2RG3A

Covalent complex structure of elastase
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
218
structure length
217
Chain Sequence
b'IVGGRRARPHAWPFMVSLQLRGGHFCGATLIAPNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVILQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leukocyte elastase
molecule tags Hydrolase
source organism Homo sapiens
publication title X-ray snapshot of the mechanism of inactivation of human neutrophil elastase by 1,2,5-thiadiazolidin-3-one 1,1-dioxide derivatives.
pubmed doi rcsb
total genus 39
structure length 217
sequence length 218
ec nomenclature ec 3.4.21.37: Leukocyte elastase.
pdb deposition date 2007-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2rg3A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2rg3A02
3K9XB 1KXFA 3LH3A 2GV7A 3D49H 1KXBA 1AIXH 1QR3E 1EAXA 1O3HA 2FO9A 1FAKH 3P17H 2HNTF 2VINA 4AB9A 3RMOH 4MQAA 2K1QA 2BOHB 4CH2B 1M9UA 2FS8A 2QAAA 4D7GA 4FUHA 2ZTZA 1YM0A 1CA0B 2Q6FA 4FUIA 1W14U 2XBYA 3TPIZ 1GCDA 3ZZ6A 2ZZUH 3ITIA 3SV9A 4FUCA 4ZXXH 4OS1A 3HK3B 3RXEA 2BDIA 1F92A 1HGTH 2BVSH 2ZEBA 4ZHAA 2W7SA 1LVOA 1GHXH 1F0RA 4O3UA 3UY9A 2SNVA 4ZKRU 3FP6E 1J14A 2JKHA 1W8BH 3LT3A 1LO6A 3O8RA 1TGBA 1IAUA 2RCEA 4GCHG 5JBTA 4UFDH 1BB0B 3SNDA 4IBLH 1SPJA 1DY9A 1GMHG 3MU4A 3TK9A 1JWTA 1O3EA 4Y76A 1TX6A 3ZZ4A 5DP9A 1WUNH 2NU0E 1A0JA 2FESH 2AIQA 2FI3E 2HRVA 2F91A 1TBZH 2FX4A 4MPWA 1SGNE 4NWLA 2VIWA 1INCA 1ZGIA 2FMJA 2ZDVH 1QBVH 5A09A 5FPYA 4CRBA 4YOJA 4K1SA 1LVYA 1BQYA 1ZOMA 1W11U 1AZZA 1C5VA 1UVPA 3BV9B 1YLDA 1RS0A 3WY8A 1SL3A 4Y6DA 1UHBB 2BXTH 3EA9A 2Y7XA 1BRBE 2VIPA 4NWKA 1FY1A 4TWYA 2Z3EA 1VCQA 3HPTB 3NZIA 1GJ6A 2FOFA 4FUGA 3QTOH 4AYYB 4X2YA 2ODYB 2UUKB 4NIYA 3VXFH 4IMQA 4O03A 1ELFA 3FP7E 3RXAA 1ETTH 1P03A 1MH0A 1LVBA 1HAVA 4BOHA 3U1JB 2WPLS 3BIUH 1P01A 3NK8A 1ARBA 1TBRH 3EYDA 1O3JA 3TH4H 1TGTA 1BRAA 2W3KA 1SSXA 4LOYH 3K2UA 4ABAA 1DLKB 3I29A 3LC3A 4VGCB 2BDGA 1SC8U 4A6LA 2XC0A 3AW0A 1SQAA 1GHYH 2AGIX 1ELAA 3GCTF 2JH5D 4X6NA 4JK6A 4MNVA 4JYVH 4I33A 1SOZA 1DUAA 2XW9A 1A1RA 1GBDA 4BTUB 1YPMH 1E35B 1P12E 2KAIB 1AN1E 2GT8A 1TE0A 1J15A 1QRXA 1UTNA 3T62A 3MWIU 2XBXA 3MU0A 1G37A 4TPIZ 2FTMA 1CT2E 1C5ZB 3D62A 3P8NA 2VIOA 2OCVB 2WV4A 2B7DH 1EX3A 1GG6C 2BVXH 2NU1E 1OSSA 2ZCKP 4NZQA 1DANH 2QN5T 2FOEA 2ZHWH 5L6NH 1DXWA 1IQKA 2GTBA 2G55A 2HPPH 4U01A 3RLYH 3M3VA 2Y82A 3TNTA 1O5CB 1Z8GA 1ZLRA 2QIQA 4ZMAH 2ZU5A 3TH2H 3BTDE 3MH4A 1ZHPA 3RMMH 1NROH 5C5NA 3E91A 4I8JA 4WWYA 5EXLA 1C2GA 2UUJB 1ZRKA 4GHQA 1V2QT 4E7NA 3M7UA 1X7AC 2C8ZB 4B2AA 5C3NA 3SGAE 5DP7A 3D65E 3RXOA 1KLTA 1O5FH 5BRRE 1MTNC 3KNXA 1EASA 3TIUA 4ABGA 1KXAA 2VWLA 3SNEA 1T7CA 2B9LA 2D2DA 1AY6H 4YLQH 3UQVA 3QUMP 1XUFA 2G52A 2Y6TA 1T8OA 1KLIH 2A1DB 1MTUA 2AGGX 1OP0A 5HXFA 1TRMA 2BLOA 3DT0H 2OC0A 4IGDA 1GJBB 1SGYE 1TQ7B 5GJ4B 1QB1A 1KXEA 1S85A 1IQHA 2Y80A 3T29A 2FDAA 3PROA 3DD2H 2FP7B 1ZTLA 2ZDKA 1EAIA 3M3SA 4AB8A 3DUXH 2Z9GA 2J2UA 1GGDC 4KP0A 1QFKH 2BM2A 1VITG 2QXHA 3RXKA 2A5IA 4ISIH 4KKDA 1SB1H 2FS9A 5E0GA 1CU1A 3MU8A 4FUFA 1EP5A 2GZ7A 2G4TA 1VITF 2SGDE 4R0IA 5L30H 1DICA 2ULLA 1BA8B 2WUBA 3RXTA 1C1TA 3MOCA 1YPJH 5HGGA 1QA7A 1P04A 2ZA5A 2O8LA 5BPEA 2CJIA 2W7UA 1LDTT 2ZF0H 4NSYA 2AIPA 3ATIA 4WMFA 3TK5A 3MU1A 1Y3XA 3GDSA 1P2OA 2FM2A 3P8FA 1GG6B 2LPRA 2TRMA 5C1YA 3QZQA 1F7ZA 4JYTA 5EQRA 1SLUB 1D3PB 2JETC 5JB9S 1EZXC 1BUIA 1HAVB 4JZDH 1GDUA 4UFEH 5T6DA 1K28D 3TJOA 2STAE 4AFZA 1C5RA 2ZQ1A 3SV6A 1DX5M 1D6RA 1W12U 1SVPA 1Y3YA 3MTYA 2XWBI 1UHBA 1NRSH 1DOJA 1QNJA 2J4IA 2BB4A 4AX9H 4CRCA 1GMCF 3ODFA 4A1XA 2EI7A 1SHYA 2R9PA 5LPRA 4ZHLU 2I6SA 1NESE 1Y5BT 5DP3A 1W13U 1O32A 1UCYE 3FANA 1T31A 5B6OA 2XNIA 3K6YA 1PPHE 1HNEE 3TLOA 3VPKA 1W2KH 1ZSKA 1P2NA 4I8KA 1C1PA 5ETXA 1AKSA 2YOLA 3P8OA 4ABBA 1LHCH 2OTVA 1C5OH 2XC4A 2F9BH 2PUXB 2ZI2H 3A85A 1SBWA 2FOGA 1PJPA 1GWAA 1GCTC 4RN6A 2F9UA 1QRZA 2Z9IA 1TABE 2GCHG 1DLEA 3TK6A 1GBMA 4OS2A 5A0CA 4ABIA 3F9GA 4OS6A 2TBSA 2ZWLH 1TA6A 2O8TA 5DGJA 1L1NA 1SGFA 1TGNA 1BMNH 3KL6A 1F0SA 1AUTC 4Y79A 4MVNA 4VGCC 1C1UH 1P3EA 2BDAA 4X0WU 1EZQA 4NA8A 3V0XA 4XFQA 2AS9A 1P09A 2A7JA 5FCRA 1AWFH 2ILNA 2WYGA 3SJIA 1LMWB 1HJAC 2CHAB 1EOJA 1ZPBA 2EEKA 1LQEA 3RXCA 1ABJH 3FAOA 1DS2E 1AU8A 3MHWU 4RSPA 1C1WH 1K1IA 1T32A 1YPKH 2GZ9A 1T4UH 1O3IA 1SG8B 2SGEE 1HAYB 2A7CA 2GD4B 1XUKA 1MU8B 1E38B 2A0QB 4B76A 5LH8A 3V12A 1TGCA 1NN6A 4X1RU 2BD8A 3ELAH 2H6MA 4UDWH 4MDSA 3SU4A 2F9VA 5I46H 1ZRBA 3NCLA 4OS4A 3VB7A 2P3FH 1O3PB 1B0EA 1H1BA 4Z0KA 5EW2H 1Z6EA 1RGQA 2HGTH 1V2OT 4Q7XA 3EGKH 4IW4E 1MKWK 1LTOA 3KQEA 1P2IA 1NT1A 3A81A 1QGFA 1HBTH 1TGSZ 2P95A 1V2MT 1ZMNA 2BDYA 8LPRA 4X1NU 5GDSH 2Z9JA 1XMNB 2AYWA 2GCTB 3Q3XA 1SGFG 1O2QA 1LHEH 4ZXYH 3W95A 1ELCA 2GCHF 3CS0A 2ANKH 2QYIA 1YP9A 4JZFH 3ZVAA 1MTNB 2VNTA 4XBBA 3LGVA 1CT0E 2R0LA 2CF8H 3FVFB 3KGPA 1P8VC 3BTQE 1N8OB 5CHAC 1BIOA 3RXQA 1MKWH 4NA7A 1CA0C 1TA2A 1DVAH 1HUTH 2TPIZ 1FMGA 4R8TB 1GGDB 4GAWA 3UR9A 1C4Y2 1O3OA 1C5UA 2BXUH 1W3CA 3RDZA 3S9CA 1HJ8A 1FIWA 1GL0E 2C4FH 3PO1B 1EB2A 4K8BA 1UTOA 1UK2A 1HIAA 2OC1A 4D9RA 4LK4A 1XUIA 1UMAH 3LJOA 4X6PA 4I8GA 1CGJE 3N7OA 4Y11E 1QB6A 1UVSH 3ATKA 1C2LA 1SOTA 4Y8XA 4CH8B 1O5BB 3VGCB 3U8OH 5DP8A 4XBCA 3GCOA 1GMCG 3BTME 5JB8S 1IOEA 3T2NA 1L1JA 1UO6A 2UUFB 3GYMA 5JBAS 3KQDA 4MNXA 1GBHA 2SGAA 1P2QA 4O97A 3QGNB 1WYKA 1YPLH 1F0TA 3KHVA 4TWWA 3ZZ9A 2ALVA 2HOBA 5PTPA 1UVTH 2PKAA 1OOKB 3QK1A 2GKVE 2R2MB 1NS3A 1P9SA 3JZ1B 1CSOE 3P70B 5F6MA 1VGCC 2SGFE 4H42U 3PMHB 2VIVA 1H8IH 4HZHA 1XUGA 2D26C 3LKWA 2FXRA 6GCHF 1C1QA 3NWUA 1V2TT 3AW1A 1HIAB 1G3CA 1Y3UA 3QN7A 1NTPA 1JXPA 1WU1A 3EAJA 3QTVH 2YNAA 3P95A 2O8MA 1JIMA 2QF0A 4XSKU 3RU4T 1AUJA 4ABEA 1SGTA 2BD4A 4K3JA 2H5DA 1GHZA 5C1UA 1QIXB 1QBNA 1Q2WA 2FOBA 3URCA 4MNYA 5C20A 2AEIH 1C5MD 2A32A 3Q77A 1D6WA 1WQSA 4CBNA 3LGIA 1MTWA 4NA9H 1O33A 2PW8H 4DVAU 1AFEH 2F9NA 4GPGA 4XOJA 1ZTJA 1ORFA 1VZQH 2BTCE 1V2WT 3GY3A 4Y10E 1BZXE 3UREA 1WBGB 2IPHA 3BTWE 3RXUA 1Z8IB 1O2VA 1MZDA 4O3TA 2GX4A 4I7YH 1GMHF 4GLYA 3UNSA 1SGDE 2PHBA 1AE5A 1C5PA 2VGCB 1QA0A 1XVMA 3E3TA 5GXPA 3SHCH 4FUEA 1UVOA 3MU5A 1BTYA 2O9QA 1UTQA 1IHTH 2C93B 2ZGBH 1GJ9B 5F03A 2VIQA 4Y7AA 1K1NA 4FUJA 2PLXA 1WOFA 3RP2A 1BMAA 3TGKE 1AQ7A 5DK1A 4XBDA 3A7TA 1ZSLA 3LPRA 3LGTA 1RTKA 3MFJA 3M7QA 1NRPH 1TB6H 4D8NA 2PTNA 3BTTE 1PPBH 1EJAA 1GCTB 3ZVGA 4HTCH 1O2LA 2CXVA 3KCGH 3LOXA 4TYDA 5E2PA 5CMXH 2W3IA 2PWXA 2Z6BD 1QB9A 1EZSC 1B5GH 2GT7A 1KIGH 1GHBG 3SV2H 3GY8A 4ISOA 1ANCA 1DWCH 5CE1A 2XWAA 4RKJB 5AFZH 1KDQB 1O5AB 2XC5A 1TBQH 3SUEA 1ZJDA 1C9PA 1PFXC 2ODPA 1F5KU 1LHFH 4A1TA 1FY5A 2FX6A 5TJXA 1W7GH 1C1NA 3MNCA 1TFXA 4AYVB 1N6XA 2PKSC 1C2DA 2Q1JA 1CHOF 3BTEE 5JPMH 3RM2H 1LQDB 5G4BA 1TIOA 1VJAU 3ZVFA 3LH1A 3MNBA 1TMBH 2BD5A 3SZNA 1S6FA 3RMLH 4OGXA 3C27B 2ZU3A 4CRAA 1F0UA 2PR3A 4K69A 1BTPA 1V2PT 5FXLA 3F9EA 1EQ9A 2QA9E 3PLKA 2VU8E 1C5XB 3A7YA 2ZTXA 1GDNA 3ZYEA 3QLPH 1NRQH 4WMDA 2ZHFH 1EPTA 3PMJA 1BJVA 1A4WH 1H9IE 2UWOA 3RXDA 1BTWA 1XX9A 3AAUA 1K1LA 1C5YB 3IWMA 2PV9B 5AVDA 1QTFA 1TX7A 2NU4E 5JBBS 1Y59T 1HAXB 3BN9A 4NGAH 1O2HA 1FPCH 1FIZA 1O34A 1O2YA 1ZSJA 2GMTB 1GMDG 4I8LA 1FJSA 1CBWC 6LPRA 1Z1JA 2OQUA 1W0ZU 1GBFA 3RMNH 1BTZA 3T28A 5EPYA 1ZHRA 3ZVEA 1YLCA 2KAIA 3EDXB 1GI7B 1GBJA 1MQ5A 5LPFA 1ANBA 1GJAB 1NC6A 2ANWA 2GDEH 2FLBH 2WPJS 4AGJA 2OC7A 4INKA 2CF9H 1GBKA 1RD3B 1J9CH 1EJMA 2DUCA 1GHAF 1G3EA 2PSXA 1C1VH 2PGBB 4Y71A 1AFQB 4NFEA 3Q3YA 3RM0H 3FP8E 3LC5A 1C2HA 3PMBB 3FZDA 4AFUA 5GCHF 3S0NA 3QWCH 2FOMB 4AFSA 4YLUA 3ZZBA 1YPEH 1GI8B 3GY4A 2R0KA 3OY6U 3PYHA 2ZCHP 3S7KB 5F8ZA 2B8OH 4TY7A 1MTSA 1UTMA 1EB1H 2BD9A 5EOKA 1J16A 1MKXK 1ID5H 1OPHB 3PWCA 4DIHH 1FUJA 1GHWH 1K1PA 1THRH 2H9TH 5C5OA 3V3MA 5FCKA 4IN1A 1T8LA 2Z3CA 2EI8A 3SBKA 1FI8A 1VCWA 1JRTA 5C2ZA 1KXDA 4B2CA 2P94A 1T4VH 3MI4A 1O30A 5I25A 2BLWA 1G3DA 3EE0B 3F9FA 1S82A 3CENA 3CP7A 6CHAC 3NXPA 1ELEE 1MCTA 2FI4E 1XM1A 2PFEA 2FOHA 1B7XB 1VCPA 1QURH 1HCGA 1YF4A 1O38A 1CGIE 2FZZA 3C1KA 1OX1A 3M37A 2ZFSA 3RU4E 2WUCA 4DW2U 9ESTA 2ZPRA 3A8BA 1O3FA 4Q7ZA 1GBEA 2Y5GA 3QO6A 2IN2A 1RTLA 2ZHEH 3UWJH 3ATLA 3RC5A 1DUEA 2P93A 4BAOB 1NU9A 1GPZA 1CT4E 1OWHA 1OWDA 4X8UH 1OYQA 2R3UA 3M7TA 1C5SA 2A31A 3SGQE 4Y0YE 1ELBA 1Z6JH 2OP9A 4H6SB 2VH6A 1ESAA 4Z6AH 2G5NA 1LPZB 4E06H 5LGOA 3TGJE 2J94A 3DHKH 1BMLA 5EGMA 3L33A 2FYRA 2GP9B 4ISLA 1BTXA 2PTCE 3SHAH 1BHXF 5FHTA 1TAWA 4MTBA 3A8CA 1UK4A 4UONA 4K5ZA 3OTJE 3GISB 1C5NH 1T8MA 1LKAA 5EU8A 2WYJA 3SJOA 3SU3A 1YYY1 3ATWA 2FLRH 3PO1C 3H5CB 1HAOH 1HAPH 1ESBA 1A46H 3OU0A 1Y5AT 2BLQA 4K8YA 4B73A 2ZP0H 2ZPSA 3SW2B 4SGAE 3RXGA 4ZAEA 3TITA 1O37A 3SJ8A 2ZO3H 1L1GA 3RU4D 4CRGA 1ZMLA 2HVXA 4LZ1H 2ZDMA 5T6GA 1O2JA 5DG6A 1UVUH 4BNRA 4GUXA 3MH5A 1TALA 2BLVA 1TPSA 1K1MA 2M5TA 5JDUB 2H1UA 2DE9A 3M5OA 4X2VA 1A61H 1NZQH 1G3BA 1FPHH 1NRNH 1P0SH 2O8UA 1QJ7B 2AERH 1BTHH 1EAWA 3ZZ8A 2PKSB 3STIA 4CREA 1HB0B 2A2XH 1BHXB 2P59A 4A7IB 4D7FA 4KTCA 5EW1H 3A86A 3UQOA 1UCYK 2JETB 3GCHC 1P2KA 1ESTA 1YC0A 4MNWA 1GI3A 4IMZA 2BOKA 3PLPA 4UEHH 3SO3A 7KMEH 1IQLA 3SN8A 3UWIA 3U8RH 1XVOA 1BBRH 3ZZDA 1G9IE 2IOTA 5E2OA 1EOLA 1O2KA 1XXDA 2XCNA 4AZ2B 2J92A 3TU7H 2VB0A 1O2UA 1QL8A 4K60A 1Z8RA 1SLVB 3QDZB 1RIWC 3RXFA 1B0FA 2A7HA 5C1XA 1O35A 2OC8A 2QXGA 2LNCA 1O3NA 4HFPB 2Z7FE 2HNTC 1DT2A 1O3CA 2WV5A 2ANMH 3SJ9A 1P2JA 3BTFE 1MD7A 1ZGVA 1DWBH 3ZV8A 2ZFQH 2A4GA 1OXGA 5AF9H 1A0LA 1IQNA 1GJCB 1OWJA 1XUHA 1ETRH 2G81E 2ZFPH 1Z8JB 3V13A 2H5CA 3U98H 3ENSB 5FBEA 3VGCC 5IDKA 2A4QA 1C2IA 2WINI 5EODA 2GZ8A 3OY5U 4YESB 1KXCA 1FONA 3MMGA 4H4FA 1WQVH 2AGEX 2B5TB 4WF8A 4YTAA 1MAYA 1IQMA 3GICB 2TGAA 1GJ7B 2GV6A 1GVZA 4A5TS 5HYOA 1TQ0B 2BDBA 1ETSH 1WTHD 2UWPA 1EPTC 3KQCA 3M5NA 1QRWA 4NFFA 4YT7H 3ATMA 2Q6GA 1BTUA 1AFQC 1SLXB 1C1RA 5EQSA 1K22H 4PROA 1DITH 2A4RA 3KF2A 3P6ZB 4NZLA 5E8EH 4MLFB 2QF3A 1ANEA 2ASUB 1AE8H 4IC6A 4NIVA 2C8WB 1TNIA 2ZECA 3ZZCA 1E37B 4BTIB 4BAHB 1BITA 1WV7H 3SU0A 4CBOA 1VITH 2V3HH 2VH0A 1HLTH 2D8WA 1LKBA 1SLWB 3VXEH 3M3TA 3O8DA 2BY5X 4X1SU 4JZEH 3LIWA 1GJ4H 3ZZ3A 1G30B 1GHAG 3PMAB 5ESBA 2XCFA 1DXPA 1AZ8A 4HGCA 2AMPA 5H4IB 1GVKB 1S5SA 5A8YA 4JZ1A 1SGRE 4IC5A 5L2ZH 1DY8A 2RA0A 1OKXA 4BAQB 5E0JA 3GOVB 2FEQH 1KSNA 1RFNA 1KTSB 1GL1A 1IQIA 1OWEA 5T3HA 3PV4A 3TVJB 4ISNA 4KTUA 1H9HE 1G32B 1O0DH 5A0AE 4DG4A 1SI5H 3DFJA 4MPVA 1VJ9U 2HPQH 1E36B 3IG6B 2FOAA 1GBBA 3PWBA 1G2MA 2VJ1A 2BDCA 3PLBA 3BF6H 3S9BA 3M35A 4Q7YA 5FPSA 1V2NT 3T26A 3ZZ7A 1TRNA 4UFGH 4ABFA 1D3TB 1YCPK 3A80A 3URDA 1O3MA 5A0BA 2NU3E 1BMMH 3MH6A 1THPB 3P8GA 1ELDE 1KTTB 1PQAA 1SGCA 2QCYA 1KYNA 8GCHG 1SFIA 2R3YA 3RXJA 3STJA 2THFB 3D23A 1V2LT 3TJUA 1ELTA 3ZYDA 1O2GH 4DT7B 2GGVB 1ARCA 1O3AA 3P92A 1TNGA 2HLCA 1XUJA 1OP2A 3PTNA 1PPEE 1O3KA 5DP5A 5DP6A 5ESTE 1WSSH 4I32A 3L6PA 3LGWA 1WAYB 3E16B 2ZU1A 2F83A 2GMTC 1O39A 4DIIH 2NWNA 4WMEA 1P2MA 2ZHDA 4FU8A 1HAZB 4U30A 3TJNA 4YM9A 3VEQB 3SGBE 2ZHQH 2BD3A 2ZDLA 3UR6A 2UUYA 4Q80A 3ZZ5A 2SGPE 3ESTA 1GHVH 1Q31A 2BQ6B 2PGQB 1THSH 3U9AH 4B71A 3T25A 1CGHA 1AVXA 4YOGA 4A92A 3UPEA 2DE8A 5HM9A 1W0YH 1ZJKA 1MUEB 1JRSA 3RXBA 1AB9B 7ESTE 1BOQA 3MO3A 1JBUH 3BG4C 2H9EH 3BEUA 2QXJA 1C5QA 4BANB 5A8ZA 1ZTKA 3MO9A 1P11E 1SGIB 1EATA 3K6ZA 1D3QB 4WVPE 1SQTA 1DM4B 2BVRH 3DA9B 1AVGH 1OWKA 1NFXA 3I77A 1O3DA 2OD3B 2V0BA 4GSOA 1XKAC 3EA7A 1QJ6B 4Q2KA 1JMOH 3MNSA 4CRDA 2Y7ZA 2CN0H 5C67A 1UTLM 1H4WA 1S81A 2Z9LA 3GY2A 3HGPA 1KLJH 2BD7A 1C1MA 1BDAA 2FTLE 5HM2A 1T8NA 1V2VT 1H8DH 2ZTYA 1GBTA 1O2XA 3S69A 1KDQA 2ZNKH 3LU9B 1TNKA 5F8TA 2G00A 1DFPA 2VVUA 3M5LA 1SQOA 1NFUA 1YPGH 2H2ZA 4GCHF 1O5GH 3S9AA 3UFAA 1CBWB 3Q00A 2VWOA 1V2UT 3UIRA 1O2ZA 5EG4A 1FN6A 2CMYA 1FNIA 1TPPA 2ZFFH 1A5GH 1O2IA 4YOIA 1K1OA 3RXLA 9LPRA 1IQGA 1V3XA 4JK5A 1A3BH 5ABWA 1GI1A 4A1VA 4MPXA 1PYTC 4FXGH 4AG1A 2OBOA 4AFQA 1C2FA 1D9IA 1DWEH 3TNSA 3LGYA 2SGQE 4JZIA 2IJOB 4SGBE 4ZH8A 2G51A 3TJVA 3SOSA 1A5IA 2F3CE 2VWNA 3W94A 3BG4B 1CO7E 2ZPQA 2W26A 1O2RA 1UCYH 1C2KA 3Q3KA 1PQ7A 1SMFE 2FWWA 3GCNA 1HAHH 2ESTE 2Y5FA 1SHHB 1V2ST 3KEEA 4UFFH 2Z9KA 2VIDA 1UTKA 2QXIA 1EP6A 2PSYA 4DOQA 2FODA 1RTFB 4O9VA 2OQ5A 2J34A 3SQEE 3H7OA 2EC9H 5TCCA 1G2LA 3A7VA 1GI5A 1HYLA 4INHA 3SJKA 3SU1A 4ABDA 1TPOA 1S0QA 4B2BA 1EPTB 1RXPA 1YGCH 1IQFA 1P06A 1FN8A 4Y7BA 1IQEA 4DGJA 4WXVA 1MBMA 3U8TH 1TOCB 2BMGB 5E0HA 1L4ZA 2BZAA 2P8OC 2FPZA 4BAKB 5A8XA 3I78A 1CQQA 1TRYA 2VVVA 1S84A 3RXMA 8KME2 1P3CA 1GBLA 4FUBA 4X1QU 3BTHE 1K9OE 1V2RT 1BRCE 1F2SE 4OS7A 4FU7A 1QL7A 4OS5A 4WH8A 4ESTE 1LHGH 4JYUH 2WPKS 1CA8B 1KY9A 3RXVA 5IYTA 4XE4A 4Y8YA 4JCNA 4ZKOU 3A8DA 4U2WA 1C1OA 4BTTB 1ZZZA 1TWXB 3OX7U 2A2QH 3T27A 4X1PU 1QQUA 1FY3A 1JIRA 1HXEH 5F8XA 1GBIA 1GDQA 2TGDA 1ACBE 1MMJN 3GCHB 3VB5A 1O3BA 3F1SB 1ZYOA 4ZHMU 1GJ5H 1Y8TA 2ZKSA 2W5EA 4FVBA 1TLDA 1YPHC 5DKMA 5EQQA 3A82A 5EXMA 1V2KT 3B9FH 1BT7A 1O2PA 2BZ6H 3AAVA 1OP8A 1QCPA 1W10U 3UOUA 4CRFA 1MD8A 4NSVA 4Y0ZE 1TMUH 4TPYA 1EXFA 1ANDA 2F9PA 1EKBB 1O31A 3QX5H 1JOUB 2BX3A 1FAXA 3SV7A 3ZV9A 3FZZA 3UNRA 3A7ZA 5J4SA 1C1SA 1CE5A 1H9LB 5A2MH 1YPHE 1P02A 3HKIB 4I8HA 1HJ9A 6GCHG 5GWZA 1K21H 3RXSA 4WH6A 1SFQB 2GCTC 2BY7X 1YKTA 4DCDA 3A7WA 3GY7A 3E0PB 5HMAA 1AB9C 1PPGE 4WY3A 2ZGXH 1SGEE 2OINA 1Q3XA 1V2JT 1NFWA 1MCVA 3A7XA 2XRCA 5SGAE 2FI5E 1Y3WA 1YBWA 5GPIB 2ZQ2A 3R0FA 1RIWB 3OSYA 4LZ4B 1HJAB 2CHAC 1GI4A 1ZPCA 2SFAA 1NRRH 7GCHF 3BEIB 3E0NB 1G36A 3GDUA 1UTJA 2FOCA 4CR5A 1K1JA 3L3TA 3VFEA 5EXNA 3NPSA 2O8WA 1EUFA 4B75A 1VGCB 1NY22 1AKSB 2VWMA 3HGNA 4ZKSU 2ZIQH 1FV9A 3SQHE 3VB3A 1ELVA 3SU2A 3F9HA 4HI3A 3SUFA 1EZUC 1BRUP 1NFYA 1U6QA 3BSQA 1CHGA 3ODDA 1P57B 1OWIA 3BEFB 5AHGH 2OUAA 1AHTH 2AMQA 4YZUA 3UTUH 2BY8X 1RRKA 3T5FH 2Q6DA 1IHSH 1TNLA 3MO6A 5K0HA 3MYWA 1PQ8A 2G8TA 1BBRK 2Z94A 3O8CA 4AN7A 3SV8A 3NKKA 2WPMS 3A89A 4RKOB 3RUOA 2XXLA 1O2WA 1BBRE 2FIRH 3SI4H 1TOMH 1HRTH 1L4DA 7LPRA 2ZC9H 1N6YA 3SNAA 4YO9A 2A45B 2CV3A 4ISHH 3B23B 1EAUA 1ABIH 4FVDA 2UWLA 2GDDA 2V35A 4GVUA 1GVLA 2BX4A 1ZHMA 2WPHS 1AVWA 1HFDA 4ABHA 4F4OC 2RDLA 3RLWH 1C2JA 1N1LA 1BCUH 1GJ8B 2PUQH 1LPKB 3BIVH 2ALPA 2QGRA 1O2OA 1ZR0A 4K1TA 1O5EH 2ZCLP 3RXHA 3GDVA 3RXIA 1S0RA 3SUGA 1NPMA 4M7GA 4KELA 1UK3A 1LHDH 5AFYH 4UD9H 1A7SA 3A83A 4THNH 2STBE 1HDTH 4IS5A 1UTPA 1O2NA 2BDHA 4ZROA 4ABJA 3GYLB 2BYAX 1C4U2 1GBAA 1QJ1B 3M36A 1O3LA 2ZFTA 3MH7A 2G5VA 3M5MA 4MG3A 2WPIS 1Z71A 4X8SH 2C8XB 4H6TA 1C4V2 3JZ2B 1F5LA 2ODQA 2P8OB 1A0HB 1OS8A 6ESTA 2Y81A 2EA3A 3BTKE 3FFGA 2ZGJA 1RJXB 3IITA 3ZZAA 1S83A 5J4QA 1AWHB 4X2XA 3RC4A 3AVZA 1BJUA 2QV1A 3RXRA 4QT8C 2AMDA 2ZU4A 4ZKNU 3SU5A 2TGTA 2RA3A 2R2WU 4KGAA 1UJ1A 2XBVA 2G4UA 4AG2A 2ZGCA 1GBCA 3A87A 2OLGA 3EA8A 1AO5A 1O2MA 1TNHA 1GMDF 1MU6B 2XBWA 3A8AA 1DSTA 4FUDA 3K65B 1AI8H 1D3DB 1ZPZA 3VB6A 2RG3A 5K7RA 2D1JA 1LPGB 4XDEA 3PM3A 1S6HA 3F68H 4B1TA 2C3SA 1WCZA 1TPAE 1N8OC 3LJJA 2ZG0H 3R3GB 5L2YH 1AD8H 1E34B 2V3OH 3DFLA 4BXWA 1D4PB 1F5RA 1K2I1 1YCPH 3U69H 3LONA 4ZUHA 3MNXA 1QY6A 1YCPM 3SI3H 1Y3VA 1QBOA 1PQ5A 3HK6B 3HATH 1HXFH 1MQ6A 2C8YB 2AFQB 4NCYA 4YT6H 1FDPA 3KQBA 1O2TA 2EI6A 6CHAB 3CS7A 4LXBH 1XXFA 3RXPA 2F9OA 4X8VH 1C5WB 2QC2A 1CVWH 1A2CH 1QL9A 3LGUA 1FY4A 1HAGE 3GY6A 5DPAA 5TCAA 1MKXH 2HNTE 1MZAA 1WTGH 5DP4A 4X6OA 4K1EA 3ZVDA 1IQJA 2I6QA 2AH4X 1O5DH 3NUMA 1E0FD 4BXSA 3HKJB 4MPUA 3EQ0H 3VB4A 2ANYA 1CHOG 2J38A 2BY9X 5CHAB 3SU6A 1PPFE 2HWLB 2ZGHA 4GHTA 1O36A 3G01A 2JH0D 3E1XB 3QGJA 4J1YA 1C5LH 1HV7A 1QQ4A 2XTTB 3O8BA 3GY5A 1FXYA 2P3UB 3QZRA 1W7XH 1GI2A 5GIBA 5T6FA 1J17T 1GI6A 1MBQA 4DY7B 1Z7KA 2Y5HA 1O3GA 3KN2A 3ZVCA 4E7RG 5DO4H 1TNJA 2BY6X 2ZU2A 4IN2A 2P3TB 3SUDA 4JMYA 2C90B 4U32A 4INLA 1SGQE 1L2EA 1P10A 5JYIA 2NU2E 1DE7H 5GCHG 1TONA 3U1IB 4NIWA 1ZMJA 2BQ7B 1DSUA 1FZZA 3GCTG 1XKBC 4E05H 1GJDB 1J8AA 3PTBA 3E8LA 4DURA 1HPGA 4AORA 8ESTE 1VR1H 2GVFA 2BQWB 1EJNA 3SNBA 1QHRB 1FLEE 3TH3H 2A5KA 2QY0B 4WJG2 3ZVBA 1OYTH 2PKAB 3SORA 1Z1IA 5FBIA 4WXIA 3SNCA 5JBCS 1V6DA 3H7TA 1NU7B 4X8TH 3UNQA 3AASA 4CR9A 1FQ3A 2ZFRH 3M61U 1P9UA 4I31A 1C2MA 1AMHA 4CHAB 3A88A 1PPCE 1A3EH 5DJ7A 1MAXA 4F49A 1MTVA 4AGKA 4OGYA 1PPZA 2V6NA 1LVMA 2FYQA 3LDXH 2A5AA 4UE7H 2XYAA 4FU9A 3UOPA 5LPEA 2CGAA 1L0ZA 3A84A 2J9NA 4ASHA 1C5TA 1DWDH 1Y5UT 5FAHA 1P05A 1C9TA 2JH6D 2P16A 1PYTD 2J95A 1O2SA 2ZDNA 3KIDU 3S7HB 1NO9H 1NM6A 1A5HA 1DPOA 4Y8ZA 2YNBA 4J2YB 4NIXA 3RC6A 3F6UH 1SR5C 4X2WA 4AOQA 1C2EA 2B0FA 1DDJA 2TIOA 1ELGA 2A4OA 1TMTH 1GHBF 1FY8E 1SGPE 4KTSA 2Z3DA 3V7TA 1GI9B 3OYPA 1GI0A 5FPTA 4K2YA 3UUZA 7GCHG 2BHGA 3BG8A 2OXSA 3BTGE 2TGPZ 4X6MA 4CHAC 1TX8A 4D9QA 5FX5A 4NG9H 5EPNA 4BAMB 1AGJA 2BD2A 1LCYA 5FX6A 3E6PH 2ZDAH 4B74A 1HAIH 1TYNA 3PB1E 3E90B 2VGCC 2VVCA 8GCHF 2OBQA 3Q76A 3B8JA 4DJZB 4D76A 2HALA 3TGIE 2SNWA 4TY6A 2H9HA
chains in the Genus database with same CATH superfamily
3K9XB 1KXFA 3LH3A 2GV7A 3D49H 1KXBA 1AIXH 1QR3E 1EAXA 1O3HA 2FO9A 4TSFD 1FAKH 3P17H 2HNTF 2VINA 4AB9A 3RMOH 4MQAA 2K1QA 2BOHB 2J5UA 4CH2B 1M9UA 2FS8A 2QAAA 4D7GA 4FUHA 2ZTZA 2KCAA 1YM0A 1CA0B 2Q6FA 4FUIA 1W14U 2XBYA 3TPIZ 1GCDA 4FETA 3ZZ6A 2ZZUH 3ITIA 5B6LA 3SV9A 4FUCA 4ZXXH 4OS1A 3HK3B 3RXEA 2BDIA 1F92A 1HGTH 2BVSH 2ZEBA 4ZHAA 2W7SA 1LVOA 1GHXH 1F0RA 4O3UA 3UY9A 3WW7A 2SNVA 4ZKRU 3FP6E 1J14A 2JKHA 1W8BH 3LT3A 1LO6A 3O8RA 5FL7D 1TGBA 1IAUA 2RCEA 4GCHG 5JBTA 4UFDH 1BB0B 3SNDA 4IBLH 1SPJA 1DY9A 1GMHG 3MU4A 3TK9A 1JWTA 1O3EA 4Y76A 1TX6A 3ZZ4A 1W0JD 1WUNH 5DP9A 2NU0E 1A0JA 2FESH 2AIQA 2FI3E 2HRVA 2F91A 1TBZH 2FX4A 4MPWA 1SGNE 4NWLA 2VIWA 2GJGA 1INCA 1ZGIA 2FMJA 2ZDVH 1QBVH 5A09A 5FPYA 4CRBA 4YOJA 4K1SA 1LVYA 1BQYA 3PRDA 1ZOMA 1W11U 2IJD1 1AZZA 1C5VA 2F4LA 1UVPA 3BV9B 1YLDA 1RS0A 3WY8A 1SL3A 4Y6DA 2JIZD 1UHBB 2BXTH 3EA9A 2Y7XA 1BRBE 2VIPA 4NWKA 1FY1A 4TWYA 2Z3EA 1VCQA 3HPTB 3NZIA 1VKYA 1GJ6A 2FOFA 4FUGA 3QTOH 4AYYB 4X2YA 2ODYB 2UUKB 5HIYA 3F2HA 4NIYA 3VXFH 4IMQA 4O03A 1ELFA 3FP7E 3RXAA 1ETTH 1P03A 1MH0A 1LVBA 1HAVA 4BOHA 3SYJA 3U1JB 2WPLS 3BIUH 2RFKC 1P01A 3NK8A 1ARBA 1TBRH 3EYDA 5DSFA 1O3JA 3TH4H 1TGTA 1BRAA 2W3KA 1SSXA 4LOYH 3K2UA 4ABAA 1DLKB 3I29A 3LC3A 4VGCB 2BDGA 1SC8U 4A6LA 2XC0A 3AW0A 1SQAA 1GHYH 2AGIX 2L74A 1ELAA 3GCTF 2JH5D 4X6NA 4JK6A 4MNVA 4JYVH 4I33A 1SOZA 1DUAA 2XW9A 1A1RA 1GBDA 4BTUB 1YPMH 1E35B 1P12E 2KAIB 1AN1E 2GT8A 1TE0A 1J15A 1QRXA 1UTNA 3T62A 3MWIU 2XBXA 3MU0A 1G37A 4TPIZ 2FTMA 1CT2E 1C5ZB 3D62A 3P8NA 2VIOA 2OCVB 2WV4A 2B7DH 1EX3A 1GG6C 2BVXH 2NU1E 3W1EA 1OSSA 2ZCKP 4NZQA 1DANH 2QN5T 2FOEA 2ZHWH 5L6NH 1DXWA 1IQKA 2GTBA 2G55A 2HPPH 4U01A 3RLYH 3M3VA 2Y82A 3TNTA 1O5CB 1Z8GA 1ZLRA 2QIQA 4ZMAH 2ZU5A 3TH2H 3BTDE 2XOKD 3MH4A 1ZHPA 3RMMH 1NROH 5C5NA 3E91A 4I8JA 4WWYA 5EXLA 1C2GA 2UUJB 1ZRKA 4GHQA 1V2QT 4E7NA 3M7UA 1X7AC 2C8ZB 4B2AA 5C3NA 3SGAE 5DP7A 3D65E 3RXOA 1KLTA 1O5FH 5BRRE 1MTNC 3KNXA 1EASA 3TIUA 4ABGA 1KXAA 2VWLA 2QF4A 5KECA 3SNEA 1T7CA 2B9LA 2D2DA 1AY6H 4YLQH 3UQVA 3QUMP 1XUFA 2G52A 2Y6TA 1T8OA 1KLIH 2A1DB 1MTUA 2AGGX 1OP0A 5HXFA 1TRMA 2BLOA 3DT0H 2OC0A 4IGDA 1GJBB 1SGYE 1TQ7B 5GJ4B 1QB1A 1KXEA 2JDID 1S85A 1IQHA 2Y80A 3T29A 2FDAA 3PROA 3DD2H 2FP7B 1ZTLA 2ZDKA 1EAIA 3M3SA 4AB8A 3DUXH 2Z9GA 2KCOA 2J2UA 1GGDC 4KP0A 1QFKH 2BM2A 1VITG 4Q63A 2QXHA 3RXKA 2A5IA 4ISIH 4KKDA 1SB1H 2FS9A 5E0GA 1CU1A 3MU8A 4FUFA 1EP5A 2GZ7A 2G4TA 1VITF 2SGDE 4R0IA 5L30H 1DICA 2ULLA 4DT4A 1BA8B 3OAAD 2WUBA 3RXTA 1C1TA 3MOCA 1YPJH 5HGGA 1QA7A 1P04A 2ZA5A 2O8LA 5BPEA 2CJIA 2W7UA 1LDTT 2ZF0H 3OEED 2AIPA 3ATIA 4NSYA 4WMFA 3MU1A 1Y3XA 3TK5A 3GDSA 1P2OA 2FM2A 3P8FA 1GG6B 2LPRA 2TRMA 5C1YA 3QZQA 1F7ZA 4JYTA 5EQRA 1SLUB 1D3PB 2JETC 5JB9S 1EZXC 1BUIA 1HAVB 4JZDH 1GDUA 4UFEH 5T6DA 1K28D 3TJOA 2STAE 4AFZA 1C5RA 2ZQ1A 3SV6A 1DX5M 1D6RA 1W12U 1SVPA 1Y3YA 3MTYA 1UHBA 1NRSH 1DOJA 2XWBI 1QNJA 2J4IA 4FOUC 2BB4A 2KX4A 4AX9H 4CRCA 1GMCF 3ODFA 4A1XA 2EI7A 1SHYA 2R9PA 5LPRA 2JJ1D 4ZHLU 2I6SA 1NESE 1Y5BT 2M2AA 1W13U 5DP3A 1O32A 1UCYE 3FANA 1T31A 5B6OA 2XNIA 3K6YA 1PPHE 1HNEE 2J98A 3TLOA 3VPKA 1W2KH 2KCPA 1ZSKA 1P2NA 4I8KA 1C1PA 5ETXA 1AKSA 2YOLA 3P8OA 4ABBA 1LHCH 2OTVA 1C5OH 2XC4A 2F9BH 2PUXB 2ZI2H 5KGOA 3A85A 1SBWA 2FOGA 1PJPA 1GWAA 1GCTC 4RN6A 2F9UA 1QRZA 2Z9IA 1TABE 2GCHG 1DLEA 3TK6A 1GBMA 4OS2A 5A0CA 4ABIA 3F9GA 4OS6A 2TBSA 2ZWLH 1TA6A 2O8TA 5DGJA 1L1NA 1SGFA 1TGNA 1BMNH 3KL6A 3NRLA 1F0SA 1AUTC 4Y79A 4MVNA 4VGCC 1C1UH 1P3EA 2BDAA 4X0WU 1EZQA 4NA8A 3V0XA 4XFQA 2AS9A 1P09A 2A7JA 5FCRA 1AWFH 2ILNA 2WYGA 3SJIA 1LMWB 1HJAC 2CHAB 1EOJA 1ZPBA 2EEKA 1LQEA 3RXCA 1ABJH 3FAOA 1DS2E 1AU8A 3MHWU 1WXRA 4RSPA 1C1WH 1K1IA 1T32A 1YPKH 2GZ9A 5EJZA 1T4UH 1O3IA 1SG8B 2SGEE 1HAYB 2A7CA 2GD4B 1XUKA 1MU8B 1E38B 2A0QB 4B76A 5LH8A 3V12A 1TGCA 1NN6A 4X1RU 2BD8A 3ELAH 2H6MA 4UDWH 4MDSA 3SU4A 2F9VA 5I46H 1ZRBA 3NCLA 4OS4A 3VB7A 2P3FH 1O3PB 1B0EA 1H1BA 4Z0KA 5EW2H 1Z6EA 3WWBA 1RGQA 2HGTH 1V2OT 4Q7XA 3EGKH 4IW4E 1MKWK 4B6EA 1LTOA 3KQEA 1P2IA 1NT1A 3A81A 1QGFA 3F0PA 1HBTH 1TGSZ 2P95A 1V2MT 2K0QA 1ZMNA 2BDYA 8LPRA 4X1NU 5GDSH 2Z9JA 1XMNB 2AYWA 2GCTB 3Q3XA 1SGFG 1O2QA 1LHEH 4ZXYH 3W95A 1ELCA 2GCHF 2W6ID 3CS0A 2ANKH 2QYIA 1YP9A 4JZFH 3ZVAA 1MTNB 1YLNA 2VNTA 4XBBA 3LGVA 5C0UA 1CT0E 2R0LA 2CF8H 3FVFB 3KGPA 1P8VC 3BTQE 1N8OB 3EE7A 1BIOA 5CHAC 3RXQA 1MKWH 4NA7A 1CA0C 1TA2A 1DVAH 1HUTH 2TPIZ 1FMGA 4R8TB 1GGDB 4GAWA 3UR9A 1C4Y2 1O3OA 3N99A 1C5UA 2BXUH 1W3CA 3RDZA 3S9CA 1HJ8A 1FIWA 1GL0E 2C4FH 3PO1B 1EB2A 4K8BA 1UTOA 1UK2A 1HIAA 2OC1A 4D9RA 4LK4A 1XUIA 1UMAH 3LJOA 4X6PA 4I8GA 1CGJE 3N7OA 4Y11E 1QB6A 1UVSH 4P02A 3ATKA 1C2LA 1SOTA 4Y8XA 4CH8B 1O5BB 3VGCB 3U8OH 5DP8A 4XBCA 3GCOA 1GMCG 3BTME 3FO8D 5JB8S 1IOEA 3T2NA 1L1JA 1UO6A 2UUFB 3GYMA 5JBAS 3KQDA 4MNXA 1GBHA 2SGAA 2WHXA 1P2QA 4O97A 3QGNB 1WYKA 4TT3D 1YPLH 1F0TA 3KHVA 4TWWA 3ZZ9A 2ALVA 2HOBA 5PTPA 1UVTH 2PKAA 1OOKB 3QK1A 2GKVE 2R2MB 1NS3A 1P9SA 3JZ1B 1CSOE 3P70B 5F6MA 1VGCC 2SGFE 4H42U 3PMHB 2VIVA 1H8IH 4HZHA 1XUGA 2D26C 3LKWA 2FXRA 6GCHF 1C1QA 3NWUA 1V2TT 1K0HA 3AW1A 1HIAB 1G3CA 1Y3UA 3QN7A 5F53A 1NTPA 1JXPA 1WU1A 3EAJA 3QTVH 2YNAA 3P95A 2O8MA 4F48B 1JIMA 2QF0A 4XSKU 3RU4T 1AUJA 4ABEA 1SGTA 2BD4A 4K3JA 2H5DA 1GHZA 5C1UA 1QIXB 1COWD 1QBNA 1Q2WA 2FOBA 3URCA 4MNYA 5C20A 2AEIH 1C5MD 2A32A 3Q77A 1D6WA 1OHHD 1WQSA 4CBNA 3LGIA 1MTWA 4NA9H 1O33A 2PW8H 4DVAU 1AFEH 2F9NA 2K8IA 2V7QD 4GPGA 4XOJA 1ZTJA 1ORFA 1VZQH 2BTCE 1V2WT 3GY3A 4Y10E 1BZXE 3UREA 1WBGB 2IPHA 3BTWE 3RXUA 1Z8IB 1O2VA 1MZDA 4O3TA 2GX4A 4I7YH 1GMHF 4GLYA 3UNSA 1SGDE 2PHBA 1AE5A 1C5PA 2VGCB 1QA0A 1XVMA 3E3TA 4RT0A 5GXPA 3SHCH 4FUEA 1UVOA 3MU5A 1BTYA 2O9QA 1UTQA 1IHTH 2C93B 2ZGBH 1GJ9B 5F03A 2VIQA 4Y7AA 1K1NA 4FUJA 2PLXA 1WOFA 3RP2A 1BMAA 3TGKE 1AQ7A 5DK1A 4XBDA 3A7TA 1ZSLA 3LPRA 3LGTA 1RTKA 3MFJA 3M7QA 1NRPH 1TB6H 3FOAA 2PTNA 4D8NA 3BTTE 1PPBH 1EJAA 1GCTB 3ZVGA 4HTCH 1O2LA 4ACAA 1E1RD 2CXVA 3KCGH 3LOXA 4TYDA 5E2PA 5CMXH 2W3IA 2PWXA 2Z6BD 1QB9A 1EZSC 1B5GH 2GT7A 1KIGH 1GHBG 3SV2H 3GY8A 4ISOA 1ANCA 1DWCH 5CE1A 2XWAA 4RKJB 5AFZH 1KDQB 1O5AB 2XC5A 1TBQH 3SUEA 1ZJDA 1C9PA 1PFXC 2ODPA 1F5KU 1LHFH 4A1TA 1FY5A 2FX6A 5TJXA 1W7GH 1C1NA 3MNCA 1TFXA 4AYVB 1N6XA 2PKSC 1C2DA 2Q1JA 1CHOF 3BTEE 5JPMH 3RM2H 1LQDB 5G4BA 1TIOA 1VJAU 3F2FA 3ZVFA 3LH1A 3MNBA 1TMBH 2BD5A 3SZNA 1S6FA 3RMLH 5EJLA 4OGXA 3C27B 2ZU3A 4CRAA 1F0UA 2PR3A 4K69A 1BTPA 1V2PT 5FXLA 3F9EA 1EQ9A 2QA9E 3PLKA 2VU8E 1C5XB 3A7YA 2ZTXA 1GDNA 3ZYEA 3QLPH 1NRQH 4WMDA 2ZHFH 1EPTA 3PMJA 1BJVA 1WDIA 1A4WH 1H9IE 2UWOA 3RXDA 1BTWA 1XX9A 3AAUA 1K1LA 1C5YB 3IWMA 2PV9B 2WSSD 5AVDA 1QTFA 1TX7A 2NU4E 5JBBS 1Y59T 1HAXB 3BN9A 4NGAH 1O2HA 1FPCH 1FIZA 1O34A 1O2YA 1ZSJA 2GMTB 1GMDG 4I8LA 1FJSA 1CBWC 6LPRA 1Z1JA 2OQUA 1W0ZU 1GBFA 3RMNH 1BTZA 3T28A 5EPYA 1ZHRA 3ZVEA 1YLCA 2KAIA 3EDXB 2VBCA 1GI7B 1GBJA 1MQ5A 5LPFA 1ANBA 1GJAB 1NC6A 2ANWA 2AHME 2GDEH 2FLBH 1UW7A 2WPJS 4AGJA 2OC7A 4INKA 2CF9H 1GBKA 1RD3B 1J9CH 1EJMA 2DUCA 1GHAF 3F3BA 1G3EA 2PSXA 1C1VH 2PGBB 4Y71A 1AFQB 4NFEA 3Q3YA 3RM0H 3FP8E 3LC5A 1C2HA 2KR7A 3PMBB 3FZDA 4AFUA 5GCHF 3S0NA 3QWCH 2FOMB 4AFSA 4YLUA 3ZZBA 1YPEH 1GI8B 3GY4A 2R0KA 3OY6U 3PYHA 2ZCHP 3S7KB 5F8ZA 2B8OH 4TY7A 1MTSA 1UTMA 1EB1H 2BD9A 5EOKA 1J16A 1MKXK 1ID5H 1OPHB 3PWCA 4DIHH 1FUJA 1GHWH 1K1PA 1THRH 2H9TH 3OTPA 5C5OA 3V3MA 5FCKA 4IN1A 1T8LA 2Z3CA 2EI8A 3SBKA 1FI8A 1VCWA 1JRTA 5C2ZA 1KXDA 2QE7D 4B2CA 2P94A 1T4VH 3MI4A 1O30A 5I25A 2BLWA 1G3DA 3EE0B 3F9FA 1S82A 3CENA 3CP7A 6CHAC 3NXPA 1ELEE 1MCTA 2FI4E 1XM1A 2PFEA 2FOHA 1B7XB 3OEHD 1VCPA 1QURH 1HCGA 1YF4A 1O38A 1CGIE 2FZZA 3C1KA 1OX1A 3M37A 2ZFSA 3RU4E 2WUCA 4DW2U 5CDFE 9ESTA 2ZPRA 3A8BA 1O3FA 4Q7ZA 1GBEA 2Y5GA 3QO6A 2IN2A 1RTLA 2ZHEH 3UWJH 3ATLA 3RC5A 1DUEA 2P93A 4BAOB 1NU9A 1GPZA 1CT4E 1OWHA 1OWDA 4X8UH 1OYQA 2R3UA 3M7TA 1C5SA 2A31A 3SGQE 4Y0YE 4RT1A 1ELBA 1Z6JH 2OP9A 4H6SB 1ESAA 2VH6A 4Z6AH 2G5NA 1LPZB 4E06H 5LGOA 3TGJE 2J94A 3DHKH 1BMLA 5EGMA 3L33A 2FYRA 2GP9B 4ISLA 1BTXA 1SQRA 2PTCE 3SHAH 1H8HD 1BHXF 5FHTA 1TAWA 4MTBA 4OM9A 3A8CA 1UK4A 4UONA 4K5ZA 3OTJE 3GISB 1C5NH 1T8MA 1LKAA 5EU8A 2WYJA 3N7DA 3SJOA 1W0KD 3SU3A 1YYY1 3ATWA 2FLRH 3PO1C 3H5CB 1HAOH 1HAPH 1ESBA 1A46H 3OU0A 1Y5AT 3F2GA 4F55A 2BLQA 4K8YA 4B73A 2ZP0H 2ZPSA 3SW2B 4SGAE 3RXGA 4ZAEA 3TITA 1O37A 3SJ8A 2ZO3H 1L1GA 3RU4D 4CRGA 1ZMLA 2HVXA 4LZ1H 2ZDMA 5T6GA 1O2JA 5DG6A 1UVUH 4BNRA 4GUXA 3MH5A 1TALA 4XRNA 2BLVA 1TPSA 1K1MA 2M5TA 5JDUB 2H1UA 2DE9A 3M5OA 4X2VA 1A61H 1NZQH 1G3BA 1FPHH 1NRNH 1P0SH 2KCYA 2O8UA 1QJ7B 2AERH 1BTHH 1EAWA 3ZZ8A 2PKSB 3STIA 4CREA 1HB0B 2A2XH 1BHXB 2P59A 4A7IB 4D7FA 4KTCA 5EW1H 3A86A 3UQOA 1UCYK 2JETB 3GCHC 1P2KA 1ESTA 1YC0A 4MNWA 1GI3A 4IMZA 2BOKA 3PLPA 4UEHH 3SO3A 7KMEH 1IQLA 3SN8A 3UWIA 3U8RH 1XVOA 1BBRH 3ZZDA 1G9IE 2IOTA 5E2OA 1EOLA 1O2KA 1XXDA 2XCNA 4AZ2B 2J92A 3TU7H 2VB0A 1O2UA 1QL8A 4K60A 1Z8RA 1SLVB 3QDZB 1RIWC 3RXFA 1B0FA 2A7HA 5C1XA 1O35A 2OC8A 2QXGA 2LNCA 1O3NA 4HFPB 2Z7FE 2HNTC 1DT2A 1O3CA 2WV5A 2ANMH 3SJ9A 2W6JD 1P2JA 3BTFE 1MD7A 1ZGVA 1DWBH 3ZV8A 2ZFQH 2A4GA 1OXGA 5AF9H 1A0LA 1IQNA 1GJCB 1OWJA 1XUHA 1ETRH 2G81E 2ZFPH 1Z8JB 3V13A 2H5CA 3U98H 1NBME 3ENSB 5FBEA 3VGCC 5IDKA 2A4QA 1C2IA 2WINI 4ACBA 5EODA 2GZ8A 3OY5U 4YESB 1KXCA 1FONA 3MMGA 1FX0B 1NBMD 1WQVH 2AGEX 2B5TB 4H4FA 4WF8A 4YTAA 1MAYA 1IQMA 3GICB 2TGAA 1GJ7B 2GV6A 1GVZA 4A5TS 5HYOA 1TQ0B 2BDBA 1ETSH 1WTHD 2UWPA 1EPTC 3KQCA 3M5NA 1QRWA 4NFFA 4YT7H 3ATMA 2Q6GA 1BTUA 1AFQC 1SLXB 1C1RA 5EQSA 1K22H 4PROA 1DITH 2A4RA 3KF2A 3P6ZB 4NZLA 5E8EH 4MLFB 2QF3A 1ANEA 2ASUB 1AE8H 4IC6A 4NIVA 2C8WB 1TNIA 2ZECA 3ZZCA 1E37B 4BTIB 4BAHB 1BITA 1WV7H 3SU0A 4CBOA 1VITH 2V3HH 2VH0A 1HLTH 2D8WA 1LKBA 1SLWB 3VXEH 3M3TA 3O8DA 2BY5X 4X1SU 4JZEH 3LIWA 1GJ4H 3ZZ3A 1G30B 1GHAG 1QZ8A 3PMAB 5ESBA 2XCFA 1DXPA 1AZ8A 4HGCA 2AMPA 5H4IB 1GVKB 1S5SA 5A8YA 4JZ1A 1SGRE 4IC5A 5L2ZH 1DY8A 2RA0A 1OKXA 4BAQB 5E0JA 3GOVB 2FEQH 1KSNA 1RFNA 1KTSB 1GL1A 1IQIA 1OWEA 5T3HA 3PV4A 3TVJB 4ISNA 4KTUA 3OE7D 1H9HE 4P00A 1G32B 1O0DH 5A0AE 4DG4A 1SI5H 3DFJA 4MPVA 1VJ9U 2HPQH 1E36B 3IG6B 2FOAA 1GBBA 3PWBA 1G2MA 2VJ1A 2BDCA 3PLBA 3BF6H 3S9BA 3M35A 4HG6A 4Q7YA 5FPSA 1V2NT 3T26A 3ZZ7A 1TRNA 4UFGH 4ABFA 1D3TB 1YCPK 3A80A 3URDA 1O3MA 5A0BA 2NU3E 1BMMH 3MH6A 1THPB 3P8GA 1ELDE 1KTTB 1PQAA 5C0TA 1SGCA 2QCYA 1KYNA 8GCHG 1SFIA 2R3YA 3RXJA 3STJA 2THFB 3D23A 1V2LT 3TJUA 1ELTA 3ZYDA 1O2GH 4DT7B 2GGVB 1ARCA 1O3AA 3P92A 1TNGA 2HLCA 1XUJA 1OP2A 3PTNA 1PPEE 1O3KA 5DP5A 3PV5A 5DP6A 5ESTE 1WSSH 4I32A 3L6PA 3LGWA 1WAYB 3E16B 2ZU1A 2F83A 2GMTC 1O39A 4DIIH 2NWNA 4WMEA 1P2MA 2ZHDA 4FU8A 3PV2A 1HAZB 4U30A 3TJNA 4YM9A 3VEQB 3N7EA 3SGBE 2ZHQH 2BD3A 2ZDLA 3UR6A 2UUYA 4Q80A 3ZZ5A 2SGPE 3ESTA 1GHVH 1Q31A 2BQ6B 2PGQB 1THSH 3U9AH 4B71A 3T25A 1CGHA 1AVXA 4YOGA 4A92A 3UPEA 5HKKD 2DE8A 5HM9A 1W0YH 4B6FA 1ZJKA 2J97A 3KYFA 5C17A 1MUEB 1JRSA 3RXBA 1AB9B 7ESTE 1BOQA 3MO3A 1JBUH 3BG4C 2H9EH 3BEUA 5KEDA 2QXJA 1C5QA 4BANB 5A8ZA 1ZTKA 3MO9A 1P11E 1SGIB 1EATA 3K6ZA 1D3QB 4WVPE 1SQTA 1DM4B 2BVRH 3DA9B 1BMFD 1AVGH 1OWKA 1NFXA 3I77A 1O3DA 2OD3B 2V0BA 4GSOA 1XKAC 3EA7A 1QJ6B 4Q2KA 1JMOH 3MNSA 4CRDA 2Y7ZA 2CN0H 5C67A 1UTLM 1H4WA 1S81A 2Z9LA 3GY2A 3HGPA 1KLJH 2BD7A 1C1MA 1BDAA 2FTLE 5HM2A 1T8NA 1V2VT 1H8DH 2ZTYA 1GBTA 1O2XA 3S69A 1KDQA 2ZNKH 3LU9B 1TNKA 5F8TA 2G00A 5CHBA 1DFPA 2VVUA 3M5LA 1SQOA 1NFUA 1YPGH 2H2ZA 4GCHF 1O5GH 3S9AA 3UFAA 1CBWB 1KMHB 3Q00A 2VWOA 1V2UT 3UIRA 1O2ZA 5EG4A 1FN6A 2CMYA 1FNIA 1TPPA 2ZFFH 1A5GH 1O2IA 4YOIA 1K1OA 3RXLA 9LPRA 1IQGA 1V3XA 4JK5A 1A3BH 5ABWA 1GI1A 4A1VA 4MPXA 1PYTC 4FXGH 4AG1A 1SKYE 2OBOA 4AFQA 1C2FA 1D9IA 1DWEH 3TNSA 3LGYA 2LP6A 2SGQE 4JZIA 2IJOB 4SGBE 4ZH8A 2G51A 3TJVA 3SOSA 1A5IA 2F3CE 2VWNA 3W94A 3BG4B 2YMSB 1CO7E 2ZPQA 2W26A 1O2RA 1UCYH 3F0OA 1C2KA 3Q3KA 1PQ7A 1SMFE 2FWWA 3GCNA 1HAHH 2ESTE 2Y5FA 1SHHB 1V2ST 3KEEA 4UFFH 2Z9KA 2VIDA 1UTKA 2QXIA 1EP6A 2PSYA 3WWFA 4DOQA 2FODA 1RTFB 4O9VA 2OQ5A 2J34A 3SQEE 3H7OA 2EC9H 4XD7D 1G2LA 3A7VA 5TCCA 1GI5A 1HYLA 4INHA 3SJKA 3SU1A 5EJ1A 4ABDA 1TPOA 1S0QA 4B2BA 2EQNA 1EPTB 1RXPA 1YGCH 1IQFA 1P06A 1FN8A 4Y7BA 3KQ5A 1IQEA 4DGJA 4WXVA 1MBMA 3U8TH 2LELA 1TOCB 2BMGB 5E0HA 2OK5A 1L4ZA 2BZAA 2P8OC 2FPZA 4BAKB 5A8XA 3I78A 1CQQA 1TRYA 2VVVA 5IK2D 1S84A 3RXMA 2YMSC 8KME2 1P3CA 1GBLA 4FUBA 4X1QU 3BTHE 1K9OE 1V2RT 1BRCE 1F2SE 4OS7A 2KFWA 4FU7A 1QL7A 4OS5A 3DCLA 4WH8A 4ESTE 1LHGH 4JYUH 2WPKS 1CA8B 1KY9A 3RXVA 5IYTA 4XE4A 2HLDD 4Y8YA 4JCNA 4ZKOU 3A8DA 4U2WA 1C1OA 4BTTB 1E79D 1TWXB 1ZZZA 3OX7U 2A2QH 3T27A 4X1PU 1QQUA 1FY3A 1JIRA 1HXEH 5F8XA 1GBIA 1GDQA 2TGDA 1ACBE 1MMJN 3GCHB 3VB5A 1O3BA 3F1SB 1ZYOA 4ZHMU 1GJ5H 2CK3D 1Y8TA 2ZKSA 2W5EA 4FVBA 1TLDA 1YPHC 5DKMA 5EQQA 3A82A 5EXMA 1V2KT 3B9FH 1BT7A 1O2PA 2BZ6H 3AAVA 1OP8A 1QCPA 1W10U 3GS9A 3UOUA 4CRFA 1MD8A 4NSVA 4Y0ZE 5GNDA 1TMUH 4TPYA 1EXFA 1ANDA 2F9PA 1EKBB 1O31A 3QX5H 1JOUB 2BX3A 1FAXA 3SV7A 3ZV9A 3FZZA 3UNRA 3A7ZA 5J4SA 1C1SA 5HIZA 1CE5A 1H9LB 5A2MH 1YPHE 1P02A 3HKIB 4I8HA 1HJ9A 6GCHG 5GWZA 1K21H 3RXSA 4WH6A 1SFQB 2GCTC 2BY7X 5C94A 1YKTA 4DCDA 3A7WA 3VG8A 3GY7A 3E0PB 5HMAA 1AB9C 1PPGE 4WY3A 2ZGXH 1SGEE 2OINA 1Q3XA 1V2JT 1NFWA 1MCVA 3A7XA 2XRCA 5SGAE 3SZEA 2FI5E 1Y3WA 1YBWA 5GPIB 2ZQ2A 3R0FA 1RIWB 3OSYA 2EY4C 4LZ4B 1HJAB 2CHAC 1GI4A 1ZPCA 2SFAA 1NRRH 7GCHF 3BEIB 3E0NB 1G36A 3GDUA 1UTJA 3DSOA 1YY3A 2FOCA 4CR5A 1K1JA 3L3TA 3VFEA 5EXNA 4I86A 3NPSA 2O8WA 4YXWD 1EUFA 4B75A 1VGCB 1NY22 1AKSB 2VWMA 3HGNA 4ZKSU 2HVYB 2ZIQH 1FV9A 3SQHE 3VB3A 1ELVA 3SU2A 3F9HA 4HI3A 3SUFA 3UAIC 4AC9A 1EZUC 1BRUP 1NFYA 1U6QA 3BSQA 1CHGA 3ODDA 1P57B 4ZCNA 1OWIA 3BEFB 5AHGH 3DSPA 2OUAA 1AHTH 2AMQA 4YZUA 3UTUH 2BY8X 1RRKA 3T5FH 2Q6DA 4M9FA 1IHSH 1TNLA 3MO6A 5K0HA 3MYWA 1PQ8A 2G8TA 1BBRK 2Z94A 3O8CA 4AN7A 3SV8A 3NKKA 2WPMS 3A89A 4RKOB 3RUOA 2XXLA 1O2WA 1BBRE 2FIRH 2KM0A 1E1QD 1TOMH 3SI4H 1HRTH 1L4DA 7LPRA 2ZC9H 1N6YA 3SNAA 4YO9A 2A45B 2CV3A 2YMSD 4ISHH 3B23B 1EAUA 1ABIH 4FVDA 2UWLA 2GDDA 2V35A 4GVUA 1EFRD 1GVLA 2BX4A 4RI0A 1ZHMA 2WPHS 2WZQA 1AVWA 1HFDA 4ABHA 4F4OC 2J98B 2RDLA 3RLWH 1C2JA 1N1LA 1BCUH 1GJ8B 2PUQH 1LPKB 3BIVH 2ALPA 2QGRA 1O2OA 1ZR0A 4K1TA 1O5EH 2ZCLP 3RXHA 3GDVA 3RXIA 1S0RA 2WPDD 3SUGA 1NPMA 4M7GA 4KELA 1UK3A 1LHDH 5AFYH 4UD9H 1A7SA 3A83A 4THNH 2STBE 1HDTH 4IS5A 1UTPA 2KZ4A 1O2NA 2BDHA 4ZROA 4Q4LA 4ABJA 3GYLB 2BYAX 1C4U2 1GBAA 1QJ1B 3M36A 1O3LA 2ZFTA 3MH7A 3KYGA 2G5VA 3M5MA 4MG3A 2WPIS 1Z71A 4X8SH 2C8XB 4H6TA 3AK5A 1C4V2 3JZ2B 1F5LA 1MABB 2ODQA 2P8OB 1A0HB 1OS8A 6ESTA 2Y81A 2EA3A 3BTKE 3FFGA 2ZGJA 1RJXB 3IITA 3ZZAA 1S83A 5J4QA 1AWHB 4X2XA 3RC4A 3AVZA 1BJUA 2QV1A 3RXRA 4QT8C 2AMDA 2ZU4A 4ZKNU 3SU5A 2TGTA 2RA3A 2R2WU 4KGAA 1UJ1A 2XBVA 2G4UA 4AG2A 2ZGCA 1GBCA 3A87A 2OLGA 3EA8A 1AO5A 1O2MA 1TNHA 1GMDF 1MU6B 2XBWA 3A8AA 1DSTA 4FUDA 3K65B 1AI8H 1D3DB 1ZPZA 3VB6A 2RG3A 5K7RA 2D1JA 1LPGB 4XDEA 3PM3A 1S6HA 3F68H 4B1TA 2C3SA 1WCZA 1TPAE 1N8OC 3LJJA 2ZG0H 3R3GB 5L2YH 1AD8H 1E34B 3ZIAD 2V3OH 3DFLA 5T1VA 1S6LA 4BXWA 3OFND 1D4PB 1F5RA 1K2I1 1YCPH 3U69H 3LONA 4ZUHA 3MNXA 1QY6A 1YCPM 3SI3H 1Y3VA 1QBOA 2QF5A 1PQ5A 3HK6B 3HATH 1HXFH 1MQ6A 2C8YB 2AFQB 4NCYA 3PRBA 4YT6H 1FDPA 3KQBA 1O2TA 2EI6A 6CHAB 3CS7A 4LXBH 1XXFA 3RXPA 2F9OA 4X8VH 1C5WB 2QC2A 2XNDD 1CVWH 1A2CH 1QL9A 3LGUA 1FY4A 1HAGE 2JJ2D 3GY6A 5DPAA 5TCAA 1MKXH 2HNTE 1MZAA 1WTGH 5DP4A 4X6OA 4K1EA 3ZVDA 1IQJA 2I6QA 2IPQX 2AH4X 1O5DH 3NUMA 1E0FD 4BXSA 3DSGA 3HKJB 4MPUA 3EQ0H 3VB4A 2ANYA 1CHOG 2J38A 3CNRA 2BY9X 5CHAB 3SU6A 1PPFE 2HWLB 2ZGHA 4GHTA 1O36A 3G01A 2JH0D 3E1XB 3QGJA 4J1YA 1C5LH 1HV7A 1QQ4A 2XTTB 3O8BA 3GY5A 1FXYA 5EIYA 4ASUD 2P3UB 3QZRA 1W7XH 1GI2A 5GIBA 5T6FA 1J17T 1GI6A 1MBQA 4DY7B 1Z7KA 2Y5HA 1O3GA 3KN2A 3ZVCA 4E7RG 5DO4H 1TNJA 2BY6X 2ZU2A 4IN2A 2P3TB 3SUDA 4JMYA 2C90B 4U32A 4INLA 1SGQE 1L2EA 1P10A 2WV9A 3FKSD 5JYIA 2NU2E 1DE7H 5GCHG 1TONA 3U1IB 4NIWA 3FN8A 1ZMJA 2BQ7B 1DSUA 1FZZA 3GCTG 1XKBC 4E05H 1GJDB 1J8AA 3PTBA 3E8LA 4DURA 1HPGA 4AORA 8ESTE 1VR1H 2GVFA 2PP6A 2BQWB 1EJNA 3SNBA 1QHRB 1FLEE 3TH3H 3UB0A 2A5KA 2QY0B 4WJG2 3ZVBA 2L6OA 1OYTH 2PKAB 3SORA 1Z1IA 5FBIA 4WXIA 3SNCA 5JBCS 1V6DA 3H7TA 1NU7B 4X8TH 3UNQA 3AASA 4CR9A 1FQ3A 2ZFRH 3M61U 1P9UA 4I31A 1C2MA 1AMHA 4CHAB 2V3MA 1PPCE 1A3EH 3A88A 1MAXA 5DJ7A 4F49A 1MTVA 4AGKA 4OGYA 1PPZA 2V6NA 1LVMA 2FYQA 3LDXH 2A5AA 4UE7H 2XYAA 4FU9A 3UOPA 5LPEA 2CGAA 1L0ZA 3A84A 2J9NA 4ASHA 1C5TA 1DWDH 1Y5UT 5FAHA 1P05A 1C9TA 2JH6D 2P16A 1PYTD 2J95A 2RDEA 1O2SA 2ZDNA 3KIDU 3S7HB 1NO9H 1NM6A 1A5HA 1DPOA 4Y8ZA 1YWUA 2YNBA 4J2YB 4NIXA 3RC6A 3MQKC 3F6UH 1SR5C 4X2WA 4AOQA 1C2EA 2B0FA 1DDJA 2TIOA 1ELGA 2A4OA 1TMTH 1GHBF 1FY8E 1SGPE 4KTSA 2Z3DA 3V7TA 1GI9B 3OYPA 1GI0A 5FPTA 1H8ED 4K2YA 3UUZA 5DN6D 7GCHG 2BHGA 3BG8A 2OXSA 3BTGE 2TGPZ 4X6MA 4CHAC 1TX8A 4D9QA 5FX5A 4NG9H 5EPNA 4BAMB 1AGJA 2BD2A 1LCYA 3H09A 5FX6A 3U28C 3E6PH 2ZDAH 4B74A 4Z1MD 1HAIH 1TYNA 3PB1E 3E90B 2VGCC 2VVCA 8GCHF 2OBQA 3Q76A 3B8JA 4DJZB 4D76A 2HALA 3TGIE 2SNWA 2F43B 4TY6A 2H9HA
chains in the Genus database with same CATH topology
3K9XB 1KXFA 3LH3A 2GV7A 3D49H 1KXBA 1AIXH 1QR3E 1EAXA 1O3HA 2FO9A 1FAKH 3P17H 2HNTF 2VINA 4AB9A 3RMOH 4MQAA 2K1QA 2BOHB 4CH2B 1M9UA 2FS8A 2QAAA 4D7GA 4FUHA 2ZTZA 1YM0A 1CA0B 2Q6FA 4FUIA 1W14U 2XBYA 3TPIZ 1GCDA 3ZZ6A 2ZZUH 3ITIA 3SV9A 4FUCA 4ZXXH 4OS1A 3HK3B 3RXEA 2BDIA 1F92A 1HGTH 2BVSH 2ZEBA 4ZHAA 2W7SA 1LVOA 1GHXH 1F0RA 4O3UA 3UY9A 2SNVA 4ZKRU 3FP6E 1J14A 2JKHA 1W8BH 3LT3A 1LO6A 3O8RA 1TGBA 1IAUA 2RCEA 4GCHG 5JBTA 4UFDH 1BB0B 3SNDA 4IBLH 1SPJA 1DY9A 1GMHG 3MU4A 3TK9A 1JWTA 1O3EA 4Y76A 1TX6A 3ZZ4A 5DP9A 1WUNH 2NU0E 1A0JA 2FESH 2AIQA 2FI3E 2HRVA 2F91A 1TBZH 2FX4A 4MPWA 1SGNE 4NWLA 2VIWA 1INCA 1ZGIA 2FMJA 2ZDVH 1QBVH 5A09A 5FPYA 4CRBA 4YOJA 4K1SA 1LVYA 1BQYA 1ZOMA 1W11U 1AZZA 1C5VA 1UVPA 3BV9B 1YLDA 1RS0A 3WY8A 1SL3A 4Y6DA 1UHBB 2BXTH 3EA9A 2Y7XA 1BRBE 2VIPA 4NWKA 1FY1A 4TWYA 2Z3EA 1VCQA 3HPTB 3NZIA 1GJ6A 2FOFA 4FUGA 3QTOH 4AYYB 4X2YA 2ODYB 2UUKB 4NIYA 3VXFH 4IMQA 4O03A 1ELFA 3FP7E 3RXAA 1ETTH 1P03A 1MH0A 1LVBA 1HAVA 4BOHA 3U1JB 2WPLS 3BIUH 1P01A 3NK8A 1ARBA 1TBRH 3EYDA 1O3JA 3TH4H 1TGTA 1BRAA 2W3KA 1SSXA 4LOYH 3K2UA 4ABAA 1DLKB 3I29A 3LC3A 4VGCB 2BDGA 1SC8U 4A6LA 2XC0A 3AW0A 1SQAA 1GHYH 2AGIX 1ELAA 3GCTF 2JH5D 4X6NA 4JK6A 4MNVA 4JYVH 4I33A 1SOZA 1DUAA 2XW9A 1A1RA 1GBDA 4BTUB 1YPMH 1E35B 1P12E 2KAIB 1AN1E 2GT8A 1TE0A 1J15A 1QRXA 1UTNA 3T62A 3MWIU 2XBXA 3MU0A 1G37A 4TPIZ 2FTMA 1CT2E 1C5ZB 3D62A 3P8NA 2VIOA 2OCVB 2WV4A 2B7DH 1EX3A 1GG6C 2BVXH 2NU1E 1OSSA 2ZCKP 4NZQA 1DANH 2QN5T 2FOEA 2ZHWH 5L6NH 1DXWA 1IQKA 2GTBA 2G55A 2HPPH 4U01A 3RLYH 3M3VA 2Y82A 3TNTA 1O5CB 1Z8GA 1ZLRA 2QIQA 4ZMAH 2ZU5A 3TH2H 3BTDE 3MH4A 1ZHPA 3RMMH 1NROH 5C5NA 3E91A 4I8JA 4WWYA 5EXLA 1C2GA 2UUJB 1ZRKA 4GHQA 1V2QT 4E7NA 3M7UA 1X7AC 2C8ZB 4B2AA 5C3NA 3SGAE 5DP7A 3D65E 3RXOA 1KLTA 1O5FH 5BRRE 1MTNC 3KNXA 1EASA 3TIUA 4ABGA 1KXAA 2VWLA 3SNEA 1T7CA 2B9LA 2D2DA 1AY6H 4YLQH 3UQVA 3QUMP 1XUFA 2G52A 2Y6TA 1T8OA 1KLIH 2A1DB 1MTUA 2AGGX 1OP0A 5HXFA 1TRMA 2BLOA 3DT0H 2OC0A 4IGDA 1GJBB 1SGYE 1TQ7B 5GJ4B 1QB1A 1KXEA 1S85A 1IQHA 2Y80A 3T29A 2FDAA 3PROA 3DD2H 2FP7B 1ZTLA 2ZDKA 1EAIA 3M3SA 4AB8A 3DUXH 2Z9GA 2J2UA 1GGDC 4KP0A 1QFKH 2BM2A 1VITG 2QXHA 3RXKA 2A5IA 4ISIH 4KKDA 1SB1H 2FS9A 5E0GA 1CU1A 3MU8A 4FUFA 1EP5A 2GZ7A 2G4TA 1VITF 2SGDE 4R0IA 5L30H 1DICA 2ULLA 1BA8B 2WUBA 3RXTA 1C1TA 3MOCA 1YPJH 5HGGA 1QA7A 1P04A 2ZA5A 2O8LA 5BPEA 2CJIA 2W7UA 1LDTT 2ZF0H 4NSYA 2AIPA 3ATIA 4WMFA 3TK5A 3MU1A 1Y3XA 3GDSA 1P2OA 2FM2A 3P8FA 1GG6B 2LPRA 2TRMA 5C1YA 3QZQA 1F7ZA 4JYTA 5EQRA 1SLUB 1D3PB 2JETC 5JB9S 1EZXC 1BUIA 1HAVB 4JZDH 1GDUA 4UFEH 5T6DA 1K28D 3TJOA 2STAE 4AFZA 1C5RA 2ZQ1A 3SV6A 1DX5M 1D6RA 1W12U 1SVPA 1Y3YA 3MTYA 2XWBI 1UHBA 1NRSH 1DOJA 1QNJA 2J4IA 2BB4A 4AX9H 4CRCA 1GMCF 3ODFA 4A1XA 2EI7A 1SHYA 2R9PA 5LPRA 4ZHLU 2I6SA 1NESE 1Y5BT 5DP3A 1W13U 1O32A 1UCYE 3FANA 1T31A 5B6OA 2XNIA 3K6YA 1PPHE 1HNEE 3TLOA 3VPKA 1W2KH 1ZSKA 1P2NA 4I8KA 1C1PA 5ETXA 1AKSA 2YOLA 3P8OA 4ABBA 1LHCH 2OTVA 1C5OH 2XC4A 2F9BH 2PUXB 2ZI2H 3A85A 1SBWA 2FOGA 1PJPA 1GWAA 1GCTC 4RN6A 2F9UA 1QRZA 2Z9IA 1TABE 2GCHG 1DLEA 3TK6A 1GBMA 4OS2A 5A0CA 4ABIA 3F9GA 4OS6A 2TBSA 2ZWLH 1TA6A 2O8TA 5DGJA 1L1NA 1SGFA 1TGNA 1BMNH 3KL6A 1F0SA 1AUTC 4Y79A 4MVNA 4VGCC 1C1UH 1P3EA 2BDAA 4X0WU 1EZQA 4NA8A 3V0XA 4XFQA 2AS9A 1P09A 2A7JA 5FCRA 1AWFH 2ILNA 2WYGA 3SJIA 1LMWB 1HJAC 2CHAB 1EOJA 1ZPBA 2EEKA 1LQEA 3RXCA 1ABJH 3FAOA 1DS2E 1AU8A 3MHWU 4RSPA 1C1WH 1K1IA 1T32A 1YPKH 2GZ9A 1T4UH 1O3IA 1SG8B 2SGEE 1HAYB 2A7CA 2GD4B 1XUKA 1MU8B 1E38B 2A0QB 4B76A 5LH8A 3V12A 1TGCA 1NN6A 4X1RU 2BD8A 3ELAH 2H6MA 4UDWH 4MDSA 3SU4A 2F9VA 5I46H 1ZRBA 3NCLA 4OS4A 3VB7A 2P3FH 1O3PB 1B0EA 1H1BA 4Z0KA 5EW2H 1Z6EA 1RGQA 2HGTH 1V2OT 4Q7XA 3EGKH 4IW4E 1MKWK 1LTOA 3KQEA 1P2IA 1NT1A 3A81A 1QGFA 1HBTH 1TGSZ 2P95A 1V2MT 1ZMNA 2BDYA 8LPRA 4X1NU 5GDSH 2Z9JA 1XMNB 2AYWA 2GCTB 3Q3XA 1SGFG 1O2QA 1LHEH 4ZXYH 3W95A 1ELCA 2GCHF 3CS0A 2ANKH 2QYIA 1YP9A 4JZFH 3ZVAA 1MTNB 2VNTA 4XBBA 3LGVA 1CT0E 2R0LA 2CF8H 3FVFB 3KGPA 1P8VC 3BTQE 1N8OB 5CHAC 1BIOA 3RXQA 1MKWH 4NA7A 1CA0C 1TA2A 1DVAH 1HUTH 2TPIZ 1FMGA 4R8TB 1GGDB 4GAWA 3UR9A 1C4Y2 1O3OA 1C5UA 2BXUH 1W3CA 3RDZA 3S9CA 1HJ8A 1FIWA 1GL0E 2C4FH 3PO1B 1EB2A 4K8BA 1UTOA 1UK2A 1HIAA 2OC1A 4D9RA 4LK4A 1XUIA 1UMAH 3LJOA 4X6PA 4I8GA 1CGJE 3N7OA 4Y11E 1QB6A 1UVSH 3ATKA 1C2LA 1SOTA 4Y8XA 4CH8B 1O5BB 3VGCB 3U8OH 5DP8A 4XBCA 3GCOA 1GMCG 3BTME 5JB8S 1IOEA 3T2NA 1L1JA 1UO6A 2UUFB 3GYMA 5JBAS 3KQDA 4MNXA 1GBHA 2SGAA 1P2QA 4O97A 3QGNB 1WYKA 1YPLH 1F0TA 3KHVA 4TWWA 3ZZ9A 2ALVA 2HOBA 5PTPA 1UVTH 2PKAA 1OOKB 3QK1A 2GKVE 2R2MB 1NS3A 1P9SA 3JZ1B 1CSOE 3P70B 5F6MA 1VGCC 2SGFE 4H42U 3PMHB 2VIVA 1H8IH 4HZHA 1XUGA 2D26C 3LKWA 2FXRA 6GCHF 1C1QA 3NWUA 1V2TT 3AW1A 1HIAB 1G3CA 1Y3UA 3QN7A 1NTPA 1JXPA 1WU1A 3EAJA 3QTVH 2YNAA 3P95A 2O8MA 1JIMA 2QF0A 4XSKU 3RU4T 1AUJA 4ABEA 1SGTA 2BD4A 4K3JA 2H5DA 1GHZA 5C1UA 1QIXB 1QBNA 1Q2WA 2FOBA 3URCA 4MNYA 5C20A 2AEIH 1C5MD 2A32A 3Q77A 1D6WA 1WQSA 4CBNA 3LGIA 1MTWA 4NA9H 1O33A 2PW8H 4DVAU 1AFEH 2F9NA 4GPGA 4XOJA 1ZTJA 1ORFA 1VZQH 2BTCE 1V2WT 3GY3A 4Y10E 1BZXE 3UREA 1WBGB 2IPHA 3BTWE 3RXUA 1Z8IB 1O2VA 1MZDA 4O3TA 2GX4A 4I7YH 1GMHF 4GLYA 3UNSA 1SGDE 2PHBA 1AE5A 1C5PA 2VGCB 1QA0A 1XVMA 3E3TA 5GXPA 3SHCH 4FUEA 1UVOA 3MU5A 1BTYA 2O9QA 1UTQA 1IHTH 2C93B 2ZGBH 1GJ9B 5F03A 2VIQA 4Y7AA 1K1NA 4FUJA 2PLXA 1WOFA 3RP2A 1BMAA 3TGKE 1AQ7A 5DK1A 4XBDA 3A7TA 1ZSLA 3LPRA 3LGTA 1RTKA 3MFJA 3M7QA 1NRPH 1TB6H 4D8NA 2PTNA 3BTTE 1PPBH 1EJAA 1GCTB 3ZVGA 4HTCH 1O2LA 2CXVA 3KCGH 3LOXA 4TYDA 5E2PA 5CMXH 2W3IA 2PWXA 2Z6BD 1QB9A 1EZSC 1B5GH 2GT7A 1KIGH 1GHBG 3SV2H 3GY8A 4ISOA 1ANCA 1DWCH 5CE1A 2XWAA 4RKJB 5AFZH 1KDQB 1O5AB 2XC5A 1TBQH 3SUEA 1ZJDA 1C9PA 1PFXC 2ODPA 1F5KU 1LHFH 4A1TA 1FY5A 2FX6A 5TJXA 1W7GH 1C1NA 3MNCA 1TFXA 4AYVB 1N6XA 2PKSC 1C2DA 2Q1JA 1CHOF 3BTEE 5JPMH 3RM2H 1LQDB 5G4BA 1TIOA 1VJAU 3ZVFA 3LH1A 3MNBA 1TMBH 2BD5A 3SZNA 1S6FA 3RMLH 4OGXA 3C27B 2ZU3A 4CRAA 1F0UA 2PR3A 4K69A 1BTPA 1V2PT 5FXLA 3F9EA 1EQ9A 2QA9E 3PLKA 2VU8E 1C5XB 3A7YA 2ZTXA 1GDNA 3ZYEA 3QLPH 1NRQH 4WMDA 2ZHFH 1EPTA 3PMJA 1BJVA 1A4WH 1H9IE 2UWOA 3RXDA 1BTWA 1XX9A 3AAUA 1K1LA 1C5YB 3IWMA 2PV9B 5AVDA 1QTFA 1TX7A 2NU4E 5JBBS 1Y59T 1HAXB 3BN9A 4NGAH 1O2HA 1FPCH 1FIZA 1O34A 1O2YA 1ZSJA 2GMTB 1GMDG 4I8LA 1FJSA 1CBWC 6LPRA 1Z1JA 2OQUA 1W0ZU 1GBFA 3RMNH 1BTZA 3T28A 5EPYA 1ZHRA 3ZVEA 1YLCA 2KAIA 3EDXB 1GI7B 1GBJA 1MQ5A 5LPFA 1ANBA 1GJAB 1NC6A 2ANWA 2GDEH 2FLBH 2WPJS 4AGJA 2OC7A 4INKA 2CF9H 1GBKA 1RD3B 1J9CH 1EJMA 2DUCA 1GHAF 1G3EA 2PSXA 1C1VH 2PGBB 4Y71A 1AFQB 4NFEA 3Q3YA 3RM0H 3FP8E 3LC5A 1C2HA 3PMBB 3FZDA 4AFUA 5GCHF 3S0NA 3QWCH 2FOMB 4AFSA 4YLUA 3ZZBA 1YPEH 1GI8B 3GY4A 2R0KA 3OY6U 3PYHA 2ZCHP 3S7KB 5F8ZA 2B8OH 4TY7A 1MTSA 1UTMA 1EB1H 2BD9A 5EOKA 1J16A 1MKXK 1ID5H 1OPHB 3PWCA 4DIHH 1FUJA 1GHWH 1K1PA 1THRH 2H9TH 5C5OA 3V3MA 5FCKA 4IN1A 1T8LA 2Z3CA 2EI8A 3SBKA 1FI8A 1VCWA 1JRTA 5C2ZA 1KXDA 4B2CA 2P94A 1T4VH 3MI4A 1O30A 5I25A 2BLWA 1G3DA 3EE0B 3F9FA 1S82A 3CENA 3CP7A 6CHAC 3NXPA 1ELEE 1MCTA 2FI4E 1XM1A 2PFEA 2FOHA 1B7XB 1VCPA 1QURH 1HCGA 1YF4A 1O38A 1CGIE 2FZZA 3C1KA 1OX1A 3M37A 2ZFSA 3RU4E 2WUCA 4DW2U 9ESTA 2ZPRA 3A8BA 1O3FA 4Q7ZA 1GBEA 2Y5GA 3QO6A 2IN2A 1RTLA 2ZHEH 3UWJH 3ATLA 3RC5A 1DUEA 2P93A 4BAOB 1NU9A 1GPZA 1CT4E 1OWHA 1OWDA 4X8UH 1OYQA 2R3UA 3M7TA 1C5SA 2A31A 3SGQE 4Y0YE 1ELBA 1Z6JH 2OP9A 4H6SB 2VH6A 1ESAA 4Z6AH 2G5NA 1LPZB 4E06H 5LGOA 3TGJE 2J94A 3DHKH 1BMLA 5EGMA 3L33A 2FYRA 2GP9B 4ISLA 1BTXA 2PTCE 3SHAH 1BHXF 5FHTA 1TAWA 4MTBA 3A8CA 1UK4A 4UONA 4K5ZA 3OTJE 3GISB 1C5NH 1T8MA 1LKAA 5EU8A 2WYJA 3SJOA 3SU3A 1YYY1 3ATWA 2FLRH 3PO1C 3H5CB 1HAOH 1HAPH 1ESBA 1A46H 3OU0A 1Y5AT 2BLQA 4K8YA 4B73A 2ZP0H 2ZPSA 3SW2B 4SGAE 3RXGA 4ZAEA 3TITA 1O37A 3SJ8A 2ZO3H 1L1GA 3RU4D 4CRGA 1ZMLA 2HVXA 4LZ1H 2ZDMA 5T6GA 1O2JA 5DG6A 1UVUH 4BNRA 4GUXA 3MH5A 1TALA 2BLVA 1TPSA 1K1MA 2M5TA 5JDUB 2H1UA 2DE9A 3M5OA 4X2VA 1A61H 1NZQH 1G3BA 1FPHH 1NRNH 1P0SH 2O8UA 1QJ7B 2AERH 1BTHH 1EAWA 3ZZ8A 2PKSB 3STIA 4CREA 1HB0B 2A2XH 1BHXB 2P59A