2RG3A

Covalent complex structure of elastase
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
218
structure length
217
Chain Sequence
IVGGRRARPHAWPFMVSLQLRGGHFCGATLIAPNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVILQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Leukocyte elastase
publication title X-ray snapshot of the mechanism of inactivation of human neutrophil elastase by 1,2,5-thiadiazolidin-3-one 1,1-dioxide derivatives.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 217
sequence length 218
ec nomenclature ec 3.4.21.37: Leukocyte elastase.
pdb deposition date 2007-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2rg3A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2rg3A02
3DUXH 2BMGB 1ZJKA 1DS2E 2BY5X 5LPRA 3BG8A 2RA3A 3M61U 1O2TA 3TPIZ 4JK5A 3DFLA 1G3EA 3BTDE 4KGAA 4B76A 5BRRE 1A5IA 2FOGA 3UNQA 4O03A 2FOEA 1GI4A 2G5NA 3VB5A 3K2UA 1EP5A 1D6RA 4FXGH 2PFEA 5DO4H 2P94A 1ZSJA 3M5OA 1GMCG 1JIRA 2QV1A 3UUZA 1ZPCA 4CREA 1P11E 1TRNA 4NZLA 1EZXC 2O9QA 5T6DA 1YCPK 2FODA 3KHVA 4FVBA 1W7XH 1SG8B 1IOEA 2DE8A 1QRZA 2SGPE 2BQ6B 4X1QU 1O37A 1C5RA 1WUNH 1FQ3A 2A31A 4A6LA 1IQMA 4YO9A 2GCTB 1AN1E 1AVGH 3SOSA 1MKWK 2GDDA 3HKIB 4J2YB 3U9AH 1WV7H 3SI4H 1NTPA 1GBDA 1OOKB 1TGSZ 1O2HA 1SGPE 2GCTC 3RXBA 4IBLH 1Y3UA 4BAKB 2GT7A 3TGIE 2BB4A 1F7ZA 3TJUA 1AZZA 3P92A 1C5QA 1V2QT 2Z3CA 2P3FH 4B71A 2TGPZ 3B9FH 3TJOA 3QZRA 2W26A 1DUAA 4Y7AA 5F8ZA 1YPEH 1O3EA 2FOCA 3PV4A 5I46H 5L30H 1NROH 3EE0B 3KEEA 1O2NA 3KGPA 5F6MA 1TWXB 3SGAE 2WUCA 1AY6H 5PTPA 5FHTA 1OP2A 2Z9IA 1CGHA 1P06A 3EA9A 1O2ZA 1YPHC 4AFQA 1BRUP 2BQWB 3QX5H 4AGKA 3HGPA 3O8RA 3MU8A 3A7WA 1UVOA 1RD3B 1X7AC 2Q6FA 4FU9A 1A2CH 1TPOA 2XC4A 1Z1IA 2SGDE 5E8EH 5E2PA 3A80A 1K1JA 1SLXB 2ALPA 3C27B 1F0SA 5TCCA 4BAHB 3T28A 4OS5A 1ZMNA 1ELFA 3RXAA 1SFQB 2H5CA 5EG4A 1GVKB 4GPGA 3L33A 3TNSA 2Y7ZA 3UNRA 3KCGH 4X6MA 3N7OA 1O30A 4KP0A 1G3BA 5LGOA 1CA0B 2J9NA 1QBVH 1GBHA 2GCHF 1MAXA 4ABHA 4DIIH 3TK9A 2XBWA 1ABJH 1JBUH 2BLVA 1T4VH 1GJAB 3A7YA 1YCPM 1CA0C 4ZKOU 3MTYA 3SUFA 1QBNA 1K1LA 2ZDNA 3BTFE 1C2JA 1OP0A 1WSSH 2ZPRA 3BEFB 2G4UA 1EP6A 3GCHB 1C5WB 1T8OA 3VB4A 1ARBA 1PPBH 1MTNB 1AFEH 3F68H 3P8OA 3W94A 3GCHC 4X1NU 4NIWA 4WVPE 1TMUH 4RKJB 1C5SA 4M7GA 1GJDB 2SNWA 2VGCB 3M3TA 1RRKA 1MTNC 1C9PA 2XC5A 1TOCB 2BZAA 2HALA 1N6XA 3K9XB 3SJ9A 1QJ1B 3ZZ7A 1OWHA 3RC4A 1GGDB 1Y8TA 4NWLA 1T8LA 4MNYA 2VGCC 1OYQA 1FXYA 1MAYA 2BVXH 1BRCE 1PPFE 4XBDA 1C1VH 2XYAA 2FO9A 2EI7A 4XSKU 1D3PB 1AFQB 1GGDC 1UVTH 2Y82A 2WPHS 1SI5H 4TPIZ 2BY8X 1C5NH 1DLKB 2JETB 2P3UB 1O2RA 1UO6A 1A0LA 2J2UA 4E7RG 1AFQC 2BD7A 1K1MA 3A8AA 2IJOB 2JETC 3CENA 1HIAA 2F9BH 2FPZA 2A32A 3SGBE 1AB9B 3RU4T 1UTPA 1P9UA 1AKSB 5B6OA 3URCA 1C5TA 1IQLA 1CT2E 4YT6H 2H2ZA 1RXPA 1AB9C 2ZTXA 4CBOA 2BDHA 3RXSA 3FP6E 5DP3A 1BA8B 3U1IB 1HPGA 4UFFH 3MNSA 4ABIA 1T32A 2SGAA 3BIVH 4ZXXH 1BHXB 3A89A 1SGFG 4ZH8A 2BD4A 1O5DH 5F8XA 2Q1JA 4F4OC 1LQDB 1LHFH 2VIOA 2RG3A 1O3IA 1S0QA 1GJ5H 1ZTJA 1XUIA 3KQDA 3RXGA 1JXPA 1DSTA 1V6DA 4MNVA 4NCYA 3ZZ3A 3KQCA 2D26C 1P03A 1MBMA 3T5FH 3P70B 1BJUA 5LPEA 1LTOA 1OX1A 2H9TH 2NU2E 2STAE 1GMHG 2PLXA 4IMZA 3LU9B 2R3YA 1BJVA 1TLDA 4FU8A 4JMYA 3TIUA 2ZGHA 3ZVFA 1CBWB 2NU3E 1P2OA 1AD8H 3BTQE 1HFDA 1HAVB 1DSUA 2XC0A 4X1SU 4A92A 1AI8H 5HM9A 6GCHG 3M5LA 3MNCA 5ESTE 1G9IE 1SGIB 4JK6A 1SR5C 2XBYA 2G00A 2PGBB 3E91A 3SNBA 4X1PU 2ALVA 3NK8A 2GT8A 3PWBA 4CH2B 3DA9B 5AFZH 2OXSA 3FP8E 4Q7XA 3SNAA 1LDTT 1O34A 1GBIA 2G51A 1FY8E 4D76A 1RTKA 2TRMA 2CN0H 1FN8A 1UCYE 3UQVA 1AIXH 3TJVA 4Y8ZA 4RSPA 2WYJA 4DVAU 1O5FH 2FI4E 4NA7A 1O3NA 1Y5BT 5FX6A 2OQ5A 3A87A 1F0RA 2V6NA 3LOXA 4B2AA 4HFPB 3ZVCA 3FAOA 1W7GH 2AGEX 4K1SA 1N8OB 1HUTH 1BZXE 1QBOA 1QA7A 4K69A 2A7HA 2IOTA 4HGCA 1NT1A 4MPUA 1O2IA 3ZVEA 1Z8RA 1MMJN 1SOZA 3PM3A 4LK4A 1SFIA 2TIOA 2ODYB 5DP9A 3KQBA 1S85A 1N8OC 1AWHB 1UTJA 2FYQA 1PQ8A 1SBWA 2C3SA 3TK6A 2FZZA 1C5MD 2TPIZ 4HZHA 6ESTA 3A7XA 1WAYB 1AQ7A 1THRH 1EAXA 3RP2A 5DK1A 3ZZ6A 3UY9A 2A2XH 3SZNA 3PTNA 1TMTH 1TNIA 4CRFA 1BMAA 1O3DA 1W13U 1RGQA 4JYVH 3RXPA 1CHGA 1KXCA 1O39A 1TNLA 3SNDA 4BTUB 4Y79A 2LNCA 4B75A 3V0XA 1ELEE 1GBFA 1MZDA 2A4OA 1Y3WA 3K65B 1V2LT 1C2FA 1H9HE 2VH0A 4LZ4B 3CP7A 3TVJB 4X8UH 3LC5A 1O32A 2TGAA 2XRCA 2NU1E 2FOFA 1GJ7B 4AG2A 1FPHH 2ZPSA 1GHWH 1Y3VA 1V2UT 4GCHF 1BCUH 1PFXC 1GHYH 1WCZA 2GZ7A 1YLCA 3RXOA 1TGTA 1G3DA 1BRBE 3S9AA 2VNTA 4ZHAA 3DD2H 1VGCC 2ZC9H 4B1TA 4R8TB 1ZTKA 1BTWA 2QA9E 1Y59T 2WPMS 1HB0B 1M9UA 3A7VA 4Y8XA 1W0ZU 2GP9B 1H9IE 1PPEE 4NA8A 1GBLA 5EW1H 3A8DA 3LC3A 2QXIA 2WINI 1T31A 3VEQB 1P02A 2AH4X 3PYHA 2C8WB 4MG3A 3RLWH 1KXBA 3UPEA 1HBTH 2CHAB 3RXMA 3BTTE 1C5PA 1SHYA 4ZMAH 1TFXA 1ZMLA 3TITA 1T8NA 1ZRBA 4TWYA 4WWYA 3VFEA 1DT2A 4Y0ZE 4D7FA 3LGIA 4O97A 3RM0H 2CHAC 2FS9A 1KXAA 2OQUA 2VIPA 2VVCA 3RXCA 1EOLA 2ZCHP 1LHDH 3MWIU 5EU8A 1P2KA 1KXEA 1P3EA 1FN6A 3ZZ4A 4TY6A 1KY9A 2J95A 1KIGH 2OP9A 1GCTB 1GHAF 2STBE 2BOHB 1QQ4A 3AASA 4I33A 1FY1A 3A83A 5ABWA 5CE1A 4Z6AH 1C5YB 3F1SB 2V35A 2B8OH 1LPKB 1O3OA 3VXEH 2ZHWH 1GCTC 1MZAA 2P3TB 1LVYA 1LQEA 3PLKA 4AORA 1C1OA 1AO5A 3ZVAA 3B8JA 3PO1B 4ZAEA 3STJA 4GHTA 4ISOA 1TRMA 3RLYH 3BTME 1GJ6A 2B9LA 3BEIB 4MPXA 3SJIA 1S81A 3RXRA 3PO1C 3M5MA 5IYTA 4NIVA 4X2WA 1TX6A 3ZVDA 2PSXA 1DWBH 3M7QA 3UNSA 3S9CA 1C2KA 2SGFE 4WF8A 5GWZA 1Z8JB 2XCFA 4BNRA 1MTSA 4ZHLU 1DITH 2GCHG 3EQ0H 1KLIH 2ZDMA 4NSYA 1EB1H 4WMFA 1OWIA 2QN5T 5AVDA 2VINA 5H4IB 1TQ0B 3AAVA 3LGTA 2VVVA 3BTHE 4D8NA 1HXFH 1ESBA 3O8DA 3M7UA 1V2KT 5AHGH 1SSXA 3VGCB 2B5TB 1XXDA 2WYGA 1UTNA 2W3IA 2W3KA 1GBEA 1B0EA 2ZDKA 1FI8A 4NFEA 3HK3B 1ZTLA 2ANYA 3I78A 3BEUA 1RS0A 4JZEH 2ODQA 3ATLA 2BDGA 3AAUA 2NU4E 1ZGVA 4IN2A 3SV9A 1O2YA 4Y0YE 1QY6A 4XDEA 1C2GA 2AYWA 2YOLA 3TK5A 3TH3H 5ETXA 1T7CA 3GY7A 3V3MA 1QGFA 2F9PA 5A8ZA 1HAGE 5L2ZH 3ATMA 3GDUA 1QL9A 2OCVB 5FX5A 2ZO3H 4IS5A 1Z6JH 1G3CA 1OYTH 2ZIQH 2JH6D 1NRSH 2PKAB 4K3JA 1TA2A 5J4QA 3RU4E 1VITF 2DE9A 2Y6TA 1DX5M 2P59A 2F9UA 2VWMA 1RTFB 1NRPH 2LPRA 3RMMH 1DDJA 1NO9H 2FLBH 1V2JT 2ZG0H 5JBAS 3E0NB 2OBQA 1C2EA 4TWWA 4FUJA 3A88A 2GX4A 2EI6A 4Q80A 1SGNE 1NFYA 4OGYA 3RDZA 2J94A 5JBBS 2FXRA 3MU0A 1L2EA 1P8VC 1SGYE 6LPRA 3EGKH 1RFNA 2GGVB 2ZHFH 2A45B 3TLOA 3SO3A 3GCOA 3QLPH 1GMDF 1UHBA 3EA8A 4I8LA 2BY7X 1MQ6A 3SQHE 1A3BH 3RXJA 8GCHF 3H5CB 1O2UA 1P12E 1O3GA 3A8BA 5DP6A 2VB0A 4MTBA 4NIXA 3O8BA 4ZKNU 3UOPA 4BTIB 1PPCE 3SNCA 1YC0A 2GV6A 3UR6A 1YYY1 3GY6A 3BTGE 2QXHA 1MKXH 4OS4A 3ENSB 4H6SB 1C4V2 1FIWA 4J1YA 1O5AB 3PMAB 3FP7E 3NUMA 4DW2U 1HAHH 4UFGH 2BOKA 4E05H 5L6NH 1F5LA 5GCHG 2ZFTA 2AMDA 4WH6A 1F0UA 1O2JA 4KTCA 1EKBB 1SGCA 3UFAA 1FNIA 3QDZB 3LPRA 1TGNA 2HNTE 3PB1E 1AE5A 1J14A 1ANCA 4KTSA 2ODPA 5FPSA 2JH0D 2CJIA 3Q3KA 2BX4A 3SGQE 1TPAE 1HAIH 1ZPZA 1TA6A 1BIOA 3D62A 1EZSC 1FPCH 4A1VA 3PLPA 4FUFA 1VJ9U 2G81E 2QF3A 1VR1H 2PKSB 1C5XB 2ZFFH 1IQGA 3F9EA 3BSQA 1IQHA 1EB2A 2Y81A 1CO7E 2V0BA 1UTMA 4PROA 1J8AA 2ESTE 1SPJA 3PWCA 1XXFA 1FY4A 1CQQA 2FWWA 2BQ7B 3F6UH 2PKSC 3GDVA 3MO6A 1CU1A 2FIRH 1NZQH 1SLWB 3M5NA 3K6ZA 1GJ4H 1C1MA 3MNBA 2UUJB 4Y76A 1XVMA 4FUDA 3DHKH 1C1NA 1NPMA 5GIBA 1BB0B 3SUDA 3H7OA 1C1RA 1C1UH 1ZR0A 3KNXA 2A4GA 2KAIA 2ZFSA 2ILNA 1C5ZB 2XWBI 3QTOH 4FUGA 3RXUA 4X8TH 2VIVA 1O5BB 2F91A 3FVFB 4AFUA 3HKJB 1GBAA 2FOAA 1TAWA 1EAUA 4ABFA 2TGDA 1XUHA 1P0SH 2ZFPH 4AN7A 4FUHA 1PPHE 1P10A 1QA0A 2RA0A 4X0WU 4ZXYH 3ODFA 3IITA 1NY22 1SMFE 1QURH 1EOJA 1C5VA 3S69A 4Q7YA 1W3CA 2JH5D 2FM2A 2A5IA 1SGFA 3A82A 5DP4A 3SU3A 4XBBA 4XFQA 1MU8B 1P9SA 2VIDA 1JIMA 1PQ7A 3MMGA 4E06H 2V3HH 1YLDA 3PROA 4X6NA 2ULLA 3RXFA 2A1DB 1TNJA 1AU8A 1ELBA 1RIWB 1KXDA 3GY8A 2FI3E 1FAXA 1ZHPA 4B2CA 4ABAA 3SV2H 1LVBA 1AWFH 4LOYH 4AYYB 1AHTH 2D1JA 2XTTB 1E34B 1S83A 1TNHA 1RIWC 4XBCA 2IPHA 1S0RA 3OY6U 1FLEE 4GCHG 3GY5A 1KDQB 1IAUA 1SL3A 1ARCA 5HM2A 8ESTE 1ESTA 2UUKB 4I32A 2AIPA 2NWNA 1HJ9A 1DFPA 2BD9A 3NWUA 3M35A 2ZTZA 2CGAA 7LPRA 1UTLM 3F9HA 1O38A 7GCHG 1YPKH 1HCGA 1MCVA 2EEKA 2BXTH 1HAXB 2UWPA 1ZSLA 1BUIA 3A7TA 1FONA 2Z9KA 5HGGA 1EPTA 4UEHH 2SGEE 1TRYA 2OINA 2UUFB 4AFZA 3T2NA 2BY9X 2BZ6H 5C20A 1DWCH 1W2KH 1A5GH 1P57B 3A85A 3STIA 2QCYA 1TB6H 4BTTB 3SW2B 1IQEA 1GL1A 3Q00A 1DWDH 2O8LA 1HNEE 1MTWA 2FOHA 3NCLA 4ZKRU 3RXKA 2VJ1A 2BVRH 2TBSA 2G52A 3ATWA 1BTUA 2XW9A 1GJBB 4U01A 1LPZB 3NPSA 4U32A 4DG4A 1W11U 1DY9A 2HLCA 5EQRA 1MQ5A 4X8VH 1D3DB 1GBKA 1GDNA 1T8MA 2UWOA 2VWOA 4K5ZA 1C1QA 3MU4A 1MD8A 4YLQH 4X2VA 2YNBA 1GI1A 1ESAA 2ZHQH 4BXWA 2RCEA 3ITIA 2PV9B 3NKKA 3SJ8A 2FX4A 4YM9A 2PR3A 1GBJA 1DWEH 1PJPA 1J16A 1ANBA 1NU7B 1L1JA 5J4SA 3GICB 1YPLH 1SOTA 4CRGA 3T29A 1ANEA 2J34A 4Z0KA 1O3AA 1TNKA 1QL8A 4DCDA 5DPAA 8LPRA 4AX9H 1DPOA 2O8TA 3NXPA 3PMJA 1BTXA 1PQ5A 1EAWA 1TGCA 1GWAA 1LO6A 1IHSH 3QUMP 1LVMA 1QJ7B 3QGJA 1BTHH 2BM2A 1K2I1 3ZZ8A 4MPWA 1FIZA 3MOCA 1K9OE 1D3TB 2CMYA 3RM2H 4FUIA 3BG4C 2FX6A 1H4WA 4ZKSU 2WPJS 2ZDAH 1FDPA 2ZHEH 1U6QA 3F9FA 1WYKA 3BV9B 1LKBA 3BTWE 3HATH 1XM1A 2ZU3A 1OWKA 1J15A 1ZJDA 3T62A 1HAOH 1UVUH 2A4RA 2BX3A 2BD8A 3SHAH 2R2MB 3A84A 1L1NA 4GVUA 1BMLA 1QHRB 3ZZAA 1VJAU 1ZHRA 4E7NA 5LPFA 5A2MH 1V2VT 1ZLRA 4VGCB 1Z8GA 2VIQA 2GTBA 3ZZBA 4IC6A 1G36A 4I7YH 4F49A 3ZYEA 2J92A 1O0DH 5EW2H 1OS8A 1C2HA 2C93B 4MNXA 3EDXB 2P95A 2PHBA 3RXQA 1P2QA 2C8ZB 1EXFA 4VGCC 1ID5H 1Q3XA 3RMLH 5DP8A 1UTOA 3HGNA 3VB3A 2OC1A 1F92A 2BVSH 1B7XB 2BXUH 4Q7ZA 1ZSKA 3ESTA 4JZ1A 1YPHE 1QJ6B 1AMHA 1ZZZA 3JZ1B 1OKXA 3MO9A 3D23A 3LGWA 1CA8B 1CGJE 5C1XA 1O2MA 5EXMA 1DXPA 4ABDA 1SLVB 1LPGB 1O5CB 3ZV8A 1KLJH 1TX8A 3ATIA 2G5VA 4FUEA 5E2OA 5EPYA 1CSOE 4IW4E 4LXBH 5L2YH 3OYPA 1MKXK 1T4UH 1BBRK 4Y7BA 3T26A 1AUTC 1VGCB 2BD3A 3BTEE 2J38A 5C1YA 2HNTC 1VCQA 3PMHB 1O3JA 1V2TT 3P8GA 4H4FA 1C1PA 1A1RA 1HAYB 5SGAE 1SLUB 2Y5GA 3QK1A 4X6PA 4RN6A 1DM4B 2HRVA 1DY8A 1WTHD 3E90B 3MYWA 3A81A 4AG1A 1GG6C 3RUOA 4GLYA 1JRSA 1GI3A 2CF8H 2OUAA 1GMDG 1DANH 3GDSA 1ZHMA 2Z9LA 1O2XA 1UVSH 4GUXA 1MD7A 5T6GA 5C5OA 8GCHG 3RXIA 2H9HA 2HNTF 2BLWA 3E6PH 5IDKA 3BN9A 1J17T 2GZ9A 2PUXB 4YLUA 4INHA 1UMAH 3A7ZA 4MNWA 3SV7A 5BPEA 1AUJA 2ZF0H 3V13A 2Z3EA 1QB9A 4B74A 3TH4H 1WOFA 1GDUA 1ZPBA 1YM0A 1HIAB 3SU1A 4GSOA 1S84A 2ZP0H 4ABGA 2EI8A 1BDAA 1XMNB 2AMPA 1O2VA 1F2SE 1D4PB 2WUBA 4DGJA 2HVXA 4A5TS 4SGAE 4YESB 2P93A 5CHAC 1ELGA 1XKBC 3UQOA 3FANA 5DG6A 3LIWA 1FY5A 4UONA 3LGVA 1G2LA 1DXWA 2THFB 1NC6A 4OS6A 3U8TH 1PYTC 4DJZB 2A4QA 2Z9GA 2XBXA 1E36B 2ZECA 1GVLA 1QQUA 1E35B 1SHHB 1YP9A 1GI5A 3DFJA 1ORFA 4TY7A 1NS3A 4CHAB 2QXGA 1TE0A 3MHWU 4DY7B 2ZQ2A 1BRAA 2ZPQA 4JCNA 1GMHF 5JB8S 2AGGX 3Q77A 4RKOB 1CT4E 2M5TA 5E0GA 1O2LA 4CHAC 4BAMB 5GXPA 1OWJA 1ZYOA 1BT7A 3O8CA 1P3CA 4D7GA 5EPNA 1EQ9A 3Q3XA 4CRBA 6GCHF 1FUJA 3P8FA 1SGEE 2WV4A 3E3TA 2AFQB 4K1TA 2EA3A 2QY0B 3L3TA 1C2IA 3MH6A 1SGTA 3SQEE 2R0LA 1ABIH 3PTBA 3UR9A 2R0KA 3LH1A 2FOMB 3B23B 2CV3A 1LVOA 4I31A 3V7TA 1UTKA 4O3UA 3SV6A 2ZCLP 4JZDH 3NZIA 1EASA 2OC8A 2FTMA 3BTKE 4WJG2 2SFAA 1TPPA 3OY5U 4K8YA 2BDCA 5LH8A 1EJAA 3T25A 4KTUA 1L4DA 3D49H 1DOJA 1LHGH 1NRQH 1C2MA 1F0TA 1GHZA 4CRCA 1TBRH 1QCPA 1AVWA 4THNH 4KKDA 1AGJA 1HJ8A 2VH6A 2HGTH 4UD9H 1Y3YA 1V2RT 1TOMH 1Z7KA 1VCWA 1C2DA 1TX7A 5C67A 4NZQA 2GV7A 2QXJA 1O3KA 3QTVH 5FPYA 5T6FA 2OBOA 3ATKA 3AW0A 1KDQA 1INCA 3LGUA 1Y5AT 4OGXA 1GCDA 1QIXB 1AKSA 5DJ7A 4CRAA 3S7HB 1NRRH 2AERH 5EGMA 4X6OA 9ESTA 3SU4A 1ETSH 2XNIA 2PWXA 2F9VA 5HYOA 3U8OH 2GDEH 1VITH 5EXLA 3SORA 2GKVE 4O9VA 4A1TA 1GJCB 5EOKA 1NN6A 4INKA 4INLA 3GYMA 4BAOB 1KXFA 1AZ8A 1J9CH 4AZ2B 4IGDA 3GCTF 4AOQA 3Q3YA 5E0JA 2A7JA 8KME2 4DIHH 5CMXH 1KLTA 1DLEA 3RMNH 1P2IA 1W14U 1S6HA 3LT3A 1TABE 1GI0A 2O8WA 3M7TA 5DKMA 2FTLE 4X2XA 1HXEH 4B2BA 4U30A 5FBEA 1Y5UT 2DUCA 2ZDVH 4ISNA 4HTCH 1BTPA 3SUEA 1GBTA 4D9RA 5A0CA 1O3FA 3QZQA 1FAKH 6CHAB 3SU0A 3GY4A 3SHCH 2ASUB 4OS1A 2BTCE 2HPQH 3RXEA 1JMOH 1HJAB 2SGQE 2G55A 3OSYA 5F03A 2ANKH 1V2MT 4ABBA 2QF0A 1PQAA 1P2JA 2FI5E 1LHEH 1RTLA 3RC6A 1HAVA 3CS0A 6CHAC 1LHCH 3QGNB 2GVFA 2FOBA 1HJAC 1JOUB 4Q2KA 1C5UA 3MH4A 1BBRH 3KN2A 1O2WA 2OLGA 3LJOA 3ZVBA 5JPMH 3M36A 1NESE 2BHGA 3RU4D 3G01A 1HV7A 1LMWB 3EAJA 5F8TA 4X2YA 2VWLA 1GHVH 4DOQA 2XWAA 3L6PA 1ETRH 1O2SA 1UCYH 1OP8A 3OX7U 3LH3A 1S6FA 2FYRA 3CS7A 3DT0H 5I25A 3WY8A 1TNGA 1WTGH 1C1TA 4KELA 3BIUH 3K6YA 5TJXA 1A3EH 1MU6B 1UK2A 4UDWH 3UWIA 1FY3A 4WH8A 1YPJH 3P17H 1V2OT 2BDAA 2AGIX 3AW1A 3TU7H 4GAWA 2Z7FE 2C8YB 1NU9A 1C1SA 1QR3E 2K1QA 2NU0E 1THPB 3QWCH 3P95A 1EJMA 2XBVA 1MUEB 2ZGXH 1SQAA 1EX3A 5A0AE 3SU2A 4BOHA 4NSVA 2UWLA 4B73A 4WXIA 2QGRA 1QRXA 1GHBF 2PW8H 2BYAX 1N1LA 2QAAA 4OS2A 3H7TA 3IG6B 1XX9A 1SC8U 3GYLB 5C2ZA 4YOIA 3M3SA 4YZUA 2ZKSA 1EJNA 3KL6A 3M37A 1BMMH 3ELAH 1SGDE 4MDSA 2FS8A 4H42U 3TNTA 3TJNA 1DICA 5G4BA 3GY3A 4Y71A 3SBKA 4FVDA 3P6ZB 1F5RA 1RJXB 2H9EH 1QL7A 3ZZCA 3ZV9A 4D9QA 2A5KA 1AE8H 1F5KU 2ZDLA 3UOUA 4ABEA 1O5EH 1G30B 1ZMJA 2ZWLH 3RXLA 5FAHA 1A5HA 2C4FH 1ZOMA 3V12A 1O3BA 5EXNA 2B0FA 1EATA 1EUFA 4ZROA 1LCYA 1CHOF 3QN7A 1GI7B 2P16A 2R3UA 4JZFH 3Q76A 3KIDU 4UFEH 2ZEBA 1EZQA 1UJ1A 4MVNA 1P09A 1O3HA 1V2NT 3RXTA 1AVXA 4I8HA 2GD4B 3UIRA 1ZGIA 2V3OH 1K1PA 5A0BA 1IQIA 1A46H 2F3CE 1OPHB 4YTAA 1K22H 1YKTA 1GPZA 3D65E 3C1KA 4U2WA 5A8YA 1G32B 2SNVA 3RXHA 2Q6DA 5JB9S 4CR5A 1TONA 1GI9B 5FBIA 2G4TA 2OC7A 1ELVA 1QB6A 1EZUC 3PMBB 1O2PA 5TCAA 3R3GB 1H9LB 3ZYDA 5A09A 2BD5A 2F83A 1Y3XA 4ABJA 1NM6A 5E0HA 4K1EA 2HWLB 1BOQA 5DGJA 4BXSA 1GMCF 1HYLA 3FZDA 3EYDA 3SN8A 2FESH 2G8TA 3TGKE 1C1WH 1QRWA 1L1GA 1O36A 2ZFQH 2ZU5A 1UTQA 1SQTA 1PYTD 3R0FA 1PPZA 1GJ8B 3U8RH 1DUEA 2OC0A 1DE7H 4Y6DA 1TALA 4WY3A 2VVUA 3SU5A 1KYNA 2A7CA 2Z3DA 2BDYA 3A8CA 3MU5A 4UE7H 3OTJE 2PSYA 4NIYA 5A8XA 2FP7B 4NG9H 1OWEA 3AVZA 2AS9A 4Y8YA 1NFUA 2ZA5A 1OWDA 5EQQA 3I29A 4ISLA 1OSSA 5FXLA 4TYDA 3MFJA 5C3NA 1GHAG 5FCRA 1YF4A 3BF6H 3SNEA 3S9BA 1YGCH 5AF9H 2BLQA 4MPVA 1KSNA 1P01A 5GJ4B 1THSH 1K21H 1GI2A 3JZ2B 3UREA 1HLTH 1O35A 2JKHA 1UHBB 2W5EA 1C4U2 3IWMA 2W7SA 3I77A 3RC5A 2R9PA 1C5LH 2FDAA 3P8NA 7KMEH 1E38B 1NFXA 1K28D 1QFKH 4CBNA 1IHTH 1YCPH 3MH7A 1Q31A 2Y5FA 4H6TA 1B0FA 2BD2A 2IN2A 3QO6A 3SUGA 1GI6A 2CF9H 3URDA 5GCHF 1DVAH 1N6YA 1BHXF 1V2ST 1IQKA 1FMGA 1O2QA 1P04A 2Y5HA 1O3PB 5K0HA 1W12U 1TGBA 2HPPH 3MNXA 1P2NA 2ZQ1A 1O2OA 5EODA 1CBWC 1MKWH 1YPGH 5HMAA 3BG4B 1HRTH 3EA7A 2B7DH 3FZZA 1IQFA 2PUQH 3E0PB 2HOBA 2WPLS 5DP5A 3U69H 2C90B 2Q6GA 4A7IB 1BBRE 2OTVA 1BTYA 4LZ1H 1W8BH 2F9OA 4MQAA 1PPGE 3ZZ9A 1H8DH 4QT8C 3ZZ5A 3MO3A 1WQVH 2EC9H 3VB6A 1Q2WA 7ESTE 2Y80A 3KQEA 4JYTA 3RXDA 4Y10E 1JWTA 5JBCS 3KF2A 3LGYA 1GJ9B 2VIWA 4AB9A 1TIOA 4I8JA 2A5AA 4X1RU 3HPTB 2TGTA 2ZZUH 1NRNH 5EQSA 4ISIH 4K2YA 1TBQH 1VCPA 1K1IA 1GHXH 2I6QA 2P8OB 1QTFA 2PKAA 2ZNKH 2ZU2A 1E0FD 1NFWA 2ZGJA 1YPMH 2ZI2H 1FZZA 3GCNA 1V2WT 2ZHDA 2P8OC 3A86A 1L0ZA 1Z8IB 1JRTA 1WQSA 1O3LA 1WBGB 4IN1A 4ZUHA 1CE5A 1ELTA 1G37A 1Z1JA 1XUFA 2YNAA 2KAIB 1D3QB 1HGTH 3SV8A 4YT7H 1C5OH 1VITG 2ZU1A 4GHQA 4OS7A 1S5SA 2BDBA 1CVWH 5JDUB 1A0HB 1XUJA 1O2KA 3S7KB 4I8GA 2VWNA 1O3CA 3SJOA 1XUKA 1B5GH 3VXFH 1LKAA 4A1XA 5HXFA 3TH2H 1QNJA 4ASHA 1XUGA 3GCTG 1GBCA 1GG6B 2CXVA 4TPYA 4ISHH 4HI3A 1GDQA 2XXLA 1UCYK 1WU1A 4AFSA 5DP7A 4ESTE 1W0YH 3ZVGA 1BQYA 2C8XB 5C1UA 3ZZDA 1MBQA 3VPKA 2D8WA 1W10U 1UK3A 1TQ7B 2QIQA 2ZGCA 2BLOA 2FMJA 2BY6X 2ZU4A 4FUBA 1A0JA 5ESBA 2GZ8A 5JYIA 1K1OA 2J4IA 1ELDE 3GY2A 1Z71A 4JYUH 4WXVA 3VB7A 2A0QB 1A7SA 2R2WU 1GVZA 2AIQA 3W95A 1EAIA 1H1BA 4K60A 3SU6A 1ACBE 3E16B 1A61H 4K8BA 7GCHF 4X8SH 5CHAB 1P05A 3TGJE 1GBBA 4BAQB 2H1UA 4YOJA 3E8LA 4FUCA 3RMOH 3U1JB 1CGIE 1XKAC 2WV5A 1E37B 1D9IA 1H8IH 3U98H 2ZGBH 3M3VA 5GPIB 1ANDA 2AEIH 1TYNA 4Y11E 4AB8A 1ELAA 4YOGA 1O33A 4BANB 1IQNA 2FLRH 4XOJA 2AMQA 4WMEA 1O5GH 2WPKS 4AGJA 1S82A 2Z9JA 4NFFA 2XCNA 2Z94A 1GL0E 1KTSB 1ZRKA 2F9NA 5T3HA 1EPTB 1QB1A 1HAZB 1TMBH 3ODDA 1GI8B 9LPRA 1P2MA 2D2DA 1SQOA 1CT0E 2GMTB 2ANMH 2RDLA 1EPTC 2ZCKP 4CRDA 4NA9H 1XVOA 4UFDH 1FV9A 1IQJA 1TPSA 2ZTYA 1L4ZA 4WMDA 2GMTC 2H6MA 1O31A 3SI3H 2PTCE 4MLFB 2A2QH 1GBMA 3GOVB 3MI4A 1V2PT 1YBWA 4CR9A 1GHBG 1HAPH 2PGQB 2ZFRH 2O8UA 4SGBE 4IMQA 4R0IA 4JZIA 3SJKA 3F9GA 4CH8B 1O3MA 1G2MA 1UVPA 3MH5A 3OU0A 3T27A 1C4Y2 4I8KA 3GISB 3MU1A 4NGAH 1MTUA 2W7UA 2I6SA 1SGQE 1SVPA 4DT7B 1ETTH 2PTNA 1ELCA 1OXGA 1D6WA 1VZQH 1MH0A 1A4WH 1O2GH 3FFGA 4IC5A 5FPTA 3LJJA 1Z6EA 3RXVA 4DURA 2WPIS 1BMNH 1CHOG 2BDIA 2O8MA 2FEQH 1FJSA 1HDTH 3UWJH 5C5NA 5JBTA 1MCTA 4NWKA 2QYIA 5AFYH 5K7RA 1TBZH 1BTZA 1K1NA 1C9TA 1UK4A 3HK6B 5GDSH 3E1XB 3LONA 3UTUH 1KTTB 3VGCC 2OD3B 2Y7XA 4XE4A 2VU8E 2ANWA 1V3XA 1C2LA 2QC2A 2UUYA 2Z6BD 1SB1H 1SGRE 1BITA 1MTVA 3PLBA 4FU7A 4ZHMU 5FCKA 2H5DA 3LDXH 3LKWA 4O3TA 4AYVB 3S0NA
chains in the Genus database with same CATH superfamily
2LP6A 3DUXH 2BMGB 1ZJKA 1DS2E 2BY5X 5LPRA 3BG8A 2RA3A 3M61U 1O2TA 3TPIZ 4JK5A 3DFLA 1G3EA 3BTDE 4KGAA 4B76A 5BRRE 1A5IA 3W1EA 2FOGA 3UNQA 4O03A 3OFND 2FOEA 2KCAA 1GI4A 2G5NA 3VB5A 3K2UA 1EP5A 1D6RA 4FXGH 3KQ5A 2PFEA 5DO4H 2P94A 1ZSJA 3M5OA 1GMCG 1JIRA 2QV1A 3UUZA 3EE7A 2WZQA 1ZPCA 4CREA 1P11E 1TRNA 4NZLA 1EZXC 2O9QA 5T6DA 1YCPK 2FODA 3KHVA 4FVBA 1W7XH 1SG8B 1IOEA 2DE8A 1QRZA 2SGPE 2BQ6B 4X1QU 1O37A 1C5RA 1WUNH 1FQ3A 2A31A 4A6LA 1IQMA 4YO9A 2GCTB 1AN1E 1AVGH 3SOSA 3OE7D 1MKWK 2GDDA 3HKIB 4J2YB 3U9AH 1WV7H 3SI4H 1NTPA 1GBDA 1OOKB 1TGSZ 1O2HA 1SGPE 2GCTC 3RXBA 1SKYE 4IBLH 1Y3UA 4BAKB 2GT7A 3TGIE 2BB4A 1F7ZA 3TJUA 1AZZA 3P92A 5CHBA 1C5QA 1V2QT 2Z3CA 2P3FH 4B71A 1QZ8A 2TGPZ 3B9FH 3TJOA 3QZRA 2W26A 1DUAA 4Y7AA 5F8ZA 1YPEH 1O3EA 2FOCA 3PV4A 5I46H 5L30H 1NROH 3EE0B 3KEEA 3U28C 1O2NA 1E1RD 3KGPA 5F6MA 1TWXB 3SGAE 2WUCA 1AY6H 5PTPA 5FHTA 1OP2A 2Z9IA 1CGHA 1P06A 3EA9A 1O2ZA 1YPHC 4AFQA 1BRUP 2BQWB 3QX5H 4AGKA 3HGPA 3O8RA 3MU8A 3A7WA 4B6FA 1UVOA 1RD3B 1X7AC 2Q6FA 4FU9A 1A2CH 1TPOA 2XC4A 1Z1IA 2SGDE 5E8EH 5E2PA 5C0TA 3A80A 1K1JA 1SLXB 2ALPA 3C27B 1F0SA 5TCCA 4BAHB 3T28A 4OS5A 1ZMNA 1ELFA 3RXAA 1SFQB 3SYJA 2EY4C 2H5CA 5EG4A 1GVKB 4GPGA 3L33A 3TNSA 2Y7ZA 3UNRA 3KCGH 4X6MA 3N7OA 1O30A 4KP0A 1G3BA 5LGOA 1CA0B 2J9NA 4XD7D 1QBVH 1GBHA 2GCHF 1MAXA 4ABHA 4DIIH 3TK9A 2XBWA 1ABJH 1JBUH 2BLVA 1T4VH 1GJAB 2QF5A 3A7YA 1YCPM 1CA0C 4ZKOU 3MTYA 3SUFA 1QBNA 1K1LA 2ZDNA 3BTFE 1C2JA 1OP0A 1WSSH 2ZPRA 3BEFB 2G4UA 1EP6A 3GCHB 1C5WB 1T8OA 3VB4A 1ARBA 1PPBH 1MTNB 1E1QD 1AFEH 3F68H 3FO8D 3P8OA 3W94A 3GCHC 4X1NU 4NIWA 4WVPE 2JIZD 1TMUH 5C0UA 4RKJB 1C5SA 4M7GA 1GJDB 2SNWA 2VGCB 3M3TA 1RRKA 1MTNC 1C9PA 2XC5A 4FOUC 1TOCB 2BZAA 2HALA 1N6XA 3K9XB 3SJ9A 1QJ1B 3ZZ7A 1OWHA 3RC4A 1GGDB 1Y8TA 4NWLA 1T8LA 4MNYA 2VGCC 1OYQA 1FXYA 1MAYA 3DSOA 2BVXH 1BRCE 1PPFE 4XBDA 1C1VH 2XYAA 2FO9A 2EI7A 4XSKU 1D3PB 1AFQB 1GGDC 1UVTH 2Y82A 2WPHS 1SI5H 4TPIZ 2BY8X 1C5NH 1DLKB 2JETB 3OTPA 2P3UB 3PV5A 1O2RA 1UO6A 1A0LA 2J2UA 4E7RG 3UAIC 1AFQC 2BD7A 1NBME 1K1MA 3A8AA 2IJOB 2JETC 3CENA 1HIAA 2F9BH 2FPZA 2A32A 3SGBE 1AB9B 3RU4T 1UTPA 1P9UA 1AKSB 5B6OA 3URCA 1C5TA 1IQLA 1CT2E 4YT6H 2H2ZA 1RXPA 1AB9C 2ZTXA 4CBOA 2BDHA 3RXSA 3FP6E 5DP3A 1BA8B 3U1IB 1HPGA 4UFFH 3MNSA 4ABIA 1T32A 2SGAA 3BIVH 4ZXXH 1BHXB 3A89A 1SGFG 4ZH8A 2BD4A 1O5DH 5F8XA 2Q1JA 4F4OC 1LQDB 1LHFH 2VIOA 2RG3A 1O3IA 1S0QA 1GJ5H 1ZTJA 1XUIA 3KQDA 3RXGA 1JXPA 1DSTA 1V6DA 4MNVA 3UB0A 4ACAA 4NCYA 3ZZ3A 3KQCA 2D26C 1P03A 1MBMA 2YMSB 3T5FH 3P70B 1BJUA 5LPEA 1LTOA 1OX1A 2H9TH 2NU2E 2STAE 1GMHG 2PLXA 4IMZA 3LU9B 2R3YA 1BJVA 1TLDA 4FU8A 4JMYA 3TIUA 2ZGHA 3CNRA 2YMSC 1CBWB 3ZVFA 2NU3E 1P2OA 1AD8H 3BTQE 1HFDA 1HAVB 1DSUA 2XC0A 4X1SU 4A92A 1AI8H 5HM9A 6GCHG 3M5LA 3MNCA 5ESTE 1G9IE 1SGIB 4JK6A 1SR5C 2XBYA 2G00A 2PGBB 3E91A 3SNBA 4X1PU 2ALVA 3NK8A 2GT8A 3PWBA 4CH2B 3DA9B 5AFZH 2OXSA 3FP8E 4Q7XA 3SNAA 1LDTT 1O34A 1GBIA 2G51A 1FY8E 4D76A 1RTKA 2TRMA 2CN0H 1FN8A 1UCYE 3KYFA 3UQVA 2WV9A 1AIXH 3TJVA 4Y8ZA 4RSPA 2WYJA 4DVAU 1O5FH 2FI4E 4NA7A 3FN8A 1O3NA 1Y5BT 5FX6A 2OQ5A 3A87A 1F0RA 2V6NA 3LOXA 4B2AA 4HFPB 3ZVCA 3FAOA 1W7GH 2AGEX 4K1SA 1N8OB 1HUTH 4M9FA 1BZXE 1QBOA 1QA7A 4K69A 2A7HA 2IOTA 4HGCA 1NT1A 4MPUA 1O2IA 2W6ID 3ZVEA 1Z8RA 1MMJN 1SOZA 3PM3A 4LK4A 1SFIA 2TIOA 2ODYB 5DP9A 3KQBA 1S85A 1N8OC 1AWHB 1UTJA 2FYQA 1PQ8A 1SBWA 2C3SA 3TK6A 2FZZA 1C5MD 2TPIZ 4HZHA 6ESTA 3A7XA 1WAYB 1AQ7A 1THRH 1EAXA 2F43B 3RP2A 5DK1A 3ZZ6A 3UY9A 2A2XH 3SZNA 3PTNA 1TMTH 1TNIA 4CRFA 1BMAA 1O3DA 1W13U 1RGQA 4JYVH 5IK2D 2L6OA 3RXPA 1CHGA 1KXCA 1O39A 1TNLA 3SNDA 4BTUB 4Y79A 2LNCA 4B75A 3V0XA 1ELEE 1GBFA 1MZDA 2A4OA 1Y3WA 3K65B 1V2LT 5HIZA 3DSPA 1C2FA 3F0PA 1H9HE 2VH0A 4LZ4B 3CP7A 3TVJB 4X8UH 3PV2A 3LC5A 1O32A 2TGAA 1K0HA 4Q4LA 2XRCA 2NU1E 2FOFA 1GJ7B 4AG2A 1FPHH 2ZPSA 1GHWH 1Y3VA 1V2UT 3DCLA 4GCHF 1BCUH 1PFXC 1GHYH 1WCZA 2GZ7A 1YLCA 3RXOA 1TGTA 1G3DA 1BRBE 3S9AA 2VNTA 4ZHAA 3DD2H 1VGCC 2ZC9H 4B1TA 4R8TB 1ZTKA 1BTWA 1SQRA 2QA9E 1Y59T 2WPMS 1HB0B 1M9UA 3A7VA 4Y8XA 1W0ZU 4OM9A 5DSFA 2GP9B 1H9IE 1PPEE 4NA8A 1GBLA 5EW1H 3A8DA 3LC3A 2QXIA 2WINI 3F2GA 1T31A 3VEQB 1P02A 2AH4X 3PYHA 3OAAD 2C8WB 4MG3A 3RLWH 1KXBA 3UPEA 1HBTH 2CHAB 3RXMA 3BTTE 1C5PA 1SHYA 4ZMAH 1TFXA 1ZMLA 3TITA 1T8NA 1ZRBA 4TWYA 4WWYA 3VFEA 1DT2A 4Y0ZE 3WW7A 4D7FA 3LGIA 4O97A 3RM0H 2CHAC 2FS9A 1KXAA 2OQUA 2VIPA 2VVCA 3RXCA 1EOLA 2ZCHP 1LHDH 3MWIU 5EU8A 1P2KA 1KXEA 1P3EA 1FN6A 3ZZ4A 4TY6A 1KY9A 2J95A 1KIGH 2OP9A 1GCTB 1GHAF 2STBE 2BOHB 1QQ4A 3AASA 4I33A 1FY1A 3A83A 5ABWA 5CE1A 4Z6AH 1C5YB 3F1SB 2V35A 2B8OH 1LPKB 1O3OA 3VXEH 2ZHWH 1GCTC 1MZAA 2P3TB 1LVYA 1LQEA 3PLKA 4AORA 1C1OA 1AO5A 3ZVAA 3B8JA 3PO1B 4ZAEA 3STJA 4GHTA 4ISOA 2JDID 1TRMA 3RLYH 3BTME 1GJ6A 2B9LA 3BEIB 4MPXA 3SJIA 1S81A 3RXRA 3PO1C 3M5MA 5IYTA 4NIVA 4X2WA 1TX6A 3ZVDA 2PSXA 1DWBH 3M7QA 3UNSA 3S9CA 1C2KA 2SGFE 5EJZA 4WF8A 5GWZA 1Z8JB 2XCFA 4BNRA 1MTSA 4ZHLU 1DITH 2GCHG 3EQ0H 1KLIH 2ZDMA 4NSYA 1EB1H 4WMFA 1OWIA 2QN5T 5AVDA 2VINA 5H4IB 1TQ0B 3AAVA 3LGTA 2VVVA 3BTHE 4D8NA 1HXFH 1ESBA 3O8DA 3M7UA 1V2KT 5AHGH 1SSXA 3VGCB 2B5TB 1XXDA 2WYGA 1UTNA 2W3IA 4ACBA 2W3KA 1GBEA 1B0EA 2ZDKA 1FI8A 4NFEA 3HK3B 1ZTLA 2ANYA 3I78A 3BEUA 1RS0A 4JZEH 2KCYA 2ODQA 3ATLA 2BDGA 3AAUA 2NU4E 1ZGVA 4IN2A 3SV9A 1O2YA 4Y0YE 1QY6A 4XDEA 1C2GA 2AYWA 2YOLA 3TK5A 3TH3H 5ETXA 1T7CA 3GY7A 3V3MA 1QGFA 2F9PA 5A8ZA 1HAGE 5L2ZH 3ATMA 3GDUA 1QL9A 2OCVB 5FX5A 2ZO3H 4IS5A 1Z6JH 1G3CA 1OYTH 2ZIQH 2JH6D 1NRSH 2PKAB 4K3JA 1TA2A 5J4QA 3RU4E 1VITF 2DE9A 2Y6TA 1DX5M 2P59A 2F9UA 2VWMA 1RTFB 1NRPH 2LPRA 2JJ2D 1DDJA 3RMMH 1NO9H 2FLBH 1V2JT 2ZG0H 5JBAS 3E0NB 2OBQA 1C2EA 4DT4A 4TWWA 4FUJA 3A88A 3N7DA 2GX4A 2EI6A 4Q80A 1SGNE 1NFYA 1WDIA 4OGYA 3RDZA 3H09A 2J94A 5JBBS 2FXRA 3MU0A 1L2EA 1P8VC 1SGYE 6LPRA 3EGKH 1RFNA 3F2FA 2GGVB 2ZHFH 2A45B 3WWBA 3TLOA 3SO3A 3GCOA 3QLPH 1GMDF 1UHBA 2YMSD 3EA8A 4I8LA 2BY7X 1MQ6A 3SQHE 1A3BH 3RXJA 8GCHF 3H5CB 1O2UA 1P12E 1O3GA 3A8BA 5DP6A 2VB0A 4MTBA 4NIXA 3O8BA 4Q63A 4ZKNU 3UOPA 4BTIB 1PPCE 3SNCA 1YC0A 2GV6A 3UR6A 1YYY1 3GY6A 2KM0A 3BTGE 2QXHA 1MKXH 4OS4A 3ENSB 4H6SB 1C4V2 1FIWA 4J1YA 1O5AB 3PMAB 3FP7E 3NUMA 4DW2U 1HAHH 4UFGH 2BOKA 4E05H 5L6NH 1F5LA 5GCHG 2V7QD 2ZFTA 2AMDA 4WH6A 1F0UA 1O2JA 4KTCA 1EKBB 1SGCA 3UFAA 1FNIA 3QDZB 3LPRA 1TGNA 2HNTE 3PB1E 1AE5A 1J14A 1ANCA 4KTSA 2ODPA 5FPSA 2JH0D 2CJIA 3Q3KA 2BX4A 3SGQE 4RT1A 1TPAE 1HAIH 1MABB 1ZPZA 1TA6A 1BIOA 3D62A 1EZSC 1FPCH 2AHME 2OK5A 4A1VA 3PLPA 4FUFA 1VJ9U 2G81E 2J98A 2QF3A 1VR1H 2PKSB 1C5XB 2ZFFH 1IQGA 3F9EA 5C94A 3BSQA 1IQHA 1EB2A 2Y81A 1CO7E 2V0BA 1UTMA 4PROA 1J8AA 2ESTE 1SPJA 3PWCA 1XXFA 1FY4A 1CQQA 5KECA 2FWWA 2BQ7B 3F6UH 2PKSC 3GDVA 3MO6A 1CU1A 2FIRH 1NZQH 1SLWB 3M5NA 3K6ZA 1GJ4H 1C1MA 3MNBA 2UUJB 4Y76A 1XVMA 4FUDA 3DHKH 1C1NA 1NPMA 5GIBA 1BB0B 3SUDA 3H7OA 1C1RA 1C1UH 1ZR0A 3KNXA 2A4GA 2KAIA 2ZFSA 2ILNA 1C5ZB 2XWBI 3QTOH 4FUGA 3RXUA 4X8TH 1COWD 1O5BB 2VIVA 2F91A 3FVFB 4AFUA 3HKJB 1GBAA 2FOAA 1TAWA 1EAUA 4ABFA 2TGDA 1XUHA 1P0SH 2ZFPH 4AN7A 4FUHA 1PPHE 1P10A 1QA0A 2RA0A 4X0WU 4ZXYH 3ODFA 3IITA 1NY22 1SMFE 1QURH 1EOJA 1C5VA 3S69A 4Q7YA 3PRDA 1W3CA 2JH5D 2FM2A 2A5IA 1SGFA 3A82A 5DP4A 3SU3A 4XBBA 4XFQA 1MU8B 1P9SA 2VIDA 1JIMA 1PQ7A 3MMGA 4E06H 2V3HH 1YLDA 3PROA 4X6NA 2ULLA 3RXFA 2A1DB 1TNJA 1AU8A 1ELBA 1RIWB 1KXDA 3GY8A 2FI3E 1FAXA 1ZHPA 3F0OA 4B2CA 4ABAA 3SV2H 1LVBA 1AWFH 4LOYH 4AYYB 1AHTH 2D1JA 2XTTB 1E34B 1S83A 1TNHA 1RIWC 4XBCA 2IPHA 1S0RA 3OY6U 5GNDA 1FLEE 4GCHG 3GY5A 1KDQB 1IAUA 1SL3A 1ARCA 5HM2A 8ESTE 1ESTA 2UUKB 4I32A 2AIPA 2NWNA 1HJ9A 3OEED 1OHHD 1DFPA 2BD9A 3NWUA 3M35A 2ZTZA 2CGAA 7LPRA 1UTLM 3F9HA 1O38A 7GCHG 1YPKH 1HCGA 1MCVA 2EEKA 2BXTH 1HAXB 2UWPA 1ZSLA 1BUIA 3A7TA 1FONA 2Z9KA 5HGGA 1EPTA 4UEHH 2SGEE 1TRYA 2OINA 2UUFB 4AFZA 3T2NA 2BY9X 3SZEA 4F48B 2BZ6H 5C20A 1DWCH 1W2KH 1VKYA 5CDFE 1A5GH 1P57B 3A85A 3STIA 2QCYA 1TB6H 4BTTB 3SW2B 1IQEA 1GL1A 3Q00A 1DWDH 2O8LA 1HNEE 1MTWA 2FOHA 3NCLA 4ZKRU 3RXKA 2VJ1A 2BVRH 2TBSA 2G52A 3ATWA 1BTUA 2XW9A 1GJBB 4U01A 1LPZB 3NPSA 4U32A 4DG4A 1W11U 1DY9A 1W0KD 2HLCA 5EQRA 1MQ5A 4X8VH 2V3MA 1D3DB 1GBKA 1GDNA 1T8MA 2UWOA 2VWOA 4K5ZA 1C1QA 3MU4A 1MD8A 4YLQH 4X2VA 2YNBA 1GI1A 1ESAA 2ZHQH 4BXWA 2RCEA 3ITIA 2PV9B 3NKKA 3SJ8A 2FX4A 4YM9A 2PR3A 1GBJA 1DWEH 1PJPA 1J16A 1YY3A 1ANBA 1NU7B 1L1JA 5J4SA 3GICB 1YPLH 1SOTA 4CRGA 3T29A 1ANEA 2J34A 4Z0KA 1O3AA 1TNKA 1QL8A 4DCDA 5DPAA 8LPRA 4AX9H 1DPOA 2O8TA 3NXPA 4AC9A 3PMJA 1BTXA 1PQ5A 1EAWA 1TGCA 1GWAA 1LO6A 1IHSH 3QUMP 1LVMA 1QJ7B 3QGJA 1BTHH 2BM2A 1K2I1 3ZZ8A 4MPWA 1FIZA 3MOCA 1K9OE 1D3TB 2CMYA 3RM2H 4FUIA 3BG4C 2FX6A 1H4WA 4ZKSU 2WPJS 4ZCNA 2ZDAH 1FDPA 2ZHEH 1U6QA 3F9FA 1WYKA 3BV9B 1LKBA 3BTWE 3HATH 1XM1A 2ZU3A 1OWKA 1J15A 1ZJDA 3T62A 1HAOH 1UVUH 2A4RA 2BX3A 2BD8A 3SHAH 2R2MB 3A84A 1L1NA 2L74A 4GVUA 1BMLA 1QHRB 3ZZAA 1VJAU 1ZHRA 4E7NA 5LPFA 5A2MH 1V2VT 1ZLRA 4VGCB 1Z8GA 2VIQA 2GTBA 3ZZBA 4IC6A 1G36A 4I7YH 4F49A 3ZYEA 1EFRD 1O0DH 1E79D 2J92A 5EW2H 2HLDD 1OS8A 1C2HA 2C93B 4MNXA 3EDXB 2P95A 2PHBA 3RXQA 1P2QA 2C8ZB 1EXFA 4VGCC 1ID5H 1Q3XA 3RMLH 5DP8A 1UTOA 3HGNA 4YXWD 3VB3A 2OC1A 1F92A 2WSSD 2BVSH 1B7XB 2BXUH 4Q7ZA 1ZSKA 3ESTA 4JZ1A 1YPHE 1QJ6B 1AMHA 1ZZZA 2QF4A 3JZ1B 1OKXA 3MO9A 3D23A 3LGWA 1CA8B 1CGJE 5C1XA 1O2MA 5EXMA 1DXPA 4ABDA 1SLVB 1LPGB 1O5CB 3ZV8A 1KLJH 1TX8A 3ATIA 2G5VA 4FUEA 5E2OA 5EPYA 1CSOE 4IW4E 4LXBH 5L2YH 3OYPA 1MKXK 1T4UH 1BBRK 4Y7BA 3T26A 1AUTC 1VGCB 2BD3A 3BTEE 2J38A 5C1YA 2HNTC 1VCQA 3PMHB 1O3JA 1V2TT 3P8GA 4H4FA 1C1PA 1A1RA 1HAYB 5SGAE 1SLUB 2Y5GA 3QK1A 4X6PA 4RN6A 1DM4B 2HRVA 1DY8A 1WTHD 4B6EA 1W0JD 3E90B 3MYWA 3A81A 4AG1A 1GG6C 3RUOA 4GLYA 1JRSA 1GI3A 2CF8H 2OUAA 1GMDG 1DANH 3GDSA 1ZHMA 2Z9LA 1O2XA 1UVSH 4GUXA 1MD7A 5T6GA 5C5OA 8GCHG 3GS9A 3RXIA 2H9HA 2HNTF 2BLWA 3E6PH 5IDKA 3BN9A 1J17T 2GZ9A 2PUXB 4YLUA 4INHA 1UMAH 3A7ZA 4MNWA 3SV7A 5BPEA 1AUJA 2ZF0H 3V13A 2Z3EA 1QB9A 4B74A 3TH4H 1WOFA 2XOKD 1GDUA 1ZPBA 1YM0A 1HIAB 2WPDD 3SU1A 4GSOA 1S84A 2ZP0H 4ABGA 2EI8A 1BDAA 1XMNB 2AMPA 1O2VA 1F2SE 1D4PB 2WUBA 4DGJA 2HVXA 4A5TS 4SGAE 4YESB 2P93A 5CHAC 1ELGA 1XKBC 3PRBA 3UQOA 3FANA 5DG6A 3LIWA 1FY5A 4UONA 3LGVA 1G2LA 2RFKC 1DXWA 2THFB 1NC6A 4OS6A 3U8TH 1PYTC 4DJZB 2A4QA 2Z9GA 2XBXA 1E36B 2ZECA 1GVLA 1QQUA 1E35B 1SHHB 1YP9A 1GI5A 3DFJA 1ORFA 4TY7A 1NS3A 4CHAB 2QXGA 5EJ1A 1TE0A 3MHWU 4DY7B 2ZQ2A 1BRAA 5HMAA 2ZPQA 4JCNA 1GMHF 5JB8S 2AGGX 3Q77A 2K0QA 4RKOB 5FL7D 1CT4E 2M5TA 5E0GA 1O2LA 4CHAC 3OEHD 4BAMB 5GXPA 1OWJA 1ZYOA 1BT7A 3O8CA 1P3CA 4D7GA 5EPNA 1EQ9A 3Q3XA 4CRBA 6GCHF 1FUJA 3P8FA 1SGEE 2WV4A 3E3TA 2AFQB 4K1TA 2EA3A 2QY0B 3L3TA 1C2IA 3MH6A 1SGTA 3SQEE 2R0LA 1ABIH 3PTBA 3UR9A 2R0KA 3LH1A 2FOMB 3B23B 2CV3A 1LVOA 4I31A 3V7TA 1UTKA 4O3UA 3SV6A 2ZCLP 4JZDH 3NZIA 1EASA 2OC8A 2FTMA 3BTKE 4WJG2 2QE7D 2SFAA 1TPPA 3OY5U 4K8YA 2BDCA 5LH8A 5B6LA 1EJAA 3T25A 4KTUA 1L4DA 3D49H 4TSFD 1DOJA 1LHGH 1NRQH 1C2MA 1F0TA 1GHZA 4CRCA 1TBRH 1QCPA 1AVWA 4THNH 4KKDA 1AGJA 1HJ8A 2VH6A 5EIYA 2HGTH 4UD9H 1Y3YA 1V2RT 1TOMH 1Z7KA 1VCWA 1C2DA 1TX7A 5C67A 4NZQA 2GV7A 2QXJA 1O3KA 3QTVH 5FPYA 5T6FA 2OBOA 3ATKA 3AW0A 1KDQA 1INCA 3LGUA 1Y5AT 4OGXA 1GCDA 1QIXB 3F2HA 1AKSA 5DJ7A 4CRAA 3S7HB 1NRRH 2AERH 5EGMA 4X6OA 9ESTA 3SU4A 1ETSH 2XNIA 2PWXA 2F9VA 2F4LA 5HYOA 3U8OH 2GDEH 1VITH 5EXLA 3SORA 2GKVE 4O9VA 2HVYB 4A1TA 1GJCB 5EOKA 1NN6A 4INKA 4INLA 3GYMA 1FX0B 4BAOB 1KXFA 1AZ8A 1J9CH 4AZ2B 4IGDA 3GCTF 4AOQA 3Q3YA 5E0JA 2A7JA 8KME2 4DIHH 5CMXH 1KLTA 1DLEA 3RMNH 2KFWA 1P2IA 1W14U 1S6HA 3LT3A 1TABE 1GI0A 2O8WA 3M7TA 5DKMA 2FTLE 4X2XA 1HXEH 4B2BA 4U30A 5FBEA 2KR7A 1Y5UT 2DUCA 2ZDVH 5KGOA 4ISNA 2JJ1D 4HTCH 1BTPA 3SUEA 1GBTA 4D9RA 5A0CA 1O3FA 3QZQA 1FAKH 6CHAB 3SU0A 3GY4A 3SHCH 2ASUB 4OS1A 2BTCE 2HPQH 3RXEA 1JMOH 1HJAB 4TT3D 2SGQE 2G55A 3DSGA 3OSYA 5F03A 3FOAA 2ANKH 1V2MT 4ABBA 2QF0A 1PQAA 1P2JA 2FI5E 1LHEH 1RTLA 3RC6A 1HAVA 3CS0A 6CHAC 1LHCH 3QGNB 2GVFA 2FOBA 1HJAC 1JOUB 4Q2KA 1C5UA 3MH4A 1BBRH 3KN2A 1O2WA 2OLGA 3LJOA 3ZVBA 5JPMH 3M36A 1NESE 2BHGA 3RU4D 3G01A 1HV7A 1LMWB 3EAJA 1WXRA 5F8TA 4X2YA 2VWLA 1GHVH 4DOQA 2XWAA 3L6PA 1ETRH 1O2SA 1UCYH 1OP8A 3OX7U 3LH3A 1S6FA 2FYRA 3CS7A 3DT0H 5I25A 3WY8A 1TNGA 1WTGH 1C1TA 4HG6A 4KELA 1YWUA 3BIUH 3K6YA 5TJXA 2GJGA 1A3EH 1MU6B 1UK2A 4UDWH 3UWIA 1FY3A 4WH8A 1YPJH 3P17H 1V2OT 4P02A 2BDAA 2AGIX 3AW1A 3N7EA 3TU7H 4GAWA 2Z7FE 2C8YB 1NU9A 2VBCA 1C1SA 1QR3E 2K1QA 2NU0E 1THPB 4Z1MD 3QWCH 3P95A 1EJMA 2XBVA 1MUEB 2ZGXH 1SQAA 1EX3A 5A0AE 3SU2A 4BOHA 4NSVA 2UWLA 4B73A 4WXIA 3WWFA 2QGRA 1QRXA 2XNDD 1GHBF 2PW8H 2BYAX 1N1LA 2QAAA 4OS2A 3H7TA 5KEDA 3IG6B 2KCOA 1XX9A 1SC8U 3GYLB 5C2ZA 5T1VA 4YOIA 3M3SA 4YZUA 2ZKSA 1EJNA 3KL6A 3M37A 1BMMH 3ELAH 1SGDE 4MDSA 2FS8A 4ASUD 4H42U 3TNTA 3TJNA 1DICA 5G4BA 3GY3A 4Y71A 3SBKA 4FVDA 3P6ZB 1F5RA 1RJXB 2H9EH 2RDEA 1QL7A 3ZZCA 3ZV9A 4D9QA 2A5KA 1AE8H 1F5KU 2ZDLA 3UOUA 4ABEA 5HKKD 1O5EH 1G30B 1ZMJA 2ZWLH 4XRNA 3RXLA 5FAHA 1A5HA 2C4FH 1ZOMA 3V12A 1O3BA 5EXNA 2B0FA 1EATA 1EUFA 4ZROA 1LCYA 1CHOF 3QN7A 1GI7B 2P16A 2R3UA 2KZ4A 4JZFH 3Q76A 3KIDU 4UFEH 2ZEBA 1EZQA 1UJ1A 4MVNA 1P09A 1O3HA 1V2NT 3RXTA 1AVXA 4I8HA 2GD4B 3UIRA 1ZGIA 2V3OH 1K1PA 5A0BA 1S6LA 1IQIA 1A46H 2F3CE 1OPHB 4YTAA 1K22H 1YKTA 1GPZA 3D65E 3C1KA 4U2WA 5A8YA 1G32B 2SNVA 3RXHA 2Q6DA 5JB9S 4CR5A 1TONA 1GI9B 5FBIA 2G4TA 2OC7A 1ELVA 1QB6A 1EZUC 3PMBB 1O2PA 5TCAA 3R3GB 1H9LB 4I86A 3ZYDA 5A09A 2BD5A 5DN6D 2F83A 1Y3XA 4ABJA 1NM6A 5E0HA 4K1EA 2HWLB 1BOQA 2J97A 5DGJA 4BXSA 1GMCF 1HYLA 3FZDA 3EYDA 3SN8A 2FESH 2G8TA 3TGKE 1C1WH 1QRWA 1L1GA 1O36A 2ZFQH 2ZU5A 1UTQA 3VG8A 1SQTA 1PYTD 3R0FA 1PPZA 1GJ8B 3U8RH 1DUEA 2OC0A 1DE7H 4Y6DA 1TALA 4WY3A 2VVUA 3SU5A 1KYNA 2A7CA 2Z3DA 2BDYA 3A8CA 3MU5A 4UE7H 3OTJE 2PSYA 4NIYA 5A8XA 2FP7B 4NG9H 1OWEA 3AVZA 2AS9A 4Y8YA 1NFUA 2ZA5A 1OWDA 5EQQA 3I29A 4ISLA 1OSSA 5FXLA 4TYDA 3MFJA 5C3NA 1GHAG 5FCRA 1YF4A 3BF6H 3SNEA 3S9BA 1YGCH 5AF9H 2BLQA 4MPVA 1KSNA 1P01A 5GJ4B 1THSH 1K21H 1GI2A 3JZ2B 3UREA 1HLTH 1NBMD 1O35A 2JKHA 2PP6A 1UHBB 2W5EA 1C4U2 3IWMA 2W7SA 3I77A 3RC5A 2R9PA 1C5LH 2FDAA 2IJD1 3P8NA 7KMEH 1E38B 1NFXA 1K28D 1QFKH 4CBNA 1IHTH 1YCPH 3MH7A 1Q31A 2Y5FA 4H6TA 1B0FA 2BD2A 2IN2A 3QO6A 3SUGA 1GI6A 2M2AA 2CF9H 3URDA 5GCHF 1DVAH 1N6YA 1BHXF 1V2ST 1IQKA 1FMGA 1H8HD 1O2QA 1P04A 2Y5HA 1O3PB 5K0HA 1W12U 1TGBA 2HPPH 3MNXA 1P2NA 2ZQ1A 1O2OA 5EODA 2IPQX 1CBWC 1MKWH 1YPGH 1KMHB 3BG4B 1HRTH 3EA7A 2B7DH 3FZZA 1IQFA 2PUQH 3E0PB 4P00A 2HOBA 2WPLS 5DP5A 3U69H 2C90B 2Q6GA 4A7IB 1BBRE 2OTVA 1BTYA 4LZ1H 1W8BH 2F9OA 4MQAA 1PPGE 3ZZ9A 1H8DH 4QT8C 3ZZ5A 3MO3A 1WQVH 2EC9H 3VB6A 1Q2WA 7ESTE 2Y80A 3KQEA 4JYTA 3RXDA 4Y10E 1JWTA 5JBCS 3KF2A 3LGYA 1GJ9B 2VIWA 4AB9A 1TIOA 4I8JA 2A5AA 4X1RU 3HPTB 2TGTA 2ZZUH 1NRNH 2J98B 5EQSA 4ISIH 4K2YA 1TBQH 1VCPA 1K1IA 1GHXH 2I6QA 2P8OB 2LELA 1QTFA 2PKAA 2ZNKH 2CK3D 2ZU2A 1E0FD 1NFWA 2ZGJA 1YPMH 2ZI2H 1FZZA 3GCNA 1V2WT 2ZHDA 2P8OC 3A86A 1L0ZA 1Z8IB 1JRTA 1WQSA 1O3LA 1WBGB 4IN1A 4ZUHA 1CE5A 1ELTA 1G37A 1Z1JA 1XUFA 3NRLA 2YNAA 3KYGA 2KAIB 1D3QB 1HGTH 3SV8A 4YT7H 1C5OH 1VITG 2ZU1A 4GHQA 4OS7A 1S5SA 2BDBA 1CVWH 5JDUB 1A0HB 1XUJA 1O2KA 3S7KB 4I8GA 2VWNA 1O3CA 3SJOA 1XUKA 1B5GH 3VXFH 1LKAA 4A1XA 5HXFA 3TH2H 1QNJA 4ASHA 1YLNA 1XUGA 3GCTG 1GBCA 3N99A 1GG6B 2CXVA 4TPYA 4ISHH 4HI3A 1GDQA 2XXLA 2WHXA 1UCYK 1WU1A 4AFSA 5DP7A 4ESTE 1W0YH 2J5UA 3ZVGA 1BMFD 1BQYA 2C8XB 5C1UA 3ZZDA 1MBQA 3VPKA 2D8WA 1W10U 1UK3A 3FKSD 3MQKC 1TQ7B 2QIQA 4RT0A 2ZGCA 2BLOA 2FMJA 2BY6X 2ZU4A 4FUBA 1A0JA 5ESBA 2GZ8A 5JYIA 1K1OA 2J4IA 1ELDE 3GY2A 1Z71A 4JYUH 4WXVA 3VB7A 2A0QB 1A7SA 2R2WU 1GVZA 2AIQA 3W95A 1EAIA 1H1BA 4K60A 3SU6A 1ACBE 3E16B 1A61H 4K8BA 7GCHF 4X8SH 5CHAB 1P05A 3TGJE 1GBBA 4BAQB 3AK5A 2H1UA 2EQNA 4YOJA 3E8LA 4FUCA 3RMOH 3U1JB 1CGIE 1XKAC 2WV5A 1E37B 1D9IA 1H8IH 4FETA 3U98H 2ZGBH 3M3VA 5GPIB 1ANDA 2AEIH 1TYNA 4Y11E 4AB8A 1ELAA 4YOGA 1O33A 4BANB 1IQNA 2FLRH 4XOJA 2AMQA 4WMEA 1O5GH 2WPKS 2W6JD 4AGJA 1S82A 3F3BA 2Z9JA 4NFFA 2XCNA 2Z94A 1GL0E 1KTSB 1UW7A 1ZRKA 2F9NA 5T3HA 1EPTB 1QB1A 1HAZB 1TMBH 3ODDA 1GI8B 4RI0A 9LPRA 1P2MA 2D2DA 1SQOA 1CT0E 2GMTB 2ANMH 2RDLA 1EPTC 2ZCKP 4CRDA 4NA9H 1XVOA 4UFDH 1FV9A 1IQJA 1TPSA 2ZTYA 1L4ZA 4WMDA 2GMTC 2H6MA 1O31A 3SI3H 2PTCE 4MLFB 2A2QH 1GBMA 3GOVB 3MI4A 1V2PT 1YBWA 4CR9A 1GHBG 1HAPH 2PGQB 2ZFRH 2O8UA 5HIYA 4SGBE 4IMQA 4R0IA 4JZIA 3SJKA 3F9GA 1H8ED 4CH8B 1O3MA 1G2MA 1UVPA 2K8IA 3MH5A 3OU0A 3T27A 5C17A 1C4Y2 4I8KA 3GISB 3MU1A 2KCPA 4NGAH 1MTUA 2W7UA 2I6SA 1SGQE 1SVPA 4DT7B 1ETTH 2PTNA 1ELCA 1OXGA 1D6WA 1VZQH 1MH0A 1A4WH 1O2GH 3FFGA 4IC5A 5FPTA 3LJJA 1Z6EA 3RXVA 4DURA 2WPIS 1BMNH 1CHOG 2BDIA 2O8MA 2FEQH 1FJSA 1HDTH 3UWJH 5C5NA 5JBTA 1MCTA 4NWKA 2QYIA 5AFYH 5K7RA 4F55A 1TBZH 1BTZA 1K1NA 2KX4A 1C9TA 1UK4A 3HK6B 5GDSH 3E1XB 3LONA 3UTUH 1KTTB 3VGCC 2OD3B 3ZIAD 2Y7XA 4XE4A 2VU8E 2ANWA 1V3XA 1C2LA 2QC2A 2UUYA 2Z6BD 1SB1H 5F53A 1SGRE 1BITA 1MTVA 3PLBA 4FU7A 5EJLA 4ZHMU 5FCKA 2H5DA 3LDXH 3LKWA 4O3TA 4AYVB 3S0NA
chains in the Genus database with same CATH topology
3DUXH 2BMGB 1ZJKA 1DS2E 2BY5X 5LPRA 3BG8A 2RA3A 3M61U 1O2TA 3TPIZ 4JK5A 3DFLA 1G3EA 3BTDE 4KGAA 4B76A 5BRRE 1A5IA 2FOGA 3UNQA 4O03A 2FOEA 1GI4A 2G5NA 3VB5A 3K2UA 1EP5A 1D6RA 4FXGH 2PFEA 5DO4H 2P94A 1ZSJA 3M5OA 1GMCG 1JIRA 2QV1A 3UUZA 1ZPCA 4CREA 1P11E 1TRNA 4NZLA 1EZXC 2O9QA 5T6DA 1YCPK 2FODA 3KHVA 4FVBA 1W7XH 1SG8B 1IOEA 2DE8A 1QRZA 2SGPE 2BQ6B 4X1QU 1O37A 1C5RA 1WUNH 1FQ3A 2A31A 4A6LA 1IQMA 4YO9A 2GCTB 1AN1E 1AVGH 3SOSA 1MKWK 2GDDA 3HKIB 4J2YB 3U9AH 1WV7H 3SI4H 1NTPA 1GBDA 1OOKB 1TGSZ 1O2HA 1SGPE 2GCTC 3RXBA 4IBLH 1Y3UA 4BAKB 2GT7A 3TGIE 2BB4A 1F7ZA 3TJUA 1AZZA 3P92A 1C5QA 1V2QT 2Z3CA 2P3FH 4B71A 2TGPZ 3B9FH 3TJOA 3QZRA 2W26A 1DUAA 4Y7AA 5F8ZA 1YPEH 1O3EA 2FOCA 3PV4A 5I46H 5L30H 1NROH 3EE0B 3KEEA 1O2NA 3KGPA 5F6MA 1TWXB 3SGAE 2WUCA 1AY6H 5PTPA 5FHTA 1OP2A 2Z9IA 1CGHA 1P06A 3EA9A 1O2ZA 1YPHC 4AFQA 1BRUP 2BQWB 3QX5H 4AGKA 3HGPA 3O8RA 3MU8A 3A7WA 1UVOA 1RD3B 1X7AC 2Q6FA 4FU9A 1A2CH 1TPOA 2XC4A 1Z1IA 2SGDE 5E8EH 5E2PA 3A80A 1K1JA 1SLXB 2ALPA 3C27B 1F0SA 5TCCA 4BAHB 3T28A 4OS5A 1ZMNA 1ELFA 3RXAA 1SFQB 2H5CA 5EG4A 1GVKB 4GPGA 3L33A 3TNSA 2Y7ZA 3UNRA 3KCGH 4X6MA 3N7OA 1O30A 4KP0A 1G3BA 5LGOA 1CA0B 2J9NA 1QBVH 1GBHA 2GCHF 1MAXA 4ABHA 4DIIH 3TK9A 2XBWA 1ABJH 1JBUH 2BLVA 1T4VH 1GJAB 3A7YA 1YCPM 1CA0C 4ZKOU 3MTYA 3SUFA 1QBNA 1K1LA 2ZDNA 3BTFE 1C2JA 1OP0A 1WSSH 2ZPRA 3BEFB 2G4UA 1EP6A 3GCHB 1C5WB 1T8OA 3VB4A 1ARBA 1PPBH 1MTNB 1AFEH 3F68H 3P8OA 3W94A 3GCHC 4X1NU 4NIWA 4WVPE 1TMUH 4RKJB 1C5SA 4M7GA 1GJDB 2SNWA 2VGCB 3M3TA 1RRKA 1MTNC 1C9PA 2XC5A 1TOCB 2BZAA 2HALA 1N6XA 3K9XB 3SJ9A 1QJ1B 3ZZ7A 1OWHA 3RC4A 1GGDB 1Y8TA 4NWLA 1T8LA 4MNYA 2VGCC 1OYQA 1FXYA 1MAYA 2BVXH 1BRCE 1PPFE 4XBDA 1C1VH 2XYAA 2FO9A 2EI7A 4XSKU 1D3PB 1AFQB 1GGDC 1UVTH 2Y82A 2WPHS 1SI5H 4TPIZ 2BY8X 1C5NH 1DLKB 2JETB 2P3UB 1O2RA 1UO6A 1A0LA 2J2UA 4E7RG 1AFQC 2BD7A 1K1MA 3A8AA 2IJOB 2JETC 3CENA 1HIAA 2F9BH 2FPZA 2A32A 3SGBE 1AB9B 3RU4T 1UTPA 1P9UA 1AKSB 5B6OA 3URCA 1C5TA 1IQLA 1CT2E 4YT6H 2H2ZA 1RXPA 1AB9C 2ZTXA 4CBOA 2BDHA 3RXSA 3FP6E 5DP3A 1BA8B 3U1IB 1HPGA 4UFFH 3MNSA 4ABIA 1T32A 2SGAA 3BIVH 4ZXXH 1BHXB 3A89A 1SGFG 4ZH8A 2BD4A 1O5DH 5F8XA 2Q1JA 4F4OC 1LQDB 1LHFH 2VIOA 2RG3A 1O3IA 1S0QA 1GJ5H 1ZTJA 1XUIA 3KQDA 3RXGA 1JXPA 1DSTA 1V6DA 4MNVA 4NCYA 3ZZ3A 3KQCA 2D26C 1P03A 1MBMA 3T5FH 3P70B 1BJUA 5LPEA 1LTOA 1OX1A 2H9TH 2NU2E 2STAE 1GMHG 2PLXA 4IMZA 3LU9B 2R3YA 1BJVA 1TLDA 4FU8A 4JMYA 3TIUA 2ZGHA 3ZVFA 1CBWB 2NU3E 1P2OA 1AD8H 3BTQE 1HFDA 1HAVB 1DSUA 2XC0A 4X1SU 4A92A 1AI8H 5HM9A 6GCHG 3M5LA 3MNCA 5ESTE 1G9IE 1SGIB 4JK6A 1SR5C 2XBYA 2G00A 2PGBB 3E91A 3SNBA 4X1PU 2ALVA 3NK8A 2GT8A 3PWBA 4CH2B 3DA9B 5AFZH 2OXSA 3FP8E 4Q7XA 3SNAA 1LDTT 1O34A 1GBIA 2G51A 1FY8E 4D76A 1RTKA 2TRMA 2CN0H 1FN8A 1UCYE 3UQVA 1AIXH 3TJVA 4Y8ZA 4RSPA 2WYJA 4DVAU 1O5FH 2FI4E 4NA7A 1O3NA 1Y5BT 5FX6A 2OQ5A 3A87A 1F0RA 2V6NA 3LOXA 4B2AA 4HFPB 3ZVCA 3FAOA 1W7GH 2AGEX 4K1SA 1N8OB 1HUTH 1BZXE 1QBOA 1QA7A 4K69A 2A7HA 2IOTA 4HGCA 1NT1A 4MPUA 1O2IA 3ZVEA 1Z8RA 1MMJN 1SOZA 3PM3A 4LK4A 1SFIA 2TIOA 2ODYB 5DP9A 3KQBA 1S85A 1N8OC 1AWHB 1UTJA 2FYQA 1PQ8A 1SBWA 2C3SA 3TK6A 2FZZA 1C5MD 2TPIZ 4HZHA 6ESTA 3A7XA 1WAYB 1AQ7A 1THRH 1EAXA 3RP2A 5DK1A 3ZZ6A 3UY9A 2A2XH 3SZNA 3PTNA 1TMTH 1TNIA 4CRFA 1BMAA 1O3DA 1W13U 1RGQA 4JYVH 3RXPA 1CHGA 1KXCA 1O39A 1TNLA 3SNDA 4BTUB 4Y79A 2LNCA 4B75A 3V0XA 1ELEE 1GBFA 1MZDA 2A4OA 1Y3WA 3K65B 1V2LT 1C2FA 1H9HE 2VH0A 4LZ4B 3CP7A 3TVJB 4X8UH 3LC5A 1O32A 2TGAA 2XRCA 2NU1E 2FOFA 1GJ7B 4AG2A 1FPHH 2ZPSA 1GHWH 1Y3VA 1V2UT 4GCHF 1BCUH 1PFXC 1GHYH 1WCZA 2GZ7A 1YLCA 3RXOA 1TGTA 1G3DA 1BRBE 3S9AA 2VNTA 4ZHAA 3DD2H 1VGCC 2ZC9H 4B1TA 4R8TB 1ZTKA 1BTWA 2QA9E 1Y59T 2WPMS 1HB0B 1M9UA 3A7VA 4Y8XA 1W0ZU 2GP9B 1H9IE 1PPEE 4NA8A 1GBLA 5EW1H 3A8DA 3LC3A 2QXIA 2WINI 1T31A 3VEQB 1P02A 2AH4X 3PYHA 2C8WB 4MG3A 3RLWH 1KXBA 3UPEA 1HBTH 2CHAB 3RXMA 3BTTE 1C5PA 1SHYA 4ZMAH 1TFXA 1ZMLA 3TITA 1T8NA 1ZRBA 4TWYA 4WWYA 3VFEA 1DT2A 4Y0ZE 4D7FA 3LGIA 4O97A 3RM0H 2CHAC 2FS9A 1KXAA 2OQUA 2VIPA 2VVCA 3RXCA 1EOLA 2ZCHP 1LHDH 3MWIU 5EU8A 1P2KA 1KXEA 1P3EA 1FN6A 3ZZ4A 4TY6A 1KY9A 2J95A 1KIGH 2OP9A 1GCTB 1GHAF 2STBE 2BOHB 1QQ4A 3AASA 4I33A 1FY1A 3A83A 5ABWA 5CE1A 4Z6AH 1C5YB 3F1SB 2V35A 2B8OH 1LPKB 1O3OA 3VXEH 2ZHWH 1GCTC 1MZAA 2P3TB 1LVYA 1LQEA 3PLKA 4AORA 1C1OA 1AO5A 3ZVAA 3B8JA 3PO1B 4ZAEA 3STJA 4GHTA 4ISOA 1TRMA 3RLYH 3BTME 1GJ6A 2B9LA 3BEIB 4MPXA 3SJIA 1S81A 3RXRA 3PO1C 3M5MA 5IYTA 4NIVA 4X2WA 1TX6A 3ZVDA 2PSXA 1DWBH 3M7QA 3UNSA 3S9CA 1C2KA 2SGFE 4WF8A 5GWZA 1Z8JB 2XCFA 4BNRA 1MTSA 4ZHLU 1DITH 2GCHG 3EQ0H 1KLIH 2ZDMA 4NSYA 1EB1H 4WMFA 1OWIA 2QN5T 5AVDA 2VINA 5H4IB 1TQ0B 3AAVA 3LGTA 2VVVA 3BTHE 4D8NA 1HXFH 1ESBA 3O8DA 3M7UA 1V2KT 5AHGH 1SSXA 3VGCB 2B5TB 1XXDA 2WYGA 1UTNA 2W3IA 2W3KA 1GBEA 1B0EA 2ZDKA 1FI8A 4NFEA 3HK3B 1ZTLA 2ANYA 3I78A 3BEUA 1RS0A 4JZEH 2ODQA 3ATLA 2BDGA 3AAUA 2NU4E 1ZGVA 4IN2A 3SV9A 1O2YA 4Y0YE 1QY6A 4XDEA 1C2GA 2AYWA 2YOLA 3TK5A 3TH3H 5ETXA 1T7CA 3GY7A 3V3MA 1QGFA 2F9PA 5A8ZA 1HAGE 5L2ZH 3ATMA 3GDUA 1QL9A 2OCVB 5FX5A 2ZO3H 4IS5A 1Z6JH 1G3CA 1OYTH 2ZIQH 2JH6D 1NRSH 2PKAB 4K3JA 1TA2A 5J4QA 3RU4E 1VITF 2DE9A 2Y6TA 1DX5M 2P59A 2F9UA 2VWMA 1RTFB 1NRPH 2LPRA 3RMMH 1DDJA 1NO9H 2FLBH 1V2JT 2ZG0H 5JBAS 3E0NB 2OBQA 1C2EA 4TWWA 4FUJA 3A88A 2GX4A 2EI6A 4Q80A 1SGNE 1NFYA 4OGYA 3RDZA 2J94A 5JBBS 2FXRA 3MU0A 1L2EA 1P8VC 1SGYE 6LPRA 3EGKH 1RFNA 2GGVB 2ZHFH 2A45B 3TLOA 3SO3A 3GCOA 3QLPH 1GMDF 1UHBA 3EA8A 4I8LA 2BY7X 1MQ6A 3SQHE 1A3BH 3RXJA 8GCHF 3H5CB 1O2UA 1P12E 1O3GA 3A8BA 5DP6A 2VB0A 4MTBA 4NIXA 3O8BA 4ZKNU 3UOPA 4BTIB 1PPCE 3SNCA 1YC0A 2GV6A 3UR6A 1YYY1 3GY6A 3BTGE 2QXHA 1MKXH 4OS4A 3ENSB 4H6SB 1C4V2 1FIWA 4J1YA 1O5AB 3PMAB 3FP7E 3NUMA 4DW2U 1HAHH 4UFGH 2BOKA 4E05H 5L6NH 1F5LA 5GCHG 2ZFTA 2AMDA 4WH6A 1F0UA 1O2JA 4KTCA 1EKBB 1SGCA 3UFAA 1FNIA 3QDZB 3LPRA 1TGNA 2HNTE 3PB1E 1AE5A 1J14A 1ANCA 4KTSA 2ODPA 5FPSA 2JH0D 2CJIA 3Q3KA 2BX4A 3SGQE 1TPAE 1HAIH 1ZPZA 1TA6A 1BIOA 3D62A 1EZSC 1FPCH 4A1VA 3PLPA 4FUFA 1VJ9U 2G81E 2QF3A 1VR1H 2PKSB 1C5XB 2ZFFH 1IQGA 3F9EA 3BSQA 1IQHA 1EB2A 2Y81A 1CO7E 2V0BA 1UTMA 4PROA 1J8AA 2ESTE 1SPJA 3PWCA 1XXFA 1FY4A 1CQQA 2FWWA 2BQ7B 3F6UH 2PKSC 3GDVA 3MO6A 1CU1A 2FIRH 1NZQH 1SLWB 3M5NA 3K6ZA 1GJ4H 1C1MA 3MNBA 2UUJB 4Y76A 1XVMA 4FUDA 3DHKH 1C1NA 1NPMA 5GIBA 1BB0B 3SUDA 3H7OA 1C1RA 1C1UH 1ZR0A 3KNXA 2A4GA 2KAIA 2ZFSA 2ILNA 1C5ZB 2XWBI 3QTOH 4FUGA 3RXUA 4X8TH 2VIVA 1O5BB 2F91A 3FVFB 4AFUA 3HKJB 1GBAA 2FOAA 1TAWA 1EAUA 4ABFA 2TGDA 1XUHA 1P0SH 2ZFPH 4AN7A 4FUHA 1PPHE 1P10A 1QA0A 2RA0A 4X0WU 4ZXYH 3ODFA 3IITA 1NY22 1SMFE 1QURH 1EOJA 1C5VA 3S69A 4Q7YA 1W3CA 2JH5D 2FM2A 2A5IA 1SGFA 3A82A 5DP4A 3SU3A 4XBBA 4XFQA 1MU8B 1P9SA 2VIDA 1JIMA 1PQ7A 3MMGA 4E06H 2V3HH 1YLDA 3PROA 4X6NA 2ULLA 3RXFA 2A1DB 1TNJA 1AU8A 1ELBA 1RIWB 1KXDA 3GY8A 2FI3E 1FAXA 1ZHPA 4B2CA 4ABAA 3SV2H 1LVBA 1AWFH 4LOYH 4AYYB 1AHTH 2D1JA 2XTTB 1E34B 1S83A 1TNHA 1RIWC 4XBCA 2IPHA 1S0RA 3OY6U 1FLEE 4GCHG 3GY5A 1KDQB 1IAUA 1SL3A 1ARCA 5HM2A 8ESTE 1ESTA 2UUKB 4I32A 2AIPA 2NWNA 1HJ9A 1DFPA 2BD9A 3NWUA 3M35A 2ZTZA 2CGAA 7LPRA 1UTLM 3F9HA 1O38A 7GCHG 1YPKH 1HCGA 1MCVA 2EEKA 2BXTH 1HAXB 2UWPA 1ZSLA 1BUIA 3A7TA 1FONA 2Z9KA 5HGGA 1EPTA 4UEHH 2SGEE 1TRYA 2OINA 2UUFB 4AFZA 3T2NA 2BY9X 2BZ6H 5C20A 1DWCH 1W2KH 1A5GH 1P57B 3A85A 3STIA 2QCYA 1TB6H 4BTTB 3SW2B 1IQEA 1GL1A 3Q00A 1DWDH 2O8LA 1HNEE 1MTWA 2FOHA 3NCLA 4ZKRU 3RXKA 2VJ1A 2BVRH 2TBSA 2G52A 3ATWA 1BTUA 2XW9A 1GJBB 4U01A 1LPZB 3NPSA 4U32A 4DG4A 1W11U 1DY9A 2HLCA 5EQRA 1MQ5A 4X8VH 1D3DB 1GBKA 1GDNA 1T8MA 2UWOA 2VWOA 4K5ZA 1C1QA 3MU4A 1MD8A 4YLQH 4X2VA 2YNBA 1GI1A 1ESAA 2ZHQH 4BXWA 2RCEA 3ITIA 2PV9B 3NKKA 3SJ8A 2FX4A 4YM9A 2PR3A 1GBJA 1DWEH 1PJPA 1J16A 1ANBA 1NU7B 1L1JA 5J4SA 3GICB 1YPLH 1SOTA 4CRGA 3T29A 1ANEA 2J34A 4Z0KA 1O3AA 1TNKA 1QL8A 4DCDA 5DPAA 8LPRA 4AX9H 1DPOA 2O8TA 3NXPA 3PMJA 1BTXA 1PQ5A 1EAWA 1TGCA 1GWAA 1LO6A 1IHSH 3QUMP 1LVMA 1QJ7B 3QGJA 1BTHH 2BM2A 1K2I1 3ZZ8A 4MPWA 1FIZA 3MOCA 1K9OE 1D3TB 2CMYA 3RM2H 4FUIA 3BG4C 2FX6A