4ZROA

2.1 a x-ray structure of fipv-3clpro bound to covalent inhibitor
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
299
structure length
299
Chain Sequence
SGLRKMAQPSGVVEPCIVRVAYGNNVLNGLWLGDEVICPRHVIASDTSRVINYENELSSVRLHNFSIAKNNAFLGVVSAKYKGVNLVLKVNQVNPNTPEHKFKSVRPGESFNILACYEGCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGTLYFVYMHHLELGNGSHVGSNLEGEMYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMTLESYNAWAKTNSFTEIVSTDAFNMLAAKTGYSVEKLLECIVRLNKGFGGRTILSYGSLCDEFTPTEVIRQMYGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords 3C-like proteinase
publication title X-ray structure and inhibition of the feline infectious peritonitis virus 3C-like protease: Structural implications for drug design.
pubmed doi rcsb
source organism Feline coronavirus (strain fipv wsu-79/1146)
total genus 85
structure length 299
sequence length 299
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 4zroA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4zroA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4zroA01
2RDLA 1OP2A 1H9LB 1F5RA 1GBAA 3ZZ8A 2O8WA 1GBKA 3EA7A 3MH6A 2F3CE 5F8TA 1A0HB 3QK1A 1O38A 1Y59T 4JK6A 3MU0A 3SBKA 2CF8H 1MQ5A 5JBAS 5AVDA 1GJ8B 1IQEA 4ASHA 2PUQH 2TGPZ 3A81A 1C1TA 2GCHG 2FEQH 4X1QU 1ABIH 1ELFA 3M5OA 2ULLA 3E8LA 5L2ZH 1V2UT 2HALA 2ZC9H 1P3EA 4BANB 4YLUA 2FI3E 1UCYE 1AB9C 1B5GH 2ZDLA 4Y8YA 1CO7E 3E3TA 1SSXA 3SW2B 1TPOA 3ZZ9A 3E16B 3SUGA 1WCZA 1AZZA 2P8OB 5A0CA 1DT2A 4U2WA 3ZVBA 3RXGA 3SGQE 3TJUA 4B73A 1YPJH 3ZVAA 1GI5A 4Q2KA 3BN9A 3T62A 2IPHA 2NU1E 3RXLA 3ZZ4A 2QCYA 1HYLA 1T8OA 4PROA 3VXFH 1S5SA 1BRUP 3PLBA 1C5QA 2F9NA 4TY6A 1O3FA 4WMEA 4U30A 4MNWA 3VFEA 5FPYA 4K60A 1HAHH 4BAMB 3AASA 4LOYH 3RP2A 3LGYA 4TPIZ 3K6YA 4Y71A 2NU4E 2A5IA 2ZO3H 2A4QA 2I6SA 2WPJS 1DUEA 1ANDA 1Z8JB 4X6PA 5TCAA 2QXHA 4DGJA 3B9FH 2CV3A 3SGBE 2QGRA 3KN2A 3BTME 4IMQA 4Y0YE 1T7CA 1QFKH 5C3NA 2BY5X 1WOFA 1C2GA 2B0FA 1XX9A 1CGIE 4B2BA 4K2YA 4XBCA 1GBFA 1KSNA 2OINA 4K8YA 3URDA 2BD4A 2J94A 2P59A 2BVXH 3LU9B 2ZPSA 2FOGA 4E7RG 4ZUHA 3PO1B 3ZV9A 1O3OA 1DPOA 1SL3A 1INCA 4WVPE 4YM9A 4X2XA 1HB0B 3GCOA 1HAGE 1GHAF 2P95A 1BTPA 4E05H 1VZQH 2BQWB 7GCHF 1W14U 3R3GB 4LZ1H 4K5ZA 5JBCS 1QCPA 2ODPA 4HI3A 3TGKE 2UWOA 3KQEA 3MO6A 3SZNA 1W13U 1CHGA 1DITH 2FESH 4GPGA 1YPMH 1KXAA 2BLWA 3S9CA 2HOBA 1QRXA 4MPWA 7GCHG 1O2NA 1MCVA 4FUCA 4UDWH 5DKMA 3BEIB 3P92A 3QDZB 1FI8A 3BTQE 4DCDA 3D62A 1QB9A 2GZ7A 1DWEH 1YPHC 2ZU2A 1O3JA 1QL8A 1ZMLA 1TQ0B 1GI1A 3QZQA 1QNJA 1FQ3A 3P70B 1M9UA 1FY5A 2V3OH 1HUTH 3M5LA 2VVCA 1DFPA 1HCGA 1GPZA 1ZLRA 1TE0A 1FPCH 4KTSA 1K21H 2EI8A 2FTMA 2G00A 2QN5T 4CHAC 1RRKA 3RLYH 2CHAB 1PQ8A 9LPRA 5CMXH 8KME2 3E6PH 1B0EA 3I78A 2ZHEH 1C5SA 1UHBB 3LH1A 3IG6B 3MNXA 3U8TH 2A5AA 3BG4B 2OXSA 1UVSH 2IJOB 1D3DB 1LO6A 1YC0A 4ZXXH 2ODQA 1IQNA 2LIZA 2FZZA 1OS8A 2Q6GA 5J4SA 1P02A 3MU1A 1LVOA 2AMDA 1XUJA 1P2OA 1J9CH 3UNQA 2UUJB 1NO9H 2OD3B 3RXMA 1C5XB 2G51A 2NU2E 1ELCA 1HAOH 4WH8A 3TK9A 2J9NA 4XBBA 2D8WA 3GYMA 2BLOA 5EOKA 4NA8A 3M5NA 3UR9A 1KDQB 2JH6D 1GI2A 3G01A 4E06H 1O37A 3A8AA 1S0QA 2GVFA 2XBVA 1J16A 8LPRA 2HNTE 1C2FA 2FO9A 1KLTA 4ABBA 2BY6X 4AGKA 4ABAA 1GBIA 3ZV8A 1O34A 2XC0A 1P11E 1ELVA 1SB1H 1D6WA 2BYAX 1P3CA 1BITA 2FOAA 2EC9H 2BDYA 3RDZA 4KTUA 1DX5M 3P8FA 1DY8A 1QR3E 3TK6A 3RXEA 1GCTB 2ODYB 4KGAA 4MNXA 1GBJA 3LGTA 1IHTH 1O2ZA 3O8CA 1RGQA 7KMEH 2C90B 4DIHH 2SGAA 4M7GA 1ZR0A 4O3TA 1AE5A 2Z9JA 4Y8ZA 2QV1A 4I8LA 2BDBA 3VGCC 1O3GA 1TNHA 4X2YA 2WUBA 1K1OA 1LHEH 1ANEA 3ZZDA 1Z1JA 1HV7A 1O3CA 1E35B 4ZXYH 4INLA 2ZZUH 1P03A 3BIUH 2C4FH 1UTPA 3SN8A 1UTOA 1HAIH 3U98H 3MU8A 1P01A 1GDUA 4BTUB 5EW2H 3BTKE 2XC4A 3C1KA 5EW1H 4AB9A 2F9BH 2KAIB 3RC5A 1FXYA 4AFUA 5HM9A 1SLVB 3M35A 3A82A 4TWWA 1GI6A 1YM0A 1C5OH 2VIQA 2GV6A 1B0FA 4FU8A 1LKBA 2A45B 3FANA 4JYUH 3QLPH 1CA0C 3HK3B 2VGCC 3PMJA 1SGYE 2PLXA 2A32A 2PKAB 1F0UA 4XOJA 3ZZ3A 3SO3A 2GCTB 1HAXB 4Y11E 1IQLA 2ZA5A 1BTWA 1NFXA 4YT7H 1S81A 1GHWH 3RXQA 5FX5A 1LHGH 4GVUA 3SUDA 4AFSA 1HJ8A 1SPJA 4YOJA 1O3IA 5GXPA 1O2IA 2WV4A 1QA7A 2P3TB 3LGIA 1SOZA 2OUAA 2QXIA 3RXJA 1Z71A 2VWNA 4UFGH 1C5NH 4Z0KA 1VR1H 1XM1A 3ZYEA 1C2MA 3UWJH 3A86A 1UTJA 3K9XB 3ODFA 3RMNH 2FX6A 1Y5BT 1BBRH 4BNRA 4X8SH 4MQAA 1J14A 1SVPA 3R0FA 3TJNA 1EZXC 3AW1A 1IQMA 2W26A 3E1XB 3KQCA 3EA8A 1FIZA 1ZGIA 1QGFA 1PPHE 2R0LA 2FPZA 2ZGJA 2XC5A 1MTSA 1O2XA 1NN6A 4IN2A 4FXGH 3QTOH 4F49A 1NM6A 4WWYA 2ZG0H 3NUMA 3M3VA 1C5YB 1A5HA 1MU8B 1GG6C 3RC6A 4ZHMU 4NSVA 5A8ZA 1G3DA 4ZHLU 1S83A 3UOUA 1H4WA 3MU4A 4X6MA 3MI4A 1GGDB 1NC6A 1C2HA 1AHTH 1O2SA 1SGIB 4LK4A 1UVPA 1GDQA 3A8BA 1O5FH 2IOTA 3LGVA 2A5KA 3L3TA 2GZ9A 4I8HA 3M7TA 1YPHE 4ISOA 4Z6AH 1JMOH 3MH5A 5C1UA 3RU4D 2P16A 3UOPA 2WPIS 2PHBA 4Y8XA 1MBQA 1DUAA 1SFIA 4FUIA 1O31A 1SGQE 3NPSA 1ELAA 1WU1A 1QIXB 4I8KA 3SJOA 1E34B 1W7XH 2VIWA 3ATIA 1WV7H 2ZKSA 1HAYB 1KTTB 2R3YA 5FXLA 1UTLM 3TIUA 1TRNA 1SHHB 2VIPA 2ZTXA 4HTCH 1LTOA 4ZMAH 2WINI 4K8BA 3P8OA 4JZFH 1TNJA 3F9HA 3SU1A 1RIWB 4IS5A 3SNCA 4AYYB 1RFNA 1GI8B 4O9VA 5F8XA 5DGJA 3VB5A 1VJ9U 3BV9B 1HIAA 3RXVA 1GMHF 1NFUA 1GWAA 5JYIA 1KXFA 3NKKA 2STAE 1PFXC 2UWLA 2ZPRA 3QUMP 1QJ1B 2GP9B 3TGIE 4SGAE 3SUFA 1CHOG 3B8JA 1O5GH 1O5CB 1A0JA 1GMHG 1YCPM 4CBNA 2AERH 1GHZA 3IITA 2WUCA 4ISHH 7LPRA 3V0XA 1OYTH 2FI4E 1MTVA 4YOGA 1BRCE 4INKA 2FXRA 2HGTH 3URCA 1MCTA 1H8IH 3GICB 1KTSB 3FZDA 1J8AA 1HAVB 1A46H 1TX8A 4CRFA 3W95A 2BM2A 1GMDF 2CJIA 2SGPE 4TPYA 1NRRH 2ZU4A 4IMZA 1VCWA 5IYTA 2SNWA 1ZMJA 1W10U 4SGBE 2BD3A 1VITF 2Z9IA 1ZTKA 2AIQA 3SNAA 3ZZCA 1MBMA 1T8NA 1V2QT 2B8OH 4OS5A 2C8YB 2QYIA 4AOQA 4X2VA 2VNTA 3PLKA 3SU0A 2ZFTA 4YZUA 1W2KH 1VITG 1VGCB 5C1YA 3RXCA 1TOCB 1OKXA 1TGSZ 4I33A 1GBCA 1XMNB 3P95A 4X8TH 1KIGH 4QT8C 4IGDA 1BTXA 2F9VA 2C93B 1WSSH 2Z9KA 5JPMH 5A0BA 2FM2A 1TNGA 3K65B 1ZJKA 1FN8A 4B74A 3TNSA 2RG3A 3LJJA 3TK5A 2WYJA 4AFZA 5GWZA 2CF9H 1BOQA 5J4QA 3SORA 3QO6A 1N8OC 4E7NA 1C2DA 2R0KA 3HGNA 5DP8A 3ELAH 3FAOA 4JZ1A 2Q6DA 3AVZA 3FP8E 4THNH 5FCKA 5EXNA 1MTWA 3NCLA 2VH6A 4Y10E 5EGMA 4YTAA 1TONA 3RXPA 3FFGA 1D3PB 1HJ9A 4ZROA 1O2PA 3U1IB 1SLWB 1SR5C 2FYQA 4BAQB 1ID5H 1IOEA 1NT1A 1GVZA 3EAJA 4RSPA 2QA9E 4CRAA 1GJAB 4UD9H 1BBRE 1HAPH 1MKWK 1N6XA 1L1NA 5HM2A 2CN0H 1BTYA 2P3UB 3FP7E 2H5DA 1O3DA 1NU7B 1C1OA 1EJNA 1G3CA 4MNVA 3ZZ5A 3GCNA 4I7YH 1CSOE 1IAUA 3ATKA 2FLRH 3KEEA 3O8DA 3SU6A 1V2KT 5FPTA 1RD3B 1UMAH 1JOUB 3FZZA 1NRPH 5EU8A 1EX3A 1P05A 3A7ZA 5GJ4B 5FHTA 3VB3A 4A1XA 1CGHA 2FOFA 2BDCA 5E2OA 3RXDA 1LDTT 3A87A 3Q3KA 1S84A 1Y8TA 1YPKH 3PWCA 2ZI2H 1MD8A 3VXEH 5LPFA 1ZTJA 5L30H 6GCHF 3PMBB 1SMFE 1WTGH 2ZECA 3P6ZB 1S85A 1A7SA 3NWUA 1W3CA 1F5KU 4KKDA 2HVXA 2ANMH 1ZPZA 6GCHG 1YPGH 2J2UA 1OP0A 2BLVA 3RXBA 4K3JA 3U8RH 5E8EH 2ESTE 2I6QA 4X8VH 1DICA 1YPLH 1NROH 1SGFA 5T6GA 3OY6U 4AYVB 2ZWLH 1AN1E 1S6FA 3ZVDA 1XUGA 4FUGA 3M37A 3RLWH 4UE7H 1SGTA 2JETC 2R9PA 3BTGE 3A83A 1Y5UT 3RXKA 4DOQA 4JZDH 2ZU5A 3JZ2B 2Y82A 1C5UA 2V35A 2KAIA 3ESTA 3JZ1B 1Z1IA 3LC3A 1AFQC 5L6NH 4LZ4B 4MPUA 2PKSC 1NTPA 5DJ7A 4CH2B 1BCUH 1BQYA 1QQ4A 1TRMA 5EQQA 2GTBA 2GMTB 1UTNA 2ZHDA 3H7TA 1TAWA 1V2NT 3SHCH 1DANH 4D7FA 2ZFQH 2PKAA 3UY9A 4OGYA 1O3EA 3D49H 2G81E 1C5PA 2JH5D 3SU5A 2ZCKP 3TU7H 1Y3XA 1P2JA 2DE9A 4TY7A 1AUJA 2AMQA 3RU4T 1MTNC 1TBZH 2A2XH 1K1LA 1EOJA 1A5GH 1K2I1 2ZGCA 4I31A 2VWLA 1W12U 3V3MA 2WPLS 1UVTH 1H9IE 3BIVH 2D26C 5FAHA 4H6TA 1XUKA 5TJXA 1V3XA 5EPYA 3ITIA 2OC7A 4VGCB 3SU3A 2OTVA 1IHSH 1W0YH 3T2NA 3GY4A 4JZEH 1SGRE 3MWIU 1TMTH 1WQVH 1GHAG 1FY3A 2G4TA 1GL1A 2FX4A 1O5EH 3SNEA 1SQTA 4B2CA 4NG9H 2Y6TA 3A85A 4ZKOU 2BZAA 1O5AB 2WPHS 5T3HA 1Q3XA 4JMYA 3VGCB 4ABHA 2A2QH 3ZYDA 1ZSKA 2BZ6H 2Y7XA 3GDUA 3LGWA 3MO3A 3BEFB 1CQQA 1UO6A 1CVWH 3GY3A 3PB1E 1HXEH 3UTUH 1UVUH 1HPGA 2BHGA 4NWKA 3DFJA 2B9LA 3LOXA 2VWMA 1QBOA 1VITH 4UONA 5GDSH 5JB9S 2PSXA 2VH0A 1ZSJA 2C8WB 1SC8U 1YCPK 1ELEE 2D1JA 3SV7A 2ZDAH 4JYTA 1ZHMA 3PMAB 1LPKB 3RM0H 2P8OC 2STBE 2D2DA 1O32A 1WQSA 4OS7A 2FOCA 1C4U2 1QB6A 2H2ZA 1C4Y2 1C2KA 1P2QA 2Z7FE 2GGVB 2VGCB 2BMGB 4Q7YA 1S82A 2F83A 1O3MA 2BOHB 1C9TA 3UNRA 1A4WH 2XW9A 1NZQH 1Y3YA 1L1JA 2Y81A 4JCNA 2G4UA 3LONA 1T32A 4Y7AA 1SGFG 2C8XB 4J1YA 4MPVA 5JBBS 3BG8A 1DVAH 4ZKRU 3NXPA 2AS9A 2ZQ2A 3D65E 4BTIB 3GDSA 4CR9A 1DXPA 1C1MA 3PTNA 2YNAA 1GJBB 3A80A 1O2RA 1TOMH 1D4PB 3WY8A 2Y5HA 4FUBA 1F0TA 2R2WU 3K6ZA 2YNBA 4AG1A 5JB8S 1QTFA 3MMGA 4ABFA 3OTJE 7ESTE 1SGCA 1TNKA 1OXGA 2XYAA 3U8OH 3LKWA 2FWWA 4U01A 3ZVFA 1AMHA 2ZCLP 3N7OA 3OYPA 3PO1C 1GHYH 3GCHB 2TGAA 5AHGH 3W94A 1ANBA 1JWTA 1GHXH 2R3UA 2BD9A 1DWBH 4OS2A 3RXOA 5A2MH 1O2WA 2FS9A 1ZTLA 3EGKH 2SGFE 3S7HB 4YOIA 1TGNA 2A4OA 5C20A 1BHXF 1K1NA 1CT0E 4CREA 4B1TA 9ESTA 3QN7A 4H6SB 3L6PA 2A7HA 5L2YH 1CBWC 1XUFA 1JBUH 3PLPA 2BD8A 2J34A 4O97A 2ZFPH 5LPEA 1BMAA 4CR5A 1CA8B 1JIMA 3BTWE 1C2LA 1B7XB 1TRYA 3STJA 2YOLA 1GL0E 3LDXH 2EI7A 3KHVA 1P9SA 2Q6FA 1G37A 1Y3VA 1NRQH 2ZHWH 3Q77A 5FCRA 1BT7A 3RXSA 1EB2A 1TPSA 1XUIA 3A7XA 2SGQE 1MU6B 1TX6A 4ABGA 2Y5FA 2CHAC 3EA9A 1MAYA 2XWBI 1OWJA 1V2JT 2O9QA 3TJOA 5AF9H 4A6LA 1BUIA 3Q76A 4NIVA 4XE4A 3B23B 1P2IA 4A7IB 4RKJB 1ELTA 1OOKB 3SHAH 3BG4C 1HJAC 2ZFRH 3Q3XA 3PROA 2ZU1A 3S9AA 1EAWA 1HAZB 1MUEB 2R2MB 3HKIB 4FUJA 3ZVEA 2ZU3A 1FDPA 3F1SB 2G5VA 1TMUH 5E0GA 1LCYA 2UWPA 2K7XA 4Y0ZE 2PWXA 1XXDA 3SI3H 1AVXA 1F2SE 3GY2A 1SI5H 2FMJA 1OWHA 2B5TB 3RU4E 1SLXB 2BOKA 4NIYA 1E36B 1TIOA 2OQ5A 1C1RA 2FOBA 4CRCA 2V3HH 1G32B 3BTHE 1JIRA 4KELA 2H5CA 4B75A 5IDKA 4RN6A 3VPKA 2J4IA 3DT0H 2QAAA 1ZHPA 1F5LA 2AGGX 2SGDE 2TRMA 2Y80A 2TPIZ 3SNDA 2BDIA 5C1XA 5DP9A 2PTNA 2XCNA 1LPZB 1EPTB 1LQEA 3QWCH 1BDAA 3SGAE 2XRCA 1AIXH 1O2YA 3VB4A 2B7DH 4CH8B 2QF3A 1DE7H 4BTTB 4F4OC 2ZTYA 3SQHE 2A1DB 4KP0A 2LNCA 4B76A 1GCDA 4JK5A 1XVOA 1FMGA 3H5CB 6LPRA 4KTCA 4D9QA 1OWEA 1MTUA 1MAXA 1V6DA 2Z3DA 4TYDA 1L4DA 1C5RA 4FUHA 4X6OA 2OP9A 3GY6A 2BTCE 1QY6A 3V7TA 5T6DA 4GUXA 1TWXB 3KF2A 5EODA 4ZH8A 3TPIZ 4B71A 1JRTA 1MKXH 2EEKA 1DY9A 1O2KA 3DFLA 1V2RT 2RCEA 3BTEE 1LHDH 1L0ZA 1O35A 5B6OA 1GBLA 3SJKA 3TJVA 3TNTA 2ZQ1A 4ABIA 2V6NA 2PSYA 2ZHQH 3QZRA 1O2UA 4A5TS 1DWCH 1D9IA 1Z6EA 1EZUC 1NY22 2GZ8A 2XBYA 2O8LA 3RC4A 4X8UH 5EQRA 5CE1A 3M3SA 1TX7A 4MNYA 4X2WA 2BQ7B 4UFEH 3TLOA 2QC2A 3RXHA 2AGIX 3S7KB 2XNIA 3UUZA 2VIVA 2JKHA 4YT6H 5HXFA 3GY8A 2P93A 4A92A 3DUXH 1IQIA 1HLTH 2M5TA 3DHKH 1V2PT 5E2PA 1DXWA 3RMMH 2FDAA 1Z8RA 3ATWA 1WYKA 1ANCA 2OBOA 2RA0A 2NWNA 2BVSH 5ESTE 5CHAC 4I8JA 1KXDA 4DVAU 3UNSA 3C27B 1C5LH 1NFWA 1ZSLA 1AWFH 2WPKS 1BMLA 4U32A 2THFB 2BDHA 1QJ6B 1IQHA 5FX6A 8GCHF 2AFQB 1P8VC 1Q2WA 4RKOB 3F68H 2O8MA 3F9GA 1MQ6A 2SGEE 3T5FH 8ESTE 1BJUA 1D3TB 2VIDA 3ZVCA 8GCHG 5PTPA 1G2LA 1G30B 1EKBB 1XKBC 2Z94A 3CS7A 3KL6A 2HWLB 1YBWA 1HGTH 1ARCA 2PR3A 1BJVA 3U69H 1IQFA 5EPNA 1UK4A 4ABDA 4A1VA 1TGTA 1UCYK 3E0NB 2A4RA 3GCTF 1AY6H 4WF8A 5HGGA 4NIWA 1OWKA 1GMDG 1V2OT 2CMYA 4BXWA 1MKWH 3MO9A 1C1NA 2H1UA 3SV2H 2BDGA 2ZIQH 1EB1H 2AIPA 4JZIA 3GCTG 1EATA 1O3AA 1PYTD 1AB9B 4UFDH 1NESE 5DG6A 2F9PA 1O2TA 2WYGA 1KLIH 1GHBF 5K7RA 2ZCHP 1WAYB 1BMMH 4GLYA 4K1EA 1GGDC 2GD4B 4I32A 4NFEA 3UPEA 1FY1A 2JETB 4FVDA 4YESB 3QTVH 1GHBG 4GSOA 4Q80A 1KXCA 1TFXA 1UHBA 4A1TA 4Q7ZA 6CHAC 1G9IE 4K1SA 4WXIA 1DSUA 1P09A 1QRWA 3GOVB 2AYWA 3UIRA 2F91A 3L33A 3RUOA 2FI5E 5G4BA 4IC5A 3T29A 2PKSB 3DA9B 4FUFA 5DP3A 4MDSA 4X1PU 1JXPA 2BQ6B 1YGCH 1MD7A 2W5EA 5ETXA 3SV9A 2XTTB 2HPPH 3HK6B 1ELBA 1X7AC 2QXGA 4CBOA 1F92A 2FTLE 2J92A 1E37B 1RTFB 3LIWA 1BMNH 2NU3E 3LT3A 4HGCA 1AU8A 1ESAA 1V2TT 5F6MA 1DLKB 4GCHF 1KDQA 1TMBH 1KYNA 1S0RA 2GKVE 1ESBA 1MTNB 2BXUH 3M61U 1RTKA 1TQ7B 1O0DH 1RIWC 1HRTH 2FYRA 4GCHG 2W3KA 1K1IA 1T4VH 3MOCA 1V2VT 4MVNA 4X1RU 2UUYA 3A89A 2ANKH 2SNVA 4BAKB 3QGNB 1C5TA 5EQSA 1KXEA 4X1NU 2BXTH 2ZHFH 3UR6A 1ZGVA 1DLEA 1GBBA 1SG8B 1AKSB 2OC0A 3CENA 5TCCA 4CRBA 2ZPQA 3ATMA 1W11U 3KCGH 1AVWA 1GBMA 1UVOA 4ZKNU 3S0NA 3I77A 1C5ZB 3F6UH 2OBQA 1DM4B 2ASUB 1G2MA 4GAWA 2ANWA 3MFJA 1FAXA 3A88A 5ABWA 2GCHF 4D9RA 2DE8A 1OYQA 1PQ7A 5DP7A 2VB0A 1C1QA 4LXBH 1XUHA 1UK3A 1UTKA 1QURH 4FU7A 1AI8H 4NZQA 4JYVH 1SGDE 4CHAB 1P06A 2FP7B 3T26A 3FP6E 1ELDE 4ZKSU 3H7OA 1EJMA 2TIOA 1BZXE 4X6NA 5DP6A 1VGCC 4CRGA 2VU8E 1O2HA 2GT7A 1QRZA 1HDTH 1TALA 2A0QB 5EXMA 2BD5A 3MNCA 4R0IA 1VJAU 2PUXB 3D23A 1S6HA 5DP4A 3AAVA 1NRNH 5E0HA 2GDEH 2PGBB 3GYLB 1NS3A 1GI4A 3LC5A 1KXBA 3GY5A 1LHFH 3RXUA 1RS0A 1PQ5A 1GHVH 3HGPA 5A09A 4MTBA 3LGUA 4OGXA 1O3BA 1FIWA 2XWAA 1OWDA 2P3FH 3P8GA 3HATH 5A8XA 2EI6A 3T25A 1EUFA 2F9UA 4XFQA 4HFPB 2W7SA 1A5IA 4BXSA 3PYHA 2P94A 3GDVA 3E90B 3BTTE 1C1UH 4DG4A 3F9FA 1ABJH 2OLGA 1E0FD 1SOTA 3M7UA 2O8TA 1YCPH 2ANYA 2JH0D 1ZOMA 2XCFA 1HIAB 2G8TA 3TH4H 1P2NA 1THPB 3SU2A 2VJ1A 1ORFA 1PPBH 2O8UA 4ISLA 1AGJA 5GIBA 1V2MT 3LPRA 5DP5A 4DURA 3BEUA 1MMJN 1ZPCA 4GHTA 4ISNA 4ABJA 3HKJB 4UFFH 1EAIA 2GDDA 2C8ZB 5DK1A 1ZRBA 1YPEH 1QL9A 1Y3UA 4NGAH 1O36A 1EOLA 4NFFA 1EPTA 3A7VA 1G3BA 1BRAA 1OWIA 1Z6JH 1AD8H 1SGPE 2J38A 3F9EA 1AQ7A 4XSKU 1GBDA 1EZSC 1GI3A 2TGDA 3P17H 1SLUB 2ZGXH 1CBWB 3SQEE 4MPXA 1FY8E 1RJXB 3A8CA 1UTMA 1ZJDA 1AZ8A 1O2JA 1C2EA 1LVBA 1GJ5H 1YKTA 1W8BH 2WV5A 1E38B 1V2ST 1O3NA 2NU0E 1YF4A 1PYTC 1P9UA 1SGEE 3M7QA 3UQOA 1DS2E 3V12A 1IQKA 1T8MA 5LPRA 4YO9A 5ESBA 3ATLA 1GVKB 2ZFSA 1W7GH 4AB8A 5EXLA 4YLQH 3EQ0H 4I8GA 3SI4H 1C1WH 2PTCE 5E0JA 1EXFA 1TYNA 3S9BA 1CA0B 1T31A 1GJ6A 2TBSA 3PWBA 1HJAB 1NU9A 2ZDVH 3A84A 1CGJE 2BY7X 1GJ7B 4NIXA 1GMCF 2BD7A 2UUFB 2GMTC 4XDEA 1GDNA 3RXFA 2GT8A 1ELGA 3CP7A 4K69A 2ILNA 1GMCG 3PV4A 5F8ZA 4NA9H 1P0SH 1AWHB 2XXLA 2H9HA 1QBNA 1EJAA 4O03A 2ZDMA 1OP8A 2CGAA 5AFYH 2VINA 5AFZH 4AORA 1PQAA 2G5NA 3TH3H 3RXIA 4AN7A 1C1SA 1YLDA 3I29A 3RXRA 3ENSB 4ABEA 3TGJE 1ETRH 2FOHA 2IN2A 3FVFB 3MH7A 5F03A 2Z9GA 4FU9A 1QJ7B 3U9AH 3ZZAA 3E91A 3RMOH 2TGTA 1O5DH 1C5VA 2CXVA 3ODDA 3SU4A 1THSH 1Y3WA 1ZMNA 1EP5A 2FODA 4X0WU 3NZIA 1WUNH 2LPRA 4VGCC 1EQ9A 1ZHRA 3ZVGA 4WY3A 3OX7U 3SJ8A 1C4V2 2BD2A 4UEHH 1J17T 1HAVA 3RM2H 3TVJB 3MYWA 3ZZBA 1L1GA 3ZZ7A 2H9EH 1QBVH 1H8DH 2HLCA 1PJPA 5I25A 3VB7A 1O3HA 1T4UH 1D6RA 4BOHA 5LH8A 1TLDA 1FNIA 1Y5AT 3M3TA 1GI9B 1GG6B 1TNLA 1KY9A 1G36A 4X1SU 5FPSA 1BTUA 1K22H 1FAKH 1QL7A 1TA2A 4WMDA 4B2AA 4WJG2 1GVLA 1BB0B 4OS4A 2UUKB 3GISB 1P10A 1F0RA 1K1JA 2QF0A 1TB6H 1Z7KA 2BX3A 3A7TA 3QGJA 3T27A 4AZ2B 3U1JB 1MZAA 1NPMA 2FLBH 2OC1A 1SGNE 3KQDA 1GJ4H 5GPIB 2VVVA 2Z3EA 2VWOA 2PV9B 4AG2A 4CRDA 1SQAA 1WTHD 1KLJH 1AE8H 1PPZA 1PPCE 3S69A 5FBIA 3T28A 1EP6A 2ZNKH 1ACBE 4WH6A 1LHCH 4K1TA 2BDAA 1UK2A 1N1LA 1Q31A 1P2MA 4R8TB 3KIDU 1QHRB 1XKAC 2Q1JA 1RXPA 2GV7A 1OX1A 3TITA 2PFEA 4J2YB 4ZAEA 3ZZ6A 2A31A 5T6FA 1DWDH 4NWLA 2AGEX 2Z9LA 1C5MD 3V13A 1HXFH 1QB1A 3SV8A 3MH4A 1FONA 5CHAB 2PW8H 1BHXB 1P57B 1C2IA 3A8DA 4AX9H 3BSQA 3O8BA 1YLCA 5DPAA 5LGOA 3PTBA 4DY7B 4WXVA 2ZEBA 1GBHA 4AGJA 1CT2E 2BVRH 1O33A 2HNTF 3A7YA 3MNBA 4NSYA 4OS6A 3EDXB 1D3QB 2BY8X 1O2QA 2HRVA 1UJ1A 1A3EH 2ALPA 1ETSH 1C9PA 3IWMA 1IQJA 1GCTC 2AMPA 1AKSA 1TABE 4DW2U 1HBTH 1V2WT 1Z8IB 4O3UA 1O2VA 3GCHC 4D76A 5DO4H 1AVGH 1LKAA 3VB6A 2C3SA 4NZLA 1GI7B 2FS8A 4H4FA 2SFAA 3TH2H 1A0LA 2XBXA 1OPHB 5SGAE 6ESTA 1O39A 2BB4A 3DD2H 1O3KA 3SJIA 3K2UA 1EAUA 1G3EA 4MG3A 3NK8A 1LMWB 5H4IB 1ETTH 4NA7A 2ZDKA 3M36A 2BLQA 4FVBA 2GX4A 2H6MA 2ZGBH 6CHAB 3EYDA 1A2CH 1TPPA 1YP9A 4TWYA 3MNSA 1N8OB 3PM3A 1C1PA 1CE5A 2OQUA 5I46H 1BRBE 2AEIH 3BTDE 1UCYH 2BY9X 2J95A 2ALVA 1H9HE 4DT7B 1AUTC 5HYOA 3RXTA 1FJSA 1FY4A 4DIIH 3SUEA 1DDJA 1Z8GA 3AAUA 4FUDA 1P04A 5C5OA 1BBRK 1O2OA 3AW0A 3Q3YA 1CT4E 2WPMS 1K1PA 3MTYA 3RMLH 2GCTC 4WMFA 4NCYA 3UFAA 2A4GA 1ARBA 4IW4E 1GI0A 4BAHB 3UQVA 2Z6BD 1UTQA 3QX5H 1N6YA 2FOMB 4ZHAA 2DUCA 1TNIA 1AFEH 3RXAA 1J15A 1C1VH 5C67A 1FLEE 1TGBA 1CHOF 1DOJA 3OU0A 1GBEA 1EZQA 1NFYA 1PPGE 5HMAA 1K28D 4IC6A 2ZP0H 1TGCA 1GJDB 2VIOA 4GHQA 1QA0A 1BIOA 3VEQB 1GJ9B 2PGQB 1PPEE 1MKXK 2QXJA 4OS1A 4HZHA 3KQBA 5FBEA 1HFDA 1O3LA 4ESTE 1FUJA 1LVYA 1EPTC 3HPTB 3LJOA 1TA6A 1A1RA 3SNBA 1RTLA 2QY0B 1XVMA 2FIRH 2W3IA 4Q7XA 4MLFB 1O2LA 2A7CA 3UWIA 3MHWU 1WBGB 5C5NA 5EG4A 1FV9A 4Y7BA 3SOSA 1ZPBA 1F0SA 2V0BA 2OC8A 3A7WA 3EE0B 3STIA 1F7ZA 3KGPA 3SV6A 1XXFA 1NRSH 1OSSA 1SBWA 4AFQA 3BTFE 5BRRE 2G55A 4H42U 3UREA 1FPHH 1C2JA 4Y6DA 3KNXA 1L2EA 1O5BB 1ZRKA 1LPGB 2Y5GA 1THRH 1BTHH 5A8YA 1V2LT 5JBTA 1ZZZA 1QQUA 5JDUB 2QIQA 1HNEE 1JRSA 5A0AE 5GCHF 1O30A 2FOEA 4IBLH 2ZTZA 1H1BA 2RA3A 1AFQB 4IN1A 3Q00A 1DSTA 4BAOB 2W7UA 1BTZA 1P2KA 1AO5A 3OY5U 1U6QA 4Y79A 5GCHG 1IQGA 1YYY1 1PPFE 2Y7ZA 2H9TH 3CS0A 3E0PB 1CU1A 1K1MA 1T8LA 1VCPA 1O2MA 1L4ZA 4D8NA 1GJCB 3BF6H 2EA3A 3O8RA 4INHA 1MZDA 1SQOA 2G52A 2HNTC 3LH3A 1VCQA 3PMHB 1TPAE 2ZGHA 1ZYOA 5BPEA 1TBRH 3OSYA 1A61H 1W0ZU 2XBWA 1FZZA 4FUEA 1LVMA 1FN6A 4DJZB 1LQDB 1A3BH 1GBTA 2HPQH 1P12E 2ZDNA 2AH4X 2F9OA 5K0HA 1K9OE 4Y76A 2K1QA 1EAXA 2ZFFH 1SFQB 3P8NA 2A7JA 2ZF0H 1BA8B 3M5MA 3SJ9A 2OCVB 4ISIH 4D7GA 1MH0A 1C5WB 3GY7A 1SHYA 1ESTA 5C2ZA 1EASA 1O2GH 3MU5A 3EBNA 2VVUA 2Z3CA 1TBQH 4XBDA 1O3PB 2BX4A
chains in the Genus database with same CATH superfamily
2RDLA 1OP2A 1H9LB 1F5RA 1GBAA 3ZZ8A 2O8WA 1GBKA 3EA7A 3MH6A 2F3CE 5F8TA 2JIZD 3DSOA 1A0HB 3QK1A 1O38A 1Y59T 4JK6A 3MU0A 3SBKA 2CF8H 1MQ5A 5JBAS 5AVDA 1GJ8B 1IQEA 4ASHA 2PUQH 2TGPZ 3A81A 1C1TA 2GCHG 2FEQH 4X1QU 1ABIH 1ELFA 2PP6A 3M5OA 2ULLA 3E8LA 5L2ZH 1V2UT 2HALA 2ZC9H 1P3EA 4BANB 4YLUA 2FI3E 1UCYE 3VG8A 1AB9C 1B5GH 2ZDLA 4Y8YA 1CO7E 3E3TA 1SSXA 3SW2B 1TPOA 3ZZ9A 3E16B 3SUGA 3SYJA 1WCZA 1AZZA 1E79D 2P8OB 5A0CA 1DT2A 4U2WA 3ZVBA 3RXGA 3SGQE 3TJUA 4B73A 1YPJH 3F0OA 3ZVAA 1GI5A 4Q2KA 3BN9A 3T62A 2IPHA 2NU1E 4Z1MD 3RXLA 1VKYA 3ZZ4A 2QCYA 1HYLA 1T8OA 4PROA 3VXFH 1S5SA 1BRUP 3PLBA 1C5QA 2F9NA 4TY6A 1O3FA 4WMEA 2J5UA 5HIZA 4U30A 3F0PA 4MNWA 3VFEA 5FPYA 4K60A 1HAHH 4BAMB 2OK5A 3AASA 4LOYH 3RP2A 3LGYA 2KX4A 4TPIZ 3K6YA 4Y71A 2NU4E 2A5IA 2ZO3H 2A4QA 2I6SA 2WPJS 1DUEA 1ANDA 1Z8JB 4X6PA 5TCAA 2QXHA 4DGJA 3B9FH 2CV3A 3SGBE 2QGRA 3KN2A 3BTME 4IMQA 4Y0YE 1T7CA 1QFKH 5C3NA 2BY5X 1WOFA 1C2GA 2B0FA 1XX9A 1CGIE 4B2BA 4K2YA 4XBCA 1GBFA 1KSNA 2OINA 4K8YA 3URDA 2BD4A 2J94A 2P59A 2BVXH 3LU9B 2ZPSA 2FOGA 4E7RG 4ZUHA 3PO1B 3ZV9A 1O3OA 1DPOA 1SL3A 1INCA 4WVPE 4YM9A 4X2XA 1HB0B 3GCOA 1HAGE 1GHAF 2P95A 1BTPA 4E05H 1VZQH 2L6OA 2BQWB 7GCHF 1W14U 3R3GB 4LZ1H 4K5ZA 5JBCS 1QCPA 2ODPA 4HI3A 3TGKE 2UWOA 3KQEA 3MO6A 3SZNA 1W13U 1BMFD 1CHGA 1DITH 2FESH 4GPGA 1YPMH 1KXAA 2BLWA 3S9CA 2HOBA 1QRXA 1K0HA 4MPWA 7GCHG 1O2NA 1MCVA 1WXRA 4FUCA 4UDWH 5DKMA 3BEIB 3P92A 3QDZB 1FI8A 3BTQE 4DCDA 3D62A 1QB9A 2GZ7A 1DWEH 1YPHC 2ZU2A 1O3JA 1QL8A 1ZMLA 1TQ0B 1GI1A 3QZQA 1QNJA 3AK5A 1FQ3A 3P70B 1M9UA 1FY5A 2V3OH 1HUTH 3M5LA 2VVCA 1DFPA 1HCGA 1GPZA 1ZLRA 1TE0A 5DSFA 1FPCH 4KTSA 1K21H 2EI8A 2FTMA 2G00A 2QN5T 4CHAC 1RRKA 3RLYH 2CHAB 1PQ8A 9LPRA 5CMXH 8KME2 3E6PH 1B0EA 3I78A 2ZHEH 1C5SA 2IPQX 1UHBB 3LH1A 3IG6B 3MNXA 3U8TH 2A5AA 3BG4B 2OXSA 1UVSH 2IJOB 1D3DB 1LO6A 5C17A 1YC0A 4ZXXH 2ODQA 1IQNA 2LIZA 2FZZA 1OS8A 2Q6GA 5J4SA 1P02A 3MU1A 1LVOA 2AMDA 1XUJA 1P2OA 1J9CH 3UNQA 2UUJB 1NO9H 2OD3B 3RXMA 1C5XB 2G51A 2NU2E 1ELCA 1HAOH 4WH8A 3TK9A 2J9NA 4XBBA 2D8WA 3GYMA 2BLOA 5EOKA 4NA8A 3M5NA 3UR9A 1KDQB 2JH6D 1GI2A 3G01A 4E06H 1O37A 3A8AA 1S0QA 2GVFA 2XBVA 1J16A 2M2AA 8LPRA 2HNTE 1C2FA 2FO9A 1KLTA 4ABBA 2BY6X 4AGKA 4ABAA 1GBIA 3ZV8A 1O34A 2XC0A 1P11E 3OFND 1ELVA 1SB1H 1D6WA 2BYAX 1P3CA 1BITA 2W6ID 2FOAA 2EC9H 2BDYA 3RDZA 4KTUA 1DX5M 3P8FA 1DY8A 1QR3E 3TK6A 3RXEA 3OAAD 1GCTB 2ODYB 4KGAA 4MNXA 1GBJA 3LGTA 1IHTH 1O2ZA 3O8CA 1RGQA 7KMEH 2C90B 5DN6D 4DIHH 2SGAA 4M7GA 1ZR0A 4O3TA 3KQ5A 4F48B 2QE7D 1AE5A 2Z9JA 4Y8ZA 5B6LA 2QV1A 4I8LA 2BDBA 3VGCC 1O3GA 1TNHA 4X2YA 2WUBA 4M9FA 1K1OA 1LHEH 1ANEA 3ZZDA 1Z1JA 1HV7A 1O3CA 1E35B 4ZXYH 4INLA 2ZZUH 1P03A 3BIUH 2C4FH 1UTPA 3SN8A 1UTOA 1HAIH 3U98H 3MU8A 1P01A 1YWUA 1GDUA 4BTUB 5EW2H 3BTKE 3KYGA 2XC4A 3C1KA 5EW1H 4AB9A 2F9BH 2KAIB 3RC5A 1FXYA 4AFUA 5HM9A 1SLVB 3M35A 3A82A 4TWWA 1GI6A 1YM0A 1C5OH 2VIQA 2GV6A 1B0FA 4FU8A 1LKBA 2V3MA 2A45B 3FANA 4JYUH 3QLPH 4XD7D 1CA0C 3HK3B 2VGCC 3PMJA 1SGYE 2PLXA 2A32A 2PKAB 1F0UA 4XOJA 3ZZ3A 3SO3A 2GCTB 1HAXB 4Y11E 1IQLA 2ZA5A 1BTWA 1NFXA 4YT7H 1S81A 1GHWH 3RXQA 5FX5A 1LHGH 4GVUA 3SUDA 4AFSA 1HJ8A 1SPJA 4YOJA 1O3IA 5GXPA 1O2IA 2WV4A 1QA7A 2P3TB 3LGIA 1SOZA 2OUAA 2WZQA 2QXIA 3RXJA 1Z71A 2VWNA 4UFGH 1C5NH 4Z0KA 1VR1H 1XM1A 3ZYEA 1C2MA 3UWJH 3A86A 1UTJA 3K9XB 3ODFA 4AC9A 3RMNH 1W0JD 2FX6A 1Y5BT 3N99A 1BBRH 1WDIA 4BNRA 4X8SH 4MQAA 4RT1A 1J14A 1SVPA 3R0FA 3TJNA 1EZXC 3AW1A 1IQMA 2W26A 1YY3A 3E1XB 3KQCA 3EA8A 1FIZA 1ZGIA 3WWBA 1QGFA 1PPHE 2R0LA 2FPZA 2ZGJA 2XC5A 1MTSA 1O2XA 1NN6A 4IN2A 4FXGH 3QTOH 4F49A 1NM6A 4WWYA 2ZG0H 3NUMA 3M3VA 1C5YB 1A5HA 1MU8B 1GG6C 3RC6A 4ZHMU 4NSVA 5A8ZA 3GS9A 1G3DA 4ZHLU 1S83A 3UOUA 1H4WA 3MU4A 1NBME 4X6MA 3MI4A 1GGDB 1NC6A 1C2HA 1AHTH 1O2SA 1SGIB 4LK4A 1UVPA 1GDQA 3A8BA 1O5FH 2IOTA 3LGVA 2A5KA 3L3TA 2GZ9A 4I8HA 3M7TA 1YPHE 4ISOA 4Z6AH 1JMOH 3MH5A 5C1UA 3RU4D 2P16A 3UOPA 2WPIS 2PHBA 4Y8XA 1MBQA 1DUAA 1SFIA 4FUIA 5CHBA 1O31A 1SGQE 3NPSA 1ELAA 1WU1A 1QIXB 4I8KA 3SJOA 1E34B 1W7XH 2VIWA 4DT4A 3ATIA 1WV7H 2YMSB 2ZKSA 1HAYB 1KTTB 2R3YA 5FXLA 1UTLM 3TIUA 1TRNA 1SHHB 2VIPA 2ZTXA 4HTCH 1LTOA 4ZMAH 2WINI 5IK2D 4K8BA 3P8OA 4JZFH 1TNJA 3F9HA 3SU1A 1RIWB 4IS5A 3SNCA 4AYYB 1RFNA 1GI8B 4O9VA 5F8XA 5DGJA 3VB5A 1VJ9U 3BV9B 1HIAA 3RXVA 1GMHF 1NFUA 1GWAA 5JYIA 1KXFA 3NKKA 2STAE 1PFXC 2UWLA 2ZPRA 3QUMP 1QJ1B 2GP9B 3TGIE 4SGAE 3SUFA 1CHOG 3B8JA 1O5GH 4TSFD 1O5CB 1A0JA 1GMHG 1YCPM 4CBNA 2AERH 1GHZA 3IITA 2WUCA 4ISHH 7LPRA 3V0XA 1OYTH 2FI4E 1MTVA 2KCYA 4YOGA 1BRCE 4INKA 2XOKD 2FXRA 2HGTH 2LELA 3URCA 1MCTA 1H8IH 3GICB 1KTSB 3FZDA 1J8AA 1HAVB 1A46H 1TX8A 4CRFA 3W95A 2BM2A 1GMDF 2CJIA 2SGPE 4TPYA 1NRRH 2ZU4A 4FOUC 4IMZA 1VCWA 5IYTA 2SNWA 1ZMJA 1W10U 4SGBE 2BD3A 1VITF 2Z9IA 1ZTKA 2AIQA 3SNAA 3ZZCA 1MBMA 1T8NA 1V2QT 2B8OH 4OS5A 2C8YB 2QYIA 3KYFA 4AOQA 4X2VA 2VNTA 3PLKA 3SU0A 2ZFTA 4YZUA 1W2KH 1VITG 1VGCB 5C1YA 3RXCA 1TOCB 1OKXA 1TGSZ 4I33A 1GBCA 1XMNB 3P95A 4X8TH 1KIGH 4QT8C 4IGDA 2RDEA 1BTXA 2F9VA 2C93B 1WSSH 2Z9KA 5JPMH 5A0BA 2FM2A 1TNGA 3K65B 1ZJKA 1FN8A 4B74A 3TNSA 2RG3A 3LJJA 3TK5A 2WYJA 4AFZA 5GWZA 2CF9H 1BOQA 5J4QA 3SORA 3QO6A 1N8OC 4E7NA 1C2DA 2R0KA 3HGNA 5DP8A 3ELAH 3FAOA 4Q4LA 5EJLA 4JZ1A 2Q6DA 3AVZA 3FP8E 4THNH 3DSPA 5FCKA 5EXNA 1MTWA 3NCLA 2VH6A 4Y10E 5EGMA 4YTAA 1TONA 3RXPA 3FFGA 1D3PB 1HJ9A 4ZROA 1O2PA 3U1IB 1SLWB 1SR5C 2FYQA 4BAQB 1ID5H 1IOEA 1NT1A 1H8HD 1GVZA 3UB0A 3EAJA 4RSPA 2QA9E 4CRAA 1GJAB 4UD9H 1BBRE 1HAPH 1MKWK 1N6XA 1L1NA 5HM2A 2CN0H 1BTYA 3FOAA 2P3UB 3FP7E 2H5DA 1O3DA 1NU7B 1C1OA 1EJNA 1G3CA 1S6LA 4MNVA 3N7DA 3ZZ5A 3GCNA 4I7YH 1CSOE 1IAUA 3ATKA 2FLRH 3KEEA 3O8DA 3SU6A 1V2KT 5FPTA 1RD3B 1UMAH 1JOUB 3FZZA 1NRPH 5EU8A 1EX3A 1P05A 3A7ZA 5GJ4B 3PV2A 2GJGA 5FHTA 3VB3A 4A1XA 1CGHA 2FOFA 2BDCA 5E2OA 3RXDA 1LDTT 3A87A 3Q3KA 1S84A 1Y8TA 1YPKH 3PWCA 2ZI2H 1MD8A 3VXEH 5LPFA 1ZTJA 3H09A 5L30H 6GCHF 3PMBB 1SMFE 1WTGH 2ZECA 3P6ZB 1S85A 1A7SA 3NWUA 1W3CA 2W6JD 1F5KU 4KKDA 2HVXA 2ANMH 1ZPZA 6GCHG 1YPGH 2J2UA 1OP0A 4RI0A 2BLVA 3RXBA 4K3JA 3U8RH 2EY4C 5E8EH 2ESTE 2I6QA 4X8VH 1DICA 1YPLH 1NROH 2J98A 1SGFA 5T6GA 3OY6U 4AYVB 2ZWLH 1AN1E 1S6FA 3ZVDA 1XUGA 4FUGA 3M37A 3RLWH 4UE7H 1SGTA 2JETC 2R9PA 3BTGE 3A83A 1Y5UT 3RXKA 4DOQA 4JZDH 2ZU5A 3CNRA 3JZ2B 2Y82A 1C5UA 2V35A 2KAIA 3ESTA 3JZ1B 1Z1IA 3LC3A 1AFQC 5L6NH 4LZ4B 4MPUA 2PKSC 1NTPA 5DJ7A 4CH2B 1BCUH 1BQYA 1QQ4A 1TRMA 3FKSD 5EQQA 2GTBA 2GMTB 1UTNA 2ZHDA 3H7TA 1TAWA 1V2NT 3SHCH 1DANH 4D7FA 2ZFQH 2PKAA 3UY9A 4OGYA 1O3EA 3D49H 2G81E 1C5PA 2JH5D 3SU5A 2ZCKP 3TU7H 1Y3XA 1P2JA 2DE9A 4TY7A 1AUJA 2AMQA 3RU4T 1MTNC 1TBZH 2A2XH 1K1LA 1EOJA 1A5GH 1K2I1 2ZGCA 4I31A 2VWLA 1W12U 3V3MA 2WPLS 5KEDA 1UVTH 1H9IE 3BIVH 5F53A 2D26C 5FAHA 4H6TA 1XUKA 5TJXA 1V3XA 5EPYA 3ITIA 2OC7A 4VGCB 3SU3A 2OTVA 1IHSH 1W0YH 3T2NA 3GY4A 4JZEH 1SGRE 3MWIU 1TMTH 1WQVH 1GHAG 1FY3A 2G4TA 1GL1A 2FX4A 1O5EH 3SNEA 1SQTA 4B2CA 4NG9H 2Y6TA 3A85A 4ZKOU 2BZAA 1O5AB 2WPHS 5T3HA 1Q3XA 4JMYA 3VGCB 4ABHA 2A2QH 3ZYDA 1ZSKA 2BZ6H 2Y7XA 3GDUA 3LGWA 2XNDD 3BEFB 3MO3A 1CQQA 1UO6A 1CVWH 3GY3A 3PB1E 1HXEH 5C94A 3UTUH 1UVUH 1HPGA 2BHGA 4NWKA 3DFJA 2B9LA 3LOXA 2VWMA 1QBOA 1VITH 4UONA 5GDSH 5JB9S 2PSXA 2VH0A 1ZSJA 2C8WB 1SC8U 1YCPK 1ELEE 2D1JA 3SV7A 2ZDAH 4JYTA 1ZHMA 3PMAB 1LPKB 3RM0H 2P8OC 2STBE 2D2DA 4YXWD 1O32A 1WQSA 4OS7A 2FOCA 1C4U2 1QB6A 2H2ZA 1C4Y2 1C2KA 1P2QA 2Z7FE 2GGVB 2VGCB 2BMGB 4Q7YA 1S82A 2F83A 1O3MA 2BOHB 1C9TA 3UNRA 1A4WH 2XW9A 1NZQH 1Y3YA 1L1JA 2Y81A 4JCNA 2G4UA 3LONA 1T32A 4Y7AA 1SGFG 2C8XB 2V7QD 4J1YA 4MPVA 5JBBS 3BG8A 1DVAH 4ZKRU 3NXPA 2AS9A 2ZQ2A 3D65E 4BTIB 2RFKC 3GDSA 4CR9A 1DXPA 1C1MA 3PTNA 2YNAA 1GJBB 3A80A 1O2RA 1TOMH 1D4PB 3WY8A 2Y5HA 4FUBA 1F0TA 2R2WU 3K6ZA 2YNBA 4AG1A 5JB8S 1QTFA 3MMGA 4ABFA 3OTJE 7ESTE 1SGCA 1TNKA 1OXGA 2XYAA 3U8OH 3LKWA 2FWWA 4U01A 3ZVFA 1AMHA 2ZCLP 3N7OA 3OYPA 3PO1C 1GHYH 3GCHB 2TGAA 5AHGH 3W94A 1ANBA 1JWTA 1GHXH 2R3UA 2BD9A 1DWBH 4OS2A 3RXOA 1H8ED 5A2MH 1O2WA 2FS9A 1ZTLA 1W0KD 3EGKH 2SGFE 3S7HB 4YOIA 1TGNA 2A4OA 5C20A 1BHXF 1K1NA 1CT0E 4CREA 4B1TA 9ESTA 3QN7A 4H6SB 3L6PA 2A7HA 5L2YH 1CBWC 1XUFA 1JBUH 3PLPA 3UAIC 2BD8A 2J34A 3F2HA 4O97A 2ZFPH 5LPEA 1BMAA 4CR5A 1CA8B 1JIMA 3BTWE 1C2LA 1B7XB 1TRYA 3STJA 2YOLA 1GL0E 3LDXH 2EI7A 3KHVA 1P9SA 2Q6FA 1G37A 1Y3VA 1NRQH 2ZHWH 3Q77A 5FCRA 1BT7A 3RXSA 1EB2A 1TPSA 1XUIA 3A7XA 2SGQE 1MU6B 1TX6A 4ABGA 2Y5FA 5FL7D 5EIYA 2CHAC 2L74A 3EA9A 1MAYA 2XWBI 2HLDD 1OWJA 1V2JT 2O9QA 3TJOA 5AF9H 4A6LA 1BUIA 3Q76A 4NIVA 4XE4A 3B23B 1P2IA 4A7IB 4RKJB 1ELTA 1OOKB 3SHAH 3BG4C 1HJAC 3NRLA 2ZFRH 3Q3XA 2YMSD 3PROA 2WV9A 2ZU1A 5C0TA 3S9AA 1EAWA 1HAZB 1MUEB 2R2MB 3HKIB 4FUJA 3ZVEA 2ZU3A 1FDPA 3F1SB 2G5VA 1TMUH 5E0GA 1LCYA 2UWPA 2K7XA 4Y0ZE 2PWXA 1COWD 1XXDA 3SI3H 1AVXA 1F2SE 3GY2A 1SI5H 2FMJA 1OWHA 2B5TB 3RU4E 1SLXB 2BOKA 4NIYA 1E36B 1TIOA 2OQ5A 1C1RA 2FOBA 4CRCA 2V3HH 1G32B 3BTHE 1JIRA 4KELA 2H5CA 4B75A 5IDKA 4RN6A 3VPKA 2J4IA 3DT0H 2QAAA 4TT3D 1ZHPA 1F5LA 2AGGX 2SGDE 2TRMA 2Y80A 2TPIZ 3SNDA 2BDIA 5C1XA 5DP9A 2PTNA 2XCNA 1LPZB 1EPTB 1LQEA 3QWCH 1BDAA 3SGAE 2XRCA 1AIXH 1O2YA 3VB4A 2B7DH 4CH8B 2QF3A 1DE7H 4BTTB 4F4OC 2ZTYA 3SQHE 2A1DB 4KP0A 2LNCA 4B76A 1GCDA 4JK5A 1XVOA 1FMGA 3H5CB 6LPRA 4KTCA 4D9QA 1OWEA 1MTUA 1MAXA 1V6DA 2Z3DA 4TYDA 1L4DA 1C5RA 4FUHA 4X6OA 2OP9A 3GY6A 2BTCE 1QY6A 3V7TA 5T6DA 4GUXA 1TWXB 3KF2A 5EODA 4ZH8A 3TPIZ 4B71A 1JRTA 1MKXH 3N7EA 2EEKA 1DY9A 1O2KA 3DFLA 1V2RT 2RCEA 3BTEE 3SZEA 1LHDH 1L0ZA 1O35A 5B6OA 1GBLA 3SJKA 3TJVA 3TNTA 3MQKC 3OEED 2ZQ1A 4ABIA 2V6NA 2PSYA 2ZHQH 3QZRA 1O2UA 4A5TS 1DWCH 1D9IA 1Z6EA 1EZUC 1NY22 2GZ8A 2XBYA 2KM0A 2O8LA 3RC4A 4X8UH 5EQRA 5CE1A 3M3SA 1TX7A 4MNYA 4X2WA 2BQ7B 4UFEH 3TLOA 2QC2A 4XRNA 3RXHA 2AGIX 3S7KB 2XNIA 3UUZA 2VIVA 2JKHA 4YT6H 5HXFA 3GY8A 2P93A 4A92A 3DUXH 1IQIA 1HLTH 2M5TA 3DHKH 5CDFE 1V2PT 5E2PA 1DXWA 3RMMH 2FDAA 1Z8RA 3ATWA 1WYKA 1ANCA 2OBOA 2RA0A 2NWNA 2BVSH 5ESTE 5CHAC 4I8JA 1KXDA 4DVAU 3UNSA 3C27B 1C5LH 1NFWA 3WWFA 1ZSLA 1AWFH 2WPKS 1BMLA 4U32A 2THFB 2BDHA 1QJ6B 1IQHA 5FX6A 8GCHF 2AFQB 1P8VC 1Q2WA 4RKOB 2AHME 3F68H 2O8MA 3F9GA 1MQ6A 2SGEE 3T5FH 8ESTE 1BJUA 1D3TB 2VIDA 3ZVCA 8GCHG 5PTPA 1G2LA 1G30B 1EKBB 1XKBC 1UW7A 2Z94A 3CS7A 3KL6A 2HWLB 1YBWA 1HGTH 1ARCA 2PR3A 1BJVA 3U69H 1IQFA 4P02A 1UK4A 5EPNA 4ABDA 4A1VA 1TGTA 1UCYK 3E0NB 2A4RA 3F3BA 3GCTF 1AY6H 4WF8A 5HGGA 4NIWA 4B6FA 1OWKA 1GMDG 1V2OT 2CMYA 4BXWA 1MKWH 3MO9A 1C1NA 2H1UA 3SV2H 2BDGA 2ZIQH 1EB1H 2AIPA 4JZIA 3GCTG 1EATA 1O3AA 1PYTD 1AB9B 4UFDH 1NESE 5DG6A 2F9PA 1O2TA 2WYGA 1KLIH 1GHBF 5K7RA 2ZCHP 1WAYB 1BMMH 4GLYA 4K1EA 1GGDC 2GD4B 4I32A 4NFEA 3UPEA 1FY1A 2JETB 4FVDA 4YESB 3QTVH 2WHXA 1GHBG 4GSOA 4Q80A 1KXCA 1TFXA 1UHBA 2KCPA 4A1TA 4Q7ZA 6CHAC 1G9IE 4K1SA 4WXIA 1DSUA 1P09A 1QRWA 3GOVB 2AYWA 3UIRA 2F91A 3L33A 3RUOA 2FI5E 5G4BA 4IC5A 3T29A 2PKSB 3DA9B 4FUFA 5DP3A 4MDSA 2KR7A 1JXPA 4X1PU 2BQ6B 1YGCH 1MD7A 2W5EA 5ETXA 3SV9A 2XTTB 2HPPH 3HK6B 1ELBA 1X7AC 2QXGA 4CBOA 1F92A 2FTLE 2J92A 1E37B 1RTFB 3LIWA 1BMNH 2NU3E 3LT3A 4HGCA 1AU8A 1ESAA 1V2TT 2YMSC 5F6MA 1DLKB 4GCHF 1KDQA 1TMBH 1KYNA 1S0RA 2GKVE 1ESBA 1MTNB 2BXUH 3M61U 1RTKA 2WPDD 1TQ7B 1O0DH 1RIWC 1HRTH 2FYRA 4GCHG 2W3KA 1K1IA 3WW7A 1T4VH 3MOCA 1V2VT 4MVNA 4X1RU 2UUYA 3A89A 2ANKH 2SNVA 4BAKB 3QGNB 1C5TA 5EQSA 1KXEA 4X1NU 2BXTH 2ZHFH 3PV5A 1ZGVA 3UR6A 1DLEA 1GBBA 1SG8B 1AKSB 2OC0A 3CENA 5TCCA 4CRBA 2ZPQA 3ATMA 1W11U 3KCGH 1AVWA 1GBMA 1SQRA 1UVOA 4ZKNU 3S0NA 3I77A 1C5ZB 3F6UH 2OBQA 3OTPA 1DM4B 2ASUB 1G2MA 4GAWA 2ANWA 3MFJA 1FAXA 3A88A 5ABWA 2GCHF 4D9RA 2DE8A 5T1VA 1OYQA 1PQ7A 5DP7A 2VB0A 1C1QA 4LXBH 1XUHA 2VBCA 1UK3A 1UTKA 1QURH 4FU7A 1AI8H 4NZQA 4JYVH 1SGDE 4CHAB 1P06A 2FP7B 3T26A 3FP6E 1ELDE 4ZKSU 3H7OA 1EJMA 2TIOA 1BZXE 4X6NA 5DP6A 1VGCC 4CRGA 2VU8E 1O2HA 2GT7A 1QRZA 1HDTH 1TALA 2A0QB 5EXMA 2BD5A 3MNCA 4R0IA 1VJAU 2PUXB 3D23A 1S6HA 5DP4A 3AAVA 1NRNH 5E0HA 2GDEH 2PGBB 3GYLB 1NS3A 1GI4A 3LC5A 1KXBA 4P00A 3GY5A 1LHFH 3RXUA 1RS0A 1PQ5A 1GHVH 5KGOA 3HGPA 4RT0A 5A09A 4MTBA 3LGUA 4OGXA 1O3BA 1FIWA 2XWAA 1OWDA 2P3FH 3P8GA 3HATH 5A8XA 2EI6A 3T25A 1EUFA 2F9UA 4XFQA 4HFPB 2W7SA 1A5IA 2QF5A 4BXSA 2F4LA 3PYHA 2P94A 3GDVA 3E90B 3BTTE 1C1UH 4DG4A 3F9FA 1ABJH 2OLGA 1E0FD 1SOTA 3M7UA 2O8TA 1YCPH 2ANYA 2JH0D 1ZOMA 2XCFA 1HIAB 2G8TA 3TH4H 1P2NA 1THPB 3SU2A 2VJ1A 1ORFA 1PPBH 2O8UA 4ISLA 1AGJA 5EJZA 5GIBA 1V2MT 3LPRA 5DP5A 1SKYE 4DURA 2KCAA 3BEUA 1MMJN 1ZPCA 3DCLA 4GHTA 4ISNA 3HKJB 4ABJA 2CK3D 4UFFH 1EAIA 2GDDA 2C8ZB 5DK1A 1ZRBA 1YPEH 1QL9A 1Y3UA 4NGAH 1O36A 1EOLA 4NFFA 1EPTA 3A7VA 1G3BA 1BRAA 1OWIA 3EE7A 1Z6JH 1AD8H 1SGPE 4ACBA 2J38A 3F9EA 1AQ7A 4XSKU 1GBDA 1EZSC 1GI3A 2TGDA 3P17H 1SLUB 2ZGXH 1CBWB 1OHHD 3SQEE 4MPXA 1FY8E 1RJXB 3A8CA 1UTMA 2KFWA 1ZJDA 1AZ8A 1O2JA 1C2EA 1LVBA 1GJ5H 1YKTA 1W8BH 2WV5A 1E38B 1V2ST 1O3NA 2NU0E 1YF4A 3U28C 1PYTC 1P9UA 1SGEE 3M7QA 3UQOA 1DS2E 3V12A 1IQKA 1T8MA 5LPRA 4YO9A 5ESBA 3ATLA 1GVKB 2ZFSA 1W7GH 4AB8A 5EXLA 4YLQH 3EQ0H 4I8GA 3SI4H 1C1WH 2PTCE 5E0JA 1EXFA 1TYNA 1QZ8A 3S9BA 1CA0B 1T31A 1GJ6A 2TBSA 3PWBA 1HJAB 1NU9A 2ZDVH 3A84A 1CGJE 2BY7X 1GJ7B 4NIXA 1GMCF 2BD7A 2UUFB 1E1RD 2GMTC 4XDEA 1GDNA 3RXFA 2GT8A 2QF4A 1ELGA 5KECA 3CP7A 4K69A 2ILNA 1GMCG 3PV4A 5F8ZA 4NA9H 1P0SH 1AWHB 2XXLA 2H9HA 1QBNA 1EJAA 4O03A 3PRDA 2ZDMA 1OP8A 2CGAA 5AFYH 2VINA 5AFZH 4AORA 1PQAA 2G5NA 3TH3H 3RXIA 4AN7A 1C1SA 1YLDA 3I29A 3RXRA 3ENSB 3F2FA 3PRBA 4ABEA 3TGJE 1ETRH 2FOHA 2IN2A 3FVFB 3MH7A 5F03A 2Z9GA 4FU9A 1QJ7B 3U9AH 3ZZAA 3E91A 3RMOH 2TGTA 1O5DH 1C5VA 2CXVA 3ODDA 3SU4A 1THSH 1Y3WA 1ZMNA 1EP5A 2FODA 4X0WU 3NZIA 1WUNH 2LPRA 4VGCC 1EQ9A 1ZHRA 3ZVGA 4WY3A 3OX7U 3SJ8A 1C4V2 2BD2A 4UEHH 1J17T 1HAVA 3RM2H 3TVJB 3MYWA 5HIYA 3ZZBA 1L1GA 3ZZ7A 2H9EH 1QBVH 1H8DH 2HLCA 1PJPA 5I25A 3VB7A 1O3HA 1T4UH 1D6RA 4BOHA 5LH8A 1TLDA 1FNIA 1Y5AT 3M3TA 1GI9B 1GG6B 1TNLA 1KY9A 1G36A 4X1SU 5FPSA 1BTUA 1K22H 1FAKH 1QL7A 1TA2A 4WMDA 4B2AA 4WJG2 1GVLA 1FX0B 1BB0B 5HKKD 4OS4A 2UUKB 3GISB 2J98B 1P10A 1F0RA 3FO8D 3DSGA 1K1JA 2QF0A 1TB6H 1Z7KA 1YLNA 2BX3A 3A7TA 3QGJA 3T27A 4AZ2B 3U1JB 1MZAA 1NPMA 2FLBH 2OC1A 1SGNE 3KQDA 1GJ4H 5GPIB 2VVVA 2Z3EA 2VWOA 2PV9B 4AG2A 2JDID 4CRDA 1SQAA 1WTHD 1KLJH 1AE8H 1PPZA 1PPCE 3S69A 5FBIA 3T28A 1EP6A 2ZNKH 1ACBE 4WH6A 1LHCH 4K1TA 2BDAA 1UK2A 1N1LA 1Q31A 1P2MA 4R8TB 3KIDU 1QHRB 1XKAC 3OEHD 2Q1JA 1RXPA 2GV7A 1OX1A 3TITA 2PFEA 4J2YB 4ZAEA 3ZZ6A 2A31A 5T6FA 1DWDH 4NWLA 2AGEX 2Z9LA 1C5MD 3V13A 1HXFH 1QB1A 3SV8A 3MH4A 1FONA 5CHAB 2PW8H 1BHXB 1P57B 1C2IA 3A8DA 4AX9H 3BSQA 3O8BA 1YLCA 5DPAA 5LGOA 3PTBA 4DY7B 4WXVA 2ZEBA 1GBHA 4AGJA 1CT2E 2BVRH 1O33A 2HNTF 3A7YA 3MNBA 4NSYA 4OS6A 3EDXB 1D3QB 2BY8X 1O2QA 2HRVA 1UJ1A 1A3EH 2ALPA 1ETSH 1C9PA 3IWMA 1IQJA 1GCTC 2IJD1 2AMPA 1AKSA 1TABE 4DW2U 1HBTH 1V2WT 1Z8IB 4O3UA 1O2VA 3GCHC 4D76A 3FN8A 5DO4H 1AVGH 1LKAA 3VB6A 2C3SA 4NZLA 1GI7B 2FS8A 4H4FA 3F2GA 2SFAA 3TH2H 4I86A 1A0LA 2XBXA 1OPHB 5SGAE 6ESTA 4B6EA 1O39A 2K0QA 2BB4A 4ZCNA 3DD2H 1O3KA 3SJIA 3K2UA 1EAUA 1G3EA 4MG3A 3NK8A 1LMWB 5H4IB 1ETTH 4NA7A 2ZDKA 3M36A 2BLQA 4FVBA 2GX4A 2H6MA 2ZGBH 6CHAB 3EYDA 1A2CH 1TPPA 1YP9A 4TWYA 3MNSA 1N8OB 3PM3A 1C1PA 1CE5A 2OQUA 5I46H 5EJ1A 1BRBE 2AEIH 3BTDE 1UCYH 2BY9X 2J95A 2ALVA 1H9HE 4DT7B 1AUTC 5HYOA 3RXTA 1FJSA 1FY4A 4DIIH 3SUEA 1DDJA 1Z8GA 3AAUA 4FUDA 1P04A 4ASUD 5C5OA 1BBRK 1O2OA 3AW0A 3Q3YA 2KZ4A 1CT4E 2WPMS 1K1PA 3MTYA 3RMLH 2GCTC 4WMFA 4NCYA 2HVYB 3UFAA 2A4GA 1ARBA 4IW4E 1GI0A 4BAHB 3UQVA 2Z6BD 1UTQA 3QX5H 1N6YA 2FOMB 4ZHAA 2DUCA 2EQNA 1TNIA 1AFEH 3RXAA 1J15A 1C1VH 5C67A 4F55A 2J97A 1FLEE 1TGBA 1CHOF 1DOJA 3OU0A 1GBEA 1EZQA 1NFYA 1PPGE 5HMAA 1K28D 4IC6A 2ZP0H 1TGCA 1GJDB 2VIOA 4FETA 4GHQA 1QA0A 1BIOA 3VEQB 1GJ9B 2JJ1D 1NBMD 2PGQB 1PPEE 1MKXK 2QXJA 4OS1A 4HZHA 3KQBA 5FBEA 1HFDA 1O3LA 4ESTE 1FUJA 1LVYA 1EPTC 3HPTB 3LJOA 1TA6A 1A1RA 3SNBA 1RTLA 2QY0B 1XVMA 2FIRH 2W3IA 4Q7XA 4MLFB 1O2LA 2A7CA 3UWIA 3MHWU 1WBGB 5C5NA 5EG4A 1FV9A 4Y7BA 3SOSA 5C0UA 1E1QD 1F0SA 1ZPBA 2OC8A 2V0BA 3A7WA 3EE0B 3STIA 1F7ZA 3KGPA 3SV6A 1XXFA 1NRSH 1OSSA 1SBWA 4AFQA 3BTFE 5BRRE 2G55A 4H42U 3UREA 2K8IA 1FPHH 1C2JA 4Y6DA 3KNXA 1L2EA 1O5BB 1ZRKA 1LPGB 2Y5GA 2WSSD 1THRH 1BTHH 1EFRD 1V2LT 5A8YA 3OE7D 1ZZZA 1QQUA 5JBTA 5JDUB 2QIQA 1HNEE 1JRSA 5A0AE 5GCHF 1O30A 2FOEA 4IBLH 2ZTZA 1H1BA 2RA3A 1AFQB 2KCOA 4IN1A 3Q00A 1DSTA 4BAOB 2W7UA 4Q63A 1BTZA 1P2KA 1AO5A 2LP6A 3OY5U 1U6QA 4Y79A 5GCHG 1IQGA 1YYY1 1PPFE 2Y7ZA 2H9TH 3CS0A 3E0PB 1CU1A 1K1MA 1T8LA 1VCPA 1O2MA 1L4ZA 4D8NA 1GJCB 3BF6H 2EA3A 3O8RA 3W1EA 4INHA 1MZDA 1KMHB 1SQOA 2G52A 2HNTC 3LH3A 1VCQA 2JJ2D 3PMHB 1TPAE 2ZGHA 1ZYOA 5BPEA 1TBRH 2F43B 3OSYA 1A61H 1W0ZU 2XBWA 1FZZA 4FUEA 1LVMA 1FN6A 3ZIAD 4DJZB 1LQDB 1A3BH 1GBTA 2HPQH 1P12E 2ZDNA 4OM9A 2AH4X 2F9OA 5K0HA 1K9OE 4Y76A 2K1QA 1EAXA 1MABB 2ZFFH 1SFQB 3P8NA 4ACAA 2A7JA 2ZF0H 1BA8B 3M5MA 3SJ9A 5GNDA 2OCVB 4ISIH 4D7GA 1MH0A 1C5WB 3GY7A 1SHYA 1ESTA 5C2ZA 1EASA 4HG6A 1O2GH 3MU5A 3EBNA 2VVUA 2Z3CA 1TBQH 4XBDA 1O3PB 2BX4A
chains in the Genus database with same CATH topology
2RDLA 1OP2A 1H9LB 1F5RA 1GBAA 3ZZ8A 2O8WA 1GBKA 3EA7A 3MH6A 2F3CE 5F8TA 1A0HB 3QK1A 1O38A 1Y59T 4JK6A 3MU0A 3SBKA 2CF8H 1MQ5A 5JBAS 5AVDA 1GJ8B 1IQEA 4ASHA 2PUQH 2TGPZ 3A81A 1C1TA 2GCHG 2FEQH 4X1QU 1ABIH 1ELFA 3M5OA 2ULLA 3E8LA 5L2ZH 1V2UT 2HALA 2ZC9H 1P3EA 4BANB 4YLUA 2FI3E 1UCYE 1AB9C 1B5GH 2ZDLA 4Y8YA 1CO7E 3E3TA 1SSXA 3SW2B 1TPOA 3ZZ9A 3E16B 3SUGA 1WCZA 1AZZA 2P8OB 5A0CA 1DT2A 4U2WA 3ZVBA 3RXGA 3SGQE 3TJUA 4B73A 1YPJH 3ZVAA 1GI5A 4Q2KA 3BN9A 3T62A 2IPHA 2NU1E 3RXLA 3ZZ4A 2QCYA 1HYLA 1T8OA 4PROA 3VXFH 1S5SA 1BRUP 3PLBA 1C5QA 2F9NA 4TY6A 1O3FA 4WMEA 4U30A 4MNWA 3VFEA 5FPYA 4K60A 1HAHH 4BAMB 3AASA 4LOYH 3RP2A 3LGYA 4TPIZ 3K6YA 4Y71A 2NU4E 2A5IA 2ZO3H 2A4QA 2I6SA 2WPJS 1DUEA 1ANDA 1Z8JB 4X6PA 5TCAA 2QXHA 4DGJA 3B9FH 2CV3A 3SGBE 2QGRA 3KN2A 3BTME 4IMQA 4Y0YE 1T7CA 1QFKH 5C3NA 2BY5X 1WOFA 1C2GA 2B0FA 1XX9A 1CGIE 4B2BA 4K2YA 4XBCA 1GBFA 1KSNA 2OINA 4K8YA 3URDA 2BD4A 2J94A 2P59A 2BVXH 3LU9B 2ZPSA 2FOGA 4E7RG 4ZUHA 3PO1B 3ZV9A 1O3OA 1DPOA 1SL3A 1INCA 4WVPE 4YM9A 4X2XA 1HB0B 3GCOA 1HAGE 1GHAF 2P95A 1BTPA 4E05H 1VZQH 2BQWB 7GCHF 1W14U 3R3GB 4LZ1H 4K5ZA 5JBCS 1QCPA 2ODPA 4HI3A 3TGKE 2UWOA 3KQEA 3MO6A 3SZNA 1W13U 1CHGA 1DITH 2FESH 4GPGA 1YPMH 1KXAA 2BLWA 3S9CA 2HOBA 1QRXA 4MPWA 7GCHG 1O2NA 1MCVA 4FUCA 4UDWH 5DKMA 3BEIB 3P92A 3QDZB 1FI8A 3BTQE 4DCDA 3D62A 1QB9A 2GZ7A 1DWEH 1YPHC 2ZU2A 1O3JA 1QL8A 1ZMLA 1TQ0B 1GI1A 3QZQA 1QNJA 1FQ3A 3P70B 1M9UA 1FY5A 2V3OH 1HUTH 3M5LA 2VVCA 1DFPA 1HCGA 1GPZA 1ZLRA 1TE0A 1FPCH 4KTSA 1K21H 2EI8A 2FTMA 2G00A 2QN5T 4CHAC 1RRKA 3RLYH 2CHAB 1PQ8A 9LPRA 5CMXH 8KME2 3E6PH 1B0EA 3I78A 2ZHEH 1C5SA 1UHBB 3LH1A 3IG6B 3MNXA 3U8TH 2A5AA 3BG4B 2OXSA 1UVSH 2IJOB 1D3DB 1LO6A 1YC0A 4ZXXH 2ODQA 1IQNA 2LIZA 2FZZA 1OS8A 2Q6GA 5J4SA 1P02A 3MU1A 1LVOA 2AMDA 1XUJA 1P2OA 1J9CH 3UNQA 2UUJB 1NO9H 2OD3B 3RXMA 1C5XB 2G51A 2NU2E 1ELCA 1HAOH 4WH8A 3TK9A 2J9NA 4XBBA 2D8WA 3GYMA 2BLOA 5EOKA 4NA8A 3M5NA 3UR9A 1KDQB 2JH6D 1GI2A 3G01A 4E06H 1O37A 3A8AA 1S0QA 2GVFA 2XBVA 1J16A 8LPRA 2HNTE 1C2FA 2FO9A 1KLTA 4ABBA 2BY6X 4AGKA 4ABAA 1GBIA 3ZV8A 1O34A 2XC0A 1P11E 1ELVA 1SB1H 1D6WA 2BYAX 1P3CA 1BITA 2FOAA 2EC9H 2BDYA 3RDZA 4KTUA 1DX5M 3P8FA 1DY8A 1QR3E 3TK6A 3RXEA 1GCTB 2ODYB 4KGAA 4MNXA 1GBJA 3LGTA 1IHTH 1O2ZA 3O8CA 1RGQA 7KMEH 2C90B 4DIHH 2SGAA 4M7GA 1ZR0A 4O3TA 1AE5A 2Z9JA 4Y8ZA 2QV1A 4I8LA 2BDBA 3VGCC 1O3GA 1TNHA 4X2YA 2WUBA 1K1OA 1LHEH 1ANEA 3ZZDA 1Z1JA 1HV7A 1O3CA 1E35B 4ZXYH 4INLA 2ZZUH 1P03A 3BIUH 2C4FH 1UTPA 3SN8A 1UTOA 1HAIH 3U98H 3MU8A 1P01A 1GDUA 4BTUB 5EW2H 3BTKE 2XC4A 3C1KA 5EW1H 4AB9A 2F9BH 2KAIB 3RC5A 1FXYA 4AFUA 5HM9A 1SLVB 3M35A 3A82A 4TWWA 1GI6A 1YM0A 1C5OH 2VIQA 2GV6A 1B0FA 4FU8A 1LKBA 2A45B 3FANA 4JYUH 3QLPH 1CA0C 3HK3B 2VGCC 3PMJA 1SGYE 2PLXA 2A32A 2PKAB 1F0UA 4XOJA 3ZZ3A 3SO3A 2GCTB 1HAXB 4Y11E 1IQLA 2ZA5A 1BTWA 1NFXA 4YT7H 1S81A 1GHWH 3RXQA 5FX5A 1LHGH 4GVUA 3SUDA 4AFSA 1HJ8A 1SPJA 4YOJA 1O3IA 5GXPA 1O2IA 2WV4A 1QA7A 2P3TB 3LGIA 1SOZA 2OUAA 2QXIA 3RXJA 1Z71A 2VWNA 4UFGH 1C5NH 4Z0KA 1VR1H 1XM1A 3ZYEA 1C2MA 3UWJH 3A86A 1UTJA 3K9XB 3ODFA 3RMNH 2FX6A 1Y5BT 1BBRH 4BNRA 4X8SH 4MQAA 1J14A 1SVPA 3R0FA 3TJNA 1EZXC 3AW1A 1IQMA 2W26A 3E1XB 3KQCA 3EA8A 1FIZA 1ZGIA 1QGFA 1PPHE 2R0LA 2FPZA 2ZGJA 2XC5A 1MTSA 1O2XA 1NN6A 4IN2A 4FXGH 3QTOH 4F49A 1NM6A 4WWYA 2ZG0H 3NUMA 3M3VA 1C5YB 1A5HA 1MU8B 1GG6C 3RC6A 4ZHMU 4NSVA 5A8ZA 1G3DA 4ZHLU 1S83A 3UOUA 1H4WA 3MU4A 4X6MA 3MI4A 1GGDB 1NC6A 1C2HA 1AHTH 1O2SA 1SGIB 4LK4A 1UVPA 1GDQA 3A8BA 1O5FH 2IOTA 3LGVA 2A5KA 3L3TA 2GZ9A 4I8HA 3M7TA 1YPHE 4ISOA 4Z6AH 1JMOH 3MH5A 5C1UA 3RU4D 2P16A 3UOPA 2WPIS 2PHBA 4Y8XA 1MBQA 1DUAA 1SFIA 4FUIA 1O31A 1SGQE 3NPSA 1ELAA 1WU1A 1QIXB 4I8KA 3SJOA 1E34B 1W7XH 2VIWA 3ATIA 1WV7H 2ZKSA 1HAYB 1KTTB 2R3YA 5FXLA 1UTLM 3TIUA 1TRNA 1SHHB 2VIPA 2ZTXA 4HTCH 1LTOA 4ZMAH 2WINI 4K8BA 3P8OA 4JZFH 1TNJA 3F9HA 3SU1A 1RIWB 4IS5A 3SNCA 4AYYB 1RFNA 1GI8B 4O9VA 5F8XA 5DGJA 3VB5A 1VJ9U 3BV9B 1HIAA 3RXVA 1GMHF 1NFUA 1GWAA 5JYIA 1KXFA 3NKKA 2STAE 1PFXC 2UWLA 2ZPRA 3QUMP 1QJ1B 2GP9B 3TGIE 4SGAE 3SUFA 1CHOG 3B8JA 1O5GH 1O5CB 1A0JA 1GMHG 1YCPM 4CBNA 2AERH 1GHZA 3IITA 2WUCA 4ISHH 7LPRA 3V0XA 1OYTH 2FI4E 1MTVA 4YOGA 1BRCE 4INKA 2FXRA 2HGTH 3URCA 1MCTA 1H8IH 3GICB 1KTSB 3FZDA 1J8AA 1HAVB 1A46H 1TX8A 4CRFA 3W95A 2BM2A 1GMDF 2CJIA 2SGPE 4TPYA 1NRRH 2ZU4A 4IMZA 1VCWA 5IYTA 2SNWA 1ZMJA 1W10U 4SGBE 2BD3A 1VITF 2Z9IA 1ZTKA 2AIQA 3SNAA 3ZZCA 1MBMA 1T8NA 1V2QT 2B8OH 4OS5A 2C8YB 2QYIA 4AOQA 4X2VA 2VNTA 3PLKA 3SU0A 2ZFTA 4YZUA 1W2KH 1VITG 1VGCB 5C1YA 3RXCA 1TOCB 1OKXA 1TGSZ 4I33A 1GBCA 1XMNB 3P95A 4X8TH 1KIGH 4QT8C 4IGDA 1BTXA 2F9VA 2C93B 1WSSH 2Z9KA 5JPMH 5A0BA 2FM2A 1TNGA 3K65B 1ZJKA 1FN8A 4B74A 3TNSA 2RG3A 3LJJA 3TK5A 2WYJA 4AFZA 5GWZA 2CF9H 1BOQA 5J4QA 3SORA 3QO6A 1N8OC 4E7NA 1C2DA 2R0KA 3HGNA 5DP8A 3ELAH 3FAOA 4JZ1A 2Q6DA 3AVZA 3FP8E 4THNH 5FCKA 5EXNA 1MTWA 3NCLA 2VH6A 4Y10E 5EGMA 4YTAA 1TONA 3RXPA 3FFGA 1D3PB 1HJ9A 4ZROA 1O2PA 3U1IB 1SLWB 1SR5C 2FYQA 4BAQB 1ID5H 1IOEA 1NT1A 1GVZA 3EAJA 4RSPA 2QA9E 4CRAA 1GJAB 4UD9H 1BBRE 1HAPH 1MKWK 1N6XA 1L1NA 5HM2A 2CN0H 1BTYA 2P3UB 3FP7E 2H5DA 1O3DA 1NU7B 1C1OA 1EJNA 1G3CA 4MNVA 3ZZ5A 3GCNA 4I7YH 1CSOE 1IAUA 3ATKA 2FLRH 3KEEA 3O8DA 3SU6A 1V2KT 5FPTA 1RD3B 1UMAH 1JOUB 3FZZA 1NRPH 5EU8A 1EX3A 1P05A 3A7ZA 5GJ4B 5FHTA 3VB3A 4A1XA 1CGHA 2FOFA 2BDCA 5E2OA 3RXDA 1LDTT 3A87A 3Q3KA 1S84A 1Y8TA 1YPKH 3PWCA 2ZI2H 1MD8A 3VXEH 5LPFA 1ZTJA 5L30H 6GCHF 3PMBB 1SMFE 1WTGH 2ZECA 3P6ZB 1S85A 1A7SA 3NWUA 1W3CA 1F5KU 4KKDA 2HVXA 2ANMH 1ZPZA 6GCHG 1YPGH 2J2UA 1OP0A 2BLVA 3RXBA 4K3JA 3U8RH 5E8EH 2ESTE 2I6QA 4X8VH 1DICA 1YPLH 1NROH 1SGFA 5T6GA 3OY6U 4AYVB 2ZWLH 1AN1E 1S6FA 3ZVDA 1XUGA 4FUGA 3M37A 3RLWH 4UE7H 1SGTA 2JETC 2R9PA 3BTGE 3A83A 1Y5UT 3RXKA 4DOQA 4JZDH 2ZU5A 3JZ2B 2Y82A 1C5UA 2V35A 2KAIA 3ESTA 3JZ1B 1Z1IA 3LC3A 1AFQC 5L6NH 4LZ4B 4MPUA 2PKSC 1NTPA 5DJ7A 4CH2B 1BCUH 1BQYA 1QQ4A 1TRMA 5EQQA 2GTBA 2GMTB 1UTNA 2ZHDA 3H7TA 1TAWA 1V2NT 3SHCH 1DANH 4D7FA 2ZFQH 2PKAA 3UY9A 4OGYA 1O3EA 3D49H 2G81E 1C5PA 2JH5D 3SU5A 2ZCKP 3TU7H 1Y3XA 1P2JA 2DE9A 4TY7A 1AUJA 2AMQA 3RU4T 1MTNC 1TBZH 2A2XH 1K1LA 1EOJA 1A5GH 1K2I1 2ZGCA 4I31A 2VWLA 1W12U 3V3MA 2WPLS 1UVTH 1H9IE 3BIVH 2D26C 5FAHA 4H6TA 1XUKA 5TJXA 1V3XA 5EPYA 3ITIA 2OC7A 4VGCB 3SU3A 2OTVA 1IHSH 1W0YH 3T2NA 3GY4A 4JZEH 1SGRE 3MWIU 1TMTH 1WQVH 1GHAG 1FY3A 2G4TA 1GL1A 2FX4A 1O5EH 3SNEA 1SQTA 4B2CA 4NG9H 2Y6TA 3A85A 4ZKOU 2BZAA 1O5AB 2WPHS 5T3HA 1Q3XA 4JMYA 3VGCB 4ABHA 2A2QH 3ZYDA 1ZSKA 2BZ6H 2Y7XA 3GDUA 3LGWA 3MO3A 3BEFB 1CQQA 1UO6A 1CVWH 3GY3A 3PB1E 1HXEH 3UTUH 1UVUH 1HPGA 2BHGA 4NWKA 3DFJA 2B9LA 3LOXA 2VWMA 1QBOA 1VITH 4UONA 5GDSH 5JB9S 2PSXA 2VH0A 1ZSJA 2C8WB 1SC8U 1YCPK 1ELEE 2D1JA 3SV7A 2ZDAH 4JYTA 1ZHMA 3PMAB 1LPKB 3RM0H 2P8OC 2STBE 2D2DA 1O32A 1WQSA 4OS7A 2FOCA 1C4U2 1QB6A 2H2ZA 1C4Y2 1C2KA 1P2QA 2Z7FE 2GGVB 2VGCB 2BMGB 4Q7YA 1S82A 2F83A 1O3MA 2BOHB 1C9TA 3UNRA 1A4WH 2XW9A 1NZQH 1Y3YA 1L1JA 2Y81A 4JCNA 2G4UA 3LONA 1T32A 4Y7AA 1SGFG 2C8XB 4J1YA 4MPVA 5JBBS 3BG8A 1DVAH 4ZKRU 3NXPA 2AS9A 2ZQ2A 3D65E 4BTIB 3GDSA 4CR9A 1DXPA 1C1MA 3PTNA 2YNAA 1GJBB 3A80A 1O2RA 1TOMH 1D4PB 3WY8A 2Y5HA 4FUBA 1F0TA 2R2WU 3K6ZA 2YNBA 4AG1A 5JB8S 1QTFA 3MMGA 4ABFA 3OTJE 7ESTE 1SGCA 1TNKA 1OXGA 2XYAA 3U8OH 3LKWA 2FWWA 4U01A 3ZVFA 1AMHA 2ZCLP 3N7OA 3OYPA 3PO1C 1GHYH 3GCHB 2TGAA 5AHGH 3W94A 1ANBA 1JWTA 1GHXH 2R3UA 2BD9A 1DWBH 4OS2A 3RXOA 5A2MH 1O2WA 2FS9A 1ZTLA 3EGKH 2SGFE 3S7HB 4YOIA 1TGNA 2A4OA 5C20A 1BHXF 1K1NA 1CT0E 4CREA 4B1TA 9ESTA 3QN7A 4H6SB 3L6PA 2A7HA 5L2YH 1CBWC 1XUFA 1JBUH 3PLPA 2BD8A 2J34A 4O97A 2ZFPH 5LPEA 1BMAA 4CR5A 1CA8B 1JIMA 3BTWE 1C2LA 1B7XB 1TRYA 3STJA 2YOLA 1GL0E 3LDXH 2EI7A 3KHVA 1P9SA 2Q6FA 1G37A 1Y3VA 1NRQH 2ZHWH 3Q77A 5FCRA 1BT7A 3RXSA 1EB2A 1TPSA 1XUIA 3A7XA 2SGQE 1MU6B 1TX6A 4ABGA 2Y5FA 2CHAC 3EA9A 1MAYA 2XWBI 1OWJA 1V2JT 2O9QA 3TJOA 5AF9H 4A6LA 1BUIA 3Q76A 4NIVA 4XE4A 3B23B 1P2IA 4A7IB 4RKJB 1ELTA 1OOKB 3SHAH </