3E8LA

The crystal structure of the double-headed arrowhead protease inhibitor a in complex with two trypsins
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine proteinase inhibitor A
publication title The ternary structure of double-headed arrowhead protease inhibitor API-A complexed with two trypsins reveals a novel reactive site conformation.
pubmed doi rcsb
source organism Sagittaria sagittifolia
molecule tags Hydrolase inhibitor/hydrolase
total genus 52
structure length 223
sequence length 223
chains with identical sequence B
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2008-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3e8lA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3e8lA02
2Y81A 3FZDA 4FUCA 1FIWA 1P0SH 1ELEE 3PLKA 4DGJA 3LGVA 1A5IA 1OYTH 3MH4A 2OQ5A 5DP7A 3RU4E 1SMFE 1A61H 1RRKA 3F9FA 4NSYA 4I8KA 4YESB 3L33A 4BAOB 2W7SA 1LO6A 3A81A 5J4SA 2XRCA 2Z7FE 2P93A 4AFZA 2IJOB 2PFEA 2NWNA 1WQSA 2PKSC 2F9BH 3LJOA 2Y5GA 1O36A 2VINA 5AFYH 1A5GH 1O3EA 1O2MA 3E90B 1GJ5H 1P05A 3SI3H 3F6UH 4MPWA 1S0RA 2BY9X 1BHXB 3SW2B 4ZMAH 2A4OA 4XE4A 2ASUB 1P2IA 3SU3A 3P17H 2PSYA 1YCPM 2ZECA 2Y6TA 1Z1JA 3LT3A 3MTYA 2F9VA 1GBHA 3AVZA 1H9HE 2GGVB 1CT2E 2IOTA 1J16A 3SUGA 6CHAC 4UDWH 2VB0A 3KN2A 4U32A 3SNCA 1SLWB 3SZNA 4NZLA 2KAIA 2ZPRA 2FO9A 1JBUH 4D8NA 1W10U 1ELBA 1OKXA 3K2UA 1B0EA 1QR3E 2J9NA 2ZFQH 8LPRA 2BY7X 1VCQA 4UFDH 2UUYA 1AFEH 3KQDA 2D26C 3FP7E 1ELVA 1W12U 1OWJA 1K9OE 2XC5A 1GI5A 4B2AA 3VGCB 1NC6A 3A80A 1CQQA 3SU5A 1G3DA 1NRRH 1V2QT 2VH6A 1S6HA 3ATMA 5FHTA 1AKSB 3D23A 1OX1A 1KDQB 4CRDA 2AIPA 1ZTLA 3TU7H 2J95A 4LZ1H 1K1PA 1QA7A 1QNJA 3E3TA 4RKJB 2ALVA 2AGIX 1S83A 1C1SA 1ZMLA 2WYGA 3EYDA 2GVFA 3O8DA 4NIVA 2FOHA 4JZ1A 5E0HA 1NRPH 1QRXA 3UNQA 1Z71A 2D2DA 5AHGH 1FY5A 2A32A 1TWXB 2VWOA 3RU4T 1GVKB 3P8FA 3SGAE 1Q2WA 1F5KU 3SU0A 2BXTH 2O8UA 1C2KA 2JKHA 4DCDA 3BTDE 3ZZ7A 1O5GH 1LQDB 3MU8A 1DM4B 4H6TA 2ZDNA 3LPRA 1Y3UA 4AB8A 1UTLM 1DT2A 2OLGA 3V7TA 1PQ5A 3R0FA 4FUGA 2J2UA 2ZDMA 2A4RA 1GWAA 2VH0A 3NKKA 2CHAB 4K8BA 3SI4H 4E7RG 2EC9H 1LVYA 2RCEA 1THSH 3P95A 1QTFA 2BVXH 1BA8B 1GBIA 3GDSA 3KEEA 1HAGE 3PMAB 4JZIA 4BTIB 1AMHA 1UCYK 1L1NA 3RMMH 4TYDA 1GHBG 3E1XB 4IN2A 2TIOA 3EAJA 1QB6A 4OGYA 1HAXB 2BTCE 1PQ8A 1QHRB 1G36A 1P2QA 1Q31A 2ZDKA 1NESE 4DG4A 1V2JT 2A4GA 1O2YA 1C5ZB 1O5EH 1TALA 3BTHE 1ARCA 1C2JA 2QY0B 1VCPA 2FZZA 1RXPA 1QJ6B 2QA9E 1CGJE 1MKXK 1TNKA 1S85A 2BLVA 1C1UH 2XCNA 3U8TH 2EI7A 3GCHC 3U1IB 5EOKA 3L6PA 1C5WB 2ZPSA 3SORA 3PWBA 3KL6A 1O30A 4Q7XA 2ZF0H 3ATKA 1S82A 1GBBA 4I8HA 1OP0A 1C4U2 5AF9H 1EB1H 5EQSA 1MMJN 1DPOA 1T31A 4E05H 1H4WA 3BV9B 2J92A 1W2KH 1UTPA 2M5TA 2ESTE 3GYLB 3T25A 3MWIU 1V2LT 1FIZA 2ZHDA 2A5KA 3QK1A 4INHA 3E0NB 5C67A 2PGQB 4TPYA 2Z9GA 1MQ5A 2Z3CA 1SL3A 2OC0A 1NO9H 3M5MA 1HGTH 3SU2A 3A8BA 2V3OH 1F5RA 1GBMA 1LPGB 4AOQA 3BG4B 3QGJA 1JRSA 1JRTA 4Y8ZA 1Z1IA 4BAKB 3M3SA 4A92A 3BG8A 1MU6B 1C5TA 1LQEA 1C2GA 3PWCA 1C2FA 5L6NH 1O2JA 1BB0B 1OSSA 2OP9A 4AGKA 1TABE 4GUXA 3RXGA 2G00A 4Y11E 2FEQH 2Z3DA 4NSVA 4YT7H 4ABJA 1P2OA 1T8OA 3PB1E 3KIDU 2BQWB 1EAXA 4ZXYH 3A85A 1BRUP 5A8ZA 2PKAB 1WSSH 2CF8H 3A87A 4X8VH 3ZYDA 4Z6AH 1KSNA 4A5TS 2ZFSA 5A2MH 4GVUA 1SQOA 1FY1A 1S84A 1O3JA 1TX7A 8GCHG 2NU2E 2FP7B 1GHBF 6GCHF 1P12E 5FXLA 4Y6DA 1A3BH 1C1WH 1XX9A 2R2WU 1C5SA 1TNIA 3PO1B 2TRMA 1MKWK 1D4PB 4J2YB 3GDUA 1K1JA 3A7XA 1P2MA 4TWWA 3VFEA 1KXDA 1DANH 1NFWA 1O3DA 2EEKA 1SQTA 1WV7H 1V2UT 1J17T 2P3UB 1C5QA 2OXSA 2QCYA 2ZZUH 3GCTG 4AFUA 1UVOA 2CN0H 1HAPH 1V2WT 2Z9LA 1DWEH 3RM2H 4TWYA 4I8GA 1S81A 3DT0H 5ESTE 4THNH 4WXIA 1DLKB 4BOHA 2TBSA 3VB7A 2FOMB 1A1RA 2V35A 1XXDA 2P3TB 1O3IA 1HAYB 1XUIA 2C90B 2ZTYA 4NCYA 4JK6A 3ODFA 2GTBA 2D8WA 1IQHA 1O2RA 3H7TA 3M7TA 3QGNB 1GDNA 1O3AA 1JMOH 2Q6FA 1T4UH 4D7GA 2ZA5A 4VGCB 2ZIQH 1G37A 1AVGH 1YBWA 3VXFH 3UIRA 4FVBA 4YM9A 1HYLA 2WPJS 1O3MA 2XC4A 4NWLA 1MD8A 3FP8E 5EPYA 1AO5A 3M37A 2H2ZA 2H9HA 3RXMA 1OP2A 2SFAA 3PMHB 4K69A 4UFGH 3UWJH 3LGWA 1GJBB 4MPUA 1BITA 1GPZA 5LPEA 1UVSH 3QLPH 5T6FA 1TQ7B 2GMTC 1UO6A 4XBBA 2VIQA 1EAUA 1GMCG 1XUJA 1WUNH 3AAVA 1FN6A 3DA9B 5TJXA 3L3TA 4QT8C 4ABHA 5A09A 4CRCA 1ACBE 3MNXA 4ZHLU 4B73A 3RXUA 1OXGA 2ZCHP 5GXPA 1TMTH 1ZR0A 1EZXC 2C8ZB 2R9PA 4ZAEA 1EJMA 2BDGA 2ZQ2A 1GHAF 4ABDA 3SBKA 4NIWA 2P95A 3MU5A 2EI8A 3DUXH 2OTVA 3EGKH 3ZZ3A 4ABIA 2BQ6B 2FS8A 1GBFA 1J15A 2FOBA 7GCHF 3A8CA 3GCTF 3BTTE 4X6PA 1QY6A 1RFNA 3GY4A 4D76A 5F6MA 4X2YA 1D3QB 1ZJKA 4INKA 1P10A 3TGJE 1GVZA 4Y0YE 2R0LA 3SJOA 4K1SA 3RXHA 1UCYH 3F9HA 5A8XA 1C5MD 2GV7A 3RXLA 1HIAA 5E0GA 1EZQA 1KLTA 4O3UA 1GJ7B 2VJ1A 3MFJA 4WF8A 1QBNA 2TPIZ 1BT7A 4B76A 1GHXH 4A1XA 4WJG2 1BTZA 1LVBA 1SLVB 1QQUA 3MH5A 3RXAA 2GT7A 1ZSLA 1ZOMA 1L1GA 2UWPA 1G2MA 2Y5FA 3ZV9A 8KME2 1SPJA 3LC5A 2PW8H 1CBWB 2YNAA 1G32B 3M36A 1ELCA 1FY4A 1TLDA 2GV6A 1S5SA 2P59A 3VXEH 1THRH 5I25A 2OUAA 1LPKB 4BXWA 1O35A 5H4IB 4FUHA 4DOQA 1NTPA 1ESBA 1NN6A 4JCNA 3LONA 2HGTH 4GLYA 1W7GH 5DK1A 1TGNA 1UHBA 1XM1A 1RIWC 1TRYA 1UVTH 3RXJA 3SNDA 4A1TA 2CHAC 3W95A 3ZYEA 1DWDH 2OCVB 3LU9B 4PROA 1J9CH 1L1JA 5TCCA 3LH3A 1BRBE 1O34A 1Y8TA 1O37A 3RXKA 2BLOA 1BCUH 2ZTZA 3ITIA 1O3FA 1GI7B 2STBE 1WCZA 4GAWA 4RKOB 1O31A 1G3BA 4IC5A 2Z9KA 2XBVA 1ESTA 1KXAA 1TRNA 1LVOA 1N8OC 1TNLA 3TNSA 2AGEX 1C4V2 3PYHA 3ZZ4A 2OC7A 1QJ1B 7ESTE 1GI8B 1TB6H 2C4FH 1V2NT 4Y8XA 1GJ8B 5LPFA 5GCHF 4TY7A 2BD9A 1K1NA 1E36B 2BD7A 2OC8A 2ZCKP 3RC6A 3EA7A 3SU1A 4ZHAA 4JYVH 1C5UA 2PGBB 1AFQB 1LHGH 4KTCA 3T29A 1DITH 2BZ6H 4IMZA 1DE7H 4Y76A 3D62A 6ESTA 2F9NA 3SV9A 4DVAU 1ORFA 2AMDA 1GHWH 4I33A 3T27A 2UWLA 3TJUA 3VPKA 2VWNA 2ZU5A 2FS9A 5EXMA 1N6YA 1EQ9A 1EZUC 3QWCH 5DPAA 1C5PA 1MKWH 2Z9JA 1WYKA 4F49A 1O2LA 1YPLH 2FPZA 4INLA 4R0IA 1AB9B 2BX4A 1C2HA 2ZFFH 3A7YA 4NIYA 2GT8A 1HJ9A 4O3TA 3T28A 1EOLA 3KQBA 4H42U 1CU1A 3SUEA 3BG4C 5FPSA 4X2VA 3GYMA 4JYTA 2ZU1A 3ZZCA 1YLDA 4ISIH 5DP6A 3SJ8A 1SHHB 3NWUA 4KKDA 1IQEA 2BDIA 4GPGA 1GBDA 1THPB 4LZ4B 2ZG0H 5A8YA 1QB9A 2R3YA 1FY8E 1ZHMA 1EAWA 1TGTA 2HVXA 3OY5U 1SOZA 1ID5H 2FYRA 1EJAA 3BTME 3UQOA 1ETRH 1ZPCA 1H1BA 4TY6A 1F0RA 1JIMA 2A4QA 1MAXA 2BY8X 1LPZB 2HOBA 1TNHA 4AYVB 1AQ7A 1TMBH 5DG6A 2OBOA 1V2RT 1AKSA 4U01A 1O3GA 1KDQA 2JH5D 3NXPA 1O3NA 1VITH 2PHBA 2Y7XA 1A0LA 4B75A 3URDA 3KCGH 3K65B 4CR9A 4AORA 2GCTB 1E37B 1ABIH 1K1LA 2GP9B 2TGAA 4FU8A 1CT4E 1P03A 4ESTE 3LDXH 1UJ1A 3GY5A 2JETB 3D65E 4CBNA 5K0HA 3A83A 1ZTKA 4I8JA 1TA6A 1OWHA 3B23B 2O8WA 4XBCA 2BM2A 2DE8A 1DWBH 3OYPA 1BTYA 3GY6A 3Q76A 1HAZB 2JH0D 1GCTB 1HV7A 1IHSH 1O2VA 2NU1E 2OINA 2ZKSA 1C1PA 2FESH 3S7HB 3RLWH 3A7VA 1AVXA 1AVWA 5T6DA 1FXYA 1CGHA 3V12A 3SUFA 3UY9A 1XUHA 1PPEE 3M3VA 4FU9A 4OS7A 2BY5X 1SGEE 5GDSH 3UNSA 3ATIA 4NWKA 1O2KA 4CHAB 1MCTA 1T4VH 4UE7H 4WXVA 3A86A 2FTMA 4IS5A 1FY3A 1A5HA 3A89A 4VGCC 3CP7A 1HAHH 3SJIA 2AIQA 1KLIH 2WPIS 3U98H 5AVDA 2BD4A 2FOFA 1IHTH 3TJNA 2V3HH 2HNTE 4XBDA 1S0QA 2VWMA 1QRWA 1P09A 1UK2A 1B5GH 1P11E 1VITG 2BD8A 1HJAB 3Q77A 1K28D 2QGRA 1PPHE 1D6RA 1XKAC 1UVUH 1A46H 1G30B 1QBVH 2XBXA 4XDEA 3MU0A 2LPRA 1ZTJA 2OC1A 4ISOA 3K9XB 1HAOH 2SGEE 2ANMH 2W5EA 1GI4A 5F8TA 2WUBA 1AN1E 4Y0ZE 1YC0A 1JIRA 4RN6A 1GI0A 1OPHB 2BDHA 2UUKB 2ZEBA 5L2ZH 4CH2B 1ZPBA 2P16A 1PPGE 3W94A 1BBRK 1BJUA 1TRMA 1AWFH 4AFSA 4MLFB 1IQLA 2NU3E 1Z6EA 2DE9A 3VB4A 1DICA 4NA8A 5DP5A 5K7RA 5C1UA 3GCOA 4B2BA 2VIOA 1ABJH 3SN8A 3MO9A 4DY7B 1GJCB 2F9PA 3AASA 4X6MA 4IN1A 1MZDA 3EE0B 4JZFH 1HAVB 1Z8JB 2O8LA 3ZZ5A 1UTMA 1IQIA 1C2DA 3U8OH 4FUEA 1PPBH 3ZZBA 1GBJA 4GCHG 2SGDE 3KQEA 4AG1A 4OS5A 1GGDB 1NFUA 4CRAA 1EOJA 5EU8A 1O5AB 2XCFA 3BTGE 3SGBE 2C8YB 1G3EA 3LH1A 3O8BA 1SLXB 2A45B 1Z7KA 2EA3A 4UONA 4B71A 3JZ2B 4BNRA 2RA0A 1V2KT 2VGCB 1PPCE 3MO6A 1E35B 3RU4D 1FN8A 2BOHB 1INCA 1MH0A 3GY2A 3SQHE 2XWBI 4NZQA 5A0AE 3TK6A 1VITF 3GICB 3PLBA 4I32A 3SU4A 5CHAB 1GDQA 3A84A 1K22H 1AE8H 3SO3A 3TGKE 2F83A 1SGIB 3U9AH 2CGAA 4D9QA 4KTUA 1O39A 3PLPA 2HLCA 2XXLA 3RXFA 4MPVA 1V2TT 1NFXA 1YF4A 2GZ9A 1ZPZA 1TAWA 4MNYA 4MVNA 1NU9A 3BIUH 4DW2U 1O5CB 1NS3A 1YM0A 2A5IA 1TGBA 2XTTB 3AAUA 1YLCA 1NRSH 2Y80A 1TOCB 4UD9H 1GJ6A 5EXLA 3FP6E 1MBMA 2ZCLP 1SFIA 1P3EA 1QL7A 3NPSA 2P3FH 2YOLA 3U1JB 1FMGA 1SSXA 1ANDA 4IBLH 3SV7A 3TPIZ 3TH3H 4BAHB 1ZMJA 1P8VC 1ANCA 5JPMH 1VZQH 1CA0C 4YO9A 3TLOA 3A8DA 1LKAA 1O0DH 1EAIA 1AD8H 1O5DH 4Q7YA 1F0TA 4GHTA 3C1KA 9ESTA 1SG8B 1ANEA 1RTLA 1GI9B 1CSOE 3LJJA 1YPMH 1A0JA 2W26A 1SGYE 2XBWA 1G9IE 3BEUA 4GCHF 1MTNC 1AFQC 5E0JA 3RLYH 1LHCH 2A5AA 2GCHG 2ZNKH 2BZAA 4CRFA 4NG9H 5A0BA 3LGYA 5JBCS 4ZXXH 3PTNA 1GG6B 1OYQA 1FONA 4BAMB 4YLUA 1GJDB 1ZGIA 1FPCH 1CGIE 1P2JA 4X6OA 7KMEH 3CENA 3ZVGA 1RGQA 1AB9C 2TGTA 1NM6A 4OS4A 1UCYE 2R3UA 4WY3A 4AN7A 2WPLS 1MCVA 1SGDE 2P8OC 1X7AC 2ANYA 3RDZA 3S9CA 1V2MT 4HTCH 1H9LB 2VNTA 6CHAB 1GL1A 2BB4A 3SNAA 3BTKE 1SGFA 1LHDH 3Q00A 2HPPH 1IQMA 1J14A 1M9UA 1W8BH 5I46H 3M35A 1AE5A 3A82A 2AGGX 1FJSA 4YOJA 1GHZA 4AGJA 1LDTT 5GIBA 3Q3XA 1XUKA 1D3DB 2B7DH 3S69A 4ZKOU 1MQ6A 1UTOA 1KIGH 4TPIZ 2FMJA 3MH7A 1C5RA 1SGQE 4A7IB 5EGMA 3TH2H 3N7OA 2UWOA 2P94A 4KELA 1ESAA 1GMHG 2BVRH 4JZDH 3LGUA 1C5OH 2CV3A 4FVDA 1KYNA 3RC4A 1K21H 1UVPA 3M7QA 1BIOA 1TBRH 1GBEA 1ANBA 1A7SA 2J4IA 4KP0A 3LC3A 8GCHF 2WPHS 1AGJA 1C1MA 2ZGHA 4YLQH 1GI3A 3D49H 4XOJA 2HNTF 2GZ8A 1ZSKA 1Q3XA 3OY6U 3TGIE 2FWWA 3SJ9A 1YGCH 4J1YA 2FOCA 1WOFA 1FAXA 1OS8A 1TGSZ 1IAUA 3O8RA 1A2CH 4B74A 3QZQA 2Z3EA 3M5NA 4DURA 2QYIA 4K1TA 2GDDA 4ZUHA 5L2YH 1ARBA 3PMJA 1GI6A 1BQYA 2BD5A 1EATA 1AZZA 1BTPA 3HGNA 5F03A 5FAHA 5BPEA 3ESTA 1CA8B 4WH8A 3ELAH 2D1JA 1O2UA 1QJ7B 2AMQA 4XSKU 3URCA 4CHAC 2BD3A 1BDAA 3VGCC 4NA9H 2ANWA 1C1TA 2HALA 2HPQH 2ZGXH 3BSQA 2EI6A 1P3CA 4I7YH 1BRCE 1PQ7A 1HBTH 1TQ0B 1PJPA 2G55A 5JDUB 1C5YB 1C5XB 1AZ8A 3SQEE 5EQQA 5FX6A 1HJAC 1GMDG 2RA3A 3KHVA 1UTJA 2XC0A 2Z6BD 1MKXH 1QFKH 4MTBA 4AB9A 1QRZA 2SGAA 1SVPA 3STJA 3PMBB 2GZ7A 1Z8RA 4X6NA 6LPRA 1TIOA 3UPEA 1YPKH 5DKMA 1P9SA 3NZIA 1EPTB 1Z8IB 2PUQH 1O33A 4WH6A 4X8TH 1DSUA 1UMAH 5HGGA 5DP4A 1GJ4H 9LPRA 3RM0H 2SNWA 1P02A 5C2ZA 3UR9A 1ZRBA 1DFPA 1OP8A 1YYY1 1BMLA 4LOYH 2ZQ1A 1GMCF 3IITA 3MHWU 1ZJDA 1OWEA 4RSPA 5HM9A 2A2XH 4O97A 5CMXH 1C9PA 2ALPA 2PTNA 3I77A 4KTSA 3MNBA 1O2HA 1XVOA 1EASA 5C5NA 1MAYA 1C5LH 4XFQA 1ZMNA 4FXGH 2Y82A 1T8MA 2C8WB 3MH6A 3RXRA 2H9EH 1TX6A 3HATH 5GJ4B 1ZSJA 3EDXB 1XKBC 1GVLA 4Y7BA 2ILNA 3ZVEA 2QXGA 1O32A 3VB5A 2PTCE 3TITA 1P2KA 4WWYA 5EW1H 1TA2A 3F1SB 1DXPA 3LGTA 3OSYA 2WUCA 1Z6JH 3GY3A 3MYWA 3UQVA 1GGDC 1WU1A 3QO6A 1F92A 2V6NA 2QF0A 4WMEA 2A31A 2WV4A 4K2YA 5GWZA 2VVCA 5FPYA 3UFAA 3UOUA 2H9TH 3RXIA 1B7XB 4E7NA 1IQJA 3S9BA 2A7HA 1T32A 3PROA 4NFFA 2BX3A 1FLEE 3V3MA 2I6QA 3MO3A 3G01A 1CT0E 3MOCA 1QL8A 2G8TA 1Z8GA 1DY9A 1C2LA 5FBIA 5EODA 3BTQE 3RXEA 1HUTH 2QF3A 3FZZA 4AYYB 1GMDF 1MD7A 3Q3YA 4MPXA 1SQAA 2ZU3A 1RTKA 3M61U 1BUIA 2Q1JA 1EXFA 2QXIA 3JZ1B 3MMGA 1HDTH 1QQ4A 1OWKA 2ODYB 3RXOA 2FOEA 3ODDA 1OWDA 4CR5A 2BXUH 1GHVH 4WMFA 3DD2H 2THFB 5LH8A 3KQCA 1AWHB 4K3JA 1SHYA 1TE0A 2BDYA 2ZFPH 4YT6H 2FOAA 2GD4B 4B2CA 4B1TA 1SOTA 2F91A 1O3BA 3C27B 4Y8YA 1ZHPA 2W7UA 1SGFG 4BANB 2G4TA 1KY9A 1FZZA 1O5BB 3QN7A 1HFDA 1FAKH 4D9RA 1KXCA 2BDBA 2VIPA 1K1IA 1VJ9U 2J94A 1C5VA 1G3CA 2ZFTA 2ZHEH 3SJKA 3TK9A 1GHYH 1O3CA 4R8TB 4ISHH 3FANA 4Y7AA 4E06H 3LIWA 1L4DA 2WV5A 4LK4A 1A4WH 2QXJA 2FDAA 4HI3A 2ULLA 3SHAH 3V0XA 3HK3B 1VGCB 2ZGJA 1XUFA 1O38A 2GX4A 1FNIA 5FX5A 7LPRA 4O9VA 3E8LA 1N6XA 3ZZ8A 4I31A 3UTUH 1IQNA 3PO1C 2AMPA 1HAIH 2W3KA 4GHQA 1BRAA 5SGAE 1C1QA 3P8OA 5LGOA 1RS0A 2O8TA 2ZI2H 3TJOA 1W3CA 1O3HA 2GMTB 1GG6C 2LNCA 1O2SA 4X1QU 3TK5A 1D3TB 1MTSA 1NU7B 3UNRA 4D7FA 1BTXA 1W13U 1NRQH 4MNXA 3LGIA 1W11U 1BMNH 1ELAA 1VR1H 5GPIB 1EUFA 2G5NA 3E6PH 5T3HA 1L2EA 1ELTA 1N1LA 3HK6B 3H7OA 2PV9B 4IW4E 4UFFH 1LHFH 4ABGA 3RXSA 4NGAH 1BJVA 1P57B 1QBOA 4YTAA 4K5ZA 2FTLE 1Y59T 3GY7A 1O2OA 2O8MA 4Q7ZA 2ZGBH 2BOKA 3RMLH 4ZROA 1W0YH 1ETTH 1KLJH 1O2ZA 3BIVH 2RG3A 1E34B 2BVSH 2Z9IA 1V2ST 3M7UA 4X1NU 5C20A 1GBCA 1HAVA 3ZVCA 1TONA 2PR3A 3RXDA 1VJAU 4ZKNU 2HRVA 2ZU2A 5E2PA 1O2PA 2FX4A 1NZQH 4MNVA 4Y71A 2OQUA 3RXPA 3HPTB 3P8GA 2Y5HA 4X1SU 2ZDLA 3U69H 4M7GA 1S6FA 1NY22 5FCRA 1XMNB 1O2GH 1C2EA 1WQVH 1P9UA 4JZEH 5CE1A 5ESBA 1DSTA 1YCPK 1HRTH 5FCKA 2C3SA 2FLRH 1L0ZA 4ZHMU 4BTUB 1O2IA 2BQ7B 1ELGA 1TPPA 1BOQA 1IQFA 3RXQA 1C9TA 4X8UH 1ZYOA 1QA0A 1YPHE 1DVAH 4X1RU 2VIDA 4AFQA 2FXRA 1BMAA 1EJNA 3ENSB 4MG3A 2B9LA 4DJZB 1WAYB 1BMMH 1C1OA 3BEFB 3RXVA 2KAIB 1LHEH 5JBBS 3F9EA 1AU8A 1GBAA 1DOJA 3RXBA 3GCNA 1GBKA 1V6DA 2AH4X 1TMUH 1EP5A 3E91A 1RIWB 4WVPE 1F5LA 1C1RA 4AZ2B 1P04A 2XW9A 1AY6H 2JH6D 3HKIB 2ZPQA 1SI5H 2R0KA 3GDVA 1MUEB 3E0PB 3TIUA 5L30H 1QIXB 1SGCA 1YP9A 1FI8A 1QGFA 2A0QB 5F8XA 1LTOA 6GCHG 2CJIA 2DUCA 3RC5A 2NU0E 5IDKA 2PKAA 3P92A 1MZAA 1DS2E 5ABWA 1NPMA 3TVJB 4DIIH 1TPSA 3WY8A 3QUMP 1N8OB 3T26A 3V13A 3FFGA 1DY8A 1NFYA 1UTQA 4NFEA 1TNGA 3PTBA 5DP3A 1HB0B 1GDUA 1TX8A 1PFXC 1JXPA 1EP6A 3EA9A 3GY8A 3T5FH 2G52A 2ZTXA 3S7KB 1CBWC 2OD3B 1TPOA 1T8NA 1EPTC 2XBYA 4CRBA 1Y5UT 3FVFB 1W14U 2VVUA 1BZXE 3IG6B 4FUBA 4DT7B 1CHGA 2XWAA 1IQKA 2WYJA 2BHGA 1TBZH 1P01A 1C2MA 3ZVDA 1TNJA 3S9AA 3SV6A 2SGQE 1IOEA 1PPFE 1F0SA 2J34A 2STAE 4FU7A 4YOGA 3HKJB 3M5OA 3P8NA 2QAAA 2B8OH 3F68H 1QCPA 3BEIB 3HGPA 4OS6A 2CF9H 1FQ3A 3R3GB 1OWIA 1TOMH 1UTKA 1Y5AT 3B8JA 3SNBA 3A7WA 1FDPA 4AG2A 2FIRH 1HLTH 5E8EH 2XYAA 3TH4H 2Q6GA 2Q6DA 3ZVAA 2SGPE 1ZZZA 1C1NA 4ZKSU 3SV2H 3UUZA 8ESTE 4X1PU 3DFLA 2BY6X 2Z94A 1HXFH 4BAQB 1SGNE 1KTSB 1W0ZU 2ODPA 2AFQB 2F9UA 3NK8A 1IQGA 1PQAA 4Q2KA 3RXTA 1DXWA 5TCAA 1C1VH 2QV1A 1W7XH 4ASHA 1SC8U 1BTUA 3ZZDA 2FYQA 2H5CA 1WBGB 2G4UA 1H9IE 4ABEA 4U2WA 1DWCH 1C5NH 1EKBB 5JBTA 4F4OC 2AYWA 1PYTD 3E16B 1O2NA 2I6SA 2YNBA 1HNEE 3MI4A 1HXEH 4SGAE 2BMGB 5E2OA 5C5OA 2VWLA 1V2PT 1K2I1 2PKSB 1UK3A 1BBRE 2QXHA 2WPKS 3K6YA 5FBEA 3UREA 3BTWE 1CO7E 1ELDE 4HGCA 4JYUH 1GHAG 2UUFB 5C1YA 4OGXA 3P6ZB 1EZSC 1KTTB 2AS9A 1HJ8A 4FUFA 1O2TA 4Z0KA 3A7TA 1DX5M 1HPGA 1SR5C 1UK4A 2HWLB 1LKBA 5BRRE 3TJVA 2BYAX 3TNTA 3ZVFA 5JBAS 4CREA 3NUMA 7GCHG 1A0HB 2CMYA 2FLBH 3ZV8A 4GSOA 2ZFRH 2R2MB 4JMYA 4CH8B 3NCLA 3I29A 5HXFA 1DUEA 3EA8A 1O2WA 4DIHH 4JK5A 1O2QA 2G51A 1BTHH 1BHXF 2ZHWH 3RMOH 2TGDA 2ODQA 2G81E 3BTEE 4ABAA 1RTFB 3OX7U 3ZVBA 5FPTA 3T62A 1K1OA 1TGCA 4FUDA 1TPAE 2VIVA 2ZP0H 1SBWA 1KXFA 4IGDA 3RP2A 1L4ZA 1GCDA 1K1MA 3A8AA 3OTJE 5DO4H 5EW2H 5C1XA 1VGCC 3MU1A 1C4Y2 1J8AA 2GCTC 2FI4E 4FUJA 3Q3KA 3QDZB 3M3TA 1SLUB 1ZRKA 2BD2A 2FI5E 3ATWA 3QX5H 4U30A 2OBQA 1P2NA 2JETC 1O3KA 2WPMS 1QURH 5DGJA 3KF2A 1DUAA 1EPTA 4NA7A 1YCPH 4H4FA 1C2IA 4IC6A 1ZGVA 4CRGA 1GCTC 4Y79A 3SU6A 2GCHF 2ZU4A 1E38B 1YPEH 5T6GA 4K60A 1BBRH 2AERH 1DDJA 1NT1A 1LCYA 4BTTB 1F0UA 2ZHQH 4ZKRU 2BLWA 3ZZ6A 2TGPZ 3UOPA 1JOUB 3RXCA 3U8RH 4MDSA 1Y3YA 4ISLA 1AHTH 4OS1A 3VEQB 3UWIA 4ABFA 2SNVA 3DFJA 1AUJA 1ZLRA 3BF6H 3IWMA 1D9IA 3BTFE 2PWXA 1SB1H 1V3XA 2AEIH 2ZO3H 1XUGA 3LKWA 4UFEH 1SGPE 1GI1A 1E0FD 1Y3XA 1AIXH 2GKVE 3BN9A 1BTWA 4ZH8A 1XXFA 2FM2A 5G4BA 5GCHG 1KXEA 2BLQA 3SOSA 1XVMA 3SGQE 3EQ0H 4NIXA 5A0CA 3SNEA 4KGAA 1PYTC 1V2VT 3FAOA 2HNTC 1LVMA 1MU8B 2IPHA 1ELFA 3GOVB 2ZHFH 3S0NA 3GCHB 1PPZA 1CE5A 3O8CA 2VU8E 1TBQH 2O9QA 3A7ZA 1VCWA 1H8IH 5LPRA 5EG4A 5B6OA 3A88A 2Y7ZA 2A7JA 3STIA 3VB3A 3UR6A 4X8SH 1GJ9B 2H1UA 3MNSA 4FUIA 5AFZH 1A3EH 1OOKB 2ZWLH 1GMHF 2GDEH 2W3IA 5ETXA 1D3PB 1SGTA 4OS2A 2BDAA 1T8LA 2PUXB 2IN2A 4Q80A 4BXSA 1RD3B 3QZRA 4YZUA 3KNXA 1QL9A 2UUJB 1CHOG 1MTWA 1QB1A 1NROH 2A7CA 2QN5T 1F7ZA 5HYOA 5HM2A 1O3PB 1FUJA 2PLXA 3CS0A 2WINI 2G5VA 4HFPB 1D6WA 5HMAA 1O2XA 4CBOA 5EPNA 1YPHC 2C93B 2C8XB 2K1QA 5DJ7A 1UTNA 1T7CA 1O3OA 2A2QH 1B0FA 3T2NA 3DHKH 3F9GA 5JB8S 3VB6A 4A6LA 3LOXA 3ZZAA 2FI3E 1AUTC 2A1DB 1F2SE 4A1VA 1G2LA 4K1EA 1WTHD 1Y5BT 1EB2A 1SFQB 2ZC9H 3M5LA 2ANKH 1ETSH 1O3LA 3MNCA 1GBTA 1HIAB 3SHCH 5F8ZA 2H5DA 2CXVA 3OU0A 1MTVA 3GISB 1P06A 2SGFE 5IYTA 3B9FH 4I8LA 1CA0B 2ZDAH 2FX6A 2FOGA 3I78A 2VGCC 4K8YA 1AI8H 3QTVH 4ABBA 4H6SB 2B5TB 1YPJH 3QTOH 4AX9H 1SGRE 3RUOA 4Y10E 1GJAB 4O03A 3K6ZA 4IMQA 2J38A 1Y3VA 5EQRA 2FODA 3P70B 4MNWA 4X2WA 1MTUA 5CHAC 2RDLA 5PTPA 1MTNB 3H5CB 4ISNA 2F3CE 1FPHH 3AW0A 2V0BA 5JYIA 1CVWH 4UEHH 2ZGCA 1LMWB 4LXBH 4MQAA 1GL0E 1GI2A 1KXBA 3PM3A 4YOIA 1O5FH 3SUDA 1TYNA 2B0FA 3SV8A 2BDCA 1YPGH 2PSXA 1MBQA 1TFXA 1Y3WA 3AW1A 2NU4E 1YKTA 1UHBB 2ZDVH 1DLEA 2VIWA 5C3NA 1FV9A 1H8DH 4X2XA 1NRNH 5EXNA 5J4QA 2F9OA 3ATLA 1HCGA 4SGBE 5DP9A 3ZZ9A 5DP8A 1EX3A 2VVVA 1V2OT 2H6MA 2P8OB 2QC2A 1JWTA 3CS7A 1ZHRA 3KGPA 5JB9S 1GBLA 3PV4A 1RJXB 1WTGH 3RMNH 2QIQA 1CHOF 4HZHA 4X0WU 2XNIA 1U6QA 4WMDA 3MU4A
chains in the Genus database with same CATH superfamily
2Y81A 3FZDA 4FUCA 1FIWA 1NBME 1P0SH 1ELEE 3PLKA 4DGJA 3LGVA 1A5IA 1OYTH 3MH4A 2OQ5A 5DP7A 3RU4E 1SMFE 1A61H 1RRKA 3F9FA 4NSYA 4I8KA 4YESB 3L33A 4BAOB 2W7SA 1LO6A 3A81A 5J4SA 2XRCA 2Z7FE 2P93A 4AFZA 2IJOB 2PFEA 5T1VA 2NWNA 1WQSA 2PKSC 2F9BH 3LJOA 2Y5GA 1O36A 2VINA 5AFYH 1A5GH 1O3EA 2WHXA 1O2MA 5HIYA 3E90B 1GJ5H 1P05A 3SI3H 3F6UH 4MPWA 1S0RA 2BY9X 1BHXB 3SW2B 4ZMAH 2A4OA 4XE4A 2ASUB 1P2IA 3SU3A 4Z1MD 3P17H 2PSYA 1YCPM 3SYJA 2ZECA 2Y6TA 1Z1JA 3LT3A 3MTYA 2F9VA 1GBHA 3AVZA 1H9HE 2GGVB 1CT2E 2IOTA 1J16A 2JIZD 3SUGA 6CHAC 4UDWH 2VB0A 3KN2A 4U32A 3SNCA 2JDID 1SLWB 3SZNA 4NZLA 2KAIA 2ZPRA 2FO9A 1JBUH 4D8NA 1W10U 1ELBA 1OKXA 3K2UA 1B0EA 5EJ1A 1QR3E 2J9NA 2ZFQH 4TT3D 8LPRA 2BY7X 1VCQA 4UFDH 2UUYA 1AFEH 3KQDA 2D26C 3FP7E 1ELVA 1W12U 3F3BA 1OWJA 1K9OE 2YMSB 2XC5A 1GI5A 2RFKC 4B2AA 3VGCB 1NC6A 3A80A 1CQQA 3SU5A 1G3DA 1NRRH 1V2QT 2VH6A 1S6HA 3ATMA 5FHTA 1AKSB 3D23A 1OX1A 1KDQB 4CRDA 2AIPA 1ZTLA 3TU7H 4HG6A 2J95A 3OAAD 4LZ1H 1UW7A 1K1PA 1QA7A 1QNJA 3E3TA 4RKJB 2ALVA 2AGIX 1S83A 1C1SA 1ZMLA 2WYGA 3EYDA 2GVFA 3O8DA 1WXRA 4NIVA 2FOHA 4JZ1A 5E0HA 5KEDA 2QE7D 1NRPH 1QRXA 3UNQA 1Z71A 2D2DA 5AHGH 1FY5A 2A32A 1TWXB 2VWOA 3RU4T 1GVKB 3P8FA 3SGAE 1Q2WA 5KGOA 1F5KU 3SU0A 2BXTH 2O8UA 1C2KA 2JKHA 4DCDA 3BTDE 3ZZ7A 1O5GH 1LQDB 3MU8A 5HKKD 1DM4B 4H6TA 2ZDNA 3LPRA 3OTPA 1Y3UA 4AB8A 1UTLM 1DT2A 2OLGA 5IK2D 3V7TA 1PQ5A 3R0FA 4FUGA 1COWD 2J2UA 2ZDMA 2A4RA 1GWAA 2VH0A 3NKKA 2CHAB 4K8BA 3SI4H 2J5UA 4E7RG 2EC9H 1LVYA 2RCEA 1THSH 3P95A 1QTFA 2BVXH 1BA8B 1GBIA 3GDSA 3KEEA 1HAGE 3PMAB 4JZIA 4BTIB 1AMHA 1UCYK 5C94A 1L1NA 3RMMH 4TYDA 1GHBG 3E1XB 4IN2A 2TIOA 3EAJA 1QB6A 4OGYA 1HAXB 2BTCE 1PQ8A 1QHRB 1G36A 1P2QA 1Q31A 2ZDKA 1NESE 4DG4A 1V2JT 2A4GA 2L6OA 1O2YA 1C5ZB 1O5EH 1TALA 3BTHE 1ARCA 2J98A 1C2JA 2QY0B 1VCPA 2FZZA 1RXPA 4XRNA 1QJ6B 2QA9E 1CGJE 1MKXK 1TNKA 1S85A 2BLVA 2W6JD 2EY4C 1C1UH 2WV9A 2XCNA 3U8TH 2EI7A 3GCHC 3U1IB 5EOKA 3L6PA 1C5WB 2ZPSA 3SORA 3PWBA 3KL6A 5CHBA 1O30A 4Q7XA 2ZF0H 3ATKA 1S82A 1GBBA 4I8HA 1OP0A 2HLDD 1C4U2 5AF9H 1EB1H 5EQSA 1MMJN 1DPOA 1T31A 4E05H 2V3MA 1H4WA 3BV9B 2J92A 1W2KH 1UTPA 2M5TA 2ESTE 3GYLB 3T25A 3MWIU 1V2LT 2JJ2D 1FIZA 2ZHDA 2A5KA 3QK1A 4INHA 3E0NB 5C67A 2PGQB 2JJ1D 4TPYA 2Z9GA 1MQ5A 2Z3CA 1SL3A 2OC0A 1NO9H 3M5MA 1HGTH 3FKSD 3PRBA 3SU2A 3A8BA 2V3OH 1F5RA 1GBMA 1LPGB 4AOQA 3BG4B 5F53A 3QGJA 1JRSA 1JRTA 4Y8ZA 1Z1IA 4BAKB 3M3SA 4A92A 3BG8A 1MU6B 1C5TA 1LQEA 1C2GA 3PWCA 1C2FA 3F2HA 5L6NH 1O2JA 1BB0B 1OSSA 2OP9A 4AGKA 1TABE 4GUXA 3RXGA 2G00A 4Y11E 2FEQH 2Z3DA 4NSVA 1E79D 4DT4A 4YT7H 4ABJA 1P2OA 1T8OA 3PB1E 3KIDU 2BQWB 1EAXA 4ZXYH 1E1RD 3A85A 1BRUP 5A8ZA 2PKAB 1WSSH 2CF8H 3A87A 3SZEA 4X8VH 3ZYDA 4Z6AH 1KSNA 4A5TS 2ZFSA 5A2MH 4GVUA 1SQOA 2KZ4A 1FY1A 1S84A 1O3JA 1TX7A 8GCHG 2NU2E 2FP7B 1GHBF 6GCHF 1P12E 5FXLA 4Y6DA 1A3BH 1C1WH 1XX9A 2R2WU 1C5SA 1TNIA 4ASUD 3PO1B 2TRMA 1MKWK 1D4PB 4J2YB 3GDUA 3PV5A 1K1JA 3A7XA 1P2MA 4TWWA 3VFEA 1KXDA 1DANH 1NFWA 1O3DA 2EEKA 1SQTA 1WV7H 1V2UT 1J17T 2P3UB 1C5QA 2OXSA 2QCYA 2ZZUH 3GCTG 4AFUA 1UVOA 2CN0H 1HAPH 1V2WT 2Z9LA 1DWEH 3RM2H 4TWYA 4B6FA 4I8GA 1S81A 3DT0H 5ESTE 4THNH 4WXIA 1DLKB 4BOHA 2TBSA 3VB7A 2FOMB 1A1RA 2V35A 1XXDA 2P3TB 1O3IA 1HAYB 1XUIA 2C90B 2ZTYA 4NCYA 4JK6A 3ODFA 2GTBA 2D8WA 1IQHA 1O2RA 3H7TA 3M7TA 3QGNB 1GDNA 1O3AA 1JMOH 2Q6FA 1T4UH 3OFND 4D7GA 2ZA5A 4VGCB 2ZIQH 1G37A 1AVGH 1YBWA 3VXFH 3UIRA 4FVBA 4YM9A 1HYLA 2WPJS 1O3MA 2XC4A 4NWLA 1MD8A 3FP8E 5EPYA 1AO5A 3M37A 3N7DA 2H2ZA 2H9HA 3RXMA 1OP2A 2SFAA 3PMHB 4K69A 4UFGH 5DN6D 3UWJH 3LGWA 1GJBB 4MPUA 1BITA 1GPZA 5LPEA 1UVSH 3QLPH 5T6FA 1TQ7B 2GMTC 1UO6A 4P02A 4XBBA 2VIQA 1EAUA 1GMCG 1XUJA 1WUNH 3AAVA 1FN6A 3DA9B 5TJXA 3L3TA 4QT8C 4ABHA 5A09A 4CRCA 1ACBE 3MNXA 4ZHLU 4B73A 3RXUA 1OXGA 2ZCHP 3DSGA 5GXPA 1TMTH 1ZR0A 1EZXC 2C8ZB 2R9PA 4ZAEA 1EJMA 2BDGA 2ZQ2A 1GHAF 4ABDA 3SBKA 4NIWA 2P95A 3MU5A 2EI8A 3DUXH 2OTVA 3EGKH 3ZZ3A 4ABIA 2BQ6B 4M9FA 2FS8A 1GBFA 1J15A 2FOBA 7GCHF 3A8CA 3GCTF 3BTTE 4X6PA 1QY6A 1RFNA 3GY4A 4D76A 5F6MA 5HIZA 4X2YA 1D3QB 1ZJKA 2QF5A 4INKA 5EJLA 1P10A 2M2AA 3TGJE 1GVZA 1K0HA 2WSSD 4Y0YE 2R0LA 3SJOA 4K1SA 3RXHA 1UCYH 3F9HA 5A8XA 1C5MD 2GV7A 3RXLA 3GS9A 1HIAA 5E0GA 1EZQA 1KLTA 4O3UA 1GJ7B 2VJ1A 3MFJA 4WF8A 2KM0A 1QBNA 2TPIZ 1BT7A 4B76A 1GHXH 4A1XA 4WJG2 1BTZA 1LVBA 1SLVB 1QQUA 3MH5A 3RXAA 2GT7A 1ZSLA 1ZOMA 1L1GA 2UWPA 1G2MA 2Y5FA 3ZV9A 8KME2 1SPJA 3LC5A 2PW8H 1BMFD 1CBWB 2YNAA 1G32B 3M36A 4FOUC 1ELCA 1FY4A 1TLDA 2GV6A 1S5SA 2P59A 3VXEH 1THRH 5I25A 2K0QA 2OUAA 1LPKB 4BXWA 1O35A 5H4IB 4FUHA 4DOQA 1NTPA 1ESBA 1NN6A 4JCNA 3LONA 2HGTH 4GLYA 1W7GH 5DK1A 1TGNA 1UHBA 1XM1A 1RIWC 1TRYA 1UVTH 3RXJA 5EJZA 1SKYE 3SNDA 4A1TA 2CHAC 3W95A 3ZYEA 1DWDH 2OCVB 3LU9B 4PROA 1J9CH 1L1JA 5TCCA 3LH3A 1BRBE 1O34A 1Y8TA 1O37A 4RT1A 2BLOA 3RXKA 1BCUH 2ZTZA 3ITIA 1O3FA 1GI7B 2STBE 1WCZA 3DSOA 4GAWA 4RKOB 1O31A 1G3BA 4IC5A 2Z9KA 2XBVA 1ESTA 1KXAA 1TRNA 1LVOA 1N8OC 1TNLA 3TNSA 2AGEX 1C4V2 3PYHA 3ZZ4A 2OC7A 1QJ1B 7ESTE 1GI8B 1TB6H 2C4FH 1V2NT 3H09A 4Y8XA 1GJ8B 5LPFA 5GCHF 4TY7A 2BD9A 1K1NA 1E36B 2BD7A 2OC8A 2ZCKP 3RC6A 3EA7A 3SU1A 4ZHAA 4JYVH 2RDEA 1C5UA 2PGBB 1AFQB 1LHGH 4KTCA 3T29A 1DITH 2BZ6H 4IMZA 1DE7H 4Y76A 3D62A 3UAIC 6ESTA 2F9NA 3SV9A 4DVAU 1ORFA 2AMDA 1GHWH 4I33A 3T27A 2UWLA 3TJUA 3VPKA 2VWNA 2ZU5A 2FS9A 5EXMA 1N6YA 1EQ9A 1EZUC 3QWCH 5DPAA 1C5PA 1MKWH 2Z9JA 2F43B 1WYKA 4F49A 1O2LA 1YPLH 2FPZA 4INLA 4R0IA 1AB9B 2BX4A 1C2HA 2ZFFH 3A7YA 4NIYA 2GT8A 1HJ9A 4O3TA 3T28A 1EOLA 3KQBA 4H42U 1CU1A 3SUEA 3BG4C 5FPSA 3N7EA 4X2VA 3GYMA 4JYTA 2ZU1A 3ZZCA 1YLDA 4ISIH 5DP6A 3SJ8A 1SHHB 3NWUA 4KKDA 1IQEA 2BDIA 2VBCA 4GPGA 1GBDA 1THPB 4LZ4B 2ZG0H 5A8YA 1QB9A 2R3YA 1FY8E 1ZHMA 1EAWA 1TGTA 2HVXA 3OY5U 1SOZA 1ID5H 2FYRA 1EJAA 3BTME 3UQOA 1ETRH 1ZPCA 1H1BA 4TY6A 1F0RA 1JIMA 2A4QA 1MAXA 2BY8X 1LPZB 2HOBA 1TNHA 4AYVB 1AQ7A 1TMBH 5DG6A 2OBOA 1V2RT 1AKSA 4U01A 1O3GA 1KDQA 2JH5D 3NXPA 1O3NA 1VITH 2PHBA 2Y7XA 1A0LA 4B75A 1W0KD 3URDA 3KCGH 3K65B 4CR9A 4AORA 2GCTB 1E37B 1ABIH 1K1LA 2GP9B 2TGAA 4FU8A 1CT4E 1P03A 4ESTE 3LDXH 1UJ1A 4P00A 3GY5A 2JETB 3D65E 4CBNA 5K0HA 3A83A 1ZTKA 4I8JA 1TA6A 1OWHA 1H8HD 3B23B 2O8WA 4XBCA 2BM2A 2DE8A 1DWBH 3OYPA 1BTYA 3GY6A 3Q76A 1HAZB 2JH0D 1GCTB 1HV7A 1IHSH 1O2VA 2NU1E 2OINA 2ZKSA 1C1PA 2FESH 3S7HB 3RLWH 3A7VA 1AVXA 1AVWA 5T6DA 1FXYA 1CGHA 3V12A 3SUFA 3UY9A 1XUHA 1PPEE 2XNDD 3M3VA 4FU9A 4OS7A 2BY5X 1SGEE 5GDSH 3UNSA 3ATIA 4NWKA 1O2KA 4CHAB 1MCTA 1T4VH 4UE7H 4WXVA 3A86A 2FTMA 4IS5A 1FY3A 1A5HA 3A89A 4VGCC 3CP7A 2WZQA 1HAHH 3SJIA 2AIQA 1KLIH 2WPIS 3U98H 3FO8D 5AVDA 2BD4A 2FOFA 1IHTH 3TJNA 2V3HH 2HNTE 4XBDA 1S0QA 2VWMA 1QRWA 1P09A 1UK2A 1B5GH 1P11E 1VITG 2BD8A 1HJAB 3Q77A 1K28D 2QGRA 1PPHE 1D6RA 1XKAC 1UVUH 1A46H 1G30B 1QBVH 2XBXA 3EE7A 4XDEA 3MU0A 2LPRA 1ZTJA 2OC1A 4ISOA 3K9XB 1HAOH 2SGEE 2ANMH 2W5EA 1GI4A 5F8TA 2WUBA 1AN1E 4Y0ZE 1YC0A 1JIRA 4RN6A 1GI0A 1OPHB 2BDHA 2UUKB 2ZEBA 5L2ZH 4CH2B 1ZPBA 2P16A 1PPGE 3W94A 1KMHB 1BBRK 1BJUA 1TRMA 1AWFH 4AFSA 3ZIAD 4MLFB 1IQLA 2NU3E 1Z6EA 2DE9A 3VB4A 1DICA 4NA8A 5DP5A 5K7RA 5C1UA 3GCOA 4B2BA 2VIOA 1ABJH 3SN8A 3MO9A 4DY7B 1GJCB 1VKYA 2F9PA 3AASA 4X6MA 4IN1A 1MZDA 1E1QD 3EE0B 4JZFH 1HAVB 1Z8JB 2O8LA 3ZZ5A 1UTMA 1IQIA 1C2DA 3U8OH 4FUEA 1PPBH 3ZZBA 1GBJA 4GCHG 2SGDE 3KQEA 4AG1A 4OS5A 1GGDB 1SQRA 1NFUA 4CRAA 1EOJA 1H8ED 1O5AB 2XCFA 3BTGE 5EU8A 3SGBE 2C8YB 1G3EA 3LH1A 3O8BA 1SLXB 2A45B 1Z7KA 2EA3A 4UONA 4B71A 1NBMD 3JZ2B 4BNRA 2RA0A 1V2KT 2VGCB 1PPCE 3MO6A 1E35B 3RU4D 1FN8A 5DSFA 2BOHB 1INCA 1MH0A 3GY2A 3SQHE 2XWBI 4NZQA 5A0AE 3TK6A 1VITF 3GICB 3PLBA 4I32A 3SU4A 5CHAB 1GDQA 3A84A 1K22H 1AE8H 3SO3A 3TGKE 2F83A 1SGIB 3U9AH 2CGAA 4D9QA 4KTUA 1O39A 3PLPA 2HLCA 2XXLA 3RXFA 4MPVA 1V2TT 1NFXA 1YF4A 2GZ9A 5B6LA 2W6ID 1ZPZA 1TAWA 4MNYA 4MVNA 1NU9A 3BIUH 4DW2U 1O5CB 1NS3A 1YM0A 2A5IA 1TGBA 2XTTB 2K8IA 1YLCA 3AAUA 1NRSH 2Y80A 1TOCB 4UD9H 1GJ6A 5EXLA 3FP6E 1MBMA 2ZCLP 1SFIA 2LP6A 1P3EA 1QL7A 3NPSA 2P3FH 2YOLA 3U1JB 1FMGA 1SSXA 1ANDA 4IBLH 3SV7A 3TPIZ 3TH3H 4BAHB 1ZMJA 1P8VC 1ANCA 2YMSD 5JPMH 1VZQH 1CA0C 4YO9A 3TLOA 3A8DA 1LKAA 1O0DH 1EAIA 1AD8H 1OHHD 1O5DH 4Q7YA 3OE7D 1F0TA 4GHTA 3C1KA 9ESTA 1SG8B 1ANEA 1RTLA 1GI9B 2GJGA 1CSOE 3LJJA 1YPMH 1A0JA 2W26A 1SGYE 2XBWA 4RT0A 1G9IE 3BEUA 4GCHF 1MTNC 1AFQC 5E0JA 3RLYH 1LHCH 2A5AA 2GCHG 2ZNKH 2BZAA 4CRFA 4NG9H 5A0BA 3U28C 3LGYA 5JBCS 4ZXXH 3PTNA 1GG6B 1OYQA 1FONA 4BAMB 4YLUA 1GJDB 1ZGIA 1FPCH 1CGIE 1P2JA 4X6OA 7KMEH 3CENA 3ZVGA 1RGQA 1AB9C 2TGTA 1NM6A 4OS4A 3AK5A 1UCYE 2R3UA 4WY3A 4AN7A 2WPLS 1MCVA 1SGDE 2P8OC 1X7AC 2ANYA 3RDZA 3S9CA 2L74A 1V2MT 4HTCH 1H9LB 2VNTA 6CHAB 1GL1A 2BB4A 3SNAA 3BTKE 1SGFA 1LHDH 3Q00A 2HPPH 1IQMA 1J14A 1M9UA 1W8BH 5I46H 3M35A 1AE5A 3A82A 2AGGX 1FJSA 4YOJA 1GHZA 3F2GA 4AGJA 1LDTT 5GIBA 3Q3XA 1XUKA 1D3DB 2B7DH 3S69A 4ZKOU 1MQ6A 1UTOA 1KIGH 4TPIZ 2FMJA 3MH7A 1C5RA 1SGQE 2KCPA 5EGMA 4A7IB 3DCLA 3TH2H 3N7OA 2UWOA 2P94A 4KELA 1ESAA 1GMHG 2BVRH 4JZDH 3LGUA 1C5OH 2CV3A 4FVDA 1KYNA 3RC4A 1K21H 1UVPA 3M7QA 1BIOA 1TBRH 1GBEA 1ANBA 1A7SA 2J4IA 4KP0A 3LC3A 8GCHF 2WPHS 1AGJA 5C0TA 1C1MA 2ZGHA 4YLQH 1GI3A 3D49H 4XOJA 2HNTF 2GZ8A 1ZSKA 1Q3XA 3OY6U 3TGIE 2FWWA 3SJ9A 1YGCH 4TSFD 4J1YA 2FOCA 1WOFA 1FAXA 1OS8A 1TGSZ 1IAUA 3O8RA 1A2CH 4B74A 3QZQA 2Z3EA 3M5NA 4DURA 2QYIA 4K1TA 2GDDA 4ZUHA 5L2YH 1ARBA 3PMJA 1GI6A 1BQYA 2BD5A 1EATA 1AZZA 1BTPA 3F0PA 3HGNA 5F03A 5FAHA 5BPEA 3ESTA 1CA8B 4WH8A 3ELAH 2D1JA 1O2UA 1QJ7B 2AMQA 2YMSC 4XSKU 3URCA 4CHAC 2BD3A 1BDAA 3VGCC 2HVYB 4I86A 4NA9H 2ANWA 1C1TA 2HALA 2HPQH 2ZGXH 3BSQA 2EI6A 2LELA 1P3CA 4I7YH 1BRCE 1PQ7A 1HBTH 1TQ0B 1PJPA 2G55A 5JDUB 4RI0A 1C5YB 3W1EA 1C5XB 1AZ8A 3SQEE 5EQQA 5FX6A 1HJAC 1GMDG 2RA3A 3KHVA 1UTJA 2XC0A 2Z6BD 1MKXH 1QFKH 4MTBA 4AB9A 1QRZA 2SGAA 1SVPA 4F48B 3STJA 3PMBB 2GZ7A 1Z8RA 4X6NA 6LPRA 1TIOA 3UPEA 1YPKH 5DKMA 1P9SA 3NZIA 1EPTB 1Z8IB 2PUQH 1O33A 4WH6A 4X8TH 1DSUA 1UMAH 5HGGA 5DP4A 1GJ4H 9LPRA 3RM0H 2SNWA 1P02A 5C2ZA 3UR9A 1ZRBA 1DFPA 1OP8A 1YYY1 1BMLA 4LOYH 2ZQ1A 1GMCF 3IITA 3MHWU 1ZJDA 1OWEA 4RSPA 5HM9A 2A2XH 5C17A 4O97A 5CMXH 1C9PA 5GNDA 2ALPA 2PTNA 3I77A 4KTSA 3MNBA 1O2HA 1XVOA 1EASA 5C5NA 1MAYA 1C5LH 4XFQA 1ZMNA 4FXGH 2Y82A 1T8MA 2C8WB 3MH6A 3RXRA 2H9EH 1TX6A 3HATH 5GJ4B 1ZSJA 3EDXB 1XKBC 1GVLA 4Y7BA 2ILNA 3WWBA 3ZVEA 2QXGA 1O32A 3VB5A 2PTCE 2AHME 3TITA 1P2KA 4WWYA 5EW1H 1TA2A 3F1SB 1DXPA 3LGTA 3OSYA 2WUCA 1Z6JH 3GY3A 3MYWA 3UQVA 1GGDC 1WU1A 3QO6A 1F92A 2V6NA 2QF0A 4WMEA 2A31A 2WV4A 2EQNA 4K2YA 5GWZA 2VVCA 5FPYA 3UFAA 3UOUA 2H9TH 3RXIA 1B7XB 4Q63A 1IQJA 4E7NA 3S9BA 2A7HA 1T32A 3PROA 4NFFA 2BX3A 1FLEE 3V3MA 2I6QA 3MO3A 3G01A 1CT0E 3KYFA 3MOCA 1QL8A 2G8TA 1Z8GA 1DY9A 1C2LA 5FBIA 5EODA 1FX0B 3BTQE 3RXEA 1HUTH 2QF3A 2QF4A 3FZZA 4AYYB 4ACAA 1GMDF 1MD7A 3Q3YA 2V7QD 1SQAA 4MPXA 2ZU3A 1RTKA 3M61U 1BUIA 2Q1JA 1EXFA 2QXIA 3JZ1B 3MMGA 1HDTH 1QQ4A 1OWKA 2ODYB 3RXOA 2FOEA 3ODDA 2F4LA 1OWDA 4CR5A 2BXUH 1GHVH 2WPDD 4WMFA 3DD2H 2THFB 5LH8A 3KQCA 1AWHB 4K3JA 2KCOA 1SHYA 1TE0A 2BDYA 2ZFPH 4YT6H 2FOAA 2GD4B 4B2CA 4B1TA 1SOTA 2F91A 1O3BA 3C27B 4Y8YA 1ZHPA 2W7UA 1SGFG 4BANB 2G4TA 1KY9A 1FZZA 1O5BB 3QN7A 1HFDA 1FAKH 4D9RA 1KXCA 3VG8A 2BDBA 2VIPA 1K1IA 1VJ9U 2J94A 1C5VA 1G3CA 2ZFTA 2ZHEH 3SJKA 3TK9A 1GHYH 1O3CA 4R8TB 4ISHH 3FANA 5C0UA 4Y7AA 4E06H 3LIWA 1L4DA 2WV5A 3FOAA 2KCYA 4LK4A 1A4WH 2QXJA 2FDAA 4HI3A 2ULLA 3SHAH 3V0XA 3HK3B 1VGCB 2ZGJA 1XUFA 1O38A 2GX4A 1FNIA 5FX5A 1MABB 7LPRA 4O9VA 3E8LA 1N6XA 3ZZ8A 4I31A 3UTUH 1IQNA 3PO1C 2AMPA 1HAIH 2W3KA 4GHQA 1BRAA 5SGAE 1C1QA 3P8OA 5LGOA 1RS0A 2O8TA 2ZI2H 3TJOA 1W3CA 1O3HA 2GMTB 1GG6C 2LNCA 1O2SA 4X1QU 3TK5A 1D3TB 1MTSA 2IPQX 1NU7B 3UNRA 4D7FA 1BTXA 1W13U 1NRQH 4MNXA 3LGIA 1W11U 1BMNH 1ELAA 1VR1H 2CK3D 1YY3A 5GPIB 1EUFA 2G5NA 3E6PH 5T3HA 1L2EA 1ELTA 3KYGA 1N1LA 3HK6B 3H7OA 2PV9B 4IW4E 5FL7D 4UFFH 3OEHD 2XOKD 1LHFH 4ABGA 3RXSA 4NGAH 1BJVA 1P57B 1QBOA 4YTAA 1EFRD 3PRDA 4K5ZA 2FTLE 1Y59T 3GY7A 1O2OA 2O8MA 4Q7ZA 2ZGBH 2BOKA 3RMLH 4ZROA 1W0YH 1ETTH 1KLJH 1O2ZA 3BIVH 2RG3A 1E34B 2BVSH 2Z9IA 1V2ST 3M7UA 4X1NU 5C20A 1GBCA 1HAVA 3ZVCA 1TONA 2PR3A 3RXDA 1VJAU 4ZKNU 2HRVA 2ZU2A 5E2PA 1O2PA 2FX4A 1NZQH 4FETA 4MNVA 3N99A 4Y71A 2OQUA 1W0JD 3RXPA 3HPTB 3P8GA 2Y5HA 4X1SU 1YLNA 2ZDLA 3U69H 4M7GA 1S6FA 1NY22 5FCRA 1XMNB 1O2GH 3OEED 1C2EA 1WQVH 1P9UA 4JZEH 5CE1A 5ESBA 1DSTA 1YCPK 1HRTH 5FCKA 2C3SA 2FLRH 3MQKC 1L0ZA 4ZHMU 3PV2A 4BTUB 1O2IA 2BQ7B 1ELGA 1TPPA 1BOQA 1IQFA 3RXQA 1C9TA 4X8UH 1ZYOA 1QA0A 1YPHE 1DVAH 4X1RU 2VIDA 5EIYA 4AFQA 2FXRA 1BMAA 1EJNA 3ENSB 4MG3A 2B9LA 4DJZB 1WAYB 1BMMH 1C1OA 3BEFB 3RXVA 2KAIB 1LHEH 5JBBS 3F9EA 1AU8A 4OM9A 1GBAA 1DOJA 3RXBA 3GCNA 1GBKA 1V6DA 2AH4X 1TMUH 1EP5A 3E91A 1RIWB 4WVPE 1F5LA 1C1RA 4AZ2B 1P04A 2XW9A 1AY6H 2JH6D 3HKIB 2ZPQA 1SI5H 2R0KA 3GDVA 1MUEB 3E0PB 3TIUA 5L30H 1QIXB 1SGCA 1YP9A 1FI8A 3WW7A 1QGFA 2A0QB 5F8XA 1LTOA 6GCHG 2CJIA 2DUCA 3RC5A 2NU0E 5IDKA 2PKAA 3P92A 1MZAA 1DS2E 5ABWA 1NPMA 3TVJB 4DIIH 1TPSA 3WY8A 3QUMP 1N8OB 3T26A 3V13A 3FFGA 1DY8A 1NFYA 1UTQA 4NFEA 1TNGA 3PTBA 5DP3A 4XD7D 1HB0B 1GDUA 1TX8A 1PFXC 2KR7A 1JXPA 1EP6A 3EA9A 3GY8A 3T5FH 2G52A 2ZTXA 3S7KB 1CBWC 2OD3B 1TPOA 1T8NA 1EPTC 2XBYA 4CRBA 1Y5UT 3FVFB 1W14U 2VVUA 1BZXE 3IG6B 4FUBA 4DT7B 1CHGA 2XWAA 1IQKA 2WYJA 2BHGA 1TBZH 1P01A 1C2MA 3ZVDA 1TNJA 3S9AA 3SV6A 2SGQE 1IOEA 1PPFE 1F0SA 2J34A 2STAE 4FU7A 4YOGA 3HKJB 3M5OA 2J97A 3P8NA 2QAAA 2B8OH 3F68H 1QCPA 3BEIB 3HGPA 4OS6A 2CF9H 1FQ3A 3R3GB 1OWIA 1TOMH 1UTKA 1Y5AT 1YWUA 3B8JA 3SNBA 3A7WA 1FDPA 4AG2A 2FIRH 1HLTH 5E8EH 2XYAA 3TH4H 2Q6GA 2Q6DA 3ZVAA 2SGPE 1ZZZA 4AC9A 1C1NA 4ZKSU 3SV2H 3UUZA 8ESTE 4X1PU 3DFLA 2BY6X 2Z94A 1HXFH 4BAQB 1SGNE 1KTSB 1W0ZU 2ODPA 2AFQB 2F9UA 3NK8A 1IQGA 2J98B 1PQAA 4Q2KA 3RXTA 5TCAA 1DXWA 1C1VH 2QV1A 1W7XH 4ASHA 1SC8U 1BTUA 3ZZDA 2FYQA 2H5CA 1WBGB 2G4UA 1H9IE 4ABEA 4U2WA 3F2FA 1DWCH 1C5NH 1EKBB 5JBTA 4F4OC 2AYWA 1PYTD 3E16B 1O2NA 2I6SA 2YNBA 1HNEE 3CNRA 3MI4A 1HXEH 4SGAE 2BMGB 5E2OA 5C5OA 2VWLA 1V2PT 1K2I1 2PKSB 1UK3A 1BBRE 2QXHA 2WPKS 3K6YA 5FBEA 3UREA 3BTWE 1CO7E 1ELDE 2KCAA 4HGCA 1GHAG 4JYUH 2UUFB 5C1YA 4OGXA 3P6ZB 1EZSC 1KTTB 2AS9A 1HJ8A 4FUFA 1O2TA 4Z0KA 3A7TA 1DX5M 1HPGA 1SR5C 1UK4A 2HWLB 1LKBA 5BRRE 3TJVA 2BYAX 3TNTA 3ZVFA 4F55A 5JBAS 4CREA 3NUMA 7GCHG 1A0HB 2CMYA 2FLBH 3ZV8A 4GSOA 2ZFRH 2R2MB 4JMYA 4CH8B 3NCLA 3I29A 5HXFA 1DUEA 3EA8A 1O2WA 4DIHH 4JK5A 1O2QA 2G51A 1BTHH 1BHXF 2ZHWH 3RMOH 2TGDA 2ODQA 2G81E 3BTEE 4ABAA 1RTFB 3OX7U 3ZVBA 5FPTA 3T62A 1K1OA 1TGCA 4FUDA 1TPAE 2VIVA 2ZP0H 1SBWA 3UB0A 1KXFA 4IGDA 3RP2A 1L4ZA 1GCDA 1K1MA 3A8AA 3OTJE 5DO4H 5EW2H 5C1XA 1VGCC 3MU1A 1C4Y2 1J8AA 2GCTC 2FI4E 5CDFE 4FUJA 3Q3KA 3QDZB 3M3TA 1SLUB 1ZRKA 2BD2A 2FI5E 3ATWA 3QX5H 4U30A 2OBQA 1S6LA 1P2NA 2JETC 3NRLA 1O3KA 2WPMS 1QURH 5DGJA 3KF2A 1DUAA 1EPTA 4NA7A 4Q4LA 1YCPH 4H4FA 1C2IA 4IC6A 1ZGVA 4CRGA 1GCTC 4Y79A 3SU6A 2GCHF 2ZU4A 1E38B 2KFWA 1YPEH 5T6GA 4K60A 1BBRH 2AERH 1DDJA 3WWFA 1NT1A 1LCYA 4BTTB 1F0UA 2ZHQH 4ZKRU 2BLWA 3ZZ6A 2TGPZ 3UOPA 1JOUB 3RXCA 3U8RH 4MDSA 1Y3YA 4ISLA 1AHTH 4OS1A 3VEQB 3UWIA 3KQ5A 4ABFA 2SNVA 3DFJA 1AUJA 1ZLRA 3BF6H 3IWMA 1D9IA 3FN8A 3BTFE 2PWXA 1SB1H 1V3XA 2AEIH 2ZO3H 1XUGA 3LKWA 4UFEH 1SGPE 1GI1A 1E0FD 1Y3XA 1AIXH 2GKVE 3BN9A 1BTWA 4ZH8A 1XXFA 2FM2A 5G4BA 5GCHG 1KXEA 2BLQA 3SOSA 1XVMA 3SGQE 3EQ0H 4NIXA 5A0CA 3SNEA 4KGAA 1PYTC 1V2VT 3FAOA 2HNTC 1LVMA 1MU8B 2IPHA 1ELFA 3GOVB 2ZHFH 3S0NA 3GCHB 1WDIA 1PPZA 1CE5A 3O8CA 2VU8E 1TBQH 2O9QA 3A7ZA 1VCWA 1H8IH 5LPRA 5EG4A 5B6OA 3A88A 2Y7ZA 2A7JA 3STIA 3VB3A 3UR6A 4X8SH 1GJ9B 2H1UA 3MNSA 4FUIA 5AFZH 1A3EH 1OOKB 2ZWLH 1GMHF 2GDEH 2W3IA 5ETXA 1D3PB 1SGTA 4OS2A 2BDAA 1T8LA 2PUXB 4YXWD 2IN2A 4Q80A 4BXSA 1RD3B 3QZRA 4YZUA 3KNXA 1QL9A 2UUJB 1CHOG 1MTWA 1QB1A 1NROH 2A7CA 2QN5T 1F7ZA 5HYOA 5HM2A 1O3PB 1FUJA 2PLXA 3CS0A 2WINI 2G5VA 4HFPB 1D6WA 5HMAA 1O2XA 4CBOA 5EPNA 1YPHC 2C93B 2C8XB 4ZCNA 3DSPA 2K1QA 5DJ7A 1UTNA 1T7CA 1O3OA 2A2QH 1B0FA 3T2NA 3DHKH 3F9GA 5JB8S 3VB6A 4A6LA 3LOXA 3ZZAA 2FI3E 1AUTC 2A1DB 1F2SE 4A1VA 1G2LA 3F0OA 4K1EA 1WTHD 1Y5BT 1EB2A 2KX4A 1SFQB 2ZC9H 3M5LA 2ANKH 5KECA 1ETSH 1O3LA 3MNCA 1QZ8A 1GBTA 1HIAB 3SHCH 5F8ZA 2H5DA 2CXVA 3OU0A 1MTVA 3GISB 1P06A 2SGFE 5IYTA 3B9FH 4I8LA 1CA0B 2ZDAH 4B6EA 2FX6A 2FOGA 3I78A 2VGCC 4K8YA 1AI8H 3QTVH 4ABBA 4H6SB 2B5TB 1YPJH 3QTOH 4AX9H 1SGRE 3RUOA 4Y10E 1GJAB 4O03A 3K6ZA 4IMQA 2J38A 1Y3VA 5EQRA 2PP6A 2FODA 3P70B 4MNWA 4X2WA 1MTUA 5CHAC 2RDLA 5PTPA 1MTNB 3H5CB 4ISNA 2F3CE 1FPHH 3AW0A 2OK5A 2V0BA 5JYIA 1CVWH 4UEHH 2ZGCA 1LMWB 4LXBH 4MQAA 1GL0E 1GI2A 1KXBA 4ACBA 3PM3A 4YOIA 1O5FH 3SUDA 1TYNA 2B0FA 3SV8A 2BDCA 1YPGH 2PSXA 1MBQA 1TFXA 1Y3WA 3AW1A 2NU4E 1YKTA 1UHBB 2ZDVH 1DLEA 2VIWA 5C3NA 1FV9A 1H8DH 4X2XA 1NRNH 5EXNA 5J4QA 2F9OA 3ATLA 1HCGA 4SGBE 5DP9A 3ZZ9A 5DP8A 1EX3A 2VVVA 1V2OT 2H6MA 2P8OB 2QC2A 1JWTA 3CS7A 1ZHRA 3KGPA 5JB9S 1GBLA 3PV4A 1RJXB 1WTGH 3RMNH 2QIQA 1CHOF 4HZHA 4X0WU 2IJD1 2XNIA 1U6QA 4WMDA 3MU4A
chains in the Genus database with same CATH topology
2Y81A 3FZDA 4FUCA 1FIWA 1P0SH 1ELEE 3PLKA 4DGJA 3LGVA 1A5IA 1OYTH 3MH4A 2OQ5A 5DP7A 3RU4E 1SMFE 1A61H 1RRKA 3F9FA 4NSYA 4I8KA 4YESB 3L33A 4BAOB 2W7SA 1LO6A 3A81A 5J4SA 2XRCA 2Z7FE 2P93A 4AFZA 2IJOB 2PFEA 2NWNA 1WQSA 2PKSC 2F9BH 3LJOA 2Y5GA 1O36A 2VINA 5AFYH 1A5GH 1O3EA 1O2MA 3E90B 1GJ5H 1P05A 3SI3H 3F6UH 4MPWA 1S0RA 2BY9X 1BHXB 3SW2B 4ZMAH 2A4OA 4XE4A 2ASUB 1P2IA 3SU3A 3P17H 2PSYA 1YCPM 2ZECA 2Y6TA 1Z1JA 3LT3A 3MTYA 2F9VA 1GBHA 3AVZA 1H9HE 2GGVB 1CT2E 2IOTA 1J16A 3SUGA 6CHAC 4UDWH 2VB0A 3KN2A 4U32A 3SNCA 1SLWB 3SZNA 4NZLA 2KAIA 2ZPRA 2FO9A 1JBUH 4D8NA 1W10U 1ELBA 1OKXA 3K2UA 1B0EA 1QR3E 2J9NA 2ZFQH 8LPRA 2BY7X 1VCQA 4UFDH 2UUYA 1AFEH 3KQDA 2D26C 3FP7E 1ELVA 1W12U 1OWJA 1K9OE 2XC5A 1GI5A 4B2AA 3VGCB 1NC6A 3A80A 1CQQA 3SU5A 1G3DA 1NRRH 1V2QT 2VH6A 1S6HA 3ATMA 5FHTA 1AKSB 3D23A 1OX1A 1KDQB 4CRDA 2AIPA 1ZTLA 3TU7H 2J95A 4LZ1H 1K1PA 1QA7A 1QNJA 3E3TA 4RKJB 2ALVA 2AGIX 1S83A 1C1SA 1ZMLA 2WYGA 3EYDA 2GVFA 3O8DA 4NIVA 2FOHA 4JZ1A 5E0HA 1NRPH 1QRXA 3UNQA 1Z71A 2D2DA 5AHGH 1FY5A 2A32A 1TWXB 2VWOA 3RU4T 1GVKB 3P8FA 3SGAE 1Q2WA 1F5KU 3SU0A 2BXTH 2O8UA 1C2KA 2JKHA 4DCDA 3BTDE 3ZZ7A 1O5GH 1LQDB 3MU8A 1DM4B 4H6TA 2ZDNA 3LPRA 1Y3UA 4AB8A 1UTLM 1DT2A 2OLGA 3V7TA 1PQ5A 3R0FA 4FUGA 2J2UA 2ZDMA 2A4RA 1GWAA 2VH0A 3NKKA 2CHAB 4K8BA 3SI4H 4E7RG 2EC9H 1LVYA 2RCEA 1THSH 3P95A 1QTFA 2BVXH 1BA8B 1GBIA 3GDSA 3KEEA 1HAGE 3PMAB 4JZIA 4BTIB 1AMHA 1UCYK 1L1NA 3RMMH 4TYDA 1GHBG 3E1XB 4IN2A 2TIOA 3EAJA 1QB6A 4OGYA 1HAXB 2BTCE 1PQ8A 1QHRB 1G36A 1P2QA 1Q31A 2ZDKA 1NESE 4DG4A 1V2JT 2A4GA 1O2YA 1C5ZB 1O5EH 1TALA 3BTHE 1ARCA 1C2JA 2QY0B 1VCPA 2FZZA 1RXPA 1QJ6B 2QA9E 1CGJE 1MKXK 1TNKA 1S85A 2BLVA 1C1UH 2XCNA 3U8TH 2EI7A 3GCHC 3U1IB 5EOKA 3L6PA 1C5WB 2ZPSA 3SORA 3PWBA 3KL6A 1O30A 4Q7XA 2ZF0H 3ATKA 1S82A 1GBBA 4I8HA 1OP0A 1C4U2 5AF9H 1EB1H 5EQSA 1MMJN 1DPOA 1T31A 4E05H 1H4WA 3BV9B 2J92A 1W2KH 1UTPA 2M5TA 2ESTE 3GYLB 3T25A 3MWIU 1V2LT 1FIZA 2ZHDA 2A5KA 3QK1A 4INHA 3E0NB 5C67A 2PGQB 4TPYA 2Z9GA 1MQ5A 2Z3CA 1SL3A 2OC0A 1NO9H 3M5MA 1HGTH 3SU2A 3A8BA 2V3OH 1F5RA 1GBMA 1LPGB 4AOQA 3BG4B 3QGJA 1JRSA 1JRTA 4Y8ZA 1Z1IA 4BAKB 3M3SA 4A92A 3BG8A 1MU6B 1C5TA 1LQEA 1C2GA 3PWCA 1C2FA 5L6NH 1O2JA 1BB0B 1OSSA 2OP9A 4AGKA 1TABE 4GUXA 3RXGA 2G00A 4Y11E 2FEQH 2Z3DA 4NSVA 4YT7H 4ABJA 1P2OA 1T8OA 3PB1E 3KIDU 2BQWB 1EAXA 4ZXYH 3A85A 1BRUP 5A8ZA 2PKAB 1WSSH 2CF8H 3A87A 4X8VH 3ZYDA 4Z6AH 1KSNA 4A5TS 2ZFSA 5A2MH 4GVUA 1SQOA 1FY1A 1S84A 1O3JA 1TX7A 8GCHG 2NU2E 2FP7B 1GHBF 6GCHF 1P12E 5FXLA 4Y6DA 1A3BH 1C1WH 1XX9A 2R2WU 1C5SA 1TNIA 3PO1B 2TRMA 1MKWK 1D4PB 4J2YB 3GDUA 1K1JA 3A7XA 1P2MA 4TWWA 3VFEA 1KXDA 1DANH 1NFWA 1O3DA 2EEKA 1SQTA 1WV7H 1V2UT 1J17T 2P3UB 1C5QA 2OXSA 2QCYA 2ZZUH 3GCTG 4AFUA 1UVOA 2CN0H 1HAPH 1V2WT 2Z9LA 1DWEH 3RM2H 4TWYA 4I8GA 1S81A 3DT0H 5ESTE 4THNH 4WXIA 1DLKB 4BOHA 2TBSA 3VB7A 2FOMB 1A1RA 2V35A 1XXDA 2P3TB 1O3IA 1HAYB 1XUIA 2C90B 2ZTYA 4NCYA 4JK6A 3ODFA 2GTBA 2D8WA 1IQHA 1O2RA 3H7TA 3M7TA 3QGNB 1GDNA 1O3AA 1JMOH 2Q6FA 1T4UH 4D7GA 2ZA5A 4VGCB 2ZIQH 1G37A 1AVGH 1YBWA 3VXFH 3UIRA 4FVBA 4YM9A 1HYLA 2WPJS 1O3MA 2XC4A 4NWLA 1MD8A 3FP8E 5EPYA 1AO5A 3M37A 2H2ZA 2H9HA 3RXMA 1OP2A 2SFAA 3PMHB 4K69A 4UFGH 3UWJH 3LGWA 1GJBB 4MPUA 1BITA 1GPZA 5LPEA 1UVSH 3QLPH 5T6FA 1TQ7B 2GMTC 1UO6A 4XBBA 2VIQA 1EAUA 1GMCG 1XUJA 1WUNH 3AAVA 1FN6A 3DA9B 5TJXA 3L3TA 4QT8C 4ABHA 5A09A 4CRCA 1ACBE 3MNXA 4ZHLU 4B73A 3RXUA 1OXGA 2ZCHP 5GXPA 1TMTH 1ZR0A 1EZXC 2C8ZB 2R9PA 4ZAEA 1EJMA 2BDGA 2ZQ2A 1GHAF 4ABDA 3SBKA 4NIWA 2P95A 3MU5A 2EI8A 3DUXH 2OTVA 3EGKH 3ZZ3A 4ABIA 2BQ6B 2FS8A 1GBFA 1J15A 2FOBA 7GCHF 3A8CA 3GCTF 3BTTE 4X6PA 1QY6A 1RFNA 3GY4A 4D76A 5F6MA 4X2YA 1D3QB 1ZJKA 4INKA 1P10A 3TGJE 1GVZA 4Y0YE 2R0LA 3SJOA 4K1SA 3RXHA 1UCYH 3F9HA 5A8XA 1C5MD 2GV7A 3RXLA 1HIAA 5E0GA 1EZQA 1KLTA 4O3UA 1GJ7B 2VJ1A 3MFJA 4WF8A 1QBNA 2TPIZ 1BT7A 4B76A 1GHXH 4A1XA 4WJG2 1BTZA 1LVBA 1SLVB 1QQUA 3MH5A 3RXAA 2GT7A 1ZSLA 1ZOMA 1L1GA 2UWPA 1G2MA 2Y5FA 3ZV9A 8KME2 1SPJA 3LC5A 2PW8H 1CBWB 2YNAA 1G32B 3M36A 1ELCA 1FY4A 1TLDA 2GV6A 1S5SA 2P59A 3VXEH 1THRH 5I25A 2OUAA 1LPKB 4BXWA 1O35A 5H4IB 4FUHA 4DOQA 1NTPA 1ESBA 1NN6A 4JCNA 3LONA 2HGTH 4GLYA 1W7GH 5DK1A 1TGNA 1UHBA 1XM1A 1RIWC 1TRYA 1UVTH 3RXJA 3SNDA 4A1TA 2CHAC 3W95A 3ZYEA 1DWDH 2OCVB 3LU9B 4PROA 1J9CH 1L1JA 5TCCA 3LH3A 1BRBE 1O34A 1Y8TA 1O37A 3RXKA 2BLOA 1BCUH 2ZTZA 3ITIA 1O3FA 1GI7B 2STBE 1WCZA 4GAWA 4RKOB 1O31A 1G3BA 4IC5A 2Z9KA 2XBVA 1ESTA 1KXAA 1TRNA 1LVOA 1N8OC 1TNLA 3TNSA 2AGEX 1C4V2 3PYHA 3ZZ4A 2OC7A 1QJ1B 7ESTE 1GI8B 1TB6H 2C4FH 1V2NT 4Y8XA 1GJ8B 5LPFA 5GCHF 4TY7A 2BD9A 1K1NA 1E36B 2BD7A 2OC8A 2ZCKP 3RC6A 3EA7A 3SU1A 4ZHAA 4JYVH 1C5UA 2PGBB 1AFQB 1LHGH 4KTCA 3T29A 1DITH 2BZ6H 4IMZA 1DE7H 4Y76A 3D62A 6ESTA 2F9NA 3SV9A 4DVAU 1ORFA 2AMDA 1GHWH 4I33A 3T27A 2UWLA 3TJUA 3VPKA 2VWNA 2ZU5A 2FS9A 5EXMA 1N6YA 1EQ9A 1EZUC 3QWCH 5DPAA 1C5PA 1MKWH 2Z9JA 1WYKA 4F49A 1O2LA 1YPLH 2FPZA 4INLA 4R0IA 1AB9B 2BX4A 1C2HA 2ZFFH 3A7YA 4NIYA 2GT8A 1HJ9A 4O3TA 3T28A 1EOLA 3KQBA 4H42U 1CU1A 3SUEA 3BG4C 5FPSA 4X2VA 3GYMA 4JYTA 2ZU1A 3ZZCA 1YLDA 4ISIH 5DP6A 3SJ8A 1SHHB 3NWUA 4KKDA 1IQEA 2BDIA 4GPGA 1GBDA 1THPB 4LZ4B 2ZG0H 5A8YA 1QB9A 2R3YA 1FY8E 1ZHMA 1EAWA 1TGTA 2HVXA 3OY5U 1SOZA 1ID5H 2FYRA 1EJAA 3BTME 3UQOA 1ETRH 1ZPCA 1H1BA 4TY6A 1F0RA 1JIMA 2A4QA 1MAXA 2BY8X 1LPZB 2HOBA 1TNHA 4AYVB 1AQ7A 1TMBH 5DG6A 2OBOA 1V2RT 1AKSA 4U01A 1O3GA 1KDQA 2JH5D 3NXPA 1O3NA 1VITH 2PHBA 2Y7XA 1A0LA 4B75A 3URDA 3KCGH 3K65B 4CR9A 4AORA 2GCTB 1E37B 1ABIH 1K1LA 2GP9B 2TGAA 4FU8A 1CT4E 1P03A 4ESTE 3LDXH 1UJ1A 3GY5A 2JETB 3D65E 4CBNA 5K0HA 3A83A 1ZTKA 4I8JA 1TA6A 1OWHA 3B23B 2O8WA 4XBCA 2BM2A 2DE8A 1DWBH 3OYPA 1BTYA 3GY6A 3Q76A 1HAZB 2JH0D 1GCTB 1HV7A 1IHSH 1O2VA 2NU1E 2OINA 2ZKSA 1C1PA 2FESH 3S7HB 3RLWH 3A7VA 1AVXA 1AVWA 5T6DA 1FXYA 1CGHA 3V12A 3SUFA 3UY9A 1XUHA 1PPEE 3M3VA 4FU9A 4OS7A 2BY5X 1SGEE 5GDSH 3UNSA 3ATIA 4NWKA 1O2KA 4CHAB 1MCTA 1T4VH 4UE7H 4WXVA 3A86A 2FTMA 4IS5A 1FY3A 1A5HA 3A89A 4VGCC 3CP7A 1HAHH 3SJIA 2AIQA 1KLIH 2WPIS 3U98H 5AVDA 2BD4A 2FOFA 1IHTH 3TJNA 2V3HH 2HNTE 4XBDA 1S0QA 2VWMA 1QRWA 1P09A 1UK2A 1B5GH 1P11E 1VITG 2BD8A 1HJAB 3Q77A 1K28D 2QGRA 1PPHE 1D6RA 1XKAC 1UVUH 1A46H 1G30B 1QBVH 2XBXA 4XDEA 3MU0A 2LPRA 1ZTJA 2OC1A 4ISOA 3K9XB 1HAOH 2SGEE 2ANMH 2W5EA 1GI4A 5F8TA 2WUBA 1AN1E 4Y0ZE 1YC0A 1JIRA 4RN6A 1GI0A 1OPHB 2BDHA 2UUKB 2ZEBA 5L2ZH 4CH2B 1ZPBA 2P16A 1PPGE 3W94A 1BBRK 1BJUA 1TRMA 1AWFH 4AFSA 4MLFB 1IQLA 2NU3E 1Z6EA 2DE9A 3VB4A 1DICA 4NA8A 5DP5A 5K7RA 5C1UA 3GCOA 4B2BA 2VIOA 1ABJH 3SN8A 3MO9A 4DY7B 1GJCB 2F9PA 3AASA 4X6MA 4IN1A 1MZDA 3EE0B 4JZFH 1HAVB 1Z8JB 2O8LA 3ZZ5A 1UTMA 1IQIA 1C2DA 3U8OH 4FUEA 1PPBH 3ZZBA 1GBJA 4GCHG 2SGDE 3KQEA 4AG1A 4OS5A 1GGDB 1NFUA 4CRAA 1EOJA 5EU8A 1O5AB 2XCFA 3BTGE 3SGBE 2C8YB 1G3EA 3LH1A 3O8BA 1SLXB 2A45B 1Z7KA 2EA3A 4UONA 4B71A 3JZ2B 4BNRA 2RA0A 1V2KT 2VGCB 1PPCE 3MO6A 1E35B 3RU4D 1FN8A 2BOHB 1INCA 1MH0A 3GY2A 3SQHE 2XWBI 4NZQA 5A0AE 3TK6A 1VITF 3GICB 3PLBA 4I32A 3SU4A 5CHAB 1GDQA 3A84A 1K22H 1AE8H 3SO3A 3TGKE 2F83A 1SGIB 3U9AH 2CGAA 4D9QA 4KTUA 1O39A 3PLPA 2HLCA 2XXLA 3RXFA 4MPVA 1V2TT 1NFXA 1YF4A 2GZ9A 1ZPZA 1TAWA 4MNYA 4MVNA 1NU9A 3BIUH 4DW2U 1O5CB 1NS3A 1YM0A 2A5IA 1TGBA 2XTTB 3AAUA 1YLCA 1NRSH 2Y80A 1TOCB 4UD9H 1GJ6A 5EXLA 3FP6E 1MBMA 2ZCLP 1SFIA 1P3EA 1QL7A 3NPSA 2P3FH 2YOLA 3U1JB 1FMGA 1SSXA 1ANDA 4IBLH 3SV7A 3TPIZ 3TH3H 4BAHB 1ZMJA 1P8VC 1ANCA 5JPMH 1VZQH 1CA0C 4YO9A 3TLOA 3A8DA 1LKAA 1O0DH 1EAIA 1AD8H 1O5DH 4Q7YA 1F0TA 4GHTA 3C1KA 9ESTA 1SG8B 1ANEA 1RTLA 1GI9B 1CSOE 3LJJA 1YPMH 1A0JA 2W26A 1SGYE 2XBWA 1G9IE 3BEUA 4GCHF 1MTNC 1AFQC 5E0JA 3RLYH 1LHCH 2A5AA 2GCHG 2ZNKH 2BZAA 4CRFA 4NG9H 5A0BA 3LGYA 5JBCS 4ZXXH 3PTNA 1GG6B 1OYQA 1FONA 4BAMB 4YLUA 1GJDB 1ZGIA 1FPCH 1CGIE 1P2JA 4X6OA 7KMEH 3CENA 3ZVGA 1RGQA 1AB9C 2TGTA 1NM6A 4OS4A 1UCYE 2R3UA 4WY3A 4AN7A 2WPLS 1MCVA 1SGDE 2P8OC 1X7AC 2ANYA 3RDZA 3S9CA 1V2MT 4HTCH 1H9LB 2VNTA 6CHAB 1GL1A 2BB4A 3SNAA 3BTKE 1SGFA 1LHDH 3Q00A