4ZROA

2.1 a x-ray structure of fipv-3clpro bound to covalent inhibitor
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
299
structure length
299
Chain Sequence
b'SGLRKMAQPSGVVEPCIVRVAYGNNVLNGLWLGDEVICPRHVIASDTSRVINYENELSSVRLHNFSIAKNNAFLGVVSAKYKGVNLVLKVNQVNPNTPEHKFKSVRPGESFNILACYEGCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGTLYFVYMHHLELGNGSHVGSNLEGEMYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMTLESYNAWAKTNSFTEIVSTDAFNMLAAKTGYSVEKLLECIVRLNKGFGGRTILSYGSLCDEFTPTEVIRQMYGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title X-ray structure and inhibition of the feline infectious peritonitis virus 3C-like protease: Structural implications for drug design.
pubmed doi rcsb
source organism Feline coronavirus (strain fipv wsu-79/1146)
molecule tags Hydrolase/hydrolase inhibitor
total genus 85
structure length 299
sequence length 299
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 4zroA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4zroA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4zroA01
2OQUA 4TWYA 1XVMA 3OYPA 1A46H 3GCTG 4KTUA 1T7CA 1RS0A 4X1RU 1V2VT 2ZTXA 2Z7FE 4JMYA 2O8MA 1D3QB 4DG4A 1SGNE 2ZCKP 2BX3A 4TPIZ 2FIRH 2W26A 2GTBA 5H4IB 5FPTA 2RG3A 4ZHLU 3SW2B 2ZGBH 2BDHA 4LK4A 5G4BA 2OC7A 3RC4A 2BY8X 4CRBA 2BOKA 2BY6X 3VXFH 3SN8A 1C1RA 1ZTKA 1B5GH 2BDIA 2HVXA 3RXBA 1FNIA 1TABE 1Z1IA 5DO4H 1F0SA 4FUDA 1UK2A 3CENA 1XUIA 4WMDA 1EPTC 3NUMA 3SUEA 3F9HA 1T8OA 1YCPK 1QB6A 3U1JB 2ZHEH 2HRVA 2J38A 1NC6A 3Q76A 1GBJA 2FOEA 3UY9A 1QFKH 1Z8GA 4D76A 5JBAS 2W3KA 1LVOA 5AF9H 1GVLA 1BTZA 1UCYH 1PPGE 2FXRA 3PWBA 2AYWA 4K3JA 1GI7B 4AORA 3AW1A 1KLJH 3D62A 2C8ZB 2ZGXH 1NTPA 1QQUA 3BIUH 4X6MA 3RU4D 1SQOA 3GOVB 1BMLA 5DPAA 2I6QA 3A7ZA 2BYAX 1J8AA 1CQQA 1O5BB 2EI8A 1NROH 1NFXA 2ZU1A 2Y5HA 3MU4A 1ZSKA 1UTMA 3AAVA 2PUXB 3SGBE 4LZ1H 1C1NA 4X8VH 3TNTA 5E2OA 1TQ7B 4QT8C 3QN7A 1S81A 3R0FA 3TH2H 2P3UB 4K1SA 1C5NH 1CGIE 1ESTA 4GHTA 2H5CA 2A5IA 2C8YB 1M9UA 4YT7H 4Y76A 3GCNA 1E36B 1W7XH 2ZFQH 2XBWA 3FANA 2PFEA 1ELVA 1O2GH 1GHWH 4CH2B 8LPRA 1MBQA 4OS5A 1ZSLA 3A84A 1GI0A 5B6OA 4ABJA 3WY8A 3C27B 1OKXA 1AFEH 4DY7B 1TALA 2PGBB 2OINA 1CE5A 2WINI 2UWLA 3VEQB 2F9UA 3ATLA 5FCRA 2ZTYA 1GBTA 1YYY1 2GZ8A 7ESTE 4R0IA 3SU3A 1CA8B 3E6PH 2ZFSA 2WPLS 4Y8YA 1SFQB 4NZQA 2FI5E 2ZU3A 3U98H 3RM2H 2BLVA 4THNH 1RTFB 3P70B 1UTQA 3CS0A 4KELA 2Z9LA 1RXPA 2JH6D 2F3CE 2VIWA 4Y79A 3SU1A 1LKBA 1IOEA 2Y81A 1E38B 1EX3A 1FN8A 3CP7A 3LPRA 3URCA 1DWCH 3JZ2B 2ZGJA 1IQHA 1F7ZA 3ZVDA 1EAUA 4UDWH 2A7JA 1C2FA 1IAUA 4KP0A 5GCHG 1C4Y2 2V3HH 4YT6H 1EZUC 4K2YA 5FX6A 2PKSC 1ZPZA 3HGPA 5ESTE 2D1JA 3EYDA 5FPYA 3EA9A 1NESE 4FUBA 4KGAA 3RXRA 3RXLA 1F5LA 1CSOE 3SNAA 1YPLH 1WYKA 3K6ZA 4X8SH 3BTQE 1QBVH 1N6XA 4BAQB 4WXVA 5JB8S 4B2CA 5BPEA 1BITA 1LHGH 3NKKA 1RTLA 4X6OA 3TJUA 3OY6U 3SQHE 2IN2A 4INHA 1Y5UT 2J9NA 4K1TA 4ASHA 3ZZ4A 3GY2A 4ISIH 2OCVB 1THRH 2XBVA 1K1JA 3RP2A 4GAWA 1OS8A 2QF0A 4TY7A 4I31A 2IPHA 1GBLA 3VGCB 2YNBA 2BD8A 3GY3A 1BMNH 1VR1H 1V2TT 1TE0A 8GCHG 1V2MT 2FYQA 2PKAB 1BTHH 2SGQE 5HYOA 2QXGA 1ANBA 1ZZZA 1P2QA 1EZXC 3KNXA 1ELFA 2FLBH 3ZYEA 1PFXC 3SGQE 2XWAA 1NFWA 3MMGA 1BA8B 4Z6AH 1QL8A 3SNBA 1FXYA 1NN6A 1OWIA 1DITH 2K7XA 1ZHMA 2FEQH 1ZMLA 1XUFA 1GG6B 1ZGVA 3SJ8A 2C93B 3TITA 4X6PA 1U6QA 2TGTA 1UJ1A 1JMOH 3A8CA 1G3DA 4JZFH 1O3JA 1HAVB 4FUGA 1B0EA 3M7TA 2ZDMA 3UPEA 4MNVA 1Q31A 1TNKA 2PR3A 2A4QA 2B9LA 1XXDA 1L2EA 1NO9H 3MYWA 2F9BH 1XUHA 4I8KA 1W0ZU 4ZAEA 2RA0A 1VCQA 4FXGH 4JYVH 3DUXH 1PQ7A 1WTGH 2ODYB 1LHEH 4INKA 4UEHH 5JDUB 1C5ZB 1BUIA 1TYNA 2ZECA 1FAKH 2QXJA 5DG6A 1A5HA 1TIOA 1HAYB 1G30B 2ZGCA 2BY7X 1DPOA 1V2UT 3HK6B 2QXIA 4B1TA 1PYTD 2FTMA 3FFGA 1YKTA 4I8HA 1GHAF 4ABBA 5ETXA 1EB1H 3SU6A 1S0QA 2STBE 3ZVAA 2ZPRA 2ULLA 4A5TS 4CRAA 2W3IA 3ITIA 1ZRKA 2RCEA 5DP8A 4X1QU 5DP7A 3VGCC 4MVNA 3V0XA 4X2WA 1TOMH 1RRKA 3E1XB 2PUQH 2V6NA 1LQDB 4WF8A 5C2ZA 1AUJA 2WYGA 1NPMA 1CBWB 4H4FA 5HM2A 5TCAA 3SUFA 3VB3A 3DT0H 1BBRH 4IN2A 1O31A 4GPGA 5EODA 1L4DA 2R9PA 2SNWA 4CR9A 1QL9A 1MD7A 1O33A 1BRCE 1K9OE 1C1OA 1CVWH 3I77A 1Z6EA 4M7GA 1O2MA 3F68H 3GCTF 1O2RA 1A7SA 2XRCA 3LC3A 2UUYA 1GG6C 1MTNB 2FODA 1TMBH 1XXFA 1JOUB 1YPKH 3A7VA 4NWKA 4MNYA 2PHBA 1E35B 2Y82A 9LPRA 2BZ6H 4XSKU 4UONA 1EAXA 5I46H 2QXHA 2SGEE 3HPTB 1ZR0A 2VGCB 4GVUA 2XYAA 1O5DH 1XUKA 2A45B 3URDA 4Q2KA 5A8XA 1T8LA 2G52A 1SLVB 3VPKA 2THFB 2HGTH 7LPRA 1GBCA 1UTNA 2M5TA 3U9AH 2VIDA 1F0UA 4FU8A 1EOJA 1EZQA 1C5LH 1EASA 4R8TB 1TRNA 2Z9IA 1ETTH 4ZH8A 1Y8TA 1YPHC 2KAIB 1EPTA 4MLFB 2OP9A 1MD8A 5DP6A 4TYDA 4U2WA 5DKMA 1KYNA 3BTGE 3NCLA 4LXBH 2FOHA 3BTEE 1GWAA 4B74A 2J4IA 2OQ5A 1L1JA 3GICB 5E8EH 1E34B 1DDJA 1TA6A 1O5GH 2F9VA 1C5XB 3A85A 3O8RA 4B2BA 2BZAA 5AHGH 4DJZB 4AGJA 1DXPA 1K1MA 3Q3KA 3M3TA 1LKAA 3AVZA 3E0PB 2Z9KA 4I8LA 5DK1A 3A7YA 1G32B 1GBBA 4UFGH 4AG1A 1SGRE 1C2JA 1E37B 1CBWC 3PTBA 5E2PA 3RXQA 1N6YA 3V13A 1LCYA 2ZG0H 4Q7YA 1ZLRA 1BRAA 2UUFB 1LPKB 3M5NA 5C1XA 1GMCF 5F8TA 1ZPCA 3TIUA 4B71A 2CV3A 1F92A 2OBOA 2W7SA 1W11U 2HLCA 5E0HA 3PM3A 4Y10E 4OS7A 2A5AA 3LJOA 1C2EA 1H8DH 2FPZA 1BIOA 3P92A 2ANKH 1HJAB 2PWXA 4KKDA 1QJ1B 3T2NA 2ZDVH 1LDTT 1MTNC 2ZU4A 1QTFA 4BTUB 2BD9A 3OTJE 1YGCH 1O3HA 1EJAA 1SGIB 2HPPH 2ZC9H 3UNQA 2WV5A 1GI3A 3N7OA 4LOYH 4O3TA 1NY22 2VGCC 3QTVH 3KF2A 3UOPA 1P10A 3SJIA 2GMTB 1EAIA 4GCHG 3GISB 4MPUA 5L6NH 3W95A 3P17H 1J16A 2R3YA 2PSYA 3MU0A 2SGFE 1ORFA 1GJAB 5K0HA 1LQEA 5HGGA 1A0HB 1EXFA 2B8OH 1C2DA 3LGIA 2A7HA 2GCHG 4Y11E 3E0NB 1A61H 2ZHWH 2O9QA 3A8DA 2V3OH 1SG8B 1P03A 2HNTE 4F49A 1P57B 3TGJE 3TK5A 1YP9A 1MKXH 3LGWA 1W7GH 3P8OA 4DOQA 1GJ6A 3UTUH 1BTPA 1DANH 4ABEA 2R2MB 3PMHB 5JYIA 3SU2A 4WMEA 2C90B 5SGAE 1GHVH 1N8OB 1C1VH 1YM0A 4NA8A 4AFSA 1V2NT 1ZMJA 1O2WA 3ZZBA 2WV4A 3RXEA 6ESTA 1O2JA 1ELDE 1P2OA 1FY3A 2ODPA 1OP2A 1O3CA 5GCHF 1DE7H 3MO6A 1C5UA 3ENSB 1IQLA 1KY9A 2PLXA 1FLEE 4I8JA 1O2ZA 1WBGB 2PW8H 4WXIA 1O5AB 4U30A 3T29A 4BOHA 1OXGA 4A6LA 3PB1E 5CMXH 2W5EA 2G55A 1QRWA 1C2IA 5TJXA 3RU4E 1SQTA 4K5ZA 4SGBE 1QBOA 1O2SA 1A5IA 2OUAA 3W94A 2QC2A 1HJAC 2K1QA 1BOQA 1OOKB 3AW0A 1K22H 4CHAB 1X7AC 1CGJE 1PPHE 4ISOA 1PQ8A 1AUTC 3QTOH 1GBMA 2ZWLH 2BDCA 1SFIA 3PTNA 1O3OA 3ODDA 2GZ7A 4X2VA 1L1NA 1ABJH 2VWOA 3MO9A 4FUHA 3ZVGA 4XOJA 3SU5A 1KXAA 5EGMA 3HKIB 4YLQH 1K1NA 1OP0A 4XFQA 1MQ6A 1O2UA 3LT3A 2GCTB 1HBTH 6GCHG 3KN2A 1WSSH 3I29A 1AU8A 4NFEA 1DT2A 2SGDE 2QV1A 3SV8A 8GCHF 2SFAA 4D8NA 1Y59T 4YTAA 1FY1A 2VVVA 3A7XA 4Y0YE 2VH0A 5GDSH 2WUCA 4CREA 4CRGA 2VWMA 2PSXA 2BQ7B 3RXFA 1P01A 1EP5A 2ZIQH 1TGSZ 4GHQA 1VGCB 1SGCA 2ZDAH 2TPIZ 1W3CA 3ZZ6A 1ANDA 1L0ZA 1N8OC 2NU2E 3QLPH 4TY6A 1C1WH 1GMHG 2CHAC 2QCYA 1O38A 1VITG 1DM4B 1SQAA 1P04A 1PPBH 4Y8ZA 5JPMH 1HYLA 4HI3A 2GDEH 1E0FD 1SBWA 1HAHH 3O8BA 2UWPA 3RLWH 1C5TA 3EA8A 2XCFA 3PMJA 1V2RT 1GI4A 2FOCA 2HNTF 3ATKA 3TH4H 1SPJA 2YNAA 1SOTA 2G4TA 5EOKA 1O39A 4K8YA 2IOTA 5FAHA 1SGPE 2A31A 1O3MA 4JZ1A 1PJPA 5E0GA 5T6GA 1JIMA 3PLPA 1HB0B 3BEUA 3A83A 3MOCA 3RXCA 3RXAA 2D2DA 1FY5A 1TPPA 3ESTA 2LIZA 2A32A 3SJKA 1IQIA 3RXPA 2GZ9A 3M5MA 1OYQA 2GCTC 5FCKA 4D9QA 4WVPE 1UTKA 2Q6FA 4INLA 3SV2H 1O2YA 1AIXH 2PKAA 2SGAA 2ZI2H 2H9HA 4OGXA 3TJOA 3RC6A 3PYHA 4X8UH 1UVSH 5HMAA 2QN5T 1NU7B 1NM6A 1RIWB 3LH1A 1CU1A 1QA7A 1NZQH 4RSPA 1ARCA 1ELBA 2XTTB 1O3IA 1DVAH 1Z1JA 3CS7A 3E8LA 1ELTA 1VGCC 5A0BA 4ZKOU 2Z9JA 2TIOA 1TX7A 3OSYA 1P2JA 1W8BH 2AERH 3STJA 1C5VA 1TNJA 1YCPM 5AVDA 1O3AA 4ISLA 2AGEX 5F8ZA 4ZKSU 3RMLH 1SMFE 4VGCB 5DP4A 3M5OA 1HGTH 1AKSB 3A88A 1BMMH 3F9EA 2A4OA 5FBIA 2TGPZ 4IW4E 1TA2A 1HAVA 3M3VA 2XC4A 1CT2E 1V2ST 3UREA 3VXEH 2BB4A 4KTSA 3LONA 2AH4X 2Y80A 5ABWA 2WYJA 1ELCA 1PPCE 3RM0H 3RXIA 4NIWA 3KIDU 4PROA 4O9VA 3UQOA 1HAOH 2EEKA 4CH8B 1BHXB 1JXPA 5JB9S 1HAIH 1BCUH 2ZHQH 4X2YA 2BHGA 1HV7A 3FAOA 5HM9A 4JZDH 1GI2A 1NRPH 1UMAH 1UK3A 3RXOA 1Y3XA 3IG6B 1S0RA 1TX6A 2BVXH 2J34A 3BTME 4Q7ZA 4WY3A 3QGJA 3ZYDA 2F9PA 3Q3YA 1AZZA 2G51A 2Y7ZA 1C5YB 1ANCA 2C3SA 1DLEA 3A8BA 3BG4B 4I8GA 1GBEA 4AGKA 1C1TA 1O36A 3LU9B 2XW9A 3TPIZ 1INCA 4D9RA 1D3TB 2GDDA 1C2GA 4YO9A 2ZDLA 1OPHB 3UWJH 2FESH 3K65B 3S7HB 5A8YA 3MTYA 3ZZ9A 1RGQA 1T32A 4DURA 2B5TB 1MTUA 1XMNB 2TBSA 1QIXB 1HXFH 2GVFA 3HK3B 1RIWC 1QB1A 1OSSA 1SLXB 4CRFA 1TNIA 1ANEA 4NCYA 2XBYA 3T62A 2EI6A 4ZHAA 1HAGE 2QY0B 3LC5A 1O2PA 1FJSA 5FBEA 1GHXH 4A1XA 4DW2U 4HFPB 2P93A 4VGCC 5FXLA 1CHGA 3ATMA 1SLUB 1TPSA 1H9LB 3MFJA 1KDQB 1SGFG 1B7XB 1MZAA 2G00A 1EAWA 2ZFFH 2Z6BD 3S9AA 1Q3XA 1BTXA 4SGAE 4DVAU 1D3DB 1HXEH 4YLUA 1V2WT 4FVBA 3TNSA 1SB1H 1GHYH 4GCHF 1C5RA 3M7QA 3MNSA 2O8TA 1NS3A 2F9OA 5EW2H 4MNWA 1WOFA 2H2ZA 1IQEA 1G37A 2TRMA 2ZQ1A 3LOXA 3M35A 1H9IE 2KAIA 4LZ4B 1Z8JB 2Z9GA 3IITA 1AY6H 2GD4B 4NIXA 2GCHF 1QCPA 1UO6A 3ZZ8A 1SI5H 2ZZUH 3SQEE 5EPNA 1QRXA 1YPJH 4BAKB 3SO3A 1C1SA 3AAUA 1EP6A 3DA9B 3BG4C 2BVSH 1TPOA 2ODQA 3HATH 1ZHPA 1PPZA 2O8UA 1C2HA 3VB6A 1D6RA 3ZVCA 1B0FA 1LTOA 3GY8A 3F6UH 2FX6A 3AASA 4K8BA 2OBQA 1TNLA 3QX5H 1TBZH 1YC0A 2H5DA 4GUXA 1O30A 2XCNA 4XDEA 4OS1A 4E05H 3BTHE 3SOSA 2AMDA 1G36A 3RXSA 1HUTH 6CHAB 2H9TH 2QF3A 5TCCA 3TVJB 2ASUB 1OWDA 3SUDA 1P05A 1O2IA 1MQ5A 1XUGA 1V6DA 5L30H 3RXDA 1ZYOA 2BOHB 4UD9H 2XBXA 4ABGA 1GJ7B 1IHSH 3NXPA 1HIAB 1RJXB 1QJ6B 5E0JA 2Q6DA 2FOAA 2ZKSA 5IDKA 2HALA 3S0NA 4FUFA 2WUBA 4MPVA 3ZZ5A 3TH3H 2AEIH 2W7UA 1O37A 4D7GA 2A5KA 1S6HA 1A0JA 2VINA 4Q80A 5T6FA 2GT7A 1UCYE 2PGQB 2ZCHP 1EZSC 1GMDF 1V2LT 4AFZA 1KTSB 1WQVH 1OWJA 5C5OA 4X1PU 5JBTA 1UVPA 1ETSH 4A1TA 1AN1E 2F91A 4OGYA 1A2CH 4H42U 2JH5D 9ESTA 2AS9A 2F9NA 2G4UA 4YOJA 3SORA 4CBOA 5C3NA 1LVMA 2A4GA 1MTSA 5LPFA 3ZV8A 2ZFPH 3IWMA 3A81A 3LDXH 3P8FA 1SGDE 5C5NA 1GI6A 3LKWA 1GCTB 1QNJA 3RC5A 2AIPA 5EU8A 1XUJA 1Y5BT 1GHBG 2ALPA 3P95A 4MG3A 3Q77A 2A7CA 1HPGA 2ZA5A 1FMGA 2R2WU 1HAXB 2XWBI 1NRQH 2QGRA 3RDZA 1FONA 3SV7A 1QA0A 3O8CA 3K6YA 1AE8H 3BN9A 4OS6A 1GMHF 3FP6E 3LGUA 2J95A 1ZTLA 1VITF 1WV7H 2Q6GA 1GDQA 2BM2A 4MNXA 4ZKRU 3MH6A 2IJOB 4AG2A 3A8AA 2AFQB 3STIA 3T26A 5EW1H 5L2ZH 2B7DH 5DP9A 1P2KA 2VIVA 6CHAC 1C1MA 2ZGHA 3SI4H 3BV9B 4WJG2 1CT0E 1GDNA 3T5FH 4A92A 2AIQA 1MCTA 3B23B 3PV4A 1VJAU 3TU7H 2NU3E 1F0RA 4Y7BA 1D6WA 1HJ8A 4IC5A 3SI3H 3M7UA 1HDTH 1UTJA 4MQAA 1EUFA 2J2UA 4WH6A 1O2NA 1C4V2 4HGCA 1P09A 2P95A 2H6MA 3DHKH 1O3BA 3D65E 1KXBA 4ABDA 1UVTH 3MH7A 5CE1A 2PV9B 3F1SB 3ZVFA 1CA0B 4B76A 3LIWA 4I7YH 2OXSA 1GJDB 4H6SB 4X6NA 2CGAA 1HAZB 1HNEE 1ESAA 3TJVA 1PPEE 2A4RA 1O0DH 2OLGA 2BLWA 1EB2A 1G9IE 3BTTE 1L1GA 4HZHA 1DUAA 1GJ9B 1AB9B 1FV9A 1DSTA 1G3EA 5GXPA 1T8MA 3KL6A 1DICA 1TB6H 1ELAA 3A80A 1DWBH 1TPAE 1BTWA 1C5OH 1FIWA 2F83A 3TK6A 4E06H 4MPWA 3U8RH 3RMNH 1TX8A 4BTTB 1GCTC 4RKJB 4X1SU 2ZEBA 1P11E 1N1LA 2FP7B 4UFFH 1P12E 2RA3A 2J94A 1BRUP 2G5VA 2BX4A 5ESBA 1WUNH 3RMOH 1FDPA 1EQ9A 1UHBB 3PROA 2WPHS 1K1LA 2CXVA 4MDSA 3GY4A 3PMAB 1QB9A 1DUEA 1C1UH 1GVZA 1UVOA 1D3PB 1ZHRA 2CN0H 1GI8B 1IQFA 4IC6A 3F9GA 4ZUHA 2WPKS 1P2IA 3KQCA 1MU8B 1F5RA 4Y7AA 1A4WH 1AVWA 3ZZCA 2ILNA 1A3BH 4ZXYH 4NWLA 2C8WB 1P06A 2ALVA 2VB0A 2YOLA 4Y0ZE 1D9IA 1G2LA 1TLDA 5IYTA 1H9HE 3G01A 1H8IH 5C1YA 3MO3A 1SL3A 3GDVA 5GWZA 3FZDA 1Y3VA 1V2JT 1YPEH 1IHTH 1YPGH 1K2I1 4YESB 3GY7A 1DWEH 2VIQA 1CA0C 1MUEB 1NU9A 3QZQA 3PO1B 3EA7A 2HPQH 4F4OC 1KXEA 1ZSJA 3VFEA 4BXSA 2P59A 2G8TA 1P3CA 4TWWA 1C9TA 2A2XH 1NT1A 1AGJA 1J15A 3S7KB 1XKAC 3RMMH 1AB9C 1MH0A 5C67A 3RXVA 2GP9B 1P2NA 4Q7XA 4NSVA 5LPRA 4IMQA 1MCVA 4ZMAH 3MWIU 4DGJA 1TFXA 1OWHA 3UUZA 4GSOA 3FP8E 2Q1JA 3FP7E 3L33A 1TBRH 3MH4A 3E16B 1W14U 4FUCA 3T27A 1GJ4H 4AB9A 4JYTA 3DD2H 1AKSA 1P8VC 1Z8RA 3SJOA 3UR9A 3U69H 4IGDA 4X0WU 2R0KA 2Y6TA 5EQRA 1GHAG 1BMAA 1DFPA 2NU1E 2GMTC 1WCZA 4O3UA 4BANB 2OTVA 1DY9A 1SGFA 4NFFA 1AO5A 4J2YB 1S5SA 1YCPH 2Z3EA 1EJNA 2OC1A 3SHCH 2FS9A 3QO6A 3ZZDA 1ETRH 4NIVA 1C4U2 1W10U 3SV9A 4WWYA 3S69A 4RN6A 3MH5A 3TGIE 3EDXB 1CT4E 5T6DA 3L6PA 2XC0A 1QRZA 2ZFRH 3U8TH 2Y5FA 4ABHA 1BZXE 1MKWK 4FU7A 1YPHE 1ARBA 2VJ1A 2FZZA 3RU4T 4XBDA 3K9XB 2BMGB 1THSH 3B8JA 1YLCA 1O5EH 1Y3UA 1BBRE 3UNRA 1V3XA 1W13U 5A0CA 1UTPA 2BD4A 3RLYH 1C2MA 5A2MH 1O3FA 1ZJKA 1O5CB 1ELEE 2FX4A 2ZDNA 1C9PA 3TJNA 2RDLA 3PO1C 1C5SA 1NFUA 1XM1A 3SU0A 3BTDE 4UFEH 2BD3A 3DFLA 4MTBA 1ID5H 3BTFE 3LGVA 2FYRA 3S9BA 4DIIH 1ZGIA 1K1PA 3DFJA 1QBNA 3D23A 4IS5A 3V12A 1G3CA 2BDGA 2ZP0H 3KEEA 4CRDA 2ANWA 1TGBA 4CHAC 2GT8A 4Y71A 2Z94A 1C5PA 2AMPA 1LHCH 3SNDA 4Y6DA 3GCHB 5AFZH 3H7TA 1W0YH 4JCNA 3PLKA 5EG4A 1ZOMA 1G2MA 4WMFA 2BDBA 1LVYA 2DE9A 1ABIH 1TBQH 1TAWA 1NRRH 2ZQ2A 1KDQA 4I33A 1NRSH 1O2QA 2Y7XA 3QGNB 4NZLA 1AVGH 4BNRA 1YPMH 1TQ0B 3A82A 1IQJA 1FUJA 1RFNA 5J4SA 3NK8A 1GBFA 1O5FH 1MMJN 1QJ7B 2B0FA 2FOFA 1K28D 1CHOG 2P16A 3B9FH 2QIQA 2WPMS 5A8ZA 3HGNA 2PKSB 3KHVA 4RKOB 1C5MD 5L2YH 4BAOB 5HXFA 1LPZB 4AFQA 1GMCG 3GCOA 1CO7E 2BTCE 1XVOA 3T25A 3BTWE 4YZUA 1KTTB 1KSNA 1O34A 3FVFB 5EXMA 1KIGH 1EKBB 2FLRH 1BDAA 1FAXA 1LO6A 1T4UH 5EPYA 1C5QA 2JH0D 3E90B 1K1IA 1DWDH 1TGCA 1GHBF 2FI4E 1KXFA 3UIRA 2BVRH 3HKJB 1RTKA 3H7OA 4IBLH 1UCYK 2FO9A 1W2KH 2CMYA 1S6FA 2BD5A 2TGDA 1FN6A 3S9CA 1MTWA 4NIYA 3E91A 4DIHH 1Y3YA 5JBCS 3A89A 2AMQA 3EE0B 4XBBA 4FUEA 5C20A 3GDSA 1FY4A 1C2KA 1THPB 3SJ9A 1GBDA 2VVCA 4X8TH 2ESTE 1AQ7A 1UTOA 3UNSA 1TMTH 3GCHC 2GV7A 2J92A 1F5KU 3SGAE 1Z6JH 1C1PA 4BTIB 2OD3B 1A5GH 1HIAA 2HOBA 3GY6A 3RXTA 5DGJA 2AGIX 5EXLA 2O8LA 1PQ5A 1LHFH 2VNTA 1O2LA 3SZNA 4FUJA 1O2HA 1C5WB 1V2PT 1GBAA 3JZ1B 4NA9H 3RXUA 3MNBA 5F03A 3PWCA 1V2QT 3KCGH 3VB5A 2ZHDA 4A7IB 1F0TA 1NRNH 3ZZ7A 2VIPA 4OS4A 3UFAA 2EC9H 3P6ZB 3NWUA 3M3SA 1MZDA 2AGGX 3BEFB 4J1YA 5LH8A 2ZF0H 2QAAA 1MAYA 2WPJS 1DSUA 1C2LA 1Z7KA 3MI4A 1BJUA 4K1EA 4AN7A 1MAXA 1YF4A 1BTUA 2OC0A 2UWOA 1KLTA 3R3GB 1PPFE 3EGKH 5FPSA 2GKVE 2GGVB 2ZNKH 2XXLA 1DS2E 7GCHG 1O2XA 3VB4A 1O32A 1GDUA 4JYUH 4DCDA 3D49H 4KTCA 1GJBB 2Z3CA 2ANYA 1H1BA 1TRMA 2ZPQA 2R3UA 1LPGB 2VH6A 1BQYA 2CF8H 1TWXB 1GHZA 3GY5A 1GI1A 3ZZ3A 4JK6A 8KME2 1OP8A 4Z0KA 1NFYA 1GCDA 2PTNA 1O3DA 2DUCA 1F2SE 3PMBB 1RD3B 3ATIA 1EATA 4FU9A 2V35A 2NU4E 3I78A 2ZCLP 1AE5A 2VVUA 4AX9H 2BDAA 1SHHB 1Y5AT 1O3LA 3LJJA 4ESTE 1AMHA 1FIZA 2EA3A 2VWLA 2P3FH 2FDAA 1ACBE 1LVBA 1LHDH 1FPCH 1GJCB 2UUJB 1K1OA 2TGAA 3P8NA 1EJMA 3H5CB 1OYTH 1QGFA 3MU5A 2BQ6B 1P9SA 3SV6A 1Z8IB 3SNCA 1TGNA 3TK9A 4Y8XA 4FUIA 1DX5M 1WQSA 1O35A 4UE7H 2C8XB 4BAMB 5DJ7A 3ZVEA 4MPXA 3KGPA 4ABFA 4AYVB 4E7NA 1WTHD 3A87A 1GBHA 1BJVA 3ZV9A 1V2OT 1FPHH 1HLTH 2SGPE 3RXJA 5JBBS 3KQBA 3SU4A 3PLBA 2ZO3H 4CBNA 1GI9B 1KXDA 2DE8A 2HNTC 3SBKA 1ESBA 2UUKB 1O2KA 2ZHFH 4B75A 2JETB 1L4ZA 1BTYA 2BLQA 4BXWA 4GLYA 1O3EA 1S83A 3P8GA 4X2XA 4OS2A 1SR5C 3MHWU 1SGEE 2FOGA 3BEIB 3V3MA 1UHBA 2A2QH 4I32A 1TGTA 1FI8A 3KQEA 1AI8H 2P3TB 6GCHF 4NG9H 4BAHB 1A0LA 1J9CH 1ZMNA 3MU8A 1QL7A 5PTPA 2BD7A 2FWWA 5C1UA 3M61U 5FHTA 1IQNA 1ZRBA 1BRBE 2G5NA 2XNIA 5T3HA 1YLDA 3QUMP 2BLOA 2P94A 8ESTE 3BF6H 4CR5A 1HJ9A 1O3GA 1A3EH 4AZ2B 1DOJA 1K21H 4X1NU 1BT7A 1BB0B 2PTCE 1SGYE 1AZ8A 1HFDA 1OWKA 4YM9A 4YOGA 1OX1A 1TNGA 4JZIA 1GVKB 1O3NA 2GX4A 4CRCA 3BIVH 3LGYA 3A7TA 1VZQH 1SOZA 1ZJDA 1LMWB 4FVDA 1P3EA 1KLIH 5LGOA 2BQWB 2LNCA 4ISHH 4ZXXH 4XBCA 1GPZA 2V0BA 3LGTA 5GIBA 2FTLE 1AFQB 3MU1A 2ZPSA 1ELGA 1VCPA 4ABIA 1P0SH 1JIRA 3SUGA 4IMZA 5GPIB 2C4FH 2NU0E 1DXWA 3UQVA 3ODFA 5A0AE 2Y5GA 1P2MA 5F8XA 1T4VH 2JETC 3QK1A 3EAJA 1HRTH 2GV6A 3TGKE 1BBRK 1GJ5H 1S84A 2STAE 2A0QB 3OU0A 1JRTA 2JKHA 4JZEH 3RXGA 3FZZA 3BTKE 3M37A 2HWLB 2BDYA 5LPEA 4H6TA 3LH3A 1T31A 1Q2WA 6LPRA 1O2TA 1V2KT 1WAYB 3K2UA 1IQKA 4D7FA 3QDZB 2BXTH 4AB8A 5J4QA 4ISNA 1CHOF 2G81E 1PQAA 1KXCA 2BXUH 2LPRA 4HTCH 3GDUA 5FX5A 5GJ4B 2ZDKA 2BY9X 4AFUA 2VU8E 1GGDB 1SSXA 2BY5X 3RXHA 2FOBA 1TONA 2VWNA 4XE4A 1XX9A 3A7WA 4U01A 1SGQE 4ABAA 2EI7A 5EXNA 2P8OB 4O03A 2FMJA 1GJ8B 3KQDA 2Z3DA 4NSYA 3Q3XA 5CHAB 3EBNA 3BG8A 3RUOA 3M36A 3U1IB 1DY8A 3M5LA 1IQMA 1OWEA 1JBUH 2ZU2A 4ZHMU 1WU1A 4UFDH 4AYYB 1J17T 1FZZA 1Y3WA 3Q00A 1VJ9U 5EQSA 4ZROA 1MTVA 3BSQA 2SNVA 3OX7U 3O8DA 3MNCA 2ANMH 2ZFTA 4K60A 1GL0E 3ELAH 3QZRA 4WH8A 3VB7A 1UTLM 1AVXA 1DLKB 1AFQC 2H1UA 5DP5A 1P9UA 2H9EH 2FI3E 1D4PB 1FQ3A 1UVUH 1ZPBA 3L3TA 3ZZAA 3U8OH 2A1DB 4YOIA 1TMUH 4NA7A 3V7TA 1O3PB 3ZVBA 3EQ0H 3UOUA 3OY5U 2I6SA 2D26C 1CGHA 1ZTJA 2XC5A 1TNHA 1AWHB 1O2OA 1SVPA 1IQGA 2ZU5A 2FS8A 1GBKA 5BRRE 1Z71A 5AFYH 1TRYA 1AD8H 1W12U 5EQQA 3UWIA 3ATWA 2CF9H 3MNXA 1UK4A 3GYLB 4DT7B 5DP3A 4AOQA 1MBMA 4NGAH 2FOMB 1O3KA 1H4WA 4K69A 7KMEH 1MKWH 2CHAB 2VIOA 4ZKNU 3UR6A 4A1VA 4B2AA 4E7RG 1S82A 1A1RA 2QA9E 5A09A 2FM2A 1MU6B 1G3BA 3T28A 1GGDC 2QYIA 4U32A 1QY6A 1EPTB 4TPYA 1SLWB 1AWFH 2P8OC 3QWCH 5K7RA 1QR3E 1QHRB 3SHAH 5CHAC 3F9FA 1SHYA 1J14A 3C1KA 1T8NA 1C1QA 2CJIA 1GI5A 1VITH 1FY8E 3NPSA 4JK5A 1HAPH 1SGTA 3TLOA 1VCWA 1MKXK 4O97A 3NZIA 7GCHF 2OC8A 3SNEA 3RXKA 2D8WA 4B73A 1HCGA 2R0LA 1GL1A 3GYMA 1TOCB 2BD2A 5I25A 1AHTH 1QURH 1P02A 3A86A 1O2VA 1QQ4A 3E3TA 1XKBC 2ZTZA 5F6MA 1BHXF 1S85A 1GMDG 1JWTA 1PYTC 3RXMA 1SC8U 4IN1A 2O8WA 2NWNA 1GBIA 1JRSA 1YBWA 2WPIS 1EOLA
chains in the Genus database with same CATH superfamily
2OQUA 4TWYA 1XVMA 3OYPA 1A46H 3GCTG 4KTUA 1T7CA 1RS0A 4X1RU 1V2VT 2ZTXA 2Z7FE 4JMYA 2O8MA 1D3QB 4DG4A 1SGNE 2ZCKP 2BX3A 5DSFA 1E1QD 4TPIZ 2FIRH 2W26A 2GTBA 5H4IB 5FPTA 2RG3A 4ZHLU 3SW2B 3OEED 2ZGBH 2BDHA 4LK4A 5G4BA 2OC7A 3RC4A 2BY8X 4CRBA 3PRBA 2BOKA 2BY6X 3VXFH 3SN8A 1C1RA 1ZTKA 1B5GH 2BDIA 2HVXA 3RXBA 1FNIA 1TABE 1Z1IA 5DO4H 1F0SA 4FUDA 1UK2A 3CENA 1XUIA 4WMDA 1EPTC 3NUMA 3SUEA 3F9HA 1T8OA 1YCPK 1E1RD 1QB6A 3U1JB 2ZHEH 5C17A 2HRVA 2J38A 1NC6A 3Q76A 1GBJA 2FOEA 2QF4A 1QFKH 1Z8GA 3UY9A 4D76A 2W3KA 1LVOA 5AF9H 5JBAS 1GVLA 1BTZA 1UCYH 1PPGE 2FXRA 3PWBA 2AYWA 4K3JA 1GI7B 4AORA 3AW1A 1KLJH 3D62A 2C8ZB 2ZGXH 1NTPA 1QQUA 3BIUH 4X6MA 3RU4D 1SQOA 3GOVB 1BMLA 5DPAA 4B6EA 2I6QA 3A7ZA 2BYAX 1J8AA 1CQQA 1O5BB 2EI8A 1NROH 1NFXA 2ZU1A 2Y5HA 3MU4A 1ZSKA 1UTMA 3AAVA 2PUXB 3SGBE 4LZ1H 1C1NA 4X8VH 3TNTA 5E2OA 1TQ7B 4QT8C 3QN7A 5FL7D 1S81A 3R0FA 3TH2H 2P3UB 4K1SA 1C5NH 1CGIE 1ESTA 4GHTA 2H5CA 2A5IA 2C8YB 4P00A 1M9UA 4YT7H 3KYGA 2HLDD 4Y76A 3GCNA 1E36B 1W7XH 5EJLA 2ZFQH 2XBWA 3FANA 2PFEA 1ELVA 3FN8A 1O2GH 1GHWH 4OM9A 4CH2B 8LPRA 1MBQA 4OS5A 1ZSLA 1SQRA 3A84A 1GI0A 5B6OA 4ABJA 3WY8A 3C27B 2LELA 1OKXA 1AFEH 4DY7B 1TALA 2PGBB 2OINA 1CE5A 2WINI 2UWLA 3VEQB 2F9UA 3ATLA 5FCRA 2ZTYA 1GBTA 3F3BA 1YYY1 2GZ8A 7ESTE 4R0IA 3SU3A 1CA8B 3E6PH 2WSSD 2ZFSA 2WPLS 4Y8YA 1SFQB 4NZQA 2FI5E 2ZU3A 3U98H 3RM2H 2BLVA 4THNH 1RTFB 3P70B 1UTQA 3CS0A 4KELA 2Z9LA 1RXPA 2JH6D 2F3CE 2VIWA 4Y79A 3SU1A 1W0JD 1LKBA 1IOEA 2Y81A 1E38B 1EX3A 1FN8A 3CP7A 3LPRA 3URCA 1DWCH 3JZ2B 2ZGJA 2IJD1 1IQHA 1F7ZA 3ZVDA 1EAUA 4UDWH 2A7JA 1C2FA 1IAUA 4KP0A 2JJ2D 1C4Y2 5GCHG 2V3HH 3KQ5A 4YT6H 1EZUC 4K2YA 5FX6A 2PKSC 3OFND 1ZPZA 3HGPA 5ESTE 3PRDA 2D1JA 3EYDA 5FPYA 3EA9A 1NESE 4FUBA 4KGAA 3RXRA 5HKKD 3RXLA 1F5LA 1CSOE 3SNAA 1YPLH 1WYKA 3K6ZA 4X8SH 3BTQE 1QBVH 1N6XA 4BAQB 4WXVA 5JB8S 4B2CA 5BPEA 1BITA 1LHGH 3NKKA 1RTLA 4X6OA 3TJUA 3OY6U 3SQHE 2IN2A 4INHA 1Y5UT 2J9NA 4K1TA 4ASHA 3ZZ4A 3GY2A 4ISIH 2OCVB 1THRH 2XBVA 1K1JA 3RP2A 4GAWA 1OS8A 2QF0A 4TY7A 4I31A 2IPHA 1NBME 1GBLA 3VGCB 2YNBA 2AHME 2BD8A 3GY3A 1BMNH 1VR1H 1V2TT 1TE0A 8GCHG 1V2MT 2FYQA 2PKAB 1BTHH 2SGQE 5HYOA 2QXGA 1ANBA 1ZZZA 1P2QA 1EZXC 3KNXA 1ELFA 5T1VA 2FLBH 3ZYEA 1PFXC 3SGQE 1SKYE 1K0HA 2XWAA 1NFWA 3MMGA 1BA8B 4Z6AH 1QL8A 3SNBA 1FXYA 1NN6A 1OWIA 1DITH 2K7XA 1ZHMA 2FEQH 1ZMLA 1H8HD 1XUFA 1GG6B 1ZGVA 3SJ8A 5CHBA 2C93B 3CNRA 3TITA 4X6PA 4B6FA 1U6QA 2TGTA 1UJ1A 1JMOH 3A8CA 1G3DA 4JZFH 1O3JA 1HAVB 4FUGA 3F2HA 2KR7A 1B0EA 3M7TA 2ZDMA 3UPEA 4MNVA 1Q31A 1TNKA 2PR3A 2A4QA 2B9LA 1XXDA 1L2EA 1NO9H 3U28C 3MYWA 3SZEA 2F9BH 3F2GA 1XUHA 4Z1MD 4I8KA 1W0ZU 4ZAEA 2RA0A 1VCQA 4FXGH 4JYVH 3DUXH 1PQ7A 1WTGH 2ODYB 1LHEH 4INKA 4UEHH 3UB0A 5JDUB 1C5ZB 1BUIA 1TYNA 2ZECA 1FAKH 2QXJA 5DG6A 1A5HA 1TIOA 1HAYB 1G30B 2ZGCA 2BY7X 1DPOA 1V2UT 3DSOA 3HK6B 2QXIA 4B1TA 1PYTD 2FTMA 3FFGA 1YKTA 4I8HA 1GHAF 4ABBA 5ETXA 1EB1H 3SU6A 1S0QA 2STBE 3ZVAA 2ZPRA 2ULLA 3FKSD 4A5TS 4CRAA 2W3IA 3ITIA 1ZRKA 2RCEA 5DP8A 4X1QU 5DP7A 3VGCC 4MVNA 3V0XA 4X2WA 1TOMH 1RRKA 3E1XB 2PUQH 2V6NA 1LQDB 4WF8A 5C2ZA 1AUJA 2WYGA 1NPMA 1CBWB 4H4FA 5HM2A 1H8ED 5TCAA 3SUFA 4XD7D 3VB3A 3DT0H 1BBRH 4IN2A 1O31A 4GPGA 1NBMD 5EODA 1L4DA 2R9PA 2SNWA 4CR9A 1QL9A 1MD7A 1O33A 1BRCE 1K9OE 1C1OA 4Q4LA 1CVWH 3I77A 1Z6EA 4M7GA 1O2MA 3F68H 3GCTF 1O2RA 1A7SA 2XRCA 3LC3A 2UUYA 1GG6C 1MTNB 2FODA 1TMBH 1XXFA 1JOUB 1YPKH 3A7VA 4NWKA 4MNYA 2PHBA 1E35B 2Y82A 9LPRA 2BZ6H 4XSKU 4UONA 1EAXA 5IK2D 5I46H 2QXHA 2SGEE 3HPTB 1ZR0A 2VGCB 4GVUA 2XYAA 1O5DH 1XUKA 2A45B 3URDA 4Q2KA 5A8XA 1T8LA 2G52A 1SLVB 3VPKA 2THFB 2HGTH 7LPRA 1GBCA 1UTNA 2M5TA 3U9AH 2VIDA 1F0UA 4FU8A 1EOJA 1EZQA 1C5LH 1EASA 4R8TB 1TRNA 2Z9IA 1ETTH 4ZH8A 1Y8TA 1YPHC 2KAIB 1EPTA 4MLFB 2OP9A 1MD8A 5DP6A 4TYDA 4U2WA 5DKMA 1KYNA 1MABB 3BTGE 3NCLA 4LXBH 2FOHA 3BTEE 1GWAA 4B74A 2J4IA 2OQ5A 1L1JA 3GICB 5E8EH 1E34B 1DDJA 1TA6A 1O5GH 2F9VA 1C5XB 3A85A 3O8RA 4B2BA 2BZAA 5AHGH 4AC9A 5F53A 4AGJA 1DXPA 1K1MA 3Q3KA 4DJZB 3M3TA 1LKAA 3AVZA 3E0PB 2Z9KA 4I8LA 5DK1A 3A7YA 1G32B 1GBBA 4UFGH 4AG1A 1SGRE 1C2JA 2V3MA 1E37B 1CBWC 3PTBA 5E2PA 3RXQA 1N6YA 3V13A 1LCYA 2ZG0H 4Q7YA 1ZLRA 1BRAA 2UUFB 1LPKB 3M5NA 5C1XA 1GMCF 5F8TA 1ZPCA 3TIUA 4B71A 2CV3A 1F92A 2OBOA 3N7DA 2W7SA 1W11U 2HLCA 5E0HA 1OHHD 3PM3A 4Y10E 4OS7A 2A5AA 3LJOA 1C2EA 1H8DH 2FPZA 1BIOA 3P92A 2ANKH 1HJAB 5GNDA 2PWXA 4KKDA 1QJ1B 3T2NA 2ZDVH 1LDTT 1MTNC 2ZU4A 1QTFA 4BTUB 2BD9A 3OTJE 2RDEA 1YGCH 5HIYA 1O3HA 1EJAA 1SGIB 2HPPH 2ZC9H 3UNQA 2WV5A 3WWBA 4I86A 1GI3A 3N7OA 4LOYH 4O3TA 1NY22 2VGCC 3QTVH 2F4LA 3KF2A 2JIZD 3UOPA 1P10A 3SJIA 2GMTB 1EAIA 4GCHG 3GISB 4MPUA 5L6NH 3W95A 3P17H 1J16A 2R3YA 2PSYA 1WXRA 3MU0A 2SGFE 1ORFA 1GJAB 5K0HA 1LQEA 5HGGA 1A0HB 1EXFA 2B8OH 1C2DA 3LGIA 2A7HA 2GCHG 4Y11E 3E0NB 1A61H 2ZHWH 2O9QA 3A8DA 2V3OH 1SG8B 1P03A 2HNTE 4F49A 1P57B 3TGJE 3TK5A 1YP9A 1MKXH 3LGWA 1W7GH 3P8OA 4DOQA 1GJ6A 3UTUH 1BTPA 1DANH 4ABEA 2R2MB 3PMHB 5JYIA 3SU2A 4WMEA 2C90B 5SGAE 1GHVH 1N8OB 1C1VH 1YM0A 2WPDD 4NA8A 2CK3D 4AFSA 1V2NT 1ZMJA 1O2WA 3ZZBA 2WV4A 3RXEA 6ESTA 1O2JA 1ELDE 1P2OA 1FY3A 2ODPA 1OP2A 1O3CA 5GCHF 1DE7H 3MO6A 1C5UA 3ENSB 1IQLA 1KY9A 2PLXA 1FLEE 4I8JA 1O2ZA 1WBGB 2PW8H 4WXIA 1O5AB 4U30A 3T29A 4BOHA 1OXGA 4A6LA 3PB1E 5CMXH 2W5EA 2G55A 1QRWA 1C2IA 5TJXA 3RU4E 1SQTA 4K5ZA 4SGBE 1QBOA 1O2SA 1A5IA 2RFKC 2OUAA 3W94A 2QC2A 1HJAC 2K1QA 1BOQA 1OOKB 3AW0A 1K22H 4CHAB 1X7AC 1CGJE 1PPHE 4ISOA 1PQ8A 1AUTC 3QTOH 1GBMA 2ZWLH 2BDCA 1SFIA 3PTNA 1O3OA 3ODDA 2GZ7A 4X2VA 1L1NA 1ABJH 2VWOA 3MO9A 4FUHA 3ZVGA 4XOJA 3SU5A 1KXAA 5EGMA 3HKIB 4YLQH 1K1NA 1OP0A 4XFQA 1MQ6A 1O2UA 3LT3A 2GCTB 1HBTH 6GCHG 3KN2A 1WSSH 3I29A 2L6OA 1AU8A 4NFEA 1DT2A 2SGDE 2QV1A 3SV8A 8GCHF 2SFAA 4D8NA 1Y59T 4YTAA 1FY1A 2VVVA 3A7XA 4Y0YE 2VH0A 5GDSH 2WUCA 4CREA 4CRGA 2VWMA 2PSXA 2BQ7B 3RXFA 1P01A 1EP5A 2ZIQH 1TGSZ 4GHQA 1VGCB 1SGCA 2ZDAH 2TPIZ 1W3CA 3ZZ6A 1ANDA 1L0ZA 1N8OC 2NU2E 3QLPH 5KGOA 4TY6A 1C1WH 1GMHG 2CHAC 2QCYA 1O38A 1VITG 1DM4B 1SQAA 1P04A 1PPBH 3VG8A 5B6LA 4Y8ZA 5JPMH 1HYLA 4HI3A 2GDEH 1E0FD 1SBWA 1HAHH 3O8BA 2UWPA 3RLWH 3WW7A 1C5TA 3EA8A 2XCFA 3PMJA 2LP6A 1V2RT 1GI4A 2FOCA 2HNTF 3ATKA 3TH4H 1SPJA 2YNAA 1SOTA 2G4TA 5EOKA 1O39A 4K8YA 2IOTA 5FAHA 1SGPE 2A31A 1O3MA 4JZ1A 1PJPA 5E0GA 5T6GA 1JIMA 3PLPA 1HB0B 3BEUA 3A83A 3MOCA 3RXCA 3RXAA 2D2DA 1FY5A 1TPPA 3ESTA 2LIZA 2A32A 3SJKA 5DN6D 1IQIA 2J98B 2GZ9A 3M5MA 3RXPA 1OYQA 2GCTC 5FCKA 4D9QA 4WVPE 1UTKA 2Q6FA 4INLA 3SV2H 1O2YA 1AIXH 2PKAA 2SGAA 2ZI2H 2H9HA 4OGXA 3TJOA 3RC6A 3PYHA 4HG6A 4X8UH 1UVSH 5HMAA 2QN5T 1NU7B 1NM6A 1RIWB 3LH1A 1CU1A 1QA7A 1NZQH 4RSPA 1ARCA 1ELBA 2XTTB 1O3IA 1DVAH 1Z1JA 3CS7A 3E8LA 1ELTA 1VGCC 5A0BA 4ZKOU 2Z9JA 2TIOA 1TX7A 3OSYA 1P2JA 1W8BH 2AERH 3STJA 1C5VA 1TNJA 1YCPM 5AVDA 1O3AA 4ISLA 2AGEX 5F8ZA 4ZKSU 3RMLH 1SMFE 4VGCB 5DP4A 3M5OA 1HGTH 1AKSB 3A88A 1BMMH 3F9EA 2A4OA 5FBIA 2TGPZ 4IW4E 1TA2A 1HAVA 2K0QA 3M3VA 2XC4A 1CT2E 1V2ST 3UREA 3VXEH 2BB4A 4KTSA 3LONA 2AH4X 2Y80A 5ABWA 2WYJA 1ELCA 1PPCE 1YWUA 3RM0H 3RXIA 4NIWA 3KIDU 4PROA 4O9VA 3UQOA 1HAOH 2EEKA 4CH8B 1BHXB 1JXPA 5JB9S 1HAIH 1BCUH 2ZHQH 4X2YA 2BHGA 1HV7A 3FAOA 5HM9A 4JZDH 1GI2A 1NRPH 1UMAH 1UK3A 3RXOA 1Y3XA 3IG6B 1S0RA 1TX6A 2BVXH 2J34A 1WDIA 3BTME 4Q7ZA 4WY3A 3QGJA 3ZYDA 2F9PA 3Q3YA 1AZZA 2YMSB 2G51A 2Y7ZA 1C5YB 1ANCA 2C3SA 1DLEA 3A8BA 3BG4B 4I8GA 1GBEA 4AGKA 1C1TA 1O36A 3LU9B 2XW9A 3TPIZ 1INCA 4D9RA 1D3TB 2GDDA 1C2GA 4YO9A 2ZDLA 1OPHB 3UWJH 2FESH 3K65B 3S7HB 5A8YA 3MTYA 3ZZ9A 1RGQA 1T32A 4DURA 2B5TB 1MTUA 1XMNB 2TBSA 1QIXB 1HXFH 2GVFA 3HK3B 1RIWC 1QB1A 1OSSA 1SLXB 4CRFA 1TNIA 2EY4C 1ANEA 4NCYA 2XBYA 3T62A 2EI6A 2KCOA 4ZHAA 1HAGE 2QY0B 3LC5A 1O2PA 1FJSA 5FBEA 1GHXH 4A1XA 4DW2U 4HFPB 2P93A 4VGCC 5FXLA 1CHGA 3ATMA 1SLUB 1TPSA 1H9LB 3MFJA 1KDQB 1SGFG 1B7XB 1MZAA 2G00A 2M2AA 1EAWA 2ZFFH 2Z6BD 3S9AA 1Q3XA 1BTXA 4SGAE 4DVAU 1D3DB 1HXEH 4YLUA 1V2WT 4FVBA 3TNSA 1SB1H 1GHYH 4GCHF 4YXWD 1C5RA 3M7QA 3MNSA 2O8TA 1NS3A 2F9OA 5EW2H 4MNWA 1WOFA 2H2ZA 1IQEA 1G37A 2TRMA 2ZQ1A 3LOXA 2EQNA 3M35A 1H9IE 2KAIA 4LZ4B 1Z8JB 2Z9GA 3IITA 1AY6H 2GD4B 4NIXA 2GCHF 1QCPA 1UO6A 3ZZ8A 1SI5H 2ZZUH 3SQEE 5EPNA 2YMSC 1QRXA 1YPJH 4BAKB 3SO3A 1C1SA 3AAUA 1EP6A 3DA9B 3BG4C 2QE7D 5KEDA 2BVSH 1TPOA 2ODQA 3HATH 3H09A 1ZHPA 1PPZA 2O8UA 1C2HA 3VB6A 1D6RA 3ZVCA 1B0FA 2JDID 1LTOA 3GY8A 3F6UH 2FX6A 3AASA 4K8BA 1YLNA 2OBQA 1TNLA 3QX5H 1TBZH 1YC0A 2H5DA 4GUXA 1O30A 2XCNA 4XDEA 4OS1A 4E05H 3BTHE 3SOSA 2AMDA 1G36A 3RXSA 1HUTH 6CHAB 2H9TH 2QF3A 5TCCA 3TVJB 2ASUB 1OWDA 3SUDA 1P05A 1O2IA 1MQ5A 1XUGA 1V6DA 5L30H 3RXDA 1ZYOA 2BOHB 4UD9H 2XBXA 4ABGA 1GJ7B 4XRNA 1IHSH 3NXPA 3SYJA 1HIAB 1RJXB 1QJ6B 5C0UA 5E0JA 2Q6DA 2FOAA 2ZKSA 5IDKA 2HALA 3S0NA 4FUFA 2WUBA 4MPVA 3ZZ5A 3TH3H 2AEIH 2W7UA 5C94A 1O37A 4D7GA 2A5KA 1S6HA 1A0JA 2VINA 4Q80A 5T6FA 4FOUC 2GT7A 1UCYE 2PGQB 2ZCHP 1EZSC 1GMDF 1V2LT 4AFZA 1KTSB 1WQVH 1OWJA 5C5OA 4X1PU 5JBTA 1UVPA 1ETSH 4A1TA 1COWD 1AN1E 2F91A 4OGYA 1A2CH 4H42U 2JH5D 9ESTA 2AS9A 2F9NA 2G4UA 4YOJA 3SORA 4CBOA 5C3NA 1LVMA 2A4GA 1MTSA 5LPFA 3ZV8A 2ZFPH 3IWMA 3A81A 3LDXH 3P8FA 1SGDE 5C5NA 1GI6A 3LKWA 1GCTB 1QNJA 3RC5A 2AIPA 5EU8A 1XUJA 1Y5BT 1GHBG 2ALPA 3P95A 4MG3A 3Q77A 2A7CA 4RT1A 1HPGA 2ZA5A 4F55A 1FMGA 2R2WU 1HAXB 2XWBI 1NRQH 2QGRA 3N7EA 3RDZA 1FONA 3SV7A 1QA0A 3O8CA 3K6YA 1AE8H 3BN9A 4OS6A 1GMHF 3FP6E 2L74A 3LGUA 2J95A 1YY3A 1ZTLA 3DSGA 1VITF 1WV7H 2Q6GA 1GDQA 2BM2A 4MNXA 4ZKRU 3MH6A 4RI0A 2IJOB 4AG2A 3A8AA 2AFQB 3STIA 3T26A 5EW1H 5L2ZH 2B7DH 5DP9A 1P2KA 2VIVA 6CHAC 1C1MA 2ZGHA 3SI4H 3BV9B 4WJG2 1CT0E 1GDNA 3T5FH 4A92A 2AIQA 1MCTA 3B23B 3PV4A 1VJAU 3TU7H 2NU3E 1F0RA 4Y7BA 1D6WA 1HJ8A 4IC5A 3SI3H 3M7UA 1HDTH 1UTJA 4MQAA 1EUFA 2J2UA 4WH6A 1O2NA 1C4V2 4HGCA 1P09A 2P95A 2H6MA 3DHKH 1O3BA 3D65E 1KXBA 4ABDA 1UVTH 3MH7A 5CE1A 2PV9B 3F1SB 3ZVFA 1CA0B 4B76A 3LIWA 3OEHD 2OXSA 1GJDB 4H6SB 4X6NA 4I7YH 2CGAA 1HAZB 1HNEE 1ESAA 3TJVA 1PPEE 2A4RA 3UAIC 1O0DH 2OLGA 2BLWA 1EB2A 1G9IE 3BTTE 1L1GA 4HZHA 1DUAA 1GJ9B 1AB9B 1FV9A 1DSTA 1G3EA 1VKYA 5GXPA 1T8MA 3KL6A 1DICA 1TB6H 1ELAA 3A80A 1DWBH 1TPAE 1BTWA 1C5OH 4ASUD 1FIWA 2F83A 3TK6A 4E06H 4MPWA 3U8RH 3RMNH 1TX8A 4BTTB 1GCTC 4RKJB 4X1SU 2ZEBA 1P11E 1N1LA 2FP7B 4UFFH 1P12E 2RA3A 2J94A 3N99A 3KYFA 1BRUP 2G5VA 2WV9A 1S6LA 2BX4A 5ESBA 1WUNH 3RMOH 1FDPA 1EQ9A 1UHBB 3PROA 2WPHS 1K1LA 2CXVA 4MDSA 3GY4A 3PMAB 1QB9A 1DUEA 1C1UH 1GVZA 1UVOA 1D3PB 1ZHRA 2CN0H 1GI8B 1IQFA 4IC6A 3F9GA 4ZUHA 2WPKS 1P2IA 3KQCA 1MU8B 1F5RA 4Y7AA 1A4WH 1AVWA 2KX4A 5C0TA 3ZZCA 2ILNA 1A3BH 4ZXYH 4NWLA 2C8WB 2KCAA 1P06A 2ALVA 2VB0A 2YOLA 4Y0ZE 1D9IA 1G2LA 1TLDA 4TT3D 5IYTA 5EJ1A 1H9HE 3G01A 1H8IH 5C1YA 3MO3A 1SL3A 3GDVA 5GWZA 3FZDA 1Y3VA 1V2JT 1YPEH 1IHTH 1YPGH 2VBCA 1K2I1 2W6ID 4YESB 3GY7A 1DWEH 2VIQA 1CA0C 1MUEB 1NU9A 3QZQA 3PO1B 3EA7A 2HPQH 2J98A 4ACBA 4F4OC 1KXEA 1ZSJA 3VFEA 4BXSA 2P59A 2G8TA 1P3CA 4TWWA 1C9TA 2A2XH 1NT1A 1AGJA 1J15A 3S7KB 1XKAC 3RMMH 1AB9C 1MH0A 5C67A 3RXVA 2GP9B 1P2NA 4Q7XA 4NSVA 5LPRA 4IMQA 1MCVA 4ZMAH 3MWIU 4DGJA 4TSFD 1TFXA 1OWHA 3UUZA 4GSOA 3FP8E 2Q1JA 3FP7E 3L33A 1TBRH 3MH4A 3E16B 1W14U 4FUCA 3T27A 1GJ4H 4AB9A 4JYTA 3DD2H 4FETA 1AKSA 1P8VC 1Z8RA 3SJOA 3UR9A 3U69H 4IGDA 4X0WU 2R0KA 2Y6TA 5EQRA 1GHAG 1BMAA 1DFPA 2NU1E 2GMTC 1WCZA 4O3UA 4BANB 2OTVA 1DY9A 1SGFA 4NFFA 1AO5A 4J2YB 1S5SA 1YCPH 2IPQX 2Z3EA 1EJNA 2OC1A 3SHCH 2FS9A 3QO6A 2YMSD 3ZZDA 1ETRH 4NIVA 1C4U2 1W10U 3SV9A 4WWYA 3S69A 4RN6A 3MH5A 3TGIE 3EDXB 1CT4E 5T6DA 3L6PA 2XC0A 1QRZA 2ZFRH 3U8TH 2Y5FA 4ABHA 1BZXE 1MKWK 4FU7A 1YPHE 1ARBA 2VJ1A 2FZZA 3RU4T 4XBDA 3K9XB 2BMGB 2PP6A 1THSH 3B8JA 2OK5A 1YLCA 1O5EH 4ACAA 1Y3UA 1BBRE 3UNRA 1V3XA 1W13U 5A0CA 1UTPA 2BD4A 3RLYH 2WZQA 1C2MA 5A2MH 1O3FA 1ZJKA 1O5CB 1ELEE 2FX4A 2ZDNA 1C9PA 3TJNA 2RDLA 3PO1C 1C5SA 1NFUA 1XM1A 3SU0A 3BTDE 4UFEH 2BD3A 2HVYB 3DFLA 4MTBA 1ID5H 3BTFE 3LGVA 2FYRA 3DCLA 3S9BA 4DIIH 1ZGIA 1K1PA 4Q63A 3DFJA 2J97A 4RT0A 1QBNA 3D23A 4IS5A 3V12A 1G3CA 2BDGA 2ZP0H 3KEEA 4CRDA 2ANWA 1TGBA 4CHAC 2GT8A 4Y71A 2Z94A 1C5PA 2AMPA 1LHCH 2QF5A 3SNDA 4Y6DA 3GCHB 5AFZH 4ZCNA 3H7TA 1W0YH 4JCNA 3PLKA 5EG4A 1ZOMA 1G2MA 5EJZA 2F43B 4WMFA 2BDBA 1LVYA 2DE9A 1ABIH 1TBQH 1TAWA 1NRRH 2ZQ2A 1KDQA 4I33A 1NRSH 1O2QA 2Y7XA 3QGNB 4NZLA 1AVGH 4BNRA 1YPMH 1TQ0B 3A82A 1IQJA 1FUJA 1RFNA 5J4SA 3NK8A 1GBFA 1O5FH 1MMJN 1QJ7B 2B0FA 2FOFA 1K28D 1CHOG 2P16A 3B9FH 2QIQA 2WPMS 5EIYA 5A8ZA 3HGNA 2PKSB 3KHVA 4RKOB 1C5MD 1EFRD 5L2YH 4BAOB 5HXFA 1LPZB 4AFQA 1GMCG 3GCOA 1CO7E 2BTCE 1XVOA 3T25A 3BTWE 4YZUA 1KTTB 1KSNA 1O34A 3FVFB 5EXMA 1KIGH 1EKBB 2FLRH 3DSPA 1BDAA 1FAXA 1LO6A 1T4UH 5EPYA 1C5QA 2JH0D 3E90B 1K1IA 1DWDH 1TGCA 1GHBF 2FI4E 3MQKC 1KXFA 3PV5A 3UIRA 2BVRH 3HKJB 1RTKA 3H7OA 4IBLH 1UCYK 2FO9A 1W2KH 2CMYA 3W1EA 1S6FA 2BD5A 2TGDA 1FN6A 3S9CA 1MTWA 4NIYA 2K8IA 3E91A 4DIHH 1Y3YA 5JBCS 3A89A 1E79D 2AMQA 3EE0B 5HIZA 4XBBA 4FUEA 5C20A 3GDSA 1FY4A 1C2KA 1THPB 3SJ9A 1GBDA 2VVCA 4X8TH 2ESTE 1AQ7A 1UTOA 3UNSA 1UW7A 1TMTH 3GCHC 2GV7A 2J92A 1F5KU 3SGAE 1Z6JH 1C1PA 4BTIB 2OD3B 1A5GH 1HIAA 2HOBA 3GY6A 1W0KD 3RXTA 5DGJA 2AGIX 5EXLA 2O8LA 1PQ5A 1LHFH 2VNTA 1O2LA 3SZNA 4FUJA 1O2HA 1C5WB 1V2PT 2KFWA 1GBAA 4M9FA 3JZ1B 4NA9H 3RXUA 3MNBA 5F03A 3PWCA 1V2QT 3KCGH 3VB5A 2ZHDA 4A7IB 1F0TA 1NRNH 3ZZ7A 2VIPA 4OS4A 3UFAA 2EC9H 3P6ZB 3NWUA 3GS9A 3M3SA 1MZDA 2AGGX 3BEFB 4J1YA 5LH8A 2ZF0H 2QAAA 1MAYA 2WPJS 1DSUA 1C2LA 1Z7KA 3MI4A 1BJUA 4K1EA 4AN7A 1MAXA 1YF4A 1BTUA 2OC0A 1BMFD 2UWOA 1KLTA 3R3GB 1PPFE 3EGKH 5FPSA 2GKVE 2GGVB 2ZNKH 2XXLA 3OTPA 1DS2E 7GCHG 1O2XA 3VB4A 1O32A 1GDUA 4JYUH 4DCDA 3D49H 4KTCA 1GJBB 2Z3CA 2ANYA 1H1BA 1TRMA 2ZPQA 2R3UA 1LPGB 2VH6A 1BQYA 3WWFA 2CF8H 1TWXB 1GHZA 3GY5A 1GI1A 3ZZ3A 4JK6A 8KME2 1OP8A 4Z0KA 1NFYA 1GCDA 2PTNA 1O3DA 2DUCA 1F2SE 3PMBB 2KM0A 1RD3B 3ATIA 3ZIAD 1EATA 4FU9A 2V35A 2NU4E 3I78A 2ZCLP 1AE5A 2JJ1D 2VVUA 4AX9H 3AK5A 2BDAA 1SHHB 1Y5AT 1O3LA 2W6JD 3LJJA 4ESTE 1AMHA 1FIZA 2EA3A 2VWLA 2P3FH 2FDAA 1ACBE 1LVBA 1LHDH 1FPCH 1GJCB 2UUJB 1K1OA 2TGAA 3P8NA 1EJMA 3H5CB 1OYTH 1QGFA 3MU5A 2BQ6B 1P9SA 3SV6A 1Z8IB 3SNCA 1TGNA 3TK9A 4Y8XA 4FUIA 1DX5M 1WQSA 1O35A 4UE7H 2C8XB 4BAMB 5DJ7A 3ZVEA 4MPXA 3KGPA 4ABFA 4AYVB 4E7NA 1WTHD 3A87A 1GBHA 1BJVA 3ZV9A 1V2OT 1FPHH 1HLTH 2SGPE 3RXJA 5JBBS 3KQBA 3SU4A 3PLBA 2ZO3H 4CBNA 1GI9B 1KXDA 2DE8A 2HNTC 3SBKA 1ESBA 2UUKB 1O2KA 2ZHFH 4B75A 3F0OA 2JETB 1L4ZA 1BTYA 2BLQA 4BXWA 4GLYA 1O3EA 1S83A 3P8GA 4X2XA 4OS2A 1SR5C 3MHWU 1SGEE 2FOGA 3BEIB 3V3MA 1UHBA 2A2QH 4I32A 1TGTA 1FI8A 3KQEA 1AI8H 2P3TB 6GCHF 4NG9H 4BAHB 1A0LA 1J9CH 1ZMNA 3MU8A 1QL7A 5PTPA 2BD7A 2FWWA 5C1UA 3M61U 5FHTA 1IQNA 1ZRBA 1BRBE 2G5NA 2XNIA 5T3HA 2XNDD 1YLDA 3QUMP 2BLOA 2P94A 8ESTE 3BF6H 4CR5A 1HJ9A 1O3GA 1A3EH 4AZ2B 1DOJA 1K21H 4X1NU 1BT7A 1BB0B 2PTCE 1SGYE 1AZ8A 1HFDA 1OWKA 4YM9A 4YOGA 1OX1A 1TNGA 4JZIA 1GVKB 1O3NA 2GX4A 4CRCA 3BIVH 3LGYA 3A7TA 1VZQH 1SOZA 1ZJDA 1LMWB 4FVDA 1P3EA 1KLIH 5LGOA 2BQWB 2LNCA 4ISHH 4ZXXH 4XBCA 1GPZA 2V0BA 3LGTA 5GIBA 2FTLE 1AFQB 3MU1A 2ZPSA 1ELGA 1VCPA 4ABIA 1P0SH 1JIRA 3SUGA 4IMZA 5GPIB 2C4FH 2NU0E 1DXWA 3UQVA 3ODFA 5A0AE 2Y5GA 1P2MA 5F8XA 1T4VH 2JETC 3QK1A 3EAJA 1HRTH 2GV6A 3TGKE 1BBRK 1GJ5H 1S84A 3FOAA 2STAE 2A0QB 3OU0A 1JRTA 2JKHA 4JZEH 3RXGA 3FZZA 3BTKE 3M37A 2HWLB 2BDYA 5LPEA 4H6TA 3LH3A 1T31A 1Q2WA 6LPRA 3F0PA 1O2TA 1V2KT 1WAYB 2V7QD 3K2UA 1IQKA 4D7FA 3QDZB 2BXTH 2WHXA 4AB8A 5J4QA 4ISNA 1CHOF 2G81E 1PQAA 1KXCA 2BXUH 2LPRA 4HTCH 3GDUA 5FX5A 5GJ4B 2ZDKA 2BY9X 4AFUA 2VU8E 1GGDB 1SSXA 2BY5X 3RXHA 2FOBA 1TONA 2VWNA 4XE4A 1XX9A 3A7WA 4U01A 1SGQE 4ABAA 2EI7A 5EXNA 2P8OB 4O03A 2FMJA 1GJ8B 3KQDA 2Z3DA 4NSYA 3Q3XA 5CHAB 3EBNA 3BG8A 3RUOA 3M36A 3U1IB 1DY8A 3M5LA 1IQMA 1OWEA 1JBUH 2ZU2A 4ZHMU 1WU1A 4UFDH 4AYYB 1J17T 1FZZA 1Y3WA 3OE7D 2GJGA 3Q00A 1VJ9U 5EQSA 1FX0B 5KECA 2J5UA 4ZROA 1MTVA 4DT4A 3BSQA 2SNVA 3OX7U 3O8DA 3MNCA 2ANMH 2ZFTA 4K60A 1GL0E 3ELAH 3QZRA 4WH8A 3VB7A 1UTLM 3FO8D 1AVXA 1DLKB 2XOKD 1AFQC 2H1UA 5DP5A 1P9UA 2H9EH 2FI3E 1D4PB 3EE7A 1FQ3A 1UVUH 1ZPBA 3L3TA 3ZZAA 3F2FA 3U8OH 2A1DB 4YOIA 1TMUH 2KCYA 4NA7A 3OAAD 1KMHB 3V7TA 1O3PB 3ZVBA 3EQ0H 3UOUA 3OY5U 2I6SA 2D26C 1CGHA 1ZTJA 2XC5A 1TNHA 1AWHB 1O2OA 1SVPA 1IQGA 2ZU5A 2FS8A 4P02A 1GBKA 5BRRE 1Z71A 5AFYH 1TRYA 1AD8H 1W12U 5EQQA 3UWIA 3ATWA 2CF9H 3MNXA 1UK4A 3GYLB 3PV2A 4DT7B 5DP3A 4AOQA 1MBMA 4NGAH 2KZ4A 2FOMB 1O3KA 1H4WA 4K69A 7KMEH 1MKWH 2CHAB 2VIOA 4ZKNU 3UR6A 4A1VA 4B2AA 4E7RG 1S82A 1A1RA 2QA9E 5A09A 2FM2A 1MU6B 1G3BA 3T28A 1GGDC 2QYIA 4U32A 1QY6A 1EPTB 1QZ8A 4TPYA 1SLWB 1AWFH 2P8OC 3QWCH 5K7RA 1QR3E 1QHRB 3SHAH 5CHAC 5CDFE 3F9FA 1SHYA 1J14A 3C1KA 1T8NA 1C1QA 2CJIA 1GI5A 1VITH 1FY8E 3NPSA 4JK5A 1HAPH 1SGTA 3TLOA 1VCWA 1MKXK 4O97A 3NZIA 7GCHF 2OC8A 3SNEA 4F48B 3RXKA 2D8WA 4B73A 1HCGA 2R0LA 1GL1A 3GYMA 1TOCB 2BD2A 5I25A 1AHTH 1QURH 1P02A 3A86A 1O2VA 1QQ4A 3E3TA 1XKBC 2ZTZA 5F6MA 1BHXF 1S85A 1GMDG 1JWTA 1PYTC 3RXMA 1SC8U 3NRLA 4IN1A 2O8WA 2NWNA 1GBIA 1JRSA 1YBWA 2WPIS 1EOLA 2KCPA
chains in the Genus database with same CATH topology
2OQUA 4TWYA 1XVMA 3OYPA 1A46H 3GCTG 4KTUA 1T7CA 1RS0A 4X1RU 1V2VT 2ZTXA 2Z7FE 4JMYA 2O8MA 1D3QB 4DG4A 1SGNE 2ZCKP 2BX3A 4TPIZ 2FIRH 2W26A 2GTBA 5H4IB 5FPTA 2RG3A 4ZHLU 3SW2B 2ZGBH 2BDHA 4LK4A 5G4BA 2OC7A 3RC4A 2BY8X 4CRBA 2BOKA 2BY6X 3VXFH 3SN8A 1C1RA 1ZTKA 1B5GH 2BDIA 2HVXA 3RXBA 1FNIA 1TABE 1Z1IA 5DO4H 1F0SA 4FUDA 1UK2A 3CENA 1XUIA 4WMDA 1EPTC 3NUMA 3SUEA 3F9HA 1T8OA 1YCPK 1QB6A 3U1JB 2ZHEH 2HRVA 2J38A 1NC6A 3Q76A 1GBJA 2FOEA 3UY9A 1QFKH 1Z8GA 4D76A 5JBAS 2W3KA 1LVOA 5AF9H 1GVLA 1BTZA 1UCYH 1PPGE 2FXRA 3PWBA 2AYWA 4K3JA 1GI7B 4AORA 3AW1A 1KLJH 3D62A 2C8ZB 2ZGXH 1NTPA 1QQUA 3BIUH 4X6MA 3RU4D 1SQOA 3GOVB 1BMLA 5DPAA 2I6QA 3A7ZA 2BYAX 1J8AA 1CQQA 1O5BB 2EI8A 1NROH 1NFXA 2ZU1A 2Y5HA 3MU4A 1ZSKA 1UTMA 3AAVA 2PUXB 3SGBE 4LZ1H 1C1NA 4X8VH 3TNTA 5E2OA 1TQ7B 4QT8C 3QN7A 1S81A 3R0FA 3TH2H 2P3UB 4K1SA 1C5NH 1CGIE 1ESTA 4GHTA 2H5CA 2A5IA 2C8YB 1M9UA 4YT7H 4Y76A 3GCNA 1E36B 1W7XH 2ZFQH 2XBWA 3FANA 2PFEA 1ELVA 1O2GH 1GHWH 4CH2B 8LPRA 1MBQA 4OS5A 1ZSLA 3A84A 1GI0A 5B6OA 4ABJA 3WY8A 3C27B 1OKXA 1AFEH 4DY7B 1TALA 2PGBB 2OINA 1CE5A 2WINI 2UWLA 3VEQB 2F9UA 3ATLA 5FCRA 2ZTYA 1GBTA 1YYY1 2GZ8A 7ESTE 4R0IA 3SU3A 1CA8B 3E6PH 2ZFSA 2WPLS 4Y8YA 1SFQB 4NZQA 2FI5E 2ZU3A 3U98H 3RM2H 2BLVA 4THNH 1RTFB 3P70B 1UTQA 3CS0A 4KELA 2Z9LA 1RXPA 2JH6D 2F3CE 2VIWA 4Y79A 3SU1A 1LKBA 1IOEA 2Y81A 1E38B 1EX3A 1FN8A 3CP7A 3LPRA 3URCA 1DWCH 3JZ2B 2ZGJA 1IQHA 1F7ZA 3ZVDA 1EAUA 4UDWH 2A7JA 1C2FA 1IAUA 4KP0A 5GCHG 1C4Y2 2V3HH 4YT6H 1EZUC 4K2YA 5FX6A 2PKSC 1ZPZA 3HGPA 5ESTE 2D1JA 3EYDA 5FPYA 3EA9A 1NESE 4FUBA 4KGAA 3RXRA 3RXLA 1F5LA 1CSOE 3SNAA 1YPLH 1WYKA 3K6ZA 4X8SH 3BTQE 1QBVH 1N6XA 4BAQB 4WXVA 5JB8S 4B2CA 5BPEA 1BITA 1LHGH 3NKKA 1RTLA 4X6OA 3TJUA 3OY6U 3SQHE 2IN2A 4INHA 1Y5UT 2J9NA 4K1TA 4ASHA 3ZZ4A 3GY2A 4ISIH 2OCVB 1THRH 2XBVA 1K1JA 3RP2A 4GAWA 1OS8A 2QF0A 4TY7A 4I31A 2IPHA 1GBLA 3VGCB 2YNBA 2BD8A 3GY3A 1BMNH 1VR1H 1V2TT 1TE0A 8GCHG 1V2MT 2FYQA 2PKAB 1BTHH 2SGQE 5HYOA 2QXGA 1ANBA 1ZZZA 1P2QA 1EZXC 3KNXA 1ELFA 2FLBH 3ZYEA 1PFXC 3SGQE 2XWAA 1NFWA 3MMGA 1BA8B 4Z6AH 1QL8A 3SNBA 1FXYA 1NN6A 1OWIA 1DITH 2K7XA 1ZHMA 2FEQH 1ZMLA 1XUFA 1GG6B 1ZGVA 3SJ8A 2C93B 3TITA 4X6PA 1U6QA 2TGTA 1UJ1A 1JMOH 3A8CA 1G3DA 4JZFH 1O3JA 1HAVB 4FUGA 1B0EA 3M7TA 2ZDMA 3UPEA 4MNVA 1Q31A 1TNKA 2PR3A 2A4QA 2B9LA 1XXDA 1L2EA 1NO9H 3MYWA 2F9BH 1XUHA 4I8KA 1W0ZU 4ZAEA 2RA0A 1VCQA 4FXGH 4JYVH 3DUXH 1PQ7A 1WTGH 2ODYB 1LHEH 4INKA 4UEHH 5JDUB 1C5ZB 1BUIA 1TYNA 2ZECA 1FAKH 2QXJA 5DG6A 1A5HA 1TIOA 1HAYB 1G30B 2ZGCA 2BY7X 1DPOA 1V2UT 3HK6B 2QXIA 4B1TA 1PYTD 2FTMA 3FFGA 1YKTA 4I8HA 1GHAF 4ABBA 5ETXA 1EB1H 3SU6A 1S0QA 2STBE 3ZVAA 2ZPRA 2ULLA 4A5TS 4CRAA 2W3IA 3ITIA 1ZRKA 2RCEA 5DP8A 4X1QU 5DP7A 3VGCC 4MVNA 3V0XA 4X2WA 1TOMH 1RRKA 3E1XB 2PUQH 2V6NA 1LQDB 4WF8A 5C2ZA 1AUJA 2WYGA 1NPMA 1CBWB 4H4FA 5HM2A 5TCAA 3SUFA 3VB3A 3DT0H 1BBRH 4IN2A 1O31A 4GPGA 5EODA 1L4DA 2R9PA 2SNWA 4CR9A 1QL9A 1MD7A 1O33A 1BRCE 1K9OE 1C1OA 1CVWH 3I77A 1Z6EA 4M7GA 1O2MA 3F68H 3GCTF 1O2RA 1A7SA 2XRCA 3LC3A 2UUYA 1GG6C 1MTNB 2FODA 1TMBH 1XXFA 1JOUB 1YPKH 3A7VA 4NWKA 4MNYA 2PHBA 1E35B 2Y82A 9LPRA 2BZ6H 4XSKU 4UONA 1EAXA 5I46H 2QXHA 2SGEE 3HPTB 1ZR0A 2VGCB 4GVUA 2XYAA 1O5DH 1XUKA 2A45B 3URDA 4Q2KA 5A8XA 1T8LA 2G52A 1SLVB 3VPKA 2THFB 2HGTH 7LPRA 1GBCA 1UTNA 2M5TA 3U9AH 2VIDA 1F0UA 4FU8A 1EOJA 1EZQA 1C5LH 1EASA 4R8TB 1TRNA 2Z9IA 1ETTH 4ZH8A 1Y8TA 1YPHC 2KAIB 1EPTA 4MLFB 2OP9A 1MD8A 5DP6A 4TYDA 4U2WA 5DKMA 1KYNA 3BTGE 3NCLA 4LXBH 2FOHA 3BTEE 1GWAA 4B74A 2J4IA 2OQ5A 1L1JA 3GICB 5E8EH 1E34B 1DDJA 1TA6A 1O5GH 2F9VA 1C5XB 3A85A 3O8RA 4B2BA 2BZAA 5AHGH 4DJZB 4AGJA 1DXPA 1K1MA 3Q3KA 3M3TA 1LKAA 3AVZA 3E0PB 2Z9KA 4I8LA 5DK1A 3A7YA 1G32B 1GBBA 4UFGH 4AG1A 1SGRE 1C2JA 1E37B 1CBWC 3PTBA 5E2PA 3RXQA 1N6YA 3V13A 1LCYA 2ZG0H 4Q7YA 1ZLRA 1BRAA 2UUFB 1LPKB 3M5NA 5C1XA 1GMCF 5F8TA 1ZPCA 3TIUA 4B71A 2CV3A 1F92A 2OBOA 2W7SA 1W11U 2HLCA 5E0HA 3PM3A 4Y10E 4OS7A 2A5AA 3LJOA 1C2EA 1H8DH 2FPZA 1BIOA 3P92A 2ANKH 1HJAB 2PWXA 4KKDA 1QJ1B 3T2NA 2ZDVH 1LDTT 1MTNC 2ZU4A 1QTFA 4BTUB 2BD9A 3OTJE 1YGCH 1O3HA 1EJAA 1SGIB 2HPPH 2ZC9H 3UNQA 2WV5A 1GI3A 3N7OA 4LOYH 4O3TA 1NY22 2VGCC 3QTVH 3KF2A 3UOPA 1P10A 3SJIA 2GMTB 1EAIA 4GCHG 3GISB 4MPUA 5L6NH 3W95A 3P17H 1J16A 2R3YA 2PSYA 3MU0A 2SGFE 1ORFA 1GJAB 5K0HA 1LQEA 5HGGA 1A0HB 1EXFA 2B8OH 1C2DA 3LGIA 2A7HA 2GCHG 4Y11E 3E0NB 1A61H 2ZHWH 2O9QA 3A8DA 2V3OH 1SG8B 1P03A 2HNTE 4F49A 1P57B 3TGJE 3TK5A 1YP9A 1MKXH 3LGWA 1W7GH 3P8OA 4DOQA 1GJ6A 3UTUH 1BTPA 1DANH 4ABEA 2R2MB 3PMHB 5JYIA 3SU2A 4WMEA 2C90B 5SGAE 1GHVH 1N8OB 1C1VH 1YM0A 4NA8A 4AFSA 1V2NT 1ZMJA 1O2WA 3ZZBA 2WV4A 3RXEA 6ESTA 1O2JA 1ELDE 1P2OA 1FY3A 2ODPA 1OP2A 1O3CA 5GCHF 1DE7H 3MO6A 1C5UA 3ENSB 1IQLA 1KY9A 2PLXA 1FLEE 4I8JA 1O2ZA 1WBGB 2PW8H 4WXIA 1O5AB 4U30A 3T29A 4BOHA 1OXGA 4A6LA 3PB1E 5CMXH 2W5EA 2G55A 1QRWA 1C2IA 5TJXA 3RU4E 1SQTA 4K5ZA 4SGBE 1QBOA 1O2SA 1A5IA 2OUAA 3W94A 2QC2A 1HJAC 2K1QA 1BOQA 1OOKB 3AW0A 1K22H 4CHAB 1X7AC 1CGJE 1PPHE 4ISOA 1PQ8A 1AUTC 3QTOH 1GBMA 2ZWLH 2BDCA 1SFIA 3PTNA 1O3OA 3ODDA 2GZ7A 4X2VA 1L1NA 1ABJH 2VWOA 3MO9A 4FUHA 3ZVGA 4XOJA 3SU5A 1KXAA 5EGMA 3HKIB 4YLQH 1K1NA 1OP0A 4XFQA 1MQ6A 1O2UA 3LT3A 2GCTB 1HBTH 6GCHG 3KN2A 1WSSH 3I29A 1AU8A 4NFEA 1DT2A 2SGDE 2QV1A 3SV8A 8GCHF 2SFAA 4D8NA 1Y59T 4YTAA 1FY1A 2VVVA 3A7XA 4Y0YE 2VH0A 5GDSH 2WUCA 4CREA 4CRGA 2VWMA 2PSXA 2BQ7B 3RXFA 1P01A 1EP5A 2ZIQH 1TGSZ 4GHQA 1VGCB 1SGCA 2ZDAH 2TPIZ 1W3CA 3ZZ6A 1ANDA 1L0ZA 1N8OC 2NU2E 3QLPH 4TY6A 1C1WH 1GMHG 2CHAC 2QCYA 1O38A 1VITG 1DM4B 1SQAA 1P04A 1PPBH 4Y8ZA 5JPMH 1HYLA 4HI3A 2GDEH 1E0FD 1SBWA 1HAHH 3O8BA 2UWPA 3RLWH 1C5TA 3EA8A 2XCFA 3PMJA 1V2RT 1GI4A 2FOCA 2HNTF 3ATKA 3TH4H 1SPJA 2YNAA 1SOTA 2G4TA 5EOKA 1O39A 4K8YA 2IOTA 5FAHA 1SGPE 2A31A 1O3MA 4JZ1A 1PJPA 5E0GA 5T6GA 1JIMA 3PLPA 1HB0B 3BEUA 3A83A 3MOCA 3RXCA 3RXAA 2D2DA 1FY5A 1TPPA 3ESTA 2LIZA 2A32A 3SJKA 1IQIA 3RXPA 2GZ9A 3M5MA 1OYQA 2GCTC 5FCKA 4D9QA 4WVPE 1UTKA 2Q6FA 4INLA 3SV2H 1O2YA 1AIXH 2PKAA 2SGAA 2ZI2H 2H9HA 4OGXA 3TJOA 3RC6A 3PYHA 4X8UH 1UVSH 5HMAA 2QN5T 1NU7B 1NM6A 1RIWB 3LH1A 1CU1A 1QA7A 1NZQH 4RSPA 1ARCA 1ELBA 2XTTB 1O3IA 1DVAH 1Z1JA 3CS7A 3E8LA 1ELTA 1VGCC 5A0BA 4ZKOU 2Z9JA 2TIOA 1TX7A 3OSYA 1P2JA 1W8BH 2AERH 3STJA 1C5VA 1TNJA 1YCPM 5AVDA 1O3AA 4ISLA 2AGEX 5F8ZA 4ZKSU 3RMLH 1SMFE 4VGCB 5DP4A 3M5OA 1HGTH 1AKSB 3A88A 1BMMH 3F9EA 2A4OA 5FBIA 2TGPZ 4IW4E 1TA2A 1HAVA 3M3VA 2XC4A 1CT2E 1V2ST 3UREA 3VXEH 2BB4A 4KTSA 3LONA 2AH4X 2Y80A 5ABWA 2WYJA 1ELCA 1PPCE 3RM0H 3RXIA 4NIWA 3KIDU 4PROA 4O9VA 3UQOA 1HAOH 2EEKA 4CH8B 1BHXB 1JXPA 5JB9S 1HAIH 1BCUH 2ZHQH 4X2YA 2BHGA 1HV7A 3FAOA 5HM9A 4JZDH 1GI2A 1NRPH 1UMAH 1UK3A 3RXOA 1Y3XA 3IG6B 1S0RA 1TX6A 2BVXH 2J34A 3BTME 4Q7ZA 4WY3A 3QGJA 3ZYDA 2F9PA 3Q3YA 1AZZA 2G51A 2Y7ZA 1C5YB 1ANCA 2C3SA 1DLEA 3A8BA 3BG4B 4I8GA 1GBEA 4AGKA 1C1TA 1O36A 3LU9B 2XW9A 3TPIZ 1INCA 4D9RA 1D3TB 2GDDA 1C2GA 4YO9A 2ZDLA 1OPHB 3UWJH 2FESH 3K65B 3S7HB 5A8YA 3MTYA 3ZZ9A 1RGQA 1T32A 4DURA 2B5TB 1MTUA 1XMNB 2TBSA 1QIXB 1HXFH 2GVFA 3HK3B 1RIWC 1QB1A 1OSSA 1SLXB 4CRFA 1TNIA 1ANEA 4NCYA 2XBYA 3T62A 2EI6A 4ZHAA 1HAGE 2QY0B 3LC5A 1O2PA 1FJSA 5FBEA 1GHXH 4A1XA 4DW2U 4HFPB 2P93A 4VGCC 5FXLA 1CHGA 3ATMA 1SLUB 1TPSA 1H9LB 3MFJA 1KDQB 1SGFG 1B7XB 1MZAA 2G00A 1EAWA 2ZFFH 2Z6BD 3S9AA 1Q3XA 1BTXA 4SGAE 4DVAU 1D3DB 1HXEH 4YLUA 1V2WT 4FVBA 3TNSA 1SB1H 1GHYH 4GCHF 1C5RA 3M7QA 3MNSA 2O8TA 1NS3A 2F9OA 5EW2H 4MNWA 1WOFA 2H2ZA 1IQEA 1G37A 2TRMA 2ZQ1A 3LOXA 3M35A 1H9IE 2KAIA 4LZ4B 1Z8JB 2Z9GA 3IITA 1AY6H 2GD4B 4NIXA 2GCHF 1QCPA 1UO6A 3ZZ8A 1SI5H 2ZZUH 3SQEE 5EPNA 1QRXA 1YPJH 4BAKB 3SO3A 1C1SA 3AAUA 1EP6A 3DA9B 3BG4C 2BVSH 1TPOA 2ODQA 3HATH 1ZHPA 1PPZA 2O8UA 1C2HA 3VB6A 1D6RA 3ZVCA 1B0FA 1LTOA 3GY8A 3F6UH 2FX6A 3AASA 4K8BA 2OBQA 1TNLA 3QX5H 1TBZH 1YC0A 2H5DA 4GUXA 1O30A 2XCNA 4XDEA 4OS1A 4E05H 3BTHE 3SOSA 2AMDA 1G36A 3RXSA 1HUTH 6CHAB 2H9TH 2QF3A 5TCCA 3TVJB 2ASUB 1OWDA 3SUDA 1P05A 1O2IA 1MQ5A 1XU