3E8LA

The crystal structure of the double-headed arrowhead protease inhibitor a in complex with two trypsins
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor/hydrolase
molecule keywords Serine proteinase inhibitor A
publication title The ternary structure of double-headed arrowhead protease inhibitor API-A complexed with two trypsins reveals a novel reactive site conformation.
pubmed doi rcsb
source organism Sagittaria sagittifolia
total genus 52
structure length 223
sequence length 223
chains with identical sequence B
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2008-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3e8lA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3e8lA02
1GHYH 2F83A 4I8HA 2AIQA 3DFLA 3LGYA 2CMYA 4YZUA 2C3SA 3P8FA 1IHTH 3A8DA 1NFUA 3MH4A 1V2JT 4BTTB 5EW1H 2G81E 1LO6A 1AZ8A 2XBWA 2ZCLP 2O8LA 3E6PH 3RXGA 1TGTA 1TNJA 1VITF 1NRSH 4KTSA 1SB1H 1NZQH 1BRUP 1LDTT 2ZTYA 4AFQA 4NWLA 1P2QA 3BG4B 2OBOA 5A8YA 1BHXF 3FANA 3SQEE 4LXBH 2JH6D 1S84A 2FOGA 1GJ4H 3UOUA 2BD7A 1OKXA 3URDA 1K1MA 2XC4A 3B9FH 1ZHMA 3VGCB 3UIRA 4KKDA 2AFQB 2KAIA 1TNHA 2Z7FE 2STBE 1F0RA 1ZJDA 1O2KA 2XWBI 2Y5FA 1WAYB 2ZGJA 4A1VA 3M7UA 3PWCA 4JZFH 1C4Y2 4FUEA 4WY3A 1VCPA 1ABIH 1OP2A 3PO1C 3SNEA 2EI6A 1QQ4A 2A4GA 1AFEH 4THNH 3PMJA 2UUFB 4ABBA 4HTCH 2PKSC 3E90B 2WPMS 1O5FH 1O2VA 3A7TA 1UK3A 4ZH8A 2QXHA 3SN8A 1SGYE 2HNTE 2WINI 2GMTB 1K1OA 4FUHA 4WVPE 4SGBE 3OX7U 5IYTA 2HNTF 2GGVB 1NESE 5C1UA 4YM9A 4FUFA 1DT2A 2VWLA 2FLBH 3ZVGA 1P05A 4IN2A 1O31A 2PW8H 4DG4A 2BQ7B 1GHZA 1MUEB 1IOEA 1HJ9A 3RUOA 2ZP0H 1GHAF 3M5MA 3GCHB 1O30A 3EQ0H 3H5CB 1EAWA 1AGJA 2QF0A 1F5RA 3PLKA 5HM9A 2OINA 5FBEA 5C20A 4YOJA 2Y6TA 1SL3A 7LPRA 1NY22 2FOEA 1GDUA 1C9PA 2NWNA 5GJ4B 2FODA 3PMHB 3K6ZA 2BD8A 1H9IE 4UFDH 1KXDA 1GMCG 2PGQB 3DD2H 2AS9A 2BDGA 1G30B 3MU0A 2HGTH 1D6WA 2ZZUH 4H6TA 4ZHLU 4B2BA 1DANH 1P2OA 1Z6JH 2ZHQH 1SMFE 1C2EA 1XX9A 1GJ8B 1AY6H 1Z8JB 1DPOA 1FY3A 1KLIH 6ESTA 3RXSA 1OWDA 4X8SH 1TGCA 3QO6A 4GAWA 2Q6FA 1GI0A 1GBMA 2P3UB 1C2KA 1CVWH 1DWCH 1TGSZ 1O2QA 3A84A 2QIQA 4VGCB 3NWUA 1O3EA 5LPEA 1BBRK 1D6RA 5C2ZA 1WQVH 3SNBA 2TGTA 5A0CA 3ODDA 2B0FA 3LIWA 2FI3E 3SW2B 1EX3A 1C5UA 1SGCA 5LH8A 1GVZA 1P04A 4U32A 3WY8A 5TCAA 3SNCA 3RMLH 4CH8B 2BX3A 1VITG 1O2IA 1WTHD 1DY8A 1T8NA 2A0QB 2BY9X 5C5OA 1EAXA 4NFFA 3TJOA 3P17H 1ZSKA 1E34B 1OSSA 2AMQA 1A5IA 1MZDA 4AX9H 1YM0A 2QXIA 1Z1IA 3U69H 1CO7E 3H7TA 2F91A 1KLTA 4YT7H 1NT1A 3LGUA 3SU4A 1MU6B 3QZQA 5DKMA 3SNDA 1MQ6A 1Y3UA 1QL9A 1MAYA 3AASA 2RA0A 3P92A 1NRPH 4Y0YE 2TGPZ 4UDWH 1W10U 2C93B 4WMEA 1W14U 1YPEH 1MCTA 5PTPA 3E0NB 4I8LA 2D26C 3SV7A 3U8TH 1A1RA 2F9VA 3Q3YA 2Y7ZA 3SNAA 4GUXA 1NPMA 1CHGA 1FY8E 1UTJA 1UVUH 3IITA 1V3XA 4CR5A 4FU8A 3A8CA 1Z8IB 2HPPH 2W7UA 3BTDE 4CREA 1Z7KA 1VZQH 2QXGA 3GY7A 2OCVB 2PTCE 3KN2A 4BAKB 3RP2A 4NCYA 1O36A 2VIPA 1RS0A 2F9UA 2NU4E 1UVPA 4X6OA 5HMAA 1TALA 1T8OA 1YCPK 3QZRA 3SUGA 3LT3A 5GIBA 4NIVA 1QJ7B 1PPGE 4ABIA 5A0BA 1NM6A 4E7RG 4YOGA 1SBWA 2YNAA 1UHBB 2YOLA 3MU8A 2R9PA 3QX5H 3V12A 4OS2A 1UVOA 3ZZ8A 4IN1A 3PMAB 2ZU2A 3BIVH 1H4WA 4YOIA 1A3BH 1P11E 1O3LA 5DP3A 3LJOA 2Q1JA 1YP9A 2TPIZ 1P3CA 1SLVB 3Q3XA 1CGHA 1C5OH 2EEKA 2AERH 1V2TT 2W3KA 4K8BA 2J94A 1O35A 2H5DA 4AYVB 2BDAA 1ZMNA 1AB9B 1ESBA 5GPIB 3LGTA 1GHVH 2XYAA 1MTNC 3CENA 4NGAH 1BTWA 1Y5BT 3BTFE 1HIAB 1MZAA 1TNKA 4AFUA 4KELA 1GBIA 2ANWA 1V2MT 1LHDH 3D65E 2BQ6B 2G8TA 1KXAA 3MO6A 5TCCA 1AWFH 2GCTB 1NN6A 3C1KA 1TBRH 1C5PA 4X2WA 4BANB 1QQUA 3SV6A 1BMAA 1TGNA 4YESB 4X2XA 5LGOA 3OY5U 2G5VA 2SFAA 2ESTE 2Z9LA 4KTUA 1CQQA 2Z3EA 1TNIA 3LONA 4GVUA 3M36A 2Z9KA 2QCYA 1TPSA 4FUCA 3NUMA 1NRNH 5EQQA 4XBCA 5CMXH 2PLXA 1BB0B 3SU0A 3STIA 2CGAA 4Y8ZA 5LPFA 1V2KT 2VGCB 1IQFA 1LVBA 3P70B 1XUKA 1GPZA 1C1WH 1ID5H 1SSXA 3A88A 3SUEA 4ABEA 1OWKA 1FJSA 2HVXA 1RIWB 3SO3A 2AMPA 1MTVA 3M37A 3Q3KA 2PSYA 4Q7XA 1V2PT 1INCA 1C5YB 1DY9A 5L6NH 5FPTA 4FUJA 1O2JA 2UUJB 4IC6A 4B2AA 2G55A 2V3HH 3SV2H 3ATKA 2XC0A 1MTUA 2YNBA 3TNSA 1CA8B 3FAOA 1FLEE 3STJA 3FZDA 4JYUH 5FX6A 3AAUA 1P8VC 3SJ8A 1PJPA 1Z71A 1F0SA 4JCNA 3MH6A 1NROH 1WCZA 3BEFB 1BT7A 4JK5A 2GT8A 1DUEA 2SNWA 4DIIH 3CP7A 5DP5A 1EPTB 1EZQA 4JZIA 4BXWA 1MH0A 2J92A 3BV9B 4VGCC 1CSOE 2FM2A 1OP8A 1ZZZA 4NA7A 4YT6H 1HAVB 1O5BB 3DT0H 1GGDB 1T32A 3L6PA 1W7XH 2LPRA 2F9PA 2ZDNA 1SQOA 2IJOB 1DDJA 5JB8S 5FPSA 1QFKH 1P9SA 1P10A 1BTXA 4X6MA 2DE8A 1NU9A 3I78A 1J14A 3ESTA 3T2NA 1G2MA 1SGFG 4CRCA 1D3QB 1K21H 2A4QA 2ZPRA 4JK6A 3S7KB 3ZZ5A 5LPRA 1BJUA 2ZHEH 2VH6A 1HAXB 4BOHA 1QCPA 4E06H 1ANEA 1RRKA 1O2RA 2XRCA 3SI3H 2R0KA 1EAUA 1UJ1A 4HI3A 4DJZB 1MTWA 2NU3E 1SHYA 3LPRA 4U30A 5E2OA 1DXWA 4A5TS 1JXPA 3KL6A 3LH3A 4UFFH 3RXCA 4XBBA 1AKSB 1A46H 3SU1A 1ZMLA 2PKAB 3SU6A 3ATWA 1GBCA 3A83A 3GYMA 2BOHB 3LGIA 5H4IB 1SGTA 5FXLA 3M35A 2AGGX 2BYAX 2FP7B 1O2XA 1CA0C 2R2WU 2TBSA 6LPRA 2BLVA 1O0DH 2GKVE 4A1TA 4HGCA 5F8ZA 3MH7A 1FI8A 2A2QH 3VB5A 1SGQE 4RSPA 1FAXA 1BMNH 4X2VA 3ELAH 1GI4A 1KXFA 3N7OA 4O97A 3UR9A 1HJAB 4YO9A 4YTAA 1IQIA 1AD8H 1JOUB 1QNJA 2ALPA 3RXFA 3ZVAA 1TABE 1V2VT 3F1SB 2ODQA 1ZLRA 2ZDAH 4Z6AH 1GJDB 2G4UA 2FOBA 4CBOA 1TQ7B 1GBJA 1RJXB 1QB1A 1EKBB 1Q31A 1EJNA 4D9QA 3V0XA 1MMJN 4FU7A 1QURH 2V3OH 4OS6A 4ZUHA 3QGNB 2BDBA 3QGJA 1RTKA 4Y71A 3LC3A 2BD9A 2HLCA 3K2UA 1ELVA 1K1NA 3EE0B 4ISNA 3BTME 1P12E 2SGAA 3LJJA 3MU5A 1B7XB 3SU5A 1C1MA 2SGDE 4WH8A 1FONA 2ANYA 4K5ZA 2I6SA 4FVBA 1RFNA 4NA9H 2FI4E 2O8MA 2BX4A 1DE7H 1C5TA 1CGJE 4X1SU 2CJIA 3P8GA 3PTBA 2FYRA 1BTYA 3BTTE 3T25A 2B9LA 1K28D 1MD7A 4JZDH 1GI7B 1PPBH 2Z9JA 1H1BA 5EXNA 1QIXB 5CE1A 3NZIA 2CHAC 7GCHG 2ANKH 1PPEE 3MTYA 2VU8E 2GDDA 2XCFA 1GCDA 1GBEA 4F4OC 1SFIA 4B71A 1AE5A 4WMFA 4BNRA 1B0EA 3SJKA 4TY7A 1DLEA 4X1RU 1TONA 3VB7A 2IOTA 2QN5T 2ZDMA 3P6ZB 5L2YH 1Y3WA 2A32A 2AIPA 5EXMA 1DVAH 1XKAC 3ZZ9A 1P2KA 3U8OH 4ABFA 1BOQA 1DSTA 1P2NA 1FN8A 3RXMA 1IQEA 1C2JA 2BZ6H 3NCLA 5L30H 2H6MA 1SVPA 2TGAA 2P8OC 1BQYA 5EPYA 4AOQA 1A3EH 1HAGE 1EB1H 4OS7A 1IHSH 1ZRBA 2ZKSA 1TYNA 1HPGA 5C3NA 2ZFPH 1SLXB 6GCHF 1TBZH 1GI3A 1HDTH 1KDQB 2FI5E 3RLWH 2BXTH 3MOCA 5A09A 4Y10E 3HKJB 4IC5A 1FXYA 1S0QA 3TH3H 1GJ5H 2J95A 4CRAA 3S9BA 5GCHF 4FVDA 3PLBA 4X1PU 2C8YB 2XXLA 2A1DB 4A92A 3MU4A 2FOFA 3A87A 5EQSA 3M3VA 2A4OA 1C1NA 4I8GA 4PROA 2QA9E 3F68H 2OC0A 3FP6E 1UK4A 2ZU5A 2J38A 1S6HA 2UUYA 4B74A 4X2YA 5J4SA 4GPGA 3VPKA 3A7WA 2ZDKA 1VGCB 3ZZ7A 3UWIA 3NK8A 1EUFA 2O8TA 4WMDA 1C2GA 1H9LB 1UTOA 4XE4A 3BTEE 3P8OA 1HXFH 3GDVA 8LPRA 3UOPA 2P3TB 4TWWA 1XUJA 5F03A 5K0HA 4UFEH 1UTMA 1FV9A 1G9IE 3U9AH 1L1GA 2VIQA 4CR9A 3KHVA 3OSYA 1GBDA 2BQWB 1TBQH 3MO3A 1SGFA 1AQ7A 2ZECA 1O2TA 2ALVA 1C1TA 4R8TB 1V2LT 3KQBA 3F9EA 4WXIA 1GBKA 5FCRA 1H9HE 4TPYA 2ZI2H 1DLKB 1G32B 2PV9B 4B1TA 4J1YA 2UWOA 4MPUA 2GZ7A 4WXVA 2H1UA 4YLUA 2BD4A 1UTPA 1ETRH 1RTLA 4DGJA 1LTOA 1DXPA 4D8NA 1UCYH 3MNBA 2ZIQH 2H9TH 3A89A 3BF6H 1AN1E 5DP9A 1W0YH 1TRMA 1QGFA 3BEIB 2ZPSA 1AU8A 2UWPA 3QK1A 1HAHH 1ACBE 2O9QA 4I33A 2R3YA 4A7IB 1HAOH 1ZGVA 1GJAB 1Q3XA 2FOMB 2O8WA 1GJ9B 2WV5A 1HAZB 8KME2 2WPKS 1GI5A 3UY9A 1CBWB 1E38B 3ODFA 1XM1A 4Y79A 1BITA 3BTQE 1TGBA 3SGQE 3LH1A 1Y3YA 3PB1E 1G3CA 3S9CA 4RKOB 2ANMH 2K1QA 5FPYA 1AIXH 5DO4H 1D4PB 1DFPA 2W5EA 5DG6A 4XFQA 1BA8B 1QB6A 3PM3A 4OGXA 1KXBA 3RXBA 4MNVA 4AG1A 1XKBC 4NZLA 3TGIE 4ZMAH 1QA0A 3SGBE 1EZXC 3TH2H 1AFQC 3GY4A 2HNTC 3A7YA 4CRFA 1W0ZU 1XXFA 5SGAE 1MD8A 2B7DH 2QXJA 3BTKE 5A8ZA 1BTZA 4ISLA 3T62A 2BVRH 2R0LA 3RXHA 4O3TA 5DK1A 1QL8A 1ZTKA 3W95A 1HNEE 3S9AA 4AB9A 1LHGH 3ZZDA 1O39A 3HGPA 3QTVH 1KXEA 2R2MB 1VCQA 3ENSB 1K1LA 3ZYDA 1NFWA 2OXSA 1P3EA 5G4BA 4AFZA 4MNYA 1O3CA 2GZ8A 2BY8X 3NXPA 1QBNA 3AW1A 2FWWA 4MNWA 5CHAC 6GCHG 1FY4A 2ULLA 4K3JA 3QLPH 2P16A 3A8AA 4MG3A 2OQUA 1O33A 3KGPA 3T27A 4OS5A 1TAWA 1W8BH 1Z8RA 5F8TA 2Z3DA 2C90B 6CHAC 1TLDA 3FFGA 3VXEH 4FUDA 4AGKA 2HPQH 3RMMH 1YPHC 1O3DA 1BRBE 1O2PA 1QB9A 2ILNA 3OU0A 5GCHG 4BTUB 3TJVA 2CN0H 4INLA 3V7TA 5L2ZH 5AVDA 7ESTE 2FESH 3MO9A 3DHKH 2EA3A 1GI1A 1Z8GA 4UD9H 1C5MD 4H6SB 1T4VH 3FVFB 1AUJA 4NIXA 1JMOH 2H5CA 1ANBA 1TMTH 1ABJH 1SGEE 4NSVA 1ORFA 1YPMH 2G4TA 3A86A 2ZG0H 4O03A 2C4FH 2R3UA 3RC6A 1YGCH 1AVGH 3VXFH 1SQAA 1L0ZA 1PPCE 4INKA 3SZNA 2GD4B 1OS8A 4I32A 1D3PB 2BOKA 4CH2B 3TLOA 4UONA 2ZU1A 2BDHA 5JBTA 1ZPBA 1EJMA 2B8OH 3JZ1B 3RU4T 3CS7A 1AMHA 4CRDA 4LK4A 1UHBA 3BG4C 2ZC9H 1Y8TA 2G52A 1BTHH 3SJOA 2ZQ1A 3EDXB 1J15A 3O8RA 1UMAH 1C9TA 1TMUH 1QA7A 2ASUB 3KQEA 2VWMA 1ESAA 4B75A 1SGPE 2I6QA 2VVUA 1QR3E 3GDUA 3M3SA 3RXIA 3VGCC 2G51A 1WOFA 4NIWA 1TFXA 3M61U 1MAXA 1DWDH 1ZJKA 4DVAU 1P0SH 4RN6A 3MNXA 2V0BA 2CV3A 3ATMA 1ARBA 4OGYA 1FZZA 4ZXYH 4DY7B 1GJCB 8GCHF 1E0FD 1NRRH 1V2UT 4ZHAA 1P09A 5EPNA 1HYLA 4KTCA 4K1SA 4Y7BA 3S69A 1PPHE 1O5EH 4DW2U 4FU9A 1LHEH 1HBTH 5F6MA 3BEUA 1YC0A 3HK3B 1OX1A 5DP6A 1N8OB 2OP9A 1AE8H 1K22H 2C8WB 4ABAA 2QYIA 1B0FA 1OWHA 4BTIB 1YPKH 4KP0A 3ZV8A 2ZGXH 1LKAA 2QF3A 1QRWA 2GMTC 1YCPM 1O3JA 9ESTA 1C1RA 1ZTLA 3K9XB 1SGDE 5BPEA 2NU0E 4ASHA 2PR3A 1HV7A 2STAE 4CHAB 4ESTE 2Z6BD 4ABHA 1F5KU 3SU3A 4MTBA 3GCHC 4GSOA 1P2MA 1QY6A 5T6FA 4K69A 1SOZA 3RXRA 1L1NA 3UNQA 1V2OT 3RXTA 3UUZA 3LDXH 3A85A 4ABJA 2DE9A 4ZHMU 1Y5AT 5FBIA 5ESBA 3S7HB 1DOJA 3SU2A 4E05H 3BTGE 5DP8A 2BZAA 3U98H 1AUTC 1SFQB 2A5IA 1T4UH 2HWLB 3ATLA 1ZR0A 2BMGB 2FYQA 1TE0A 3A8BA 1GBHA 1F7ZA 1TRYA 4ZXXH 1GHWH 7GCHF 4BAHB 1HAYB 1QL7A 2ZGBH 3E16B 1TPOA 2ODPA 1E35B 4XOJA 3K6YA 3RDZA 3V13A 1AI8H 3RXLA 2OD3B 3LU9B 2Z9IA 3TGKE 1DSUA 1UVTH 1WQSA 1J17T 4A1XA 1BUIA 1GDNA 1W2KH 2XBXA 1CGIE 3IWMA 3KF2A 2Y80A 1PQAA 1MKWH 2Q6GA 4ABDA 1ZOMA 3T29A 2A4RA 3ZZAA 3M7QA 3E1XB 1FAKH 1L2EA 3RC4A 5FAHA 3UNRA 1KLJH 1TB6H 1HAVA 1PQ7A 1A5HA 5T3HA 3PO1B 3RM2H 1AZZA 4IMZA 1UCYK 3U1IB 1EP6A 1C5LH 1H8IH 1UTNA 4MNXA 1OYTH 2Q6DA 4Y7AA 2ZHWH 3UNSA 5A0AE 1ELBA 3BSQA 2SNVA 3SV8A 2P94A 1TMBH 3EAJA 5E0JA 1ZRKA 2PGBB 3KQCA 1VJAU 2THFB 4UE7H 1NU7B 1F0TA 4XDEA 4Y8YA 2VH0A 2FOCA 2QY0B 3GICB 1Q2WA 2J2UA 1ELTA 1SHHB 3GY6A 1F2SE 3LGWA 8ESTE 2D8WA 1PFXC 4B73A 4O9VA 2QAAA 1XVOA 5IDKA 4E7NA 1EP5A 3AVZA 1L1JA 1TQ0B 2BD5A 2BLQA 2WPJS 1BDAA 1AKSA 2PKAA 2TGDA 4Y11E 2P3FH 3PROA 1YF4A 1E37B 1CHOF 2GVFA 3TH4H 1QHRB 4ZROA 3A7XA 4AG2A 1GWAA 2J34A 1C1UH 4CRGA 1WYKA 3HGNA 2F9NA 8GCHG 1IQMA 1GBTA 2PHBA 3UQOA 1A4WH 4Y0ZE 1LVYA 1A61H 3PWBA 1KY9A 1GHXH 4K1EA 4ISHH 4WWYA 2RG3A 1O3IA 3RXJA 4Q2KA 3ATIA 1A7SA 4CBNA 2G00A 3ZZ4A 3EA9A 1GMHF 2B5TB 4X1NU 3M7TA 3BTWE 1OYQA 1K1IA 1D3DB 4A6LA 4XSKU 1TNGA 4D7GA 3TITA 2BVXH 2IPHA 1NO9H 1THRH 3D62A 3K65B 1G2LA 2FDAA 3RLYH 2A7CA 1GBAA 2EI8A 3ZZBA 3S0NA 3MMGA 1LPZB 3TU7H 1T8MA 3MHWU 2RA3A 1GI8B 3AW0A 2ZCHP 3MYWA 1DWBH 3GY3A 1ZPZA 1M9UA 2GV7A 2HRVA 2VIVA 3QWCH 5AF9H 2PTNA 1XVMA 2OC8A 2VVVA 1TPPA 1OPHB 2A5KA 5E0HA 4B76A 1SC8U 1AB9C 3E8LA 3URCA 4Y8XA 1YYY1 5GDSH 5DGJA 4X8VH 3T5FH 1SLWB 3TJUA 1FQ3A 1LQDB 1S85A 2RCEA 1EQ9A 3HKIB 4MVNA 2M5TA 3HATH 3RMOH 2FIRH 2OC7A 1PYTD 4M7GA 1N8OC 1V2NT 1ARCA 2GCTC 1OOKB 1NFYA 1O38A 1MU8B 2HOBA 4ZKRU 3P8NA 3RXKA 3QN7A 2BY6X 3D49H 1ZTJA 4TYDA 1EJAA 3BTHE 2AGEX 3B8JA 3KNXA 1OXGA 1A0LA 5FX5A 4BAOB 3TK5A 1EZSC 2NU2E 2QC2A 3SJ9A 1IQGA 1KTSB 3R0FA 4ZAEA 1GMDG 2OLGA 4JZ1A 3GOVB 2VGCC 1V2WT 3B23B 2BDCA 1KDQA 2DUCA 3QUMP 3V3MA 1C4U2 1GJ7B 1NC6A 1C2HA 2ZGHA 1GL1A 1S81A 4O3UA 1GI9B 2XBVA 1RIWC 2SGFE 2GV6A 3BN9A 3SOSA 1MQ5A 3TNTA 4GHQA 3MWIU 4UFGH 3SHAH 5JDUB 1JBUH 4IGDA 1IQJA 2EC9H 4FUBA 2FOHA 3SQHE 3TK6A 1BZXE 4OS4A 3M3TA 1DUAA 5C5NA 2FPZA 3MNSA 5T6DA 3MU1A 1O2NA 1IQLA 1RXPA 1Y59T 4B2CA 1FIWA 3QTOH 1VITH 1P57B 2F9BH 4FXGH 1W3CA 2JKHA 1TPAE 4TWYA 1GBLA 2KAIB 1J9CH 1C1SA 2GZ9A 1GHBF 3L33A 4R0IA 3TK9A 1CHOG 1HCGA 5C67A 1XUHA 3LGVA 3Q77A 2FLRH 3KCGH 5GXPA 1KTTB 3F6UH 3W94A 1O3FA 1CT0E 1UCYE 2BDIA 3F9GA 1EPTC 1MTNB 2VNTA 2ZTXA 3Q00A 2BD3A 3P95A 1UTLM 1FPHH 1GGDC 3RXAA 3FZZA 2XCNA 2ZU4A 3M5NA 4K2YA 1GMHG 1KXCA 1ESTA 2BHGA 3UPEA 3SUFA 1Z6EA 1VR1H 3GCTG 1VCWA 1LPKB 5C1YA 5HM2A 2ZHDA 1WSSH 1UTKA 1QTFA 2PUQH 4Q7YA 4TY6A 2AEIH 4ISOA 1P03A 4BAMB 2CF8H 1HUTH 1DWEH 4AZ2B 2ZU3A 3RXQA 2BLWA 1C5VA 2ZCKP 5GWZA 2ZPQA 2V6NA 4I8KA 2ZA5A 1ZYOA 1C5RA 3L3TA 2W26A 1N6XA 1LCYA 1QBOA 4NA8A 1O3HA 1BTPA 1V2QT 1TNLA 2V35A 3SBKA 3GCOA 4INHA 2BD2A 1ZSJA 2A45B 2GTBA 1C5NH 1TWXB 1UO6A 1RGQA 1YLCA 2ZFFH 1S83A 1P02A 1MKWK 3RXVA 2P95A 1MCVA 1THSH 1TOCB 5E0GA 2BTCE 3NKKA 1SR5C 1EASA 1O5AB 1YLDA 5EG4A 2ZQ2A 4NZQA 3E91A 1WU1A 3O8DA 5AFZH 1TOMH 2VIWA 2FZZA 4U2WA 5EGMA 3AAVA 1SGNE 1YPHE 1GBBA 4GCHF 3PLPA 1GJBB 1HJAC 4SGAE 1LHFH 1YPGH 2WUCA 1HGTH 1GCTB 1BMLA 2WPHS 2BXUH 3I29A 4AORA 1WV7H 2PSXA 3RU4E 5EODA 3GY8A 5A2MH 4IBLH 1S6FA 1DICA 3RM0H 2ZNKH 1C1VH 1ZSLA 2F9OA 2WYJA 2W3IA 1MKXH 3SJIA 1FNIA 3RXDA 2A7JA 1GJ6A 3I77A 4D7FA 5FHTA 1HAIH 4JYVH 5A8XA 4Y76A 2VB0A 3UR6A 2BB4A 2GCHF 5JBBS 5EQRA 2A31A 2CXVA 3E0PB 3RXPA 2OC1A 1O32A 4LZ1H 2PWXA 3UQVA 3UFAA 3R3GB 1LQEA 3LOXA 4WJG2 2FX6A 5DP7A 1H8DH 1ZMJA 1ZHPA 1DM4B 3FP8E 2FXRA 3VEQB 1O5CB 2UUKB 3EGKH 3ZVEA 1K1JA 3ZZCA 4NIYA 2PUXB 1C1OA 1Y3XA 1V2ST 1LHCH 2FTMA 5AHGH 2FOAA 1JIMA 1W7GH 1TRNA 3ZV9A 1FY5A 5I46H 4XBDA 1GHBG 1SGRE 3KEEA 3GDSA 2ZF0H 1TX6A 5B6OA 3E3TA 4AB8A 1EAIA 2SGEE 1O2MA 1FY1A 1P9UA 2OUAA 4DT7B 4I8JA 1G3EA 2G5NA 2H2ZA 2FEQH 2A2XH 2C8ZB 2EI7A 1F92A 2ZDVH 1HB0B 1LVMA 1ZGIA 3KQDA 4AN7A 1CA0B 4WF8A 1J8AA 3GY2A 2ODYB 1ZPCA 1O3MA 2ZHFH 3UREA 1ELAA 1FDPA 3GY5A 1O2SA 2AH4X 3C27B 1O3PB 3LC5A 1G3DA 4DURA 1QBVH 4BXSA 2JETB 3SI4H 2A7HA 4NWKA 1L4DA 5JB9S 1W12U 3O8CA 5ESTE 1P06A 1XUIA 4K1TA 1ELFA 1NTPA 3RC5A 5I25A 1DX5M 1O3OA 5AFYH 3TGJE 4JMYA 1BTUA 1HLTH 3ZYEA 1T7CA 1GI2A 1PQ5A 2SGPE 4X6PA 1LMWB 2VWOA 3KIDU 1A0JA 3MI4A 1SPJA 2J9NA 1ETTH 2Y5GA 2LNCA 1KSNA 3VB6A 2JH5D 4TPIZ 1GHAG 1T8LA 1TA2A 3HK6B 1HIAA 2VJ1A 3U8RH 1MBMA 2GX4A 2QGRA 1O2UA 3U1JB 2D1JA 2ZDLA 1X7AC 3SORA 1JIRA 1GG6B 1C5ZB 1VGCC 3IG6B 2WPLS 1AVWA 3RU4D 1QRXA 1EOLA 1O2GH 1QRZA 1O2OA 1S5SA 1NRQH 4UEHH 1EXFA 2C8XB 2BLOA 3G01A 1L4ZA 1HRTH 3PV4A 5JPMH 1W11U 1A5GH 2OTVA 7KMEH 1G37A 1XXDA 5K7RA 1HJ8A 2W7SA 1THPB 2CHAB 4ZKSU 4LZ4B 1AWHB 2AGIX 4OS1A 4GCHG 1K2I1 3RXEA 2CF9H 1YPLH 3T28A 4MPWA 5TJXA 3EA7A 2VIOA 4X8TH 1O5GH 1HFDA 1ETSH 2WYGA 4I31A 1AO5A 2XW9A 2P59A 1V6DA 5EOKA 2BY7X 1N1LA 3SHCH 2BDYA 2FO9A 2XTTB 1OWJA 4K8YA 1ELEE 2ZFTA 1CE5A 2XC5A 2FS8A 2ZFQH 3TJNA 2J4IA 2IN2A 4FUIA 4Y6DA 5E8EH 3TVJB 1C2MA 1UTQA 2GP9B 4YLQH 1K9OE 1A0HB 3T26A 1O2HA 2P8OB 2ZO3H 4IMQA 1OP0A 1O37A 3EA8A 1UK2A 1BRAA 1O2ZA 1P2IA 5HXFA 3H7OA 3VB4A 2GCHG 1OWIA 3A80A 4I7YH 1ELDE 4MPVA 1CBWC 3JZ2B 1O3GA 3TPIZ 5EU8A 4ZKOU 2FMJA 4ABGA 1LPGB 1P2JA 3VFEA 2BVSH 1GVKB 3DA9B 1CU1A 2UWLA 1RTFB 1W13U 3SUDA 1RD3B 1FIZA 4Q7ZA 1U6QA 2OBQA 1DS2E 1LKBA 1VJ9U 3DFJA 1A2CH 2WV4A 4QT8C 4X0WU 1YKTA 4MLFB 3VB3A 3QDZB 1EOJA 2VINA 3ZZ6A 5FCKA 5T6GA 4J2YB 5JBAS 1GDQA 3RMNH 1IQNA 1EPTA 5C1XA 1GBFA 4X1QU 2F3CE 2Y81A 3F9HA 5JBCS 1GCTC 1TX7A 5JYIA 4Z0KA 4HZHA 2D2DA 2P93A 1GMDF 3O8BA 2AMDA 1GVLA 2Y7XA 3SV9A 1O3KA 5E2PA 1EZUC 1BBRE 1F5LA 2FX4A 2PKSB 2WUBA 5ABWA 1F0UA 3PTNA 4H42U 1HXEH 1OWEA 2NU1E 1UVSH 1C5WB 1O5DH 4MDSA 1GI6A 2OQ5A 3ZVFA 1S0RA 3A81A 1G36A 2XWAA 4MQAA 1EB2A 2PFEA 3ITIA 3OY6U 1JWTA 1BIOA 3CS0A 3BG8A 4H4FA 3GYLB 1YBWA 2O8UA 1BJVA 1C1PA 4MPXA 1BHXB 5F8XA 3HPTB 4DOQA 2TIOA 4X6NA 1P01A 2QV1A 4BAQB 1YPJH 1KIGH 1O2WA 2ZFSA 1BBRH 3RXOA 3RXUA 3LKWA 3MFJA 1C2DA 5J4QA 3OYPA 1QJ6B 2ZGCA 3PYHA 2BY5X 5EW2H 1C2FA 2TRMA 3ZVBA 1ZHRA 1GL0E 4RKJB 3M5LA 2RDLA 1TX8A 1SGIB 1G3BA 3BIUH 1ELCA 1ELGA 1O3NA 5DP4A 3FP7E 3TIUA 4ZKNU 2Z94A 3SGAE 4ISIH 4AYYB 1ANDA 4NG9H 4X8UH 1EATA 1AHTH 1C5SA 1XUGA 2Z9GA 5EXLA 3DUXH 1V2RT 4KGAA 1SI5H 2VVCA 2VWNA 1PQ8A 2GT7A 1SLUB 2H9EH 4AGJA 4IS5A 3ZVCA 2VIDA 1B5GH 3GCTF 2Y5HA 4U01A 2HALA 1MKXK 2FS9A 3M5OA 3ZZ3A 1C4V2 1Y3VA 1PYTC 4CRBA 1SOTA 1IAUA 1K1PA 3ZVDA 1FMGA 1AFQB 4LOYH 1AVXA 2ZEBA 1O2LA 4JZEH 4F49A 1WTGH 2A5AA 1SG8B 3Q76A 1HAPH 2JETC 2XBYA 1NFXA 1C5QA 5DPAA 2ZWLH 1IQKA 3MNCA 3A7ZA 4D76A 4DIHH 3GISB 1FUJA 3A7VA 3F9FA 4AFSA 1JRTA 5HGGA 5HYOA 5BRRE 1FPCH 1O3AA 4GLYA 1BRCE 2WPIS 1IQHA 5DJ7A 1QJ1B 1TIOA 1NS3A 2FTLE 1YCPH 1DITH 2ZTZA 3GCNA 4Q80A 1WBGB 3OTJE 4WH6A 1GMCF 1MBQA 5ETXA 1C1QA 5CHAB 3MH5A 1C2LA 4JYTA 1GG6C 1ANCA 3UWJH 4K60A 2ZFRH 2Y82A 3D23A 1O34A 1C5XB 1LVOA 1PPZA 2GDEH 4IW4E 1WUNH 2H9HA 1Y5UT 6CHAB 1BCUH 2AYWA 1CT4E 4D9RA 4HFPB 1SQTA 1XUFA 1C2IA 4DCDA 2XNIA 1J16A 4FUGA 3NPSA 1BMMH 1S82A 4NFEA 3A82A 1T31A 1D9IA 1O3BA 1D3TB 1PPFE 4NSYA 2JH0D 2SGQE 3PMBB 9LPRA 4GHTA 1MTSA 1XMNB 2BM2A 2Z3CA 3EYDA 1Z1JA 1FN6A 1KYNA 4CHAC 1N6YA 3UTUH 1JRSA 1TA6A 1E36B 1CT2E 1O2YA
chains in the Genus database with same CATH superfamily
1GHYH 2F83A 4I8HA 2AIQA 3DFLA 3LGYA 2CMYA 4YZUA 2C3SA 3P8FA 1IHTH 3A8DA 1NFUA 3MH4A 1V2JT 4BTTB 5EW1H 2G81E 1LO6A 1AZ8A 2XBWA 2ZCLP 2O8LA 3E6PH 3RXGA 1TGTA 1TNJA 1VITF 1NRSH 4KTSA 1SB1H 1NZQH 1BRUP 1LDTT 2ZTYA 4AFQA 4NWLA 1P2QA 3BG4B 2OBOA 5A8YA 1BHXF 3FANA 3SQEE 2RDEA 4LXBH 2JH6D 1S84A 2FOGA 1GJ4H 3UOUA 2BD7A 1OKXA 3URDA 1K1MA 2XC4A 3B9FH 1ZHMA 3VGCB 3UIRA 4KKDA 2AFQB 2KAIA 1TNHA 2Z7FE 2STBE 1F0RA 1ZJDA 1O2KA 2XWBI 2Y5FA 1WAYB 2ZGJA 4A1VA 3M7UA 3PWCA 4JZFH 1C4Y2 2V3MA 4FUEA 4WY3A 1VCPA 1ABIH 1OP2A 3PO1C 3SNEA 3GS9A 2EI6A 1QQ4A 2A4GA 1AFEH 4THNH 3PMJA 2UUFB 4ABBA 2WSSD 2PKSC 3E90B 2WPMS 1O5FH 4HTCH 1O2VA 3A7TA 1UK3A 4ZH8A 2QXHA 3SN8A 1SGYE 2HNTE 2WINI 2GMTB 2WHXA 1K1OA 4FUHA 4WVPE 4SGBE 3OX7U 5IYTA 2HNTF 2GGVB 1NESE 5C1UA 4YM9A 4FUFA 1DT2A 2VWLA 2FLBH 3ZVGA 1P05A 4IN2A 1O31A 2PW8H 4DG4A 2BQ7B 1GHZA 1MUEB 1IOEA 1HJ9A 3RUOA 2ZP0H 1GHAF 3M5MA 3GCHB 1O30A 3EQ0H 3H5CB 3OAAD 1EAWA 1AGJA 4F55A 2QF0A 1F5RA 3PLKA 5HM9A 2OINA 5FBEA 5C20A 4YOJA 2Y6TA 1SL3A 7LPRA 3WW7A 1NY22 2FOEA 1GDUA 1C9PA 2NWNA 5GJ4B 2FODA 3PMHB 3K6ZA 2BD8A 1H9IE 4UFDH 1KXDA 1GMCG 2PGQB 3DD2H 2AS9A 2BDGA 1G30B 3MU0A 2HGTH 1D6WA 2ZZUH 4H6TA 4ZHLU 4B2BA 1DANH 1P2OA 1Z6JH 2ZHQH 1SMFE 1C2EA 1XX9A 1GJ8B 1AY6H 1Z8JB 1DPOA 1FY3A 1KLIH 6ESTA 2AHME 3RXSA 1OWDA 3DSOA 4X8SH 1TGCA 3QO6A 4GAWA 2Q6FA 1GI0A 1GBMA 2P3UB 1C2KA 1CVWH 1DWCH 1TGSZ 1O2QA 3A84A 2QIQA 4VGCB 3NWUA 1O3EA 5LPEA 1BBRK 1D6RA 5C2ZA 1WQVH 3SNBA 2TGTA 5A0CA 2XOKD 2B0FA 3LIWA 2FI3E 3ODDA 1EX3A 3SW2B 1C5UA 1SGCA 5LH8A 1GVZA 1P04A 4U32A 3WY8A 5TCAA 3SNCA 3RMLH 4CH8B 2BX3A 1VITG 1O2IA 1WTHD 1DY8A 1T8NA 2A0QB 2BY9X 5C5OA 1EAXA 4NFFA 3TJOA 3P17H 1ZSKA 1E34B 1OSSA 2AMQA 1A5IA 1MZDA 4AX9H 1YM0A 2QXIA 1Z1IA 3U69H 1CO7E 3H7TA 2F91A 1KLTA 4YT7H 1NT1A 3LGUA 3SU4A 1MU6B 3QZQA 5DKMA 3PRDA 3SNDA 1MQ6A 1Y3UA 1QL9A 1MAYA 4I86A 3AASA 2RA0A 3P92A 2YMSB 1NRPH 4Y0YE 2TGPZ 4UDWH 1W10U 1YLNA 2C93B 1W0JD 4WMEA 1W14U 1YPEH 1MCTA 5PTPA 3E0NB 4I8LA 2D26C 3SV7A 3U8TH 1A1RA 2F9VA 3Q3YA 2Y7ZA 3SNAA 4GUXA 1NPMA 1CHGA 1FY8E 1UTJA 1UVUH 3IITA 1V3XA 4CR5A 4FU8A 3A8CA 1Z8IB 2HPPH 5EIYA 2W7UA 3BTDE 4CREA 1Z7KA 1VZQH 2QXGA 3GY7A 4TT3D 2OCVB 2PTCE 3KN2A 4BAKB 3RP2A 4NCYA 1O36A 2VIPA 1RS0A 2F9UA 2NU4E 1UVPA 4X6OA 5HMAA 1TALA 1T8OA 1YCPK 3QZRA 3SUGA 3LT3A 5GIBA 4NIVA 1QJ7B 1PPGE 4ABIA 5A0BA 1NM6A 4E7RG 4YOGA 1SBWA 2YNAA 1UHBB 2YOLA 3MU8A 2R9PA 3QX5H 3V12A 4OS2A 4ZCNA 3MQKC 1UVOA 3ZZ8A 4IN1A 3PMAB 2ZU2A 3BIVH 1H4WA 4YOIA 1A3BH 1P11E 1O3LA 5DP3A 3LJOA 2Q1JA 1YP9A 4M9FA 2TPIZ 1P3CA 5FL7D 2EY4C 1SLVB 3Q3XA 1CGHA 1C5OH 2EEKA 2AERH 1V2TT 2W3KA 4K8BA 2J94A 1O35A 2H5DA 3N7DA 4AYVB 2BDAA 1ZMNA 1AB9B 1ESBA 5GPIB 3LGTA 1GHVH 2XYAA 1MTNC 3CENA 4NGAH 1BTWA 1Y5BT 3BTFE 1HIAB 4AC9A 5KECA 1MZAA 1TNKA 4AFUA 4KELA 1GBIA 2ANWA 1V2MT 1LHDH 3D65E 2BQ6B 2G8TA 1KXAA 3MO6A 5TCCA 1AWFH 2GCTB 1NN6A 3N7EA 5CHBA 3C1KA 1TBRH 1C5PA 4X2WA 4BANB 1QQUA 3SV6A 1BMAA 2W6JD 1TGNA 4YESB 4X2XA 5LGOA 3OY5U 2G5VA 2SFAA 2ESTE 2Z9LA 4KTUA 1CQQA 2Z3EA 1TNIA 3LONA 4GVUA 3M36A 2Z9KA 2QCYA 1TPSA 4FUCA 3NUMA 1NRNH 5EQQA 4XBCA 5CMXH 2PLXA 1BB0B 2K0QA 3SU0A 3STIA 2CGAA 4Y8ZA 4ACBA 2F43B 5LPFA 1V2KT 2VGCB 1IQFA 1LVBA 3P70B 1XUKA 1GPZA 1C1WH 1ID5H 1SSXA 3A88A 3SUEA 4ABEA 1OWKA 1FJSA 2HVXA 1RIWB 3SO3A 2AMPA 1MTVA 3M37A 3Q3KA 2PSYA 4Q7XA 1V2PT 1INCA 1C5YB 1DY9A 5L6NH 5FPTA 4FUJA 1O2JA 2UUJB 4IC6A 4B2AA 2G55A 2V3HH 3SV2H 3ATKA 2XC0A 1MTUA 2YNBA 3TNSA 1CA8B 3FAOA 1FLEE 3STJA 3FZDA 2KX4A 4JYUH 5FX6A 3AAUA 1P8VC 3SJ8A 1PJPA 1Z71A 1F0SA 4JCNA 3MH6A 1NROH 1WCZA 3BEFB 1BT7A 4JK5A 2GT8A 1DUEA 2EQNA 2SNWA 4DIIH 3CP7A 5DP5A 1EPTB 1EZQA 4JZIA 4BXWA 1MH0A 2J92A 3BV9B 4VGCC 1CSOE 2FM2A 1OP8A 1ZZZA 4NA7A 4YT6H 1HAVB 1O5BB 3DT0H 1GGDB 1T32A 3L6PA 2W6ID 1W7XH 2LPRA 2F9PA 2ZDNA 1SQOA 2QF5A 2IJOB 1DDJA 5JB8S 5FPSA 1QFKH 1P9SA 1P10A 1BTXA 4X6MA 2DE8A 1NU9A 3I78A 1J14A 3ESTA 3T2NA 1G2MA 1SGFG 4CRCA 1D3QB 1K21H 2A4QA 2ZPRA 4JK6A 3S7KB 3ZZ5A 5LPRA 1BJUA 2ZHEH 2VH6A 1HAXB 4BOHA 1QCPA 2QF4A 1YWUA 4E06H 1ANEA 1RRKA 1O2RA 2XRCA 3SI3H 2R0KA 1EAUA 1UJ1A 4HI3A 4DJZB 1MTWA 2NU3E 1SHYA 3LPRA 4U30A 5E2OA 2YMSC 1DXWA 1NBME 4A5TS 1JXPA 3KL6A 3LH3A 4UFFH 3RXCA 4XBBA 1AKSB 1A46H 3SU1A 1ZMLA 2PKAB 3SU6A 3ATWA 1GBCA 3A83A 3GYMA 2BOHB 3LGIA 5H4IB 1SGTA 5FXLA 3M35A 2AGGX 2BYAX 2FP7B 1O2XA 1CA0C 2R2WU 2TBSA 6LPRA 2BLVA 1O0DH 2GKVE 4A1TA 4HGCA 5F8ZA 3MH7A 1FI8A 2A2QH 3VB5A 4YXWD 1SGQE 4RSPA 1FAXA 1BMNH 4X2VA 3ELAH 1GI4A 1KXFA 3N7OA 4O97A 3UR9A 1HJAB 4YO9A 3PRBA 4YTAA 3SZEA 1IQIA 1AD8H 1JOUB 1QNJA 2ALPA 3RXFA 3ZVAA 1TABE 1V2VT 3F1SB 2ODQA 1ZLRA 2ZDAH 4Z6AH 1GJDB 2G4UA 2FOBA 3FKSD 1TQ7B 4CBOA 1GBJA 1RJXB 1QB1A 1EKBB 1Q31A 1EJNA 4D9QA 3V0XA 1MMJN 4FU7A 1QURH 2V3OH 4OS6A 4ZUHA 3QGNB 2BDBA 3F3BA 1RTKA 3QGJA 4Y71A 3LC3A 4P02A 2BD9A 2HLCA 3K2UA 1ELVA 1K1NA 3EE0B 4ISNA 3BTME 1P12E 1UW7A 2SGAA 3LJJA 3MU5A 1B7XB 3SU5A 1C1MA 2SGDE 4WH8A 2KCYA 1FONA 2ANYA 4K5ZA 2I6SA 4FVBA 1RFNA 4NA9H 2FI4E 2O8MA 2BX4A 1DE7H 1C5TA 1CGJE 4X1SU 2CJIA 3P8GA 3PTBA 2FYRA 1BTYA 3BTTE 3T25A 2B9LA 1K28D 1MD7A 4JZDH 1GI7B 1PPBH 2Z9JA 1H1BA 5EXNA 1QIXB 5CE1A 3NZIA 2CHAC 7GCHG 2ANKH 1PPEE 3MTYA 2VU8E 2GDDA 2XCFA 1GCDA 1GBEA 4F4OC 1SFIA 4B71A 1AE5A 4WMFA 4BNRA 3EE7A 1B0EA 3SJKA 4TY7A 1DLEA 4X1RU 1TONA 3VB7A 2IOTA 2QN5T 2ZDMA 3P6ZB 5L2YH 1Y3WA 2A32A 2AIPA 1COWD 5EXMA 1DVAH 1XKAC 3ZZ9A 1P2KA 3U8OH 4ABFA 1BOQA 1DSTA 1P2NA 1FN8A 3RXMA 1IQEA 1C2JA 2BZ6H 3NCLA 5L30H 2H6MA 1SVPA 2TGAA 5EJ1A 2P8OC 1BQYA 5EPYA 4AOQA 1A3EH 1HAGE 1EB1H 2L74A 4OS7A 1IHSH 1ZRBA 2ZKSA 1TYNA 1HPGA 1NBMD 5C3NA 2ZFPH 1SLXB 6GCHF 1TBZH 1GI3A 1HDTH 1KDQB 2FI5E 3RLWH 2BXTH 3MOCA 5A09A 4Y10E 3HKJB 4IC5A 1FXYA 1S0QA 3TH3H 1GJ5H 2J95A 4CRAA 3S9BA 5GCHF 4FVDA 3PLBA 4X1PU 2C8YB 2XXLA 2A1DB 4A92A 3MU4A 2FOFA 4RT1A 3A87A 5EQSA 3M3VA 2A4OA 1C1NA 4I8GA 4PROA 2QA9E 3F68H 2OC0A 3FP6E 1UK4A 2ZU5A 2J38A 1S6HA 2UUYA 4B74A 4X2YA 5J4SA 4GPGA 3VPKA 3A7WA 2ZDKA 1VGCB 1SQRA 3ZZ7A 3UWIA 3NK8A 1EUFA 2O8TA 4WMDA 1C2GA 1H9LB 1UTOA 4XE4A 3BTEE 5KEDA 3P8OA 1HXFH 3GDVA 8LPRA 3OTPA 3UOPA 2P3TB 4TWWA 5F53A 1XUJA 5F03A 5K0HA 4UFEH 1UTMA 1FV9A 1G9IE 3U9AH 1L1GA 2VIQA 4CR9A 3KHVA 3OSYA 1GBDA 2BQWB 1TBQH 3MO3A 1SGFA 1AQ7A 2ZECA 1O2TA 2ALVA 1C1TA 4R8TB 1V2LT 3KQBA 3F9EA 4WXIA 1GBKA 5FCRA 1H9HE 4TPYA 2ZI2H 1DLKB 1G32B 2PV9B 4B1TA 4J1YA 2UWOA 4MPUA 2GZ7A 4WXVA 4XRNA 2H1UA 4YLUA 2BD4A 1UTPA 1ETRH 1RTLA 4DGJA 1LTOA 1DXPA 2KM0A 4D8NA 1UCYH 3MNBA 2ZIQH 2H9TH 3A89A 3BF6H 1AN1E 5DP9A 3VG8A 1W0YH 1TRMA 1QGFA 3BEIB 2ZPSA 1AU8A 2UWPA 3QK1A 1HAHH 1ACBE 2O9QA 4I33A 2R3YA 4A7IB 1HAOH 1ZGVA 1GJAB 1Q3XA 2FOMB 2O8WA 1GJ9B 2WV5A 1HAZB 8KME2 2WPKS 1GI5A 4XD7D 3UY9A 1CBWB 1E38B 3ODFA 1XM1A 3H09A 4Y79A 1BITA 3BTQE 1TGBA 3SGQE 3LH1A 1Y3YA 3PB1E 1G3CA 3S9CA 4RKOB 2ANMH 2K1QA 5FPYA 1AIXH 5DO4H 1D4PB 1DFPA 2W5EA 5DG6A 4XFQA 3DSPA 1BA8B 1QB6A 3PM3A 4OGXA 1KXBA 3RXBA 4MNVA 4AG1A 1XKBC 4NZLA 3TGIE 4ZMAH 1QA0A 3SGBE 1EZXC 3TH2H 1AFQC 3GY4A 2HNTC 3A7YA 4CRFA 2RFKC 1W0ZU 1XXFA 5SGAE 1MD8A 2B7DH 2QXJA 3BTKE 5A8ZA 5EJZA 1BTZA 4ISLA 3T62A 2BVRH 2R0LA 3RXHA 4O3TA 5DK1A 1QL8A 1ZTKA 3W95A 1HNEE 1KMHB 3S9AA 4AB9A 1LHGH 3ZZDA 1O39A 3HGPA 3QTVH 1KXEA 2R2MB 1VCQA 3ENSB 1K1LA 3ZYDA 3OEHD 1NFWA 2OXSA 1P3EA 5G4BA 4AFZA 4MNYA 1O3CA 2GZ8A 2BY8X 3NXPA 1QBNA 3AW1A 2FWWA 4MNWA 5CHAC 3WWBA 6GCHG 1FY4A 2ULLA 4K3JA 3QLPH 2P16A 3A8AA 2PP6A 4MG3A 2OQUA 1O33A 3KGPA 3T27A 4OS5A 1TAWA 1W8BH 1Z8RA 5F8TA 2Z3DA 3F0PA 2C90B 6CHAC 1TLDA 3FFGA 3VXEH 4FUDA 4AGKA 2HPQH 1WDIA 3RMMH 1YPHC 1O3DA 1BRBE 1O2PA 1QB9A 2ILNA 3OU0A 5GCHG 4BTUB 3TJVA 2CN0H 4INLA 3V7TA 5L2ZH 5AVDA 7ESTE 2FESH 3MO9A 4HG6A 3DHKH 2EA3A 1GI1A 4ASUD 1Z8GA 4UD9H 1C5MD 4F48B 4H6SB 1T4VH 3FVFB 1AUJA 4NIXA 1JMOH 2H5CA 1ANBA 1TMTH 1ABJH 1SGEE 4NSVA 1ORFA 1YPMH 2G4TA 3A86A 2ZG0H 4O03A 2C4FH 2WV9A 2R3UA 3F0OA 3RC6A 1YGCH 1AVGH 3VXFH 1SQAA 1L0ZA 1PPCE 4INKA 3SZNA 2GD4B 1OS8A 4I32A 1D3PB 2BOKA 4CH2B 3TLOA 4UONA 2ZU1A 2BDHA 5JBTA 1WXRA 1ZPBA 1EJMA 2B8OH 3JZ1B 3RU4T 3CS7A 1AMHA 4CRDA 4LK4A 1UHBA 3BG4C 2ZC9H 1Y8TA 2G52A 1BTHH 3SJOA 2ZQ1A 3EDXB 1J15A 3O8RA 1UMAH 1C9TA 1TMUH 1QA7A 2ASUB 3KQEA 2VWMA 1ESAA 4B75A 1SGPE 2I6QA 2VVUA 1QR3E 3GDUA 3M3SA 3RXIA 3VGCC 2G51A 1WOFA 4NIWA 1TFXA 3M61U 1MAXA 1DWDH 1ZJKA 1E79D 4DVAU 1P0SH 4RN6A 3MNXA 2V0BA 2CV3A 3ATMA 1ARBA 4OGYA 1FZZA 4ZXYH 4DY7B 3KQ5A 1GJCB 2QE7D 8GCHF 4OM9A 1E0FD 1NRRH 1V2UT 4ZHAA 1P09A 5EPNA 1HYLA 4KTCA 4K1SA 4Y7BA 3S69A 1PPHE 1O5EH 4DW2U 4FU9A 1LHEH 1HBTH 5F6MA 3BEUA 1YC0A 3HK3B 1OX1A 5DP6A 1N8OB 2OP9A 1AE8H 1K22H 3F2HA 2C8WB 4ABAA 2QYIA 1B0FA 4B6EA 1OWHA 4BTIB 1YPKH 4KP0A 3ZV8A 2ZGXH 1LKAA 2QF3A 1QRWA 2GMTC 1YCPM 1O3JA 9ESTA 1C1RA 1ZTLA 3K9XB 1SGDE 5BPEA 2NU0E 4ASHA 2PR3A 1HV7A 2STAE 4CHAB 4ESTE 2Z6BD 4ABHA 1F5KU 3SU3A 2J98A 4MTBA 3GCHC 4GSOA 1P2MA 1QY6A 5T6FA 3NRLA 4K69A 1SOZA 3RXRA 1L1NA 3UNQA 1V2OT 3RXTA 3UUZA 3LDXH 3A85A 4ABJA 2KZ4A 2DE9A 4ZHMU 1Y5AT 5FBIA 5ESBA 3S7HB 5C17A 1DOJA 3SU2A 4E05H 3BTGE 5DP8A 2BZAA 3U98H 1AUTC 1SFQB 2A5IA 1T4UH 2HWLB 3ATLA 1ZR0A 2BMGB 2FYQA 1TE0A 3A8BA 1GBHA 1F7ZA 1TRYA 4ZXXH 1GHWH 7GCHF 4BAHB 1HAYB 1QL7A 2ZGBH 3E16B 1TPOA 2ODPA 1E35B 3UAIC 4XOJA 3K6YA 3RDZA 3V13A 1AI8H 3RXLA 2OD3B 3LU9B 2Z9IA 3TGKE 1DSUA 1E1QD 1UVTH 1WQSA 1J17T 4A1XA 1BUIA 1GDNA 1W2KH 2XBXA 1CGIE 3IWMA 3KF2A 2Y80A 1PQAA 1MKWH 2Q6GA 4ABDA 1ZOMA 3T29A 2A4RA 3ZZAA 3M7QA 3E1XB 1FAKH 1L2EA 3RC4A 5FAHA 3UNRA 1KLJH 1TB6H 1HAVA 1PQ7A 1A5HA 5T3HA 3PO1B 3RM2H 1AZZA 4IMZA 1UCYK 3U1IB 1EP6A 1C5LH 1H8ED 1H8IH 1UTNA 4MNXA 5CDFE 1OYTH 2Q6DA 4P00A 4Y7AA 2ZHWH 3UNSA 5A0AE 1ELBA 3BSQA 2SNVA 3SV8A 2P94A 1TMBH 3EAJA 3WWFA 5E0JA 1ZRKA 2PGBB 3KQCA 1VJAU 2THFB 4UE7H 1NU7B 5DSFA 1F0TA 3FOAA 4XDEA 2VH0A 4Y8YA 2FOCA 2QY0B 3GICB 1Q2WA 2J2UA 1ELTA 1SHHB 3GY6A 1F2SE 3LGWA 8ESTE 2D8WA 1PFXC 4B73A 4O9VA 2QAAA 1XVOA 5IDKA 4E7NA 1EP5A 3AVZA 1L1JA 1TQ0B 2BD5A 2BLQA 2WPJS 1BDAA 1BMFD 1AKSA 2PKAA 2TGDA 4Y11E 2P3FH 3PROA 1YF4A 1E37B 1CHOF 2GVFA 3TH4H 1QHRB 4ZROA 3A7XA 4AG2A 1GWAA 2J34A 1C1UH 4CRGA 1WYKA 3HGNA 2F9NA 8GCHG 1IQMA 1GBTA 2PHBA 3UQOA 2JIZD 1A4WH 4Y0ZE 1LVYA 1A61H 3PWBA 1KY9A 1GHXH 4K1EA 4ISHH 4WWYA 2RG3A 1O3IA 3RXJA 5B6LA 4Q2KA 3ATIA 3FO8D 3UB0A 1A7SA 4CBNA 2G00A 3ZZ4A 3EA9A 1GMHF 2B5TB 4X1NU 3M7TA 3BTWE 5KGOA 1OYQA 1K1IA 3OEED 1D3DB 4A6LA 4XSKU 1TNGA 4D7GA 3TITA 2BVXH 2IPHA 1NO9H 1THRH 3D62A 3K65B 1G2LA 2FDAA 3RLYH 2A7CA 1GBAA 2EI8A 3ZZBA 3S0NA 3MMGA 1LPZB 3TU7H 1T8MA 3MHWU 2RA3A 1GI8B 3AW0A 2ZCHP 3MYWA 1DWBH 3GY3A 1ZPZA 1M9UA 2GV7A 2HRVA 2VIVA 3QWCH 5AF9H 2PTNA 5IK2D 1XVMA 2OC8A 2VVVA 1TPPA 1OPHB 2A5KA 5E0HA 4B76A 1SC8U 1AB9C 3E8LA 3URCA 4Y8XA 1YYY1 5GDSH 5DGJA 4X8VH 3T5FH 1SLWB 3TJUA 1S6LA 1FQ3A 1LQDB 1S85A 2RCEA 1EQ9A 3HKIB 4MVNA 5HIYA 2M5TA 3HATH 3RMOH 2FIRH 2OC7A 1PYTD 4M7GA 1N8OC 1V2NT 1ARCA 2GCTC 1OOKB 1NFYA 1O38A 1MU8B 2HOBA 4ZKRU 3P8NA 3RXKA 3QN7A 2BY6X 3D49H 1ZTJA 4TYDA 1EJAA 3BTHE 2AGEX 3B8JA 3KNXA 1OXGA 1A0LA 5FX5A 4BAOB 3TK5A 1EZSC 2NU2E 2QC2A 3SJ9A 1IQGA 1KTSB 3R0FA 4ZAEA 1GMDG 2OLGA 4JZ1A 3GOVB 5C94A 2VGCC 1V2WT 3B23B 2IJD1 2BDCA 2JJ2D 1KDQA 2DUCA 3QUMP 3V3MA 1C4U2 1GJ7B 1NC6A 1C2HA 2ZGHA 1GL1A 1S81A 4O3UA 1GI9B 2XBVA 1RIWC 2SGFE 2GV6A 3BN9A 3SOSA 1MQ5A 3TNTA 4GHQA 3MWIU 4UFGH 3SHAH 5JDUB 1JBUH 4IGDA 1IQJA 2EC9H 4FUBA 2FOHA 3SQHE 3TK6A 1BZXE 4OS4A 3M3TA 1DUAA 5C5NA 2FPZA 2J5UA 3MNSA 5T6DA 3MU1A 1O2NA 1IQLA 1RXPA 3OFND 1Y59T 4B2CA 1FIWA 3QTOH 1VITH 2J97A 1P57B 2OK5A 2F9BH 4FXGH 1W3CA 2JKHA 1TPAE 4TWYA 1GBLA 2KAIB 1J9CH 1C1SA 4Q63A 2GZ9A 1GHBF 3L33A 4R0IA 3TK9A 1CHOG 1HCGA 5C67A 1XUHA 3LGVA 3Q77A 2FLRH 3KCGH 5GXPA 1KTTB 3F6UH 3W94A 1O3FA 1CT0E 1UCYE 2BDIA 3F9GA 1EPTC 1MTNB 2VNTA 2ZTXA 3Q00A 2BD3A 3P95A 2KCAA 1UTLM 1FPHH 1GGDC 3RXAA 3FZZA 2XCNA 2ZU4A 3M5NA 4K2YA 1GMHG 1KXCA 1ESTA 2BHGA 3UPEA 3SUFA 1Z6EA 1VR1H 3GCTG 4FETA 1VCWA 1LPKB 5C1YA 2F4LA 5HM2A 2ZHDA 1WSSH 1UTKA 1QTFA 2PUQH 4Q7YA 2LELA 4TY6A 2AEIH 4ISOA 1P03A 4BAMB 2CF8H 1HUTH 1DWEH 4AZ2B 2ZU3A 3RXQA 2BLWA 3KYGA 1C5VA 2ZCKP 5GWZA 2ZPQA 2V6NA 4I8KA 2ZA5A 1ZYOA 1C5RA 3L3TA 2W26A 1N6XA 1LCYA 1QBOA 4NA8A 1O3HA 1BTPA 1V2QT 1OHHD 1TNLA 2V35A 2HVYB 4Q4LA 3SBKA 3GCOA 4INHA 2BD2A 1ZSJA 2A45B 2GTBA 1C5NH 1TWXB 1UO6A 1RGQA 1YLCA 2ZFFH 1S83A 1P02A 1MKWK 3RXVA 2P95A 1MCVA 1THSH 1TOCB 5E0GA 2BTCE 3NKKA 1SR5C 1EASA 1O5AB 1YLDA 5EG4A 2ZQ2A 4NZQA 2HLDD 3E91A 1WU1A 3O8DA 5AFZH 1TOMH 2VIWA 2FZZA 4U2WA 5EGMA 3AAVA 1SGNE 1YPHE 1GBBA 2IPQX 4GCHF 3PLPA 4Z1MD 1GJBB 1HJAC 4SGAE 1LHFH 1YPGH 2WUCA 1HGTH 1GCTB 1BMLA 2WPHS 4ACAA 2BXUH 3I29A 4AORA 1WV7H 2PSXA 3RU4E 5EODA 3GY8A 5A2MH 4IBLH 1S6FA 2K8IA 1DICA 2KFWA 3RM0H 2ZNKH 1C1VH 1ZSLA 2F9OA 2WYJA 3F2FA 2W3IA 1MKXH 3SJIA 1FNIA 3RXDA 2A7JA 1GJ6A 3I77A 4D7FA 5FHTA 1HAIH 4JYVH 5A8XA 4Y76A 2VB0A 3UR6A 2BB4A 2GCHF 5JBBS 5EQRA 2A31A 2CXVA 3E0PB 3RXPA 2OC1A 3CNRA 1O32A 4LZ1H 4RT0A 2PWXA 5GNDA 3UQVA 3UFAA 5HIZA 3R3GB 1LQEA 3LOXA 4WJG2 2FX6A 4B6FA 2WPDD 5DP7A 1H8DH 5DN6D 1ZMJA 1ZHPA 1DM4B 3FP8E 2FXRA 3VEQB 3DSGA 1O5CB 2UUKB 3AK5A 3EGKH 3ZVEA 1K1JA 3ZZCA 4NIYA 2PUXB 1C1OA 1Y3XA 1V2ST 1LHCH 2FTMA 5AHGH 2FOAA 1JIMA 1W7GH 1TRNA 3ZV9A 1FY5A 5I46H 4XBDA 1GHBG 1SGRE 3KEEA 3GDSA 2ZF0H 1TX6A 5B6OA 3E3TA 4AB8A 1EAIA 2SGEE 1O2MA 1FY1A 1P9UA 2OUAA 4DT7B 4I8JA 1G3EA 2G5NA 2H2ZA 2FEQH 2A2XH 1E1RD 2C8ZB 2EI7A 1F92A 2ZDVH 1HB0B 1LVMA 1ZGIA 3KQDA 4AN7A 1CA0B 4WF8A 3PV5A 1J8AA 1VKYA 2ODYB 3GY2A 3DCLA 1ZPCA 1O3MA 4FOUC 2ZHFH 3UREA 1ELAA 1FDPA 3GY5A 1O2SA 2AH4X 2WZQA 3C27B 1O3PB 3ZIAD 3LC5A 1G3DA 4DURA 1QBVH 4BXSA 2JETB 3SI4H 2A7HA 4NWKA 1L4DA 5JB9S 1W12U 3O8CA 2L6OA 5ESTE 1P06A 1XUIA 4K1TA 1ELFA 1NTPA 3PV2A 3RC5A 5I25A 1DX5M 1O3OA 5AFYH 3TGJE 4JMYA 1BTUA 1HLTH 3ZYEA 1T7CA 1GI2A 1PQ5A 2SGPE 4X6PA 3FN8A 2V7QD 1LMWB 2VWOA 3KIDU 1A0JA 3MI4A 1SPJA 2J9NA 1ETTH 2Y5GA 2LNCA 1KSNA 3VB6A 2JH5D 4TPIZ 1GHAG 4DT4A 1T8LA 1TA2A 2KCOA 3HK6B 1HIAA 2VJ1A 3U8RH 1MBMA 2GX4A 2QGRA 1O2UA 3U1JB 2D1JA 2ZDLA 1X7AC 3SORA 1JIRA 1GG6B 1C5ZB 1EFRD 1VGCC 3IG6B 2WPLS 1AVWA 3RU4D 1QRXA 1EOLA 2M2AA 1O2GH 1QRZA 1O2OA 1S5SA 1NRQH 4UEHH 1EXFA 2C8XB 2BLOA 3G01A 1L4ZA 1HRTH 3PV4A 5JPMH 5HKKD 1W11U 1A5GH 2OTVA 7KMEH 1G37A 1XXDA 5K7RA 1HJ8A 2W7SA 1THPB 2CHAB 4ZKSU 4LZ4B 1AWHB 2AGIX 4OS1A 4GCHG 1K2I1 3RXEA 2CF9H 1YPLH 3T28A 4MPWA 5TJXA 3EA7A 2VIOA 4X8TH 2JJ1D 1O5GH 1HFDA 1ETSH 2CK3D 2WYGA 4I31A 1AO5A 2XW9A 2P59A 1V6DA 5EOKA 2BY7X 1N1LA 3SHCH 2BDYA 2FO9A 2XTTB 1OWJA 4K8YA 1ELEE 2ZFTA 1CE5A 2XC5A 2FS8A 2ZFQH 3TJNA 2J4IA 2IN2A 4FUIA 4Y6DA 5E8EH 3TVJB 1C2MA 1UTQA 2GP9B 4YLQH 1K9OE 1A0HB 3T26A 3KYFA 1O2HA 2P8OB 2ZO3H 4IMQA 3F2GA 1OP0A 1O37A 3EA8A 1UK2A 1BRAA 5T1VA 1O2ZA 1P2IA 5HXFA 3H7OA 3VB4A 2GCHG 1OWIA 3A80A 2J98B 1ELDE 4MPVA 4I7YH 1CBWC 3JZ2B 1O3GA 3TPIZ 5EU8A 4ZKOU 1FX0B 2FMJA 2LP6A 4ABGA 1LPGB 1P2JA 3VFEA 2BVSH 1GVKB 3DA9B 1CU1A 2UWLA 1RTFB 1W13U 3SUDA 1RD3B 1FIZA 4Q7ZA 1U6QA 2OBQA 1DS2E 1LKBA 1VJ9U 3DFJA 1A2CH 2WV4A 4QT8C 4X0WU 1YKTA 4MLFB 3VB3A 3SYJA 3QDZB 1EOJA 2VINA 3ZZ6A 5FCKA 5T6GA 4J2YB 5JBAS 1GDQA 3RMNH 1IQNA 1EPTA 5C1XA 1GBFA 4X1QU 2F3CE 2Y81A 3F9HA 1QZ8A 5JBCS 1GCTC 1TX7A 5JYIA 4Z0KA 4HZHA 2D2DA 2P93A 1GMDF 3O8BA 2AMDA 1GVLA 2Y7XA 3SV9A 1O3KA 5E2PA 1EZUC 1BBRE 1F5LA 1YY3A 2FX4A 2PKSB 2WUBA 5ABWA 1F0UA 3PTNA 4H42U 1HXEH 1OWEA 2NU1E 1UVSH 2KCPA 1C5WB 1O5DH 4MDSA 1GI6A 2OQ5A 3ZVFA 1S0RA 3A81A 1G36A 2XWAA 4MQAA 1EB2A 2PFEA 3ITIA 3OY6U 1JWTA 1BIOA 3CS0A 3BG8A 4H4FA 2GJGA 3GYLB 1YBWA 2O8UA 1BJVA 1C1PA 4MPXA 1BHXB 5F8XA 3HPTB 4DOQA 2TIOA 4X6NA 1P01A 2QV1A 4BAQB 1YPJH 1KIGH 1O2WA 2ZFSA 3OE7D 5EJLA 1BBRH 3RXOA 3RXUA 3N99A 3LKWA 3MFJA 1C2DA 5J4QA 3OYPA 1QJ6B 2ZGCA 3PYHA 2BY5X 5EW2H 1C2FA 2TRMA 3ZVBA 1ZHRA 1GL0E 4RKJB 3M5LA 2RDLA 1TX8A 1SGIB 1G3BA 3BIUH 1ELCA 1ELGA 1O3NA 5DP4A 3FP7E 3TIUA 4ZKNU 2Z94A 3SGAE 2JDID 4ISIH 4AYYB 1ANDA 4NG9H 4TSFD 1EATA 4X8UH 1AHTH 1C5SA 1XUGA 2Z9GA 5EXLA 3DUXH 1V2RT 4KGAA 1SI5H 2VVCA 2VWNA 1PQ8A 1H8HD 2GT7A 1SLUB 2H9EH 4AGJA 4IS5A 2VBCA 3ZVCA 2VIDA 1B5GH 3GCTF 2Y5HA 4U01A 2HALA 1MKXK 2FS9A 3M5OA 3ZZ3A 1C4V2 1Y3VA 1PYTC 4CRBA 1SOTA 1IAUA 1K1PA 3ZVDA 1FMGA 1SKYE 1AFQB 4LOYH 1AVXA 2ZEBA 1O2LA 4JZEH 4F49A 1WTGH 2A5AA 1SG8B 3Q76A 1HAPH 1MABB 2JETC 2XBYA 1NFXA 1C5QA 5DPAA 2ZWLH 3W1EA 1IQKA 3MNCA 3A7ZA 4D76A 2XNDD 3GISB 4DIHH 1FUJA 3A7VA 3F9FA 4AFSA 1JRTA 5HGGA 5HYOA 5BRRE 2KR7A 1FPCH 1O3AA 4GLYA 1BRCE 2WPIS 1W0KD 1IQHA 4RI0A 5DJ7A 1QJ1B 2YMSD 1TIOA 1NS3A 2FTLE 1YCPH 1DITH 2ZTZA 3GCNA 1K0HA 4Q80A 1WBGB 3OTJE 4WH6A 1GMCF 1MBQA 5ETXA 1C1QA 5CHAB 3MH5A 1C2LA 4JYTA 1GG6C 1ANCA 3UWJH 4K60A 2ZFRH 2Y82A 5C0TA 3D23A 1O34A 1C5XB 1LVOA 1PPZA 2GDEH 4IW4E 1WUNH 2H9HA 1Y5UT 6CHAB 1BCUH 2AYWA 1CT4E 4D9RA 4HFPB 1SQTA 1XUFA 3U28C 1C2IA 4DCDA 2XNIA 1J16A 4FUGA 3NPSA 1BMMH 1S82A 4NFEA 3A82A 1T31A 1D9IA 1O3BA 1D3TB 1PPFE 4NSYA 2JH0D 2SGQE 3PMBB 5C0UA 9LPRA 4GHTA 1MTSA 1XMNB 2BM2A 2Z3CA 3EYDA 1Z1JA 1FN6A 1KYNA 4CHAC 1N6YA 3UTUH 1JRSA 1TA6A 1E36B 1CT2E 1O2YA
chains in the Genus database with same CATH topology
1GHYH 2F83A 4I8HA 2AIQA 3DFLA 3LGYA 2CMYA 4YZUA 2C3SA 3P8FA 1IHTH 3A8DA 1NFUA 3MH4A 1V2JT 4BTTB 5EW1H 2G81E 1LO6A 1AZ8A 2XBWA 2ZCLP 2O8LA 3E6PH 3RXGA 1TGTA 1TNJA 1VITF 1NRSH 4KTSA 1SB1H 1NZQH 1BRUP 1LDTT 2ZTYA 4AFQA 4NWLA 1P2QA 3BG4B 2OBOA 5A8YA 1BHXF 3FANA 3SQEE 4LXBH 2JH6D 1S84A 2FOGA 1GJ4H 3UOUA 2BD7A 1OKXA 3URDA 1K1MA 2XC4A 3B9FH 1ZHMA 3VGCB 3UIRA 4KKDA 2AFQB 2KAIA 1TNHA 2Z7FE 2STBE 1F0RA 1ZJDA 1O2KA 2XWBI 2Y5FA 1WAYB 2ZGJA 4A1VA 3M7UA 3PWCA 4JZFH 1C4Y2 4FUEA 4WY3A 1VCPA 1ABIH 1OP2A 3PO1C 3SNEA 2EI6A 1QQ4A 2A4GA 1AFEH 4THNH 3PMJA 2UUFB 4ABBA 4HTCH 2PKSC 3E90B 2WPMS 1O5FH 1O2VA 3A7TA 1UK3A 4ZH8A 2QXHA 3SN8A 1SGYE 2HNTE 2WINI 2GMTB 1K1OA 4FUHA 4WVPE 4SGBE 3OX7U 5IYTA 2HNTF 2GGVB 1NESE 5C1UA 4YM9A 4FUFA 1DT2A 2VWLA 2FLBH 3ZVGA 1P05A 4IN2A 1O31A 2PW8H 4DG4A 2BQ7B 1GHZA 1MUEB 1IOEA 1HJ9A 3RUOA 2ZP0H 1GHAF 3M5MA 3GCHB 1O30A 3EQ0H 3H5CB 1EAWA 1AGJA 2QF0A 1F5RA 3PLKA 5HM9A 2OINA 5FBEA 5C20A 4YOJA 2Y6TA 1SL3A 7LPRA 1NY22 2FOEA 1GDUA 1C9PA 2NWNA 5GJ4B 2FODA 3PMHB 3K6ZA 2BD8A 1H9IE 4UFDH 1KXDA 1GMCG 2PGQB 3DD2H 2AS9A 2BDGA 1G30B 3MU0A 2HGTH 1D6WA 2ZZUH 4H6TA 4ZHLU 4B2BA 1DANH 1P2OA 1Z6JH 2ZHQH 1SMFE 1C2EA 1XX9A 1GJ8B 1AY6H 1Z8JB 1DPOA 1FY3A 1KLIH 6ESTA 3RXSA 1OWDA 4X8SH 1TGCA 3QO6A 4GAWA 2Q6FA 1GI0A 1GBMA 2P3UB 1C2KA 1CVWH 1DWCH 1TGSZ 1O2QA 3A84A 2QIQA 4VGCB 3NWUA 1O3EA 5LPEA 1BBRK 1D6RA 5C2ZA 1WQVH 3SNBA 2TGTA 5A0CA 3ODDA 2B0FA 3LIWA 2FI3E 3SW2B 1EX3A 1C5UA 1SGCA 5LH8A 1GVZA 1P04A 4U32A 3WY8A 5TCAA 3SNCA 3RMLH 4CH8B 2BX3A 1VITG 1O2IA 1WTHD 1DY8A 1T8NA 2A0QB 2BY9X 5C5OA 1EAXA 4NFFA 3TJOA 3P17H 1ZSKA 1E34B 1OSSA 2AMQA 1A5IA 1MZDA 4AX9H 1YM0A 2QXIA 1Z1IA 3U69H 1CO7E 3H7TA 2F91A 1KLTA 4YT7H 1NT1A 3LGUA 3SU4A 1MU6B 3QZQA 5DKMA 3SNDA 1MQ6A 1Y3UA 1QL9A 1MAYA 3AASA 2RA0A 3P92A 1NRPH 4Y0YE 2TGPZ 4UDWH 1W10U 2C93B 4WMEA 1W14U 1YPEH 1MCTA 5PTPA 3E0NB 4I8LA 2D26C 3SV7A 3U8TH 1A1RA 2F9VA 3Q3YA 2Y7ZA 3SNAA 4GUXA 1NPMA 1CHGA 1FY8E 1UTJA 1UVUH 3IITA 1V3XA 4CR5A 4FU8A 3A8CA 1Z8IB 2HPPH 2W7UA 3BTDE 4CREA 1Z7KA 1VZQH 2QXGA 3GY7A 2OCVB 2PTCE 3KN2A 4BAKB 3RP2A 4NCYA 1O36A 2VIPA 1RS0A 2F9UA 2NU4E 1UVPA 4X6OA 5HMAA 1TALA 1T8OA 1YCPK 3QZRA 3SUGA 3LT3A 5GIBA 4NIVA 1QJ7B 1PPGE 4ABIA 5A0BA 1NM6A 4E7RG 4YOGA 1SBWA 2YNAA 1UHBB 2YOLA 3MU8A 2R9PA 3QX5H 3V12A 4OS2A 1UVOA 3ZZ8A 4IN1A 3PMAB 2ZU2A 3BIVH 1H4WA 4YOIA 1A3BH 1P11E 1O3LA 5DP3A 3LJOA 2Q1JA 1YP9A 2TPIZ 1P3CA 1SLVB 3Q3XA 1CGHA 1C5OH 2EEKA 2AERH 1V2TT 2W3KA 4K8BA 2J94A 1O35A 2H5DA 4AYVB 2BDAA 1ZMNA 1AB9B 1ESBA 5GPIB 3LGTA 1GHVH 2XYAA 1MTNC 3CENA 4NGAH 1BTWA 1Y5BT 3BTFE 1HIAB 1MZAA 1TNKA 4AFUA 4KELA 1GBIA 2ANWA 1V2MT 1LHDH 3D65E 2BQ6B 2G8TA 1KXAA 3MO6A 5TCCA 1AWFH 2GCTB 1NN6A 3C1KA 1TBRH 1C5PA 4X2WA 4BANB 1QQUA 3SV6A 1BMAA 1TGNA 4YESB 4X2XA 5LGOA 3OY5U 2G5VA 2SFAA 2ESTE 2Z9LA 4KTUA 1CQQA 2Z3EA 1TNIA 3LONA 4GVUA 3M36A 2Z9KA 2QCYA 1TPSA 4FUCA 3NUMA 1NRNH 5EQQA 4XBCA 5CMXH 2PLXA 1BB0B 3SU0A 3STIA 2CGAA 4Y8ZA 5LPFA 1V2KT 2VGCB 1IQFA 1LVBA 3P70B 1XUKA 1GPZA 1C1WH 1ID5H 1SSXA 3A88A 3SUEA 4ABEA 1OWKA 1FJSA 2HVXA 1RIWB 3SO3A 2AMPA 1MTVA 3M37A 3Q3KA 2PSYA 4Q7XA 1V2PT 1INCA 1C5YB 1DY9A 5L6NH 5FPTA 4FUJA 1O2JA 2UUJB 4IC6A 4B2AA 2G55A 2V3HH 3SV2H 3ATKA 2XC0A 1MTUA 2YNBA 3TNSA 1CA8B 3FAOA 1FLEE 3STJA 3FZDA 4JYUH 5FX6A 3AAUA 1P8VC 3SJ8A 1PJPA 1Z71A 1F0SA 4JCNA 3MH6A 1NROH 1WCZA 3BEFB 1BT7A 4JK5A 2GT8A 1DUEA 2SNWA 4DIIH 3CP7A 5DP5A 1EPTB 1EZQA 4JZIA 4BXWA 1MH0A 2J92A 3BV9B 4VGCC 1CSOE 2FM2A 1OP8A 1ZZZA 4NA7A 4YT6H 1HAVB 1O5BB 3DT0H 1GGDB 1T32A 3L6PA 1W7XH 2LPRA 2F9PA 2ZDNA 1SQOA 2IJOB 1DDJA 5JB8S 5FPSA 1QFKH 1P9SA 1P10A 1BTXA 4X6MA 2DE8A 1NU9A 3I78A 1J14A 3ESTA 3T2NA 1G2MA 1SGFG 4CRCA 1D3QB 1K21H 2A4QA 2ZPRA 4JK6A 3S7KB 3ZZ5A 5LPRA 1BJUA 2ZHEH 2VH6A 1HAXB 4BOHA 1QCPA 4E06H 1ANEA 1RRKA 1O2RA 2XRCA 3SI3H 2R0KA 1EAUA 1UJ1A 4HI3A 4DJZB 1MTWA 2NU3E 1SHYA 3LPRA 4U30A 5E2OA 1DXWA 4A5TS 1JXPA 3KL6A 3LH3A 4UFFH 3RXCA 4XBBA 1AKSB 1A46H 3SU1A 1ZMLA 2PKAB 3SU6A 3ATWA 1GBCA 3A83A 3GYMA 2BOHB 3LGIA 5H4IB 1SGTA 5FXLA 3M35A 2AGGX 2BYAX 2FP7B 1O2XA 1CA0C 2R2WU 2TBSA 6LPRA 2BLVA 1O0DH 2GKVE 4A1TA 4HGCA 5F8ZA 3MH7A 1FI8A 2A2QH 3VB5A 1SGQE 4RSPA 1FAXA 1BMNH 4X2VA 3ELAH 1GI4A 1KXFA 3N7OA 4O97A 3UR9A 1HJAB 4YO9A 4YTAA 1IQIA 1AD8H 1JOUB 1QNJA 2ALPA 3RXFA 3ZVAA 1TABE 1V2VT 3F1SB 2ODQA 1ZLRA 2ZDAH 4Z6AH 1GJDB 2G4UA 2FOBA 4CBOA 1TQ7B 1GBJA 1RJXB 1QB1A 1EKBB 1Q31A 1EJNA 4D9QA 3V0XA 1MMJN 4FU7A 1QURH 2V3OH 4OS6A 4ZUHA 3QGNB 2BDBA 3QGJA 1RTKA 4Y71A 3LC3A 2BD9A 2HLCA 3K2UA 1ELVA 1K1NA 3EE0B 4ISNA 3BTME 1P12E 2SGAA 3LJJA 3MU5A 1B7XB 3SU5A 1C1MA 2SGDE 4WH8A 1FONA 2ANYA 4K5ZA 2I6SA 4FVBA 1RFNA 4NA9H 2FI4E 2O8MA 2BX4A 1DE7H 1C5TA 1CGJE 4X1SU 2CJIA 3P8GA 3PTBA 2FYRA 1BTYA 3BTTE 3T25A 2B9LA 1K28D 1MD7A 4JZDH 1GI7B 1PPBH 2Z9JA 1H1BA 5EXNA 1QIXB 5CE1A 3NZIA 2CHAC 7GCHG 2ANKH 1PPEE 3MTYA 2VU8E 2GDDA 2XCFA 1GCDA 1GBEA 4F4OC 1SFIA 4B71A 1AE5A 4WMFA 4BNRA 1B0EA 3SJKA 4TY7A 1DLEA 4X1RU 1TONA 3VB7A 2IOTA 2QN5T 2ZDMA 3P6ZB 5L2YH 1Y3WA 2A32A 2AIPA 5EXMA 1DVAH 1XKAC 3ZZ9A 1P2KA 3U8OH 4ABFA 1BOQA 1DSTA 1P2NA 1FN8A 3RXMA 1IQEA 1C2JA 2BZ6H 3NCLA 5L30H 2H6MA 1SVPA 2TGAA 2P8OC 1BQYA 5EPYA 4AOQA 1A3EH 1HAGE 1EB1H 4OS7A 1IHSH 1ZRBA 2ZKSA 1TYNA 1HPGA 5C3NA 2ZFPH 1SLXB 6GCHF 1TBZH 1GI3A 1HDTH 1KDQB 2FI5E 3RLWH 2BXTH 3MOCA 5A09A 4Y10E 3HKJB 4IC5A 1FXYA 1S0QA 3TH3H 1GJ5H 2J95A 4CRAA 3S9BA 5GCHF 4FVDA 3PLBA 4X1PU 2C8YB 2XXLA 2A1DB 4A92A 3MU4A 2FOFA 3A87A 5EQSA 3M3VA 2A4OA 1C1NA 4I8GA 4PROA 2QA9E 3F68H 2OC0A 3FP6E 1UK4A 2ZU5A 2J38A 1S6HA 2UUYA 4B74A 4X2YA 5J4SA 4GPGA 3VPKA 3A7WA 2ZDKA 1VGCB 3ZZ7A 3UWIA 3NK8A 1EUFA 2O8TA 4WMDA 1C2GA 1H9LB 1UTOA 4XE4A 3BTEE 3P8OA 1HXFH 3GDVA 8LPRA 3UOPA 2P3TB 4TWWA 1XUJA 5F03A 5K0HA 4UFEH 1UTMA 1FV9A 1G9IE 3U9AH 1L1GA 2VIQA 4CR9A 3KHVA 3OSYA 1GBDA 2BQWB 1TBQH 3MO3A 1SGFA 1AQ7A 2ZECA 1O2TA 2ALVA 1C1TA 4R8TB 1V2LT 3KQBA 3F9EA 4WXIA 1GBKA 5FCRA 1H9HE 4TPYA 2ZI2H 1DLKB 1G32B 2PV9B 4B1TA 4J1YA 2UWOA 4MPUA 2GZ7A 4WXVA 2H1UA 4YLUA 2BD4A 1UTPA 1ETRH 1RTLA 4DGJA 1LTOA 1DXPA 4D8NA 1UCYH 3MNBA 2ZIQH 2H9TH 3A89A 3BF6H 1AN1E 5DP9A 1W0YH 1TRMA 1QGFA 3BEIB 2ZPSA 1AU8A 2UWPA 3QK1A 1HAHH 1ACBE 2O9QA 4I33A 2R3YA 4A7IB 1HAOH 1ZGVA 1GJAB 1Q3XA 2FOMB 2O8WA 1GJ9B 2WV5A 1HAZB 8KME2 2WPKS 1GI5A 3UY9A 1CBWB 1E38B 3ODFA 1XM1A 4Y79A 1BITA 3BTQE 1TGBA 3SGQE 3LH1A 1Y3YA 3PB1E 1G3CA 3S9CA 4RKOB 2ANMH 2K1QA 5FPYA 1AIXH 5DO4H 1D4PB 1DFPA 2W5EA 5DG6A 4XFQA 1BA8B 1QB6A 3PM3A 4OGXA 1KXBA 3RXBA 4MNVA 4AG1A 1XKBC 4NZLA 3TGIE 4ZMAH 1QA0A 3SGBE 1EZXC 3TH2H 1AFQC 3GY4A 2HNTC 3A7YA 4CRFA 1W0ZU 1XXFA 5SGAE 1MD8A 2B7DH 2QXJA 3BTKE 5A8ZA 1BTZA 4ISLA 3T62A 2BVRH 2R0LA 3RXHA 4O3TA 5DK1A 1QL8A 1ZTKA 3W95A 1HNEE 3S9AA 4AB9A 1LHGH 3ZZDA 1O39A 3HGPA 3QTVH 1KXEA 2R2MB 1VCQA 3ENSB 1K1LA 3ZYDA 1NFWA 2OXSA 1P3EA 5G4BA 4AFZA 4MNYA 1O3CA 2GZ8A 2BY8X 3NXPA 1QBNA 3AW1A 2FWWA 4MNWA 5CHAC 6GCHG 1FY4A 2ULLA 4K3JA 3QLPH 2P16A 3A8AA 4MG3A 2OQUA 1O33A 3KGPA 3T27A 4OS5A 1TAWA 1W8BH 1Z8RA 5F8TA 2Z3DA 2C90B 6CHAC 1TLDA 3FFGA 3VXEH 4FUDA 4AGKA 2HPQH 3RMMH 1YPHC 1O3DA 1BRBE 1O2PA 1QB9A 2ILNA 3OU0A 5GCHG 4BTUB 3TJVA 2CN0H 4INLA 3V7TA 5L2ZH 5AVDA 7ESTE 2FESH 3MO9A 3DHKH 2EA3A 1GI1A 1Z8GA 4UD9H 1C5MD 4H6SB 1T4VH 3FVFB 1AUJA 4NIXA 1JMOH 2H5CA 1ANBA 1TMTH 1ABJH 1SGEE 4NSVA 1ORFA 1YPMH 2G4TA 3A86A 2ZG0H 4O03A 2C4FH 2R3UA 3RC6A 1YGCH 1AVGH 3VXFH 1SQAA 1L0ZA 1PPCE 4INKA 3SZNA 2GD4B 1OS8A 4I32A 1D3PB 2BOKA 4CH2B 3TLOA 4UONA 2ZU1A 2BDHA 5JBTA 1ZPBA 1EJMA 2B8OH 3JZ1B 3RU4T 3CS7A 1AMHA 4CRDA 4LK4A 1UHBA 3BG4C 2ZC9H 1Y8TA 2G52A 1BTHH 3SJOA 2ZQ1A 3EDXB 1J15A 3O8RA 1UMAH 1C9TA 1TMUH 1QA7A 2ASUB 3KQEA 2VWMA 1ESAA 4B75A 1SGPE 2I6QA 2VVUA 1QR3E 3GDUA 3M3SA 3RXIA 3VGCC 2G51A 1WOFA 4NIWA 1TFXA 3M61U 1MAXA 1DWDH 1ZJKA 4DVAU 1P0SH 4RN6A 3MNXA 2V0BA 2CV3A 3ATMA 1ARBA 4OGYA 1FZZA 4ZXYH 4DY7B 1GJCB 8GCHF 1E0FD 1NRRH 1V2UT 4ZHAA 1P09A 5EPNA 1HYLA 4KTCA 4K1SA 4Y7BA 3S69A 1PPHE 1O5EH 4DW2U 4FU9A 1LHEH 1HBTH 5F6MA 3BEUA 1YC0A 3HK3B 1OX1A 5DP6A 1N8OB