3E8LA

The crystal structure of the double-headed arrowhead protease inhibitor a in complex with two trypsins
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine proteinase inhibitor A
publication title The ternary structure of double-headed arrowhead protease inhibitor API-A complexed with two trypsins reveals a novel reactive site conformation.
pubmed doi rcsb
source organism Sagittaria sagittifolia
molecule tags Hydrolase inhibitor/hydrolase
total genus 52
structure length 223
sequence length 223
chains with identical sequence B
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2008-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3e8lA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3e8lA02
3UOPA 2QC2A 2G55A 5E0GA 2P59A 3T62A 3SV7A 1O2WA 4FUJA 1BJUA 5C1YA 4UFEH 4X8VH 5EU8A 1ZJDA 3A81A 3SU1A 5CMXH 1WCZA 3ZVBA 1T8MA 1RJXB 1W0YH 2XW9A 3MO3A 3T5FH 3HK6B 3LPRA 3TK9A 3L33A 2A0QB 2W5EA 2Z9JA 4JZEH 1AVXA 4CH8B 2ZCHP 3TGKE 2ZU5A 2UWOA 1LPKB 5DP4A 1GJ7B 1P2JA 2Z9GA 3VXEH 2QXHA 1QNJA 1ELBA 1SBWA 4GPGA 2FTMA 2ZIQH 7ESTE 2WV5A 3HGNA 2A1DB 1N6YA 3K6ZA 1AVGH 3VXFH 3GY2A 2H5DA 5AVDA 3KQBA 1D3TB 3OY5U 5AFZH 1P9SA 1YPJH 3SW2B 1PFXC 5K0HA 3P95A 4JMYA 2G81E 1CA0B 3RXKA 1C2GA 3KL6A 1AE5A 1GBLA 1RIWB 2BZAA 3PLPA 3S9BA 3KEEA 2D1JA 2PLXA 4F49A 5GJ4B 4B75A 1W13U 3SU3A 1UVOA 3PMHB 5ESBA 2O9QA 2O8LA 2Q6GA 2XC0A 1P2KA 5FBEA 1DWCH 2XXLA 3RXVA 2Y82A 4H42U 4B73A 4A7IB 1ELDE 1GI1A 1GBFA 1QA0A 1NTPA 1P11E 2J94A 4IC6A 1GJ8B 2STBE 1PPCE 4J2YB 2FMJA 1PPGE 3AASA 4CR9A 1FY8E 2NU2E 4GSOA 1GBHA 1JRTA 1HBTH 1Y5BT 1DWEH 2F9BH 3SORA 5JPMH 2GDEH 1VJ9U 4MTBA 4AYVB 2DUCA 1AWHB 2FYQA 1FNIA 1IQKA 2G4UA 2EA3A 1QQUA 3GICB 4NIYA 1UVSH 4JCNA 3NK8A 2W3KA 1HNEE 2QY0B 4I33A 3A7XA 2ZCKP 3RP2A 1A3EH 4Q7YA 3ZZ9A 4LZ1H 2VIQA 3QTVH 5GWZA 1ZTKA 4WH6A 1K1IA 2AS9A 1Y5AT 1P0SH 3GCTF 3SO3A 1LQDB 1DM4B 4O97A 1GHWH 3MOCA 1LPZB 2AGEX 1VR1H 4NSVA 3SNEA 4X1QU 3MNBA 3SJ8A 3ZZ6A 3MYWA 2EEKA 2FOHA 3TNTA 1OWDA 2Q6DA 1L4ZA 3QDZB 3SOSA 1SC8U 3MO6A 5FAHA 1BBRH 3ZVEA 5C1XA 1EUFA 3ATIA 3TNSA 1UHBA 1ZMJA 1V2ST 3LH1A 3NPSA 5GPIB 1NFWA 3BG4B 1V2WT 2A31A 1GVKB 1GBKA 3EA7A 1O2NA 4B76A 4UONA 1TX7A 2BD2A 2VH0A 2VVCA 5JB8S 4KP0A 3T25A 4MQAA 1WV7H 1DICA 1N6XA 4B2AA 3SNAA 3PTBA 2R9PA 5JBAS 1S5SA 4CRDA 1SPJA 1ARBA 1O2IA 2OCVB 2AERH 4B2BA 1K1NA 2FOBA 1D6RA 1CO7E 1P02A 1SR5C 1SGTA 4FUBA 5HM2A 3F9EA 1CQQA 1HJAB 1B0EA 1EJNA 4AORA 1O2RA 1Q2WA 3LJOA 5DP3A 1V2JT 4I32A 1DLEA 2NU4E 4B71A 1MKWH 1AQ7A 1P01A 1JMOH 1TLDA 1E36B 3S9CA 1A46H 1LQEA 5AFYH 1QBOA 3PWBA 1KXCA 1WQVH 1FY1A 1MTVA 3EGKH 1OYQA 3URDA 4YOGA 1SGPE 3KCGH 3BTGE 3V13A 1MCVA 2PV9B 2WPIS 2OC0A 8GCHF 2HPQH 5L6NH 5T6GA 1Z71A 5EOKA 4BTUB 1O3FA 2GCHF 4Y7BA 4BAHB 2AYWA 2ANWA 2BD7A 2CHAC 5EXNA 2AEIH 2ZWLH 3RXMA 5A0AE 1GBJA 3ODFA 2SNVA 2ZGBH 2FDAA 1ZR0A 2GV6A 5JB9S 1YGCH 1LHCH 4JZ1A 2RA0A 2XTTB 3BV9B 2ZU4A 1J9CH 1K1LA 1D6WA 1ELCA 4OS2A 1GHYH 3UIRA 3EYDA 1FJSA 2F9UA 3E16B 3TPIZ 1ELVA 1MTNB 1O2ZA 2VGCC 1O3GA 1KLTA 3AW0A 1LCYA 1GBAA 4GCHF 3TGJE 3SUEA 3D23A 3SI3H 5HYOA 1INCA 1LTOA 1Y3WA 1YPMH 1DFPA 1ETTH 1GJDB 1G36A 1D3QB 4UDWH 1GMHF 1SFIA 4K1EA 4ZROA 1YC0A 2G8TA 5PTPA 3GDUA 3T2NA 4NWKA 5TCCA 1DPOA 2FESH 1B0FA 1YBWA 5E2OA 2FYRA 4Y79A 1C5ZB 3ZZAA 2PW8H 3GY8A 1GL0E 3PO1C 2FZZA 5DPAA 1P3CA 1ZHPA 4BAOB 1AFQC 4A5TS 3RU4E 2TBSA 2J38A 3A8DA 5FPTA 1CSOE 1IAUA 2C8ZB 1P9UA 2UUKB 4KKDA 2ZDLA 3AAVA 3RXUA 4ABJA 2V6NA 2ZGHA 1BRBE 4HZHA 3TITA 1GI6A 2O8WA 1EP6A 4ESTE 2BDAA 3LGYA 1ESBA 1G9IE 4WVPE 2ZFTA 2TPIZ 3UQOA 2SGAA 1EXFA 4IN2A 3MU0A 4ABBA 2PKSB 2HNTE 1LHFH 2JH6D 1PYTC 2VIPA 3OTJE 4NA9H 3KNXA 4X2VA 3ZZ4A 2RA3A 2AIQA 3DD2H 1CBWB 4FXGH 3S0NA 1FONA 1E37B 1TE0A 3GCOA 1ELEE 1GBDA 1T31A 4KTCA 2A4QA 3ZVDA 4ABHA 1ZHRA 2BLVA 2BQWB 3M3VA 2WV4A 3ATMA 3RU4T 5EG4A 1BITA 1VCPA 4CRCA 1GMCG 4RSPA 5ETXA 3MU4A 3BG4C 2TGAA 1QRZA 2V3HH 3P6ZB 1H9HE 2G5VA 1KIGH 2XRCA 3TK5A 2W3IA 4LXBH 3V0XA 3FP6E 3HGPA 2BY8X 1C5PA 4YM9A 1BMMH 2Z6BD 1FAXA 1NRSH 1WTGH 1ARCA 4Z6AH 3ODDA 3RC6A 3A82A 1NU7B 3VB5A 4UFFH 4A1VA 2HOBA 1QL7A 3OX7U 5FPSA 5F8XA 1EAIA 1TGBA 5JBCS 1GJ6A 1S6FA 1QB9A 5FX6A 1GHAG 1AU8A 2VH6A 2ZQ1A 1F5RA 2F3CE 2WPHS 1V2KT 3TH2H 1MMJN 4RKJB 1SGDE 4IC5A 4DIHH 1SLVB 4AFZA 2GZ7A 1BBRK 4FVBA 2VWNA 3A7ZA 1C1SA 2BY7X 1V2NT 4FU7A 1BQYA 1ESTA 1QR3E 1QBNA 1ANBA 3SV6A 1O3PB 2XCNA 3LGWA 4I8KA 6ESTA 3RLYH 2QGRA 2BQ6B 3RXLA 7GCHF 2BB4A 4A1XA 1TIOA 4X1SU 4CR5A 1HAVA 3MNCA 3SU4A 4ZH8A 3T26A 4YESB 5EPNA 1GCTC 5A8XA 2ZTZA 4E05H 2GVFA 3RXJA 1O5CB 1SGRE 1C5UA 2PKAB 1AKSA 2JKHA 5EODA 2G5NA 2XBYA 1GBTA 4NA8A 1U6QA 3M5NA 4FUCA 3E0PB 3F9HA 3LU9B 1UVPA 3MU8A 3LC5A 1KXDA 1HDTH 1P3EA 4AB9A 1BTPA 1CT0E 1WOFA 3ZZ7A 1TX8A 2R2WU 4MPVA 1GVLA 5C20A 4GUXA 4IMZA 1GI0A 2CF9H 4CRFA 5C1UA 1HAHH 3D49H 1YPHC 1UCYH 1TMBH 3M3TA 1CGIE 1O2HA 2FS8A 1LHEH 1G2LA 4X2XA 1DS2E 3CP7A 3T28A 4VGCC 2ZDAH 3IG6B 4AFSA 3R0FA 4ABEA 1S82A 2GDDA 4ABFA 1F0RA 1GBIA 5E2PA 1C5NH 2ZCLP 2PSYA 5A2MH 1ZHMA 4ABDA 4XOJA 1TA2A 2WYGA 4DJZB 2XBXA 1FXYA 1NU9A 1QURH 1XVMA 3N7OA 1TBZH 1C2IA 4MDSA 1OPHB 2R3YA 1P2MA 2OC7A 5EQQA 1C5VA 4WXIA 1IOEA 1NROH 2FXRA 4YLUA 2ZKSA 1S0QA 3FZDA 4CBOA 5G4BA 1G37A 4IN1A 1TPAE 4WMFA 3BEUA 1GDNA 2FO9A 1W2KH 4MNYA 1HIAB 4E06H 2AMPA 1O3EA 4E7NA 4ZAEA 2AH4X 2EI8A 3UR9A 2ZGJA 2CMYA 1DOJA 2PKSC 1QGFA 1TNHA 1ZTJA 2PTCE 1ZOMA 2YNBA 1O2XA 3PLBA 2QCYA 3FP7E 3P8OA 3ATLA 5DKMA 1GL1A 2JETC 2QYIA 4ISIH 2GKVE 1GJBB 1YCPK 2C8XB 1ABJH 1W3CA 4AFQA 2B5TB 4TY6A 2BDYA 3MMGA 1GGDC 3RMNH 2ASUB 1PYTD 5I25A 5EW1H 2HRVA 2XBVA 1XUJA 1L0ZA 1EQ9A 1C5WB 1A0JA 1HV7A 3TK6A 3H5CB 1P2IA 2Q1JA 1SQAA 1TWXB 2EI6A 3UREA 1DE7H 1UTJA 3TH3H 4O3TA 3SBKA 4XBBA 4K1TA 1KDQA 1O3DA 1TGCA 1C1PA 5DGJA 3UNSA 1G2MA 3MU1A 4NSYA 1BTYA 4DIIH 3O8RA 1DX5M 1O30A 4D76A 3NKKA 2PFEA 1BRUP 1FN6A 1GJAB 1ZPCA 3MTYA 1C4V2 1O39A 1XXFA 1C2JA 1W7XH 3M61U 2IN2A 1O3LA 3Q3KA 3GY5A 1GHZA 4D7FA 1THSH 5GCHF 4YO9A 1FIWA 2BD9A 3QLPH 4ISOA 3L6PA 1GJ4H 2YOLA 2CGAA 1TGTA 1O31A 9LPRA 5EXLA 2WUBA 5H4IB 2CHAB 3BSQA 3RXRA 2HVXA 1ZMNA 3MU5A 5LPFA 2AGGX 3GYLB 2B8OH 1O3IA 1BHXB 3V3MA 1MKXH 4I8GA 1O3AA 1O2TA 1C2MA 2QN5T 1UK4A 3U8RH 3NZIA 3RC5A 1NRQH 4HTCH 4Y0ZE 4OGYA 2G52A 3LGVA 4YOIA 4JZFH 3LONA 2A2XH 1C5OH 5FXLA 3SJKA 2J2UA 2FEQH 3I29A 4H6TA 2VGCB 2R0KA 4IGDA 1B7XB 3SQHE 1IQNA 3MH6A 2ZA5A 4NA7A 3KGPA 3E3TA 2CF8H 4INHA 1LDTT 1HAGE 1OWEA 4ZHAA 5IYTA 1Z8JB 1QHRB 4TWWA 5F8ZA 3KQDA 2GP9B 4YTAA 3ZVFA 3VGCC 3P8GA 1HYLA 4ZXYH 1V2VT 3K65B 1NRNH 3S69A 2G51A 2VIWA 1EAWA 2RG3A 1BMLA 4NFEA 3MNXA 2VIOA 1AVWA 4MNXA 3HKJB 5DG6A 1ZSLA 1FQ3A 3PO1B 4AG1A 1ELAA 2BYAX 1L4DA 4Y10E 1AFQB 1MZDA 2GCHG 1BHXF 1TOCB 5J4SA 1F0UA 2P3UB 1TAWA 1ZSJA 1WTHD 2J92A 6CHAB 1CVWH 1UTQA 1PPBH 5AHGH 1ZGVA 2H9TH 3QWCH 3TLOA 3ZZBA 1VITF 1V2TT 1Y3VA 1ZMLA 3VB6A 1TONA 2FI4E 2PHBA 4FUGA 1GHBF 3SUGA 5LPRA 3KQEA 3P17H 3U8TH 1K9OE 1O2UA 1A3BH 1TRYA 1GHVH 1EATA 2GZ8A 3OSYA 1O2JA 2FX6A 4DT7B 2R3UA 5FCRA 2GD4B 1SGYE 3DA9B 2ZDNA 1C5MD 2H9HA 1QTFA 1OOKB 4GHQA 3RC4A 2ZEBA 5T6DA 1VCQA 1LMWB 1TFXA 4I7YH 1C5SA 1K1JA 1JIRA 3FFGA 2W26A 3PV4A 4UFGH 1F0SA 3MHWU 4ZUHA 4X6OA 1DDJA 3V12A 1GBBA 4FUEA 1FY4A 3VB7A 1O5AB 1GHXH 1UCYK 1O36A 1CT2E 2BOKA 1O37A 2AGIX 4AG2A 5A8ZA 1BTUA 3M36A 4A92A 5DP8A 1S84A 2OTVA 4SGAE 1EB2A 3OY6U 1UTPA 1ELGA 1EPTA 1KTSB 3VB3A 1TBQH 2QAAA 2VIVA 3M5LA 4D8NA 1QIXB 2SGPE 4GVUA 2NU1E 1RTLA 2GZ9A 2BD5A 2ANMH 2J95A 1NESE 4WWYA 4XBCA 1BRCE 1EASA 4ABAA 5GXPA 1K1OA 2ESTE 1HLTH 1O3CA 7KMEH 1IQLA 1DLKB 3TGIE 4BAQB 3D65E 2SGDE 3SGAE 2BDHA 3B8JA 3SGQE 1F5LA 4MPUA 3UFAA 2FLRH 3SNDA 3MO9A 5L2YH 4ZHMU 1A0HB 3WY8A 1IHTH 1SGFA 1TBRH 2ZECA 1XUFA 1V2RT 1TRNA 3BTFE 1G3EA 3Q76A 2FX4A 1HAVB 4CH2B 4BAMB 1O5FH 1XUKA 2A5IA 4MPXA 1CGJE 3S7HB 3ATKA 1WBGB 1BMAA 4AX9H 2XYAA 1YPGH 3BIUH 5DJ7A 4OS5A 3GCNA 5AF9H 3Q00A 1LKBA 1AKSB 1TABE 4FU9A 1OS8A 3PTNA 1DY9A 1XXDA 1EZSC 1EJMA 1FV9A 3QZRA 2G00A 5HM9A 1MH0A 3RXAA 1HFDA 2XBWA 2QF3A 3O8DA 1DITH 1GCTB 1YLDA 2VWLA 2Z7FE 1O3KA 1CA8B 4JYUH 4Q7XA 2TGPZ 1OWIA 1RGQA 2M5TA 4DY7B 1C4U2 3A83A 1NFYA 2QF0A 1HXFH 1XMNB 4ZXXH 3T27A 4BANB 5FBIA 3JZ1B 3BTHE 5B6OA 1UK2A 4NZQA 3GY7A 3ZV9A 1IQMA 3IITA 2P94A 3QO6A 2FP7B 3DHKH 3ZVAA 3QZQA 3OYPA 3NWUA 4B74A 4ABGA 1H8DH 1CE5A 2BLQA 3U9AH 3ZVCA 2QXIA 3D62A 4ZKSU 1E34B 1V2MT 2OBQA 1L1JA 3TH4H 1Q3XA 1IQFA 2WPKS 4VGCB 1MTUA 4LZ4B 2SFAA 5DO4H 3MFJA 1YCPH 1O2YA 5T6FA 3E0NB 4H4FA 1IQEA 3A80A 1LVMA 4K60A 4JYVH 1SB1H 1ELTA 1K1PA 1O2PA 2FI5E 1ZYOA 1HAXB 1BBRE 1NT1A 1OP0A 3L3TA 3LC3A 3M7TA 2P3FH 1A4WH 1O2OA 2B0FA 2KAIA 1G3CA 2GV7A 3LIWA 4WMDA 3RXPA 3E1XB 1F0TA 3QN7A 4DG4A 3FVFB 1C2KA 1O2KA 4NFFA 4B1TA 2TGTA 1MKXK 4Q2KA 2VVUA 2A7HA 1TMTH 3K2UA 2XC4A 4ABIA 3CENA 6CHAC 1GDQA 4Q7ZA 4TPYA 1W7GH 3GY4A 2HGTH 2BQ7B 4AOQA 1ZRBA 2PGQB 2BZ6H 3BF6H 2J34A 2BD4A 1LPGB 1J15A 1ZGIA 1FN8A 2AFQB 2JH5D 3EE0B 3RXTA 1TNIA 2UUFB 3I77A 5DP7A 1N8OC 1HAIH 2BD3A 2GT7A 2JETB 2A2QH 1P04A 1IQHA 1FPHH 1S85A 3QK1A 1GBEA 2F9PA 2UWPA 4K69A 1D4PB 3SU2A 1O2MA 6GCHF 1P05A 1KDQB 1XM1A 1GGDB 1P09A 3RXGA 1W10U 1H4WA 1OSSA 4X8SH 3B23B 2BDGA 5FPYA 1BTZA 3SUDA 2A5AA 1JBUH 1MAYA 1GBMA 4NZLA 3SI4H 2QIQA 1KXAA 1AB9C 3TJNA 2YNAA 4CBNA 1T4VH 3BTEE 5J4QA 1WSSH 1TB6H 5JBTA 1W12U 1FY5A 4Y0YE 2P8OC 1MTWA 1EOLA 1YM0A 1TPPA 1DSUA 1XKBC 4AB8A 4ZMAH 1H8IH 4Y6DA 1ANDA 4BXWA 4HGCA 1GI3A 1OX1A 3FAOA 5DP5A 2VU8E 4JZIA 3MH4A 1O33A 2CV3A 2BDBA 3RXDA 5C5NA 2ZPRA 1XUIA 2C93B 1O3NA 1PQAA 1XKAC 1BTXA 2NWNA 3ELAH 4Y76A 4OS4A 1ZRKA 5JDUB 3K6YA 1UK3A 4MVNA 3M3SA 1P10A 1VITH 1TGNA 3PWCA 3M7QA 3RLWH 3RXCA 1LHGH 2H2ZA 3LT3A 2ZFRH 4KGAA 3U8OH 1H9LB 2DE9A 2BVXH 1KYNA 5DK1A 4SGBE 1S83A 3UPEA 2OLGA 1IQGA 1EZXC 2CN0H 1RRKA 2ODPA 5FHTA 2TIOA 4MG3A 3H7TA 4GLYA 1GI5A 1THRH 4OGXA 4K8BA 3O8CA 2PGBB 2FTLE 1W8BH 2BY6X 1A7SA 1QB6A 3QX5H 4NWLA 1DUAA 1SSXA 2ANKH 4B2CA 2LNCA 1O32A 2GTBA 1O5DH 1D3PB 1YKTA 1ACBE 1TQ0B 1YLCA 1Z8IB 2OD3B 4KTSA 1ZLRA 1A2CH 1YPKH 1VZQH 3M5MA 4X6NA 1MU8B 1P8VC 1PPEE 2SGFE 3JZ2B 1DVAH 1HJ8A 4BTIB 1HJ9A 1C2LA 3RMMH 1L1GA 5TCAA 2FIRH 3VGCB 4I8LA 2ALVA 5GDSH 2GMTC 2Z3CA 3SHCH 2FODA 3F1SB 1J17T 1FZZA 1DT2A 1HB0B 2B9LA 3F68H 5GCHG 4Q80A 2ZTXA 1AUTC 4LOYH 2OBOA 1WYKA 4THNH 4O03A 1QL9A 3EA8A 2D26C 3GY3A 1WU1A 1G3DA 1GMDF 1FIZA 2OC8A 4WH8A 1YPEH 2F91A 1JWTA 1F2SE 1K1MA 2CXVA 4X6MA 1C2HA 3CS7A 1XUHA 3GOVB 1QJ7B 3KF2A 1OP8A 3LGTA 3UUZA 4YZUA 5E8EH 3BTDE 1AI8H 4TWYA 1QRXA 3SN8A 2J9NA 1P2QA 1H9IE 2HNTF 2LPRA 1DXWA 4D7GA 1UJ1A 3AW1A 1UHBB 3E6PH 1GMCF 4Y8ZA 4YOJA 2O8TA 1CU1A 3RDZA 1Z7KA 3LDXH 1AMHA 1EPTB 2FPZA 2HWLB 4FUFA 3BTKE 2TGDA 4OS1A 1S0RA 1W14U 2FOMB 4JYTA 1TNGA 1BCUH 1ETSH 1MCTA 1J16A 2NU3E 3RXQA 1T7CA 4X2WA 2BY9X 2ZF0H 5HGGA 1M9UA 3PMAB 3P92A 2A4GA 4TPIZ 1GJCB 2IPHA 1L1NA 2F9OA 5A8YA 1GJ9B 1K22H 1ORFA 3TJVA 2ZDVH 4FU8A 1RFNA 1GHAF 3A7YA 1Z6EA 2BLWA 3A85A 1BTWA 1PPFE 1T4UH 1AGJA 1EX3A 1QB1A 4ISLA 2QXGA 1VITG 1BUIA 2A45B 2BM2A 2Z9KA 1MUEB 2UUYA 2XWAA 4Y8XA 4YLQH 3V7TA 1YP9A 1BMNH 1A61H 1SOZA 1V2OT 2AIPA 4X8TH 1VGCB 3KIDU 1C5XB 1K2I1 1HPGA 2OQ5A 3SNCA 2F9NA 1O35A 2ZFPH 1BB0B 1Z1IA 2BD8A 1TALA 2R0LA 3GCTG 4IBLH 1QFKH 3LGIA 1MD7A 2PTNA 4NIVA 5HXFA 1JIMA 4BAKB 1EP5A 1T32A 3BIVH 4ZKNU 1A0LA 1J14A 2P16A 1O5BB 4ZKOU 2HLCA 1Y3YA 3O8BA 3UTUH 5BRRE 1QJ1B 3BEIB 4X6PA 5EXMA 5ESTE 1C1VH 2Y5FA 1E38B 1MBQA 2WPMS 5A09A 2ZI2H 1WQSA 1UCYE 1TQ7B 1AWFH 2QA9E 1O2GH 2SGEE 3SGBE 1WAYB 2Y7XA 3W95A 3VPKA 1CHOF 1QA7A 1Y5UT 4TY7A 3MI4A 3STJA 1P06A 1IHSH 1NO9H 3AVZA 3UWIA 3A89A 3BTWE 1GI9B 2BX3A 2VJ1A 5L2ZH 3A7WA 3UNRA 1FUJA 1A1RA 4UE7H 3S7KB 1PQ8A 2BOHB 1V2UT 2BTCE 1HXEH 1O3OA 2ZU3A 4CHAB 2KAIB 1HCGA 1EZQA 3HK3B 1UTLM 2HNTC 1G32B 4UD9H 3ZYEA 6LPRA 4Z0KA 1H1BA 2ZFSA 2ZNKH 1LVOA 1CHGA 3LKWA 4INKA 4Y11E 1TMUH 1SGIB 5EQSA 3U69H 3UY9A 3LH3A 3UNQA 4HFPB 1FPCH 5EPYA 1AIXH 1DANH 1X7AC 3ZZCA 9ESTA 1LVBA 4F4OC 2B7DH 1SMFE 3SJOA 1PPZA 4DW2U 4ZHLU 3R3GB 5K7RA 3UR6A 1O38A 8GCHG 3U1JB 1RS0A 1XUGA 4YT6H 3ZZ8A 2A5KA 4CRBA 3PM3A 1V6DA 4BTTB 5LPEA 1FAKH 2RDLA 2XC5A 2XNIA 3GY6A 5CE1A 1PQ5A 1AD8H 1G3BA 1SFQB 3ESTA 4K2YA 4XFQA 1CGHA 3M37A 2PKAA 1YF4A 2V3OH 1YYY1 5CHAC 1S81A 1KY9A 4NG9H 4WXVA 3EQ0H 3DFJA 3U98H 1C1TA 1ANEA 2H5CA 1AO5A 2ZFQH 3SU6A 5HMAA 2EC9H 2ZHDA 3Q77A 1N8OB 1MQ6A 2FLBH 1E0FD 2GCTB 3ZZDA 2AMQA 1AN1E 3A88A 1C5RA 3E91A 1W0ZU 2VIDA 1O3JA 3KHVA 1V2LT 1DY8A 2AMDA 2WINI 1EPTC 1OXGA 1JXPA 1O3MA 4GCHG 4X1RU 4WJG2 3T29A 1SGNE 2UUJB 2VVVA 2UWLA 1O0DH 4A1TA 4BXSA 1VJAU 5JBBS 1BZXE 4NCYA 2ZQ2A 1AB9B 3M5OA 4GAWA 1GMHG 2ZHFH 1GVZA 4JK6A 3MH7A 1CT4E 1TRMA 3GISB 4FUIA 1O3BA 1QJ6B 1SGCA 3BN9A 2P8OB 2Y6TA 4U01A 3A87A 4U30A 1NFUA 3RXEA 2QV1A 1O34A 1KXFA 2STAE 1YPHE 2GX4A 2GT8A 4E7RG 4YT7H 1BOQA 1Z8GA 4ZKRU 3W94A 4FVDA 2BLOA 3RXIA 3KN2A 2Y81A 4KELA 1V3XA 3NUMA 4XE4A 4ISNA 2D8WA 2Y80A 1BRAA 1UTOA 1D9IA 8ESTE 5L30H 1AZ8A 2QXJA 1HIAA 1XX9A 2A4OA 1KLIH 3SNBA 1L2EA 1VGCC 1SG8B 1GG6B 2FS9A 1P12E 3GDVA 1IQJA 3A7VA 2ODQA 2A4RA 1YCPM 2BY5X 2A7JA 5SGAE 1WUNH 4AGJA 3QGNB 3BTQE 1C5LH 1S6HA 3GCHC 3STIA 1AE8H 2O8UA 1C2FA 6GCHG 1ABIH 5C2ZA 3F9GA 2ZTYA 3ITIA 4DCDA 5C67A 3SV8A 1SHYA 2ZFFH 1ELFA 1PQ7A 2Y5HA 3PMJA 1GCDA 1ZJKA 2ZC9H 1ZPBA 3SV2H 2SNWA 2Y7ZA 2Q6FA 4XDEA 2JH0D 3BG8A 2ZP0H 1UVUH 4XBDA 3FANA 3SU0A 1NY22 3NXPA 2C8WB 3MWIU 1O2SA 2VWOA 1C5QA 4WF8A 1A5HA 5EQRA 3BTME 3TIUA 2EI7A 4BNRA 5F03A 3A8CA 2ZPSA 1C9PA 3SV9A 1ZTLA 3QGJA 2GMTB 1A5GH 2H6MA 1DUEA 1E35B 1NM6A 1TX6A 1UTKA 4DVAU 1TGSZ 1KTTB 1T8NA 1UMAH 1FMGA 4CREA 5C3NA 1RTFB 4ASHA 4CRAA 3SQEE 3QUMP 1ZPZA 2C4FH 3F9FA 3RU4D 1LKAA 2I6QA 4K1SA 4CHAC 1HAYB 2CJIA 2DE8A 2PUQH 2VNTA 1SQOA 3EAJA 4DOQA 4Y7AA 3VFEA 2PUXB 1IQIA 2FWWA 2FM2A 2BX4A 3H7OA 3FZZA 1P03A 1BA8B 3C27B 1D3DB 2FOGA 2C8YB 2PWXA 1F92A 3U1IB 4K3JA 2PR3A 4D9QA 1CA0C 3ZVGA 2Z9LA 3LGUA 1RIWC 5FX5A 2ZHQH 3EDXB 1TNKA 4HI3A 3P70B 1ANCA 3RXFA 1B5GH 5F8TA 4FUHA 3A8AA 1T8OA 4QT8C 7GCHG 3ZYDA 3RM0H 1TPOA 5E0HA 1J8AA 3F6UH 1EAXA 3PMBB 4X0WU 3SJ9A 1BIOA 1DXPA 1P57B 1SGQE 4JK5A 2BMGB 4R8TB 1QBVH 2V35A 1DWBH 3DT0H 5TJXA 2FOAA 1GI7B 2FI3E 4LK4A 5T3HA 2ZGXH 1EJAA 4AN7A 1C9TA 2WYJA 1MAXA 1HGTH 1SLWB 1TOMH 2C90B 3BEFB 1FY3A 3VEQB 2WPLS 3RXHA 2GCTC 2H1UA 3HPTB 1GI2A 2XCFA 1LHDH 1NN6A 3E90B 3HKIB 1V2QT 1ZZZA 2W7SA 1KXBA 1NS3A 1SQTA 2RCEA 4KTUA 4MLFB 1FDPA 2I6SA 1GMDG 3B9FH 3A84A 2FOEA 3E8LA 4IS5A 4XSKU 1C1UH 1P2NA 1K28D 4M7GA 4RKOB 1SVPA 4X1PU 2VWMA 1UTMA 2W7UA 3MH5A 2TRMA 3QTOH 4AGKA 2K1QA 5JYIA 4O3UA 3ATWA 1GDUA 4K5ZA 5GIBA 2HPPH 3UQVA 5LGOA 4H6SB 1BT7A 4K8YA 1BTHH 2ZU2A 2HALA 4R0IA 5ABWA 2O8MA 2WUCA 1PJPA 5C5OA 3URCA 1NFXA 3PROA 5E0JA 3NCLA 1ZSKA 4MNVA 2BDCA 2OUAA 5F6MA 1NRPH 1C1NA 3A86A 3I78A 2OQUA 1OYTH 1FI8A 1N1LA 4PROA 1Y3XA 2D2DA 1NC6A 2ZU1A 3RM2H 5A0CA 1AZZA 1C1RA 3ZV8A 3IWMA 1JRSA 4GHTA 1GG6C 4TYDA 1HUTH 2ALPA 1QQ4A 3OU0A 4DURA 1TA6A 2FOFA 3PLKA 1O2VA 3G01A 3RXSA 1RTKA 3UOUA 1NZQH 1HJAC 2ZPQA 2Z9IA 4RN6A 1MTSA 1AY6H 1RXPA 3A7TA 5DP6A 1F7ZA 1VCWA 1C4Y2 3DUXH 1AHTH 2BDIA 1HRTH 3GDSA 1W11U 1OWJA 1O5GH 1SLUB 2BHGA 4X8UH 3TJOA 2VB0A 2ZZUH 3P8FA 4O9VA 2ODYB 2ZO3H 1EB1H 3LOXA 1GI8B 3A8BA 4Y71A 2BXUH 1K21H 3EA9A 4I8HA 4MNWA 4BOHA 1P2OA 2BVSH 2WPJS 7LPRA 3BTTE 2A32A 2A7CA 2IJOB 2NU0E 3TU7H 1C1MA 1GI4A 1EOJA 1NPMA 3ENSB 1UO6A 1HAZB 4NIXA 1LVYA 1SHHB 4IMQA 1DSTA 1HAOH 1XVOA 1O2QA 1SGEE 2OXSA 1GJ5H 1SL3A 1MZAA 2P95A 1EAUA 3ZZ3A 2ZDMA 5IDKA 3M7UA 4NGAH 2ZHEH 1LO6A 1MKWK 1Q31A 1UTNA 1F5KU 1DWDH 3C1KA 3SHAH 2J4IA 5CHAB 5EW2H 2ZG0H 1SGFG 1MBMA 2ULLA 3Q3YA 1PPHE 1MTNC 4Y8YA 2G4TA 3PB1E 2VINA 1CHOG 3GYMA 2ANYA 4A6LA 3RUOA 1OWKA 2GGVB 2P93A 1ID5H 4I31A 1O2LA 1GPZA 3KQCA 1AFEH 4IW4E 1V2PT 5LH8A 5FCKA 1O5EH 4U2WA 4ISHH 4MPWA 8KME2 4U32A 1THPB 3RXOA 1HAPH 1SI5H 3FP8E 2Z3DA 3AAUA 3M35A 1ETRH 3PYHA 3UWJH 3SZNA 1A5IA 2Z94A 2ZDKA 4FUDA 1SOTA 1C1OA 4UEHH 1KLJH 1Z8RA 3K9XB 3SU5A 1TNJA 3DFLA 4AFUA 1BDAA 2Z3EA 1Y59T 1OWHA 3RMOH 2BXTH 2ZGCA 2F83A 1QCPA 1TNLA 1UVTH 1Y3UA 2OINA 2BVRH 2V0BA 1C5TA 1MU6B 3TJUA 1RD3B 1O3HA 4NIWA 1KXEA 4DGJA 1C1QA 2FOCA 1GBCA 1JOUB 3SJIA 2IOTA 2XWBI 4INLA 1C2DA 5EGMA 3P8NA 1AUJA 4JZDH 1C1WH 4OS7A 1GHBG 1Z6JH 4WMEA 2F9VA 4AYYB 1SLXB 5A0BA 1TPSA 1CBWC 5DP9A 4WY3A 1Y8TA 3CS0A 2ILNA 3RMLH 4UFDH 3S9AA 1T8LA 2H9EH 1QRWA 1EZUC 3Q3XA 1KSNA 4AZ2B 3VB4A 4J1YA 3GCHB 1OP2A 4CRGA 4D9RA 1C5YB 1TYNA 2OC1A 1MD8A 8LPRA 1QY6A 1OKXA 2R2MB 1EKBB 4OS6A 5BPEA 4X1NU 1YPLH 2PSXA 2THFB 3LJJA 1QL8A 3ZZ5A 2ZHWH 1ESAA 2Y5GA 3HATH 5I46H 1NRRH 1BJVA 1G30B 1FLEE 2C3SA 2OP9A 4I8JA 3TVJB 1Z1JA 1MQ5A 2P3TB 1C2EA 3MNSA 3SUFA 1GWAA 2SGQE 4X2YA 3RXBA
chains in the Genus database with same CATH superfamily
5C17A 3UOPA 2QC2A 2G55A 3UAIC 5E0GA 2P59A 3T62A 3SV7A 1O2WA 4FUJA 1BJUA 5C1YA 4UFEH 4X8VH 5EU8A 1ZJDA 3A81A 3SU1A 5CMXH 1WCZA 3ZVBA 1T8MA 1RJXB 1W0YH 2XW9A 3MO3A 3T5FH 3HK6B 3LPRA 3TK9A 3L33A 2A0QB 2W5EA 2Z9JA 4JZEH 1AVXA 4CH8B 2ZCHP 3TGKE 2ZU5A 2UWOA 1LPKB 5DP4A 1GJ7B 1P2JA 2Z9GA 3VXEH 2QXHA 1QNJA 1ELBA 1SBWA 4GPGA 2FTMA 2ZIQH 7ESTE 2WV5A 3HGNA 2A1DB 1N6YA 3K6ZA 1AVGH 3VXFH 3GY2A 2H5DA 5AVDA 3KQBA 1D3TB 3OY5U 5AFZH 1P9SA 1YPJH 3SW2B 1PFXC 5K0HA 3P95A 4JMYA 2G81E 3AK5A 1CA0B 3RXKA 1C2GA 3KL6A 1AE5A 1GBLA 1RIWB 2BZAA 3PLPA 3S9BA 3KEEA 2D1JA 4TSFD 2PLXA 4F49A 5GJ4B 4B75A 1W13U 3SU3A 1UVOA 3PMHB 5ESBA 2O9QA 2O8LA 2Q6GA 2XC0A 1P2KA 5FBEA 1DWCH 2XXLA 3RXVA 2Y82A 4H42U 4B73A 4A7IB 1ELDE 1GI1A 1GBFA 1QA0A 1NTPA 1P11E 2J94A 4IC6A 1GJ8B 2STBE 1PPCE 2OK5A 4J2YB 2FMJA 1PPGE 3AASA 4CR9A 1FY8E 2NU2E 4GSOA 1GBHA 1JRTA 1HBTH 1Y5BT 1DWEH 4DT4A 2F9BH 3SORA 5JPMH 2GDEH 1VJ9U 4MTBA 4AYVB 2DUCA 1AWHB 4F55A 2FYQA 1FNIA 1IQKA 2G4UA 2EA3A 1QQUA 2KZ4A 3GICB 4NIYA 1UVSH 4JCNA 3NK8A 2W3KA 1HNEE 2QY0B 4I33A 3A7XA 2ZCKP 3RP2A 1A3EH 4Q7YA 3ZZ9A 4LZ1H 2VIQA 5IK2D 3QTVH 5GWZA 1ZTKA 4WH6A 1K1IA 2AS9A 1Y5AT 1P0SH 3GCTF 3SO3A 1LQDB 1DM4B 4O97A 1GHWH 3MOCA 1LPZB 2AGEX 1VR1H 4NSVA 3SNEA 4X1QU 3MNBA 3SJ8A 3ZZ6A 3MYWA 2EEKA 2FOHA 3TNTA 1OWDA 2Q6DA 1L4ZA 3QDZB 3SOSA 1SC8U 3MO6A 5FAHA 1BBRH 3ZVEA 5C1XA 1EUFA 3ATIA 3TNSA 3OEHD 1UHBA 1ZMJA 1V2ST 3LH1A 3NPSA 5GPIB 1NFWA 3BG4B 1V2WT 2A31A 1GVKB 1GBKA 3EA7A 1O2NA 4B76A 4UONA 1TX7A 2BD2A 2VH0A 2VVCA 3CNRA 5JB8S 3SZEA 4KP0A 3T25A 2QE7D 4MQAA 1WV7H 1DICA 1N6XA 4B2AA 3SNAA 3PTBA 2R9PA 5JBAS 1S5SA 4CRDA 1SPJA 1ARBA 1O2IA 2OCVB 2AERH 4B2BA 1K1NA 2FOBA 1D6RA 1CO7E 1P02A 1SR5C 3OTPA 1SGTA 4FUBA 5HM2A 3F9EA 1CQQA 1HJAB 1B0EA 1EJNA 4AORA 1O2RA 1Q2WA 3LJOA 5DP3A 1V2JT 4I32A 1DLEA 2NU4E 4B71A 1MKWH 1AQ7A 1P01A 1JMOH 1TLDA 1E36B 3S9CA 1A46H 1LQEA 5AFYH 1QBOA 3PWBA 2HLDD 1KXCA 4Q4LA 1WQVH 1FY1A 1MTVA 3EGKH 1OYQA 3URDA 4YOGA 1SGPE 3KCGH 3BTGE 3V13A 4F48B 1MCVA 2PV9B 2WPIS 2OC0A 4FETA 8GCHF 2HPQH 5L6NH 2YMSD 1Z71A 5EOKA 5T6GA 4BTUB 1O3FA 2GCHF 2J97A 4Y7BA 4BAHB 2AYWA 2ANWA 2BD7A 2CHAC 5EXNA 5HKKD 2AEIH 2ZWLH 3RXMA 5A0AE 1GBJA 3ODFA 2SNVA 2ZGBH 2FDAA 1ZR0A 2GV6A 5JB9S 1YGCH 1LHCH 4JZ1A 2RA0A 2XTTB 3BV9B 2ZU4A 1J9CH 1K1LA 1D6WA 1ELCA 4OS2A 3OEED 3KQ5A 1GHYH 3UIRA 3EYDA 1FJSA 2F9UA 3E16B 3TPIZ 3NRLA 1ELVA 1MTNB 1O2ZA 2VGCC 1O3GA 2J98A 1KLTA 3AW0A 1LCYA 1GBAA 4GCHF 3TGJE 3SUEA 3D23A 3SI3H 5HYOA 1INCA 1LTOA 1Y3WA 4ASUD 2K8IA 1YPMH 1DFPA 1ETTH 1GJDB 1S6LA 1G36A 1D3QB 4UDWH 1GMHF 1SFIA 4K1EA 4ZROA 1YC0A 2G8TA 5PTPA 3GDUA 3T2NA 1H8ED 4NWKA 5TCCA 1DPOA 2FESH 1B0FA 1YBWA 5E2OA 2FYRA 4Z1MD 4Y79A 1C5ZB 3ZZAA 2PW8H 3GY8A 1GL0E 3PO1C 2FZZA 5DPAA 1P3CA 1ZHPA 4BAOB 1AFQC 4A5TS 3RU4E 2TBSA 2J38A 3A8DA 5FPTA 1CSOE 4TT3D 2JJ1D 1IAUA 2C8ZB 1P9UA 2UUKB 4KKDA 2ZDLA 3AAVA 3RXUA 4ABJA 2V6NA 2ZGHA 1BRBE 4HZHA 3TITA 1GI6A 2O8WA 1EP6A 4ESTE 2BDAA 3LGYA 1ESBA 1G9IE 4WVPE 2ZFTA 2TPIZ 3UQOA 2SGAA 1EXFA 4IN2A 3MU0A 4ABBA 2PKSB 2HNTE 1LHFH 2JH6D 1PYTC 2VIPA 3OTJE 4NA9H 3KNXA 4X2VA 3ZZ4A 2RA3A 2AIQA 3DD2H 1CBWB 4FXGH 3S0NA 2PP6A 1FONA 1E37B 1TE0A 3GCOA 1ELEE 1GBDA 1T31A 4KTCA 2A4QA 3ZVDA 4ABHA 1ZHRA 2BLVA 2BQWB 3M3VA 2WV4A 3ATMA 3RU4T 5EG4A 1BITA 1VCPA 4CRCA 5EJZA 1GMCG 4RSPA 5ETXA 1H8HD 3MU4A 3BG4C 2TGAA 1QRZA 2V3HH 3P6ZB 1H9HE 2G5VA 1KIGH 2XRCA 3TK5A 2W3IA 4LXBH 1NBMD 3V0XA 3FP6E 3HGPA 2BY8X 1C5PA 4YM9A 1BMMH 2Z6BD 1FAXA 2YMSB 1NRSH 1WTGH 1ARCA 4Z6AH 3ODDA 3RC6A 3A82A 1NU7B 3VB5A 4UFFH 2JDID 4A1VA 2HOBA 1QL7A 3OX7U 5FPSA 5F8XA 2W6ID 1EAIA 1TGBA 5JBCS 1GJ6A 1S6FA 1QB9A 2WSSD 5FX6A 1GHAG 1AU8A 2VH6A 2F43B 2ZQ1A 1F5RA 2F3CE 2WPHS 1V2KT 3TH2H 1MMJN 4RKJB 1SGDE 4IC5A 4DIHH 1SLVB 2WV9A 4AFZA 2GZ7A 1BBRK 4FVBA 2VWNA 3A7ZA 1C1SA 2IJD1 2BY7X 1V2NT 4FU7A 1BQYA 1ESTA 1QR3E 1QBNA 1ANBA 3SV6A 1O3PB 2XCNA 3LGWA 4I8KA 6ESTA 3RLYH 2QGRA 2BQ6B 3RXLA 7GCHF 2BB4A 4A1XA 1TIOA 4X1SU 4CR5A 1HAVA 3MNCA 3SU4A 4ZH8A 3T26A 4YESB 5EPNA 1GCTC 5A8XA 2ZTZA 4E05H 2GVFA 3RXJA 1O5CB 1SGRE 1C5UA 1YLNA 2PKAB 1AKSA 2JKHA 5DSFA 1KMHB 5EODA 2G5NA 2XBYA 3OAAD 1GBTA 4NA8A 4B6EA 1U6QA 3M5NA 4FUCA 3E0PB 3F9HA 1WDIA 3LU9B 1UVPA 3MU8A 3LC5A 1KXDA 1HDTH 1P3EA 4AB9A 3EE7A 1BTPA 1CT0E 1WOFA 3ZZ7A 1TX8A 2R2WU 4MPVA 1GVLA 5C20A 4GUXA 4IMZA 1GI0A 2CF9H 4CRFA 5C1UA 1HAHH 3D49H 1YPHC 1UCYH 1TMBH 3M3TA 1CGIE 1O2HA 2FS8A 1LHEH 1G2LA 4X2XA 1DS2E 3CP7A 3T28A 4VGCC 2ZDAH 3IG6B 3FN8A 4AFSA 3R0FA 4ABEA 1S82A 2GDDA 4FOUC 4ABFA 1F0RA 1GBIA 5E2PA 1C5NH 2ZCLP 2PSYA 5A2MH 1ZHMA 4ABDA 4XOJA 1TA2A 2WYGA 4DJZB 2XBXA 1FXYA 1NU9A 1QURH 1XVMA 3VG8A 3N7OA 1TBZH 1C2IA 4MDSA 1OPHB 2R3YA 1P2MA 2OC7A 5EQQA 1C5VA 4WXIA 1IOEA 1NROH 2FXRA 4YLUA 2ZKSA 1S0QA 3FZDA 4CBOA 5G4BA 1G37A 4IN1A 1TPAE 4WMFA 3BEUA 1GDNA 2FO9A 1W2KH 4MNYA 1HIAB 4E06H 2AMPA 1O3EA 4E7NA 4ZAEA 2AH4X 2EI8A 3UR9A 2ZGJA 5EJLA 2CMYA 1DOJA 2PKSC 1QGFA 1TNHA 1ZTJA 2PTCE 1ZOMA 2YNBA 1O2XA 3PLBA 2QCYA 3FP7E 3P8OA 3ATLA 5DKMA 1GL1A 2JETC 2QYIA 4ISIH 2GKVE 1GJBB 1YCPK 2C8XB 1ABJH 1W3CA 4AFQA 2B5TB 4TY6A 2BDYA 3MMGA 1GGDC 3RMNH 2ASUB 1PYTD 5I25A 5EW1H 2HRVA 2XBVA 1XUJA 1L0ZA 1EQ9A 1C5WB 2JJ2D 1E79D 1A0JA 1HV7A 3H5CB 3TK6A 1P2IA 2Q1JA 1SQAA 1TWXB 2EI6A 3UREA 1DE7H 1UTJA 3TH3H 4O3TA 3SBKA 4XBBA 4K1TA 3MQKC 4I86A 1KDQA 1O3DA 1TGCA 1C1PA 5DGJA 2KFWA 3UNSA 1G2MA 3MU1A 4NSYA 1BTYA 4DIIH 3O8RA 1DX5M 1O30A 4D76A 3NKKA 2PFEA 2KX4A 1BRUP 1FN6A 1GJAB 1ZPCA 3MTYA 1C4V2 1O39A 1XXFA 1C2JA 1W7XH 3M61U 2IN2A 1O3LA 3Q3KA 3GY5A 1GHZA 4D7FA 1THSH 5GCHF 4YO9A 1FIWA 2BD9A 3QLPH 4ISOA 3L6PA 1GJ4H 2YOLA 2CGAA 1TGTA 1O31A 9LPRA 5EXLA 2WUBA 5H4IB 2CHAB 3BSQA 3RXRA 2HVXA 1ZMNA 3MU5A 5LPFA 2AGGX 3GYLB 2B8OH 1O3IA 1BHXB 3V3MA 1MKXH 4I8GA 1O3AA 2WPDD 1O2TA 1C2MA 2QN5T 2J98B 1UK4A 3U8RH 3NZIA 3RC5A 1NRQH 4HTCH 4Y0ZE 4OGYA 2G52A 3LGVA 4YOIA 4JZFH 3LONA 2A2XH 1C5OH 5FXLA 3SJKA 2J2UA 2FEQH 3I29A 4H6TA 2VGCB 2R0KA 3PRDA 4IGDA 1B7XB 3SQHE 1IQNA 4OM9A 3MH6A 2ZA5A 4NA7A 3KGPA 3E3TA 2CF8H 4INHA 1LDTT 1HAGE 1OWEA 4ZHAA 1FX0B 5IYTA 1Z8JB 1QHRB 4TWWA 5F8ZA 5C0TA 3KQDA 2GP9B 4YTAA 3WWFA 3VGCC 3ZVFA 3P8GA 1HYLA 4ZXYH 1V2VT 3K65B 1NRNH 3S69A 2G51A 2VIWA 1EAWA 2RG3A 1BMLA 4NFEA 3MNXA 2VIOA 1AVWA 4MNXA 3HKJB 5DG6A 1ZSLA 1FQ3A 3PO1B 4AG1A 1ELAA 2BYAX 1L4DA 1UW7A 1AFQB 1MZDA 2GCHG 4Y10E 1BHXF 1TOCB 5J4SA 1F0UA 3PV5A 2P3UB 1TAWA 1ZSJA 1WTHD 2J92A 6CHAB 1CVWH 1UTQA 1PPBH 5AHGH 5FL7D 1ZGVA 2H9TH 3OFND 3QWCH 3TLOA 3ZZBA 1VITF 1V2TT 1Y3VA 1ZMLA 3VB6A 1TONA 2FI4E 2PHBA 4FUGA 1GHBF 3SUGA 5LPRA 3DSGA 3KQEA 3P17H 3U8TH 1K9OE 1O2UA 1A3BH 2RFKC 1TRYA 3FO8D 1GHVH 1EATA 2GZ8A 3OSYA 1O2JA 2FX6A 4DT7B 2R3UA 5FCRA 2GD4B 1SGYE 3DA9B 2ZDNA 1C5MD 2H9HA 3F3BA 1QTFA 1OOKB 2QF4A 4GHQA 1OHHD 3RC4A 2ZEBA 2KCPA 5EJ1A 5T6DA 1VCQA 1LMWB 2RDEA 1TFXA 4I7YH 1C5SA 1K1JA 1JIRA 3FFGA 2W26A 3PV4A 4UFGH 1F0SA 3MHWU 4ZUHA 4X6OA 1DDJA 3V12A 1GBBA 4FUEA 1FY4A 3VB7A 1O5AB 1GHXH 1UCYK 1O36A 1CT2E 2BOKA 1O37A 2AGIX 4AG2A 5A8ZA 1BTUA 3M36A 4A92A 5DP8A 1S84A 2OTVA 4SGAE 1EB2A 3OY6U 1UTPA 1ELGA 1EPTA 1KTSB 5GNDA 3VB3A 1TBQH 2QAAA 2VIVA 3M5LA 4D8NA 1QIXB 3WWBA 2SGPE 4GVUA 2NU1E 1RTLA 2GZ9A 2BD5A 2ANMH 3ZIAD 2J95A 1NESE 4WWYA 4XBCA 1BRCE 1EASA 4ABAA 1VKYA 5GXPA 1K1OA 2ESTE 1HLTH 1O3CA 7KMEH 1IQLA 1DLKB 3TGIE 4BAQB 3D65E 2SGDE 3SGAE 2BDHA 3B8JA 3SGQE 1F5LA 4MPUA 3UFAA 2FLRH 3SNDA 3MO9A 5L2YH 4ZHMU 4AC9A 1A0HB 3WY8A 1IHTH 1SGFA 1TBRH 2ZECA 1XUFA 1V2RT 1TRNA 3BTFE 1G3EA 3Q76A 2FX4A 1HAVB 4CH2B 4BAMB 1O5FH 1XUKA 2A5IA 4MPXA 1CGJE 3S7HB 3ATKA 1WBGB 1BMAA 4AX9H 2GJGA 2XYAA 1W0JD 1YPGH 3BIUH 5DJ7A 4OS5A 3GCNA 5AF9H 3Q00A 1LKBA 1AKSB 1TABE 4FU9A 1OS8A 3PTNA 1DY9A 1XXDA 1EZSC 1EJMA 1FV9A 3QZRA 2XOKD 2G00A 5HM9A 1MH0A 3RXAA 1HFDA 2XBWA 2QF3A 3O8DA 1DITH 1GCTB 1YLDA 2VWLA 2Z7FE 5C94A 1O3KA 1CA8B 4JYUH 4Q7XA 2TGPZ 1W0KD 1OWIA 1RGQA 2M5TA 4DY7B 1C4U2 3A83A 1NFYA 2QF0A 1HXFH 1XMNB 4ZXXH 3T27A 4BANB 5FBIA 3JZ1B 3BTHE 5B6OA 3F0PA 1UK2A 4NZQA 3GY7A 3PV2A 3ZV9A 2LP6A 1IQMA 3IITA 2P94A 3QO6A 2FP7B 3DHKH 3ZVAA 3QZQA 3OYPA 3NWUA 4B74A 4ABGA 1H8DH 1CE5A 2BLQA 3U9AH 3ZVCA 2QXIA 3D62A 4ZKSU 1E34B 1V2MT 2OBQA 4RT0A 1L1JA 3TH4H 1Q3XA 1IQFA 2WPKS 4VGCB 1MTUA 4LZ4B 2SFAA 5DO4H 3MFJA 1YCPH 1O2YA 5T6FA 3E0NB 4H4FA 1IQEA 3A80A 1LVMA 4K60A 4JYVH 1SB1H 1ELTA 1K1PA 1O2PA 2FI5E 1ZYOA 1HAXB 1BBRE 1NT1A 1OP0A 3L3TA 3LC3A 3M7TA 2P3FH 1A4WH 1O2OA 2B0FA 2KAIA 5KECA 1G3CA 2GV7A 3LIWA 4WMDA 3RXPA 3E1XB 1F0TA 3QN7A 4DG4A 3FVFB 1C2KA 1O2KA 4NFFA 4B1TA 2TGTA 1MKXK 4Q2KA 2VVUA 2A7HA 1TMTH 3K2UA 2XC4A 4ABIA 3CENA 6CHAC 1GDQA 4Q7ZA 4TPYA 1W7GH 3GY4A 2HGTH 3N7DA 2BQ7B 4AOQA 1ZRBA 2PGQB 2BZ6H 3BF6H 2J34A 2BD4A 1LPGB 2F4LA 1J15A 1ZGIA 1FN8A 2AFQB 2JH5D 3EE0B 3RXTA 2WHXA 1TNIA 2UUFB 3I77A 5DP7A 1N8OC 1HAIH 2BD3A 2GT7A 2JETB 2A2QH 3F0OA 1P04A 1IQHA 1FPHH 1S85A 3QK1A 1GBEA 2F9PA 2UWPA 4K69A 1D4PB 3SU2A 1O2MA 6GCHF 1P05A 1KDQB 1XM1A 1GGDB 1P09A 3RXGA 1W10U 1H4WA 1OSSA 4X8SH 3B23B 2BDGA 5FPYA 1BTZA 3SUDA 2A5AA 1JBUH 1MAYA 1GBMA 4NZLA 3SI4H 1COWD 2QIQA 1KXAA 1AB9C 2KCYA 3TJNA 2YNAA 4CBNA 1T4VH 3BTEE 5J4QA 1WSSH 1TB6H 5JBTA 1W12U 1FY5A 4Y0YE 2P8OC 1MTWA 1EOLA 1YM0A 1TPPA 1DSUA 1XKBC 4AB8A 4ZMAH 1H8IH 4Y6DA 1ANDA 4BXWA 4HGCA 1GI3A 1OX1A 3FAOA 5DP5A 2VU8E 4JZIA 3MH4A 1O33A 3FOAA 2CV3A 2BDBA 3RXDA 5C5NA 2ZPRA 1XUIA 2C93B 1O3NA 1PQAA 1XKAC 1BTXA 2NWNA 3ELAH 4Y76A 4OS4A 3U28C 1ZRKA 5JDUB 2J5UA 1UK3A 3K6YA 4MVNA 3M3SA 1P10A 1VITH 1TGNA 3PWCA 3M7QA 3RLWH 3RXCA 1LHGH 2H2ZA 3LT3A 2ZFRH 4KGAA 3U8OH 1H9LB 2DE9A 2BVXH 1KYNA 5DK1A 4SGBE 1S83A 3UPEA 2OLGA 1IQGA 1EZXC 4ACBA 2CN0H 1RRKA 2ODPA 3KYGA 2TIOA 5FHTA 2W6JD 4MG3A 4M9FA 3H7TA 4GLYA 1GI5A 1THRH 4OGXA 4K8BA 3O8CA 2PGBB 2FTLE 1W8BH 2BY6X 1A7SA 1YWUA 1QB6A 3QX5H 4NWLA 1DUAA 1SSXA 2ANKH 1NBME 4B2CA 2LNCA 1O32A 2GTBA 1O5DH 1D3PB 1YKTA 1ACBE 1TQ0B 1YLCA 1Z8IB 2OD3B 4KTSA 1ZLRA 1A2CH 1YPKH 1VZQH 3M5MA 4X6NA 1MU8B 1P8VC 1PPEE 2SGFE 3JZ2B 1DVAH 1HJ8A 5HIYA 4BTIB 2EY4C 1HJ9A 1C2LA 3RMMH 1L1GA 5TCAA 2FIRH 3VGCB 4I8LA 2ALVA 5GDSH 2GMTC 3DSPA 2Z3CA 3SHCH 3F2HA 2FODA 3F1SB 1J17T 1FZZA 1DT2A 1HB0B 2B9LA 3F68H 2IPQX 5GCHG 4Q80A 2ZTXA 1AUTC 4LOYH 2KCOA 2OBOA 1WYKA 4THNH 4O03A 1QL9A 3EA8A 2D26C 3GY3A 1WU1A 1G3DA 1GMDF 1FIZA 2OC8A 5C0UA 4WH8A 1YPEH 2F91A 1JWTA 1F2SE 1K1MA 2CXVA 4X6MA 1C2HA 3CS7A 1XUHA 3GOVB 1QJ7B 3KF2A 1OP8A 3LGTA 3UUZA 4YZUA 5E8EH 3BTDE 1AI8H 4TWYA 1QRXA 3SN8A 2J9NA 1P2QA 1H9IE 2KM0A 2HNTF 2LPRA 1DXWA 4D7GA 1UJ1A 2QF5A 3AW1A 1UHBB 3E6PH 1GMCF 4Y8ZA 4YOJA 2O8TA 1CU1A 3RDZA 1Z7KA 3LDXH 1AMHA 1EPTB 2FPZA 2HWLB 4FUFA 3BTKE 2TGDA 4OS1A 1S0RA 1W14U 2FOMB 2LELA 1TNGA 1BCUH 4JYTA 1ETSH 1MCTA 1J16A 2NU3E 3RXQA 1T7CA 4X2WA 2BY9X 2ZF0H 5HGGA 1M9UA 3PMAB 3P92A 2A4GA 4TPIZ 1GJCB 2IPHA 1L1NA 3H09A 2F9OA 5A8YA 1GJ9B 1K22H 1ORFA 3TJVA 2ZDVH 4FU8A 1RFNA 1GHAF 3A7YA 1Z6EA 2BLWA 3A85A 1BTWA 1PPFE 1T4UH 1AGJA 1EX3A 3WW7A 1QB1A 4ISLA 2QXGA 1VITG 1E1QD 1BUIA 2A45B 2BM2A 2Z9KA 1MUEB 2UUYA 2XWAA 4Y8XA 4YLQH 3V7TA 1YP9A 1BMNH 1A61H 1SOZA 2L74A 3GS9A 1V2OT 2AIPA 4X8TH 1VGCB 3KIDU 1C5XB 1K2I1 1HPGA 2OQ5A 3F2GA 3SNCA 2F9NA 2AHME 1O35A 2ZFPH 1BB0B 1Z1IA 2BD8A 1TALA 2R0LA 1SQRA 3GCTG 4IBLH 1QFKH 2XNDD 3LGIA 1MD7A 2PTNA 4NIVA 5HXFA 1JIMA 5B6LA 4BAKB 1EP5A 1T32A 3BIVH 4ZKNU 1A0LA 1J14A 2P16A 1O5BB 4ZKOU 2HLCA 1Y3YA 3O8BA 3UTUH 5BRRE 1QJ1B 3BEIB 4X6PA 5EXMA 5ESTE 1C1VH 2Y5FA 1E38B 1MBQA 2WPMS 5A09A 2ZI2H 1WQSA 1UCYE 1TQ7B 2WZQA 1AWFH 2QA9E 3OE7D 1O2GH 2SGEE 3SGBE 1WAYB 2Y7XA 5CHBA 3W95A 3VPKA 1CHOF 1QA7A 1Y5UT 4TY7A 3MI4A 3STJA 1P06A 1IHSH 1NO9H 3AVZA 3UWIA 3A89A 3BTWE 1GI9B 2BX3A 2VJ1A 5L2ZH 1BMFD 3A7WA 3UNRA 1FUJA 1A1RA 4UE7H 3S7KB 1PQ8A 2BOHB 1V2UT 2BTCE 1HXEH 1O3OA 2ZU3A 4CHAB 2K0QA 2KAIB 1HCGA 1EZQA 3HK3B 3SYJA 1UTLM 2HNTC 1G32B 4UD9H 3ZYEA 6LPRA 4Z0KA 1H1BA 2ZFSA 2ZNKH 1LVOA 1CHGA 3LKWA 4INKA 4Y11E 1TMUH 1SGIB 5EQSA 3U69H 3UY9A 3LH3A 3UNQA 4HFPB 1FPCH 4HG6A 1AIXH 1DANH 5EPYA 1X7AC 3ZZCA 9ESTA 1LVBA 4F4OC 2B7DH 1SMFE 3SJOA 1PPZA 4DW2U 4ZHLU 3R3GB 5K7RA 3UR6A 1O38A 8GCHG 3U1JB 5F53A 1RS0A 2EQNA 1XUGA 2CK3D 4YT6H 2KCAA 3ZZ8A 2A5KA 4CRBA 3PM3A 1V6DA 4BTTB 5LPEA 1FAKH 2RDLA 3N7EA 2XC5A 1QZ8A 2XNIA 3GY6A 5CE1A 1PQ5A 1AD8H 1G3BA 1SFQB 3ESTA 4K2YA 4XFQA 1CGHA 3M37A 2PKAA 1YF4A 2V3OH 4Q63A 1YYY1 5CHAC 1S81A 1KY9A 4NG9H 4WXVA 3EQ0H 3DFJA 3U98H 1C1TA 1ANEA 2H5CA 1AO5A 2ZFQH 3SU6A 5HMAA 2EC9H 2ZHDA 3KYFA 3Q77A 1N8OB 1MQ6A 2FLBH 1E0FD 2GCTB 3ZZDA 2AMQA 1K0HA 1AN1E 3A88A 1C5RA 3E91A 1W0ZU 2VIDA 1O3JA 3KHVA 1V2LT 1DY8A 2AMDA 2WINI 1EPTC 1OXGA 1JXPA 1O3MA 4GCHG 4X1RU 4WJG2 3T29A 1SGNE 2UUJB 2VVVA 2UWLA 1O0DH 4A1TA 4BXSA 1VJAU 5JBBS 1BZXE 4NCYA 2ZQ2A 1AB9B 3M5OA 4GAWA 1GMHG 2V7QD 2ZHFH 1GVZA 4JK6A 3MH7A 1CT4E 1TRMA 3GISB 4FUIA 1O3BA 1QJ6B 1SGCA 3BN9A 2P8OB 2Y6TA 4U01A 3A87A 4U30A 1NFUA 3RXEA 2QV1A 1O34A 1KXFA 2STAE 1YPHE 2GX4A 2GT8A 4E7RG 4YT7H 1BOQA 1Z8GA 4ZKRU 3W94A 4FVDA 2BLOA 3RXIA 3KN2A 2Y81A 4KELA 3UB0A 1V3XA 3NUMA 4XE4A 4ISNA 2D8WA 2Y80A 1BRAA 1UTOA 1D9IA 8ESTE 5L30H 1AZ8A 2QXJA 1HIAA 1XX9A 2A4OA 1KLIH 3SNBA 1L2EA 1VGCC 3W1EA 1SG8B 1GG6B 2FS9A 1P12E 3GDVA 1IQJA 3A7VA 2ODQA 2A4RA 1YCPM 2BY5X 3F2FA 2A7JA 5SGAE 1WUNH 4AGJA 3QGNB 3BTQE 1C5LH 1S6HA 3GCHC 3STIA 1AE8H 2O8UA 1C2FA 6GCHG 1ABIH 5C2ZA 3F9GA 2ZTYA 3ITIA 4DCDA 5C67A 3SV8A 2HVYB 1SHYA 2ZFFH 1ELFA 1PQ7A 2Y5HA 3PMJA 1GCDA 1ZJKA 2ZC9H 1ZPBA 3SV2H 2SNWA 2Y7ZA 4ZCNA 2Q6FA 4XDEA 2JH0D 4P02A 4P00A 3BG8A 2ZP0H 1UVUH 4XBDA 3FANA 3SU0A 1NY22 3NXPA 2C8WB 3MWIU 1O2SA 2VWOA 1C5QA 4WF8A 1A5HA 5EQRA 3BTME 3TIUA 2EI7A 4BNRA 5F03A 3A8CA 2ZPSA 4B6FA 1C9PA 3SV9A 1ZTLA 3QGJA 5KGOA 2GMTB 1A5GH 2H6MA 1DUEA 1E35B 1NM6A 1TX6A 1UTKA 4DVAU 1TGSZ 1KTTB 1T8NA 1UMAH 1FMGA 4CREA 5C3NA 1RTFB 4ASHA 4CRAA 3SQEE 3QUMP 1ZPZA 2C4FH 3F9FA 3RU4D 1LKAA 2I6QA 4K1SA 4CHAC 1HAYB 2CJIA 4RI0A 2DE8A 2PUQH 2VNTA 1SQOA 3EAJA 4DOQA 4Y7AA 3VFEA 2PUXB 1IQIA 2FWWA 2FM2A 1E1RD 2BX4A 3H7OA 3FZZA 1P03A 1BA8B 3C27B 1D3DB 2FOGA 2C8YB 2PWXA 1F92A 3U1IB 4K3JA 2PR3A 4D9QA 1CA0C 3ZVGA 2Z9LA 3LGUA 1RIWC 5FX5A 2ZHQH 3EDXB 1TNKA 4HI3A 3P70B 1ANCA 3RXFA 1B5GH 5F8TA 4FUHA 3A8AA 1T8OA 4QT8C 7GCHG 3ZYDA 3RM0H 1TPOA 5E0HA 1J8AA 3F6UH 1EAXA 3PMBB 4X0WU 3SJ9A 1BIOA 1DXPA 1P57B 1SGQE 4JK5A 2V3MA 2BMGB 4R8TB 1QBVH 2V35A 1DWBH 3DT0H 5TJXA 2FOAA 1GI7B 2FI3E 4LK4A 5T3HA 5T1VA 2ZGXH 1EJAA 4AN7A 5CDFE 1C9TA 2WYJA 1MAXA 1HGTH 1SLWB 1TOMH 2C90B 3BEFB 1FY3A 3VEQB 2WPLS 3RXHA 2GCTC 2H1UA 3HPTB 1GI2A 2XCFA 1LHDH 2L6OA 1NN6A 3E90B 3HKIB 1V2QT 1ZZZA 3DCLA 2W7SA 1KXBA 1NS3A 1SQTA 2RCEA 4KTUA 4MLFB 1FDPA 2I6SA 1GMDG 3B9FH 3A84A 2FOEA 2M2AA 3E8LA 4IS5A 4XSKU 1C1UH 1P2NA 1K28D 4M7GA 4RKOB 1SVPA 4X1PU 2VWMA 1UTMA 2W7UA 1SKYE 2TRMA 3MH5A 3QTOH 4AGKA 2K1QA 5JYIA 4O3UA 3ATWA 1GDUA 4K5ZA 5GIBA 2HPPH 3UQVA 5LGOA 4H6SB 1BT7A 4K8YA 1BTHH 2ZU2A 2HALA 4R0IA 5ABWA 2O8MA 5DN6D 2WUCA 1PJPA 5C5OA 3URCA 1NFXA 3PROA 5E0JA 3NCLA 1ZSKA 4MNVA 2BDCA 2JIZD 2OUAA 5HIZA 5F6MA 1NRPH 1C1NA 3A86A 3I78A 2OQUA 1OYTH 1FI8A 1N1LA 4PROA 1Y3XA 2D2DA 1NC6A 2ZU1A 3RM2H 5A0CA 1AZZA 1C1RA 2VBCA 1EFRD 3ZV8A 3IWMA 1JRSA 4GHTA 1GG6C 4TYDA 1HUTH 2ALPA 1QQ4A 3OU0A 2KR7A 4DURA 1TA6A 2FOFA 3PLKA 1O2VA 3G01A 3RXSA 1RTKA 3UOUA 1NZQH 1HJAC 2ZPQA 2Z9IA 4RT1A 4RN6A 1MTSA 1AY6H 4YXWD 1RXPA 3A7TA 5DP6A 1F7ZA 1VCWA 4XD7D 1C4Y2 3DUXH 1AHTH 2BDIA 1HRTH 3GDSA 1W11U 1OWJA 1O5GH 1SLUB 2BHGA 4X8UH 3TJOA 2VB0A 2ZZUH 3P8FA 4O9VA 2ODYB 2ZO3H 1EB1H 3LOXA 3DSOA 1GI8B 3A8BA 4Y71A 5EIYA 2BXUH 1K21H 3EA9A 4I8HA 4MNWA 4BOHA 1P2OA 2BVSH 2WPJS 7LPRA 3BTTE 2A32A 2A7CA 2IJOB 2NU0E 3TU7H 1C1MA 1GI4A 1EOJA 1NPMA 3ENSB 1UO6A 1HAZB 4NIXA 1LVYA 1SHHB 4IMQA 1DSTA 1HAOH 1XVOA 1O2QA 1SGEE 2OXSA 1GJ5H 1SL3A 1MZAA 2P95A 1EAUA 3ZZ3A 1YY3A 2ZDMA 5IDKA 3M7UA 4NGAH 2ZHEH 1LO6A 1MKWK 1Q31A 1UTNA 1F5KU 5KEDA 1DWDH 3C1KA 3SHAH 2J4IA 5CHAB 5EW2H 2ZG0H 1SGFG 1MBMA 2ULLA 3Q3YA 1PPHE 1MTNC 4Y8YA 2G4TA 3PB1E 2VINA 1CHOG 3GYMA 2ANYA 4A6LA 3RUOA 1OWKA 2GGVB 2P93A 1ID5H 4I31A 4XRNA 1O2LA 1GPZA 3KQCA 1AFEH 4IW4E 1V2PT 5LH8A 5FCKA 1O5EH 4U2WA 4ISHH 4MPWA 8KME2 4U32A 1THPB 3RXOA 1HAPH 1SI5H 3FP8E 1WXRA 2Z3DA 3AAUA 3M35A 1ETRH 4ACAA 3PYHA 3UWJH 3SZNA 1A5IA 2Z94A 2ZDKA 4FUDA 1SOTA 1C1OA 4UEHH 1KLJH 1Z8RA 3K9XB 3SU5A 1TNJA 3DFLA 4AFUA 1BDAA 2Z3EA 1Y59T 1OWHA 3RMOH 2BXTH 2ZGCA 2F83A 1QCPA 1MABB 1TNLA 1UVTH 1Y3UA 2OINA 2BVRH 2V0BA 1C5TA 1MU6B 3TJUA 1RD3B 1O3HA 4NIWA 1KXEA 4DGJA 1C1QA 2FOCA 1GBCA 1JOUB 3SJIA 2IOTA 2XWBI 4INLA 1C2DA 5EGMA 3P8NA 1AUJA 4JZDH 1C1WH 4OS7A 1GHBG 1Z6JH 4WMEA 2F9VA 4AYYB 1SLXB 5A0BA 1TPSA 1CBWC 5DP9A 4WY3A 1Y8TA 3CS0A 2ILNA 3RMLH 4UFDH 3S9AA 1T8LA 2H9EH 1QRWA 1EZUC 3N99A 3PRBA 3Q3XA 1KSNA 4AZ2B 3VB4A 4J1YA 3GCHB 1OP2A 4CRGA 4D9RA 1C5YB 1TYNA 2OC1A 1MD8A 8LPRA 1QY6A 1OKXA 2R2MB 1EKBB 4OS6A 5BPEA 4X1NU 1YPLH 2PSXA 2THFB 3LJJA 1QL8A 3FKSD 3ZZ5A 2ZHWH 1ESAA 2Y5GA 3HATH 2YMSC 5I46H 1NRRH 1BJVA 1G30B 1FLEE 2C3SA 2OP9A 4I8JA 3TVJB 1Z1JA 1MQ5A 2P3TB 1C2EA 3MNSA 3SUFA 1GWAA 2SGQE 4X2YA 3RXBA
chains in the Genus database with same CATH topology
3UOPA 2QC2A 2G55A 5E0GA 2P59A 3T62A 3SV7A 1O2WA 4FUJA 1BJUA 5C1YA 4UFEH 4X8VH 5EU8A 1ZJDA 3A81A 3SU1A 5CMXH 1WCZA 3ZVBA 1T8MA 1RJXB 1W0YH 2XW9A 3MO3A 3T5FH 3HK6B 3LPRA 3TK9A 3L33A 2A0QB 2W5EA 2Z9JA 4JZEH 1AVXA 4CH8B 2ZCHP 3TGKE 2ZU5A 2UWOA 1LPKB 5DP4A 1GJ7B 1P2JA 2Z9GA 3VXEH 2QXHA 1QNJA 1ELBA 1SBWA 4GPGA 2FTMA 2ZIQH 7ESTE 2WV5A 3HGNA 2A1DB 1N6YA 3K6ZA 1AVGH 3VXFH 3GY2A 2H5DA 5AVDA 3KQBA 1D3TB 3OY5U 5AFZH 1P9SA 1YPJH 3SW2B 1PFXC 5K0HA 3P95A 4JMYA 2G81E 1CA0B 3RXKA 1C2GA 3KL6A 1AE5A 1GBLA 1RIWB 2BZAA 3PLPA 3S9BA 3KEEA 2D1JA 2PLXA 4F49A 5GJ4B 4B75A 1W13U 3SU3A 1UVOA 3PMHB 5ESBA 2O9QA 2O8LA 2Q6GA 2XC0A 1P2KA 5FBEA 1DWCH 2XXLA 3RXVA 2Y82A 4H42U 4B73A 4A7IB 1ELDE 1GI1A 1GBFA 1QA0A 1NTPA 1P11E 2J94A 4IC6A 1GJ8B 2STBE 1PPCE 4J2YB 2FMJA 1PPGE 3AASA 4CR9A 1FY8E 2NU2E 4GSOA 1GBHA 1JRTA 1HBTH 1Y5BT 1DWEH 2F9BH 3SORA 5JPMH 2GDEH 1VJ9U 4MTBA 4AYVB 2DUCA 1AWHB 2FYQA 1FNIA 1IQKA 2G4UA 2EA3A 1QQUA 3GICB 4NIYA 1UVSH 4JCNA 3NK8A 2W3KA 1HNEE 2QY0B 4I33A 3A7XA 2ZCKP 3RP2A 1A3EH 4Q7YA 3ZZ9A 4LZ1H 2VIQA 3QTVH 5GWZA 1ZTKA 4WH6A 1K1IA 2AS9A 1Y5AT 1P0SH 3GCTF 3SO3A 1LQDB 1DM4B 4O97A 1GHWH 3MOCA 1LPZB 2AGEX 1VR1H 4NSVA 3SNEA 4X1QU 3MNBA 3SJ8A 3ZZ6A 3MYWA 2EEKA 2FOHA 3TNTA 1OWDA 2Q6DA 1L4ZA 3QDZB 3SOSA 1SC8U 3MO6A 5FAHA 1BBRH 3ZVEA 5C1XA 1EUFA 3ATIA 3TNSA 1UHBA 1ZMJA 1V2ST 3LH1A 3NPSA 5GPIB 1NFWA 3BG4B 1V2WT 2A31A 1GVKB 1GBKA 3EA7A 1O2NA 4B76A 4UONA 1TX7A 2BD2A 2VH0A 2VVCA 5JB8S 4KP0A 3T25A 4MQAA 1WV7H 1DICA 1N6XA 4B2AA 3SNAA 3PTBA 2R9PA 5JBAS 1S5SA 4CRDA 1SPJA 1ARBA 1O2IA 2OCVB 2AERH 4B2BA 1K1NA 2FOBA 1D6RA 1CO7E 1P02A 1SR5C 1SGTA 4FUBA 5HM2A 3F9EA 1CQQA 1HJAB 1B0EA 1EJNA 4AORA 1O2RA 1Q2WA 3LJOA 5DP3A 1V2JT 4I32A 1DLEA 2NU4E 4B71A 1MKWH 1AQ7A 1P01A 1JMOH 1TLDA 1E36B 3S9CA 1A46H 1LQEA 5AFYH 1QBOA 3PWBA 1KXCA 1WQVH 1FY1A 1MTVA 3EGKH 1OYQA 3URDA 4YOGA 1SGPE 3KCGH 3BTGE 3V13A 1MCVA 2PV9B 2WPIS 2OC0A 8GCHF 2HPQH 5L6NH 5T6GA 1Z71A 5EOKA 4BTUB 1O3FA 2GCHF 4Y7BA 4BAHB 2AYWA 2ANWA 2BD7A 2CHAC 5EXNA 2AEIH 2ZWLH 3RXMA 5A0AE 1GBJA 3ODFA 2SNVA 2ZGBH 2FDAA 1ZR0A 2GV6A 5JB9S 1YGCH 1LHCH 4JZ1A 2RA0A 2XTTB 3BV9B 2ZU4A 1J9CH 1K1LA 1D6WA 1ELCA 4OS2A 1GHYH 3UIRA 3EYDA 1FJSA 2F9UA 3E16B 3TPIZ 1ELVA 1MTNB 1O2ZA 2VGCC 1O3GA 1KLTA 3AW0A 1LCYA 1GBAA 4GCHF 3TGJE 3SUEA 3D23A 3SI3H 5HYOA 1INCA 1LTOA 1Y3WA 1YPMH 1DFPA 1ETTH 1GJDB 1G36A 1D3QB 4UDWH 1GMHF 1SFIA 4K1EA 4ZROA 1YC0A 2G8TA 5PTPA 3GDUA 3T2NA 4NWKA 5TCCA 1DPOA 2FESH 1B0FA 1YBWA 5E2OA 2FYRA 4Y79A 1C5ZB 3ZZAA 2PW8H 3GY8A 1GL0E 3PO1C 2FZZA 5DPAA 1P3CA 1ZHPA 4BAOB 1AFQC 4A5TS 3RU4E 2TBSA 2J38A 3A8DA 5FPTA 1CSOE 1IAUA 2C8ZB 1P9UA 2UUKB 4KKDA 2ZDLA 3AAVA 3RXUA 4ABJA 2V6NA 2ZGHA 1BRBE 4HZHA 3TITA 1GI6A 2O8WA 1EP6A 4ESTE 2BDAA 3LGYA 1ESBA 1G9IE 4WVPE 2ZFTA 2TPIZ 3UQOA 2SGAA 1EXFA 4IN2A 3MU0A 4ABBA 2PKSB 2HNTE 1LHFH 2JH6D 1PYTC 2VIPA 3OTJE 4NA9H 3KNXA 4X2VA 3ZZ4A 2RA3A 2AIQA 3DD2H 1CBWB 4FXGH 3S0NA 1FONA 1E37B 1TE0A 3GCOA 1ELEE 1GBDA 1T31A 4KTCA 2A4QA 3ZVDA 4ABHA 1ZHRA 2BLVA 2BQWB 3M3VA 2WV4A 3ATMA 3RU4T 5EG4A 1BITA 1VCPA 4CRCA 1GMCG 4RSPA 5ETXA 3MU4A 3BG4C 2TGAA 1QRZA 2V3HH 3P6ZB 1H9HE 2G5VA 1KIGH 2XRCA 3TK5A 2W3IA 4LXBH 3V0XA 3FP6E 3HGPA 2BY8X 1C5PA 4YM9A 1BMMH 2Z6BD 1FAXA 1NRSH 1WTGH 1ARCA 4Z6AH 3ODDA 3RC6A 3A82A 1NU7B 3VB5A 4UFFH 4A1VA 2HOBA 1QL7A 3OX7U 5FPSA 5F8XA 1EAIA 1TGBA 5JBCS 1GJ6A 1S6FA 1QB9A 5FX6A 1GHAG 1AU8A 2VH6A 2ZQ1A 1F5RA 2F3CE 2WPHS 1V2KT 3TH2H 1MMJN 4RKJB 1SGDE 4IC5A 4DIHH 1SLVB 4AFZA 2GZ7A 1BBRK 4FVBA 2VWNA 3A7ZA 1C1SA 2BY7X 1V2NT 4FU7A 1BQYA 1ESTA 1QR3E 1QBNA 1ANBA 3SV6A 1O3PB 2XCNA 3LGWA 4I8KA 6ESTA 3RLYH 2QGRA 2BQ6B 3RXLA 7GCHF 2BB4A 4A1XA 1TIOA 4X1SU 4CR5A 1HAVA 3MNCA 3SU4A 4ZH8A 3T26A 4YESB 5EPNA 1GCTC 5A8XA 2ZTZA 4E05H 2GVFA 3RXJA 1O5CB 1SGRE 1C5UA 2PKAB 1AKSA 2JKHA 5EODA 2G5NA 2XBYA 1GBTA 4NA8A 1U6QA 3M5NA 4FUCA 3E0PB 3F9HA 3LU9B 1UVPA 3MU8A 3LC5A 1KXDA 1HDTH 1P3EA 4AB9A 1BTPA 1CT0E 1WOFA 3ZZ7A 1TX8A 2R2WU 4MPVA 1GVLA 5C20A 4GUXA 4IMZA 1GI0A 2CF9H 4CRFA 5C1UA 1HAHH 3D49H 1YPHC 1UCYH 1TMBH 3M3TA 1CGIE 1O2HA 2FS8A 1LHEH 1G2LA 4X2XA 1DS2E 3CP7A 3T28A 4VGCC 2ZDAH 3IG6B 4AFSA 3R0FA 4ABEA 1S82A 2GDDA 4ABFA 1F0RA 1GBIA 5E2PA 1C5NH 2ZCLP 2PSYA 5A2MH 1ZHMA 4ABDA 4XOJA 1TA2A 2WYGA 4DJZB 2XBXA 1FXYA 1NU9A 1QURH 1XVMA 3N7OA 1TBZH 1C2IA 4MDSA 1OPHB 2R3YA 1P2MA 2OC7A 5EQQA 1C5VA 4WXIA 1IOEA 1NROH 2FXRA 4YLUA 2ZKSA 1S0QA 3FZDA 4CBOA 5G4BA 1G37A 4IN1A 1TPAE 4WMFA 3BEUA 1GDNA 2FO9A 1W2KH 4MNYA 1HIAB 4E06H 2AMPA 1O3EA 4E7NA 4ZAEA 2AH4X 2EI8A 3UR9A 2ZGJA 2CMYA 1DOJA 2PKSC 1QGFA 1TNHA 1ZTJA 2PTCE 1ZOMA 2YNBA 1O2XA 3PLBA 2QCYA 3FP7E 3P8OA 3ATLA 5DKMA 1GL1A 2JETC 2QYIA 4ISIH 2GKVE 1GJBB 1YCPK 2C8XB 1ABJH 1W3CA 4AFQA 2B5TB 4TY6A 2BDYA 3MMGA 1GGDC 3RMNH 2ASUB 1PYTD 5I25A 5EW1H 2HRVA 2XBVA 1XUJA 1L0ZA 1EQ9A 1C5WB 1A0JA 1HV7A 3TK6A 3H5CB 1P2IA 2Q1JA 1SQAA 1TWXB 2EI6A 3UREA 1DE7H 1UTJA 3TH3H 4O3TA 3SBKA 4XBBA 4K1TA 1KDQA 1O3DA 1TGCA 1C1PA 5DGJA 3UNSA 1G2MA 3MU1A 4NSYA 1BTYA 4DIIH 3O8RA 1DX5M 1O30A 4D76A 3NKKA 2PFEA 1BRUP 1FN6A 1GJAB 1ZPCA 3MTYA 1C4V2 1O39A 1XXFA 1C2JA 1W7XH 3M61U 2IN2A 1O3LA 3Q3KA 3GY5A 1GHZA 4D7FA 1THSH 5GCHF 4YO9A 1FIWA 2BD9A 3QLPH 4ISOA 3L6PA 1GJ4H 2YOLA 2CGAA 1TGTA 1O31A 9LPRA 5EXLA 2WUBA 5H4IB 2CHAB 3BSQA 3RXRA 2HVXA 1ZMNA 3MU5A 5LPFA 2AGGX 3GYLB 2B8OH 1O3IA 1BHXB 3V3MA 1MKXH 4I8GA 1O3AA 1O2TA 1C2MA 2QN5T 1UK4A 3U8RH 3NZIA 3RC5A 1NRQH 4HTCH 4Y0ZE 4OGYA 2G52A 3LGVA 4YOIA 4JZFH 3LONA 2A2XH 1C5OH 5FXLA 3SJKA 2J2UA 2FEQH 3I29A 4H6TA 2VGCB 2R0KA 4IGDA 1B7XB 3SQHE 1IQNA 3MH6A 2ZA5A 4NA7A 3KGPA 3E3TA 2CF8H 4INHA 1LDTT 1HAGE 1OWEA 4ZHAA 5IYTA 1Z8JB 1QHRB 4TWWA 5F8ZA 3KQDA 2GP9B 4YTAA 3ZVFA 3VGCC 3P8GA 1HYLA 4ZXYH 1V2VT 3K65B 1NRNH 3S69A 2G51A 2VIWA 1EAWA 2RG3A 1BMLA 4NFEA 3MNXA 2VIOA 1AVWA 4MNXA 3HKJB 5DG6A 1ZSLA 1FQ3A 3PO1B 4AG1A 1ELAA 2BYAX 1L4DA 4Y10E 1AFQB 1MZDA 2GCHG 1BHXF 1TOCB 5J4SA 1F0UA 2P3UB 1TAWA 1ZSJA 1WTHD 2J92A 6CHAB 1CVWH 1UTQA 1PPBH 5AHGH 1ZGVA 2H9TH 3QWCH 3TLOA 3ZZBA 1VITF 1V2TT 1Y3VA 1ZMLA 3VB6A 1TONA 2FI4E 2PHBA 4FUGA 1GHBF 3SUGA 5LPRA 3KQEA 3P17H 3U8TH 1K9OE 1O2UA 1A3BH 1TRYA 1GHVH 1EATA 2GZ8A 3OSYA 1O2JA 2FX6A 4DT7B 2R3UA 5FCRA 2GD4B 1SGYE 3DA9B 2ZDNA 1C5MD 2H9HA 1QTFA 1OOKB 4GHQA 3RC4A 2ZEBA 5T6DA 1VCQA 1LMWB 1TFXA 4I7YH 1C5SA 1K1JA 1JIRA 3FFGA 2W26A 3PV4A 4UFGH 1F0SA 3MHWU 4ZUHA 4X6OA 1DDJA 3V12A 1GBBA 4FUEA 1FY4A 3VB7A 1O5AB 1GHXH 1UCYK 1O36A 1CT2E 2BOKA 1O37A 2AGIX 4AG2A 5A8ZA 1BTUA 3M36A 4A92A 5DP8A 1S84A 2OTVA 4SGAE 1EB2A 3OY6U 1UTPA 1ELGA 1EPTA 1KTSB 3VB3A 1TBQH 2QAAA 2VIVA 3M5LA 4D8NA 1QIXB 2SGPE 4GVUA 2NU1E 1RTLA 2GZ9A 2BD5A 2ANMH 2J95A 1NESE 4WWYA 4XBCA 1BRCE 1EASA 4ABAA 5GXPA 1K1OA 2ESTE 1HLTH 1O3CA 7KMEH 1IQLA 1DLKB 3TGIE 4BAQB 3D65E 2SGDE 3SGAE 2BDHA 3B8JA 3SGQE 1F5LA 4MPUA 3UFAA 2FLRH 3SNDA 3MO9A 5L2YH 4ZHMU 1A0HB 3WY8A 1IHTH 1SGFA 1TBRH 2ZECA 1XUFA 1V2RT 1TRNA 3BTFE 1G3EA 3Q76A 2FX4A 1HAVB 4CH2B 4BAMB 1O5FH 1XUKA 2A5IA 4MPXA 1CGJE 3S7HB 3ATKA 1WBGB 1BMAA 4AX9H 2XYAA 1YPGH 3BIUH 5DJ7A 4OS5A 3GCNA 5AF9H 3Q00A 1LKBA 1AKSB 1TABE 4FU9A 1OS8A 3PTNA 1DY9A 1XXDA 1EZSC 1EJMA 1FV9A 3QZRA 2G00A 5HM9A 1MH0A 3RXAA 1HFDA 2XBWA 2QF3A 3O8DA 1DITH 1GCTB 1YLDA 2VWLA 2Z7FE 1O3KA 1CA8B 4JYUH 4Q7XA 2TGPZ 1OWIA 1RGQA 2M5TA 4DY7B 1C4U2 3A83A 1NFYA 2QF0A 1HXFH 1XMNB 4ZXXH 3T27A 4BANB 5FBIA 3JZ1B 3BTHE 5B6OA 1UK2A 4NZQA 3GY7A 3ZV9A 1IQMA 3IITA 2P94A 3QO6A 2FP7B 3DHKH 3ZVAA 3QZQA 3OYPA 3NWUA 4B74A 4ABGA 1H8DH 1CE5A 2BLQA 3U9AH 3ZVCA 2QXIA 3D62A 4ZKSU 1E34B 1V2MT 2OBQA 1L1JA 3TH4H 1Q3XA 1IQFA 2WPKS 4VGCB 1MTUA 4LZ4B 2SFAA 5DO4H 3MFJA 1YCPH 1O2YA 5T6FA 3E0NB 4H4FA 1IQEA 3A80A 1LVMA 4K60A 4JYVH 1SB1H 1ELTA 1K1PA 1O2PA 2FI5E 1ZYOA 1HAXB 1BBRE 1NT1A 1OP0A 3L3TA 3LC3A 3M7TA 2P3FH 1A4WH 1O2OA 2B0FA 2KAIA 1G3CA 2GV7A 3LIWA 4WMDA 3RXPA 3E1XB 1F0TA 3QN7A 4DG4A 3FVFB 1C2KA 1O2KA 4NFFA 4B1TA 2TGTA 1MKXK 4Q2KA 2VVUA 2A7HA 1TMTH 3K2UA 2XC4A 4ABIA 3CENA 6CHAC 1GDQA 4Q7ZA 4TPYA 1W7GH 3GY4A 2HGTH 2BQ7B 4AOQA 1ZRBA 2PGQB 2BZ6H