA 2WPMS 3D23A 4KTSA 2SNVA 1D4PB 5EOKA 5DP8A 4DG4A 1YKTA 3MU0A 4AB9A 3IWMA 3Q3YA 1AN1E 2D26C 2FPZA 5JPMH 2ZDLA 4JZIA 1AD8H 1L1JA 1BTYA 1JRSA 1KY9A 2FDAA 2RFKC 4AFSA 3KN2A 3BEFB 3URCA 4TWYA 2QAAA 1SGQE 1LHEH 2R2MB 3RXDA 2KCOA 1IQNA 3KNXA 1YPHE 1QL9A 2FS9A 8KME2 4IBLH 3RXMA 2G4UA 4NIWA 2A7JA 2EI8A 3LGTA 1BQYA 1RTLA 2Z9GA 1EXFA 1SGTA 3MNSA 1P02A 2RA3A 3LT3A 1HGTH 2Y5FA 3VB6A 1V3XA 3TIUA 2ZU3A 3RC6A 3M5NA 3SZEA 5FHTA 4AYYB 3FKSD 3JZ2B 4UEHH 4J1YA 4ABFA 4YLQH 4P02A 1UHBA 1THPB 1C5LH 3SI4H 1E36B 5A2MH 3GY3A 3VB7A 2BDCA 1TMTH 1S81A 4DIHH 1DM4B 2PFEA 4TPYA 3L33A 2XBXA 2A45B 2HWLB 4HFPB 3ZV8A 2AGGX 4CRDA 1OYTH 1H9HE 5JBBS 4K2YA 3TK6A 3SN8A 2GDEH 3GOVB 3U98H 1TPSA 1W0ZU 2ZFSA 4Y11E 3H5CB 4ISNA 1C4Y2 1J15A 4IC5A 5AFYH 1RXPA 3I77A 3A87A 3QZRA 1MQ5A 5EODA 2XYAA 2WV4A 2SGPE 2J92A 3IITA 4BAHB 3ZIAD 1UW7A 5L2YH 3A84A 3SUEA 1HAGE 2ZDAH 3U28C 1SLWB 1ZHRA 2XTTB 2W3IA 3M35A 1RFNA 3U8OH 1GCTB 1T8LA 3F0OA 3VFEA 2CF8H 1UTLM 3GYLB 4A1TA 3ODDA 3QGJA 4YLUA 3F9GA 1T4VH 1Z6EA 1J14A 1GJBB 2BLWA 3S9CA 5F6MA 3ENSB 7GCHG 1FY5A 2ZP0H 1ZSJA 2OBOA 1BHXB 1NROH 3SW2B 2QA9E 3OX7U 2PV9B 1BRCE 1EFRD 1DE7H 1O3BA 2QGRA 1BMFD 1DANH 1KTTB 1HAZB 3KQ5A 1QL8A 1JRTA 1W7XH 1NT1A 2WZQA 5HM2A 5C1UA 2JH6D 3A88A 2Q6FA 1MU6B 3QZQA 2VH6A 2BVXH 1KLIH 1TGSZ 1DLEA 1C1SA 2AEIH 5EW1H 1BIOA 2V7QD 5GPIB 1TMBH 3CNRA 2ZDVH 5EU8A 4B6FA 4AOQA 1ELDE 5BPEA 3I29A 3AAVA 1OWHA 3A8BA 2BD8A 1IQHA 1F0TA 1PPEE 3U69H 4AORA 1IQJA 4LK4A 3HKJB 4X6PA 2QC2A 2GCTC 3ZZBA 1FI8A 1GBMA 4K3JA 3F2GA 3M5OA 4UFDH 1AKSB 1SC8U 2PSXA 5HMAA 1Z8JB 1H8HD 3QO6A 3FO8D 1T8MA 3MH5A 2ZU4A 2LP6A 2OC7A 1ARBA 2NU3E 1DICA 1GJ9B 2FOEA 1BOQA 6GCHG 3RC4A 2XWBI 3L3TA 3NZIA 1GBAA 4FUHA 2ZGCA 2ZU1A 1Y3VA 4FUEA 1FXYA 1WV7H 1T8OA 3ATWA 3MFJA 1AGJA 3PRBA 1SGDE 5LH8A 3SBKA 1DVAH 4BTUB 5FX6A 2BD3A 1IQLA 1LCYA 1SGFA 4FU7A 1B0EA 1FIZA 1G32B 3HATH 3TJNA 4K8YA 3TK9A 1GBJA 2F91A 2FTLE 1MTWA 5FL7D 3H09A 3N99A 1W0YH 4Q2KA 3FFGA 3SNDA 2BX4A 1QL7A 3NCLA 1ELGA 2CMYA 3RXHA 3STJA 1GHAF 4ASHA 1GL1A 1LO6A 1P10A 1QZ8A 3TJUA 3MHWU 2P3TB 1IHTH 4IS5A 4CR9A 2V35A 3MH6A 1AZ8A 1C1WH 1XXFA 3PMAB 4X8SH 2KM0A 1TNIA 3P8NA 1HCGA 2OQ5A 1W3CA 2Y82A 1O2GH 3FP6E 1UCYH 2G00A 2KCYA 1GDUA 1EOLA 1LVOA 1WTGH 5FBIA 3SNCA 1GHZA 1UVOA 2HVYB 3A80A 2K1QA 3RXTA 3OE7D 1AI8H 3VEQB 3T26A 3IG6B 3BTWE 3LOXA 4MNXA 2ZO3H 1AMHA 4X1RU 4H6TA 1KXDA 3VGCB 1FNIA 1TLDA 2VWOA 3GDSA 1UMAH 2BDGA 2Y7ZA 3S0NA 3OY5U 3SJKA 3GY2A 1V2NT 1BRAA 3RMOH 3GISB 4BAKB 2A32A 1IAUA 1P2QA 1YYY1 3SU2A 5CHAB 3ITIA 4YM9A 1HAOH 5DP3A 1CT4E 4Y76A 3NUMA 1VCQA 4RT1A 3PB1E 5KECA 3O8DA 5EXNA 1OPHB 1SBWA 2QN5T 3FVFB 5C5OA 2JJ1D 2ASUB 1N6XA 6CHAB 1GI6A 1SGNE 3MI4A 2GKVE 2BDHA 3K6YA 4SGAE 1FAXA 1KLTA 1F0RA 2V0BA 3S69A 1IQGA 1O2JA 2WINI 3GCOA 3VXEH 5GCHF 1O5EH 5IK2D 4H4FA 1GVLA 1FV9A 4FUJA 3BTDE 1GGDC 3ATIA 1EZUC 2OCVB 3N7OA 2VVVA 2W6ID 4XSKU 4TSFD 4Z1MD 1W14U 2GMTB 5B6OA 4TY6A 1HJAB 1IQKA 3NK8A 2BHGA 3RXGA 2FLRH 3RC5A 2IN2A 4B6EA 2VWLA 3QWCH 1XXDA 1O34A 4FUBA 2GJGA 2G5NA 4GCHG 5C2ZA 1C2GA 4R8TB 2BD5A 1Q2WA 2AH4X 1QB6A 4YO9A 3RMLH 3UNSA 4NIVA 4INHA 3EYDA 5EQQA 3RM2H 4E7RG 1L1GA 1ESBA 1GI9B 4I8LA 2BY5X 4I32A 5AF9H 3B8JA 4X1NU 1H8DH 4XBCA 1TGTA 1S83A 5I25A 3LJJA 2O8WA 2P8OC 5E0HA 2KAIA 4NGAH 3E8LA 3D62A 4LZ1H 1G2MA 1GWAA 3PLPA 2ZPRA 4U2WA 4UFGH 1C5NH 1VITG 2XNDD 4CH8B 1D6RA 4AYVB 4FU8A 5LPFA 4ZHAA 4AFQA 3I78A 5CE1A 3DSPA 3UNRA 4MNYA 4XE4A 5F8XA 4R0IA 2R3UA 3RP2A 4XFQA 1P3CA 2Y5GA 1QIXB 1EASA 1TOMH 4CHAC 3OTJE 1ABIH 3SZNA 2B9LA 1SGYE 2BOHB 3U1IB 4D8NA 4Y0YE 5FPTA 2PP6A 1HAYB 1UTNA 1WAYB 2HLCA 1J8AA 1P2OA 4AG2A 3QK1A 1D3QB 3RXEA 3WY8A 1Z71A 3A7TA 2BQ7B 3UY9A 2AFQB 3F68H 2W5EA 1XKAC 2BD2A 3SHAH 4KTCA 4B74A 1CGIE 3PO1B 5EXMA 3T2NA 1S85A 3PROA 4TT3D 3BTTE 1DUAA 2FESH 2ZFQH 4FVDA 4ABHA 3UR9A 2V3OH 1D3DB 1LVMA 4THNH 4X2WA 4YT6H 1FY1A 2AIQA 5ABWA 3B23B 4INLA 1NRQH 5DP7A 1HAVB 2XCFA 3G01A 1EAWA 1EPTB 1TOCB 1S0QA 5DN6D 1PPFE 2CXVA 4VGCC 1MBMA 2ODYB 1EQ9A 2FEQH 4ZKRU 1DPOA 2UUKB 1ESTA 1O30A 1ZMNA 2XBWA 4MG3A 2AMPA 3DA9B 3F6UH 4GLYA 4XDEA 1Y5UT 3SV2H 4H6SB 3M61U 1NFYA 3OEED 3QTVH 2Z9KA 1OS8A 3ZYEA 1HXEH 2UWPA 1YP9A 1C2JA 4HTCH 1HFDA 3CENA 1UTOA 3K65B 1BA8B 4NWKA 1L0ZA 2FX4A 5IDKA 4PROA 1NFUA 2QXHA 4FUDA 1GJDB 2LNCA 3AVZA 1GI7B 1ETSH 3A8AA 1A7SA 3WWBA 4DOQA 2XWAA 2ZDKA 1UVUH 3KQDA 4WVPE 2HALA 1XM1A 1BMMH 5F8ZA 3VB3A 1F2SE 1O39A 1XUJA 4GPGA 1W10U 4AGKA 3T27A 1P06A 1V2WT 2BY7X 1F0UA 2H5CA 2XBVA 5HGGA 1XX9A 1B0FA 1C1QA 3KF2A 1SL3A 1J9CH 1NZQH 1PPGE 1FONA 3P70B 2Y5HA 1TNJA 4ZKSU 2OP9A 1OWDA 3T29A 3TJOA 1DS2E 3VB4A 5GWZA 4Y79A 2PUXB 1DOJA 3EA9A 3E91A 1DSTA 7GCHF 1BRUP 5J4QA 1AUTC 2I6SA 1L4DA 5GNDA 2QCYA 2SGEE 2F9BH 4CRCA 5FPSA 3SUFA 4K60A 1DWEH 3MNXA 3BIVH 3CP7A 3SV7A 2FI5E 5EW2H 2V6NA 1S6HA 1O3EA 1FZZA 4UDWH 5TCAA 1ZRKA 4LOYH 1QA0A 2A1DB 3F0PA 4X6NA 2HPPH 1SQTA 5AHGH 3SJ9A 4Y10E 2Q6GA 5E8EH 4U01A 1O3OA 1LKBA 1P01A 2HGTH 5J4SA 1WQVH 1GPZA 1TIOA 2BD9A 2XXLA 3Q77A 4NZLA 5GIBA 3EE7A 4YOIA 2YOLA 2WHXA 1QRWA 1PFXC 2QF5A 4YXWD 5LPEA 4HG6A 3ZVCA 2WPJS 2ZGBH 4I86A 2TPIZ 1YCPK 5HXFA 1CA0B 1ZOMA 1TNLA 2K0QA 3UREA 2BDAA 4DJZB 2CK3D 1P2IA 1MUEB 1V2ST 3A89A 3SJ8A 3ZZ6A 8GCHG 1A4WH 3SU4A 1ZRBA 3F2FA 1WBGB 3NKKA 1KLJH 1MTNB 3MYWA 4F49A 1EZSC 1H9IE 1WOFA 1QQ4A 3NXPA 4ISHH 4B2BA 1O2TA 2C93B 1S82A 4RN6A 1LHFH 1QB9A 1VGCC 5C94A 1A46H 6GCHF 4JK6A 4UFEH 1KXBA 1P0SH 4X6MA 4ZCNA 3UOPA 1TPOA 3D65E 1E38B 5T1VA 1P2JA 1BBRK 1F0SA 1AKSA 5HYOA 4DURA 2ALVA 1WTHD 1AY6H 1KSNA 1TONA 1UVPA 2YNAA 3PMBB 4A92A 3PYHA 3BSQA 1DY9A 4MDSA 2FZZA 1QTFA 1Z8GA 5KGOA 1TALA 2FXRA 3KIDU 1KMHB 1LKAA 2BZ6H 2G8TA 4B2CA 1GBHA 3LPRA 4KGAA 3A8DA 4BANB 4XRNA 1C4U2 1P2MA 5IYTA 2VJ1A 1OX1A 4MNWA 4WMEA 1PQ8A 1EATA 1SB1H 2F4LA 3W95A 1MTVA 1Q31A 3TU7H 1AB9B 2R3YA 2XC5A 1P8VC 1FIWA 4WY3A 4NFFA 1RRKA 4OGYA 5A0AE 3GY5A 1YLDA 2HLDD 5EJLA 2IJOB 2UUJB 3BTHE 1K1IA 1AFEH 4WXIA 2STAE 2ZHWH 3MMGA 1K22H 3FZZA 2C90B 2ODQA 1YF4A 2TGTA 1GJ4H 3UR6A 2SFAA 1MQ6A 2ZPQA 1A3EH
chains in the Genus database with same CATH topology
1ABJH 3EAJA 1DY8A 3LC5A 1TGCA 4OS7A 4GSOA 1A1RA 1MKXH 1UK3A 1A61H 4CRGA 4AFZA 1W7GH 2F9NA 5A8XA 1OOKB 1MTSA 1BJUA 4OGXA 4DGJA 4AZ2B 3E16B 2F9OA 1AE5A 1GCDA 3BV9B 5A0CA 1THRH 2FMJA 4YESB 2BLOA 1QJ6B 1ORFA 1O5GH 1MBQA 1TA2A 1V2VT 1SGFG 2BXUH 3GCNA 2H9HA 1BMNH 4B73A 1RIWB 3LU9B 2B8OH 2GTBA 1A3BH 2TGDA 2QXIA 1C1OA 1CGJE 3GCHB 1QJ7B 2BTCE 2J2UA 3VPKA 1AVWA 3ZZ4A 1O5AB 4RSPA 4ZHMU 2A4RA 1G3CA 1SGIB 1QFKH 3RXFA 4IMQA 1TX6A 3ZZ3A 3P95A 1K1NA 2OC0A 2ANYA 5DO4H 4DY7B 2OD3B 5T3HA 5C5NA 1EAIA 4X8VH 4AB8A 2C4FH 4JYVH 3U8TH 1TA6A 1CQQA 4GCHF 3QX5H 3E3TA 1ZSLA 1QY6A 2AMDA 3ZZAA 3PMHB 1SGRE 1O3FA 2ILNA 4HI3A 5CHAC 1BDAA 3L6PA 3UIRA 3ZVFA 1A0JA 1C2EA 3PLKA 3CS0A 4B76A 1TBRH 5BRRE 2OXSA 3RXKA 2BD7A 2BDBA 2VGCB 4CREA 3BN9A 5CMXH 5GJ4B 7LPRA 1TNGA 1TBZH 2GT8A 4SGBE 6CHAC 5L2ZH 1KDQB 3RLWH 1PPHE 5C1YA 3A85A 2J9NA 1JXPA 1SHYA 3SV9A 1G36A 4ZH8A 1VITF 2Z9IA 4HZHA 3SHCH 3LC3A 3RU4E 1UK2A 5DG6A 1ACBE 1EAUA 2CV3A 2ALPA 2A7HA 2B5TB 1GVKB 1OP0A 1W11U 1O37A 3Q3XA 2FX6A 2IPHA 2VIVA 3DUXH 3EA7A 2JH5D 5GXPA 4IN2A 1K1LA 2VU8E 4MLFB 1D6WA 2GGVB 3ZZ5A 4B75A 2ZFPH 4AN7A 2GD4B 3OYPA 3FP7E 3TH4H 2BZAA 2A7CA 1LHDH 3A8CA 1CBWC 3KQCA 1EX3A 1BZXE 1BTHH 3UWIA 1THSH 3LGWA 5A0BA 1L1NA 4ABJA 1FPCH 3ZZ9A 3EE0B 1GMDF 1TPPA 2GV7A 2RDLA 3GY6A 1WU1A 1S6FA 3DT0H 5TJXA 2ZQ1A 3FANA 5F03A 2XRCA 1NO9H 2G4TA 3BTFE 1G37A 1K1PA 4GHTA 1O3AA 3SV8A 1G2LA 2QF0A 1HIAB 1C4V2 1MKWH 3VB5A 4TYDA 2GDDA 3RXJA 1YPJH 1TX7A 4ABBA 3U9AH 2PLXA 1O2MA 2XC4A 1LTOA 1W13U 3F1SB 4RKJB 1N8OC 5T6FA 1GBBA 3RMMH 2PKSC 3P6ZB 2P3UB 3LH3A 5JYIA 1K1JA 4Z0KA 1EP6A 2VIPA 2PGQB 1C5WB 3DFJA 1ZPZA 4K1EA 1ELAA 5DP4A 3SJOA 2WUCA 3SNAA 3SGQE 4JZFH 4E05H 1DUEA 1C5SA 1UHBB 5A09A 1GHWH 2WYJA 2BXTH 3HKIB 2QY0B 3ATKA 2TBSA 2O8MA 4ZUHA 1RD3B 3ZZ8A 5JBTA 3S9AA 2ZWLH 4NWLA 3T62A 1LQEA 8LPRA 3SQEE 3ZVGA 1QBNA 4I7YH 5FCRA 2Y6TA 1IQMA 2P3FH 2PR3A 1C2HA 3OSYA 2GX4A 1O2YA 1TWXB 2Z9LA 4K69A 4A6LA 4K8BA 2J94A 1SLXB 3PMJA 1W8BH 2C3SA 3P8FA 1YPKH 4Y7AA 3MU1A 3E90B 1YGCH 4IN1A 1DXWA 1TNHA 2C8ZB 1OWEA 4JMYA 3SGBE 1QA7A 1GHYH 4BAMB 2A5IA 1V2LT 2XNIA 1DDJA 2FOMB 3V7TA 3TJVA 2VIWA 2A4GA 1XMNB 3FZDA 4UD9H 2ZDMA 2Z6BD 3E0PB 2O8TA 3RUOA 2GP9B 3URDA 4WH6A 5DKMA 1ID5H 1UO6A 1P09A 3ATMA 1BBRE 2GCTB 1G9IE 1O2KA 4WMDA 3QDZB 3MWIU 1AVXA 4YOGA 2F3CE 1RJXB 3ELAH 1JIMA 4U30A 1ANBA 3ATLA 1C1VH 4FUCA 2G81E 1Z8RA 4MTBA 3C27B 3CS7A 8GCHF 3H7TA 1GG6C 3BTGE 5FXLA 1C5TA 4YTAA 3T28A 2WPIS 1OKXA 3PV4A 3PTBA 1ZHMA 1CHGA 4IGDA 1KTSB 3F9EA 5A8ZA 1CGHA 1IQEA 2JKHA 2V3HH 1T32A 3MOCA 2NU2E 2F9PA 2FO9A 1KXEA 1PPZA 1Z1JA 4NG9H 1FQ3A 1E35B 3EQ0H 3BG4C 2FM2A 4INKA 2FTMA 1LDTT 5A8YA 2ZF0H 4X2YA 1DSUA 4JCNA 1O2SA 2YNBA 2FI4E 4O3UA 3MH7A 5L30H 1LQDB 2Y81A 2BVSH 1GJCB 3MU8A 4KELA 2R0LA 1DXPA 1XUGA 3V13A 1LPKB 2SNWA 5DP9A 2ZTXA 2C8WB 3U8RH 2UWLA 1C1UH 1QRZA 2BDYA 4KKDA 5ESBA 1YPGH 3TITA 3S7HB 5DK1A 4BNRA 4Y8ZA 1GBCA 1VR1H 2PW8H 1SG8B 1BTWA 1FMGA 1TRMA 1QHRB 2JETC 1ZTKA 3SU0A 1XUFA 2ZGXH 2ZU2A 2B7DH 2ZDNA 3S9BA 1HAXB 1YPLH 4TPIZ 2BB4A 1NRRH 1EUFA 2A2QH 3R3GB 5E0GA 4BXWA 1AUJA 2A5KA 2Y80A 4RKOB 4MPVA 7ESTE 4XBBA 1UTMA 1MTNC 2DE9A 3SUGA 2CHAB 1OP8A 1GBIA 3MNBA 1AFQC 2BX3A 1ZTLA 1FJSA 1FDPA 4MPXA 1TMUH 1BB0B 3MU4A 2QF3A 3A86A 8ESTE 2PTCE 1L2EA 3RMNH 1TAWA 1O3LA 4ABAA 3SU1A 1FY4A 5JDUB 2TRMA 1AZZA 1EZQA 2GCHG 2P16A 3M3SA 4TWWA 2ESTE 3QLPH 2P93A 3Q3KA 1CT2E 1EKBB 1ELBA 3EGKH 3TNSA 1L4ZA 4GUXA 4D76A 1GGDB 4DW2U 4WH8A 1BTPA 2UWOA 1LHCH 1OSSA 3HGNA 1C2DA 1PYTC 1KYNA 1Y3XA 4DIIH 1TGBA 1T4UH 4FVBA 5EPNA 2AYWA 1GHBG 4Y6DA 3LKWA 4MQAA 2BD4A 3H7OA 1CT0E 3A82A 5JB8S 5K0HA 2W3KA 1C2MA 1D3TB 1DX5M 1GBEA 1UK4A 1O31A 1SQAA 1IOEA 2IOTA 1V6DA 1GHVH 1DT2A 1JBUH 3HGPA 4D7FA 1O3DA 1C1TA 1KXCA 1XUHA 5JB9S 1QBVH 2OUAA 1GDNA 3RXQA 2XW9A 1F5LA 3D49H 3HK6B 4IC6A 1OWKA 1CA8B 3RXBA 4OS2A 2BY8X 1S0RA 4LZ4B 3B9FH 4JZEH 2ZTZA 4Q7YA 1BMLA 1P2KA 4MPWA 1Z7KA 1Z6JH 3E1XB 3KQBA 3SQHE 1SGPE 1UCYK 1GI3A 2THFB 2A2XH 2H5DA 3ZVAA 1LMWB 2ZHDA 1O0DH 1O2PA 2D2DA 1UVTH 2TIOA 4Q7ZA 1N1LA 1TQ7B 1GVZA 1TYNA 1G3EA 2P8OB 5EPYA 2ZGJA 4ZMAH 1GJ6A 3KL6A 1YCPM 3PLBA 2FYRA 4BAQB 2GT7A 3S7KB 2HVXA 2VINA 1DWCH 2VVCA 3PTNA 2VB0A 4XBDA 1K2I1 2OLGA 4OS5A 1K21H 1LHGH 1UJ1A 1HAHH 4CHAB 1ZMLA 2TGAA 1WYKA 5TCCA 3SOSA 5EG4A 2F9VA 2PUQH 1O33A 1NPMA 2G5VA 4I8JA 1A5HA 1KDQA 1MZAA 3ODFA 1QQUA 1GCTC 4JZ1A 1SQOA 2CGAA 1T8NA 1O38A 2ANMH 3TVJB 2Z3EA 3MO6A 2ZEBA 1O2WA 2AGEX 3P8GA 4IMZA 3PM3A 1BT7A 3R0FA 2Y7XA 3TGJE 1C2IA 1MCVA 1P04A 1ZGVA 2PWXA 4QT8C 1O36A 4MPUA 1WQSA 1O5FH 4ABIA 3ZVEA 1ARCA 5FBEA 3UUZA 1AIXH 1PQ5A 2BDIA 2EI6A 2EA3A 3BTEE 3RU4D 3K9XB 2WYGA 4VGCB 2OINA 4A1XA 3BTQE 2CF9H 4NIXA 1AU8A 1QB1A 4OS4A 2FYQA 4M7GA 6ESTA 1SGCA 4JK5A 2VWNA 3LIWA 1O2HA 1ZMJA 2F9UA 2BVRH 2FOGA 5ESTE 1GBLA 4X8UH 3KQEA 3K2UA 2ZHEH 1T7CA 1P9SA 3RXIA 1QR3E 3A7XA 2H2ZA 2P59A 3SNEA 1V2UT 5T6DA 2J95A 3M5MA 5E0JA 2ZIQH 1O2QA 3F9FA 1VJ9U 5PTPA 2ZKSA 2C8YB 1O2ZA 1K28D 1O2UA 1H1BA 1A5IA 1K1MA 1PQ7A 4E7NA 1ZGIA 3DHKH 4YZUA 3W94A 2ZI2H 1HIAA 3FAOA 2BLQA 4NSYA 2ZTYA 1A5GH 1KXAA 1Z8IB 1AWFH 4ZXXH 1TRNA 2J4IA 1QCPA 2QV1A 2A31A 3MTYA 3M7QA 1PJPA 3M37A 3M3VA 3MU5A 5ETXA 4O3TA 2ZA5A 1U6QA 1MCTA 1VITH 2SGFE 2STBE 4NA8A 3OU0A 1BITA 3PWCA 1A0LA 3P8OA 5DPAA 4B71A 1HBTH 1C2LA 2UUYA 5T6GA 2BQ6B 5DJ7A 1OP2A 2FI3E 1JWTA 1EB2A 3LDXH 1C2FA 2QYIA 3GY4A 2RA0A 4I8KA 5HM9A 2FOBA 1RTFB 1SGEE 2WPHS 1Y5AT 1ETTH 2DE8A 1OWJA 2A4OA 3DFLA 4GVUA 1P9UA 3M5LA 3PWBA 4NZQA 1EJNA 1FUJA 1C5OH 3T25A 1SVPA 1UTPA 5LPRA 3ZVDA 4HGCA 1Y59T 1O2RA 1ANDA 1TQ0B 2ZCHP 2H1UA 4I8GA 1Q3XA 3RM0H 1GMCG 3ZYDA 1IHSH 3RXPA 3A7ZA 4WMFA 1TABE 3T5FH 1W2KH 2HOBA 3UPEA 4WJG2 1GDQA 1EB1H 3LGIA 1P3EA 2W26A 1F5KU 1YM0A 1GI0A 1SI5H 1NRPH 1C5UA 3SNBA 1XVOA 1Z1IA 2PKAB 2SGAA 1C1MA 3LJOA 3SU3A 3VGCC 2QXJA 4ZKOU 2A0QB 2B0FA 1A2CH 1O3KA 1MMJN 3U1JB 4ZROA 1Y3WA 1HRTH 1YPEH 4KP0A 3AASA 4FU9A 5E2PA 4BXSA 3BEUA 1NRSH 4AGJA 1D3PB 1VJAU 4Y71A 1F92A 3GCTG 1EZXC 1YBWA 1CHOG 4JYUH 3QUMP 1SPJA 3SUDA 4ZAEA 2VWMA 4XOJA 1FN6A 4UFFH 1O3JA 1ZPBA 1BUIA 4IW4E 1M9UA 2BMGB 1O2NA 3NWUA 3UOUA 1VGCB 5FCKA 2Z3CA 1Y8TA 1D9IA 3BTKE 1GI8B 3RXAA 1C5XB 4DCDA 1O2XA 3RDZA 1P05A 1XUIA 1ZPCA 3TNTA 1RGQA 3BIUH 4ZXYH 1NC6A 3GDUA 2FOHA 2J34A 1ANCA 1V2KT 1GMHG 1E34B 4JYTA 1QRXA 2HNTC 2GMTC 3M3TA 2JH0D 1HJAC 2NWNA 5C67A 2ZECA 3E0NB 3M36A 3TGKE 1CO7E 1O5BB 1GJAB 1NESE 2RG3A 2D1JA 2HPQH 1GBFA 2ZU5A 3RXCA 1FAKH 1GI1A 2VIQA 3NPSA 3TH3H 3RXSA 1PPCE 4AG1A 3ESTA 4NA9H 1BHXF 1ZSKA 1HXFH 1MTUA 1TB6H 2FIRH 4Q7XA 5F8TA 4K5ZA 1Y5BT 1TGNA 1CSOE 2R9PA 1G30B 5AFZH 1GJ8B 3RU4T 1FPHH 1ZHPA 2NU0E 2FOAA 1MD8A 2GZ7A 1AVGH 2OC8A 1C2KA 1NTPA 1FN8A 3LONA 1G3DA 1JOUB 3M7UA 3LH1A 1AO5A 4Y8XA 2BYAX 4BTTB 1MH0A 2H9TH 2UUFB 2Z9JA 1QJ1B 1O2OA 4ISIH 4CRBA 1O3PB 1O35A 5JBAS 1CE5A 1YPMH 1XKBC 2PHBA 1HPGA 1HAVA 1GBKA 3RXUA 3A81A 2WPLS 1AWHB 1EPTA 2I6QA 3EDXB 1GJ7B 1P2NA 1BTUA 5EXLA 3GICB 1C5VA 4O97A 1XVMA 1SLVB 4X1PU 1V2QT 1ZR0A 4FUFA 2GCHF 1INCA 1CU1A 5JBCS 4JZDH 1MAYA 3UNQA 1H9LB 4AX9H 1F7ZA 2Z3DA 2Z7FE 4ESTE 1S84A 1J16A 1H8IH 1UCYE 4GAWA 1TRYA 3KCGH 3KEEA 1LPGB 3PO1C 3FP8E 2ZHQH 1GJ5H 3RXRA 1FLEE 3BEIB 3TH2H 4K1SA 2XCNA 1GI2A 1V2MT 2ANKH 2BY6X 2HNTE 1DWDH 1GHBF 2LPRA 3P92A 1N6YA 2NU1E 1E37B 3V3MA 1UTKA 2AGIX 1TBQH 4X2XA 1XUKA 1AHTH 1HNEE 3O8RA 1C5PA 2WPKS 1NFXA 3AAUA 3ZZ7A 2FOCA 4B2AA 4FUIA 3M7TA 3MO3A 2BOKA 1RS0A 2BQWB 1O3GA 2WV5A 2ZCLP 4B1TA 1LPZB 1O3NA 1K1OA 4Y7BA 3GY8A 1EPTC 4X2VA 2CHAC 3SV6A 5C1XA 1C5QA 1MZDA 2GZ8A 1C9TA 2NU4E 2WUBA 1YCPH 1HAIH 1Y3UA 2R2WU 4WXVA 1ELCA 3VXFH 4E06H 2CN0H 3RXOA 2EEKA 3JZ1B 2OC1A 4AFUA 1O3HA 1C9PA 3A7WA 4I31A 3SO3A 4YOJA 1MKXK 1SR5C 1VCWA 4LXBH 1HJ9A 2W7UA 4NCYA 1O2VA 2ZFFH 2GZ9A 4BTIB 3C1KA 1SMFE 3RXLA 3AW0A 1GBTA 2SGQE 2P94A 1EJMA 1BBRH 4U32A 4CR5A 1EOJA 1OWIA 5L6NH 3BG8A 1YLCA 2HRVA 2ZZUH 1DFPA 2O9QA 1BJVA 2AIPA 1F5RA 2Q6DA 3QTOH 4GHQA 4H42U 2ZCKP 4O03A 1O3CA 1DLKB 1Y3YA 4A5TS 1CBWB 1HV7A 4A1VA 2G52A 1B7XB 4OS6A 1GL0E 5E2OA 5EQRA 4UE7H 2A4QA 2AERH 7KMEH 3V0XA 2ANWA 4BAOB 4WWYA 1PPBH 1TNKA 2ULLA 1IQIA 1P03A 3SGAE 1C1PA