2RG3A

Covalent complex structure of elastase
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
218
structure length
217
Chain Sequence
b'IVGGRRARPHAWPFMVSLQLRGGHFCGATLIAPNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVILQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leukocyte elastase
publication title X-ray snapshot of the mechanism of inactivation of human neutrophil elastase by 1,2,5-thiadiazolidin-3-one 1,1-dioxide derivatives.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 39
structure length 217
sequence length 218
ec nomenclature ec 3.4.21.37: Leukocyte elastase.
pdb deposition date 2007-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2rg3A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2rg3A02
4AG1A 3M3TA 3SUFA 3LPRA 1HAYB 2ASUB 4WJG2 3ZZCA 3VB3A 5L2YH 3E90B 1P12E 2ZCLP 1GJ6A 1KDQA 1DDJA 3GCHB 1O3BA 3ZVGA 5GPIB 5A0AE 2CMYA 2P3TB 5FCRA 1NRSH 1BBRH 4ZHMU 2J4IA 5HYOA 1D9IA 1ZTLA 4X1SU 5T6FA 2W7SA 4XBDA 2OCVB 1FXYA 1ANCA 2QY0B 3MNXA 1SPJA 1C4Y2 4IN1A 3SU3A 3T2NA 4NIVA 2FOCA 4MG3A 4Y7AA 3P92A 1SSXA 3ZZDA 3NUMA 5E0JA 3E1XB 1O2HA 2BMGB 1NPMA 5JDUB 4IGDA 1ZPZA 3MYWA 1V2ST 3A89A 4MPXA 4AYVB 1TGNA 4SGBE 2B9LA 2ZFRH 2PKAB 1O3KA 3KEEA 1VR1H 3VGCC 1LCYA 1TMBH 2OBOA 4Y8ZA 3GCTG 1DY9A 1WUNH 3FANA 1P09A 2PFEA 1A61H 1SI5H 1TPSA 3ATIA 3Q00A 1RFNA 3UPEA 1MKWK 1GHAG 2QXGA 1HCGA 4D76A 2Z9KA 3OY6U 3SJKA 1CT2E 1NM6A 4WMEA 2DE9A 1XMNB 3QZQA 4X1RU 5E0GA 1GBLA 3OX7U 1T4VH 3E6PH 1UTMA 3ZVFA 1HPGA 1V3XA 3MOCA 2Y7ZA 3JZ1B 1CBWC 3GY6A 1KLTA 4RKOB 1ZRKA 2B0FA 3S9AA 1GI8B 3NXPA 2EI8A 1F5RA 3SHCH 3BV9B 1HGTH 2TPIZ 4ABBA 1S85A 1TNLA 1E37B 5JBAS 1K9OE 1JMOH 1A3EH 1EJMA 2FIRH 1IQGA 2VH6A 2Q1JA 1L1NA 4O9VA 1A46H 1TFXA 1CA0C 1Y3YA 1INCA 1Z8GA 3SGAE 2A31A 4F4OC 2V3HH 1LKBA 3KN2A 1UTJA 2QYIA 1SOTA 3SNDA 1Y8TA 1DX5M 3A8BA 1MTNB 1QL8A 3P17H 1MBMA 1MKXH 1Z7KA 3A7VA 3ZVCA 1DSUA 3RXSA 2AERH 3LC3A 1BTHH 1C5RA 1EAUA 1O38A 4ZKOU 3A7ZA 4ISLA 3URCA 3QLPH 5CMXH 4FUEA 2W26A 1H9HE 3S7KB 2A2XH 1RXPA 2R2MB 3A80A 1TAWA 3M5MA 2BX3A 3RU4E 1V2RT 1J17T 5FAHA 3FFGA 3EGKH 1LVOA 3T25A 1O3OA 1HV7A 1KTSB 1ANBA 1SVPA 4WXIA 2VIQA 1CHGA 2BY8X 5CE1A 3T27A 1GHVH 3B23B 2F9PA 2C93B 3A81A 3ITIA 4FUGA 6ESTA 1O3PB 1TRMA 1PQ8A 2BB4A 2BLQA 1NZQH 3HPTB 1GCDA 2ZI2H 1YF4A 1BMNH 2IJOB 1RRKA 1GHBF 4K8YA 2A4OA 2GV6A 1C2GA 2FXRA 4WF8A 1C5LH 1UCYH 9ESTA 1AUJA 4X2VA 3LGIA 3NKKA 3RXBA 4KTCA 2AGIX 2HPQH 2FODA 1P2JA 2LPRA 1BTXA 2FI4E 2AEIH 4Y0ZE 1VJ9U 1O2WA 1KDQB 1A4WH 5FPTA 4I33A 3LGVA 3RXFA 4ZKRU 4PROA 1ID5H 4BTUB 4NFEA 4OS5A 3ZZ5A 3ZZAA 1V2TT 3SV9A 1RD3B 2GT8A 3TIUA 2BDGA 2WUCA 4UFDH 1FUJA 2VWNA 1JRTA 2CN0H 3ODDA 4NWLA 2ZFPH 1TNIA 1QHRB 5I25A 1TRYA 2NU1E 1PPHE 3UWJH 1HAIH 3PROA 1FY5A 1S0QA 2FP7B 5AF9H 3MI4A 1G2MA 2ODYB 4CRFA 3L3TA 3O8CA 2A32A 1YYY1 5AVDA 1EP6A 1GJ7B 3LU9B 4D8NA 5C20A 1HBTH 1Z6EA 3SJ8A 2SGAA 4ISHH 1DUEA 4YOIA 1O3LA 1ZGIA 1DUAA 1KXFA 4XBBA 4CR9A 1YPEH 4JZ1A 1GBKA 2BVXH 1YC0A 2PW8H 4ABGA 1PJPA 3SU4A 1O2IA 3DT0H 2NU2E 3GY5A 1GMHG 4OS2A 2FOBA 3TITA 1F92A 2EC9H 2BYAX 2BDIA 3M7QA 5FCKA 1UVSH 3K6YA 3A8DA 1HAVB 1ELVA 1NU9A 2SGFE 1AZ8A 3T62A 2R0LA 2WPIS 1TPAE 2CXVA 3BSQA 2ZHQH 4OS1A 1MQ5A 1KYNA 2ZA5A 4XFQA 4AFZA 2OC0A 3U8OH 3STJA 1GG6B 3RXPA 4UD9H 3NCLA 1HAOH 2ANWA 1LHFH 1L0ZA 4X2YA 2TGPZ 1LDTT 1Q3XA 3M5OA 2FI3E 2FLRH 2W7UA 4FU8A 5EQSA 4JYUH 2KAIA 4CH8B 5EQQA 2UWPA 1IQEA 3BTDE 1GBJA 3LJOA 3AASA 2ZGJA 1P57B 1C2JA 3M61U 2STBE 3RXMA 1DWCH 2XCFA 2WPMS 1ACBE 2M5TA 2J94A 1GI4A 3PM3A 2BD3A 2FPZA 1P02A 2ZC9H 1LPKB 2P8OB 1WQVH 1MCTA 1XUFA 4ISIH 4X6NA 3RXAA 3HK3B 1JIRA 5F8TA 1C2FA 3LGWA 1P2OA 1CO7E 1LHCH 1Y3XA 1CA8B 1Y3VA 3DFJA 2Y5GA 5E8EH 4CRBA 1V2OT 4MPUA 6LPRA 4Y10E 4BAOB 1FDPA 4D7FA 3RU4D 6CHAB 3C27B 3ZYEA 3Q76A 4GLYA 1SLXB 1WBGB 1T8OA 3SI4H 1FAXA 1CU1A 2FOAA 5GCHF 1V2LT 1BUIA 5F03A 1ZGVA 1AY6H 3OY5U 1O36A 1TOMH 1N1LA 1E34B 1GL1A 1ARCA 1GHBG 7ESTE 5A2MH 1P2NA 1VGCB 3KQCA 2O8UA 3TLOA 3P6ZB 1DSTA 3QDZB 1EQ9A 3ZVDA 1GMDF 3OYPA 3TJUA 2QC2A 1SMFE 5A8ZA 1LHGH 3PMJA 4BTTB 1P04A 3SU6A 5H4IB 3PLPA 1AUTC 1F0SA 1GCTC 3A83A 3E8LA 2TBSA 3SQHE 3GCNA 1HAPH 1W0YH 1NO9H 3UY9A 3QGNB 1ZPCA 2ZCKP 1AWHB 1YGCH 1IAUA 1L2EA 2P95A 2SGQE 3EDXB 2J34A 1GBFA 4O97A 1P03A 6GCHF 1SB1H 4UFGH 2A0QB 3R0FA 3PLKA 5FBEA 1BIOA 4K2YA 3KQBA 1AMHA 1T8LA 4ZXYH 5LGOA 2FWWA 1ETRH 2JKHA 2QAAA 4IC6A 1JOUB 4CHAC 2BOKA 2BD4A 2GCHG 1MTVA 3RLYH 1THRH 1MQ6A 1CQQA 1GJAB 1HRTH 3MWIU 2G00A 2ESTE 2CF8H 4UFFH 1XX9A 2GMTB 2ZPSA 5DO4H 1O3GA 1C1VH 2ZTYA 1ZRBA 3SJIA 5FXLA 4KTUA 5LH8A 2SNVA 2FOGA 2ZG0H 4Y7BA 1FI8A 2Z9JA 1KXEA 1GBMA 1B5GH 1DS2E 2V0BA 2WYGA 2B5TB 3K2UA 1XUJA 2O9QA 1TYNA 2WPJS 2HVXA 1GHXH 1GBHA 3BEIB 4CR5A 4ZKSU 3OTJE 3CP7A 4HTCH 2OTVA 1FMGA 1P11E 1O2NA 3A7WA 5DKMA 2PUQH 3MU4A 1G3DA 1KIGH 2EA3A 1KLJH 1WTHD 4X2WA 4ABHA 1LKAA 2JETC 2TRMA 1C4U2 3R3GB 4THNH 1Y3UA 1UVUH 1ESAA 3UNRA 1AQ7A 1DWEH 1NFUA 2HNTC 1BJUA 1TB6H 3RXEA 3I77A 4JMYA 1EPTC 4A7IB 5SGAE 3EA9A 1GBCA 2BD5A 2ZDLA 4X6MA 4IC5A 1C2HA 4DW2U 2Y5HA 1FZZA 4K3JA 1YBWA 2A5AA 5DP9A 1ORFA 1CSOE 3SUEA 1XKAC 1OP8A 4MNVA 1LPGB 3RXIA 1YPMH 1NN6A 2A7JA 1CHOF 4I31A 4WMFA 3A8AA 4CRGA 1GGDB 2GP9B 1HXFH 3M3VA 3A84A 2OC7A 1ZSJA 5TCCA 1D3DB 1O2XA 1SFQB 4AGJA 4B76A 1BDAA 2Z6BD 3PO1C 1NY22 2KAIB 1O3HA 2VVCA 4JK5A 7LPRA 3BTGE 1DY8A 1BTYA 3SJ9A 1W12U 3UTUH 1IQNA 2WPKS 7KMEH 2C8WB 2H1UA 1O2ZA 2CV3A 3D62A 1MZDA 4I8JA 3TPIZ 3SNEA 1GWAA 5JPMH 3TJVA 4CRCA 3Q3KA 2G4UA 1MKWH 4ABIA 4GHTA 3TGKE 3GCOA 1H9LB 2AFQB 1FN8A 1EAIA 2ZU3A 3MNBA 5GCHG 1A0JA 2A4RA 1QFKH 1TA6A 4AX9H 4IBLH 1GI3A 2Z7FE 3TK6A 5IDKA 2IPHA 2PTCE 4MNWA 5I46H 3MU5A 4M7GA 2IOTA 5B6OA 5TCAA 2SGDE 2R9PA 4CREA 3AW1A 1QL9A 1C1OA 1GMDG 4XOJA 4IS5A 1QRWA 1UTKA 4ESTE 1O5CB 1QJ1B 4K8BA 4XDEA 2PLXA 1UTPA 1QL7A 3T28A 2HNTF 1UO6A 3SW2B 4AFQA 1UVPA 2ZHWH 3SUGA 2OLGA 2OXSA 1NRNH 1GBTA 1OX1A 4YZUA 1ELBA 3RXTA 1GMCF 1WYKA 6GCHG 3RC4A 1O3MA 1UTQA 3VFEA 1O3AA 1AZZA 1PPGE 1TIOA 3M7TA 1GJ4H 1SGTA 3S7HB 3F9HA 2P16A 8KME2 1K28D 5HXFA 2R2WU 1FNIA 3AAVA 1GJ5H 5G4BA 2Y82A 4NSYA 1BHXF 2UWLA 3SBKA 1ETTH 1MD8A 1YPHC 3DD2H 1P2QA 4CRDA 1F5LA 4B74A 3LC5A 4DY7B 4WH6A 1XVMA 2A45B 1GI0A 1EZUC 4QT8C 5C5OA 2XRCA 1GHZA 1LVMA 5C1YA 1G3BA 1P2KA 1O2LA 1OKXA 1C2DA 1S84A 2FI5E 2GZ8A 1QCPA 4NFFA 2GDDA 1UTOA 2BY7X 1FJSA 1K1NA 2PGQB 1UK2A 5JBCS 4E05H 1O37A 1O33A 3U98H 4OS4A 1X7AC 1O2YA 4AZ2B 1FIWA 1C2LA 2SGEE 3PV4A 1ESTA 2D2DA 5C5NA 2Z3DA 3D65E 1BJVA 2QGRA 1ZHMA 2PKSB 5DP4A 2WPHS 4E7NA 2GTBA 1SQTA 2J2UA 1BRBE 2HLCA 2QF3A 1PQ7A 5IYTA 1FQ3A 1BMAA 5JB8S 1XXFA 2W3IA 3MNSA 3Q3XA 4X2XA 1AFQB 1NROH 3GDSA 1TLDA 1EOLA 4ZXXH 1KTTB 1S83A 1O3EA 1T8NA 2FOMB 3MNCA 3BTQE 3FVFB 2H5CA 2FS9A 3ZZ7A 5GXPA 3ZVAA 3LGYA 4A1VA 1HAVA 3M35A 1CHOG 4GAWA 1GDUA 1J14A 5GIBA 2J9NA 1T4UH 4CBNA 4HZHA 4Y11E 4DCDA 2Q6DA 5A0CA 3ATLA 3K65B 2NU3E 3SV7A 3U1JB 3RXVA 3DUXH 3GY3A 3Q3YA 1KXDA 4U30A 5AFYH 3RMLH 4FUHA 1GMHF 3MH4A 4K60A 2BVSH 3MU1A 4FU7A 3VXEH 2B7DH 1G3CA 1HIAB 2H9EH 4HGCA 5LPEA 3S0NA 5ESTE 2GD4B 1LO6A 1HXEH 1ZHRA 2C3SA 3SGQE 2QCYA 1DXPA 2UWOA 3MU0A 4KELA 1YM0A 1W8BH 4LZ4B 3FP8E 3M36A 4VGCB 3MTYA 3SU2A 5DP8A 2ZF0H 4B73A 1PYTC 2VVUA 2F83A 4O3TA 4YT7H 2O8WA 3MH5A 2BD9A 1Z1IA 1D6WA 1V6DA 4YTAA 1C5TA 1GHYH 2GDEH 2C8XB 3BTHE 1YCPK 1TGCA 2OQ5A 1BTPA 2TGTA 2HNTE 3F9FA 3MU8A 2BD7A 3A7XA 2TGAA 2ZGCA 1FONA 2CHAC 2XWAA 3RXJA 1SR5C 2O8TA 4GHQA 4BAKB 3S9BA 3TK9A 2ZDVH 4F49A 4AB8A 5EG4A 2A5IA 2VU8E 1OWIA 2F9OA 3EYDA 2XCNA 1K21H 3U1IB 1C9PA 1E38B 3MMGA 1BB0B 3PB1E 3VPKA 1NS3A 2Y80A 2RA3A 1HAHH 3L6PA 4I7YH 1BHXB 4FUIA 2G4TA 1AVXA 1FY3A 1GMCG 1XUGA 4FUDA 3BTTE 4INLA 4ISOA 4OGYA 3HKJB 3GY4A 1UTLM 3ZV8A 1O31A 1ANDA 1GI2A 1ABIH 1GI9B 1FN6A 1AE8H 2JH5D 1HAZB 3UREA 4B2BA 1OSSA 2GV7A 2FTLE 2PGBB 3TH2H 4K1TA 4LK4A 4YLQH 1T32A 3RXQA 1NRPH 1A1RA 3K9XB 3PYHA 1QNJA 1ZZZA 5FPSA 1E0FD 1AB9C 1NFYA 2AMQA 1UMAH 3LKWA 4ZMAH 3C1KA 2ZWLH 4D9RA 1PPBH 3RXCA 4B71A 4TWYA 5K0HA 1QQUA 1A2CH 3UQOA 1S6HA 2V6NA 3E0PB 1UVTH 1K2I1 3V12A 3MH7A 1CGJE 3RU4T 2FYRA 2VVVA 3QK1A 3STIA 4MQAA 1C2MA 1B0EA 2ANKH 5DK1A 3P8GA 2NU4E 1D3PB 2R3UA 3BF6H 5L6NH 2AGGX 4ABFA 2PR3A 1N6XA 4YOJA 2ODPA 3UNSA 2G51A 1N8OC 1LPZB 4AFUA 3EA7A 3B9FH 5F8ZA 1F7ZA 3LOXA 1TQ7B 3UWIA 4ZHLU 2HALA 2VGCB 4TWWA 2W5EA 1P01A 2VWMA 2ZHDA 5EODA 2A7CA 4WVPE 3BEFB 4X8VH 4DURA 2CF9H 1F0TA 4NWKA 1GBAA 3M5NA 2GCHF 4J2YB 3SU5A 4I32A 4I8LA 2GGVB 2Z9GA 1RIWC 2ALPA 2ZDNA 1O3CA 3QN7A 3BG4C 3RXKA 1YPHE 2FX4A 2ZFQH 1F0UA 1ZYOA 1PPFE 3UOPA 1O2SA 2HRVA 3O8DA 2PHBA 3EQ0H 2FOEA 4NIWA 3GY8A 1F2SE 4Q2KA 1HJAC 1G9IE 1O2PA 1P06A 1EB2A 2QA9E 3QO6A 2BY6X 5LPRA 2EEKA 5EXNA 1TA2A 1AVWA 2Z94A 1DLEA 2A4GA 3PMBB 1DITH 2HWLB 2QF0A 3LGTA 3NWUA 4JCNA 3ZZ4A 4LXBH 3V0XA 5C1XA 1IQFA 3ATWA 1P8VC 1UK4A 3VB4A 1Z1JA 2RG3A 3A88A 4FUFA 1DE7H 2FX6A 4R0IA 1TGSZ 2K1QA 4RN6A 1YPKH 1SGIB 3V13A 4BAMB 1B7XB 1SQAA 4DG4A 3K6ZA 1K22H 4GCHG 2QXIA 5CHAC 1DT2A 1TQ0B 1PPZA 1BRAA 4FU9A 2VNTA 1O35A 2G55A 2ZU2A 1C5VA 2ZZUH 1D3TB 4Q80A 1W13U 1BRUP 2Y5FA 3VGCB 2Z9IA 1E36B 1GDQA 1LMWB 3ENSB 4K5ZA 3ZV9A 1WV7H 4A6LA 4Q7YA 2GCTC 1XUHA 2XXLA 1Z8JB 4R8TB 2G8TA 4OS6A 2AMPA 1LHDH 1TGTA 1F0RA 1LVYA 2ZFTA 1O5EH 1J16A 1KSNA 1BCUH 3RDZA 3A8CA 2WINI 4X8UH 1GL0E 1O2KA 5A0BA 1S5SA 5A09A 3HGPA 4X8TH 4K1EA 2I6QA 3M5LA 1CBWB 1UHBB 2XYAA 3TH3H 4AOQA 8GCHF 1IQHA 1BA8B 2VINA 3URDA 1VCQA 2C8ZB 4JYVH 4UONA 3ATMA 1OYQA 3F9EA 4KTSA 3RM2H 7GCHF 4AYYB 2XW9A 2CJIA 1BOQA 1TOCB 1C1RA 4I8GA 3SOSA 2ULLA 3ZZ9A 3KNXA 1CA0B 1O3IA 1QA7A 2NWNA 2G52A 3PTBA 1THSH 5F6MA 1ZSLA 3H5CB 2H9HA 3SV8A 3GCHC 3I29A 1AVGH 3GY2A 1SGQE 1SLVB 2BX4A 2Y6TA 3O8BA 1D6RA 2P59A 4ZAEA 2F9BH 4Q7ZA 2PTNA 3BN9A 1PPCE 4UFEH 1J9CH 2PSYA 2FZZA 3RP2A 2FEQH 2FM2A 3E91A 2BXUH 3ATKA 3MO9A 1ZOMA 4LOYH 4ABEA 3LDXH 1ZHPA 1CGIE 1CT0E 2J95A 1J15A 2ZGHA 2SNWA 3RXUA 1GI6A 1O5FH 2C90B 5E0HA 5AFZH 3RXHA 1C1PA 5LPFA 1K1JA 1VZQH 1C2IA 3KIDU 4U2WA 5DGJA 2BZ6H 5T3HA 1DANH 1MUEB 2ZO3H 2A1DB 1ELCA 1GVZA 1OP2A 5EXMA 1V2JT 2VH0A 5EOKA 3TVJB 3A82A 2AS9A 1C5OH 1JIMA 1BTUA 1EKBB 3PLBA 1H9IE 1TWXB 2ZTXA 1AE5A 1SOZA 3SV6A 1OYTH 3P8OA 1VITH 1EAXA 5ABWA 1AO5A 1IQKA 1DFPA 4Z0KA 1O2JA 1SGFG 2JH6D 3U69H 1GJ8B 4KP0A 2VIPA 2ZKSA 5EGMA 1FY1A 1HLTH 1GVLA 2FLBH 4WY3A 1FV9A 4INHA 5C2ZA 4FXGH 4RSPA 1FY4A 4FVBA 2PSXA 3KL6A 3TK5A 3VXFH 2BLVA 1AD8H 3SU0A 3TGIE 3FZDA 2EI7A 3O8RA 4E06H 3A85A 1EJNA 2LNCA 1V2WT 2XTTB 3F6UH 4CBOA 2Z3CA 3LH1A 2FDAA 2OQUA 1V2MT 1KY9A 3BG8A 1W10U 1O39A 3PWCA 2ZPQA 2D1JA 2GZ7A 2XBWA 4MLFB 5FBIA 2JH0D 4Y6DA 1C5MD 2VWLA 3E16B 1TNKA 1C5QA 1JWTA 2ZP0H 1HIAA 3DA9B 3RLWH 4ISNA 1O0DH 3RXLA 3FAOA 5T6DA 3F1SB 1QJ7B 4YESB 1ZMNA 1MTNC 3BTME 1GVKB 5EW2H 5JBTA 2ZHFH 3ESTA 5HMAA 4FUCA 1N6YA 4D9QA 3KCGH 4BANB 2OC1A 1RGQA 4NG9H 1P3EA 1O30A 1H4WA 1W2KH 3ZVEA 3RXDA 5HGGA 4IMQA 1TALA 2D8WA 1NESE 1EPTA 1SGDE 2P94A 2B8OH 3UNQA 2VIVA 3L33A 2GT7A 3F9GA 8GCHG 3RC6A 3FZZA 5GWZA 7GCHG 2BTCE 3NZIA 1EOJA 4B75A 2BQWB 4KKDA 3SU1A 5ESBA 1S6FA 4K69A 4YLUA 4FUBA 1K1IA 5J4QA 5HM9A 4GPGA 1AIXH 2H6MA 1BMMH 1T7CA 1ZMLA 4RKJB 2F9UA 1A5GH 3EAJA 3VB5A 2RDLA 1L4ZA 4FUJA 1XM1A 2AGEX 1SGRE 1ELDE 3VB6A 5K7RA 3EE0B 2ZPRA 1BT7A 2BDAA 2H9TH 2OBQA 3IITA 3DFLA 1CT4E 2ALVA 2QV1A 3BIUH 1AI8H 2BHGA 4Y8YA 1ESBA 2FESH 2DUCA 2XC4A 4YOGA 3QWCH 3A86A 1OWHA 5C67A 5EW1H 3Q77A 1EX3A 4X1QU 4BTIB 1IQIA 2BZAA 1HAXB 3CS7A 4BXSA 1NRQH 1YCPH 2W3KA 3ZYDA 3P8FA 4JZFH 1YPGH 4NIXA 1UK3A 1K1LA 4O3UA 1V2UT 1V2VT 2BXTH 4MDSA 1THPB 3PWBA 3SNAA 4CRAA 3A87A 4X6OA 4DOQA 1TRNA 3GY7A 3OSYA 4TPYA 1W7XH 1SGPE 3IG6B 2UUYA 1QY6A 1SG8B 2ZFFH 1AKSB 1T8MA 4INKA 2BQ7B 1FIZA 3SJOA 3S69A 1O2QA 1PFXC 1NC6A 1CVWH 3ZZ6A 1G36A 3V3MA 3BTFE 1NRRH 1Z71A 4GSOA 3RMNH 1ELGA 2ZGBH 3GDVA 3TNSA 2GZ9A 1LVBA 1O2TA 1T31A 3V7TA 5JYIA 2P3FH 1O3DA 5E2OA 2QXJA 5J4SA 1GCTB 3H7OA 2WUBA 2BY5X 3SHAH 4HFPB 1G32B 3LIWA 1QURH 2BD2A 1D3QB 1A5HA 1MTSA 2ZU5A 1YLDA 1TABE 1TBZH 1O3JA 3LH3A 2XWBI 1TMUH 1PQ5A 1ZMJA 5PTPA 1RS0A 2ZFSA 3ZZBA 1ZPBA 1BBRE 4NZLA 5A8XA 1YKTA 2PUXB 4OS7A 4CHAB 1EZSC 1BRCE 1H8DH 1GG6C 1OP0A 3HKIB 1IOEA 2TIOA 5L30H 1AGJA 4SGAE 3M7UA 3PTNA 5HM2A 1FPHH 3JZ2B 3TJOA 1CE5A 3GICB 2YOLA 3I78A 3MFJA 4WH8A 1V2PT 3SV2H 1G2LA 1GJCB 1ELTA 1V2QT 2P8OC 3GDUA 1Y3WA 1QR3E 4BXWA 1BMLA 3D23A 3TJNA 2FS8A 3N7OA 1GJBB 3UOUA 3QUMP 1WAYB 1EB1H 1Y59T 3ODFA 2ZNKH 1HDTH 1DICA 2AIPA 5JBBS 1C5YB 4GCHF 3SI3H 2VB0A 5ETXA 2JETB 8ESTE 1O5BB 1O3FA 3GISB 2WPLS 2R0KA 6CHAC 1O2UA 1EPTB 1MMJN 4GVUA 5DP3A 5TJXA 1EASA 2BDCA 2Z9LA 5DJ7A 1L1GA 5FX6A 4YO9A 4ASHA 2OD3B 2HGTH 4A1TA 1HJ8A 4Y79A 1P05A 2Q6GA 5EXLA 3KHVA 1UHBA 3W94A 3P95A 1EZXC 3S9CA 2GX4A 3LJJA 1VGCC 4WXVA 4B2CA 3UQVA 4IN2A 5GDSH 1VCPA 1A0LA 2WYJA 1DWDH 4BNRA 4DJZB 2FMJA 2FYQA 2J92A 1Z6JH 2BD8A 3BTEE 3PO1B 1QBNA 1QBOA 1MBQA 1P2IA 9LPRA 3SUDA 1WTGH 1UJ1A 1Z8RA 1SGNE 1WU1A 3IWMA 2ODQA 4TYDA 3A7TA 1BBRK 3MHWU 1P9SA 1GBDA 2GVFA 2XBVA 1Y5BT 1C1TA 1QRZA 3P70B 2EI6A 3W95A 1QBVH 2DE8A 4KGAA 1IQJA 2AH4X 2ZQ2A 4H6TA 2XC0A 4UDWH 2PWXA 3FP6E 4X1PU 3QGJA 2GMTC 3SNBA 4AFSA 3G01A 1TBQH 4A5TS 4X8SH 2Z3EA 1MAYA 2G5VA 1RTKA 2ZCHP 1V2KT 2UUJB 2OC8A 3NK8A 1MTWA 3GYMA 4YM9A 1SL3A 1TX8A 1EATA 3BEUA 1W3CA 3FP7E 1VJAU 2SGPE 1O2MA 3EA8A 1WSSH 2F9VA 1SHHB 2H2ZA 2F3CE 1RJXB 2OINA 1O32A 1FAKH 2WV4A 2I6SA 1U6QA 4DVAU 3TGJE 3UFAA 1Z8IB 4X1NU 1SGFA 2ZU1A 4WMDA 1RTLA 4Z6AH 5DP5A 4ABJA 1O3NA 2V35A 4I8KA 4AN7A 1C1UH 5FX5A 1UCYE 1GI7B 1L1JA 3HGNA 1C1NA 2FO9A 1ARBA 1W0ZU 1W11U 4E7RG 4TY7A 1CGHA 4Y0YE 1O2VA 1S0RA 4TY6A 1LTOA 1DLKB 3SNCA 1MAXA 1C1SA 1NU7B 3RMMH 4ZROA 1K1OA 3NPSA 1FPCH 2ANYA 1GBIA 4X6PA 3H7TA 1DWBH 3LT3A 4Y8XA 1C5PA 1S81A 3P8NA 1GGDC 1TBRH 3SGBE 1BTWA 1EUFA 3T26A 2QIQA 1HNEE 1Q2WA 3CENA 1EP5A 1LQEA 3AW0A 4UEHH 2FOHA 4ZUHA 1MKXK 4U32A 1C1MA 1TPOA 3ELAH 1QA0A 3RM0H 1JXPA 2AMDA 1XXDA 1G37A 2AIQA 1C5WB 3RXOA 1DOJA 1LQDB 3QTOH 3SO3A 5C1UA 5DPAA 2BLOA 1ZTKA 1S82A 2ILNA 5GJ4B 1ZJDA 1G30B 4K1SA 2VIWA 3SN8A 1GJDB 3KQDA 2ZEBA 1DPOA 1XUKA 2UUFB 1QB1A 1XUIA 1K1PA 1P10A 4JYTA 3RXRA 4DIHH 1TNHA 1O2RA 1AFEH 4O03A 2BQ6B 2NU0E 1PPEE 1C1QA 1A3BH 1FY8E 5DP6A 2BY9X 1O5AB 1VITF 1OXGA 5T6GA 2ZGXH 3ZZ3A 1SBWA 1VCWA 4MTBA 1ZTJA 1BQYA 1IQLA 4OGXA 2VWOA 1DM4B 2O8LA 5F8XA 1YP9A 4YT6H 5EU8A 2AYWA 2Y81A 1UCYK 3F68H 5DG6A 1C5UA 2QN5T 1SLWB 1Y5AT 2HOBA 1A5IA 1ELAA 3WY8A 1FLEE 2A2QH 4Y71A 1HB0B 1HYLA 1YCPM 1L4DA 2VJ1A 1XVOA 1QIXB 2CHAB 1TX7A 1QRXA 1BZXE 1MH0A 3CS0A 1ELEE 4AGKA 5EPNA 4ZKNU 2P93A 1UVOA 1ABJH 4H6SB 1TX6A 1C9TA 1QGFA 2VIOA 1PQAA 4AB9A 1C1WH 2XBXA 2FOFA 5EPYA 1G3EA 3GOVB 1HFDA 5EQRA 1QTFA 1E35B 1O5DH 2ZTZA 3RMOH 1QJ6B 4MNXA 1AKSA 3UUZA 1C5XB 1NTPA 2P3UB 1O2GH 3M37A 1C5ZB 2V3OH 4B1TA 2ZDKA 2PKSC 1NT1A 3GYLB 3DHKH 1O34A 1SC8U 1YLCA 2BOHB 1QB9A 3KGPA 1NFWA 1TGBA 1EZQA 3BTKE 1WQSA 2BM2A 2OP9A 1LHEH 3BIVH 3QX5H 1AFQC 3RC5A 3RUOA 3SQEE 1TNGA 1TNJA 2TGDA 5L2ZH 2ZDAH 1TPPA 1ZJKA 4I8HA 1GDNA 2OUAA 3OU0A 1AB9B 2H5DA 2A4QA 1DXWA 4BAHB 1HJ9A 3TU7H 4NCYA 1OWDA 1IHTH 4IMZA 1AWFH 4GUXA 2QXHA 2PV9B 4HI3A 2CGAA 5BRRE 4H4FA 2ZIQH 1SQOA 1Q31A 1ETSH 1SLUB 1KXBA 2XNIA 1P2MA 4XBCA 4DIIH 1TMTH 2F91A 1J8AA 4JK6A 2ZU4A 3T5FH 4NZQA 5JB9S 2FTMA 1AU8A 4FVDA 3KQEA 1N8OB 2PKAA 3TH4H 1MD7A 4X0WU 4DT7B 1OWJA 1SGYE 3E0NB 1P3CA 2C8YB 4UE7H 4VGCC 4D7GA 3ZZ8A 1WCZA 1Y5UT 3D49H 3RXGA 1MCVA 3SZNA 3PMHB 4LZ1H 2O8MA 2BVRH 1SFIA 1ANEA 3LGUA 2WV5A 3AAUA 4DGJA 1AHTH 3U8RH 4J1YA 2XC5A 1KLIH 1TE0A 8LPRA 1RIWB 2C4FH 1EJAA 1RTFB 3BG4B 1O2OA 3MO3A 1BTZA 1JBUH 3QTVH 2J38A 4AORA 1ZLRA 2HPPH 1W7GH 2A5KA 3GCTF 1ELFA 1DVAH 1BITA 3AVZA 3MH6A 1H8IH 4H42U 1C2KA 1A0HB 4MPVA 4NIYA 1GHAF 3UIRA 1HJAB 4JZIA 1SGEE 3VEQB 1VITG 1WOFA 4B2AA 2BDBA 2VIDA 1HUTH 2BLWA 1A7SA 2ANMH 1M9UA 2YNAA 3TNTA 1SHYA 1MZAA 2F9NA 1QQ4A 3PMAB 2BDYA 2UUKB 4TPIZ 1C5SA 3KF2A 1QB6A 4MPWA 1YPLH 2G81E 2GKVE 1H1BA 2Y7XA 1KXCA 1GBEA 4XSKU 1C2EA 4MVNA 5E2PA 2ZQ1A 5FHTA 2Q6FA 3T29A 1W14U 4NA9H 1GI5A 1OOKB 4U01A 4ABAA 5CHAB 1UTNA 1PYTD 1XKBC 2BDHA 4BOHA 1NFXA 4ABDA 1OS8A 1P9UA 2SFAA 4MNYA 1AN1E 3QZRA 1IQMA 2IN2A 1F5KU 1O5GH 1OWEA 3B8JA 1KXAA 1GJ9B 3E3TA 4AG2A 1IHSH 2GCTB 1TONA 3ZVBA 5BPEA 1SGCA 1B0FA 4IW4E 5DP7A 1C5NH 2STAE 4JZEH 3LONA 4ZH8A 5C3NA 4NA7A 1OWKA 3U8TH 3UR9A 2D26C 4BAQB 4CH2B 3HK6B 3UR6A 4A1XA 1HAGE 1GI1A 5A8YA 1GBBA 3HATH 2ZHEH 4A92A 1EXFA 1ZSKA 3SORA 2G5NA 2VGCC 3VB7A 2A7HA 1C4V2 1V2NT 2THFB 1D4PB 1MTUA 2XBYA 4WWYA 5AHGH 4Q7XA 3A7YA 1MU6B 1P0SH 3M3SA 5FPYA 4ZHAA 1MU8B 1JRSA 2ZDMA 1EAWA 1OPHB 3U9AH 2RA0A 1GHWH 1YPJH 2R3YA 2RCEA 4NSVA 2ZECA 4NGAH 4XE4A 1ZR0A 3BTWE 4NA8A 1GPZA 4Y76A 3MO6A 1K1MA 2YNBA 4JZDH
chains in the Genus database with same CATH superfamily
4AG1A 3M3TA 3SUFA 3LPRA 1HAYB 2LP6A 2ASUB 4WJG2 3ZZCA 3VB3A 5L2YH 3E90B 1P12E 4B6FA 2ZCLP 1GJ6A 1KDQA 1DDJA 3GCHB 1O3BA 3ZVGA 5GPIB 5A0AE 2CMYA 2P3TB 5FCRA 1NRSH 1BBRH 4ZHMU 3F2HA 2J4IA 5HYOA 1D9IA 1ZTLA 4X1SU 5T6FA 2W7SA 4XBDA 2OCVB 1FXYA 2V3MA 1ANCA 2QY0B 3MNXA 1SPJA 1C4Y2 4IN1A 3SU3A 3T2NA 4NIVA 2FOCA 4MG3A 4Y7AA 3P92A 1SSXA 3DSGA 3ZZDA 3NUMA 2W6ID 5E0JA 3E1XB 1O2HA 2BMGB 3FN8A 1NPMA 5JDUB 4IGDA 1ZPZA 3MYWA 1V2ST 3A89A 4MPXA 4AYVB 1TGNA 4SGBE 2B9LA 2ZFRH 2PKAB 1O3KA 3KEEA 1VR1H 1EFRD 3VGCC 1LCYA 1TMBH 2OBOA 4Y8ZA 3GCTG 1DY9A 1WUNH 3FANA 1P09A 2PFEA 1A61H 1SI5H 1TPSA 3ATIA 3Q00A 1RFNA 3UPEA 1MKWK 1GHAG 2QXGA 2KCOA 1HCGA 4D76A 2Z9KA 3OY6U 3SJKA 3OEED 1CT2E 1NM6A 1W0KD 4WMEA 2DE9A 1XMNB 3QZQA 4X1RU 2KCAA 5E0GA 1GBLA 3OX7U 1T4VH 3E6PH 2JDID 1UTMA 3ZVFA 1HPGA 1V3XA 3MOCA 2Y7ZA 3JZ1B 1CBWC 3GY6A 1KLTA 4RKOB 1ZRKA 2B0FA 3S9AA 1GI8B 3NXPA 2EI8A 1F5RA 3SHCH 3BV9B 1HGTH 2TPIZ 4ABBA 1S85A 1TNLA 1E37B 5JBAS 1K9OE 1JMOH 1A3EH 1EJMA 2FIRH 1IQGA 2VH6A 2Q1JA 3UAIC 1L1NA 4O9VA 1A46H 1TFXA 4AC9A 1CA0C 1Y3YA 1INCA 1Z8GA 3SGAE 2A31A 4F4OC 2V3HH 1LKBA 3KN2A 1UTJA 2QYIA 1SOTA 3SNDA 1Y8TA 1DX5M 3A8BA 1MTNB 1QL8A 3P17H 1MBMA 3F0OA 1MKXH 1Z7KA 3A7VA 3ZVCA 1DSUA 3RXSA 2AERH 3LC3A 1BTHH 2WZQA 1C5RA 1EAUA 5DN6D 5FL7D 1O38A 4ZKOU 3A7ZA 3OE7D 4ISLA 3URCA 3QLPH 5CMXH 4FUEA 2W26A 1H9HE 3S7KB 2A2XH 1RXPA 2R2MB 3A80A 1TAWA 3M5MA 2BX3A 3RU4E 1V2RT 1J17T 5FAHA 3FFGA 3EGKH 1LVOA 3T25A 1O3OA 1HV7A 1KTSB 1ANBA 1SVPA 4WXIA 2VIQA 1CHGA 2BY8X 1BMFD 5CE1A 3T27A 1GHVH 3B23B 2F9PA 2C93B 3A81A 3ITIA 4FUGA 6ESTA 1O3PB 1TRMA 1PQ8A 2BB4A 2BLQA 1NZQH 3HPTB 1GCDA 2ZI2H 1YF4A 1BMNH 2IJOB 1RRKA 3F2FA 1GHBF 3DSOA 4K8YA 2A4OA 2GV6A 1C2GA 2FXRA 5C17A 1UW7A 4WF8A 1C5LH 1NBMD 1UCYH 9ESTA 1AUJA 4X2VA 3LGIA 3NKKA 3RXBA 4KTCA 2AGIX 2HPQH 2FODA 1P2JA 2LPRA 1BTXA 2FI4E 2AEIH 4Y0ZE 1VJ9U 1O2WA 1KDQB 1A4WH 2HLDD 5FPTA 4I33A 3LGVA 3RXFA 4ZKRU 4PROA 1ID5H 4BTUB 4NFEA 4OS5A 3ZZ5A 3ZZAA 1V2TT 3SV9A 1RD3B 2GT8A 3TIUA 2BDGA 2WUCA 4UFDH 1FUJA 2VWNA 1JRTA 2CN0H 3ODDA 4NWLA 2ZFPH 1TNIA 1QHRB 5I25A 1TRYA 2NU1E 1PPHE 3UWJH 1HAIH 3PROA 1FY5A 1S0QA 2FP7B 2IJD1 5AF9H 3MI4A 1G2MA 2ODYB 4CRFA 3L3TA 3O8CA 2A32A 1YYY1 5AVDA 1EP6A 1GJ7B 3LU9B 4D8NA 5C20A 1HBTH 1MABB 1Z6EA 3SJ8A 2SGAA 4ISHH 1DUEA 4YOIA 1O3LA 1ZGIA 1DUAA 1KXFA 4XBBA 4CR9A 1YPEH 4JZ1A 1GBKA 2BVXH 1YC0A 2PW8H 4ABGA 1PJPA 3SU4A 1O2IA 3DT0H 2NU2E 3GY5A 1GMHG 4OS2A 2FOBA 3TITA 1F92A 2EC9H 2BYAX 2BDIA 3M7QA 5FCKA 1YLNA 5C94A 1UVSH 3K6YA 3A8DA 1HAVB 1ELVA 1NU9A 2SGFE 1AZ8A 3T62A 2R0LA 2WPIS 1TPAE 2CXVA 3BSQA 2ZHQH 4OS1A 1MQ5A 1KYNA 2ZA5A 4XFQA 4AFZA 2OC0A 3U8OH 3STJA 1GG6B 3RXPA 4UD9H 3NCLA 1HAOH 2ANWA 1LHFH 1L0ZA 4X2YA 2TGPZ 1LDTT 1Q3XA 3M5OA 2FI3E 2FLRH 2W7UA 4FU8A 5EQSA 4JYUH 2KAIA 4CH8B 5EQQA 2UWPA 1IQEA 3BTDE 1GBJA 3LJOA 3AASA 2ZGJA 1P57B 1C2JA 3M61U 2STBE 3RXMA 1DWCH 2XCFA 2WPMS 1ACBE 2KCPA 2M5TA 2J94A 1GI4A 3PM3A 2BD3A 2FPZA 1P02A 2ZC9H 1LPKB 2P8OB 1WQVH 1MCTA 1XUFA 4ISIH 4X6NA 3RXAA 3HK3B 1JIRA 5F8TA 1C2FA 3LGWA 1P2OA 1CO7E 1LHCH 1Y3XA 1CA8B 1Y3VA 3DFJA 2Y5GA 5E8EH 4CRBA 1V2OT 4MPUA 6LPRA 4Y10E 4BAOB 1FDPA 4D7FA 3RU4D 6CHAB 3C27B 3ZYEA 2YMSB 3Q76A 1SLXB 1WBGB 4GLYA 4P02A 1T8OA 3SI4H 1FAXA 1CU1A 2FOAA 5GCHF 1V2LT 1BUIA 5F03A 1ZGVA 1AY6H 3OY5U 1O36A 1TOMH 1N1LA 1E34B 1GL1A 1ARCA 1GHBG 7ESTE 5A2MH 5IK2D 1P2NA 1VGCB 3KQCA 2O8UA 3TLOA 3P6ZB 1DSTA 3QDZB 1EQ9A 3ZVDA 1GMDF 3OYPA 3TJUA 2QC2A 1SMFE 5A8ZA 1LHGH 3PMJA 4BTTB 1P04A 3SU6A 5H4IB 3PLPA 1AUTC 1F0SA 1GCTC 3A83A 3E8LA 2TBSA 3SQHE 3WWFA 2KX4A 3GCNA 1HAPH 1W0YH 1NO9H 3UY9A 4F48B 3QGNB 1ZPCA 2ZCKP 1AWHB 1YGCH 1IAUA 1L2EA 2P95A 2SGQE 3EDXB 2J34A 1GBFA 4O97A 1P03A 6GCHF 1SB1H 4UFGH 2A0QB 3R0FA 3PLKA 5FBEA 1BIOA 4K2YA 3KQBA 1AMHA 1T8LA 4ZXYH 5LGOA 2FWWA 1ETRH 2JKHA 2QAAA 4IC6A 1JOUB 4CHAC 2BOKA 2BD4A 2WHXA 2GCHG 3UB0A 1MTVA 3RLYH 1THRH 1MQ6A 1CQQA 1GJAB 1HRTH 3MWIU 2G00A 2ESTE 5HIYA 2CF8H 4UFFH 1XX9A 2GMTB 2ZPSA 5DO4H 1O3GA 1C1VH 2ZTYA 1ZRBA 3SJIA 5FXLA 4KTUA 5LH8A 2SNVA 2FOGA 2ZG0H 4Y7BA 1FI8A 2VBCA 2Z9JA 1KXEA 1GBMA 1B5GH 1DS2E 2V0BA 2WYGA 2B5TB 3K2UA 1XUJA 2O9QA 1TYNA 2WPJS 2HVXA 1GHXH 1GBHA 3BEIB 4CR5A 4ZKSU 3OTJE 3CP7A 4HTCH 2OTVA 1FMGA 1P11E 1O2NA 3A7WA 5DKMA 2PUQH 3MU4A 1G3DA 1KIGH 2EA3A 1KLJH 1WTHD 4X2WA 4ABHA 1LKAA 2JETC 2TRMA 1C4U2 3R3GB 4THNH 1Y3UA 1UVUH 1ESAA 3UNRA 1AQ7A 1DWEH 1NFUA 2HNTC 1BJUA 1TB6H 3RXEA 1H8ED 3I77A 4JMYA 1EPTC 4A7IB 5SGAE 3EA9A 1GBCA 2BD5A 2ZDLA 4X6MA 4IC5A 1C2HA 4DW2U 2Y5HA 1FZZA 4K3JA 1YBWA 2A5AA 5DP9A 1ORFA 1CSOE 3SUEA 1XKAC 1OP8A 4MNVA 1LPGB 3RXIA 1YPMH 1NN6A 2RFKC 2A7JA 1CHOF 4I31A 4WMFA 3A8AA 4CRGA 1WXRA 1GGDB 2GP9B 1HXFH 3M3VA 3A84A 2OC7A 1ZSJA 5TCCA 1D3DB 1O2XA 1SFQB 4AGJA 5C0UA 4B76A 1BDAA 2Z6BD 3PO1C 1FX0B 1NY22 2KAIB 1O3HA 2VVCA 4JK5A 7LPRA 3BTGE 1DY8A 1BTYA 3SJ9A 2JJ2D 1W12U 3UTUH 1IQNA 2WPKS 7KMEH 2C8WB 2H1UA 1O2ZA 2CV3A 3D62A 1MZDA 4I8JA 3TPIZ 3SNEA 1GWAA 1E79D 5JPMH 3TJVA 4CRCA 3Q3KA 2G4UA 1MKWH 3PV5A 4GHTA 4ABIA 3TGKE 3GCOA 1H9LB 2AFQB 1FN8A 1EAIA 2ZU3A 3MNBA 5GCHG 1A0JA 2A4RA 1QFKH 1TA6A 4AX9H 4IBLH 2XOKD 1GI3A 2Z7FE 2YMSD 3TK6A 5IDKA 2IPHA 2PTCE 4MNWA 5I46H 3MU5A 4M7GA 2IOTA 5B6OA 5TCAA 2SGDE 2R9PA 4CREA 5HKKD 3AW1A 1QL9A 1C1OA 1GMDG 4XOJA 4IS5A 1QRWA 1UTKA 4ESTE 1O5CB 1QJ1B 4K8BA 4XDEA 2PLXA 1UTPA 1QL7A 4OM9A 3T28A 2HNTF 5EJLA 1UO6A 3SW2B 4AFQA 1UVPA 2ZHWH 3SUGA 2OLGA 2OXSA 1NRNH 1GBTA 1OX1A 4YZUA 1ELBA 3RXTA 1GMCF 3FO8D 1WYKA 6GCHG 3RC4A 1O3MA 1UTQA 3VFEA 1O3AA 1AZZA 1PPGE 1TIOA 3M7TA 1GJ4H 1SGTA 3S7HB 2GJGA 3F9HA 2P16A 4RI0A 3OEHD 8KME2 1K28D 5HXFA 2R2WU 1FNIA 3AAVA 1GJ5H 5G4BA 2Y82A 4NSYA 1BHXF 2UWLA 3SBKA 1ETTH 1MD8A 1YPHC 3DD2H 1P2QA 4CRDA 4RT0A 1F5LA 4B74A 3LC5A 4DY7B 4WH6A 1XVMA 2A45B 1GI0A 3N99A 4ACBA 1EZUC 4QT8C 5C5OA 2XRCA 1GHZA 1LVMA 5C1YA 2F4LA 1G3BA 5C0TA 1P2KA 1O2LA 1OKXA 1C2DA 1S84A 2FI5E 2GZ8A 1QCPA 4NFFA 2GDDA 1UTOA 2BY7X 1FJSA 1K1NA 2PGQB 1UK2A 5JBCS 4E05H 1O37A 1O33A 2WPDD 3U98H 4OS4A 1X7AC 1O2YA 4AZ2B 1FIWA 1C2LA 2SGEE 3PV4A 1ESTA 2D2DA 5C5NA 2Z3DA 3D65E 1BJVA 2QGRA 1ZHMA 2PKSB 5DP4A 2WPHS 4E7NA 2GTBA 1SQTA 2J2UA 1BRBE 2HLCA 2QF3A 1PQ7A 2CK3D 5IYTA 1FQ3A 1BMAA 5JB8S 1XXFA 2W3IA 3MNSA 3Q3XA 4X2XA 1AFQB 1NROH 3GDSA 1TLDA 4ACAA 1EOLA 4ZXXH 1KTTB 1S83A 1WDIA 1O3EA 1T8NA 2FOMB 3MNCA 3BTQE 4XD7D 4F55A 3FVFB 2H5CA 2FS9A 3ZZ7A 5GXPA 3ZVAA 3LGYA 4A1VA 1HAVA 3M35A 1CHOG 4GAWA 1GDUA 1J14A 5GIBA 2J9NA 1T4UH 4CBNA 4HZHA 4Y11E 4DCDA 2Q6DA 5A0CA 3ATLA 3K65B 2NU3E 4FOUC 3SV7A 3U1JB 3RXVA 3DUXH 3GY3A 3Q3YA 1KXDA 4U30A 5AFYH 3RMLH 4FUHA 1GMHF 1SKYE 3MH4A 4K60A 2BVSH 3MU1A 4FU7A 3VXEH 2B7DH 1G3CA 1HIAB 2H9EH 4HGCA 5LPEA 3S0NA 5ESTE 2GD4B 1LO6A 1HXEH 1ZHRA 2C3SA 3SGQE 2QCYA 1DXPA 2UWOA 3MU0A 4KELA 1YM0A 1W8BH 4LZ4B 3FP8E 3M36A 4VGCB 3MTYA 3SU2A 5DP8A 2ZF0H 4B73A 1PYTC 2VVUA 2F83A 4O3TA 4YT7H 2O8WA 3MH5A 2BD9A 1Z1IA 4M9FA 1D6WA 1V6DA 4YTAA 1C5TA 1GHYH 2GDEH 2C8XB 3BTHE 1YCPK 1TGCA 2OQ5A 1BTPA 2TGTA 2J98B 2HNTE 3F9FA 3MU8A 2BD7A 3A7XA 2TGAA 2ZGCA 1FONA 2CHAC 2XWAA 3RXJA 1SR5C 2QE7D 2O8TA 4GHQA 4BAKB 3S9BA 3TK9A 2ZDVH 4F49A 4AB8A 5EG4A 2A5IA 1QZ8A 2VU8E 1OWIA 2F9OA 3EYDA 2XCNA 1K21H 3U1IB 1C9PA 1E38B 3MMGA 1BB0B 3PB1E 3VPKA 1NS3A 1SQRA 2Y80A 2RA3A 4DT4A 1HAHH 3L6PA 4I7YH 1BHXB 4FUIA 2G4TA 1AVXA 1FY3A 1GMCG 1XUGA 4FUDA 3BTTE 4INLA 4ISOA 4OGYA 3HKJB 3GY4A 1UTLM 3ZV8A 1O31A 1ANDA 1GI2A 1ABIH 5CDFE 1GI9B 1FN6A 1AE8H 2JH5D 1W0JD 1HAZB 3UREA 4B2BA 1OSSA 2GV7A 2FTLE 2PGBB 3TH2H 4K1TA 2RDEA 4LK4A 4YLQH 1T32A 3RXQA 1NRPH 1A1RA 3K9XB 3PYHA 1QNJA 1ZZZA 5FPSA 1E0FD 1AB9C 1NFYA 2AMQA 1UMAH 3LKWA 4ZMAH 3C1KA 2ZWLH 4D9RA 1PPBH 3RXCA 4B71A 4TWYA 5K0HA 1QQUA 1A2CH 3UQOA 1S6HA 2V6NA 3E0PB 1UVTH 3KYFA 1K2I1 3V12A 3MH7A 1CGJE 3RU4T 2FYRA 2VVVA 3QK1A 3STIA 4MQAA 4Q4LA 1C2MA 1B0EA 2ANKH 5DK1A 3P8GA 2NU4E 1D3PB 2R3UA 3BF6H 5L6NH 3ZIAD 2AGGX 4ABFA 2PR3A 1N6XA 4YOJA 2ODPA 3UNSA 2G51A 1N8OC 1LPZB 4AFUA 3EA7A 3B9FH 5F8ZA 1F7ZA 3LOXA 1VKYA 1TQ7B 3UWIA 4ZHLU 2HALA 2VGCB 4TWWA 2W5EA 4ZCNA 1P01A 2VWMA 2ZHDA 5EODA 2A7CA 2V7QD 4WVPE 3BEFB 4X8VH 4DURA 2CF9H 1F0TA 4NWKA 1GBAA 3M5NA 2GCHF 4J2YB 3SU5A 4I32A 4I8LA 2GGVB 2Z9GA 1RIWC 2ALPA 2ZDNA 1O3CA 3QN7A 3BG4C 3RXKA 1YPHE 2FX4A 2ZFQH 1F0UA 1ZYOA 1PPFE 3UOPA 1O2SA 2HRVA 3O8DA 2PHBA 3EQ0H 2FOEA 4NIWA 3GY8A 1F2SE 4Q2KA 1HJAC 1G9IE 1O2PA 1P06A 1EB2A 5GNDA 2QA9E 3QO6A 2BY6X 5EJZA 5LPRA 2EEKA 5EXNA 1TA2A 1AVWA 2Z94A 1DLEA 2A4GA 3PMBB 1DITH 2HWLB 2QF0A 3LGTA 3NWUA 4JCNA 3ZZ4A 4LXBH 3V0XA 5C1XA 1IQFA 3ATWA 1P8VC 1UK4A 3VB4A 1Z1JA 2RG3A 3A88A 4FUFA 1DE7H 3H09A 2FX6A 4R0IA 1TGSZ 2K1QA 4RN6A 1YPKH 1SGIB 3V13A 4BAMB 1B7XB 1SQAA 4DG4A 3K6ZA 1K22H 4GCHG 2QXIA 5CHAC 1DT2A 1TQ0B 1PPZA 1BRAA 4FU9A 2VNTA 1O35A 2G55A 2ZU2A 1C5VA 2ZZUH 1D3TB 4Q80A 1W13U 1BRUP 2Y5FA 3SZEA 3VGCB 2Z9IA 1E36B 1GDQA 4HG6A 1LMWB 3ENSB 3FKSD 4K5ZA 3ZV9A 1WV7H 2W6JD 4A6LA 4Q7YA 2GCTC 1XUHA 2XXLA 1Z8JB 4R8TB 2G8TA 4OS6A 2AMPA 1LHDH 1TGTA 1F0RA 3W1EA 1LVYA 2ZFTA 1O5EH 1J16A 3F3BA 1KSNA 1BCUH 3RDZA 3A8CA 2WINI 4X8UH 1GL0E 1O2KA 5A0BA 1S5SA 5A09A 3HGPA 3PV2A 4X8TH 4K1EA 2I6QA 3M5LA 1COWD 1CBWB 1UHBB 2XYAA 3TH3H 4AOQA 8GCHF 1IQHA 1BA8B 2VINA 3URDA 1VCQA 2C8ZB 4JYVH 4UONA 3ATMA 1OYQA 3F9EA 4KTSA 3RM2H 7GCHF 4AYYB 2XW9A 2CJIA 1BOQA 1TOCB 1C1RA 4I8GA 3SOSA 1E1QD 2ULLA 3ZZ9A 3KNXA 1CA0B 1O3IA 2KZ4A 1QA7A 2NWNA 5T1VA 2G52A 3PTBA 1THSH 5F6MA 1ZSLA 3H5CB 2H9HA 3SV8A 3GCHC 3I29A 1AVGH 3GY2A 1SGQE 1SLVB 2BX4A 3VG8A 2Y6TA 3O8BA 1D6RA 2P59A 4ZAEA 2F9BH 4Q7ZA 2AHME 2PTNA 3BN9A 1PPCE 4UFEH 1J9CH 2PSYA 2FZZA 3RP2A 2FEQH 2FM2A 3E91A 2BXUH 3ATKA 3MO9A 1ZOMA 4LOYH 4ABEA 2L74A 3LDXH 1ZHPA 1CGIE 1CT0E 2J95A 1J15A 2ZGHA 2SNWA 3RXUA 1GI6A 1O5FH 2C90B 5E0HA 5AFZH 3RXHA 1C1PA 5LPFA 1K1JA 4ASUD 1VZQH 1C2IA 3KIDU 4U2WA 5DGJA 2BZ6H 5T3HA 1DANH 1MUEB 2ZO3H 2A1DB 1ELCA 1GVZA 1OP2A 5EXMA 1V2JT 2VH0A 5EOKA 3TVJB 3A82A 2AS9A 1C5OH 1JIMA 1BTUA 1EKBB 3PLBA 1H9IE 1TWXB 2ZTXA 1AE5A 5DSFA 1SOZA 3FOAA 3SV6A 1OYTH 3P8OA 1VITH 1EAXA 3F2GA 5ABWA 1AO5A 1IQKA 1DFPA 4Z0KA 1O2JA 1SGFG 2JH6D 3OFND 3U69H 1GJ8B 4KP0A 2VIPA 2ZKSA 5EGMA 1FY1A 1HLTH 1GVLA 2FLBH 4WY3A 1FV9A 4INHA 5C2ZA 4FXGH 4RSPA 1FY4A 4FVBA 2PSXA 3KL6A 3TK5A 3VXFH 2BLVA 1AD8H 3MQKC 3SU0A 3TGIE 3FZDA 2EI7A 3O8RA 4E06H 3A85A 1EJNA 2LNCA 1V2WT 2XTTB 3F6UH 4CBOA 2Z3CA 3LH1A 2FDAA 2OQUA 1V2MT 1KY9A 3BG8A 1W10U 1O39A 3PWCA 2ZPQA 2D1JA 2GZ7A 2XBWA 4MLFB 5FBIA 2JH0D 4XRNA 4Y6DA 1C5MD 2VWLA 3E16B 1TNKA 1C5QA 1JWTA 2ZP0H 1HIAA 3DA9B 3RLWH 4ISNA 1O0DH 3RXLA 3FAOA 5T6DA 3F1SB 1QJ7B 4YESB 1ZMNA 1MTNC 3BTME 1GVKB 5EW2H 5JBTA 2ZHFH 3ESTA 5HMAA 4FUCA 1N6YA 4D9QA 3KCGH 4BANB 2OC1A 2JJ1D 1RGQA 4NG9H 1P3EA 1O30A 1H4WA 1W2KH 5EJ1A 2J98A 3ZVEA 3RXDA 5HGGA 4IMQA 1TALA 2D8WA 1NESE 1EPTA 1SGDE 1OHHD 2B8OH 2P94A 3UNQA 2VIVA 5CHBA 3L33A 2GT7A 3F9GA 8GCHG 3RC6A 3FZZA 5GWZA 7GCHG 2BTCE 3NZIA 1EOJA 4B75A 2BQWB 4KKDA 3SU1A 5ESBA 1S6FA 4K69A 4YLUA 4FUBA 1K1IA 5J4QA 5HM9A 4GPGA 1AIXH 2K0QA 2H6MA 1BMMH 1T7CA 1ZMLA 4RKJB 2F9UA 1A5GH 3EAJA 3VB5A 2RDLA 1L4ZA 4FUJA 1XM1A 2AGEX 1SGRE 1ELDE 3VB6A 5K7RA 3EE0B 2ZPRA 1BT7A 2BDAA 2H9TH 2OBQA 3IITA 3DFLA 1CT4E 2ALVA 2QV1A 3BIUH 1AI8H 2BHGA 4Y8YA 1ESBA 2FESH 2DUCA 2XC4A 4YOGA 3QWCH 3A86A 1OWHA 5C67A 5EW1H 3Q77A 1EX3A 4X1QU 4BTIB 1IQIA 2BZAA 1HAXB 3CS7A 4BXSA 1NRQH 1YCPH 2W3KA 3ZYDA 3P8FA 4JZFH 1YPGH 4NIXA 1UK3A 1K1LA 4O3UA 1V2UT 1V2VT 2BXTH 4MDSA 1THPB 3PWBA 3SNAA 3WWBA 3A87A 4CRAA 4X6OA 4DOQA 1TRNA 2J97A 3GY7A 3OSYA 4TPYA 1W7XH 1SGPE 3IG6B 2UUYA 1QY6A 1SG8B 2ZFFH 1AKSB 1T8MA 4INKA 2BQ7B 1FIZA 3SJOA 3S69A 2OK5A 1O2QA 1PFXC 1NC6A 1CVWH 1NBME 1G36A 3V3MA 3ZZ6A 3BTFE 1NRRH 1Z71A 4GSOA 3RMNH 1ELGA 2ZGBH 3GDVA 3TNSA 2GZ9A 1LVBA 1O2TA 1T31A 3V7TA 5JYIA 2P3FH 1O3DA 5E2OA 2QXJA 5J4SA 1GCTB 3H7OA 2WUBA 2BY5X 4I86A 3SHAH 2M2AA 4HFPB 1G32B 2KM0A 3LIWA 1QURH 2PP6A 2BD2A 1D3QB 1A5HA 1MTSA 2ZU5A 1YLDA 1TABE 1TBZH 1O3JA 3LH3A 2XWBI 1TMUH 1PQ5A 1ZMJA 5PTPA 1RS0A 2ZFSA 3ZZBA 1ZPBA 1BBRE 4NZLA 5A8XA 2QF5A 1YKTA 2PUXB 4OS7A 4CHAB 1EZSC 1BRCE 3SYJA 1H8DH 1GG6C 1OP0A 3HKIB 1IOEA 2TIOA 5L30H 1AGJA 4SGAE 3M7UA 3PTNA 5HM2A 1FPHH 3JZ2B 3TJOA 1CE5A 3CNRA 3GICB 2YOLA 3I78A 3MFJA 4WH8A 1V2PT 3SV2H 1G2LA 1GJCB 1ELTA 1V2QT 2P8OC 3DSPA 1Y3WA 3GDUA 1QR3E 4BXWA 1BMLA 3D23A 3TJNA 2FS8A 3N7OA 1GJBB 3UOUA 3QUMP 4RT1A 1WAYB 1EB1H 1Y59T 3ODFA 2ZNKH 1HDTH 1DICA 2AIPA 5JBBS 1C5YB 4GCHF 3SI3H 2VB0A 5ETXA 2JETB 3F0PA 8ESTE 1O5BB 1O3FA 3GISB 2WPLS 2R0KA 6CHAC 1O2UA 1EPTB 1MMJN 4GVUA 5DP3A 5TJXA 1EASA 2BDCA 2YMSC 2Z9LA 5DJ7A 1L1GA 5FX6A 4YO9A 4ASHA 2OD3B 2HGTH 2IPQX 4A1TA 1HJ8A 4TSFD 4Y79A 1P05A 2Q6GA 5EXLA 3KHVA 1UHBA 3W94A 3P95A 1EZXC 3S9CA 2GX4A 3LJJA 1VGCC 4WXVA 4B2CA 3UQVA 4IN2A 5GDSH 1VCPA 1A0LA 2WYJA 1DWDH 4BNRA 4DJZB 2JIZD 2FMJA 2FYQA 2J92A 1Z6JH 3PRDA 2BD8A 3BTEE 3PO1B 1QBNA 1QBOA 3WW7A 1MBQA 1P2IA 9LPRA 3SUDA 1WTGH 1UJ1A 1E1RD 1Z8RA 1SGNE 1WU1A 3IWMA 2ODQA 4TYDA 3A7TA 1BBRK 3MHWU 1P9SA 1GBDA 2GVFA 2XBVA 1Y5BT 1C1TA 1QRZA 3P70B 2EI6A 3W95A 1QBVH 2DE8A 4KGAA 1IQJA 2AH4X 2ZQ2A 3U28C 4H6TA 2XC0A 4UDWH 2PWXA 3FP6E 4X1PU 3QGJA 2GMTC 3SNBA 4AFSA 3G01A 1TBQH 4A5TS 4X8SH 2Z3EA 1MAYA 2G5VA 1RTKA 2ZCHP 1V2KT 2UUJB 2OC8A 3NK8A 1MTWA 3GYMA 4YM9A 4P00A 1SL3A 5F53A 1TX8A 1EATA 3BEUA 1W3CA 3FP7E 1VJAU 2SGPE 1O2MA 2XNDD 3EA8A 1WSSH 2F9VA 3OAAD 1SHHB 2H2ZA 2F3CE 1RJXB 2OINA 1O32A 1FAKH 2WV4A 2I6SA 1U6QA 4DVAU 3TGJE 3UFAA 1Z8IB 4B6EA 4X1NU 1SGFA 2ZU1A 4WMDA 1RTLA 3PRBA 4Z6AH 5DP5A 4ABJA 1O3NA 2V35A 4I8KA 4AN7A 1C1UH 3N7DA 5FX5A 1UCYE 1GI7B 1L1JA 3HGNA 1C1NA 2FO9A 1ARBA 2WSSD 1W0ZU 1W11U 4E7RG 4TY7A 1CGHA 4Y0YE 1O2VA 1S0RA 4TY6A 1LTOA 1DLKB 3SNCA 1MAXA 1C1SA 4TT3D 1NU7B 3RMMH 4ZROA 1K1OA 3NPSA 1FPCH 2ANYA 1GBIA 4X6PA 3H7TA 1DWBH 3LT3A 4Y8XA 1C5PA 1S81A 3P8NA 1GGDC 1TBRH 3SGBE 1BTWA 1EUFA 3T26A 2QIQA 1HNEE 1Q2WA 3CENA 1EP5A 1LQEA 3AW0A 4UEHH 2FOHA 4ZUHA 1MKXK 4U32A 1C1MA 1TPOA 3ELAH 1QA0A 3RM0H 1JXPA 2AMDA 1XXDA 1G37A 3AK5A 2AIQA 1C5WB 3RXOA 1DOJA 1LQDB 5B6LA 3QTOH 3SO3A 5C1UA 5DPAA 5HIZA 2BLOA 1ZTKA 1S82A 2ILNA 5GJ4B 1ZJDA 1G30B 4K1SA 2VIWA 3SN8A 1GJDB 3KQDA 2ZEBA 1DPOA 1XUKA 2UUFB 1QB1A 1XUIA 1K1PA 2WV9A 3OTPA 1P10A 4JYTA 3RXRA 4DIHH 1TNHA 2L6OA 1O2RA 1AFEH 4O03A 2BQ6B 1PPEE 2NU0E 1C1QA 1A3BH 1FY8E 5DP6A 2BY9X 1O5AB 1VITF 1OXGA 5T6GA 2ZGXH 3GS9A 3ZZ3A 1SBWA 1VCWA 4MTBA 1ZTJA 1BQYA 1IQLA 4OGXA 2VWOA 1DM4B 2O8LA 5F8XA 1YP9A 4YT6H 5EU8A 2AYWA 2Y81A 1UCYK 3F68H 5DG6A 1C5UA 2QN5T 1SLWB 1Y5AT 2HOBA 1A5IA 1ELAA 3DCLA 3WY8A 1FLEE 2A2QH 4Y71A 1HB0B 1HYLA 1YCPM 1L4DA 2VJ1A 1XVOA 5KEDA 1QIXB 2CHAB 1TX7A 1QRXA 1BZXE 1MH0A 3CS0A 1ELEE 4AGKA 5EPNA 4ZKNU 4FETA 2P93A 1UVOA 1ABJH 4H6SB 1TX6A 1C9TA 1QGFA 2VIOA 1PQAA 5KGOA 4AB9A 1C1WH 2XBXA 2FOFA 5EPYA 1G3EA 3GOVB 1KMHB 1HFDA 5EQRA 1QTFA 5KECA 1E35B 1O5DH 2ZTZA 3RMOH 1QJ6B 4MNXA 2LELA 1AKSA 3UUZA 1C5XB 1NTPA 2QF4A 2P3UB 1O2GH 3M37A 1C5ZB 2V3OH 4B1TA 2ZDKA 2PKSC 1NT1A 3GYLB 3DHKH 1O34A 1SC8U 1YLCA 2BOHB 1QB9A 1H8HD 3KGPA 1NFWA 1TGBA 1EZQA 3BTKE 1WQSA 2BM2A 2OP9A 1LHEH 3BIVH 3QX5H 1AFQC 3RC5A 3RUOA 3SQEE 1TNGA 1TNJA 2TGDA 5L2ZH 2ZDAH 5EIYA 1TPPA 1ZJKA 4I8HA 1GDNA 2OUAA 3OU0A 1AB9B 2H5DA 2A4QA 1DXWA 4BAHB 1HJ9A 3TU7H 4NCYA 1OWDA 1IHTH 4IMZA 1AWFH 4GUXA 2QXHA 2PV9B 4HI3A 2KCYA 2CGAA 5BRRE 4H4FA 2ZIQH 1SQOA 1YY3A 2HVYB 1Q31A 1ETSH 1SLUB 1KXBA 2XNIA 1P2MA 4XBCA 4DIIH 1TMTH 2F91A 1J8AA 4JK6A 2ZU4A 3T5FH 4NZQA 5JB9S 2FTMA 1AU8A 4FVDA 3KQEA 1N8OB 2K8IA 2PKAA 3TH4H 4Q63A 1MD7A 4X0WU 4DT7B 1OWJA 1SGYE 3E0NB 1P3CA 2C8YB 4UE7H 4VGCC 4D7GA 1K0HA 3ZZ8A 1WCZA 1Y5UT 3D49H 3EE7A 3RXGA 1MCVA 3SZNA 3PMHB 2J5UA 2O8MA 4LZ1H 2BVRH 1SFIA 1ANEA 3LGUA 2WV5A 3AAUA 4DGJA 1AHTH 3KYGA 3U8RH 4J1YA 2XC5A 1KLIH 1TE0A 8LPRA 1RIWB 2C4FH 1EJAA 1YWUA 2F43B 1RTFB 3BG4B 1O2OA 3MO3A 2KR7A 1BTZA 1JBUH 3QTVH 2J38A 2KFWA 1ZLRA 2HPPH 1W7GH 2A5KA 4AORA 3GCTF 1ELFA 1DVAH 1BITA 1S6LA 3AVZA 3MH6A 1H8IH 4H42U 1C2KA 1A0HB 4MPVA 4NIYA 1GHAF 3UIRA 1HJAB 4JZIA 1SGEE 3VEQB 1VITG 1WOFA 4B2AA 2BDBA 2VIDA 1HUTH 2BLWA 1A7SA 2ANMH 1M9UA 2YNAA 3TNTA 1SHYA 1MZAA 2F9NA 1QQ4A 3PMAB 2BDYA 2UUKB 4TPIZ 1C5SA 3KF2A 3NRLA 1QB6A 4MPWA 1YPLH 2G81E 2GKVE 1H1BA 2Y7XA 1KXCA 1GBEA 4XSKU 1C2EA 4MVNA 5E2PA 2ZQ1A 5FHTA 2Q6FA 3T29A 1W14U 4NA9H 1GI5A 1OOKB 4U01A 4ABAA 5CHAB 1UTNA 1PYTD 1XKBC 2BDHA 4BOHA 1NFXA 4ABDA 1OS8A 1P9UA 2SFAA 4MNYA 1AN1E 3QZRA 1IQMA 2IN2A 1F5KU 1O5GH 1OWEA 3B8JA 1KXAA 1GJ9B 3E3TA 4AG2A 1IHSH 2GCTB 1TONA 3ZVBA 5BPEA 1SGCA 1B0FA 3KQ5A 3N7EA 4IW4E 5DP7A 4YXWD 1C5NH 2STAE 4JZEH 3LONA 4ZH8A 5C3NA 4NA7A 1OWKA 3U8TH 3UR9A 4Z1MD 2D26C 4BAQB 4CH2B 3HK6B 3UR6A 4A1XA 1HAGE 1GI1A 5A8YA 1GBBA 2EY4C 2ZHEH 3HATH 4A92A 1EXFA 1ZSKA 3SORA 2G5NA 2VGCC 3VB7A 2EQNA 2A7HA 1C4V2 1V2NT 2THFB 1D4PB 1MTUA 2XBYA 4WWYA 5AHGH 4Q7XA 3A7YA 1MU6B 1P0SH 3M3SA 5FPYA 4ZHAA 1MU8B 1JRSA 2ZDMA 1EAWA 1OPHB 3U9AH 2RA0A 1GHWH 1YPJH 2R3YA 2RCEA 4NSVA 2ZECA 4NGAH 4XE4A 1ZR0A 3BTWE 4NA8A 1GPZA 4Y76A 3MO6A 1K1MA 2YNBA 4JZDH
chains in the Genus database with same CATH topology
4AG1A 3M3TA 3SUFA 3LPRA 1HAYB 2ASUB 4WJG2 3ZZCA 3VB3A 5L2YH 3E90B 1P12E 2ZCLP 1GJ6A 1KDQA 1DDJA 3GCHB 1O3BA 3ZVGA 5GPIB 5A0AE 2CMYA 2P3TB 5FCRA 1NRSH 1BBRH 4ZHMU 2J4IA 5HYOA 1D9IA 1ZTLA 4X1SU 5T6FA 2W7SA 4XBDA 2OCVB 1FXYA 1ANCA 2QY0B 3MNXA 1SPJA 1C4Y2 4IN1A 3SU3A 3T2NA 4NIVA 2FOCA 4MG3A 4Y7AA 3P92A 1SSXA 3ZZDA 3NUMA 5E0JA 3E1XB 1O2HA 2BMGB 1NPMA 5JDUB 4IGDA 1ZPZA 3MYWA 1V2ST 3A89A 4MPXA 4AYVB 1TGNA 4SGBE 2B9LA 2ZFRH 2PKAB 1O3KA 3KEEA 1VR1H 3VGCC 1LCYA 1TMBH 2OBOA 4Y8ZA 3GCTG 1DY9A 1WUNH 3FANA 1P09A 2PFEA 1A61H 1SI5H 1TPSA 3ATIA 3Q00A 1RFNA 3UPEA 1MKWK 1GHAG 2QXGA 1HCGA 4D76A 2Z9KA 3OY6U 3SJKA 1CT2E 1NM6A 4WMEA 2DE9A 1XMNB 3QZQA 4X1RU 5E0GA 1GBLA 3OX7U 1T4VH 3E6PH 1UTMA 3ZVFA 1HPGA 1V3XA 3MOCA 2Y7ZA 3JZ1B 1CBWC 3GY6A 1KLTA 4RKOB 1ZRKA 2B0FA 3S9AA 1GI8B 3NXPA 2EI8A 1F5RA 3SHCH 3BV9B 1HGTH 2TPIZ 4ABBA 1S85A 1TNLA 1E37B 5JBAS 1K9OE 1JMOH 1A3EH 1EJMA 2FIRH 1IQGA 2VH6A 2Q1JA 1L1NA 4O9VA 1A46H 1TFXA 1CA0C 1Y3YA 1INCA 1Z8GA 3SGAE 2A31A 4F4OC 2V3HH 1LKBA 3KN2A 1UTJA 2QYIA 1SOTA 3SNDA 1Y8TA 1DX5M 3A8BA 1MTNB 1QL8A 3P17H 1MBMA 1MKXH 1Z7KA 3A7VA 3ZVCA 1DSUA 3RXSA 2AERH 3LC3A 1BTHH 1C5RA 1EAUA 1O38A 4ZKOU 3A7ZA 4ISLA 3URCA 3QLPH 5CMXH 4FUEA 2W26A 1H9HE 3S7KB 2A2XH 1RXPA 2R2MB 3A80A 1TAWA 3M5MA 2BX3A 3RU4E 1V2RT 1J17T 5FAHA 3FFGA 3EGKH 1LVOA 3T25A 1O3OA 1HV7A 1KTSB 1ANBA 1SVPA 4WXIA 2VIQA 1CHGA 2BY8X 5CE1A 3T27A 1GHVH 3B23B 2F9PA 2C93B 3A81A 3ITIA 4FUGA 6ESTA 1O3PB 1TRMA 1PQ8A 2BB4A 2BLQA 1NZQH 3HPTB 1GCDA 2ZI2H 1YF4A 1BMNH 2IJOB 1RRKA 1GHBF 4K8YA 2A4OA 2GV6A 1C2GA 2FXRA 4WF8A 1C5LH 1UCYH 9ESTA 1AUJA 4X2VA 3LGIA 3NKKA 3RXBA 4KTCA 2AGIX 2HPQH 2FODA 1P2JA 2LPRA 1BTXA 2FI4E 2AEIH 4Y0ZE 1VJ9U 1O2WA 1KDQB 1A4WH 5FPTA 4I33A 3LGVA 3RXFA 4ZKRU 4PROA 1ID5H 4BTUB 4NFEA 4OS5A 3ZZ5A 3ZZAA 1V2TT 3SV9A 1RD3B 2GT8A 3TIUA 2BDGA 2WUCA 4UFDH 1FUJA 2VWNA 1JRTA 2CN0H 3ODDA 4NWLA 2ZFPH 1TNIA 1QHRB 5I25A 1TRYA 2NU1E 1PPHE 3UWJH 1HAIH 3PROA 1FY5A 1S0QA 2FP7B 5AF9H 3MI4A 1G2MA 2ODYB 4CRFA 3L3TA 3O8CA 2A32A 1YYY1 5AVDA 1EP6A 1GJ7B 3LU9B 4D8NA 5C20A 1HBTH 1Z6EA 3SJ8A 2SGAA 4ISHH 1DUEA 4YOIA 1O3LA 1ZGIA 1DUAA 1KXFA 4XBBA 4CR9A 1YPEH 4JZ1A 1GBKA 2BVXH 1YC0A 2PW8H 4ABGA 1PJPA 3SU4A 1O2IA 3DT0H 2NU2E 3GY5A 1GMHG 4OS2A 2FOBA 3TITA 1F92A 2EC9H 2BYAX 2BDIA 3M7QA 5FCKA 1UVSH 3K6YA 3A8DA 1HAVB 1ELVA 1NU9A 2SGFE 1AZ8A 3T62A 2R0LA 2WPIS 1TPAE 2CXVA 3BSQA 2ZHQH 4OS1A 1MQ5A 1KYNA 2ZA5A 4XFQA 4AFZA 2OC0A 3U8OH 3STJA 1GG6B 3RXPA 4UD9H 3NCLA 1HAOH 2ANWA 1LHFH 1L0ZA 4X2YA 2TGPZ 1LDTT 1Q3XA 3M5OA 2FI3E 2FLRH 2W7UA 4FU8A 5EQSA 4JYUH 2KAIA 4CH8B 5EQQA 2UWPA 1IQEA 3BTDE 1GBJA 3LJOA 3AASA 2ZGJA 1P57B 1C2JA 3M61U 2STBE 3RXMA 1DWCH 2XCFA 2WPMS 1ACBE 2M5TA 2J94A 1GI4A 3PM3A 2BD3A 2FPZA 1P02A 2ZC9H 1LPKB 2P8OB 1WQVH 1MCTA 1XUFA 4ISIH 4X6NA 3RXAA 3HK3B 1JIRA 5F8TA 1C2FA 3LGWA 1P2OA 1CO7E 1LHCH 1Y3XA 1CA8B 1Y3VA 3DFJA 2Y5GA 5E8EH 4CRBA 1V2OT 4MPUA 6LPRA 4Y10E 4BAOB 1FDPA 4D7FA 3RU4D 6CHAB 3C27B 3ZYEA 3Q76A 4GLYA 1SLXB 1WBGB 1T8OA 3SI4H 1FAXA 1CU1A 2FOAA 5GCHF 1V2LT 1BUIA 5F03A 1ZGVA 1AY6H 3OY5U 1O36A 1TOMH 1N1LA 1E34B 1GL1A 1ARCA 1GHBG 7ESTE 5A2MH 1P2NA 1VGCB 3KQCA 2O8UA 3TLOA 3P6ZB 1DSTA 3QDZB 1EQ9A 3ZVDA 1GMDF 3OYPA 3TJUA 2QC2A 1SMFE 5A8ZA 1LHGH 3PMJA 4BTTB 1P04A 3SU6A 5H4IB 3PLPA 1AUTC 1F0SA 1GCTC 3A83A 3E8LA 2TBSA 3SQHE 3GCNA 1HAPH 1W0YH 1NO9H 3UY9A 3QGNB 1ZPCA 2ZCKP 1AWHB 1YGCH 1IAUA 1L2EA 2P95A 2SGQE 3EDXB 2J34A 1GBFA 4O97A 1P03A 6GCHF 1SB1H 4UFGH 2A0QB 3R0FA 3PLKA 5FBEA 1BIOA 4K2YA 3KQBA 1AMHA 1T8LA 4ZXYH 5LGOA 2FWWA 1ETRH 2JKHA 2QAAA 4IC6A 1JOUB 4CHAC 2BOKA 2BD4A 2GCHG 1MTVA 3RLYH 1THRH 1MQ6A 1CQQA 1GJAB 1HRTH 3MWIU 2G00A 2ESTE 2CF8H 4UFFH 1XX9A 2GMTB 2ZPSA 5DO4H 1O3GA 1C1VH 2ZTYA 1ZRBA 3SJIA 5FXLA 4KTUA 5LH8A 2SNVA 2FOGA 2ZG0H 4Y7BA 1FI8A 2Z9JA 1KXEA 1GBMA 1B5GH 1DS2E 2V0BA 2WYGA 2B5TB 3K2UA 1XUJA 2O9QA 1TYNA 2WPJS 2HVXA 1GHXH 1GBHA 3BEIB 4CR5A 4ZKSU 3OTJE 3CP7A 4HTCH 2OTVA 1FMGA 1P11E 1O2NA 3A7WA 5DKMA 2PUQH 3MU4A 1G3DA 1KIGH 2EA3A 1KLJH 1WTHD 4X2WA 4ABHA 1LKAA 2JETC 2TRMA 1C4U2 3R3GB 4THNH 1Y3UA 1UVUH 1ESAA 3UNRA 1AQ7A 1DWEH 1NFUA 2HNTC 1BJUA 1TB6H 3RXEA 3I77A 4JMYA 1EPTC 4A7IB 5SGAE 3EA9A 1GBCA 2BD5A 2ZDLA 4X6MA 4IC5A 1C2HA 4DW2U 2Y5HA 1FZZA 4K3JA 1YBWA 2A5AA 5DP9A 1ORFA 1CSOE 3SUEA 1XKAC 1OP8A 4MNVA 1LPGB 3RXIA 1YPMH 1NN6A 2A7JA 1CHOF 4I31A 4WMFA 3A8AA 4CRGA 1GGDB 2GP9B 1HXFH 3M3VA 3A84A 2OC7A 1ZSJA 5TCCA 1D3DB 1O2XA 1SFQB 4AGJA 4B76A 1BDAA 2Z6BD 3PO1C 1NY22 2KAIB 1O3HA 2VVCA 4JK5A 7LPRA 3BTGE 1DY8A 1BTYA 3SJ9A 1W12U 3UTUH 1IQNA 2WPKS 7KMEH 2C8WB 2H1UA 1O2ZA 2CV3A 3D62A 1MZDA 4I8JA 3TPIZ 3SNEA 1GWAA 5JPMH 3TJVA 4CRCA 3Q3KA 2G4UA 1MKWH 4ABIA 4GHTA 3TGKE 3GCOA 1H9LB 2AFQB 1FN8A 1EAIA 2ZU3A 3MNBA 5GCHG 1A0JA 2A4RA 1QFKH 1TA6A 4AX9H 4IBLH 1GI3A 2Z7FE 3TK6A 5IDKA 2IPHA 2PTCE 4MNWA 5I46H 3MU5A 4M7GA 2IOTA 5B6OA 5TCAA 2SGDE 2R9PA 4CREA 3AW1A 1QL9A 1C1OA 1GMDG 4XOJA 4IS5A 1QRWA 1UTKA 4ESTE 1O5CB 1QJ1B 4K8BA 4XDEA 2PLXA 1UTPA 1QL7A 3T28A 2HNTF 1UO6A 3SW2B 4AFQA 1UVPA 2ZHWH 3SUGA 2OLGA 2OXSA 1NRNH 1GBTA 1OX1A 4YZUA 1ELBA 3RXTA 1GMCF 1WYKA 6GCHG 3RC4A 1O3MA 1UTQA 3VFEA 1O3AA 1AZZA 1PPGE 1TIOA 3M7TA 1GJ4H 1SGTA 3S7HB 3F9HA 2P16A 8KME2 1K28D 5HXFA 2R2WU 1FNIA 3AAVA 1GJ5H 5G4BA 2Y82A 4NSYA 1BHXF 2UWLA 3SBKA 1ETTH 1MD8A 1YPHC 3DD2H 1P2QA 4CRDA 1F5LA 4B74A 3LC5A 4DY7B 4WH6A 1XVMA 2A45B 1GI0A 1EZUC 4QT8C 5C5OA 2XRCA 1GHZA 1LVMA 5C1YA 1G3BA 1P2KA 1O2LA 1OKXA 1C2DA 1S84A 2FI5E 2GZ8A 1QCPA 4NFFA 2GDDA 1UTOA 2BY7X 1FJSA 1K1NA 2PGQB 1UK2A 5JBCS 4E05H 1O37A 1O33A 3U98H 4OS4A 1X7AC 1O2YA 4AZ2B 1FIWA 1C2LA 2SGEE 3PV4A 1ESTA 2D2DA 5C5NA 2Z3DA 3D65E 1BJVA 2QGRA 1ZHMA 2PKSB 5DP4A 2WPHS 4E7NA 2GTBA 1SQTA 2J2UA 1BRBE 2HLCA 2QF3A 1PQ7A 5IYTA 1FQ3A 1BMAA 5JB8S 1XXFA 2W3IA 3MNSA 3Q3XA 4X2XA 1AFQB 1NROH 3GDSA 1TLDA 1EOLA 4ZXXH 1KTTB 1S83A 1O3EA 1T8NA 2FOMB 3MNCA 3BTQE 3FVFB 2H5CA 2FS9A 3ZZ7A 5GXPA 3ZVAA 3LGYA 4A1VA 1HAVA 3M35A 1CHOG 4GAWA 1GDUA 1J14A 5GIBA 2J9NA 1T4UH 4CBNA 4HZHA 4Y11E 4DCDA 2Q6DA 5A0CA 3ATLA 3K65B 2NU3E 3SV7A 3U1JB 3RXVA 3DUXH 3GY3A 3Q3YA 1KXDA 4U30A 5AFYH 3RMLH 4FUHA 1GMHF 3MH4A 4K60A 2BVSH 3MU1A 4FU7A 3VXEH 2B7DH 1G3CA 1HIAB 2H9EH 4HGCA 5LPEA 3S0NA 5ESTE 2GD4B 1LO6A 1HXEH 1ZHRA 2C3SA 3SGQE 2QCYA 1DXPA 2UWOA 3MU0A 4KELA 1YM0A 1W8BH 4LZ4B 3FP8E 3M36A 4VGCB 3MTYA 3SU2A 5DP8A 2ZF0H 4B73A 1PYTC 2VVUA 2F83A 4O3TA 4YT7H 2O8WA 3MH5A 2BD9A 1Z1IA 1D6WA 1V6DA 4YTAA 1C5TA 1GHYH 2GDEH 2C8XB 3BTHE 1YCPK 1TGCA 2OQ5A 1BTPA 2TGTA 2HNTE 3F9FA 3MU8A 2BD7A 3A7XA 2TGAA 2ZGCA 1FONA 2CHAC 2XWAA 3RXJA 1SR5C 2O8TA 4GHQA 4BAKB 3S9BA 3TK9A 2ZDVH 4F49A 4AB8A 5EG4A 2A5IA 2VU8E 1OWIA 2F9OA 3EYDA 2XCNA 1K21H 3U1IB 1C9PA 1E38B 3MMGA 1BB0B 3PB1E 3VPKA 1NS3A 2Y80A 2RA3A 1HAHH 3L6PA 4I7YH 1BHXB 4FUIA 2G4TA 1AVXA 1FY3A 1GMCG 1XUGA 4FUDA 3BTTE 4INLA 4ISOA 4OGYA 3HKJB 3GY4A 1UTLM 3ZV8A 1O31A 1ANDA 1GI2A 1ABIH 1GI9B 1FN6A 1AE8H 2JH5D 1HAZB 3UREA 4B2BA 1OSSA 2GV7A 2FTLE 2PGBB 3TH2H 4K1TA 4LK4A 4YLQH 1T32A 3RXQA 1NRPH 1A1RA 3K9XB 3PYHA 1QNJA 1ZZZA 5FPSA 1E0FD 1AB9C 1NFYA 2AMQA 1UMAH 3LKWA 4ZMAH 3C1KA 2ZWLH 4D9RA 1PPBH 3RXCA 4B71A 4TWYA 5K0HA 1QQUA 1A2CH 3UQOA 1S6HA 2V6NA 3E0PB 1UVTH 1K2I1 3V12A 3MH7A 1CGJE 3RU4T 2FYRA 2VVVA 3QK1A 3STIA 4MQAA 1C2MA 1B0EA 2ANKH 5DK1A 3P8GA 2NU4E 1D3PB 2R3UA 3BF6H 5L6NH 2AGGX 4ABFA 2PR3A 1N6XA 4YOJA 2ODPA 3UNSA 2G51A 1N8OC 1LPZB 4AFUA 3EA7A 3B9FH 5F8ZA 1F7ZA 3LOXA 1TQ7B 3UWIA 4ZHLU 2HALA 2VGCB 4TWWA 2W5EA 1P01A 2VWMA 2ZHDA 5EODA 2A7CA 4WVPE 3BEFB 4X8VH 4DURA 2CF9H 1F0TA 4NWKA 1GBAA 3M5NA 2GCHF 4J2YB 3SU5A 4I32A 4I8LA 2GGVB 2Z9GA 1RIWC 2ALPA 2ZDNA 1O3CA 3QN7A 3BG4C 3RXKA 1YPHE 2FX4A 2ZFQH 1F0UA 1ZYOA 1PPFE 3UOPA 1O2SA 2HRVA 3O8DA 2PHBA 3EQ0H 2FOEA 4NIWA 3GY8A 1F2SE 4Q2KA 1HJAC 1G9IE 1O2PA 1P06A 1EB2A 2QA9E 3QO6A 2BY6X 5LPRA 2EEKA 5EXNA 1TA2A 1AVWA 2Z94A 1DLEA 2A4GA 3PMBB 1DITH 2HWLB 2QF0A 3LGTA 3NWUA 4JCNA 3ZZ4A 4LXBH 3V0XA 5C1XA 1IQFA 3ATWA 1P8VC 1UK4A 3VB4A 1Z1JA 2RG3A 3A88A 4FUFA 1DE7H 2FX6A 4R0IA 1TGSZ 2K1QA 4RN6A 1YPKH