2FXRA

Human beta tryptase ii complexed with activated ketone inhibitor cra-29382
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
243
structure length
243
Chain Sequence
IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-guided design of Peptide-based tryptase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Tryptase beta-2
total genus 49
structure length 243
sequence length 243
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.59: Tryptase.
pdb deposition date 2006-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fxrA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fxrA01
1HDTH 4XFQA 2O8UA 1GHVH 4D8NA 2ZCLP 3RXBA 2NU1E 1ETSH 4MPXA 4ESTE 4MG3A 1HRTH 4ABHA 3O8RA 4IW4E 3TK9A 3V3MA 2BX3A 3UIRA 1EQ9A 1EP5A 3HGPA 8ESTE 3UY9A 2STBE 1SGIB 4FUJA 2A5IA 1LDTT 3RUOA 4LZ1H 1O5FH 8GCHG 1TRMA 5A8ZA 2F3CE 2XTTB 1HYLA 1DANH 1OYQA 2CF9H 2C8ZB 2BOKA 1FDPA 5H4IB 3UTUH 1GHBG 1MUEB 8KME2 4FUHA 2HNTF 1ZPBA 3G01A 3PV4A 4ZKOU 1GJBB 1LVOA 5L30H 5CHAB 5E0HA 4HGCA 5IDKA 2TGDA 1XMNB 1K2I1 1OXGA 4CRGA 1SPJA 4MNYA 4AORA 5CHAC 1CT0E 2CHAB 2FESH 2JH6D 2Z3CA 1GJ5H 2WV4A 4A92A 1D9IA 2GTBA 1LKBA 4ISOA 3ZVGA 4AOQA 2J34A 1P2NA 1P9UA 1SFQB 4U2WA 4XE4A 5E2OA 3LGUA 3S0NA 3EYDA 2P94A 1O2ZA 3RLYH 3U8TH 1ZSLA 2BY6X 1O2TA 1Q2WA 1JMOH 1EB2A 5PTPA 1EAXA 4A1VA 1DX5M 3PO1C 1YM0A 2HGTH 2OC8A 2NU2E 1K1MA 1BMAA 4FUEA 2DE8A 4NSYA 4ISHH 4ZUHA 2F9UA 1C5MD 3ZZ7A 3HK6B 1DWDH 4IMZA 2JETC 2QY0B 4CRFA 1C2LA 3SJOA 1MQ5A 1SC8U 4BTTB 5F8TA 1Q31A 1MU6B 2WPMS 1TIOA 4E7NA 1H8IH 1TB6H 3PMJA 3DFLA 3SU5A 3M35A 2ZHWH 1TX7A 3PTBA 3GCOA 1VITF 3BTEE 4GAWA 4INLA 2W26A 1A46H 1CT2E 2EC9H 2DE9A 2ANMH 2G00A 4BAKB 3RMOH 1W10U 1BDAA 3QK1A 3ZZ5A 1YPKH 1TRYA 1B5GH 1AIXH 1DLKB 2O8MA 3K2UA 3TJNA 1CA0C 1UTLM 3A86A 1C2GA 4ABIA 4BXSA 2A7HA 1BZXE 4Y6DA 3B23B 5DP4A 4YZUA 3GY5A 3M5OA 3A8AA 4ISIH 1A1RA 2ESTE 2FYQA 2SGQE 4E06H 4Z0KA 4MDSA 1A5IA 3PMAB 3A7WA 4Q7ZA 4MNWA 5C1XA 2R9PA 1XUKA 1C2MA 1NT1A 1HJ9A 1QQUA 1BTXA 3A88A 1SQAA 1KXCA 4MVNA 1B7XB 1GMDF 1P2MA 1UO6A 5C67A 3QGJA 3ZVBA 1LHDH 5FBEA 3H7TA 2XC4A 4O3TA 5C1YA 1ANDA 1MKXH 1ZPZA 1P2KA 5LPEA 2OC7A 1K1JA 1GBTA 4ABGA 3MNBA 4B2AA 3QZRA 2OBOA 1ETRH 3LT3A 1NC6A 2BDGA 1BOQA 4XBCA 2GCTC 1CA8B 1NRNH 1SGTA 3KQEA 7ESTE 2A31A 1LVBA 1QHRB 1DITH 2AFQB 2ZDNA 3BTME 3UOPA 3UR6A 1NFUA 5C3NA 5L2YH 3QDZB 4X6OA 1MZDA 3GCNA 4AYYB 4TPIZ 1EZQA 3OU0A 1O2SA 1IQFA 1QJ6B 1VCQA 3HPTB 3IG6B 4AB9A 1AB9C 1U6QA 1S85A 2OC1A 2P95A 4JZEH 4AFUA 2FLRH 4XDEA 1S81A 1FY8E 3CENA 2XBXA 4Y0YE 2LPRA 2ZFTA 2WPKS 1ABJH 1ZMJA 1W14U 4GLYA 1QBVH 1PFXC 1BHXB 5F03A 1D3TB 1SQOA 4Y0ZE 1SL3A 3T29A 2VWOA 3D49H 3NWUA 2A4QA 1ZRBA 1ELDE 3P6ZB 1K9OE 1UVPA 3ODDA 1BCUH 4GVUA 1TFXA 2ZZUH 2FTMA 1D3QB 2R2WU 2VVCA 1DY9A 3RXVA 1HJAC 2F91A 1FY5A 4JK5A 1ZLRA 1EZXC 2ZDLA 3S7HB 1KYNA 2ZCHP 5K7RA 5EQRA 1YLDA 1NZQH 3TGIE 3EA9A 1AE8H 1A3EH 3MU5A 4ZH8A 4X1SU 4DG4A 5JDUB 1N8OC 1GBIA 2JETB 1OWEA 2BM2A 1ARCA 2ZFQH 1HIAA 2FTLE 4X1RU 1QCPA 4X6PA 1O3NA 1DUEA 2HVXA 3PO1B 1TNLA 1H9LB 1P0SH 3P95A 1BTPA 3ZVAA 2VGCC 1HXEH 1UHBB 3VGCB 4NFEA 1AWHB 1EJMA 2CGAA 2G51A 4Y10E 1FIZA 3SNAA 2BY8X 1H4WA 3K6ZA 5BPEA 4DOQA 2FIRH 3EA7A 1LPGB 1GGDB 1HIAB 2IPHA 4DJZB 4NIXA 3HKIB 3U9AH 1W2KH 3RXHA 1O2NA 3IITA 1GI2A 4OS1A 4FUGA 1BJVA 3B9FH 2CN0H 1V2JT 4WXIA 5T6FA 2ZFSA 4XBDA 1LPKB 2HNTC 2BDCA 1GI9B 1G30B 1MAXA 4BAQB 3U98H 1YPLH 1FUJA 2AGGX 2A5AA 1IOEA 4ASHA 2B9LA 4FVDA 4X8SH 3MO9A 1GCDA 1SGFA 1PQ5A 5EQSA 2BYAX 4Y8ZA 1F0UA 4RN6A 1RTLA 3V7TA 1NU9A 1RIWB 3P8FA 1SGFG 3UQVA 1EPTC 4JYTA 3KEEA 3ZZ9A 2P8OC 5JBBS 1IQGA 1TRNA 1G2MA 1GMCG 3SNEA 1GCTB 1BRBE 1O2RA 3SNCA 3GY7A 2A4OA 1TYNA 1TNKA 3RXGA 1CBWC 2PLXA 2VINA 2Y6TA 2I6SA 2AGIX 2ZU3A 2FOCA 4TYDA 4NWKA 4H4FA 5GXPA 5BRRE 5DP3A 1YKTA 4E7RG 1BRCE 1Y3YA 3RXQA 3E90B 3SORA 2ZGXH 4MLFB 5A09A 3MO3A 1S84A 2B7DH 2BD3A 3GDVA 3NPSA 2VWNA 5L6NH 3BSQA 1GI0A 1DDJA 1YYY1 2HPQH 3RMNH 3RXUA 3SQHE 1CA0B 6GCHF 4B2CA 1C5NH 2XW9A 4UFFH 4LXBH 1SOTA 3QZQA 1ANEA 2FODA 3EDXB 1AHTH 1TLDA 4MPUA 1OWHA 3E0NB 1MKWK 1O2WA 2BY9X 4DW2U 1NO9H 2VWLA 1HAXB 1PPZA 2CV3A 1XM1A 4YO9A 4X2YA 4TY6A 4XOJA 1GDNA 3EGKH 1OPHB 1HXFH 3EA8A 1AVGH 5DP9A 1WQVH 3A8DA 2ZFPH 2ZU4A 2GZ7A 3P70B 1TWXB 3M3SA 1BBRH 1KXBA 5SGAE 4ZHLU 3TK6A 4WF8A 1O3JA 3BIVH 4GPGA 2ZCKP 1F0RA 1GG6C 3RXFA 1OS8A 4AN7A 3KN2A 3NCLA 1N6XA 1NN6A 2BLVA 5CMXH 2GP9B 3SJKA 5A8XA 2FX6A 5GJ4B 5FCRA 2F9BH 2BLOA 2D8WA 3RXTA 1ZZZA 1P2OA 4FU9A 1CHOF 3KL6A 1C5YB 3TK5A 2F9NA 5EU8A 1V2MT 3SV9A 4YTAA 1GGDC 2XWAA 5AHGH 3MU8A 1O3HA 1WU1A 1MD8A 1Y5UT 1GCTC 3GDSA 2XC5A 1PPHE 3A87A 8LPRA 1TNGA 2BX4A 6GCHG 1QBNA 1KLIH 2VGCB 3GOVB 3LKWA 4X8UH 3SUFA 5HXFA 4K3JA 3M7QA 1NFXA 4IC5A 3SGAE 1DS2E 1D6RA 3T28A 4F49A 3UOUA 9ESTA 3MU1A 1OSSA 1DE7H 3P8NA 1E37B 1V2UT 2XCNA 1GJDB 3M5MA 1SGCA 1G3CA 1XUJA 2BLWA 3URCA 1JBUH 2G52A 3SU6A 1P9SA 4JK6A 3HK3B 5EOKA 1MTNC 3VGCC 1O36A 1O3MA 1SVPA 2AMDA 4FUBA 5HYOA 3BV9B 4YLQH 3SV8A 2B8OH 1CHOG 4Q2KA 4D9QA 2G4TA 1ZHPA 2D1JA 1H9IE 1UVOA 3EQ0H 2FWWA 1MCTA 3KHVA 2J2UA 2Z3DA 5FPTA 1C5XB 1C9PA 1QB6A 2AIQA 1DWEH 1P01A 5ETXA 5EW2H 4IMQA 1KSNA 1Y8TA 4K2YA 1SLVB 2K1QA 4KTCA 5DGJA 4IC6A 4H6SB 1FIWA 1FQ3A 3VB6A 1L0ZA 1PPEE 1EZUC 1W12U 1LHCH 1WQSA 1AVWA 1LO6A 2ZP0H 1J16A 2PR3A 3MH4A 1WYKA 1P06A 4H42U 4DVAU 4HI3A 4CBNA 2WPLS 3BTTE 4X2XA 1AUJA 2H9TH 3H7OA 4KP0A 4WY3A 1EB1H 2PUQH 1AKSA 2A7CA 3EE0B 4ZROA 4ABJA 3SU3A 2WYGA 2C3SA 1GJCB 3TPIZ 4X6MA 1S0QA 3ZZBA 1MZAA 1N8OB 2QF0A 5AF9H 3ZVCA 5F8XA 2PKSB 2W3KA 5A0AE 1Z7KA 3FAOA 3MHWU 2VIWA 5EODA 1UK4A 1YC0A 4NSVA 1M9UA 4LOYH 1BMMH 1T8NA 1NFWA 3VFEA 3BN9A 2HWLB 4WH6A 1BJUA 1HJAB 2CMYA 4JZ1A 3SQEE 2P3UB 1N6YA 3R3GB 2Z9GA 3E3TA 1GG6B 3F9EA 1ESAA 2ALPA 3LH3A 3E8LA 1NROH 3A83A 4K1SA 1XUGA 4ZXXH 1C5SA 2QV1A 3DA9B 1IQEA 3ITIA 1XUIA 1PPGE 1GHBF 2FDAA 1AFQC 1Q3XA 1GJAB 2D26C 4TWYA 1C5PA 3LOXA 1FJSA 1L4DA 1HAVA 2KAIA 2FPZA 1V2PT 2GCTB 4K1EA 3JZ1B 4Z6AH 4UFDH 1LQEA 3LGWA 1YF4A 2VVUA 2FI5E 4K1TA 2BD5A 1KXEA 3GY4A 1C2FA 5T6DA 3SO3A 1E34B 5FX6A 1O3IA 4UFEH 4I8KA 3VB5A 1AU8A 2P93A 2RDLA 3RM2H 3BG8A 3VXFH 3N7OA 1V2KT 2J94A 1T8LA 2FYRA 1IQLA 4CHAB 2VVVA 2GDDA 3T25A 1UTJA 5JBTA 1SB1H 5FHTA 2GD4B 2ZECA 3P17H 1EP6A 2O8LA 1UTQA 1SGPE 3RXIA 1K1IA 1THSH 1SLXB 3ATKA 4ZKRU 3A7XA 5CE1A 1QTFA 1EUFA 2QYIA 2VNTA 4FUCA 1C9TA 1GBEA 1O3AA 1CBWB 1LTOA 2ZHFH 1CGJE 1UVSH 2Y81A 1GI7B 4NWLA 2ZPQA 1SMFE 3UWIA 1IHTH 1TABE 3O8BA 3UWJH 2BY7X 4ABBA 3HATH 1C5OH 1P05A 1QIXB 1O3CA 1TGCA 1YPHE 2FOAA 2HLCA 4GCHG 1Y3XA 1MTUA 3KQCA 1ZJKA 1A5GH 1O2UA 2NU0E 1P12E 1VITG 2AH4X 3MNSA 1V2WT 5HMAA 3GCHC 3ZZCA 5C1UA 3DHKH 3MOCA 1C4Y2 1D3DB 1UTPA 2QCYA 3BIUH 3GCTF 4X1QU 1O2XA 1EX3A 3AAUA 3OSYA 3WY8A 3S9BA 2WPIS 1O2GH 2PFEA 1Z1IA 2ZGJA 3SZNA 3SI4H 2ZGCA 2FS8A 1NS3A 1V6DA 2ANYA 3TH4H 1LQDB 1F5RA 1UK2A 5HM9A 1FY3A 3ATWA 1WBGB 1DXWA 2F9VA 1PPBH 1DXPA 2J95A 1V2QT 2XYAA 4U01A 1ELGA 1ZTJA 2QA9E 1O32A 1TA2A 3FVFB 3NUMA 3RXAA 1Y59T 2Y7XA 3ZZ4A 4J1YA 2THFB 1QL7A 1C1WH 1O5BB 1TMUH 4Q80A 3SBKA 4OS7A 3RXCA 3ELAH 2QXGA 2EI7A 2FP7B 3GISB 1FPHH 1E0FD 2P59A 3SU0A 3S7KB 2BB4A 1GBLA 3ATIA 3O8DA 2BVRH 1QB1A 2C8YB 3TIUA 3FANA 3GYLB 3CS7A 1AWFH 3SHCH 1P2JA 4UONA 2F9PA 3PLKA 2BQ6B 1QA0A 3W94A 1P09A 2ZGHA 1YCPM 1C5ZB 3K65B 4RKJB 4ZHMU 1BITA 1HAIH 3PYHA 4B74A 2ZGBH 3TJUA 1V2OT 1F0SA 2VH0A 1O2YA 1LMWB 1OWJA 2FZZA 3T26A 1QQ4A 2WV5A 1XVMA 3IWMA 4DT7B 4UEHH 1FMGA 4A6LA 1G36A 3AASA 3UUZA 1ZSJA 3SJ8A 1C5RA 1LHFH 2PGQB 1CGIE 3GY2A 1A61H 2STAE 3KF2A 1ZR0A 3RU4E 1GI5A 4IGDA 1A0JA 3FZZA 4DIHH 2ZU5A 2PW8H 3LJJA 4GUXA 3RDZA 1EAIA 1TMTH 1O2MA 4I8GA 3LGYA 5EPNA 1C2DA 4NFFA 2TGTA 3PWCA 4SGBE 1FPCH 4WWYA 3SNBA 3PM3A 1KDQB 2BD4A 3RXJA 3HGNA 2VIDA 1QY6A 3RMLH 2ULLA 1VCWA 1DWCH 4YLUA 1W7XH 1C2JA 2BHGA 4Y8YA 2SNVA 1ZRKA 3ENSB 3RP2A 1ACBE 2G5VA 5A0CA 3GCHB 3NZIA 4TY7A 2J38A 3W95A 1YPMH 2I6QA 2TGPZ 3E1XB 2W3IA 3I29A 4R8TB 1C5UA 2FOHA 1K22H 4THNH 3ZZDA 1CSOE 4FUFA 4Y7BA 3M5LA 3MH7A 1EOLA 2BQWB 4K60A 1AB9B 2Z9IA 1T4UH 5J4SA 3QTVH 1SHYA 1OYTH 3QWCH 4ZKNU 3ZZAA 1GMHG 2AGEX 1TPOA 1C4U2 4I31A 4D76A 3U8OH 1K1PA 2M5TA 1BRAA 1C1MA 1A0HB 2GX4A 1QNJA 2FOEA 2CJIA 1K21H 4NCYA 4CRBA 1RRKA 1ZGVA 3PB1E 1GHXH 3SV2H 1Z8GA 1IQKA 1N1LA 1FAKH 3UQOA 1C2IA 1PJPA 1AN1E 2ZHDA 3M37A 1ABIH 3A85A 5E0JA 1SR5C 2Z9LA 4B73A 4YOGA 1GBDA 4KKDA 1NY22 3LGTA 2HALA 5C20A 1O5AB 3AW0A 4ZHAA 2PGBB 2FMJA 2OINA 1DLEA 3T5FH 3UREA 3DT0H 2GKVE 1CU1A 3FP8E 1EJNA 1MU8B 4TWWA 1L1JA 1C2EA 1UTNA 5J4QA 1J8AA 4X6NA 4A1TA 1TONA 2ZF0H 1KXDA 1PPCE 5EQQA 3S9CA 5I46H 1E36B 3KIDU 3QTOH 4BNRA 1AI8H 6LPRA 1GDQA 1NU7B 1WCZA 2RA3A 1GVZA 3MMGA 1TPPA 1Z1JA 2JH0D 1UTMA 4NZLA 1YLCA 2HPPH 1P3CA 3LGVA 2G55A 3M7UA 1TGNA 2W7UA 5DP7A 1KIGH 1RD3B 2ANWA 4I8LA 1FN8A 1MTVA 3VEQB 2BZAA 2XXLA 1ZTKA 1OOKB 3A7ZA 4LK4A 1YCPH 2GVFA 1O2OA 2Z9JA 2XBVA 3MTYA 5C2ZA 2PKSC 3DD2H 2UWLA 1GBCA 2VIPA 1MD7A 2FI4E 2OUAA 4K8YA 3NK8A 3V13A 3M36A 2AEIH 1IQHA 2VIQA 1PYTC 5EGMA 5FX5A 1RXPA 2CXVA 2NWNA 2Z9KA 4WMDA 2R2MB 1O2JA 3P92A 2BZ6H 4JYVH 2SFAA 1WV7H 2GT8A 1HAGE 2ODYB 1ID5H 5EXMA 1BQYA 1TNHA 6ESTA 1DUAA 1NTPA 3HKJB 2ZNKH 1DOJA 2QN5T 1Z8RA 4A5TS 3U1JB 3SV7A 4Y7AA 3RMMH 4A7IB 1F2SE 5IYTA 2IOTA 5A8YA 5I25A 1Z8JB 2BOHB 2AERH 4IS5A 4Y79A 1C2HA 2BDYA 2SGAA 2SGDE 3FP6E 4UE7H 5C5OA 4NG9H 4KTUA 1ELEE 4D9RA 3C1KA 3A7VA 5B6OA 4ABFA 4B75A 1ANBA 4MNXA 1F7ZA 1XX9A 3SN8A 3OY6U 1CO7E 2SGPE 1HAZB 4DY7B 3SUEA 1EZSC 1AKSB 2R0LA 2WUBA 2SGFE 2ZQ1A 1CGHA 1MBMA 2FS9A 2G8TA 1O2PA 1MTNB 3AVZA 1C5WB 4GSOA 4F4OC 1UTKA 1WTGH 1TA6A 3A7YA 3UNQA 4A1XA 1SHHB 2NU4E 3NXPA 2TIOA 1VGCB 1KXFA 4RKOB 4Y8XA 4NIWA 1A2CH 3LIWA 4X1PU 1BTZA 1FI8A 5EXNA 2W7SA 1NRSH 1SLUB 1UMAH 1O2HA 3BTGE 3M3TA 1C5QA 3C27B 4RSPA 1QJ1B 2FOGA 1RS0A 7GCHF 3LDXH 2PWXA 1ELTA 4DCDA 1C1NA 1NFYA 4MNVA 1GWAA 5TCCA 2A1DB 2GV6A 2GZ9A 2PUXB 1BBRK 3ZZ6A 1DICA 2C90B 1X7AC 3I78A 2ODQA 1GBHA 1TNIA 3M7TA 3RM0H 5F8ZA 2RA0A 5JB8S 1P04A 1QGFA 2ZA5A 1TQ0B 2O8WA 1GI6A 2FI3E 3BEUA 4K69A 4UD9H 2BDAA 1SFIA 1O5CB 1W0YH 4OS2A 1HCGA 3A84A 1S82A 2O8TA 1CE5A 3RXMA 4X2WA 1BIOA 1PQAA 4MTBA 2A0QB 2OTVA 3SUDA 2ZG0H 1PQ7A 3T27A 1P10A 2XRCA 2QIQA 5L2ZH 3KQBA 2H9EH 1NRPH 6CHAB 1AQ7A 1OKXA 1UCYH 4Y11E 1RFNA 3M5NA 3QUMP 3ZYEA 1A4WH 5DO4H 2JKHA 4ZXYH 1MTSA 1HAOH 2ZFFH 1QL9A 4O3UA 2UWPA 1QRWA 4JZDH 4JZFH 1OWKA 1K1NA 1RJXB 1HAHH 1FN6A 1DY8A 1HLTH 1TMBH 1VR1H 2B5TB 3D65E 8GCHF 2PKAA 1VITH 2ALVA 1LPZB 5C5NA 1HFDA 3RXEA 5JPMH 3SHAH 5GCHF 3KNXA 4CRCA 2Z6BD 4OS5A 2GDEH 1Z8IB 1E35B 2FEQH 3E0PB 3QN7A 1EOJA 3UR9A 3D23A 2Y5GA 4VGCC 2ASUB 2UUKB 1RIWC 4HTCH 5TJXA 3UFAA 2XCFA 4ZMAH 3A8BA 2YOLA 3ATMA 4AFZA 2V3HH 2H6MA 2CF8H 2J4IA 3B8JA 4NA7A 1BB0B 5E8EH 1OX1A 4FU7A 1A5HA 1IAUA 2H5DA 4R0IA 3VB3A 1GHYH 3TGJE 1TGTA 2FLBH 1BUIA 2QF3A 3SOSA 4DGJA 1G32B 1MBQA 3S69A 4YOJA 1G3BA 3SJ9A 1UJ1A 1O3OA 1P57B 1SGQE 2BD7A 5F6MA 1GBMA 2R0KA 2PSYA 1BA8B 1KXAA 1E38B 3OYPA 3PLBA 3TU7H 4VGCB 1MQ6A 1XUFA 3A82A 1G37A 2Y5FA 1ESTA 1HV7A 3LONA 4OS4A 5EXLA 2ZKSA 1QBOA 4BAMB 2BTCE 1ELBA 1GBFA 1TOCB 2A4GA 3U8RH 3KGPA 1O3PB 4ZKSU 1TBQH 2V6NA 1ZHRA 4ZAEA 5LPRA 1W3CA 1Y3WA 3LJOA 4CR9A 2V35A 1IHSH 4HFPB 1QA7A 3OTJE 1YBWA 4B2BA 2ZI2H 1SGDE 3TGKE 1THRH 3FP7E 1MAYA 1SGNE 2ZEBA 3LU9B 2C4FH 2SGEE 4Y76A 1XKAC 3VB7A 1XKBC 3SGBE 1GDUA 2ZDMA 2Y7ZA 1P8VC 3STJA 3RXOA 1V2TT 1RTFB 1ZHMA 1O31A 1WSSH 1DWBH 3I77A 1BT7A 1AY6H 3A89A 2EA3A 1C4V2 1LCYA 1NRRH 1S83A 1XVOA 1LHEH 2J92A 1ZJDA 2Q6DA 1RTKA 2ZDKA 4WMFA 2FX4A 4DIIH 5DP5A 1PPFE 1L1GA 3F68H 2KAIB 3MH5A 1MH0A 2C93B 2H1UA 2ZTYA 2AMPA 4X1NU 1OP8A 3BEFB 4KGAA 4I8JA 3F1SB 1DFPA 1GBAA 1O39A 2BDBA 2GT7A 1KDQA 3T62A 1TPSA 1GHAG 1ELAA 1HAPH 5JBCS 2H2ZA 3PWBA 5E2PA 1C5LH 2BMGB 2G5NA 3F6UH 1QRXA 4Q7XA 3MNXA 4JZIA 4B1TA 3PMHB 3SU1A 1TALA 3GCTG 1W11U 2Z94A 1SSXA 4AX9H 1KY9A 3TITA 5DG6A 4BOHA 3AW1A 1AVXA 3MNCA 1C1RA 1V2LT 4ISLA 2VB0A 1EAWA 3OX7U 3BF6H 5A0BA 1VGCC 2PSXA 1C5VA 2PHBA 4I8HA 3SU2A 1CHGA 9LPRA 4YESB 3GY3A 1GJ7B 2QGRA 3PROA 2Q6FA 2A7JA 3QGNB 1L1NA 1OWIA 4X0WU 4DURA 2ZPSA 3A8CA 1D4PB 1EKBB 2SNWA 1H9HE 4FU8A 4QT8C 2V0BA 3TH3H 2ZU2A 1GBBA 4YM9A 3MU0A 2PKAB 3TLOA 1B0FA 1UCYK 3LPRA 2QXJA 3SU4A 3GDUA 3TNTA 3RXKA 4X8TH 4O97A 3LC5A 1GJ8B 1XXDA 2OP9A 4ABEA 2W5EA 2Z3EA 3ZVEA 2OD3B 5GIBA 2DUCA 3ZV8A 1ZOMA 1BMNH 4YOIA 5GCHG 1RGQA 2A45B 3BG4C 4FUIA 1O3GA 1WTHD 1GBJA 1UVUH 1JRSA 4K5ZA 1ARBA 4JCNA 5E0GA 1P03A 2LNCA 2ZDAH 1T8OA 2VIOA 2Y5HA 1GJ6A 1JIMA 3GY6A 5AFYH 4WVPE 1Z71A 1FONA 3KCGH 2ZDVH 4JYUH 4IBLH 2GMTB 1KTTB 5ESBA 1LVYA 4FVBA 4B71A 1O35A 3P8GA 1H1BA 3TJOA 1O34A 1O5GH 1ZPCA 2WPJS 1H8DH 4NZQA 1BHXF 1C2KA 2PV9B 2BXTH 1GL0E 5FCKA 4WJG2 3TJVA 2ZO3H 1P02A 4UDWH 1AMHA 4WMEA 2F9OA 1O2VA 1L2EA 2ANKH 1S6HA 3UNSA 4BTIB 5DPAA 4UFGH 1DPOA 4CR5A 1CVWH 2AIPA 2ZFRH 1F5LA 1A3BH 1B0EA 3RU4D 4AYVB 5ABWA 2O9QA 5DK1A 3CS0A 1VCPA 3T2NA 2BVSH 1GJ4H 4I32A 4NGAH 2WYJA 2AYWA 4WXVA 3MYWA 3Q00A 1GL1A 2P3TB 1JIRA 4INHA 3L3TA 1O5DH 1FV9A 2IN2A 5ESTE 2AS9A 3ODFA 1O2KA 1TQ7B 3SI3H 1L4ZA 1LHGH 1EXFA 1KLTA 1DM4B 4AFSA 1OP2A 2EEKA 4O9VA 5JBAS 1C1UH 3L33A 5DP8A 4XSKU 1KTSB 5TCAA 3ZZ3A 3VXEH 1GPZA 4E05H 2ZTZA 3RXRA 1NRQH 4PROA 4Q7YA 1J15A 1V3XA 1P2IA 5EG4A 2ZC9H 1K28D 1F0TA 1O2LA 1TPAE 4MQAA 7LPRA 4NA9H 2ZIQH 5GPIB 1YPHC 3URDA 1ELCA 3BTQE 1IQMA 1GMCF 1ETTH 3QO6A 1UVTH 5HGGA 1O3LA 1O30A 4AG1A 2RCEA 1P11E 3VPKA 2BD8A 1BTHH 1SG8B 2XWBI 3RLWH 3TVJB 3NKKA 1DVAH 2ZHEH 1QRZA 2UWOA 1G3EA 3A80A 5AFZH 2FOMB 3JZ2B 2RG3A 2WPHS 4NA8A 1JWTA 5K0HA 1ORFA 1T7CA 2P8OB 2UUJB 1GI8B 1LKAA 1O0DH 1BTUA 1ANCA 1V2ST 2CHAC 2ZQ2A 2P16A 2GCHG 1VJAU 1NPMA 2J9NA 2VJ1A 1WAYB 2FOBA 2G4UA 2GV7A 1ELVA 4AG2A 1T32A 3Q3XA 1V2RT 1SGEE 3BEIB 1PQ8A 3LGIA 5FPYA 2C8WB 1MTWA 4IN1A 4K8BA 2VU8E 3H5CB 2OC0A 3FFGA 3Q3KA 4AGKA 1ZGIA 2D2DA 5DKMA 2QAAA 2BLQA 3GYMA 1J17T 4YT6H 1EATA 1O5EH 2QXIA 1O3DA 4GCHF 5FXLA 1YP9A 1C1PA 7KMEH 1QR3E 1D6WA 2WINI 3UPEA 1CT4E 1DSUA 1O3KA 1OWDA 4YT7H 4CHAC 1EASA 2V3OH 4ABAA 2OLGA 2ZHQH 5AVDA 1XXFA 4CRAA 4IN2A 1Y3UA 3DUXH 4J2YB 4OGYA 1F5KU 3SJIA 1TGSZ 1FY1A 4CH8B 1ZTLA 1YPGH 2PTNA 2H9HA 5FAHA 1AFEH 2BDHA 1GVLA 3BG4B 2F83A 5GDSH 1V2NT 1ZYOA 3MO6A 4FXGH 4FUDA 4CH2B 2FO9A 1IQJA 3L6PA 2XNIA 1S6FA 4KELA 4I7YH 1AD8H 1O38A 1QL8A 1SGRE 3CP7A 3Q3YA 1GHWH 1O3BA 3RXLA 2BD9A 4D7FA 6CHAC 3D62A 4H6TA 3RXDA 3ZVDA 2XBWA 1Y5BT 3ZZ8A 2XC0A 2Q1JA 1D3PB 1C1QA 2ODPA 2HRVA 3SW2B 1HPGA 2ZTXA 1NM6A 4MPWA 5EPYA 3SV6A 2HOBA 1A0LA 4ISNA 4O03A 4LZ4B 2ZPRA 2P3FH 3RXPA 4D7GA 1GHZA 1T31A 1TOMH 1FXYA 1SBWA 1ZMNA 4MPVA 1EJAA 4B76A 3OY5U 2IJOB 1UCYE 1S0RA 1QJ7B 1A7SA 1JRTA 3RC5A 3A81A 1BMLA 3RU4T 1YPEH 2BY5X 3V12A 1IQIA 1SLWB 1G3DA 5T6GA 3K6YA 3BTFE 3QLPH 1AZZA 1HB0B 5EW1H 1Y5AT 3Q76A 3TNSA 3ZYDA 1NESE 2ZU1A 1JOUB 3QX5H 1Z6JH 2A32A 1SGYE 3F9HA 1S5SA 3KQDA 3M61U 1PYTD 3STIA 5GWZA 4I33A 3ESTA 1P3EA 4BXWA 1FLEE 2WUCA 4WH8A 4BAHB 1MKXK 1CQQA 1HNEE 3U1IB 3SNDA 4CREA 3LC3A 1YPJH 1AUTC 1BTWA 1F92A 5JYIA 3ZVFA 4OS6A 3M3VA 3P8OA 3BTKE 2Q6GA 2AMQA 4OGXA 2VH6A 1YGCH 3F9FA 2QXHA 2A2QH 1O3FA 3LH1A 1ELFA 1HGTH 3SGQE 1MMJN 2TPIZ 1O37A 5FPSA 1THPB 1EPTA 1INCA 5LGOA 1K1LA 3BTWE 2QC2A 1EPTB 2XBYA 1GI4A 5LPFA 4GHTA 2Y80A 1OP0A 3E91A 1KLJH 1MCVA 3R0FA 3U69H 1QURH 3BTHE 1AFQB 1Z6EA 3ZV9A 4CRDA 2PTCE 1C1OA 1HBTH 2TGAA 3S9AA 2ILNA 2YNAA 1TGBA 4U32A 3PLPA 4Y71A 4BANB 2EI8A 2VWMA 2EI6A 1C1SA 1WOFA 7GCHG 1GMHF 1C1VH 1W8BH 2GCHF 1XUHA 2C8XB 1AE5A 2Y82A 2H5CA 2UUYA 1FNIA 3RC6A 2FOFA 2B0FA 3TH2H 1JXPA 2G81E 2NU3E 1ZSKA 4SGAE 1IQNA 1SQTA 1WUNH 3MFJA 4NIYA 3AAVA 5FBIA 3Q77A 4BAOB 4AZ2B 2TBSA 1J9CH 2A5KA 1TX8A 2OXSA 3E16B 3PTNA 1J14A 1BTYA 2A4RA 4U30A 5HM2A 2GGVB 3MWIU 1DT2A 2JH5D 1FY4A 1GI1A 4NIVA 2BXUH 5G4BA 1UTOA 3PMBB 1GVKB 3MH6A 1W7GH 1GJ9B 1QB9A 3UNRA 4HZHA 3K9XB 1O3EA 1T8MA 1O33A 1DSTA 1HJ8A 2OQ5A 2TRMA 2BDIA 1ESBA 3VB4A 1K1OA 3MU4A 1BRUP 1YCPK 1FZZA 4X8VH 2R3YA 1EAUA 5JB9S 2OQUA 2OCVB 1ZMLA 3FZDA 1W0ZU 2FXRA 1HAYB 4GHQA 1TX6A 4INKA 1VZQH 1SI5H 2Z7FE 1TBZH 4AGJA 5DP6A 4CBOA 1GHAF 4BTUB 1C5TA 3O8CA 4XBBA 2HNTE 3RXSA 3V0XA 1GI3A 1BBRE 1VJ9U 4JMYA 4AFQA 2R3UA 2GMTC 1GMDG 1MKWH 2UUFB 1GBKA 4AB8A 1TE0A 1UHBA 1UK3A 3SUGA 3DFJA 4TPYA 1V2VT 3MI4A 4X2VA 2BD2A 1TBRH 3F9GA 3RC4A 3A7TA 5LH8A 1AO5A 2FM2A 1TAWA 1C1TA 1Y3VA 2GZ8A 1P2QA 1SOZA 3ATLA 3E6PH 2A2XH 1HAVB 2ZWLH 3GY8A 5T3HA 1AGJA 1AZ8A 3EAJA 4M7GA 1T4VH 1G2LA 1W13U 4KTSA 1FAXA 1QFKH 1O2QA 1HUTH 2YNBA 4ABDA 5DJ7A 1G9IE 1TNJA 1LVMA 5A2MH 2BVXH 3GICB 3BTDE 2OBQA 2VIVA 1O2IA 2BQ7B
chains in the Genus database with same CATH superfamily
1HDTH 4XFQA 2O8UA 1GHVH 4D8NA 2ZCLP 3RXBA 2NU1E 1ETSH 4MPXA 4ESTE 4MG3A 1HRTH 4ABHA 3O8RA 4IW4E 3TK9A 3V3MA 2BX3A 3UIRA 1EQ9A 1EP5A 3HGPA 8ESTE 3UY9A 2STBE 1SGIB 4FUJA 2A5IA 1LDTT 3RUOA 4LZ1H 1BMFD 1O5FH 8GCHG 1TRMA 5A8ZA 2F3CE 2XTTB 1HYLA 1DANH 1OYQA 2CF9H 2C8ZB 2BOKA 1FDPA 5H4IB 3UTUH 1GHBG 1MUEB 8KME2 4FUHA 1YLNA 2HNTF 1ZPBA 3G01A 3PV4A 4ZKOU 1GJBB 1LVOA 5L30H 5CHAB 5E0HA 4HGCA 5IDKA 2TGDA 1XMNB 1K2I1 1OXGA 4CRGA 1SPJA 4MNYA 4AORA 5CHAC 1CT0E 2CHAB 2FESH 2JH6D 2Z3CA 1GJ5H 2WV4A 4A92A 1D9IA 2GTBA 1LKBA 5CDFE 4ISOA 3ZVGA 4AOQA 3FOAA 2J34A 1P2NA 1P9UA 1SFQB 4U2WA 4XE4A 5E2OA 3LGUA 3S0NA 2KCAA 3EYDA 2P94A 1O2ZA 3RLYH 3U8TH 1ZSLA 2BY6X 1O2TA 1Q2WA 1JMOH 1EB2A 5PTPA 1EAXA 4A1VA 1DX5M 3PO1C 1YM0A 2HGTH 2OC8A 2NU2E 1K1MA 1BMAA 4FUEA 2DE8A 4NSYA 4ISHH 4ZUHA 2F9UA 1C5MD 3ZZ7A 3HK6B 1DWDH 4IMZA 2JETC 5DSFA 2QY0B 4CRFA 1C2LA 3SJOA 1MQ5A 1SC8U 4BTTB 5F8TA 1Q31A 1MU6B 2WPMS 1TIOA 4E7NA 3UAIC 1H8IH 1TB6H 3PMJA 3DFLA 3SU5A 3M35A 2ZHWH 1TX7A 3PTBA 3W1EA 3GCOA 1VITF 3BTEE 4AC9A 4GAWA 4INLA 2W26A 1A46H 1CT2E 2EC9H 2DE9A 2ANMH 2G00A 4BAKB 3RMOH 1W10U 1BDAA 3QK1A 3ZZ5A 1YPKH 1TRYA 1B5GH 1AIXH 1DLKB 2O8MA 3K2UA 3TJNA 2WSSD 1CA0C 1UTLM 3A86A 1C2GA 4ABIA 4BXSA 2IPQX 2A7HA 1BZXE 4Y6DA 2KCOA 3B23B 5DP4A 4YZUA 3GY5A 3M5OA 5HIYA 3A8AA 4ISIH 1A1RA 2ESTE 2FYQA 2SGQE 4E06H 4Z0KA 4MDSA 1A5IA 3PMAB 3A7WA 4Q7ZA 4MNWA 5C1XA 2R9PA 1XUKA 1C2MA 1NT1A 1HJ9A 1QQUA 1BTXA 2JDID 3A88A 1SQAA 1KXCA 4MVNA 1B7XB 1GMDF 1P2MA 1UO6A 5C67A 3QGJA 3ZVBA 1LHDH 5FBEA 3WWFA 3H7TA 2XC4A 4O3TA 5C1YA 1ANDA 1MKXH 1ZPZA 3KYFA 1P2KA 3PV2A 5LPEA 2OC7A 1K1JA 1GBTA 4ABGA 3MNBA 4B2AA 3QZRA 2OBOA 1ETRH 3LT3A 1NC6A 2BDGA 1BOQA 4XBCA 2GCTC 1CA8B 1NRNH 1SGTA 3KQEA 7ESTE 2A31A 1LVBA 1QHRB 1DITH 2AFQB 2ZDNA 3BTME 1H8HD 3KYGA 1OHHD 3UOPA 3UR6A 1NFUA 5C3NA 5L2YH 3QDZB 4X6OA 1MZDA 3GCNA 4AYYB 4TPIZ 1EZQA 3OU0A 3OE7D 1O2SA 1IQFA 1QJ6B 1VCQA 3HPTB 3IG6B 4AB9A 1AB9C 1U6QA 1S85A 1WXRA 2OC1A 2P95A 4JZEH 4AFUA 2FLRH 4XDEA 1S81A 1FY8E 3CENA 2XBXA 4Y0YE 2LPRA 2ZFTA 2WPKS 1ABJH 1ZMJA 1W14U 4GLYA 1QBVH 1PFXC 3N99A 1BHXB 5F03A 1D3TB 2M2AA 1SQOA 4Y0ZE 1SL3A 3T29A 2VWOA 3D49H 3NWUA 2A4QA 1ZRBA 1ELDE 3P6ZB 1K9OE 1UVPA 3ODDA 1BCUH 4GVUA 1TFXA 2ZZUH 2FTMA 1D3QB 2R2WU 2VVCA 1DY9A 3RXVA 1HJAC 2F91A 1FY5A 4JK5A 1ZLRA 1EZXC 2ZDLA 3S7HB 1KYNA 2ZCHP 5K7RA 5EQRA 1YLDA 1NZQH 3TGIE 3EA9A 1AE8H 1A3EH 3MU5A 4ZH8A 4X1SU 4DG4A 5JDUB 1N8OC 1GBIA 5EJ1A 2JETB 1OWEA 2BM2A 1ARCA 2KFWA 2ZFQH 1HIAA 2FTLE 4X1RU 4HG6A 1QCPA 4X6PA 1O3NA 2XNDD 1DUEA 2HVXA 3PO1B 1TNLA 1H9LB 1P0SH 3P95A 1BTPA 3ZVAA 2VGCC 1HXEH 1UHBB 3VGCB 4NFEA 1AWHB 1EJMA 2CGAA 2G51A 4Y10E 1FIZA 3SNAA 2BY8X 1H4WA 3K6ZA 5BPEA 3DSOA 4DOQA 2FIRH 3EA7A 1LPGB 1GGDB 1HIAB 2IPHA 4DJZB 4NIXA 3HKIB 3U9AH 1W2KH 3RXHA 1O2NA 3IITA 1GI2A 4OS1A 4FUGA 1BJVA 3B9FH 2CN0H 1V2JT 4WXIA 5T6FA 4Q4LA 2ZFSA 3FKSD 4XBDA 1LPKB 2HNTC 2BDCA 1GI9B 1G30B 1MAXA 4BAQB 3U98H 1YPLH 1FUJA 2AGGX 2A5AA 1IOEA 4ASHA 4F48B 2B9LA 4FVDA 4X8SH 3MO9A 1GCDA 1SGFA 1PQ5A 5EQSA 2BYAX 4Y8ZA 1F0UA 4RN6A 1RTLA 3V7TA 1NU9A 1RIWB 3P8FA 1SGFG 3UQVA 1EPTC 4JYTA 3KEEA 3ZZ9A 2P8OC 5JBBS 1IQGA 1TRNA 1G2MA 1GMCG 3SNEA 1GCTB 3FO8D 1BRBE 1O2RA 3SNCA 3GY7A 2A4OA 3GS9A 1TYNA 1TNKA 3RXGA 1CBWC 2PLXA 2VINA 2Y6TA 2I6SA 2AGIX 2ZU3A 2FOCA 4TYDA 4NWKA 4H4FA 5GXPA 5BRRE 5DP3A 1YKTA 4E7RG 1BRCE 1Y3YA 3RXQA 3E90B 3SORA 2ZGXH 4MLFB 5A09A 3MO3A 1S84A 2B7DH 2BD3A 3GDVA 3NPSA 2VWNA 5L6NH 3BSQA 1GI0A 1DDJA 1YYY1 2HPQH 3RMNH 3RXUA 3SQHE 1CA0B 6GCHF 2CK3D 4B2CA 1C5NH 2XW9A 4UFFH 4LXBH 1SOTA 3QZQA 1ANEA 2FODA 4FOUC 3EDXB 1AHTH 1TLDA 4MPUA 1OWHA 3E0NB 1MKWK 1O2WA 2BY9X 4DW2U 2LP6A 5HIZA 1NO9H 2VWLA 1HAXB 1PPZA 2CV3A 1XM1A 4YO9A 4X2YA 4TY6A 4XOJA 1GDNA 3EGKH 1OPHB 1HXFH 3EA8A 1AVGH 5DP9A 1WQVH 3A8DA 2ZFPH 2ZU4A 2GZ7A 3P70B 1TWXB 3M3SA 1BBRH 1KXBA 5SGAE 4ZHLU 2JJ2D 3OEHD 3TK6A 4WF8A 1O3JA 3BIVH 4GPGA 2ZCKP 1F0RA 1GG6C 4P02A 3RXFA 1OS8A 4AN7A 3KN2A 3NCLA 1N6XA 1NN6A 2BLVA 5CMXH 2GP9B 3SJKA 5A8XA 2FX6A 5GJ4B 5FCRA 2F9BH 2BLOA 2D8WA 3RXTA 1ZZZA 1P2OA 4FU9A 1CHOF 3KL6A 1C5YB 3TK5A 2F9NA 5EU8A 1V2MT 3SV9A 4YXWD 4YTAA 1GGDC 2XWAA 5AHGH 3MU8A 1O3HA 1WU1A 1MD8A 1Y5UT 1GCTC 3GDSA 2XC5A 1PPHE 3A87A 8LPRA 1TNGA 2BX4A 6GCHG 1QBNA 1KLIH 2VGCB 3GOVB 3LKWA 2KM0A 4X8UH 3SUFA 5HXFA 4K3JA 3M7QA 2WV9A 1NFXA 4IC5A 3SGAE 1DS2E 1D6RA 2L74A 3T28A 3DCLA 4F49A 3UOUA 9ESTA 3MU1A 1OSSA 1DE7H 3P8NA 5KECA 1E37B 1V2UT 2XCNA 1GJDB 3M5MA 1SGCA 1G3CA 1XUJA 2BLWA 3URCA 1JBUH 2G52A 3SU6A 1P9SA 4JK6A 3HK3B 5EOKA 1MTNC 3VGCC 1O36A 1O3MA 1SVPA 2AMDA 4FUBA 5HYOA 3BV9B 4YLQH 3SV8A 2B8OH 1CHOG 4Q2KA 4D9QA 3CNRA 2G4TA 1ZHPA 2D1JA 1H9IE 1UVOA 3EQ0H 2FWWA 1MCTA 3KHVA 2J2UA 2Z3DA 5FPTA 1C5XB 1C9PA 1QB6A 2AIQA 1DWEH 1P01A 5ETXA 5EW2H 4IMQA 1KSNA 1Y8TA 4K2YA 1SLVB 2K1QA 4KTCA 5DGJA 2OK5A 4IC6A 4H6SB 1FIWA 2KCYA 1FQ3A 3VB6A 1L0ZA 1PPEE 1EZUC 1W12U 5EJZA 1LHCH 1WQSA 1AVWA 1LO6A 2ZP0H 1J16A 2PR3A 3MH4A 1WYKA 1P06A 4H42U 4DVAU 4HI3A 4CBNA 2WPLS 3BTTE 4X2XA 1AUJA 1QZ8A 2H9TH 3H7OA 4KP0A 4WY3A 3VG8A 1EB1H 2PUQH 1AKSA 2A7CA 3EE0B 4ZROA 4ABJA 3SU3A 2WYGA 2C3SA 1GJCB 3TPIZ 4X6MA 1S0QA 3ZZBA 1MZAA 1N8OB 2QF0A 5AF9H 3ZVCA 5F8XA 2PKSB 2W3KA 5A0AE 1Z7KA 3FAOA 3MHWU 2VIWA 5EODA 4RT0A 1UK4A 2K0QA 1YC0A 4NSVA 1M9UA 4LOYH 1BMMH 1T8NA 1NFWA 3VFEA 3BN9A 2HWLB 4WH6A 1BJUA 1HJAB 2CMYA 4JZ1A 3SQEE 2P3UB 1N6YA 3R3GB 2Z9GA 3E3TA 1GG6B 3F9EA 1ESAA 2ALPA 3LH3A 3E8LA 2HVYB 3F0PA 1NROH 3A83A 4K1SA 1XUGA 2PP6A 4ZXXH 1C5SA 2QV1A 3DA9B 1IQEA 3ITIA 1XUIA 1PPGE 1GHBF 2FDAA 1AFQC 1Q3XA 1GJAB 5EJLA 2D26C 4TWYA 1C5PA 3LOXA 1FJSA 1L4DA 1HAVA 2KAIA 2FPZA 1V2PT 2GCTB 4K1EA 3JZ1B 4Z6AH 4UFDH 1LQEA 3LGWA 1YF4A 2VVUA 2FI5E 4K1TA 2BD5A 1KXEA 3GY4A 1C2FA 5T6DA 1K0HA 3SO3A 1E34B 5FX6A 1O3IA 4UFEH 4B6FA 4I8KA 3VB5A 1AU8A 2P93A 2RDLA 3RM2H 3BG8A 3VXFH 3N7OA 1V2KT 2J94A 1T8LA 2FYRA 1IQLA 4CHAB 2VVVA 2GDDA 3T25A 1UTJA 5JBTA 1SB1H 5FHTA 2GD4B 2ZECA 3P17H 1EP6A 2O8LA 1UTQA 1SGPE 3RXIA 1K1IA 1THSH 1SLXB 3ATKA 4ZKRU 3A7XA 5CE1A 1QTFA 1EUFA 2QYIA 2VNTA 4FUCA 1C9TA 1GBEA 1O3AA 1CBWB 1LTOA 2ZHFH 1CGJE 1UVSH 2Y81A 1GI7B 4NWLA 2ZPQA 1SMFE 3UWIA 1IHTH 1TABE 3O8BA 3UWJH 3OEED 2BY7X 4ABBA 3HATH 1C5OH 1P05A 1QIXB 1O3CA 1TGCA 1YPHE 2FOAA 2HLCA 4GCHG 1Y3XA 1MTUA 3KQCA 5F53A 1ZJKA 1A5GH 1O2UA 2NU0E 1P12E 1VITG 2AH4X 3MNSA 1V2WT 5HMAA 3GCHC 3ZZCA 5C1UA 3DHKH 3MOCA 1C4Y2 1D3DB 1UTPA 2QCYA 3BIUH 3GCTF 4X1QU 1O2XA 1EX3A 3AAUA 3OSYA 3WY8A 3S9BA 2WPIS 1O2GH 2PFEA 1Z1IA 2ZGJA 3SZNA 3SI4H 2ZGCA 2FS8A 1NS3A 1V6DA 2ANYA 3TH4H 1LQDB 1F5RA 1UK2A 3OAAD 5HM9A 1FY3A 3ATWA 1WBGB 1DXWA 2F9VA 1PPBH 1DXPA 2J95A 1V2QT 2XYAA 4U01A 1ELGA 1ZTJA 2QA9E 4XRNA 1O32A 1TA2A 3FVFB 3NUMA 3RXAA 1Y59T 2Y7XA 5HKKD 3ZZ4A 4J1YA 2THFB 1QL7A 1C1WH 1O5BB 1TMUH 4Q80A 3SBKA 4OS7A 3RXCA 3ELAH 1FX0B 2QXGA 2EI7A 2FP7B 3GISB 1FPHH 1E0FD 2K8IA 2P59A 3SU0A 3S7KB 2BB4A 1GBLA 3ATIA 3O8DA 2BVRH 1QB1A 2C8YB 3TIUA 3FANA 3GYLB 3AK5A 3CS7A 1AWFH 3SHCH 1P2JA 4UONA 2F9PA 3PLKA 2BQ6B 1QA0A 3W94A 1P09A 2ZGHA 1YCPM 1C5ZB 3K65B 3OFND 4RKJB 1BITA 1HAIH 3PYHA 4ZHMU 4B74A 2ZGBH 3TJUA 1V2OT 1F0SA 2VH0A 1O2YA 1LMWB 1OWJA 2FZZA 3T26A 1QQ4A 2WV5A 1XVMA 3MQKC 3IWMA 4DT7B 4UEHH 1FMGA 4A6LA 1G36A 3AASA 3UUZA 1ZSJA 3SJ8A 1C5RA 1LHFH 2PGQB 1CGIE 3GY2A 1A61H 2STAE 3KF2A 1ZR0A 3RU4E 1GI5A 4IGDA 1A0JA 3FZZA 4DIHH 2ZU5A 2PW8H 3LJJA 4GUXA 3RDZA 1EAIA 1TMTH 1O2MA 4I8GA 3LGYA 5EPNA 1C2DA 4NFFA 4TT3D 2TGTA 1YWUA 3PWCA 4SGBE 1FPCH 4WWYA 3SNBA 3PM3A 1KDQB 2BD4A 3RXJA 3HGNA 2VIDA 1QY6A 3RMLH 2ULLA 1VCWA 2GJGA 1DWCH 4YLUA 1W7XH 1C2JA 2BHGA 4Y8YA 2SNVA 1ZRKA 3ENSB 3RP2A 1ACBE 2G5VA 5A0CA 3GCHB 3NZIA 4TY7A 2J38A 3W95A 1YPMH 2I6QA 2TGPZ 3E1XB 2W3IA 3I29A 4R8TB 1C5UA 2FOHA 1K22H 4THNH 3ZZDA 1CSOE 4FUFA 4Y7BA 3M5LA 3MH7A 1EOLA 2BQWB 4K60A 1AB9B 2Z9IA 1T4UH 5J4SA 3QTVH 1SHYA 1OYTH 3QWCH 4ZKNU 3ZZAA 1GMHG 2AGEX 1TPOA 2WZQA 1C4U2 4I31A 3F2HA 4D76A 3U8OH 1K1PA 2M5TA 1BRAA 1C1MA 3WWBA 1A0HB 2GX4A 1QNJA 4ZCNA 2FOEA 2CJIA 1K21H 4NCYA 4CRBA 1RRKA 1ZGVA 3PB1E 1GHXH 3SV2H 5FL7D 1Z8GA 1IQKA 1N1LA 1FAKH 3UQOA 1C2IA 1PJPA 1AN1E 2ZHDA 3M37A 1ABIH 3A85A 5E0JA 1SR5C 2Z9LA 4B73A 4YOGA 1GBDA 4KKDA 1NY22 3LGTA 2HALA 5C20A 1O5AB 3AW0A 4ZHAA 2PGBB 2FMJA 2OINA 1DLEA 3T5FH 3UREA 3DT0H 2GKVE 1CU1A 3FP8E 1EJNA 1MU8B 4TWWA 1L1JA 1C2EA 1UTNA 5J4QA 1J8AA 4X6NA 4A1TA 4ASUD 1TONA 2ZF0H 1KXDA 1PPCE 1EFRD 5EQQA 3S9CA 5I46H 1E36B 3KIDU 3QTOH 4BNRA 1AI8H 6LPRA 3OTPA 1GDQA 1NU7B 1WCZA 2RA3A 1GVZA 3MMGA 1TPPA 5C17A 1Z1JA 2JH0D 1UTMA 2J98A 4NZLA 4XD7D 1YLCA 2HPPH 1P3CA 3LGVA 2G55A 3M7UA 1TGNA 2W7UA 5DP7A 1KIGH 1RD3B 2ANWA 4I8LA 1FN8A 1MTVA 3VEQB 2BZAA 2XXLA 1ZTKA 1OOKB 3A7ZA 4LK4A 1YCPH 2GVFA 1O2OA 2Z9JA 2XBVA 3MTYA 5C2ZA 2PKSC 3DD2H 2UWLA 1GBCA 2VIPA 1MD7A 2FI4E 2OUAA 4K8YA 3NK8A 3V13A 3M36A 2AEIH 1IQHA 2VIQA 1PYTC 3N7EA 5EGMA 1RXPA 2CXVA 5FX5A 2NWNA 2Z9KA 4WMDA 2R2MB 1O2JA 3P92A 4P00A 2BZ6H 4JYVH 5GNDA 2SFAA 1WV7H 2GT8A 2WHXA 1HAGE 1SQRA 2ODYB 3WW7A 1ID5H 5EXMA 1BQYA 1TNHA 6ESTA 1DUAA 1NTPA 3HKJB 2ZNKH 1DOJA 2QN5T 1Z8RA 4A5TS 3U1JB 3SV7A 4Y7AA 3RMMH 4A7IB 1W0KD 1F2SE 5IYTA 2IOTA 5A8YA 5I25A 1Z8JB 2BOHB 2AERH 4IS5A 4Y79A 1C2HA 2BDYA 2SGAA 2SGDE 3FP6E 4UE7H 5C5OA 4NG9H 4KTUA 1ELEE 4D9RA 3C1KA 3A7VA 5B6OA 4ABFA 4B75A 3FN8A 1ANBA 4MNXA 1F7ZA 1XX9A 3SN8A 3OY6U 1CO7E 2SGPE 1HAZB 4DY7B 3SUEA 1EZSC 1AKSB 2R0LA 2WUBA 2SGFE 2ZQ1A 1CGHA 1MBMA 2FS9A 2G8TA 1O2PA 1MTNB 1E1QD 3AVZA 1C5WB 4GSOA 4F4OC 3PRBA 1UTKA 1WTGH 1TA6A 3A7YA 3UNQA 4A1XA 1SHHB 2NU4E 3NXPA 2TIOA 1VGCB 1KXFA 4RKOB 4Y8XA 3KQ5A 4NIWA 1A2CH 3LIWA 4X1PU 1BTZA 2JIZD 1FI8A 5EXNA 2W7SA 4Q63A 1NRSH 1SLUB 1UMAH 1O2HA 3BTGE 3M3TA 1C5QA 3C27B 4RSPA 1QJ1B 2FOGA 1RS0A 7GCHF 3LDXH 2PWXA 1ELTA 4DCDA 1C1NA 1NFYA 4MNVA 1GWAA 5TCCA 2A1DB 2GV6A 1NBMD 2GZ9A 1BBRK 2PUXB 3ZZ6A 1DICA 2C90B 1X7AC 3I78A 2ODQA 1GBHA 1TNIA 3M7TA 3RM0H 5F8ZA 2RA0A 5JB8S 1P04A 1QGFA 2ZA5A 1TQ0B 2O8WA 1GI6A 2FI3E 3BEUA 4K69A 1H8ED 2BDAA 4UD9H 1SFIA 1O5CB 1W0YH 4OS2A 3N7DA 1HCGA 3A84A 1S82A 2O8TA 1CE5A 3RXMA 4X2WA 1BIOA 1PQAA 2HLDD 4MTBA 2A0QB 2OTVA 3SUDA 2ZG0H 1PQ7A 3T27A 1P10A 2XRCA 2QIQA 5L2ZH 3KQBA 2H9EH 1NRPH 6CHAB 1AQ7A 1OKXA 1UCYH 4Y11E 1RFNA 3M5NA 3QUMP 3ZYEA 1A4WH 5DO4H 2JKHA 4ZXYH 1MTSA 2RFKC 1HAOH 2ZFFH 1QL9A 4O3UA 2UWPA 1QRWA 4JZDH 4JZFH 1OWKA 1K1NA 1RJXB 5EIYA 1HAHH 1FN6A 1DY8A 1HLTH 1TMBH 1VR1H 2B5TB 3D65E 8GCHF 2PKAA 1VITH 2ALVA 1LPZB 5C5NA 1HFDA 3RXEA 5JPMH 3SHAH 5GCHF 3KNXA 4CRCA 2Z6BD 4OS5A 2GDEH 1Z8IB 1E35B 2FEQH 3E0PB 3QN7A 1EOJA 3UR9A 3D23A 5B6LA 2Y5GA 3F2GA 3SYJA 4VGCC 2ASUB 2UUKB 1RIWC 4HTCH 5TJXA 3UFAA 2XCFA 4ZMAH 3A8BA 2YOLA 3ATMA 4AFZA 2V3HH 2H6MA 1YY3A 2CF8H 2J4IA 3B8JA 4NA7A 1BB0B 5E8EH 1OX1A 4FU7A 1A5HA 1IAUA 2H5DA 4R0IA 3VB3A 1GHYH 3TGJE 1TGTA 2FLBH 1BUIA 2QF3A 3SOSA 4DGJA 1G32B 1MBQA 2V3MA 3S69A 4YOJA 1G3BA 3SJ9A 1UJ1A 1O3OA 1P57B 1SGQE 2BD7A 2IJD1 5F6MA 1GBMA 5KGOA 2R0KA 2PSYA 1BA8B 1KXAA 1E38B 3OYPA 3PLBA 3TU7H 4VGCB 1MQ6A 1XUFA 3A82A 1G37A 2Y5FA 1ESTA 1HV7A 3LONA 4OS4A 5EXLA 2ZKSA 1QBOA 4BAMB 2BTCE 1ELBA 1GBFA 4Z1MD 1TOCB 2A4GA 3U8RH 3KGPA 1O3PB 4ZKSU 1TBQH 4I86A 2V6NA 4ACBA 1ZHRA 4ZAEA 5LPRA 1W3CA 1Y3WA 2YMSD 3LJOA 4CR9A 2V35A 1IHSH 4HFPB 1QA7A 3OTJE 1YBWA 4B2BA 2ZI2H 1SGDE 3TGKE 1THRH 3FP7E 1MAYA 1SGNE 2ZEBA 3LU9B 2C4FH 2SGEE 1UW7A 4Y76A 1XKAC 3VB7A 1XKBC 3SGBE 1GDUA 2ZDMA 2Y7ZA 1COWD 2F4LA 1P8VC 3STJA 3RXOA 1V2TT 1RTFB 1ZHMA 1O31A 1WSSH 1DWBH 3I77A 1BT7A 1AY6H 3A89A 2RDEA 2EA3A 1C4V2 1LCYA 1NRRH 1S83A 1XVOA 1LHEH 2F43B 2J92A 1ZJDA 2Q6DA 2KCPA 1RTKA 2ZDKA 4WMFA 2FX4A 4DIIH 5DP5A 1PPFE 1L1GA 3F68H 2KAIB 3MH5A 1MH0A 2C93B 2H1UA 2ZTYA 2AMPA 4X1NU 5C94A 1OP8A 3BEFB 4KGAA 4I8JA 3F1SB 1DFPA 1GBAA 1O39A 2BDBA 2GT7A 2W6ID 1KDQA 3T62A 1TPSA 1GHAG 1ELAA 1HAPH 5JBCS 2H2ZA 3PWBA 5E2PA 1C5LH 2BMGB 2G5NA 3F6UH 1QRXA 4Q7XA 3MNXA 4JZIA 4B1TA 3PMHB 3SU1A 1TALA 3GCTG 1W11U 5CHBA 2Z94A 1SSXA 4AX9H 1KY9A 4OM9A 3TITA 5DG6A 4BOHA 3AW1A 1AVXA 3MNCA 1C1RA 1V2LT 4ISLA 2VB0A 2V7QD 1EAWA 3OX7U 3BF6H 5A0BA 1VGCC 2PSXA 1C5VA 2PHBA 4I8HA 3SU2A 1CHGA 9LPRA 4YESB 3GY3A 1GJ7B 2QGRA 3PROA 2Q6FA 2A7JA 3QGNB 1L1NA 1OWIA 2XOKD 4X0WU 3F2FA 2ZPSA 3A8CA 4DURA 1D4PB 1EKBB 2SNWA 1H9HE 4FU8A 4QT8C 2V0BA 3TH3H 2ZU2A 1GBBA 1SKYE 4YM9A 3MU0A 2PKAB 3TLOA 1B0FA 1UCYK 3LPRA 2QXJA 3SU4A 3GDUA 3TNTA 3RXKA 4X8TH 4O97A 3LC5A 1GJ8B 1XXDA 2OP9A 4ABEA 2W5EA 2Z3EA 3ZVEA 2OD3B 5GIBA 2DUCA 3ZV8A 1ZOMA 1BMNH 4YOIA 5GCHG 1RGQA 2A45B 3BG4C 4FUIA 1O3GA 5DN6D 1WTHD 1GBJA 1UVUH 1JRSA 4K5ZA 1ARBA 4JCNA 5E0GA 1P03A 2LNCA 2ZDAH 1T8OA 2VIOA 2Y5HA 1GJ6A 1JIMA 2QF5A 3GY6A 5AFYH 4WVPE 1Z71A 1FONA 3KCGH 2ZDVH 4JYUH 4IBLH 2GMTB 1KTTB 5ESBA 1LVYA 4FVBA 4B71A 1O35A 3P8GA 1H1BA 3TJOA 1O34A 1O5GH 1ZPCA 2WPJS 3ZIAD 1H8DH 4NZQA 1BHXF 1C2KA 2PV9B 2BXTH 4B6EA 1GL0E 5FCKA 4WJG2 3TJVA 2ZO3H 1P02A 4UDWH 1AMHA 4WMEA 2F9OA 1O2VA 1L2EA 2ANKH 1S6HA 3UNSA 4BTIB 5DPAA 4UFGH 1DPOA 4CR5A 1CVWH 2AIPA 2ZFRH 1F5LA 3SZEA 1A3BH 1B0EA 3RU4D 4AYVB 5ABWA 2O9QA 5DK1A 3CS0A 1VCPA 3T2NA 2BVSH 1GJ4H 4I32A 4NGAH 2WYJA 2AYWA 4WXVA 3MYWA 4FETA 3Q00A 1GL1A 2P3TB 1JIRA 4INHA 3L3TA 1O5DH 1FV9A 2IN2A 5ESTE 2AS9A 3ODFA 1O2KA 1TQ7B 3SI3H 1L4ZA 1LHGH 1EXFA 1KLTA 1DM4B 4AFSA 1OP2A 2EEKA 4O9VA 5JBAS 1C1UH 3L33A 5DP8A 4XSKU 1KTSB 5TCAA 3ZZ3A 3VXEH 1GPZA 4E05H 2ZTZA 3RXRA 2EQNA 1NRQH 4PROA 4Q7YA 1J15A 2J98B 1V3XA 1P2IA 5EG4A 2ZC9H 1K28D 1F0TA 1O2LA 1TPAE 4MQAA 7LPRA 1E1RD 2KZ4A 4NA9H 2ZIQH 5GPIB 3PRDA 1YPHC 3URDA 1ELCA 3BTQE 1IQMA 1GMCF 1ETTH 2WPDD 3QO6A 1UVTH 5HGGA 1O3LA 1O30A 4AG1A 2RCEA 1P11E 3VPKA 2BD8A 1BTHH 1SG8B 2XWBI 3RLWH 3TVJB 3NKKA 1DVAH 2ZHEH 1QRZA 2UWOA 1G3EA 3A80A 5AFZH 2FOMB 3JZ2B 2RG3A 2WPHS 4NA8A 1JWTA 5K0HA 1ORFA 1T7CA 2P8OB 2UUJB 1GI8B 1LKAA 1O0DH 1BTUA 1ANCA 5C0TA 1V2ST 2CHAC 2ZQ2A 2P16A 2GCHG 1VJAU 1NPMA 2J9NA 2VJ1A 1WAYB 2FOBA 4RT1A 2G4UA 2GV7A 1ELVA 4AG2A 1T32A 3Q3XA 1V2RT 1SGEE 3BEIB 1PQ8A 3LGIA 4TSFD 5FPYA 2C8WB 1MTWA 4IN1A 4K8BA 2VU8E 3H5CB 2OC0A 3FFGA 3Q3KA 5T1VA 3UB0A 4AGKA 1ZGIA 2D2DA 5DKMA 2QAAA 2BLQA 3GYMA 1J17T 4YT6H 2L6OA 1EATA 1O5EH 2QXIA 1O3DA 4GCHF 5FXLA 1YP9A 1C1PA 7KMEH 1QR3E 1D6WA 2WINI 3UPEA 1CT4E 1DSUA 1O3KA 1OWDA 4YT7H 4CHAC 1EASA 2V3OH 4ABAA 2OLGA 2ZHQH 5AVDA 1XXFA 4CRAA 4IN2A 1Y3UA 3DUXH 4J2YB 4OGYA 1F5KU 3SJIA 1TGSZ 1FY1A 2VBCA 4CH8B 1ZTLA 3H09A 1YPGH 2PTNA 2H9HA 1WDIA 5FAHA 1AFEH 1NBME 2BDHA 1GVLA 3BG4B 2F83A 3PV5A 1MABB 5GDSH 1V2NT 1ZYOA 3MO6A 4FXGH 4FUDA 2JJ1D 4CH2B 2FO9A 1IQJA 3L6PA 2XNIA 1S6FA 4KELA 4I7YH 1AD8H 1O38A 1QL8A 1SGRE 3CP7A 3Q3YA 1GHWH 1O3BA 2LELA 3RXLA 2BD9A 4D7FA 6CHAC 3D62A 4H6TA 3RXDA 3ZVDA 2XBWA 1Y5BT 3ZZ8A 2XC0A 2Q1JA 1D3PB 1C1QA 2ODPA 2HRVA 3SW2B 1HPGA 2KX4A 2ZTXA 1NM6A 4MPWA 5EPYA 4ACAA 3SV6A 2HOBA 1A0LA 4ISNA 4O03A 4LZ4B 2ZPRA 2P3FH 3RXPA 4D7GA 1GHZA 1T31A 1TOMH 1FXYA 1SBWA 1ZMNA 4MPVA 1EJAA 4B76A 3OY5U 2IJOB 1UCYE 1S0RA 4M9FA 1QJ7B 1A7SA 1JRTA 3RC5A 3A81A 1BMLA 3DSGA 1YPEH 3RU4T 2BY5X 3EE7A 1IQIA 1SLWB 3V12A 1G3DA 5T6GA 5C0UA 2EY4C 3K6YA 3BTFE 3QLPH 1AZZA 1HB0B 5EW1H 1Y5AT 3Q76A 3TNSA 3ZYDA 1NESE 2ZU1A 1JOUB 3QX5H 1Z6JH 2A32A 1SGYE 3F9HA 1S5SA 3KQDA 3M61U 1PYTD 3STIA 5GWZA 4I33A 3ESTA 1P3EA 4BXWA 1FLEE 2WUCA 4WH8A 4BAHB 1MKXK 1CQQA 1HNEE 3U1IB 3SNDA 4CREA 3LC3A 4F55A 1YPJH 1AUTC 1BTWA 1F92A 5JYIA 3ZVFA 4OS6A 3M3VA 3P8OA 3BTKE 2Q6GA 2AMQA 2J5UA 4OGXA 2VH6A 1YGCH 3F9FA 2QXHA 2A2QH 1O3FA 3LH1A 1ELFA 1HGTH 3SGQE 1MMJN 2TPIZ 1O37A 5FPSA 3F0OA 1THPB 1EPTA 1INCA 5LGOA 1K1LA 3BTWE 2QC2A 1EPTB 2XBYA 1GI4A 5LPFA 4GHTA 2Y80A 1OP0A 3E91A 1KLJH 1MCVA 3R0FA 3U69H 2YMSC 1QURH 3BTHE 1AFQB 2KR7A 1Z6EA 3ZV9A 4CRDA 2PTCE 1C1OA 1HBTH 2TGAA 3S9AA 2ILNA 2YNAA 1TGBA 4U32A 3PLPA 4Y71A 4BANB 3NRLA 2EI8A 2QF4A 2VWMA 2EI6A 1C1SA 1WOFA 7GCHG 1GMHF 1C1VH 1W8BH 2GCHF 1XUHA 2C8XB 1AE5A 2Y82A 2H5CA 2UUYA 1FNIA 2YMSB 3RC6A 2FOFA 2B0FA 3TH2H 1JXPA 2G81E 2NU3E 1ZSKA 4SGAE 4DT4A 1IQNA 1SQTA 1WUNH 3MFJA 4NIYA 3AAVA 5FBIA 1VKYA 3Q77A 4BAOB 4AZ2B 2TBSA 1J9CH 2A5KA 1TX8A 2OXSA 3E16B 3PTNA 1J14A 1BTYA 2A4RA 4U30A 5HM2A 2GGVB 3MWIU 2W6JD 1DT2A 2JH5D 1FY4A 1GI1A 4NIVA 2BXUH 5G4BA 1UTOA 3PMBB 1GVKB 3MH6A 1W7GH 1GJ9B 1QB9A 5KEDA 1E79D 3UNRA 4HZHA 3K9XB 1O3EA 1T8MA 1O33A 1DSTA 1HJ8A 2QE7D 2OQ5A 2TRMA 2BDIA 1ESBA 3VB4A 5IK2D 1K1OA 2J97A 3MU4A 1BRUP 1YCPK 1FZZA 4X8VH 2R3YA 1EAUA 5JB9S 2OQUA 2OCVB 1ZMLA 3FZDA 1W0ZU 2FXRA 1HAYB 4GHQA 3U28C 1TX6A 4INKA 1VZQH 1SI5H 2Z7FE 1TBZH 4AGJA 5DP6A 4CBOA 1GHAF 1W0JD 4BTUB 1C5TA 3O8CA 4XBBA 2AHME 2HNTE 3RXSA 3V0XA 1GI3A 1BBRE 1VJ9U 4JMYA 4AFQA 2R3UA 2GMTC 1GMDG 1MKWH 2UUFB 1GBKA 4AB8A 1KMHB 1TE0A 1UHBA 1UK3A 4RI0A 3SUGA 3DFJA 4TPYA 1V2VT 3F3BA 3MI4A 4X2VA 2BD2A 1TBRH 3F9GA 3RC4A 3A7TA 5LH8A 1AO5A 2FM2A 1TAWA 1C1TA 1Y3VA 2GZ8A 1P2QA 1SOZA 3ATLA 3DSPA 3E6PH 2A2XH 1HAVB 2ZWLH 3GY8A 5T3HA 1AGJA 1AZ8A 3EAJA 4M7GA 1T4VH 1G2LA 1W13U 4KTSA 1FAXA 1QFKH 1O2QA 1HUTH 1S6LA 2YNBA 4ABDA 5DJ7A 1G9IE 1TNJA 1LVMA 5A2MH 2BVXH 3GICB 3BTDE 2OBQA 2VIVA 1O2IA 2BQ7B
chains in the Genus database with same CATH topology
1HDTH 4XFQA 2O8UA 1GHVH 4D8NA 2ZCLP 3RXBA 2NU1E 1ETSH 4MPXA 4ESTE 4MG3A 1HRTH 4ABHA 3O8RA 4IW4E 3TK9A 3V3MA 2BX3A 3UIRA 1EQ9A 1EP5A 3HGPA 8ESTE 3UY9A 2STBE 1SGIB 4FUJA 2A5IA 1LDTT 3RUOA 4LZ1H 1O5FH 8GCHG 1TRMA 5A8ZA 2F3CE 2XTTB 1HYLA 1DANH 1OYQA 2CF9H 2C8ZB 2BOKA 1FDPA 5H4IB 3UTUH 1GHBG 1MUEB 8KME2 4FUHA 2HNTF 1ZPBA 3G01A 3PV4A 4ZKOU 1GJBB 1LVOA 5L30H 5CHAB 5E0HA 4HGCA 5IDKA 2TGDA 1XMNB 1K2I1 1OXGA 4CRGA 1SPJA 4MNYA 4AORA 5CHAC 1CT0E 2CHAB 2FESH 2JH6D 2Z3CA 1GJ5H 2WV4A 4A92A 1D9IA 2GTBA 1LKBA 4ISOA 3ZVGA 4AOQA 2J34A 1P2NA 1P9UA 1SFQB 4U2WA 4XE4A 5E2OA 3LGUA 3S0NA 3EYDA 2P94A 1O2ZA 3RLYH 3U8TH 1ZSLA 2BY6X 1O2TA 1Q2WA 1JMOH 1EB2A 5PTPA 1EAXA 4A1VA 1DX5M 3PO1C 1YM0A 2HGTH 2OC8A 2NU2E 1K1MA 1BMAA 4FUEA 2DE8A 4NSYA 4ISHH 4ZUHA 2F9UA 1C5MD 3ZZ7A 3HK6B 1DWDH 4IMZA 2JETC 2QY0B 4CRFA 1C2LA 3SJOA 1MQ5A 1SC8U 4BTTB 5F8TA 1Q31A 1MU6B 2WPMS 1TIOA 4E7NA 1H8IH 1TB6H 3PMJA 3DFLA 3SU5A 3M35A 2ZHWH 1TX7A 3PTBA 3GCOA 1VITF 3BTEE 4GAWA 4INLA 2W26A 1A46H 1CT2E 2EC9H 2DE9A 2ANMH 2G00A 4BAKB 3RMOH 1W10U 1BDAA 3QK1A 3ZZ5A 1YPKH 1TRYA 1B5GH 1AIXH 1DLKB 2O8MA 3K2UA 3TJNA 1CA0C 1UTLM 3A86A 1C2GA 4ABIA 4BXSA 2A7HA 1BZXE 4Y6DA 3B23B 5DP4A 4YZUA 3GY5A 3M5OA 3A8AA 4ISIH 1A1RA 2ESTE 2FYQA 2SGQE 4E06H 4Z0KA 4MDSA 1A5IA 3PMAB 3A7WA 4Q7ZA 4MNWA 5C1XA 2R9PA 1XUKA 1C2MA 1NT1A 1HJ9A 1QQUA 1BTXA 3A88A 1SQAA 1KXCA 4MVNA 1B7XB 1GMDF 1P2MA 1UO6A 5C67A 3QGJA 3ZVBA 1LHDH 5FBEA 3H7TA 2XC4A 4O3TA 5C1YA 1ANDA 1MKXH 1ZPZA 1P2KA 5LPEA 2OC7A 1K1JA 1GBTA 4ABGA 3MNBA 4B2AA 3QZRA 2OBOA 1ETRH 3LT3A 1NC6A 2BDGA 1BOQA 4XBCA 2GCTC 1CA8B 1NRNH 1SGTA 3KQEA 7ESTE 2A31A 1LVBA 1QHRB 1DITH 2AFQB 2ZDNA 3BTME 3UOPA 3UR6A 1NFUA 5C3NA 5L2YH 3QDZB 4X6OA 1MZDA 3GCNA 4AYYB 4TPIZ 1EZQA 3OU0A 1O2SA 1IQFA 1QJ6B 1VCQA 3HPTB 3IG6B 4AB9A 1AB9C 1U6QA 1S85A 2OC1A 2P95A 4JZEH 4AFUA 2FLRH 4XDEA 1S81A 1FY8E 3CENA 2XBXA 4Y0YE 2LPRA 2ZFTA 2WPKS 1ABJH 1ZMJA 1W14U 4GLYA 1QBVH 1PFXC 1BHXB 5F03A 1D3TB 1SQOA 4Y0ZE 1SL3A 3T29A 2VWOA 3D49H 3NWUA 2A4QA 1ZRBA 1ELDE 3P6ZB 1K9OE 1UVPA 3ODDA 1BCUH 4GVUA 1TFXA 2ZZUH 2FTMA 1D3QB 2R2WU 2VVCA 1DY9A 3RXVA 1HJAC 2F91A 1FY5A 4JK5A 1ZLRA 1EZXC 2ZDLA 3S7HB 1KYNA 2ZCHP 5K7RA 5EQRA 1YLDA 1NZQH 3TGIE 3EA9A 1AE8H 1A3EH 3MU5A 4ZH8A 4X1SU 4DG4A 5JDUB 1N8OC 1GBIA 2JETB 1OWEA 2BM2A 1ARCA 2ZFQH 1HIAA 2FTLE 4X1RU 1QCPA 4X6PA 1O3NA 1DUEA 2HVXA 3PO1B 1TNLA 1H9LB 1P0SH 3P95A 1BTPA 3ZVAA 2VGCC 1HXEH 1UHBB 3VGCB 4NFEA 1AWHB 1EJMA 2CGAA 2G51A 4Y10E 1FIZA 3SNAA 2BY8X 1H4WA 3K6ZA 5BPEA 4DOQA 2FIRH 3EA7A 1LPGB 1GGDB 1HIAB 2IPHA 4DJZB 4NIXA 3HKIB 3U9AH 1W2KH 3RXHA 1O2NA 3IITA 1GI2A 4OS1A 4FUGA 1BJVA 3B9FH 2CN0H 1V2JT 4WXIA 5T6FA 2ZFSA 4XBDA 1LPKB 2HNTC 2BDCA 1GI9B 1G30B 1MAXA 4BAQB 3U98H 1YPLH 1FUJA 2AGGX 2A5AA 1IOEA 4ASHA 2B9LA 4FVDA 4X8SH 3MO9A 1GCDA 1SGFA 1PQ5A 5EQSA 2BYAX 4Y8ZA 1F0UA 4RN6A 1RTLA 3V7TA 1NU9A 1RIWB 3P8FA 1SGFG 3UQVA 1EPTC 4JYTA 3KEEA 3ZZ9A 2P8OC 5JBBS 1IQGA 1TRNA 1G2MA 1GMCG 3SNEA 1GCTB 1BRBE 1O2RA 3SNCA 3GY7A 2A4OA 1TYNA 1TNKA 3RXGA 1CBWC 2PLXA 2VINA 2Y6TA 2I6SA 2AGIX 2ZU3A 2FOCA 4TYDA 4NWKA 4H4FA 5GXPA 5BRRE 5DP3A 1YKTA 4E7RG 1BRCE 1Y3YA 3RXQA 3E90B 3SORA 2ZGXH 4MLFB 5A09A 3MO3A 1S84A 2B7DH 2BD3A 3GDVA 3NPSA 2VWNA 5L6NH 3BSQA 1GI0A 1DDJA 1YYY1 2HPQH 3RMNH 3RXUA 3SQHE 1CA0B 6GCHF 4B2CA 1C5NH 2XW9A 4UFFH 4LXBH 1SOTA 3QZQA 1ANEA 2FODA 3EDXB 1AHTH 1TLDA 4MPUA 1OWHA 3E0NB 1MKWK 1O2WA 2BY9X 4DW2U 1NO9H 2VWLA 1HAXB 1PPZA 2CV3A 1XM1A 4YO9A 4X2YA 4TY6A 4XOJA 1GDNA 3EGKH 1OPHB 1HXFH 3EA8A 1AVGH 5DP9A 1WQVH 3A8DA 2ZFPH 2ZU4A 2GZ7A 3P70B 1TWXB 3M3SA 1BBRH 1KXBA 5SGAE 4ZHLU 3TK6A 4WF8A 1O3JA 3BIVH 4GPGA 2ZCKP 1F0RA 1GG6C 3RXFA 1OS8A 4AN7A 3KN2A 3NCLA 1N6XA 1NN6A 2BLVA 5CMXH 2GP9B 3SJKA 5A8XA 2FX6A 5GJ4B 5FCRA 2F9BH 2BLOA 2D8WA 3RXTA 1ZZZA 1P2OA 4FU9A 1CHOF 3KL6A 1C5YB 3TK5A 2F9NA 5EU8A 1V2MT 3SV9A 4YTAA 1GGDC 2XWAA 5AHGH 3MU8A 1O3HA 1WU1A 1MD8A 1Y5UT 1GCTC 3GDSA 2XC5A 1PPHE 3A87A 8LPRA 1TNGA 2BX4A 6GCHG 1QBNA 1KLIH 2VGCB 3GOVB 3LKWA 4X8UH 3SUFA 5HXFA 4K3JA 3M7QA 1NFXA 4IC5A 3SGAE 1DS2E 1D6RA 3T28A 4F49A 3UOUA 9ESTA 3MU1A 1OSSA 1DE7H 3P8NA 1E37B 1V2UT 2XCNA 1GJDB 3M5MA 1SGCA 1G3CA 1XUJA 2BLWA 3URCA 1JBUH 2G52A 3SU6A 1P9SA 4JK6A 3HK3B 5EOKA 1MTNC 3VGCC 1O36A 1O3MA 1SVPA 2AMDA 4FUBA 5HYOA 3BV9B 4YLQH 3SV8A 2B8OH 1CHOG 4Q2KA 4D9QA 2G4TA 1ZHPA 2D1JA 1H9IE 1UVOA 3EQ0H 2FWWA 1MCTA 3KHVA 2J2UA 2Z3DA 5FPTA 1C5XB 1C9PA 1QB6A 2AIQA 1DWEH 1P01A 5ETXA 5EW2H 4IMQA 1KSNA 1Y8TA 4K2YA 1SLVB 2K1QA 4KTCA 5DGJA 4IC6A 4H6SB 1FIWA 1FQ3A 3VB6A 1L0ZA 1PPEE 1EZUC 1W12U 1LHCH 1WQSA 1AVWA 1LO6A 2ZP0H 1J16A 2PR3A 3MH4A 1WYKA 1P06A 4H42U 4DVAU 4HI3A 4CBNA 2WPLS 3BTTE 4X2XA 1AUJA 2H9TH 3H7OA 4KP0A 4WY3A 1EB1H 2PUQH 1AKSA 2A7CA 3EE0B 4ZROA 4ABJA 3SU3A 2WYGA 2C3SA 1GJCB 3TPIZ 4X6MA 1S0QA 3ZZBA 1MZAA 1N8OB 2QF0A 5AF9H 3ZVCA 5F8XA 2PKSB 2W3KA 5A0AE 1Z7KA 3FAOA 3MHWU 2VIWA 5EODA 1UK4A 1YC0A 4NSVA 1M9UA 4LOYH 1BMMH 1T8NA 1NFWA 3VFEA 3BN9A 2HWLB 4WH6A 1BJUA 1HJAB 2CMYA 4JZ1A 3SQEE 2P3UB 1N6YA 3R3GB 2Z9GA 3E3TA 1GG6B 3F9EA 1ESAA 2ALPA 3LH3A 3E8LA 1NROH 3A83A 4K1SA 1XUGA 4ZXXH 1C5SA 2QV1A 3DA9B 1IQEA 3ITIA 1XUIA 1PPGE 1GHBF 2FDAA 1AFQC 1Q3XA 1GJAB 2D26C 4TWYA 1C5PA 3LOXA 1FJSA 1L4DA 1HAVA 2KAIA 2FPZA 1V2PT 2GCTB 4K1EA 3JZ1B 4Z6AH 4UFDH 1LQEA 3LGWA 1YF4A 2VVUA 2FI5E 4K1TA 2BD5A 1KXEA 3GY4A 1C2FA 5T6DA 3SO3A 1E34B 5FX6A 1O3IA 4UFEH 4I8KA 3VB5A 1AU8A 2P93A 2RDLA 3RM2H 3BG8A 3VXFH 3N7OA 1V2KT 2J94A 1T8LA 2FYRA 1IQLA 4CHAB 2VVVA 2GDDA 3T25A 1UTJA 5JBTA 1SB1H 5FHTA 2GD4B 2ZECA 3P17H 1EP6A 2O8LA 1UTQA 1SGPE 3RXIA 1K1IA 1THSH 1SLXB 3ATKA 4ZKRU 3A7XA 5CE1A 1QTFA 1EUFA 2QYIA 2VNTA 4FUCA 1C9TA 1GBEA 1O3AA 1CBWB 1LTOA 2ZHFH 1CGJE 1UVSH 2Y81A 1GI7B 4NWLA 2ZPQA 1SMFE 3UWIA 1IHTH 1TABE 3O8BA 3UWJH 2BY7X 4ABBA 3HATH 1C5OH 1P05A 1QIXB 1O3CA 1TGCA 1YPHE 2FOAA 2HLCA 4GCHG 1Y3XA 1MTUA 3KQCA 1ZJKA 1A5GH 1O2UA 2NU0E 1P12E 1VITG 2AH4X 3MNSA 1V2WT 5HMAA 3GCHC 3ZZCA 5C1UA 3DHKH 3MOCA 1C4Y2 1D3DB 1UTPA 2QCYA 3BIUH 3GCTF 4X1QU 1O2XA 1EX3A 3AAUA 3OSYA 3WY8A 3S9BA 2WPIS 1O2GH 2PFEA 1Z1IA 2ZGJA 3SZNA 3SI4H 2ZGCA 2FS8A 1NS3A 1V6DA 2ANYA 3TH4H 1LQDB 1F5RA 1UK2A 5HM9A 1FY3A 3ATWA 1WBGB 1DXWA 2F9VA 1PPBH 1DXPA 2J95A 1V2QT 2XYAA 4U01A 1ELGA 1ZTJA 2QA9E 1O32A 1TA2A 3FVFB 3NUMA 3RXAA 1Y59T 2Y7XA 3ZZ4A 4J1YA 2THFB 1QL7A 1C1WH 1O5BB 1TMUH 4Q80A 3SBKA 4OS7A 3RXCA 3ELAH 2QXGA 2EI7A 2FP7B 3GISB 1FPHH 1E0FD 2P59A 3SU0A 3S7KB 2BB4A 1GBLA 3ATIA 3O8DA 2BVRH 1QB1A 2C8YB 3TIUA 3FANA 3GYLB 3CS7A 1AWFH 3SHCH 1P2JA 4UONA 2F9PA 3PLKA 2BQ6B 1QA0A 3W94A 1P09A 2ZGHA 1YCPM 1C5ZB 3K65B 4RKJB 4ZHMU 1BITA 1HAIH 3PYHA 4B74A 2ZGBH 3TJUA 1V2OT 1F0SA 2VH0A 1O2YA 1LMWB 1OWJA 2FZZA 3T26A 1QQ4A 2WV5A 1XVMA 3IWMA 4DT7B 4UEHH 1FMGA 4A6LA 1G36A 3AASA 3UUZA 1ZSJA 3SJ8A 1C5RA 1LHFH 2PGQB 1CGIE 3GY2A 1A61H 2STAE 3KF2A 1ZR0A 3RU4E 1GI5A 4IGDA 1A0JA 3FZZA 4DIHH 2ZU5A 2PW8H 3LJJA 4GUXA 3RDZA 1EAIA 1TMTH 1O2MA 4I8GA 3LGYA 5EPNA 1C2DA 4NFFA 2TGTA 3PWCA 4SGBE 1FPCH 4WWYA 3SNBA 3PM3A 1KDQB 2BD4A 3RXJA 3HGNA 2VIDA 1QY6A 3RMLH 2ULLA 1VCWA 1DWCH 4YLUA 1W7XH 1C2JA 2BHGA 4Y8YA 2SNVA 1ZRKA 3ENSB 3RP2A 1ACBE 2G5VA 5A0CA 3GCHB 3NZIA 4TY7A 2J38A 3W95A 1YPMH 2I6QA 2TGPZ 3E1XB 2W3IA 3I29A 4R8TB 1C5UA 2FOHA 1K22H 4THNH 3ZZDA 1CSOE 4FUFA 4Y7BA 3M5LA 3MH7A 1EOLA 2BQWB 4K60A 1AB9B 2Z9IA 1T4UH 5J4SA 3QTVH 1SHYA 1OYTH 3QWCH 4ZKNU 3ZZAA 1GMHG 2AGEX 1TPOA 1C4U2 4I31A 4D76A 3U8OH 1K1PA 2M5TA 1BRAA 1C1MA 1A0HB 2GX4A 1QNJA 2FOEA 2CJIA 1K21H 4NCYA 4CRBA 1RRKA 1ZGVA 3PB1E 1GHXH 3SV2H 1Z8GA 1IQKA 1N1LA 1FAKH 3UQOA 1C2IA 1PJPA 1AN1E 2ZHDA 3M37A 1ABIH 3A85A 5E0JA 1SR5C 2Z9LA 4B73A 4YOGA 1GBDA 4KKDA 1NY22 3LGTA 2HALA 5C20A 1O5AB 3AW0A 4ZHAA 2PGBB 2FMJA 2OINA 1DLEA 3T5FH 3UREA 3DT0H 2GKVE 1CU1A 3FP8E 1EJNA 1MU8B 4TWWA 1L1JA 1C2EA 1UTNA 5J4QA 1J8AA 4X6NA 4A1TA 1TONA 2ZF0H 1KXDA 1PPCE 5EQQA 3S9CA 5I46H 1E36B 3KIDU 3QTOH 4BNRA 1AI8H 6LPRA 1GDQA 1NU7B 1WCZA 2RA3A 1GVZA 3MMGA 1TPPA 1Z1JA 2JH0D 1UTMA 4NZLA 1YLCA 2HPPH 1P3CA 3LGVA 2G55A 3M7UA 1TGNA