2FXRA

Human beta tryptase ii complexed with activated ketone inhibitor cra-29382
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
243
structure length
243
Chain Sequence
b'IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptase beta-2
molecule tags Hydrolase
source organism Homo sapiens
publication title Structure-guided design of Peptide-based tryptase inhibitors.
pubmed doi rcsb
total genus 49
structure length 243
sequence length 243
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.59: Tryptase.
pdb deposition date 2006-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fxrA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fxrA01
1T4VH 3I78A 6LPRA 5EXMA 2ODQA 3S69A 2Q1JA 3RXSA 5E8EH 2ZFQH 5GDSH 1NM6A 2ZEBA 2UUFB 2Y7XA 1ANDA 1LDTT 1DPOA 1SGIB 1JIMA 1ORFA 4WH6A 3URCA 2YOLA 2A5KA 4K1SA 3PO1B 2IOTA 1BHXB 2SGEE 4I8KA 3LT3A 1S0RA 1DWEH 1MQ6A 2RA3A 1Z8IB 1LMWB 1C1UH 3H5CB 1UVPA 5ESTE 2VIWA 2AYWA 3U1IB 1F0SA 1YGCH 2VWLA 1NPMA 2Z9LA 3RLYH 2PKAB 4AX9H 3URDA 5A2MH 3ATLA 1QA7A 4MNVA 1Y3VA 5CHAB 3SGAE 5DP6A 1MTSA 3SN8A 3RMMH 3E91A 3ZZ4A 1DLKB 1DXPA 7LPRA 2VGCB 3D23A 1O5AB 4A7IB 1GCDA 3KNXA 2JETB 1BMMH 3MU0A 1BZXE 4UE7H 2GDDA 3QZQA 1AUJA 5CE1A 1B0FA 3I77A 3KQDA 2BQ6B 4YO9A 1DITH 1DDJA 3MU4A 5L2ZH 3SORA 3A7WA 1Y3XA 1DANH 4ISNA 4Y0ZE 1ZR0A 2BD3A 3GDUA 5C5OA 2VVUA 1KY9A 4D7FA 2WV4A 3FANA 1TX7A 3ZZ8A 4CRBA 3SNEA 1RGQA 2ZI2H 1AB9B 1DS2E 3P8OA 2PTCE 1FPHH 1A7SA 2GCHF 3GCTF 2NU3E 1HAZB 3FP7E 4UEHH 2D8WA 1SB1H 3U9AH 4H6TA 1QTFA 1TGSZ 1ESTA 4K60A 1V2VT 3OYPA 1IOEA 2ZDAH 1QURH 2HNTC 5LGOA 3UPEA 3SOSA 1NESE 3RXJA 3T29A 1AE8H 4IW4E 2J2UA 1GBHA 2D1JA 2C4FH 1AHTH 1C2DA 1NS3A 1ABIH 3BEFB 3U8RH 4X2YA 1FPCH 1YPLH 3AVZA 2F83A 4LZ4B 1EB2A 1UMAH 1FIZA 2H1UA 1MH0A 4IN1A 1GHXH 1EZUC 5FBEA 4ZXYH 5FPYA 4I8LA 4TY6A 1GJ6A 1HGTH 1CA0C 3T62A 3RMNH 3PMJA 4Y76A 2BD7A 2QY0B 3MO6A 1ZHRA 3GISB 1GJ4H 1TNGA 1TABE 2ZFPH 2VIDA 2R3YA 2F91A 3RXCA 4ABJA 4ZHLU 1ZOMA 1XXFA 3RXAA 3SW2B 1IHTH 3VXFH 1XKBC 1V2UT 3QTVH 1C2IA 2GX4A 3D62A 4UD9H 1AFQB 2CHAB 4X8TH 4CRGA 2ZGBH 2WUBA 1MKXK 2W3IA 3UOUA 1AKSA 1GBKA 1SLWB 3SNAA 1CHOF 1TRYA 1VR1H 2HNTE 1Y5AT 4AYYB 2ZDMA 1UHBB 1SGPE 1TYNA 3UR6A 2UWOA 2LPRA 1OWDA 1B0EA 2FI5E 1EP6A 1ACBE 1KTSB 4K3JA 1KLTA 3OTJE 5PTPA 1WYKA 3UFAA 4KP0A 2KAIA 1O3NA 1NFYA 1F92A 3ZZ7A 5JYIA 3F9FA 3U1JB 1C9PA 1O5CB 3A87A 1T8NA 2G4UA 2H6MA 1XXDA 4NA8A 4ZROA 1ANEA 2VWMA 1BDAA 2BM2A 5EODA 4ASHA 5G4BA 3A81A 1BOQA 3IITA 4CH2B 5DO4H 1P03A 1K2I1 2WINI 5HMAA 1HFDA 3RMLH 1OWIA 4XDEA 1MTNB 4OGYA 3LOXA 1LTOA 2GP9B 2ZQ2A 3RXEA 1TPSA 2XC0A 3NKKA 4MTBA 1P2KA 3PYHA 3LC5A 4LZ1H 3SNDA 3SI4H 4K8YA 2ZDNA 3F6UH 1OWHA 4A1TA 4A92A 2FLBH 3TGIE 4D8NA 2Y81A 2GCTB 1NFUA 1ABJH 1KXEA 1O3PB 1OS8A 4X1QU 3MH6A 1WQSA 5DP4A 3V7TA 2I6QA 2XYAA 4JZFH 1XUFA 4XE4A 3UNRA 5TCAA 1TRNA 1S0QA 1C2KA 1PYTC 1O2MA 4BAOB 2RDLA 1HBTH 1O5FH 1FY8E 1MQ5A 1D6WA 1XM1A 2FOEA 3SUGA 1L1NA 1SHHB 1O2SA 2O8MA 1P02A 4MLFB 2ZTYA 3AAUA 3MWIU 3A83A 3BIVH 3LC3A 1KIGH 2AMPA 4FU8A 7GCHG 1OOKB 2Z3DA 2VIPA 2BDBA 2A4OA 2R3UA 1TIOA 1F5LA 1GHAG 1ARCA 4X1PU 2TGAA 1QJ1B 1O2PA 3PLPA 1DUAA 1E38B 4BXSA 1AN1E 1ZGVA 1ELGA 1YKTA 2ZU5A 4SGAE 1YM0A 1EX3A 1TNJA 4U2WA 1QGFA 4FUHA 5A0BA 1T7CA 2GT7A 4FUIA 1EPTB 5E2OA 3SUEA 4DCDA 1NZQH 2QIQA 3KEEA 1A0HB 1V2QT 2OTVA 3SNCA 1ELVA 1N8OB 3BTME 5GCHG 5LPRA 4BNRA 1SVPA 1GCTC 3GICB 1GI9B 3CS0A 2HNTF 2ZHEH 1CHOG 4D9QA 1MTVA 2A0QB 1MD7A 1C5VA 1A1RA 4I32A 3VXEH 3BEUA 3C1KA 2OQ5A 2ZKSA 4KTCA 4NZLA 3M7UA 1V2OT 2XBXA 4TPYA 2FOGA 3RP2A 2J38A 4NIXA 1CO7E 1Y5UT 3M5OA 5T3HA 1G37A 4JCNA 1O5EH 3A8CA 1TBRH 1TNHA 1EASA 1AVWA 2CV3A 5H4IB 1O2LA 1GJBB 4GAWA 1CBWB 4ZHAA 3MNCA 5AFYH 4Y6DA 1LQEA 5TJXA 1TX6A 2BMGB 3RLWH 1O30A 4Y10E 3QUMP 1O2RA 3F9GA 1ELDE 1ETRH 1ZTJA 4KKDA 4Y79A 2TGTA 1T32A 3STJA 1QRXA 2B5TB 1TBZH 2ZU2A 1TQ0B 3GDVA 3RXLA 3PMAB 1O39A 3NK8A 1LKBA 1D3QB 4B2AA 1OWEA 2V3HH 2P93A 1C1WH 2G81E 2OCVB 1XUJA 2JETC 2UWPA 3V13A 1A3BH 1UTNA 3SU6A 1P2OA 2ZFFH 4IMQA 1GI8B 3HATH 3HK3B 5C20A 2G5VA 1A0LA 3LKWA 3UQVA 2BXUH 1ELEE 4WY3A 4AB9A 1FONA 2ZDLA 4ZHMU 4DGJA 1UTJA 1DWBH 4CR5A 3LH3A 4K8BA 4NFFA 4WJG2 3O8BA 1JMOH 2XNIA 3A84A 4M7GA 7ESTE 1TFXA 4BAQB 1BTWA 2VIVA 3T5FH 4X8VH 1QFKH 4IMZA 1GVKB 1ELTA 1WOFA 1O35A 1SG8B 3H7OA 1YP9A 3DUXH 2FYQA 3K6YA 1SGCA 4YTAA 3TK5A 1PPGE 4DG4A 5GWZA 1OWJA 3PLKA 3E3TA 2H2ZA 1SGFA 2FI4E 1TPOA 1G9IE 1V2NT 2BY7X 3FZZA 4TWWA 3EDXB 1ELBA 1KXAA 1A4WH 1XUKA 3MH7A 3NXPA 2F9NA 4YM9A 2JH6D 4U30A 4BOHA 1EPTC 4CRAA 1O2VA 3BTWE 2QXGA 4BTIB 1EZQA 3HGPA 1P09A 4WH8A 1QBOA 1DY8A 2BX4A 2FO9A 3BV9B 4TWYA 2P95A 3Q3YA 7GCHF 1MKXH 1N6YA 1AVGH 1H9HE 1H1BA 4RKJB 1NN6A 2ZU1A 3R0FA 2GCHG 1GHAF 1AY6H 1C5SA 4OS2A 3T25A 3E6PH 2GVFA 4X2WA 1ZMLA 1KXBA 4Q7XA 2FI3E 1S81A 1KLIH 2FESH 3TGJE 1QIXB 4MQAA 1ZMJA 1WAYB 6ESTA 3TK6A 5E0HA 5ESBA 1ZSJA 4O3TA 2QGRA 1DWCH 2ZFSA 4AZ2B 2FOBA 3U69H 2OC0A 1NRNH 4FUEA 3MH4A 3PTBA 3JZ1B 4I31A 1AD8H 3L33A 3P17H 1K28D 1SOZA 2D26C 2AIPA 5GXPA 3QX5H 3RM0H 3NUMA 1L4ZA 3S9BA 1BRCE 4X1NU 1AU8A 1P3CA 1IQLA 4CHAC 2GZ7A 2XC5A 1ELCA 1UO6A 4MNXA 4A5TS 1AIXH 2HOBA 1O2TA 3SU5A 1G32B 4WMDA 3RU4T 2ZU3A 1T8MA 4DW2U 4IBLH 5EGMA 3M3TA 3QTOH 3RDZA 3S9CA 1C2HA 3DFLA 4Y7AA 1LO6A 1TMTH 4LXBH 3NWUA 1BCUH 4A1VA 2NU2E 1CQQA 2BLWA 3A80A 3AAVA 3PMHB 1V2JT 2A45B 2TIOA 3P8GA 1HJ8A 2SFAA 4YOJA 1OP0A 2A32A 3F68H 1PFXC 1PPCE 1HAYB 1HJAC 2P3FH 4LK4A 1SLUB 2V3OH 3BTTE 2Y7ZA 2STAE 4Z6AH 3PLBA 2Z9KA 1JIRA 1JWTA 1CU1A 1OPHB 2OP9A 2R0KA 1GMHG 2BY8X 2ZU4A 1Y3YA 3T27A 4AG2A 3ZZDA 3QZRA 1MKWH 4AFSA 2RG3A 1V2KT 2PTNA 5L2YH 1LHGH 1UVUH 2VNTA 1VITG 2ZG0H 1YCPK 1XVMA 2CN0H 4CBNA 4XBDA 3GOVB 3T2NA 3RXRA 1FY5A 2PUQH 1Y8TA 3K6ZA 1KXFA 1XKAC 4OS5A 4PROA 4B75A 1SLXB 1G3EA 1P2MA 1TMBH 1L1GA 1GBEA 2XW9A 2BXTH 4CH8B 3RC5A 1O3BA 4ISHH 4JK5A 4X8UH 1D3PB 4HZHA 5B6OA 1U6QA 1Z6JH 4MPVA 1HCGA 2QV1A 2OBOA 3GY7A 3SV7A 3RMOH 1NY22 1INCA 1QJ6B 4MPUA 4AG1A 3TITA 1EATA 1HAVB 3OY5U 1S83A 5L30H 2WV5A 2EI6A 1P05A 5EPYA 1BIOA 5C3NA 2ZO3H 3LIWA 2BVSH 2GV7A 3T28A 1TE0A 1Y59T 2Q6FA 3ATIA 2A4GA 3RXDA 5A8ZA 1DICA 4GUXA 4F49A 4CREA 1W10U 1CBWC 3MNXA 5LPEA 1Y3UA 1BTUA 1HJ9A 1FN8A 7KMEH 2C8XB 1FJSA 6GCHF 3ATMA 2O8LA 2ZFTA 3ZV9A 1SGTA 2BD9A 4ZMAH 1P12E 4YOIA 2VWNA 3TPIZ 5C1YA 6CHAB 1LHEH 1SGRE 3SU4A 5IDKA 1IQJA 3PB1E 1H4WA 2ZC9H 2HWLB 4BXWA 1C1OA 1J9CH 3ZZ9A 1C5TA 2QA9E 1GBAA 2BY9X 4Q7ZA 5ETXA 1OKXA 4UFDH 1S6FA 2FX6A 5EXNA 1UTKA 3SNBA 2AMDA 3GDSA 1UHBA 1IQIA 1B5GH 3GY6A 3SUFA 4Q2KA 1HAIH 3A8DA 1J8AA 4BAKB 1J14A 1HAHH 2FTLE 1G3CA 1ZTKA 3KCGH 1F7ZA 1GBTA 3TNTA 4I8JA 2AGEX 4WF8A 1OP2A 1D3TB 1O3JA 2Q6DA 3SV9A 3PWBA 2BB4A 1BMAA 1BRAA 3BEIB 1LVBA 1V2ST 2XWBI 4UFEH 2QXJA 1O2UA 3BTDE 3ZVCA 5DP9A 1MUEB 4MPXA 3RXUA 1DM4B 3SGBE 3KF2A 4AORA 4DURA 1GL0E 4WVPE 4K2YA 4Y8XA 1RXPA 3LGWA 1SGYE 3RXGA 1SQAA 4TY7A 3MU8A 4E06H 5C2ZA 2GV6A 1SLVB 1S6HA 1RFNA 1P2NA 3P92A 1ESAA 1BT7A 2H5DA 4OS7A 2K1QA 3Q3KA 3NCLA 1YCPM 3O8CA 2BZAA 1C2LA 1RIWB 2SGDE 2SGQE 3UTUH 3PV4A 4I33A 4H42U 2ZZUH 4XBBA 1UJ1A 1P2JA 1D3DB 1SMFE 3M37A 2ZWLH 4CHAB 1EAIA 4AN7A 3UIRA 5DP7A 1X7AC 1GVZA 2VIOA 4ABAA 3VB5A 1HRTH 1OX1A 2PSYA 1BTHH 1O3KA 2FP7B 1O3FA 2QF0A 3VB6A 1EP5A 2BDIA 2Z3CA 1C5YB 4F4OC 2WPHS 5C1UA 1TPAE 1YPMH 2XWAA 1C2EA 1GDUA 1BA8B 2C90B 4NIWA 3L6PA 1Z8GA 5HM9A 4H6SB 2F9VA 5AVDA 1GL1A 1GGDB 1MZAA 3BTKE 1AWHB 1DSUA 1VITF 1DX5M 1G2MA 3GCOA 3L3TA 1TLDA 1BTPA 3TJUA 4BTTB 2ULLA 1W7XH 2FS8A 4WXVA 4CRFA 4BAMB 2XXLA 2ASUB 1O2JA 1EPTA 1GBDA 1RIWC 3SBKA 2AMQA 3ZZAA 3EA7A 3RM2H 2QF3A 4WMEA 3SJ9A 2R2MB 1THRH 4X6PA 4ABFA 3RXKA 3FVFB 2PLXA 5EQSA 2EI7A 1SGNE 3TK9A 3VGCB 9LPRA 1KDQA 2UWLA 3RXIA 1PQ7A 3QGJA 4BTUB 2QXHA 5I25A 1HPGA 5FPSA 1BJUA 2XCNA 1L4DA 1Z71A 2ODPA 4O3UA 5JB8S 2ZGCA 1A46H 5FBIA 1Z8JB 3RXMA 2XC4A 4X8SH 3ZV8A 2Y5FA 3DT0H 4CR9A 1NT1A 4DIHH 1F2SE 1BB0B 1NFXA 2NWNA 3SU1A 1W2KH 1BTXA 3EA9A 4R0IA 4OS4A 2Q6GA 1GHBF 1P8VC 3GCHC 1O3OA 1V2LT 1V2RT 4JYTA 4A6LA 2ZP0H 1SHYA 1SGFG 3FAOA 1WCZA 3EQ0H 1MCVA 2A4QA 4ABEA 1QR3E 3V0XA 5JBCS 1P01A 3GY8A 1T8OA 1XX9A 1W8BH 5FX6A 6CHAC 2NU1E 1IQMA 2AIQA 3UOPA 1ZPBA 1AVXA 1A5IA 4CBOA 1HLTH 2TGDA 4Q7YA 4ZUHA 4ZH8A 1XUGA 1SQTA 1CGHA 3EE0B 3O8RA 3M5LA 3K2UA 3RU4E 2DUCA 4OS1A 1BMLA 5FCRA 2GT8A 3LDXH 1VJ9U 1CT0E 1AB9C 2IJOB 1TAWA 1O37A 4JZ1A 4Y8ZA 3ZVBA 2QN5T 3BSQA 3SUDA 2FOHA 4ESTE 2BQ7B 2Z9JA 1W14U 2CMYA 1RJXB 2BD5A 1O31A 1C5QA 1SGEE 1C5NH 1YPEH 4JYUH 2M5TA 2YNAA 3OU0A 1CT4E 3TIUA 2ZPSA 4U32A 4NSYA 1FIWA 1GBLA 1TA2A 2C3SA 3VB7A 1BQYA 1S5SA 3MO3A 2C93B 1HAVA 1TGCA 2BVRH 2NU4E 2PHBA 1GCTB 2FOMB 3DA9B 1Z7KA 2A1DB 1A2CH 1UK3A 3VPKA 1PYTD 1O5GH 3A88A 2ZDVH 6GCHG 1C2JA 3A86A 4GCHG 4JYVH 3GCHB 4O97A 1ZTLA 1BRBE 2OQUA 3M7TA 4UFFH 2OLGA 2J4IA 3LGIA 1ZHMA 1VITH 1S84A 1GDQA 2QCYA 1O38A 1HUTH 1CT2E 3TH4H 1P0SH 1TALA 1WBGB 1IHSH 1O3CA 1O3EA 1F0UA 1QQUA 1O2XA 5C67A 4DOQA 1UVOA 1ARBA 1MMJN 2PR3A 3BTGE 2O8UA 1Z6EA 4YESB 1JBUH 1W3CA 4THNH 1D6RA 1KLJH 2OC1A 3MHWU 1QJ7B 2FMJA 3MH5A 4LOYH 3VGCC 4B1TA 2BD8A 2OD3B 4KTSA 2BDAA 4JZEH 4FXGH 1LPKB 1UVSH 1LVYA 1O2ZA 1MKWK 1ESBA 3Q3XA 3E16B 3RU4D 2GZ8A 5DP3A 4FUBA 5AHGH 1E0FD 2ZIQH 2FZZA 4X0WU 1YCPH 3H7TA 1ZPZA 1C1MA 2BOHB 3QGNB 1UTLM 5DPAA 3E90B 4VGCB 3U98H 5J4QA 1QY6A 3SZNA 2VWOA 1MTNC 1QHRB 5GPIB 1EAWA 1ELFA 3FFGA 5E0GA 1C1PA 2QYIA 5JPMH 3SU2A 4AOQA 3OSYA 3Q77A 2Z6BD 4E05H 4XFQA 4INHA 1O3LA 2WYJA 1MBMA 1GMCG 1AFEH 2ANWA 3E8LA 1P04A 3AW0A 2FOAA 3OY6U 3HKIB 1A0JA 5C5NA 1ZHPA 5A8XA 5FCKA 2EC9H 1O3IA 1THPB 1RRKA 1AE5A 3QK1A 4OS6A 1C1SA 1P2QA 3ZZBA 4ABGA 1HXFH 1ZZZA 5EU8A 1Q3XA 1O5DH 5F8XA 3S7KB 4GSOA 1G36A 1QRZA 3SJ8A 4IN2A 1DY9A 3SQEE 2STBE 4VGCC 1QA0A 4HGCA 3GYMA 4ZAEA 1L0ZA 4I7YH 5L6NH 3HK6B 3WY8A 4ZKNU 3F1SB 2AFQB 4GCHF 1AI8H 1GBJA 2F9PA 1FN6A 3TJOA 3BTQE 1DSTA 2WUCA 1AWFH 3AW1A 2GZ9A 3FP6E 1CA0B 1O2GH 4U01A 4NFEA 1CVWH 4X6OA 2BDYA 2BY6X 2P3UB 1GI2A 2BDGA 3D49H 3MFJA 1YPKH 5DKMA 2AERH 3LJJA 1EJAA 1PPZA 1A61H 2WPKS 1ZRBA 4R8TB 1GDNA 2H5CA 4NZQA 2HVXA 1DUEA 1Y5BT 1Y3WA 2H9HA 3GCNA 3VFEA 1GJAB 3CS7A 1TGBA 2JH5D 1BBRH 1C2GA 1SI5H 3M3VA 2FYRA 1BHXF 1Z1IA 3MYWA 1GI0A 3QWCH 1C1TA 3A7XA 1NRSH 1C5WB 1C2MA 1L2EA 3KQBA 1JRTA 5FAHA 1GBMA 1YBWA 2ZNKH 3BF6H 2V6NA 3SJIA 4I8HA 2WPIS 2VVCA 1LVOA 3TJVA 4RSPA 1ETTH 5FXLA 4FU7A 1MAXA 4KELA 4ISLA 1GJ7B 2BQWB 3RXVA 2BYAX 2R0LA 1K1LA 3EGKH 2PGQB 8KME2 4AFZA 1T8LA 1JOUB 1O3HA 3SV2H 3STIA 1MD8A 1LCYA 2WYGA 4FUCA 3S9AA 1FMGA 3BN9A 1SQOA 1Z1JA 3KL6A 2CF8H 1PPHE 2D2DA 1GBCA 4Y11E 3N7OA 1HAOH 2BLOA 1D9IA 5F8ZA 4FU9A 1G2LA 4KGAA 4BAHB 1KXDA 1H9IE 3A85A 2CXVA 5T6DA 2EI8A 1XMNB 2HALA 1M9UA 5DP5A 1QL9A 1MU8B 5K7RA 2XBWA 1EQ9A 3SJOA 3LGTA 1O2IA 2VINA 4OGXA 2DE8A 1K1IA 1TPPA 3MO9A 2I6SA 1FY3A 1HAXB 1DOJA 3O8DA 2PKSC 3PTNA 5HM2A 1Q2WA 4Y8YA 4TPIZ 5EXLA 1GMHF 3SGQE 1DE7H 4NA9H 2Z94A 1UTMA 3I29A 5K0HA 1ZGIA 3TLOA 3RXPA 3SI3H 5EQQA 3M5NA 1SPJA 1VCPA 4YLQH 1QB9A 3FP8E 4KTUA 2WPLS 1PQ5A 2BLVA 5LH8A 1P11E 2ZHFH 4B2BA 2A7CA 1UVTH 1HJAB 2BDHA 2ZGJA 1NU7B 2C8WB 3LJOA 3UNSA 4NWKA 1O3MA 1G3DA 3HPTB 1GHYH 1QQ4A 4XBCA 4K5ZA 1AGJA 2ZPRA 3RXOA 2THFB 1RTLA 5T6FA 1P2IA 2VU8E 1ZLRA 1IQGA 1GHVH 1K1PA 1H9LB 1K22H 4AGKA 3LGUA 4Z0KA 1O2OA 1K9OE 1TRMA 3E0NB 3M61U 1SFIA 4O9VA 2P8OC 2ZTXA 1GBIA 2VIQA 2W7UA 4FUGA 2OINA 1GMCF 1ZRKA 1C5LH 1CGIE 1NFWA 2FX4A 3S7HB 2GCTC 4X6NA 1FLEE 1XVOA 3M35A 5IYTA 1YPJH 1GI5A 2RCEA 4QT8C 3B9FH 1F5RA 1W11U 1ZSKA 1PPEE 1PQAA 2VJ1A 1ELAA 4DIIH 3A7VA 5F6MA 4CRDA 1O3GA 3P8NA 1NRRH 2Y5GA 5A0CA 3TVJB 1BJVA 3TJNA 1V2PT 4NIVA 4FUJA 3RXTA 2ZCKP 1FY1A 3F9HA 5JB9S 2CF9H 3A7TA 1EXFA 4D9RA 1ZJKA 4JK6A 5CMXH 2BHGA 2GKVE 4K69A 2J95A 2F9BH 2OC7A 1ANCA 1A5HA 2QAAA 3ZVFA 1AZZA 4AYVB 5A0AE 2O8WA 3ODFA 1O2WA 1WSSH 2AGGX 4IS5A 2ANYA 2B9LA 1J15A 3RXHA 4XSKU 2SNWA 4K1TA 1BUIA 3PM3A 1TGTA 3TH3H 3P8FA 1HXEH 2QC2A 5E2PA 3SU3A 1ETSH 4BANB 2G00A 4A1XA 1AFQC 5HYOA 3G01A 2PWXA 4X1SU 3EYDA 4ISOA 1EZSC 2BX3A 5GJ4B 1O2NA 2BZ6H 1UTPA 2GTBA 4XOJA 2BVXH 1VGCC 1T4UH 2J34A 5EQRA 4MDSA 3VB3A 1EAUA 1GWAA 1N6XA 3UY9A 2C8ZB 2R9PA 4NWLA 3Q00A 1IAUA 1ZYOA 4NSVA 2V0BA 1QCPA 1NRQH 4RN6A 3KGPA 5AF9H 3A89A 1G3BA 1FV9A 3BTHE 1YLCA 1QBNA 4D76A 2XTTB 3A7YA 2FM2A 1S85A 2H9EH 2QXIA 3UQOA 1GJ8B 1BBRE 3ZZ5A 2AEIH 3A82A 1FDPA 3KHVA 2ZQ1A 1E35B 2FXRA 1PQ8A 1SSXA 3BG4C 1OXGA 1EOLA 1TGNA 5A09A 2BDCA 4SGBE 3RXBA 1EKBB 2BY5X 1MBQA 1GJ9B 1C5XB 2W3KA 3ZYDA 1GI3A 3A8BA 3MNSA 3EAJA 1NC6A 1ANBA 1SGQE 1MTWA 2BD2A 3ZZ3A 1FQ3A 1GPZA 4GLYA 3SJKA 1C5ZB 2OXSA 1DT2A 3GY3A 4ABHA 1UCYK 3VEQB 3BTEE 2W7SA 1CSOE 1PJPA 1C4V2 3GY4A 3MOCA 4UDWH 2A4RA 5J4SA 3DFJA 1GJ5H 3ENSB 1BTYA 3ZZCA 5FX5A 1W7GH 4K1EA 4AFQA 1HYLA 2ZGXH 1EOJA 1RTKA 1O3AA 1UK2A 4HTCH 3S0NA 5JBTA 1TMUH 3PMBB 3V12A 1XUIA 2IN2A 1K1OA 1AQ7A 5F8TA 1OYTH 3RXFA 3U8TH 2A7JA 5JBBS 3U8OH 1GBBA 1GG6C 2G52A 2UUJB 1KXCA 1SL3A 2DE9A 1IQNA 5AFZH 1WV7H 5FPTA 2J94A 2HPQH 1E34B 3LGYA 2FODA 2VGCC 1DLEA 1O5BB 1TWXB 2GD4B 2HLCA 3BIUH 2XBYA 4AB8A 1NTPA 3ZZ6A 5JBAS 8LPRA 5CHAC 3ZVDA 1EJMA 1UTQA 4NCYA 3UNQA 1SGDE 4X2VA 4J2YB 4GVUA 1EJNA 4E7RG 4ABBA 3ODDA 1F0RA 3BTFE 3M3SA 3QLPH 2EEKA 3LPRA 2ZGHA 2XRCA 2W26A 2G8TA 1LPZB 3OX7U 1F0TA 1LPGB 5DGJA 2ILNA 4J1YA 5E0JA 1HIAB 4UONA 1FNIA 1RD3B 1XUHA 3PO1C 2TBSA 1EAXA 4E7NA 1K1MA 3SO3A 3TGKE 2OBQA 1GVLA 2SGFE 2XBVA 5BRRE 1KTTB 1O33A 2PUXB 4AGJA 2FEQH 3GY2A 1TX8A 1FI8A 4ZKRU 1KSNA 4HFPB 4TYDA 5EG4A 2G4TA 4NG9H 1QL7A 1OSSA 2Z9GA 3ESTA 1V3XA 2BTCE 2PGBB 5EPNA 1LKAA 1PPBH 3MNBA 2JKHA 4GPGA 1O2YA 2P59A 4WMFA 1LHFH 1SC8U 1GI7B 3PROA 2W5EA 3RC4A 5EW1H 1GGDC 5C1XA 1IQEA 1P10A 3MTYA 3T26A 1CGJE 1GI4A 4Y71A 2ZDKA 1TNLA 1LVMA 1P9SA 1O2QA 4ISIH 2ZF0H 1FUJA 1QNJA 1W0YH 1NO9H 4WWYA 1TA6A 2J9NA 1AKSB 5DK1A 1LHCH 1HNEE 2R2WU 1O34A 3K9XB 3QN7A 5HGGA 4DJZB 4FVBA 1QB6A 1N1LA 3SHCH 1ZMNA 1FY4A 1NU9A 1JRSA 3ITIA 3GCTG 3DHKH 8GCHF 3B23B 2O8TA 1MU6B 1V2TT 1WTGH 2SGPE 1CE5A 1AUTC 1YYY1 2CGAA 5T6GA 9ESTA 4MG3A 1P3EA 5BPEA 2TGPZ 3KQEA 2CJIA 2Z9IA 2WPJS 3HKJB 5FHTA 3V3MA 2KAIB 1GHBG 1V2MT 4AFUA 1O3DA 1IQFA 2OC8A 1C2FA 1W0ZU 2UUYA 1K1NA 2XCFA 3LU9B 1TNKA 2ESTE 2CHAC 1GI1A 5DP8A 5DJ7A 4X1RU 2FPZA 1C1QA 1MAYA 1C1VH 1UTOA 1YC0A 3A7ZA 1W12U 3MU1A 3UREA 2EA3A 2PKAA 1K1JA 2B0FA 2J92A 4FUDA 3GY5A 3SHAH 1V6DA 1E36B 1OWKA 1BBRK 1A3EH 1GHZA 1C5OH 1MTUA 2BOKA 1FAXA 1HAGE 1C5RA 4I8GA 4ZKOU 1MZDA 3P70B 3ATKA 1C9TA 1BMNH 1E37B 2GDEH 2IPHA 2VH0A 1TOMH 1GMDG 2AGIX 3B8JA 1TNIA 1WQVH 5SGAE 8GCHG 4HI3A 3ELAH 1KDQB 3RC6A 1GG6B 1QBVH 3UUZA 2JH0D 2ALVA 1TQ7B 2ANMH 3HGNA 3KQCA 1EB1H 2A2XH 1O2KA 1P9UA 2PKSB 4WXIA 3TU7H 2GMTC 3UWJH 2Y80A 4B2CA 2P94A 1OYQA 3SU0A 1IQKA 1DXWA 1C1NA 1WU1A 1AO5A 1BTZA 1HB0B 1QRWA 3FZDA 3ZYEA 2FOCA 1LQDB 1NROH 2TPIZ 2ODYB 4YT7H 1C4U2 1C4Y2 1H8IH 4YT6H 4NIYA 3SV8A 2VVVA 1UCYE 4O03A 3CENA 1FXYA 2ZPQA 2ANKH 3LGVA 1O32A 2B8OH 5ABWA 4NA7A 1V2WT 3AASA 3MMGA 2A2QH 4B71A 1Z8RA 2Y6TA 5JDUB 2PV9B 1A5GH 3VB4A 1TB6H 1TBQH 1FAKH 2F9OA 2C8YB 3R3GB 5I46H 2ZA5A 5GIBA 2PFEA 1DFPA 3KN2A 3BG4B 2FIRH 1O0DH 2ZFRH 2VH6A 3P6ZB 2BLQA 2G5NA 1UCYH 4MVNA 1DWDH 1S82A 3ZVAA 2ZCHP 2HGTH 1KYNA 1WUNH 2P3TB 1C5UA 3M36A 2HRVA 1QB1A 2FDAA 2RA0A 3SV6A 3PWCA 1W13U 1GJCB 2A31A 4DY7B 2PW8H 4B73A 1VCWA 1THSH 1SBWA 2BD4A 4B76A 1GHWH 1GI6A 2VB0A 4B74A 2Y82A 2GMTB 3MU5A 4YLUA 1EZXC 1VZQH 4ZXXH 4JZDH 4X6MA 1QL8A 3TNSA 3W95A 1YPHE 3NPSA 4IC5A 1LHDH 3IWMA 2ZHDA 2FLRH 1PPFE 3LONA 1L1JA 5A8YA 1N8OC 1GMDF 3UR9A 2TRMA 2O9QA 1YF4A 4X2XA 1SOTA 3KIDU 3C27B 1H8DH 1F5KU 2OUAA 2V35A 1G30B 4RKOB 2FWWA 5TCCA 5DG6A 1J17T 1FZZA 2Z3EA 2ZHWH 2ALPA 2UUKB 3UWIA 1MCTA 4MPWA 3JZ2B 1BITA 4FVDA 4GHTA 1O2HA 1Q31A 2A5AA 2AS9A 2PSXA 1GJDB 4Y7BA 3IG6B 2NU0E 1C1RA 1ID5H 1YPGH 4Q80A 4ABDA 5LPFA 3BG8A 1VGCB 3Q76A 4D7GA 1JXPA 3TH2H 4DVAU 2Z7FE 3MI4A 5GCHF 1O36A 5EOKA 3SQHE 3M5MA 1CA8B 1VCQA 1VJAU 4MNWA 1YLDA 3DD2H 3F9EA 2FOFA 2H9TH 1OP8A 3NZIA 1D4PB 2G51A 3RUOA 1EUFA 2P16A 3E0PB 2G55A 4INKA 2GGVB 5EW2H 1HIAA 1RS0A 1B7XB 1J16A 1IQHA 3M7QA 2Y5HA 4CRCA 4YZUA 1TONA 2A7HA 2ZECA 4FUFA 3A8AA 1DVAH 1K21H 2B7DH 1C5MD 1P57B 1P06A 1YPHC 1NRPH 2F3CE 3E1XB 4INLA 4JZIA 2YNBA 3QO6A 2F9UA 3EA8A 3P95A 4ABIA 2HPPH 1GBFA 3CP7A 2WPMS 3GYLB 1WTHD 3D65E 4GHQA 1HAPH 1HV7A 2LNCA 2ZHQH 4H4FA 4YOGA 4MNYA 4IC6A 2FS9A 1HDTH 4UFGH 5HXFA 8ESTE 1SR5C 2SGAA 1AMHA 1ZPCA 1ZSLA 3K65B 1SFQB 2P8OB 1TOCB 1T31A 4ZKSU 1UK4A 2SNVA 3ZVGA 3RXQA 2FTMA 3LH1A 4IGDA 4DT7B 2AH4X 2A5IA 1RTFB 1ZJDA 2ZCLP 2ZTZA 1AZ8A 3ATWA 4JMYA 4Y0YE 3QDZB 1C5PA 1CHGA 5F03A 3W94A 3ZVEA 4NGAH 1BRUP
chains in the Genus database with same CATH superfamily
1T4VH 3I78A 6LPRA 5EXMA 2ODQA 2JJ1D 3S69A 2Q1JA 3RXSA 5E8EH 2ZFQH 5EJZA 5GDSH 1NM6A 2ZEBA 2UUFB 2Y7XA 1ANDA 5GNDA 5C0TA 1LDTT 1DPOA 1SGIB 1JIMA 1ORFA 4WH6A 3URCA 2YOLA 2A5KA 4K1SA 3PO1B 2IOTA 1BHXB 2SGEE 4I8KA 3LT3A 1S0RA 1DWEH 1MQ6A 2RA3A 1Z8IB 2XNDD 1LMWB 1C1UH 3H5CB 1UVPA 5ESTE 2VIWA 2AYWA 3U1IB 1F0SA 5C17A 1YGCH 2VWLA 1NPMA 2Z9LA 3RLYH 2PKAB 4AX9H 3URDA 5A2MH 3ATLA 1QA7A 4MNVA 1Y3VA 5CHAB 3SGAE 5DP6A 1MTSA 3SN8A 3RMMH 3E91A 3ZZ4A 1DLKB 1DXPA 7LPRA 2VGCB 3D23A 1O5AB 4A7IB 1GCDA 3KNXA 2JETB 1BMMH 3MU0A 1BZXE 4UE7H 2GDDA 3QZQA 4ACBA 1AUJA 5CE1A 1B0FA 1WDIA 3I77A 3EE7A 3KQDA 2BQ6B 4YO9A 1DITH 1DDJA 3MU4A 5L2ZH 3SORA 2L6OA 3A7WA 1Y3XA 1DANH 4ISNA 4Y0ZE 1ZR0A 2BD3A 3GDUA 5C5OA 2VVUA 1KY9A 4D7FA 2WV4A 3FANA 1TX7A 3ZZ8A 4CRBA 3SNEA 1RGQA 4P00A 2ZI2H 1AB9B 1DS2E 3P8OA 2PTCE 1FPHH 1A7SA 2GCHF 3GCTF 2NU3E 1HAZB 3FP7E 4UEHH 2D8WA 1SB1H 3U9AH 4H6TA 1QTFA 1TGSZ 1ESTA 4K60A 1V2VT 3OYPA 1IOEA 4F55A 2ZDAH 1QURH 2HNTC 5LGOA 4Q63A 3UPEA 3SOSA 1NESE 3RXJA 3T29A 1AE8H 4IW4E 2J2UA 1GBHA 2D1JA 2C4FH 1AHTH 3DSOA 1C2DA 1NS3A 3FOAA 1ABIH 3BEFB 3U8RH 4X2YA 1FPCH 1YPLH 3AVZA 2F83A 4LZ4B 1EB2A 1UMAH 1FIZA 2H1UA 1MH0A 4IN1A 1GHXH 1EZUC 5FBEA 4ZXYH 5FPYA 4I8LA 4TY6A 1GJ6A 1HGTH 1CA0C 3FO8D 3T62A 3RMNH 4RI0A 3PMJA 4Y76A 2BD7A 2QY0B 3MO6A 1ZHRA 3GISB 1GJ4H 1TNGA 1TABE 2ZFPH 2VIDA 2R3YA 2F91A 3RXCA 4ABJA 4ZHLU 1ZOMA 1XXFA 3RXAA 3SW2B 1IHTH 3VXFH 1XKBC 1V2UT 3QTVH 1C2IA 2GX4A 3D62A 4UD9H 1AFQB 2CHAB 4X8TH 4CRGA 2ZGBH 2WUBA 1MKXK 5C0UA 2W3IA 3UOUA 1AKSA 1GBKA 1SLWB 3SNAA 1CHOF 1TRYA 1VR1H 2HNTE 1Y5AT 4AYYB 2ZDMA 1UHBB 1SGPE 1TYNA 3UR6A 2UWOA 2LPRA 4XRNA 1OWDA 1B0EA 2FI5E 1EP6A 1ACBE 1KTSB 4K3JA 1KLTA 3OTJE 5PTPA 1WYKA 3UFAA 2WPDD 4KP0A 5DN6D 2KAIA 1O3NA 1NFYA 1F92A 3NRLA 3ZZ7A 1S6LA 5JYIA 3F9FA 3U1JB 1C9PA 1O5CB 3A87A 1T8NA 2G4UA 2H6MA 1XXDA 4NA8A 4ZROA 1ANEA 1BDAA 2VWMA 2BM2A 5EODA 4ASHA 5G4BA 3A81A 1BOQA 3IITA 4CH2B 5DO4H 1P03A 1K2I1 2WINI 5HMAA 1HFDA 3H09A 3RMLH 1OWIA 4XDEA 1MTNB 4OGYA 3LOXA 1LTOA 2GP9B 2ZQ2A 3RXEA 1TPSA 2HLDD 2XC0A 3NKKA 4MTBA 1P2KA 3PYHA 3LC5A 1SKYE 4LZ1H 3SNDA 3SI4H 4K8YA 2ZDNA 3F6UH 1OWHA 4A1TA 4A92A 2FLBH 3TGIE 2K8IA 4D8NA 2Y81A 2GCTB 1NFUA 1ABJH 1KXEA 1O3PB 1OS8A 4X1QU 3MH6A 1WQSA 5DP4A 3V7TA 2I6QA 2XYAA 4JZFH 1XUFA 4XE4A 3UNRA 5TCAA 1TRNA 1S0QA 1C2KA 1PYTC 1O2MA 4BAOB 2RDLA 1HBTH 1O5FH 1FY8E 1MQ5A 1D6WA 1XM1A 2FOEA 3SUGA 1L1NA 1SHHB 1O2SA 2O8MA 1P02A 4MLFB 2ZTYA 3AAUA 3MWIU 3A83A 3BIVH 3LC3A 1KIGH 2AMPA 4FU8A 7GCHG 3UB0A 1OOKB 2Z3DA 2VIPA 2BDBA 2A4OA 2R3UA 1TIOA 1F5LA 1GHAG 1ARCA 4X1PU 2TGAA 1QJ1B 1O2PA 3PLPA 1DUAA 1E38B 4BXSA 1AN1E 1ZGVA 1ELGA 1YKTA 2ZU5A 4SGAE 1YM0A 3OAAD 1EX3A 1TNJA 4U2WA 1QGFA 4FUHA 5A0BA 1T7CA 2GT7A 4FUIA 1EPTB 5E2OA 3SUEA 4DCDA 1NZQH 2QIQA 3KEEA 1A0HB 1V2QT 2OTVA 3SNCA 1ELVA 1N8OB 3BTME 5GCHG 5LPRA 4BNRA 1SVPA 1GCTC 3GICB 1GI9B 2EY4C 3CS0A 2HNTF 1BMFD 2ZHEH 1CHOG 4D9QA 1MTVA 2A0QB 1MD7A 3DSPA 1H8HD 1C5VA 1A1RA 4I32A 3VXEH 3BEUA 3C1KA 2OQ5A 2ZKSA 4KTCA 4NZLA 3M7UA 1V2OT 2XBXA 4TPYA 2FOGA 3RP2A 2J38A 4NIXA 1CO7E 1Y5UT 3M5OA 5T3HA 1G37A 4JCNA 1O5EH 3A8CA 1TBRH 1TNHA 1EASA 1AVWA 2CV3A 5H4IB 1O2LA 1GJBB 4GAWA 1CBWB 1KMHB 2PP6A 3W1EA 4ZHAA 3MNCA 5AFYH 4Y6DA 1LQEA 5TJXA 1TX6A 2BMGB 3RLWH 1O30A 4Y10E 3QUMP 1O2RA 2JDID 3F9GA 1ELDE 1ETRH 1ZTJA 4KKDA 4Y79A 2TGTA 5F53A 1T32A 3STJA 1QRXA 2B5TB 1TBZH 2ZU2A 1TQ0B 3GDVA 3RXLA 3PMAB 1O39A 3NK8A 1LKBA 1D3QB 4B2AA 1OWEA 2V3HH 2P93A 1C1WH 2G81E 2OCVB 1XUJA 2JETC 2UWPA 3V13A 2KR7A 1A3BH 1UTNA 3SU6A 1P2OA 2ZFFH 4IMQA 1GI8B 3HATH 3HK3B 5C20A 2WZQA 2G5VA 1A0LA 3LKWA 3UQVA 2BXUH 1ELEE 4WY3A 4AB9A 1FONA 2ZDLA 4ZHMU 4DGJA 1UTJA 1DWBH 4CR5A 3LH3A 4K8BA 4NFFA 4WJG2 3O8BA 1JMOH 2XNIA 3A84A 4M7GA 7ESTE 1TFXA 4BAQB 1BTWA 2VIVA 3T5FH 4X8VH 1QFKH 2J98B 4IMZA 1GVKB 1ELTA 1WOFA 1O35A 1SG8B 3H7OA 1YP9A 3DUXH 2FYQA 3K6YA 3N7DA 1SGCA 4YTAA 3TK5A 1PPGE 4DG4A 5GWZA 1OWJA 3PLKA 3E3TA 2H2ZA 3GS9A 1YY3A 2FI4E 1SGFA 1FX0B 1TPOA 1G9IE 1V2NT 2BY7X 3FZZA 4TWWA 3EDXB 1ELBA 1KXAA 1A4WH 1XUKA 2F43B 3MH7A 3NXPA 2F9NA 4YM9A 2JH6D 4U30A 4BOHA 1EPTC 4CRAA 1O2VA 3BTWE 2QXGA 4BTIB 1EZQA 3HGPA 1P09A 4WH8A 1QBOA 1DY8A 2BX4A 3UAIC 2FO9A 3BV9B 4TWYA 2P95A 3Q3YA 7GCHF 1MKXH 1N6YA 1AVGH 1H9HE 1H1BA 4RKJB 1NN6A 2ZU1A 3R0FA 2GCHG 1GHAF 5EJLA 1AY6H 1C5SA 4OS2A 3T25A 3E6PH 2GVFA 4X2WA 1ZMLA 1KXBA 4Q7XA 2FI3E 1S81A 1KLIH 2FESH 3TGJE 1QIXB 4MQAA 1ZMJA 1WAYB 6ESTA 3TK6A 5E0HA 5ESBA 1ZSJA 4O3TA 2QGRA 1DWCH 2ZFSA 4AZ2B 2FOBA 3U69H 2OC0A 1NRNH 4FUEA 3MH4A 3PTBA 3JZ1B 4I31A 1AD8H 3L33A 3P17H 1K28D 1SOZA 2D26C 2AIPA 5GXPA 3QX5H 4F48B 3RM0H 3NUMA 1L4ZA 3S9BA 1BRCE 4X1NU 1AU8A 1P3CA 1IQLA 4CHAC 2GZ7A 2XC5A 1ELCA 1UO6A 4MNXA 4A5TS 1AIXH 2HOBA 1O2TA 3SU5A 1G32B 4WMDA 3RU4T 2ZU3A 1T8MA 4DW2U 4IBLH 5EGMA 3M3TA 3QTOH 3RDZA 3S9CA 3FKSD 1C2HA 3DFLA 4Y7AA 1LO6A 1TMTH 4LXBH 3NWUA 3WW7A 1BCUH 4A1VA 2NU2E 1CQQA 2BLWA 3A80A 3AAVA 3PMHB 1V2JT 2A45B 2TIOA 3P8GA 1HJ8A 2SFAA 4YOJA 1OP0A 2A32A 2WSSD 3F68H 1PFXC 1PPCE 1HAYB 1HJAC 2P3FH 4LK4A 1SLUB 2V3OH 3BTTE 2Y7ZA 2STAE 3F0PA 4Z6AH 3PLBA 2Z9KA 1JIRA 1JWTA 1CU1A 1OPHB 2OP9A 2R0KA 1GMHG 2BY8X 2ZU4A 1Y3YA 3T27A 5CHBA 4AG2A 3ZZDA 3QZRA 1MKWH 4AFSA 2RG3A 4B6FA 1V2KT 2PTNA 5L2YH 1LHGH 1UVUH 2VNTA 1VITG 2ZG0H 1YCPK 1XVMA 2CN0H 4CBNA 4XBDA 3GOVB 3T2NA 3RXRA 1FY5A 2M2AA 2PUQH 1Y8TA 3K6ZA 1KXFA 5KECA 2YMSC 1XKAC 1VKYA 4OS5A 2RDEA 1COWD 4PROA 4B75A 1SLXB 1G3EA 1P2MA 1TMBH 1L1GA 1GBEA 2XW9A 2BXTH 4CH8B 3RC5A 1O3BA 4ISHH 4JK5A 4X8UH 1D3PB 3OE7D 1QZ8A 4HZHA 5B6OA 1H8ED 1U6QA 1Z6JH 4MPVA 1HCGA 2QV1A 2OBOA 3GY7A 3SV7A 3RMOH 1NY22 1INCA 1QJ6B 4MPUA 4AG1A 3TITA 1EATA 2KFWA 1HAVB 3OY5U 1S83A 5L30H 2WV5A 2EI6A 1P05A 5EPYA 1BIOA 3PRBA 5C3NA 2ZO3H 4TSFD 3LIWA 2BVSH 2GV7A 3T28A 1TE0A 1Y59T 2Q6FA 3ATIA 2A4GA 3RXDA 5A8ZA 1DICA 4GUXA 4F49A 4CREA 1W10U 1CBWC 4OM9A 3MNXA 5LPEA 1Y3UA 1BTUA 1HJ9A 1FN8A 3U28C 3MQKC 7KMEH 2C8XB 1FJSA 6GCHF 3ATMA 2O8LA 2ZFTA 3ZV9A 1SGTA 2BD9A 4ZMAH 1P12E 4YOIA 2VWNA 3TPIZ 5C1YA 6CHAB 1LHEH 1SGRE 3SU4A 5IDKA 1IQJA 3PB1E 1H4WA 2ZC9H 2HWLB 4BXWA 1C1OA 1J9CH 3ZZ9A 1C5TA 2QA9E 1GBAA 2BY9X 4Q7ZA 5ETXA 1OKXA 4UFDH 1S6FA 2FX6A 5EXNA 1UTKA 3SNBA 2AMDA 3GDSA 1UHBA 1IQIA 1B5GH 3GY6A 3SUFA 4RT0A 4Q2KA 1HAIH 3A8DA 1J8AA 4BAKB 1J14A 1HAHH 2FTLE 1G3CA 1ZTKA 3KCGH 2IJD1 1F7ZA 1GBTA 3TNTA 4I8JA 2AGEX 4ASUD 4WF8A 1OP2A 1D3TB 1O3JA 2Q6DA 3SV9A 3PWBA 2BB4A 1BMAA 1BRAA 3BEIB 1LVBA 1V2ST 2XWBI 4AC9A 4UFEH 2QXJA 1O2UA 3BTDE 3ZVCA 5DP9A 1MUEB 4MPXA 3RXUA 1DM4B 3SGBE 3KF2A 4AORA 4DURA 1GL0E 4WVPE 4K2YA 4Y8XA 1RXPA 3LGWA 5CDFE 1SGYE 3RXGA 1SQAA 4TY7A 3MU8A 4E06H 5C2ZA 2GV6A 1SLVB 1S6HA 1RFNA 1P2NA 3P92A 1ESAA 1BT7A 2H5DA 4OS7A 2K1QA 3Q3KA 3NCLA 1YCPM 3O8CA 2BZAA 1C2LA 1RIWB 2SGDE 2SGQE 3UTUH 3PV4A 4I33A 4H42U 2ZZUH 4XBBA 1UJ1A 1P2JA 1D3DB 1SMFE 3M37A 2ZWLH 4CHAB 2W6JD 1EAIA 3PV2A 4AN7A 3UIRA 5DP7A 1X7AC 1GVZA 2VIOA 4ABAA 3VB5A 1HRTH 1OX1A 2PSYA 1BTHH 1O3KA 3OEED 2FP7B 1O3FA 2QF0A 3VB6A 1EP5A 2BDIA 5T1VA 2Z3CA 1C5YB 4F4OC 2WPHS 5C1UA 1TPAE 1YPMH 2XWAA 1C2EA 1GDUA 1BA8B 2C90B 4NIWA 3L6PA 1Z8GA 5HM9A 4H6SB 2F9VA 5AVDA 1GL1A 1GGDB 1MZAA 3BTKE 1AWHB 1DSUA 1VITF 1DX5M 1G2MA 3GCOA 3L3TA 1TLDA 1BTPA 3TJUA 4BTTB 2ULLA 1W7XH 2FS8A 4WXVA 4CRFA 4BAMB 2XXLA 2ASUB 1O2JA 1EPTA 1GBDA 1RIWC 3SBKA 2AMQA 3ZZAA 3EA7A 3RM2H 2QF3A 4WMEA 3SJ9A 2R2MB 1THRH 4X6PA 4ABFA 3ZIAD 3RXKA 3FVFB 2PLXA 5EQSA 2EI7A 1SGNE 3TK9A 3VGCB 9LPRA 1KDQA 2UWLA 4I86A 1PQ7A 3OEHD 3QGJA 3RXIA 4BTUB 2QXHA 5I25A 1HPGA 3DCLA 5FPSA 1BJUA 4DT4A 2XCNA 1L4DA 1Z71A 2ODPA 4O3UA 5JB8S 2ZGCA 1A46H 1W0KD 5FBIA 1Z8JB 3RXMA 2XC4A 4X8SH 3ZV8A 2Y5FA 3DT0H 4CR9A 1NT1A 4DIHH 1F2SE 1BB0B 1NFXA 2NWNA 3SU1A 1W2KH 1BTXA 3EA9A 4R0IA 4OS4A 2Q6GA 1GHBF 1P8VC 3GCHC 1O3OA 1V2LT 1V2RT 4JYTA 4A6LA 2ZP0H 1SHYA 1SGFG 3FAOA 1WCZA 3EQ0H 1MCVA 2A4QA 4ABEA 1QR3E 3WWFA 3V0XA 5JBCS 1P01A 3GY8A 2VBCA 1T8OA 1XX9A 1W8BH 3F2HA 5FX6A 6CHAC 2NU1E 1IQMA 2AIQA 3UOPA 1ZPBA 1AVXA 1A5IA 4CBOA 1HLTH 2TGDA 4Q7YA 4ZUHA 4ZH8A 1XUGA 1SQTA 1CGHA 3EE0B 3O8RA 3M5LA 3K2UA 3RU4E 2DUCA 4OS1A 1BMLA 5FCRA 2GT8A 3LDXH 1VJ9U 1CT0E 1AB9C 2IJOB 1TAWA 1O37A 4JZ1A 4Y8ZA 3ZVBA 2QN5T 3BSQA 3SUDA 2FOHA 4ESTE 2BQ7B 2Z9JA 1W14U 2CMYA 1RJXB 2BD5A 1O31A 1C5QA 1SGEE 1C5NH 1YPEH 2K0QA 4JYUH 2M5TA 2YNAA 3OU0A 1CT4E 3TIUA 2ZPSA 4U32A 4NSYA 4FETA 1FIWA 1GBLA 1TA2A 2C3SA 3VB7A 1BQYA 1OHHD 1S5SA 2C93B 3MO3A 1HAVA 1TGCA 2BVRH 2LELA 2NU4E 2PHBA 1GCTB 2FOMB 3DA9B 1Z7KA 2A1DB 1A2CH 2AHME 1UK3A 3VPKA 1PYTD 1O5GH 3A88A 2ZDVH 6GCHG 1C2JA 3A86A 4GCHG 4JYVH 3GCHB 4O97A 1ZTLA 2YMSB 1BRBE 2OQUA 3M7TA 4UFFH 2OLGA 2J4IA 3LGIA 1ZHMA 1VITH 1S84A 1GDQA 2QCYA 1O38A 1HUTH 1CT2E 3TH4H 1P0SH 1TALA 1WBGB 1IHSH 1O3CA 1O3EA 1F0UA 1QQUA 1O2XA 5C67A 4DOQA 1UVOA 1ARBA 1MMJN 2PR3A 3BTGE 2O8UA 1Z6EA 4YESB 5HIZA 1JBUH 1W3CA 1W0JD 4THNH 1D6RA 1KLJH 2OC1A 3MHWU 1QJ7B 2FMJA 3MH5A 4LOYH 3VGCC 4B1TA 2BD8A 2OD3B 4KTSA 2BDAA 4JZEH 4FXGH 1LPKB 1UVSH 1LVYA 1O2ZA 1MKWK 1ESBA 3Q3XA 3E16B 3RU4D 2GZ8A 1EFRD 5DP3A 4FUBA 5AHGH 1E0FD 2ZIQH 2FZZA 4X0WU 1YCPH 1YLNA 3H7TA 1ZPZA 1C1MA 2BOHB 3QGNB 1UTLM 5DPAA 3E90B 4VGCB 3U98H 5J4QA 1QY6A 3SZNA 2VWOA 1MTNC 1QHRB 5GPIB 1EAWA 1ELFA 3FFGA 5E0GA 1C1PA 2QYIA 5JPMH 3SU2A 4AOQA 3OSYA 3Q77A 2Z6BD 4E05H 4XFQA 4INHA 1O3LA 2WYJA 1MBMA 1GMCG 1AFEH 2ANWA 3E8LA 1P04A 3AW0A 2FOAA 3OY6U 3HKIB 1A0JA 5C5NA 1ZHPA 5A8XA 5FCKA 2EC9H 1O3IA 1THPB 1RRKA 1AE5A 3QK1A 4OS6A 1C1SA 1MABB 3OFND 1P2QA 3ZZBA 4ABGA 1HXFH 1ZZZA 5EU8A 2RFKC 3AK5A 1Q3XA 1O5DH 5F8XA 3S7KB 4GSOA 1G36A 2KCPA 1QRZA 3SZEA 3SJ8A 4IN2A 1DY9A 3SQEE 2STBE 4VGCC 1QA0A 4HGCA 1YWUA 3GYMA 4HG6A 4ZAEA 1L0ZA 4I7YH 5L6NH 3HK6B 3WY8A 2EQNA 4ZKNU 3F1SB 2AFQB 3PRDA 4GCHF 1AI8H 1GBJA 2QE7D 2F9PA 1FN6A 3TJOA 3BTQE 1DSTA 2KCYA 2WUCA 1AWFH 3AW1A 2GZ9A 3FP6E 1CA0B 1O2GH 4U01A 4NFEA 1CVWH 4X6OA 2BDYA 2BY6X 2P3UB 1GI2A 2BDGA 3D49H 3MFJA 1YPKH 5DKMA 2AERH 3LJJA 1EJAA 1PPZA 1A61H 2WPKS 1ZRBA 4R8TB 1GDNA 2H5CA 5IK2D 4NZQA 2HVXA 1DUEA 1Y5BT 1Y3WA 2H9HA 3GCNA 3VFEA 4ZCNA 1GJAB 3CS7A 1TGBA 2JH5D 1BBRH 1C2GA 1SI5H 3M3VA 2FYRA 1BHXF 1Z1IA 3MYWA 1GI0A 3QWCH 1C1TA 3A7XA 1NRSH 1C5WB 1C2MA 1L2EA 3KQBA 1JRTA 5FAHA 2WHXA 1GBMA 1YBWA 2ZNKH 3BF6H 2V6NA 3SJIA 4I8HA 2VVCA 2WPIS 1LVOA 3TJVA 4RSPA 5HKKD 1ETTH 5FXLA 4FU7A 1MAXA 4KELA 4ISLA 1GJ7B 2BQWB 3RXVA 2BYAX 2R0LA 1K1LA 3EGKH 2PGQB 8KME2 4AFZA 1T8LA 1JOUB 1O3HA 3SV2H 3STIA 1MD8A 1LCYA 2WYGA 4FUCA 3S9AA 1FMGA 3BN9A 1SQOA 1Z1JA 3KL6A 2CF8H 1PPHE 2D2DA 1GBCA 4Y11E 3N7OA 1HAOH 2BLOA 1D9IA 5F8ZA 4FU9A 1G2LA 4KGAA 4BAHB 1KXDA 1H9IE 3A85A 4TT3D 2CXVA 2QF4A 5T6DA 2EI8A 1XMNB 2HALA 1M9UA 5DP5A 1QL9A 1MU8B 5K7RA 2XBWA 1EQ9A 3SJOA 3LGTA 1O2IA 2VINA 4OGXA 5KGOA 2DE8A 1K1IA 1TPPA 3MO9A 2I6SA 1FY3A 1HAXB 1DOJA 3O8DA 2PKSC 3PTNA 5HM2A 1Q2WA 4Y8YA 4TPIZ 5EXLA 1GMHF 2GJGA 3SGQE 1DE7H 4NA9H 2Z94A 1UTMA 3I29A 3F3BA 1ZGIA 3TLOA 5K0HA 3RXPA 3SI3H 5EQQA 3M5NA 1SPJA 1VCPA 4YLQH 1QB9A 3FP8E 4KTUA 2WPLS 1PQ5A 2BLVA 5LH8A 1P11E 2ZHFH 1K0HA 4B2BA 2A7CA 1UVTH 1HJAB 2BDHA 2ZGJA 1NU7B 2C8WB 3LJOA 3UNSA 4NWKA 1O3MA 1G3DA 3HPTB 3PV5A 1GHYH 1QQ4A 4XBCA 4K5ZA 1AGJA 5HIYA 2ZPRA 3RXOA 2THFB 1RTLA 5T6FA 4B6EA 1P2IA 2VU8E 1ZLRA 1IQGA 1GHVH 1K1PA 1H9LB 1K22H 4AGKA 3LGUA 4Z0KA 1O2OA 1K9OE 1TRMA 3E0NB 3M61U 1SFIA 4O9VA 2P8OC 2ZTXA 1GBIA 2VIQA 2W7UA 4FUGA 2OINA 2KX4A 1GMCF 1ZRKA 1C5LH 1CGIE 1NFWA 2FX4A 3S7HB 2GCTC 4X6NA 1FLEE 1XVOA 3M35A 5IYTA 1YPJH 1GI5A 2RCEA 4QT8C 3B9FH 1F5RA 1W11U 1ZSKA 1PPEE 3VG8A 1PQAA 2VJ1A 1ELAA 4DIIH 3A7VA 5F6MA 4CRDA 1O3GA 3P8NA 1NRRH 2Y5GA 5EIYA 5A0CA 3TVJB 1BJVA 3TJNA 1V2PT 4NIVA 4FUJA 3RXTA 2ZCKP 1FY1A 3F9HA 5JB9S 2CF9H 3A7TA 1EXFA 4D9RA 1ZJKA 4JK6A 5CMXH 2BHGA 2GKVE 4K69A 2J95A 2F9BH 2OC7A 1UW7A 1ANCA 1A5HA 2QAAA 3ZVFA 1AZZA 4AYVB 5A0AE 2O8WA 3ODFA 1O2WA 1WSSH 2OK5A 2AGGX 4IS5A 2ANYA 2B9LA 1J15A 3RXHA 4XSKU 2SNWA 4K1TA 1BUIA 3PM3A 1TGTA 3TH3H 3P8FA 1HXEH 2QC2A 5E2PA 3SU3A 1ETSH 4BANB 2G00A 4A1XA 1AFQC 5HYOA 3G01A 2PWXA 4X1SU 3EYDA 4ISOA 1EZSC 2BX3A 5GJ4B 1O2NA 2BZ6H 1UTPA 2GTBA 4XOJA 2JIZD 2BVXH 1VGCC 1T4UH 2J34A 5EQRA 2KCOA 4MDSA 3VB3A 1EAUA 1GWAA 1N6XA 3UY9A 2C8ZB 2R9PA 3F2GA 4NWLA 3Q00A 1IAUA 1ZYOA 4NSVA 2V0BA 1QCPA 1NRQH 4RN6A 3KGPA 5AF9H 3A89A 1G3BA 1FV9A 3BTHE 1YLCA 1QBNA 4D76A 2XTTB 3A7YA 2FM2A 1S85A 2H9EH 2QXIA 3UQOA 1E79D 1BBRE 1GJ8B 3ZZ5A 2AEIH 3A82A 1FDPA 3KHVA 2ZQ1A 1E35B 2FXRA 1PQ8A 1SSXA 3BG4C 1OXGA 1EOLA 1TGNA 5A09A 2BDCA 4SGBE 3RXBA 1EKBB 5B6LA 2BY5X 1MBQA 1GJ9B 1C5XB 2W3KA 3ZYDA 2KZ4A 1GI3A 3A8BA 3MNSA 3EAJA 1NC6A 1ANBA 1SGQE 1MTWA 2BD2A 3ZZ3A 1FQ3A 1GPZA 4GLYA 3SJKA 4Q4LA 1C5ZB 2OXSA 2W6ID 1DT2A 3GY3A 4ABHA 1UCYK 3VEQB 3BTEE 2W7SA 1CSOE 1PJPA 1C4V2 3GY4A 3MOCA 4UDWH 2A4RA 2J98A 5J4SA 3DFJA 1GJ5H 3ENSB 1BTYA 3ZZCA 5FX5A 1W7GH 4K1EA 2QF5A 4AFQA 1HYLA 2ZGXH 1EOJA 1RTKA 1O3AA 1UK2A 4HTCH 3S0NA 2JJ2D 5JBTA 1TMUH 3PMBB 3V12A 1XUIA 2IN2A 1K1OA 1AQ7A 4ACAA 5F8TA 1OYTH 3RXFA 3U8TH 2A7JA 5JBBS 3U8OH 1GBBA 1GG6C 2G52A 2UUJB 1KXCA 1SL3A 2DE9A 1IQNA 5AFZH 1WV7H 5FPTA 2J94A 2HPQH 1E34B 3LGYA 2FODA 2VGCC 1DLEA 1O5BB 1TWXB 2GD4B 2HLCA 3BIUH 2XBYA 4AB8A 1NTPA 3ZZ6A 5JBAS 8LPRA 5CHAC 3ZVDA 1EJMA 1UTQA 4NCYA 3UNQA 1SGDE 4X2VA 4J2YB 4GVUA 1EJNA 4E7RG 4ABBA 3ODDA 1F0RA 3BTFE 4FOUC 3M3SA 3QLPH 2EEKA 3LPRA 2ZGHA 2XRCA 2W26A 2G8TA 1LPZB 2LP6A 3OX7U 1F0TA 5DSFA 1LPGB 5DGJA 2ILNA 4J1YA 5E0JA 1HIAB 4UONA 1FNIA 1RD3B 1XUHA 3PO1C 2V3MA 2TBSA 1EAXA 4E7NA 1K1MA 3SO3A 3TGKE 2OBQA 2HVYB 1GVLA 2SGFE 2XBVA 5BRRE 1KTTB 1O33A 1NBMD 2PUXB 4AGJA 2FEQH 3GY2A 1TX8A 1FI8A 4ZKRU 1KSNA 4HFPB 4TYDA 5EG4A 2G4TA 4NG9H 1QL7A 1OSSA 2Z9GA 3ESTA 1V3XA 2BTCE 2PGBB 5EPNA 1LKAA 1PPBH 3MNBA 2JKHA 4GPGA 1O2YA 2P59A 4WMFA 4XD7D 1LHFH 1SC8U 1GI7B 3N99A 3PROA 2W5EA 3RC4A 5EW1H 1GGDC 4YXWD 5C1XA 1IQEA 1P10A 3MTYA 3T26A 1CGJE 1GI4A 4Y71A 2ZDKA 1TNLA 1LVMA 1P9SA 1O2QA 4ISIH 2ZF0H 1FUJA 1QNJA 1W0YH 1NO9H 4WWYA 1TA6A 2J9NA 1AKSB 5DK1A 1LHCH 1HNEE 3CNRA 2R2WU 1O34A 3K9XB 3QN7A 5HGGA 4DJZB 4FVBA 1QB6A 1N1LA 3SHCH 1ZMNA 1FY4A 1NU9A 1JRSA 3ITIA 3GCTG 3KQ5A 3DHKH 8GCHF 3B23B 2O8TA 1MU6B 1V2TT 1WTGH 2SGPE 1CE5A 1AUTC 1YYY1 2CGAA 5T6GA 3FN8A 9ESTA 4MG3A 1P3EA 5BPEA 2TGPZ 3DSGA 2IPQX 3KQEA 2CJIA 2Z9IA 3F0OA 2WPJS 3HKJB 5FHTA 3V3MA 2KAIB 1GHBG 1V2MT 4AFUA 1O3DA 1IQFA 2OC8A 1C2FA 1W0ZU 2UUYA 1K1NA 2XCFA 3LU9B 1TNKA 2ESTE 2XOKD 2CHAC 1GI1A 5DP8A 5DJ7A 4X1RU 2FPZA 1C1QA 1MAYA 1C1VH 1UTOA 1YC0A 3A7ZA 1W12U 3MU1A 3UREA 2EA3A 2PKAA 1K1JA 2B0FA 2J92A 4FUDA 3GY5A 3SHAH 1V6DA 1E36B 1OWKA 1BBRK 1A3EH 1GHZA 1C5OH 1MTUA 2BOKA 3OTPA 1FAXA 1HAGE 1C5RA 4I8GA 4ZKOU 1MZDA 3P70B 3ATKA 1C9TA 1BMNH 1E37B 2GDEH 2IPHA 2VH0A 1TOMH 1GMDG 2AGIX 2F4LA 3B8JA 1TNIA 1WQVH 5SGAE 8GCHG 4HI3A 3ELAH 1KDQB 3RC6A 1GG6B 1QBVH 3UUZA 2JH0D 2ALVA 1TQ7B 2ANMH 3HGNA 3KQCA 1EB1H 2A2XH 1O2KA 4M9FA 1P9UA 2PKSB 4WXIA 3TU7H 2GMTC 3UWJH 2Y80A 4B2CA 3KYFA 2P94A 1OYQA 3SU0A 1IQKA 1DXWA 1C1NA 1WU1A 1AO5A 1BTZA 1HB0B 1QRWA 3FZDA 3ZYEA 1E1RD 2FOCA 2V7QD 1LQDB 1NROH 2TPIZ 2ODYB 4Z1MD 4YT7H 1C4U2 1C4Y2 1H8IH 4YT6H 4NIYA 3SV8A 2VVVA 1UCYE 4O03A 3CENA 1FXYA 2ZPQA 2ANKH 2CK3D 3LGVA 1O32A 3SYJA 2B8OH 5ABWA 4NA7A 1V2WT 3AASA 3MMGA 2A2QH 4B71A 1Z8RA 2Y6TA 5JDUB 2PV9B 1A5GH 3VB4A 1TB6H 1TBQH 1FAKH 2F9OA 2C8YB 3R3GB 5I46H 2ZA5A 5GIBA 2PFEA 1DFPA 3KN2A 3BG4B 2FIRH 1O0DH 2ZFRH 2VH6A 3P6ZB 2BLQA 2G5NA 1UCYH 4MVNA 1DWDH 1S82A 3ZVAA 2ZCHP 2J97A 2HGTH 1KYNA 1WUNH 2P3TB 1C5UA 3M36A 2HRVA 1QB1A 2FDAA 3F2FA 2RA0A 1NBME 3SV6A 3PWCA 5FL7D 1W13U 1GJCB 2A31A 4DY7B 2PW8H 4B73A 1VCWA 1THSH 1SBWA 2BD4A 4B76A 1GHWH 1GI6A 2VB0A 4B74A 2Y82A 2GMTB 3MU5A 4YLUA 5EJ1A 1WXRA 1EZXC 1VZQH 1SQRA 4ZXXH 4JZDH 4X6MA 1QL8A 3TNSA 3W95A 1YPHE 2WV9A 3NPSA 4IC5A 1LHDH 3IWMA 2ZHDA 2FLRH 1PPFE 3LONA 1L1JA 2L74A 5A8YA 1N8OC 1GMDF 3UR9A 2TRMA 2O9QA 1YF4A 4X2XA 1SOTA 3KIDU 3C27B 1H8DH 2KM0A 1F5KU 2J5UA 2OUAA 1G30B 2V35A 4RKOB 2FWWA 5TCCA 5DG6A 1J17T 1FZZA 2Z3EA 2ZHWH 2ALPA 2UUKB 3UWIA 1MCTA 4MPWA 3WWBA 3JZ2B 1BITA 4FVDA 4GHTA 1O2HA 1Q31A 2A5AA 2AS9A 2PSXA 1GJDB 4Y7BA 3IG6B 2NU0E 1C1RA 1ID5H 1YPGH 4Q80A 4ABDA 5LPFA 3BG8A 1VGCB 3Q76A 4D7GA 2KCAA 1JXPA 3TH2H 4P02A 2Z7FE 4DVAU 3MI4A 5GCHF 1O36A 5EOKA 3SQHE 3M5MA 1CA8B 1VCQA 1VJAU 4MNWA 1YLDA 3DD2H 3F9EA 2FOFA 2H9TH 1OP8A 3NZIA 5KEDA 1D4PB 2G51A 3RUOA 1EUFA 2P16A 3E0PB 3N7EA 2G55A 4INKA 2GGVB 5EW2H 1HIAA 2YMSD 1RS0A 1B7XB 1J16A 1IQHA 3M7QA 2Y5HA 4CRCA 4YZUA 1TONA 2A7HA 2ZECA 4FUFA 3A8AA 1DVAH 1K21H 2B7DH 1C5MD 1P57B 1P06A 1YPHC 1NRPH 2F3CE 3E1XB 4INLA 4JZIA 2YNBA 3QO6A 2F9UA 3EA8A 3P95A 4ABIA 2HPPH 1GBFA 3CP7A 2WPMS 1E1QD 3GYLB 1WTHD 4RT1A 3D65E 4GHQA 1HAPH 1HV7A 2LNCA 2ZHQH 4H4FA 4YOGA 4MNYA 4IC6A 2FS9A 1HDTH 4UFGH 5HXFA 8ESTE 1SR5C 2SGAA 1AMHA 1ZPCA 1ZSLA 3K65B 1SFQB 2P8OB 1TOCB 1T31A 5C94A 4ZKSU 1UK4A 2SNVA 3ZVGA 3RXQA 2FTMA 3LH1A 4IGDA 4DT7B 2AH4X 2A5IA 1RTFB 1ZJDA 2ZCLP 2ZTZA 1AZ8A 3ATWA 4JMYA 4Y0YE 3QDZB 1C5PA 3KYGA 1CHGA 5F03A 3W94A 3ZVEA 4NGAH 1BRUP
chains in the Genus database with same CATH topology
1T4VH 3I78A 6LPRA 5EXMA 2ODQA 3S69A 2Q1JA 3RXSA 5E8EH 2ZFQH 5GDSH 1NM6A 2ZEBA 2UUFB 2Y7XA 1ANDA 1LDTT 1DPOA 1SGIB 1JIMA 1ORFA 4WH6A 3URCA 2YOLA 2A5KA 4K1SA 3PO1B 2IOTA 1BHXB 2SGEE 4I8KA 3LT3A 1S0RA 1DWEH 1MQ6A 2RA3A 1Z8IB 1LMWB 1C1UH 3H5CB 1UVPA 5ESTE 2VIWA 2AYWA 3U1IB 1F0SA 1YGCH 2VWLA 1NPMA 2Z9LA 3RLYH 2PKAB 4AX9H 3URDA 5A2MH 3ATLA 1QA7A 4MNVA 1Y3VA 5CHAB 3SGAE 5DP6A 1MTSA 3SN8A 3RMMH 3E91A 3ZZ4A 1DLKB 1DXPA 7LPRA 2VGCB 3D23A 1O5AB 4A7IB 1GCDA 3KNXA 2JETB 1BMMH 3MU0A 1BZXE 4UE7H 2GDDA 3QZQA 1AUJA 5CE1A 1B0FA 3I77A 3KQDA 2BQ6B 4YO9A 1DITH 1DDJA 3MU4A 5L2ZH 3SORA 3A7WA 1Y3XA 1DANH 4ISNA 4Y0ZE 1ZR0A 2BD3A 3GDUA 5C5OA 2VVUA 1KY9A 4D7FA 2WV4A 3FANA 1TX7A 3ZZ8A 4CRBA 3SNEA 1RGQA 2ZI2H 1AB9B 1DS2E 3P8OA 2PTCE 1FPHH 1A7SA 2GCHF 3GCTF 2NU3E 1HAZB 3FP7E 4UEHH 2D8WA 1SB1H 3U9AH 4H6TA 1QTFA 1TGSZ 1ESTA 4K60A 1V2VT 3OYPA 1IOEA 2ZDAH 1QURH 2HNTC 5LGOA 3UPEA 3SOSA 1NESE 3RXJA 3T29A 1AE8H 4IW4E 2J2UA 1GBHA 2D1JA 2C4FH 1AHTH 1C2DA 1NS3A 1ABIH 3BEFB 3U8RH 4X2YA 1FPCH 1YPLH 3AVZA 2F83A 4LZ4B 1EB2A 1UMAH 1FIZA 2H1UA 1MH0A 4IN1A 1GHXH 1EZUC 5FBEA 4ZXYH 5FPYA 4I8LA 4TY6A 1GJ6A 1HGTH 1CA0C 3T62A 3RMNH 3PMJA 4Y76A 2BD7A 2QY0B 3MO6A 1ZHRA 3GISB 1GJ4H 1TNGA 1TABE 2ZFPH 2VIDA 2R3YA 2F91A 3RXCA 4ABJA 4ZHLU 1ZOMA 1XXFA 3RXAA 3SW2B 1IHTH 3VXFH 1XKBC 1V2UT 3QTVH 1C2IA 2GX4A 3D62A 4UD9H 1AFQB 2CHAB 4X8TH 4CRGA 2ZGBH 2WUBA 1MKXK 2W3IA 3UOUA 1AKSA 1GBKA 1SLWB 3SNAA 1CHOF 1TRYA 1VR1H 2HNTE 1Y5AT 4AYYB 2ZDMA 1UHBB 1SGPE 1TYNA 3UR6A 2UWOA 2LPRA 1OWDA 1B0EA 2FI5E 1EP6A 1ACBE 1KTSB 4K3JA 1KLTA 3OTJE 5PTPA 1WYKA 3UFAA 4KP0A 2KAIA 1O3NA 1NFYA 1F92A 3ZZ7A 5JYIA 3F9FA 3U1JB 1C9PA 1O5CB 3A87A 1T8NA 2G4UA 2H6MA 1XXDA 4NA8A 4ZROA 1ANEA 2VWMA 1BDAA 2BM2A 5EODA 4ASHA 5G4BA 3A81A 1BOQA 3IITA 4CH2B 5DO4H 1P03A 1K2I1 2WINI 5HMAA 1HFDA 3RMLH 1OWIA 4XDEA 1MTNB 4OGYA 3LOXA 1LTOA 2GP9B 2ZQ2A 3RXEA 1TPSA 2XC0A 3NKKA 4MTBA 1P2KA 3PYHA 3LC5A 4LZ1H 3SNDA 3SI4H 4K8YA 2ZDNA 3F6UH 1OWHA 4A1TA 4A92A 2FLBH 3TGIE 4D8NA 2Y81A 2GCTB 1NFUA 1ABJH 1KXEA 1O3PB 1OS8A 4X1QU 3MH6A 1WQSA 5DP4A 3V7TA 2I6QA 2XYAA 4JZFH 1XUFA 4XE4A 3UNRA 5TCAA 1TRNA 1S0QA 1C2KA 1PYTC 1O2MA 4BAOB 2RDLA 1HBTH 1O5FH 1FY8E 1MQ5A 1D6WA 1XM1A 2FOEA 3SUGA 1L1NA 1SHHB 1O2SA 2O8MA 1P02A 4MLFB 2ZTYA 3AAUA 3MWIU 3A83A 3BIVH 3LC3A 1KIGH 2AMPA 4FU8A 7GCHG 1OOKB 2Z3DA 2VIPA 2BDBA 2A4OA 2R3UA 1TIOA 1F5LA 1GHAG 1ARCA 4X1PU 2TGAA 1QJ1B 1O2PA 3PLPA 1DUAA 1E38B 4BXSA 1AN1E 1ZGVA 1ELGA 1YKTA 2ZU5A 4SGAE 1YM0A 1EX3A 1TNJA 4U2WA 1QGFA 4FUHA 5A0BA 1T7CA 2GT7A 4FUIA 1EPTB 5E2OA 3SUEA 4DCDA 1NZQH 2QIQA 3KEEA 1A0HB 1V2QT 2OTVA 3SNCA 1ELVA 1N8OB 3BTME 5GCHG 5LPRA 4BNRA 1SVPA 1GCTC 3GICB 1GI9B 3CS0A 2HNTF 2ZHEH 1CHOG 4D9QA 1MTVA 2A0QB 1MD7A 1C5VA 1A1RA 4I32A 3VXEH 3BEUA 3C1KA 2OQ5A 2ZKSA 4KTCA 4NZLA 3M7UA 1V2OT 2XBXA 4TPYA 2FOGA 3RP2A 2J38A 4NIXA 1CO7E 1Y5UT 3M5OA 5T3HA 1G37A 4JCNA 1O5EH 3A8CA 1TBRH 1TNHA 1EASA 1AVWA 2CV3A 5H4IB 1O2LA 1GJBB 4GAWA 1CBWB 4ZHAA 3MNCA 5AFYH 4Y6DA 1LQEA 5TJXA 1TX6A 2BMGB 3RLWH 1O30A 4Y10E 3QUMP 1O2RA 3F9GA 1ELDE 1ETRH 1ZTJA 4KKDA 4Y79A 2TGTA 1T32A 3STJA 1QRXA 2B5TB 1TBZH 2ZU2A 1TQ0B 3GDVA 3RXLA 3PMAB 1O39A 3NK8A 1LKBA 1D3QB 4B2AA 1OWEA 2V3HH 2P93A 1C1WH 2G81E 2OCVB 1XUJA 2JETC 2UWPA 3V13A 1A3BH 1UTNA 3SU6A 1P2OA 2ZFFH 4IMQA 1GI8B 3HATH 3HK3B 5C20A 2G5VA 1A0LA 3LKWA 3UQVA 2BXUH 1ELEE 4WY3A 4AB9A 1FONA 2ZDLA 4ZHMU 4DGJA 1UTJA 1DWBH 4CR5A 3LH3A 4K8BA 4NFFA 4WJG2 3O8BA 1JMOH 2XNIA 3A84A 4M7GA 7ESTE 1TFXA 4BAQB 1BTWA 2VIVA 3T5FH 4X8VH 1QFKH 4IMZA 1GVKB 1ELTA 1WOFA 1O35A 1SG8B 3H7OA 1YP9A 3DUXH 2FYQA 3K6YA 1SGCA 4YTAA 3TK5A 1PPGE 4DG4A 5GWZA 1OWJA 3PLKA 3E3TA 2H2ZA 1SGFA 2FI4E 1TPOA 1G9IE 1V2NT 2BY7X 3FZZA 4TWWA 3EDXB 1ELBA 1KXAA 1A4WH 1XUKA 3MH7A 3NXPA 2F9NA 4YM9A 2JH6D 4U30A 4BOHA 1EPTC 4CRAA 1O2VA 3BTWE 2QXGA 4BTIB 1EZQA 3HGPA 1P09A 4WH8A 1QBOA 1DY8A 2BX4A 2FO9A 3BV9B 4TWYA 2P95A 3Q3YA 7GCHF 1MKXH 1N6YA 1AVGH 1H9HE 1H1BA 4RKJB 1NN6A 2ZU1A 3R0FA 2GCHG 1GHAF 1AY6H 1C5SA 4OS2A 3T25A 3E6PH 2GVFA 4X2WA 1ZMLA 1KXBA 4Q7XA 2FI3E 1S81A 1KLIH 2FESH 3TGJE 1QIXB 4MQAA 1ZMJA 1WAYB 6ESTA 3TK6A 5E0HA 5ESBA 1ZSJA 4O3TA 2QGRA 1DWCH 2ZFSA 4AZ2B 2FOBA 3U69H 2OC0A 1NRNH 4FUEA 3MH4A 3PTBA 3JZ1B 4I31A 1AD8H 3L33A 3P17H 1K28D 1SOZA 2D26C 2AIPA 5GXPA 3QX5H 3RM0H 3NUMA 1L4ZA 3S9BA 1BRCE 4X1NU 1AU8A 1P3CA 1IQLA 4CHAC 2GZ7A 2XC5A 1ELCA 1UO6A 4MNXA 4A5TS 1AIXH 2HOBA 1O2TA 3SU5A 1G32B 4WMDA 3RU4T 2ZU3A 1T8MA 4DW2U 4IBLH 5EGMA 3M3TA 3QTOH 3RDZA 3S9CA 1C2HA 3DFLA 4Y7AA 1LO6A 1TMTH 4LXBH 3NWUA 1BCUH 4A1VA 2NU2E 1CQQA 2BLWA 3A80A 3AAVA 3PMHB 1V2JT 2A45B 2TIOA 3P8GA 1HJ8A 2SFAA 4YOJA 1OP0A 2A32A 3F68H 1PFXC 1PPCE 1HAYB 1HJAC 2P3FH 4LK4A 1SLUB 2V3OH 3BTTE 2Y7ZA 2STAE 4Z6AH 3PLBA 2Z9KA 1JIRA 1JWTA 1CU1A 1OPHB 2OP9A 2R0KA 1GMHG 2BY8X 2ZU4A 1Y3YA 3T27A 4AG2A 3ZZDA 3QZRA 1MKWH 4AFSA 2RG3A 1V2KT 2PTNA 5L2YH 1LHGH 1UVUH 2VNTA 1VITG 2ZG0H 1YCPK 1XVMA 2CN0H 4CBNA 4XBDA 3GOVB 3T2NA 3RXRA 1FY5A 2PUQH 1Y8TA 3K6ZA 1KXFA 1XKAC 4OS5A 4PROA 4B75A 1SLXB 1G3EA 1P2MA 1TMBH 1L1GA 1GBEA 2XW9A 2BXTH 4CH8B 3RC5A 1O3BA 4ISHH 4JK5A 4X8UH 1D3PB 4HZHA 5B6OA 1U6QA 1Z6JH 4MPVA 1HCGA 2QV1A 2OBOA 3GY7A 3SV7A 3RMOH 1NY22 1INCA 1QJ6B 4MPUA 4AG1A 3TITA 1EATA 1HAVB 3OY5U 1S83A 5L30H 2WV5A 2EI6A 1P05A 5EPYA 1BIOA 5C3NA 2ZO3H 3LIWA 2BVSH 2GV7A 3T28A 1TE0A 1Y59T 2Q6FA 3ATIA 2A4GA 3RXDA 5A8ZA 1DICA 4GUXA 4F49A 4CREA 1W10U 1CBWC 3MNXA 5LPEA 1Y3UA 1BTUA 1HJ9A 1FN8A 7KMEH 2C8XB 1FJSA 6GCHF 3ATMA 2O8LA 2ZFTA 3ZV9A 1SGTA 2BD9A 4ZMAH 1P12E 4YOIA 2VWNA 3TPIZ 5C1YA 6CHAB 1LHEH 1SGRE 3SU4A 5IDKA 1IQJA 3PB1E 1H4WA 2ZC9H 2HWLB 4BXWA 1C1OA 1J9CH 3ZZ9A 1C5TA 2QA9E 1GBAA 2BY9X 4Q7ZA 5ETXA 1OKXA 4UFDH 1S6FA 2FX6A 5EXNA 1UTKA 3SNBA 2AMDA 3GDSA 1UHBA 1IQIA 1B5GH 3GY6A 3SUFA 4Q2KA 1HAIH 3A8DA 1J8AA 4BAKB 1J14A 1HAHH 2FTLE 1G3CA 1ZTKA 3KCGH 1F7ZA 1GBTA 3TNTA 4I8JA 2AGEX 4WF8A 1OP2A 1D3TB 1O3JA 2Q6DA 3SV9A 3PWBA 2BB4A 1BMAA 1BRAA 3BEIB 1LVBA 1V2ST 2XWBI 4UFEH 2QXJA 1O2UA 3BTDE 3ZVCA 5DP9A 1MUEB 4MPXA 3RXUA 1DM4B 3SGBE 3KF2A 4AORA 4DURA 1GL0E 4WVPE 4K2YA 4Y8XA 1RXPA 3LGWA 1SGYE 3RXGA 1SQAA 4TY7A 3MU8A 4E06H 5C2ZA 2GV6A 1SLVB 1S6HA 1RFNA 1P2NA 3P92A 1ESAA 1BT7A 2H5DA 4OS7A 2K1QA 3Q3KA 3NCLA 1YCPM 3O8CA 2BZAA 1C2LA 1RIWB 2SGDE 2SGQE 3UTUH 3PV4A 4I33A 4H42U 2ZZUH 4XBBA 1UJ1A 1P2JA 1D3DB 1SMFE 3M37A 2ZWLH 4CHAB 1EAIA 4AN7A 3UIRA 5DP7A 1X7AC 1GVZA 2VIOA 4ABAA 3VB5A 1HRTH 1OX1A 2PSYA 1BTHH 1O3KA 2FP7B 1O3FA 2QF0A 3VB6A 1EP5A 2BDIA 2Z3CA 1C5YB 4F4OC 2WPHS 5C1UA 1TPAE 1YPMH 2XWAA 1C2EA 1GDUA 1BA8B 2C90B 4NIWA 3L6PA 1Z8GA 5HM9A 4H6SB 2F9VA 5AVDA 1GL1A 1GGDB 1MZAA 3BTKE 1AWHB 1DSUA 1VITF 1DX5M 1G2MA 3GCOA 3L3TA 1TLDA 1BTPA 3TJUA 4BTTB 2ULLA 1W7XH 2FS8A 4WXVA 4CRFA 4BAMB 2XXLA 2ASUB 1O2JA 1EPTA 1GBDA 1RIWC 3SBKA 2AMQA 3ZZAA 3EA7A 3RM2H 2QF3A 4WMEA 3SJ9A 2R2MB 1THRH 4X6PA 4ABFA 3RXKA 3FVFB 2PLXA 5EQSA 2EI7A 1SGNE 3TK9A 3VGCB 9LPRA 1KDQA 2UWLA 3RXIA 1PQ7A 3QGJA 4BTUB 2QXHA 5I25A 1HPGA 5FPSA 1BJUA 2XCNA 1L4DA 1Z71A 2ODPA 4O3UA 5JB8S 2ZGCA 1A46H 5FBIA 1Z8JB 3RXMA 2XC4A 4X8SH 3ZV8A 2Y5FA 3DT0H 4CR9A 1NT1A 4DIHH 1F2SE 1BB0B 1NFXA 2NWNA 3SU1A 1W2KH 1BTXA 3EA9A 4R0IA 4OS4A 2Q6GA 1GHBF 1P8VC 3GCHC 1O3OA 1V2LT 1V2RT 4JYTA 4A6LA 2ZP0H 1SHYA 1SGFG 3FAOA 1WCZA 3EQ0H 1MCVA 2A4QA 4ABEA 1QR3E 3V0XA 5JBCS 1P01A 3GY8A 1T8OA 1XX9A 1W8BH 5FX6A 6CHAC 2NU1E 1IQMA 2AIQA 3UOPA 1ZPBA 1AVXA 1A5IA 4CBOA 1HLTH 2TGDA 4Q7YA 4ZUHA 4ZH8A 1XUGA 1SQTA 1CGHA 3EE0B 3O8RA 3M5LA 3K2UA 3RU4E 2DUCA 4OS1A 1BMLA 5FCRA 2GT8A 3LDXH 1VJ9U 1CT0E 1AB9C 2IJOB 1TAWA 1O37A 4JZ1A 4Y8ZA 3ZVBA 2QN5T 3BSQA 3SUDA 2FOHA 4ESTE 2BQ7B 2Z9JA 1W14U 2CMYA 1RJXB 2BD5A 1O31A 1C5QA 1SGEE 1C5NH 1YPEH 4JYUH 2M5TA 2YNAA 3OU0A 1CT4E 3TIUA 2ZPSA 4U32A 4NSYA 1FIWA 1GBLA 1TA2A 2C3SA 3VB7A 1BQYA 1S5SA 3MO3A 2C93B 1HAVA 1TGCA 2BVRH 2NU4E 2PHBA 1GCTB 2FOMB 3DA9B 1Z7KA 2A1DB 1A2CH 1UK3A 3VPKA 1PYTD 1O5GH 3A88A 2ZDVH 6GCHG 1C2JA 3A86A 4GCHG 4JYVH 3GCHB 4O97A 1ZTLA 1BRBE 2OQUA 3M7TA 4UFFH 2OLGA 2J4IA 3LGIA