2FXRA

Human beta tryptase ii complexed with activated ketone inhibitor cra-29382
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
243
structure length
243
Chain Sequence
IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Tryptase beta-2
publication title Structure-guided design of Peptide-based tryptase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 49
structure length 243
sequence length 243
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.59: Tryptase.
pdb deposition date 2006-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fxrA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fxrA01
2BXUH 1S0QA 3LGUA 2SGDE 3UTUH 3ZVGA 2PV9B 3FANA 1D3PB 1ANCA 1Y3VA 2GKVE 1T8MA 4UFEH 2O8TA 1NT1A 1C5SA 3BTTE 3DHKH 2D1JA 2SNVA 1GL0E 1OKXA 1IOEA 3RC4A 2WUBA 4FVDA 1PPGE 1YPEH 3SQEE 2P3UB 5J4SA 1VJ9U 1JWTA 3MU1A 3RU4D 1QFKH 3RMMH 4U32A 1FONA 2HNTC 1CVWH 1VITH 1T7CA 4ISIH 1GI1A 1ZTLA 2XBWA 1MQ5A 3RMNH 1O3OA 1S85A 2VJ1A 3P8OA 4NZQA 1GCDA 1HJAB 1WTGH 5JDUB 2PSXA 1S5SA 1SBWA 4GHQA 1TAWA 4FUCA 3Q3KA 3M5LA 3ATWA 5EU8A 1RFNA 1GBFA 1Y3YA 1MZAA 2ZFRH 1K1LA 1K1OA 3K9XB 2QCYA 4E7NA 1LO6A 4AGKA 1QJ7B 2O9QA 1Z1IA 3ATMA 1V2RT 4BOHA 2ZFFH 2CJIA 1EATA 2BLOA 3MNSA 3O8CA 3UIRA 1UCYK 2WPIS 3URCA 1EPTB 1AO5A 4MNYA 2A4OA 1EAXA 2A7HA 1NRSH 1C2DA 4ZKOU 1AKSB 2ZFQH 3RXMA 1H8DH 3VB7A 1O3LA 5C5NA 1ETSH 1C5TA 2UUJB 5I25A 3A8BA 4CH2B 4FUGA 1NO9H 3SNEA 4I33A 1DLEA 1TLDA 1AWFH 4K3JA 1P2KA 1DANH 2CF8H 1O2IA 1MTVA 4IBLH 1WV7H 2V0BA 4X8TH 4K69A 2BDYA 1A7SA 1GJ7B 3GY3A 4CRCA 2GCHG 5I46H 4H6SB 1K1MA 2BDCA 1Z8IB 3FP7E 4BAKB 1GWAA 1N6YA 2GT8A 2ZHWH 1P09A 4XBDA 5IYTA 1QCPA 2PGQB 3LKWA 1ZMJA 3ITIA 4Q7YA 1THPB 3MNXA 4D9RA 1YPGH 1UTLM 3SBKA 1RD3B 2SGQE 2BD8A 3F9HA 2Z9LA 4A5TS 1V2ST 2I6QA 3PMBB 4OS1A 4E7RG 2XTTB 5T6GA 1PQ8A 1SGDE 1RTKA 2ODQA 1PPFE 2GDDA 1TX6A 5FCKA 1FXYA 3SHCH 3MWIU 4DJZB 3MO3A 1TA6A 3SGBE 1TFXA 2ZTXA 2PKAA 1F5LA 1EJAA 2BZAA 2QV1A 3E6PH 4NCYA 4D7GA 1FY5A 1A0JA 4MPWA 2IOTA 2F9PA 3F68H 2WUCA 1BJVA 3GY8A 1AFQB 1M9UA 2FO9A 2ZU2A 3A89A 2PR3A 4ZKNU 2STAE 1OWJA 1O5BB 1J16A 1FLEE 1C9TA 2GGVB 1IQMA 1CGIE 1O5EH 1SOTA 1AD8H 1GJAB 4OS7A 3KQEA 5F8ZA 2FOAA 3PB1E 3TGIE 1GHAF 1CBWC 5DJ7A 1D3QB 1O2VA 2W7SA 2BDHA 2B9LA 2IN2A 1C1SA 1DVAH 2WPHS 2ASUB 1W12U 4HTCH 1FDPA 1FNIA 1OWIA 4ISOA 1CA0C 3EA7A 4FUFA 4TWWA 1CGHA 1NU7B 4H6TA 3SU3A 4MG3A 5K7RA 5HYOA 4OS4A 1AU8A 2ALVA 3PO1C 1EJMA 1TPPA 2EI7A 2AFQB 2ZI2H 5JBAS 4X1RU 3ZZBA 1CA8B 1T8LA 5GCHF 3SUFA 1E35B 1TNGA 2JH6D 2W7UA 1HJ9A 3ATLA 2QIQA 3U69H 1TOCB 3PMJA 3TJOA 4XBBA 4BAOB 1C2KA 5HM2A 2YNAA 1UVPA 1Z8RA 1PQ7A 2ZQ1A 3F9GA 1E34B 2H5CA 4AN7A 1K28D 3BG8A 3TK6A 5L2ZH 1LPKB 1C1NA 1JXPA 3A8AA 3AASA 3EA8A 1O3JA 4FU8A 3SV7A 4ABGA 1K21H 2ZEBA 2ZPQA 5GPIB 1O2HA 2Y81A 3BTDE 4AB8A 4MTBA 1TABE 1GCTB 1DFPA 1IQNA 2JETB 1TIOA 2UWPA 3T25A 3PLBA 1DITH 3PTNA 4NWKA 2ZC9H 1MZDA 3AAUA 3VPKA 2F9OA 1HUTH 4B2AA 4RKOB 3QGNB 2F9NA 1XMNB 3TU7H 1N8OC 1XX9A 3ZZ9A 3S9AA 3MNCA 3PV4A 4KP0A 2VGCB 5C5OA 1V2WT 2VIOA 2ZF0H 2PGBB 1H9IE 4F49A 2SNWA 1C1WH 3W95A 4D9QA 3ZZ4A 4ZHLU 3GYLB 1YM0A 1SFIA 2BVRH 2R3UA 2FX6A 3Q77A 2ZFSA 1O2TA 2XC4A 2RDLA 3PYHA 4Q2KA 5EGMA 2WV4A 2BOHB 2TGTA 1LDTT 5DP6A 3IITA 1O2SA 2XC5A 1A1RA 3BIUH 1O3BA 4TY7A 3LC5A 1FY4A 1P2MA 1O3NA 1ELDE 1V2MT 1P10A 1OOKB 3FVFB 1FY1A 3SI4H 4CREA 4AOQA 1GI6A 1XVMA 1QJ1B 1HIAB 1GBJA 5T6FA 1V3XA 4FU7A 3W94A 3UNQA 4BANB 3P8FA 1PYTD 3M35A 2EC9H 1GI9B 1BQYA 2P94A 2D26C 4J2YB 3VGCB 1LCYA 1QQ4A 1W10U 3D23A 1HNEE 4AFUA 1EOLA 2AGIX 3MMGA 1C5NH 2ZDKA 4AFSA 2WYJA 3GY2A 3U9AH 2CN0H 4OS2A 1ZLRA 3D62A 4WXVA 3QK1A 1TYNA 3E8LA 5FPTA 2VINA 3MOCA 2VIQA 3B23B 3ZZ7A 5JYIA 1O2RA 1EQ9A 1QBNA 1LVMA 4ESTE 3VXEH 1VITG 1BTWA 2GCHF 2OBOA 2AGEX 2P3FH 3RC6A 5AFYH 3GY5A 1MTNC 3B9FH 1O2GH 1EP6A 2GT7A 1O2JA 1MBQA 1GVKB 1XUIA 1YPHC 1CE5A 1MUEB 1GI5A 1C9PA 1F0TA 1ZYOA 1YPKH 2ZO3H 3SJKA 4CR5A 1XUHA 2J94A 2FTLE 2BDIA 3U8TH 3E90B 3BIVH 5JB9S 3CP7A 1O2UA 4CH8B 1LHEH 4CR9A 3QN7A 3MH7A 2A7JA 1BRUP 1O2LA 1O0DH 2V6NA 4KTUA 4ABAA 2FYRA 1KXBA 4ABEA 1EZXC 1C5PA 1O2XA 3RM2H 4I8KA 4JZ1A 3BTKE 4ABDA 1AB9B 1KDQA 2NU1E 4MNXA 1RIWC 2A2XH 4CRDA 1DUEA 3NKKA 2VU8E 4BNRA 1GBAA 2AEIH 1V2KT 4BTIB 3KIDU 2B7DH 2XXLA 1AB9C 1IQFA 3LC3A 5CHAC 3OSYA 2A4RA 2IPHA 3UOUA 5E2OA 1Z1JA 1VR1H 1G3BA 5FPSA 2PSYA 3V3MA 4B74A 5FHTA 1NROH 1ZMLA 2ILNA 5E8EH 3TNSA 3ZZ6A 2BZ6H 1LMWB 1TBRH 1EAWA 1MKXK 2BXTH 1S6HA 4YTAA 3SU4A 1TNHA 1O3HA 1SG8B 1GHYH 4CHAC 2H6MA 4WVPE 1C5RA 4WXIA 2TRMA 1YLCA 3E16B 2ZPRA 2Z3DA 1DWCH 1EP5A 1F0RA 4OGXA 4NFEA 1P06A 1ZRBA 2A5IA 1O31A 4ZUHA 3M7TA 3ZZ3A 1Y5UT 1SOZA 2F9UA 1MH0A 4Z0KA 1YYY1 1IHSH 1D9IA 3CENA 2FZZA 2CHAB 3BTME 1A2CH 1MD7A 4ZHMU 3UOPA 2ZA5A 3C1KA 5EW1H 3EAJA 2QY0B 1TX8A 2G4UA 5E0HA 4JCNA 1QGFA 1S84A 3Q3YA 1LQDB 1DY8A 2CHAC 3SOSA 1F92A 1ELFA 1HXEH 1ZPCA 3MU8A 3E3TA 2WPKS 1XUFA 1NC6A 5C3NA 4BAQB 1EB1H 4MPXA 2QC2A 3A7VA 3TK9A 3A88A 1CT0E 1O2MA 2GDEH 5H4IB 3TH3H 1O3DA 5BRRE 1KXFA 1TMUH 1LTOA 3SV6A 1BBRE 1A46H 2F83A 2OCVB 4GHTA 1GVZA 1FV9A 3S0NA 4JYVH 3OY6U 1FIZA 3BEIB 5EODA 1FUJA 4IC6A 3VEQB 4LZ1H 3D49H 3S69A 1Z8JB 3ODFA 5EPYA 2H9TH 3M36A 5JB8S 1ZTJA 5DPAA 3TJNA 3PTBA 1A5IA 1VZQH 1Q31A 3RXPA 4TPYA 3UFAA 1RTLA 2BLWA 1GBIA 1KY9A 1P2QA 1W7XH 2XCNA 4BXSA 2BYAX 3L3TA 4B2BA 4YOJA 1ELEE 1SGPE 3EGKH 3NWUA 2WPJS 5AFZH 3FP6E 4GCHG 3SGQE 1OSSA 1NS3A 1TRYA 1C2JA 4UDWH 2C8WB 2OC8A 3M5OA 2ZWLH 2PWXA 4HI3A 1KXAA 4Y8YA 2KAIA 1G9IE 1DXWA 2GX4A 3QZQA 5HM9A 2BM2A 2LPRA 1IQLA 1ZGVA 3ZZDA 1F0UA 5GWZA 6ESTA 2BQWB 1UVOA 1VITF 5C1YA 5FAHA 1ZPBA 2TIOA 2VVVA 1OP0A 4VGCB 2Q6FA 2D8WA 2ZGCA 1E38B 1O5AB 1SGQE 1Y5AT 2C90B 3KEEA 3NZIA 1GHWH 1BHXB 1BRBE 4J1YA 2ZFPH 3SUGA 1AKSA 1CHGA 5F8TA 1D3DB 1O33A 3KNXA 3KHVA 8KME2 4I8HA 2AMQA 3M61U 1FMGA 1SL3A 1O2YA 4NIXA 1OYTH 1DDJA 5J4QA 3A86A 2BHGA 1YBWA 1ZPZA 1CO7E 1D3TB 1TNLA 3RXCA 3E91A 4OS5A 3Q76A 4JZFH 1TGBA 1IQEA 1Q3XA 5F6MA 1GI7B 3SU0A 3QO6A 3ZZ5A 1V2NT 4AYVB 1O30A 1OP2A 2PW8H 3FFGA 2ZNKH 4INHA 4KTSA 1BB0B 5A0AE 1O39A 4JZIA 5GIBA 1SGIB 4Y7AA 3SJ9A 1QRXA 4BTUB 4Y76A 2HWLB 1BTZA 9LPRA 1V2QT 4CRAA 1S81A 3O8DA 1NZQH 1KLTA 2ZHQH 3ATIA 3BTWE 3GISB 1P2OA 1D6WA 3QUMP 3SU5A 5HGGA 1WOFA 1FN8A 2SFAA 1T4VH 4FU9A 4K2YA 4NSYA 2AGGX 1P9SA 4UE7H 1XXFA 2VIPA 3K2UA 1KLJH 1KIGH 1DWDH 2FOHA 2BD4A 6CHAC 2BD7A 2G81E 1HJ8A 2A1DB 4JK6A 3K6ZA 1HFDA 2FDAA 4IN2A 1FAKH 4DW2U 4B75A 1O5GH 2Q6GA 1GHXH 2VVUA 1NFXA 2FYQA 4TY6A 1TNKA 3ESTA 2P95A 2TPIZ 3AW1A 3U1IB 1ELTA 1EZSC 3HK3B 1KXCA 2VWMA 3RXQA 2J95A 3JZ2B 1XKAC 3S7KB 1ZSLA 3RXLA 2ZKSA 2R2WU 3LU9B 1X7AC 1WSSH 1SGFG 1E37B 2R3YA 7GCHG 3P17H 1HAHH 4KELA 3LH3A 2BX4A 1DWEH 2A32A 2PKSC 1UMAH 4U2WA 1DS2E 1O37A 3I77A 2G8TA 4CBOA 2Y5GA 4FUDA 1ARBA 4AG2A 1SFQB 4X2YA 1IQIA 3V0XA 3NCLA 1BOQA 1SLXB 1NRQH 1TBQH 3JZ1B 2H1UA 2FOBA 5C20A 1UTJA 1CU1A 1ZJDA 4Y0ZE 4DT7B 1NFWA 1HXFH 1BT7A 3C27B 1BRAA 3BTHE 1TPAE 2V35A 3P95A 1ZHMA 1YPLH 3RXFA 4AFZA 3RXVA 3RMOH 1EKBB 1AZZA 1L2EA 2SGEE 4MPUA 2C8XB 1DOJA 3ELAH 1NESE 1DPOA 1A0HB 1G36A 1GDQA 3SZNA 2GMTC 1NPMA 2F9VA 1Z7KA 1THSH 3ZZCA 3UNRA 2WPMS 1O36A 2FP7B 5GXPA 5GDSH 1GI2A 2CXVA 3ENSB 3S9BA 3GYMA 1MCVA 1P03A 2W3KA 2H2ZA 3WY8A 1AHTH 1ETTH 1GBMA 2BLVA 1ZSKA 3DA9B 3OTJE 1MTUA 5A09A 5DP5A 5L30H 2JH0D 1GI8B 1CBWB 1KYNA 4BAHB 4XSKU 4GCHF 1OXGA 2A0QB 1C1OA 1P05A 3FZZA 3P8GA 4K5ZA 3RXHA 2VH0A 1CA0B 1SMFE 1JRTA 2C3SA 3L33A 2W26A 1BTHH 4ZKRU 4QT8C 4YLUA 3H7TA 1YKTA 5EPNA 4IC5A 3LIWA 2GZ7A 1BJUA 1W0ZU 5CMXH 4Y0YE 3LH1A 1BTPA 3PO1B 5A0BA 3RXEA 1C5UA 1O5DH 1EZQA 5FCRA 2ZDLA 4UFDH 6GCHG 1DLKB 1KTSB 1TALA 1P12E 1THRH 3PWBA 1TRMA 2G00A 2BDGA 1ABIH 1RRKA 3RXBA 2G51A 3QGJA 1EXFA 1T31A 3T2NA 2H9HA 7KMEH 2Z9GA 2BOKA 1H8IH 2Z7FE 1QHRB 2XYAA 2FEQH 2VIVA 4IGDA 2C93B 3B8JA 1OWDA 1LQEA 1TQ0B 3K6YA 5A2MH 1VCQA 3MO9A 4HZHA 4IMQA 4K1TA 1O3FA 3LDXH 1CSOE 3RXTA 3QWCH 3MH5A 2R0LA 4KKDA 1P01A 3T62A 3IWMA 1N8OB 4CRGA 1YF4A 4NIVA 1C2LA 4CRFA 4X0WU 4AG1A 3KF2A 1SLWB 3GDSA 1O2ZA 2FM2A 2PKAB 1DM4B 1TA2A 3T5FH 2FWWA 2OC1A 5C1UA 2NU2E 2BB4A 1Y5BT 3NXPA 2ZU1A 1C2HA 3PMHB 1CQQA 3A84A 2DE9A 1A5GH 2J34A 1B0FA 1ANBA 1LHDH 2NU3E 2Y6TA 3LONA 1HCGA 5L2YH 4OS6A 4DURA 2ANKH 4NFFA 4X1NU 4MNWA 3P6ZB 4E05H 1L1JA 1GI0A 1BIOA 1EB2A 1TGTA 3BF6H 2GVFA 1C5QA 5PTPA 1MKWH 1GG6C 5DP3A 3TJUA 4A6LA 1O34A 4WWYA 5JPMH 2IJOB 3A8CA 2BVSH 1Y59T 1PPCE 1OPHB 2FESH 3IG6B 4NIWA 4GVUA 2R9PA 2A31A 5LPFA 1MU8B 1C5MD 3M37A 2G5VA 1S0RA 7GCHF 3FZDA 3A82A 1UHBB 4ABBA 3STIA 2FLRH 1UVUH 2P93A 1KTTB 1UTKA 1NU9A 2P59A 3VXFH 2A7CA 2ULLA 1TMBH 1W2KH 1S6FA 4ZROA 2ESTE 1MTNB 3BTFE 2XCFA 1HAVA 4UFGH 4IN1A 3GCHC 3BTQE 4NSVA 2O8UA 4FXGH 1QRWA 1GBTA 4K1SA 3LGYA 1XUKA 1AMHA 1LKBA 2HVXA 1TE0A 4GLYA 4BTTB 5A8XA 2Z3EA 2Z94A 5DP8A 2J92A 3MYWA 1SHHB 2A2QH 1DWBH 1U6QA 2HRVA 4JZDH 2WINI 2D2DA 4AYYB 1BMLA 2OC7A 2R2MB 3BSQA 1K1JA 3K65B 3AVZA 1VGCC 1PPEE 4OGYA 2P8OC 1ELGA 1HAPH 2H9EH 3SJIA 4O3UA 1DUAA 5HMAA 3TGKE 4SGBE 4PROA 1LVYA 2PUQH 4XFQA 1AVWA 5BPEA 1RIWB 3VB6A 2NWNA 1TWXB 1F5RA 3TK5A 3URDA 1K1IA 2OUAA 4I8LA 1MD8A 1ID5H 4K8YA 3M3SA 1UVSH 3P92A 5K0HA 1OS8A 1TGNA 3MI4A 1C4U2 3P70B 4GAWA 5CHAB 3RXAA 2QN5T 4RSPA 3SGAE 3OYPA 2FODA 4NA9H 2P16A 2GD4B 1LVOA 1O3IA 4LK4A 3UREA 1K22H 3UNSA 1QBOA 3EYDA 1TOMH 1ETRH 3RXSA 4YT7H 4YM9A 1GHVH 1GBBA 2VH6A 3M3VA 4BXWA 1FPCH 1AUTC 1HGTH 1G37A 1MMJN 2Z3CA 1G3CA 2EI6A 4Y11E 1E0FD 2EA3A 2PHBA 5E2PA 4CHAB 2FOMB 1ELAA 3UQVA 1SGFA 3E0NB 1SB1H 3MH4A 1YLDA 4HFPB 3SU2A 6LPRA 1QR3E 2HNTE 4LZ4B 4UD9H 2OINA 1UVTH 3ZVBA 5AVDA 1UK4A 4ZH8A 3HGNA 1FZZA 4DCDA 1WQSA 2BQ6B 2RA0A 4B73A 1H9LB 2O8WA 3GCNA 4H42U 1MBMA 2LNCA 4HGCA 6GCHF 3NUMA 1P2JA 4WF8A 5EXMA 8LPRA 2HGTH 5DKMA 2Y7XA 3OU0A 4ZMAH 3SQHE 2EEKA 4GSOA 3TITA 1ARCA 1K9OE 1H4WA 2AMPA 3PWCA 3TPIZ 3ZVFA 5IDKA 1SQTA 3UQOA 2HPQH 2VNTA 1G3EA 3MU4A 1RXPA 1GMCG 1ZJKA 2FOCA 4ABHA 1N6XA 1HYLA 2G4TA 4ISNA 4X6OA 3EE0B 4GUXA 1NY22 1P02A 2ZECA 3F6UH 4X8UH 3EA9A 3DT0H 1QB6A 1AVXA 1V2PT 1ESAA 2BY7X 1JOUB 3V13A 3LJOA 4D76A 2XWBI 1Y3XA 1NTPA 1A4WH 1GMDG 3TLOA 1AZ8A 4LXBH 1XUJA 2FS8A 4UONA 1EJNA 1A5HA 1GJ4H 1A61H 3U8RH 3LGIA 2XW9A 2G5NA 1BITA 1AUJA 4X1SU 4A1VA 3ZZ8A 5L6NH 2FIRH 1JIMA 1E36B 1T4UH 1V2VT 2CV3A 1JIRA 1GGDC 1SLVB 3BTGE 3VB4A 3PLKA 1KDQB 3BG4C 1QJ6B 1ANEA 3A81A 2ZCHP 1IHTH 1KXDA 1O2OA 1PQ5A 2ZIQH 1V2JT 1VCWA 4ABIA 2AIQA 5HXFA 2ZTYA 5A8ZA 3RXGA 3VB3A 2BY5X 8GCHG 1HDTH 1NRRH 5C67A 5AF9H 1BMNH 3RDZA 1TQ7B 2QF3A 3RLWH 2OD3B 2OC0A 2BY8X 1IQGA 1QB1A 4YO9A 3H7OA 3UUZA 1HAGE 1UTOA 3TVJB 1GDUA 3UR6A 3T27A 1MKXH 1QURH 1WTHD 3LOXA 7LPRA 1BBRH 4X2VA 3TH4H 3VB5A 1P8VC 3PM3A 4TPIZ 4FVBA 4NA7A 4ZXYH 1WBGB 1BMAA 4AGJA 3VFEA 4NIYA 1O3EA 2NU4E 2FX4A 2ZHFH 3RXUA 2GP9B 2TGPZ 4I31A 2B0FA 1W3CA 2BDBA 2RA3A 1CHOG 2QXJA 3A80A 5JBCS 3RXJA 1C5XB 1NN6A 3A7TA 2ZGXH 4Y6DA 3A7YA 1EPTA 2Y80A 3S7HB 1J14A 1LPGB 1O35A 1P3CA 2Y82A 2ZU5A 1TNIA 4D7FA 3R0FA 4MQAA 1VJAU 3ZV8A 1QTFA 5E0GA 8ESTE 1WAYB 2UWOA 2ZCKP 2OP9A 3KCGH 1T8OA 1H9HE 1IAUA 1BZXE 1YPJH 4WMEA 3A85A 1P0SH 2GV7A 4B71A 2B8OH 4Q7XA 5C2ZA 1C2FA 2Y5HA 3DD2H 1P3EA 1GHBG 2FOFA 4WH8A 1JMOH 1DSTA 2OXSA 1Y8TA 3SW2B 1WUNH 5GCHG 1FQ3A 1T32A 3PROA 1QBVH 5ETXA 2JH5D 3MNBA 2OTVA 2FOGA 2GCTC 1PFXC 2FI4E 3RXRA 2PTCE 1QL9A 1ABJH 3HPTB 5TCCA 4NG9H 1O3MA 6CHAB 1YC0A 2V3HH 3NK8A 1B5GH 1SQOA 2WV5A 5ABWA 2YOLA 1MCTA 4X1PU 2UUYA 3RU4T 2PTNA 3L6PA 4Y71A 2J4IA 4Q80A 2M5TA 3MU0A 3M5MA 3MTYA 4JYTA 3RP2A 4WY3A 4M7GA 1NM6A 4D8NA 1O2WA 1S82A 5FPYA 3GICB 3SORA 3FP8E 1Z6EA 1ORFA 4UFFH 3GY7A 4ISHH 3OX7U 2CGAA 5E0JA 2G52A 2ZP0H 3ZV9A 1PJPA 2QF0A 3HK6B 1G2LA 2OQ5A 1UK2A 1ELVA 4LOYH 4DVAU 3Q00A 1XVOA 1HLTH 2K1QA 1HAZB 2Z9IA 2ZGBH 2KAIB 3BEUA 3RXOA 4X6PA 5LPEA 1SGEE 1O5FH 1XM1A 1W0YH 3P8NA 1P11E 1HJAC 2QA9E 4TYDA 4U30A 3SI3H 3TH2H 5LGOA 2QXHA 5GJ4B 2PKSB 1K2I1 4DY7B 4WH6A 1GMCF 5EW2H 1C4Y2 4MLFB 2XBVA 2O8MA 1UTPA 2HPPH 4KTCA 1K1NA 1O2NA 4X1QU 3V7TA 2BDAA 1L4ZA 1JBUH 3LPRA 2BY6X 1TRNA 4O03A 1GHZA 1TX7A 1C2IA 1V2OT 1C5OH 2JKHA 3EDXB 4JMYA 4ABFA 1C1UH 1YCPH 1ZSJA 1ESBA 1V2TT 3ATKA 1EOJA 1TPOA 1EPTC 1ESTA 1GMDF 4A1XA 1HV7A 1OWEA 4AFQA 3I78A 2QAAA 4BAMB 1RTFB 1B0EA 4DG4A 1NFUA 2BTCE 1OP8A 2ZHDA 4JYUH 2GMTB 2UUKB 4MDSA 1EX3A 1MAYA 1MQ6A 4XE4A 1C2MA 1GI4A 2F3CE 1O2PA 3KQCA 1V2LT 1SGNE 3AAVA 2FMJA 3A7ZA 3CS7A 3GCTG 3O8BA 1UCYE 5A8YA 3I29A 4I8GA 3KQBA 3TGJE 4IW4E 1YPHE 1ZRKA 1OWKA 1UK3A 3RXDA 3SN8A 2AIPA 2BD5A 8GCHF 2FPZA 3SUEA 2I6SA 4XBCA 1ACBE 1C2EA 1C1TA 1HAIH 2VWLA 1HRTH 3E1XB 3M7UA 3STJA 2TGDA 3UPEA 2BVXH 1O2QA 5DK1A 1G2MA 3ZVDA 3BTEE 5G4BA 1GJ6A 4DIIH 1DX5M 2WPLS 2STBE 3FAOA 1KLIH 2AH4X 2AYWA 1C5YB 2XC0A 1F7ZA 2ZDVH 3BV9B 2F91A 1HAYB 2C8ZB 1LHGH 3TIUA 1CT2E 1EZUC 1LHFH 2V3OH 3SNBA 3SNAA 1W11U 1Z8GA 1DY9A 3M3TA 1LVBA 1DT2A 1YP9A 1C4V2 2PFEA 1AFQC 1OYQA 1W7GH 4O3TA 1UCYH 1SVPA 3U1JB 2OQUA 1CHOF 1O3KA 1WU1A 2ODPA 1MKWK 1PPZA 4CBNA 1LHCH 2ZZUH 1QL7A 3A7XA 2HALA 1BA8B 1J9CH 3RC5A 2PLXA 5EXLA 3ZZAA 1QB9A 3SNCA 2W3IA 3KN2A 5AHGH 2R0KA 1HIAA 5SGAE 2ANWA 3A7WA 3MFJA 2A5KA 3DFJA 1H1BA 5DO4H 1FIWA 3SHAH 2ALPA 5EOKA 4FUBA 1W14U 4B76A 4YESB 1UHBA 1P9UA 2AS9A 4A92A 3RM0H 1SHYA 4YLQH 1YPMH 2BMGB 3HKIB 4NGAH 3AW0A 4AX9H 2ANMH 1GHBF 2FOEA 2GV6A 2BD2A 3MH6A 2OLGA 3SV2H 1GVLA 1AVGH 5LPRA 1ZGIA 4Z6AH 3QZRA 3F1SB 1RS0A 1VCPA 1FAXA 3QLPH 1UTMA 1AGJA 1GMHG 1J17T 1C5LH 4WJG2 3UY9A 4ZHAA 3TJVA 2Y7ZA 2SGPE 2SGFE 1TGSZ 1C1QA 4AZ2B 4F4OC 2UUFB 3G01A 1DSUA 2Q1JA 5FX5A 4DIHH 1WYKA 2ZU3A 4NZLA 2ZDNA 1C1MA 3ODDA 5FXLA 1G32B 4B2CA 1NFYA 2ZGJA 1Q2WA 1G30B 1KXEA 1XXDA 3T28A 1GBDA 1OWHA 2A5AA 3DFLA 3SJOA 3UWIA 1TGCA 1ZZZA 2VWNA 1FY8E 1FN6A 4NWLA 5DP7A 3LT3A 5C1XA 4RN6A 1GCTC 1GJDB 1V2UT 2JETC 5TJXA 1GG6B 3M7QA 4O97A 4YZUA 1TONA 1AE8H 3QTOH 4JK5A 5CE1A 4X2XA 3ZVCA 4THNH 1SGCA 1FI8A 2F9BH 3KGPA 2O8LA 1S83A 1FJSA 2Q6DA 1AQ7A 1QA7A 2ZCLP 4MVNA 3ZVAA 1RGQA 1ZR0A 3LJJA 9ESTA 1A3EH 2VGCC 3T29A 1F0SA 1UO6A 1SR5C 2DE8A 3QTVH 3S9CA 1YCPM 3DUXH 4NA8A 2FI3E 4DGJA 1XKBC 1ZOMA 2FLBH 1AIXH 2XBXA 1IQJA 4ABJA 3GCHB 2BLQA 1XUGA 5T6DA 1TB6H 1UJ1A 1HBTH 2XBYA 2C8YB 2QGRA 1W13U 2J38A 5EQRA 1O2KA 2TGAA 4YOIA 3N7OA 5EXNA 1NRNH 3BN9A 2AERH 3GY6A 3UR9A 1P57B 1QL8A 3RLYH 1SGTA 1GBEA 1VGCB 2P8OB 1NRPH 3GDUA 3RMLH 1G3DA 2VIDA 3SUDA 4A7IB 2ZDAH 3TNTA 1MTSA 3VGCC 3SU6A 5ESTE 1D6RA 2ANYA 5FX6A 1PYTC 2Z9JA 4Y8ZA 1SI5H 2A45B 1QY6A 1CT4E 1J15A 2VWOA 2UWLA 2CMYA 4RKJB 4WMFA 4FUEA 4MNVA 4DOQA 1QA0A 3HATH 1A0LA 4X8SH 3ZYDA 3D65E 3GCTF 2RCEA 4SGAE 1T8NA 4X6NA 5FBIA 1RJXB 1O32A 1DICA 1Z6JH 2ODYB 1MU6B 2CF9H 4R0IA 1KSNA 5TCAA 1BHXF 1GBKA 5EQSA 3SV8A 4X2WA 1SQAA 1TMTH 1FPHH 4X6MA 1BTUA 1J8AA 2A4QA 1ZTKA 4U01A 5EQQA 5DP9A 3U8OH 1BTYA 1SGYE 2AMDA 3A87A 3SU1A 1Y3UA 1QQUA 3RUOA 1BRCE 2QXGA 2TBSA 3Q3XA 1LKAA 1O3GA 1PQAA 2YNBA 7ESTE 3A83A 3KL6A 2NU0E 3BEFB 3ZYEA 2GZ8A 1BDAA 1GJCB 2HNTF 1AY6H 2QXIA 4AB9A 2XWAA 1Z71A 1ELBA 2G55A 3QX5H 2ZG0H 1O38A 3V12A 1PPHE 4WMDA 3KQDA 5FBEA 4ISLA 5DG6A 1L0ZA 1GBLA 3GDVA 4FUHA 1HAOH 2Z6BD 3PLPA 1BTXA 1SSXA 1YGCH 1MTWA 2WYGA 2ZHEH 1BCUH 4ASHA 1W8BH 3GOVB 3LGWA 1F2SE 4CRBA 1O5CB 5JBBS 2J9NA 5B6OA 1BBRK 1Y3WA 1HAXB 2ZU4A 1INCA 4K60A 1HAVB 1TNJA 1SGRE 2XRCA 1CGJE 2EI8A 2PUXB 4Y7BA 1N1LA 2RG3A 1P2IA 2BY9X 1UTNA 1QRZA 2FTMA 4I32A 2BD9A 3RU4E 4O9VA 3QDZB 2FS9A 4K8BA 1DE7H 3SV9A 4I7YH 4ZKSU 1IQKA 1B7XB 2SGAA 1GMHF 5A0CA 1GGDB 4FUIA 1HB0B 1BMMH 2GZ9A 5DP4A 3BG4B 1GPZA 1QNJA 1WCZA 3E0PB 1C1VH 1GJ5H 3CS0A 4AORA 3EQ0H 3HKJB 1P2NA 2FI5E 1EAUA 2BD3A 2ZQ2A 3ZVEA 1C1RA 1TPSA 5T3HA 2ZTZA 3A8DA 1AN1E 1GJ8B 3T26A 4TWYA 4Y79A 1O3CA 1EUFA 1SPJA 1L4DA 1C1PA 2VB0A 2XNIA 1WQVH 4K1EA 4B1TA 3F9FA 1ZMNA 1AFEH 2J2UA 1OX1A 5F03A 4UEHH 2GTBA 1F5KU 2FXRA 3MU5A 2P3TB 2B5TB 2ZGHA 4INLA 3RXIA 1AE5A 2DUCA 1QIXB 2QYIA 3HGPA 3MHWU 1L1NA 4I8JA 3LGTA 4MPVA 1EASA 3OY5U 1SC8U 3M5NA 1ANDA 3MO6A 4IS5A 2HLCA 1HPGA 1GL1A 5JBTA 1GI3A 2OBQA 1L1GA 1UTQA 1IQHA 4H4FA 3H5CB 1V6DA 2ZPSA 4XDEA 4XOJA 4Y10E 5ESBA 2H5DA 3SNDA 5EG4A 2HOBA 4YOGA 2W5EA 5DGJA 5LH8A 4IMZA 4E06H 3GY4A 1GBHA 3U98H 4YT6H 4JZEH 4X8VH 4FUJA 1GJ9B 1LPZB 1GBCA 1EAIA 1GDNA 3F9EA 4ZAEA 1O3PB 1GHAG 1ZHRA 3SO3A 1JRSA 2A4GA 1K1PA 3PMAB 1TBZH 2ZFTA 4A1TA 2VIWA 1C5WB 1C2GA 4GPGA 1P04A 3LGVA 1MAXA 1C5VA 3O8RA 4INKA 3NPSA 3SJ8A 1C5ZB 4ZXXH 2C4FH 5F8XA 1AWHB 1FY3A 1O3AA 1ELCA 2VVCA 1YCPK 2THFB 2GCTB 3GCOA 1PPBH 2Z9KA 1D4PB 1AI8H 1A3BH 1GJBB 3RXKA 2Y5FA 1BUIA 2ZDMA 4VGCC 1ZHPA 4Y8XA 3UWJH 1SLUB 3R3GB 4KGAA 4R8TB 4Q7ZA 2BX3A 2BQ7B 1DXPA
chains in the Genus database with same CATH superfamily
2BXUH 1S0QA 3LGUA 2SGDE 3UTUH 3ZVGA 2PV9B 3FANA 1D3PB 5B6LA 1ANCA 1Y3VA 3ZIAD 2GKVE 1T8MA 4UFEH 2O8TA 1NT1A 1C5SA 3BTTE 3DHKH 2D1JA 2SNVA 1GL0E 1OKXA 1IOEA 3RC4A 2WUBA 4FVDA 1PPGE 1YPEH 3SQEE 2P3UB 5J4SA 1W0JD 1S6LA 1VJ9U 1JWTA 3MU1A 3RU4D 1QFKH 3RMMH 4U32A 1FONA 2HNTC 2KZ4A 1CVWH 1VITH 1T7CA 4ISIH 2LELA 1GI1A 1ZTLA 2XBWA 1MQ5A 3RMNH 1O3OA 1S85A 2VJ1A 3P8OA 4NZQA 1GCDA 1HJAB 1WTGH 5JDUB 2KX4A 2PSXA 5EJLA 1S5SA 1SBWA 2XOKD 4GHQA 3UAIC 1H8HD 1TAWA 4FUCA 3Q3KA 3M5LA 5DSFA 3ATWA 5EU8A 1RFNA 1GBFA 1Y3YA 1MZAA 2ZFRH 1K1LA 1K1OA 3K9XB 2QCYA 4E7NA 1LO6A 4AGKA 1QJ7B 2O9QA 1Z1IA 3ATMA 1V2RT 4BOHA 2ZFFH 2CJIA 1EATA 2BLOA 3MNSA 3O8CA 3UIRA 1UCYK 2WPIS 3URCA 1EPTB 1AO5A 4MNYA 2A4OA 2KM0A 1EAXA 2A7HA 1NRSH 1C2DA 4ZKOU 1AKSB 2ZFQH 3RXMA 1H8DH 3VB7A 1O3LA 5C5NA 1ETSH 1C5TA 2UUJB 5I25A 3A8BA 4CH2B 4FUGA 1NO9H 3SNEA 4I33A 1DLEA 1TLDA 2XNDD 1AWFH 4K3JA 1P2KA 1DANH 2CF8H 1O2IA 1MTVA 4IBLH 2RDEA 1WV7H 2V0BA 4X8TH 4K69A 2BDYA 1A7SA 1GJ7B 3GY3A 4CRCA 2GCHG 5I46H 4H6SB 1K1MA 2BDCA 1Z8IB 3FP7E 4BAKB 1GWAA 1N6YA 2GT8A 2ZHWH 1P09A 4XBDA 5FL7D 1QCPA 5IYTA 2PGQB 3F2HA 3LKWA 1ZMJA 3ITIA 4Q7YA 1THPB 2VBCA 3MNXA 4D9RA 1YPGH 1UTLM 2OK5A 3SBKA 1RD3B 2SGQE 2BD8A 3F9HA 2Z9LA 4A5TS 1V2ST 2I6QA 3PMBB 4OS1A 4E7RG 2XTTB 5T6GA 1PQ8A 1SGDE 3FKSD 1RTKA 2ODQA 1PPFE 2GDDA 1TX6A 2LP6A 5DN6D 5FCKA 1FXYA 3SHCH 3MWIU 4DJZB 3MO3A 3DSGA 1TA6A 3SGBE 1TFXA 2ZTXA 2L74A 2PKAA 1F5LA 1EJAA 2BZAA 2QV1A 3E6PH 4NCYA 4D7GA 1FY5A 1A0JA 4MPWA 2IOTA 2F9PA 3F68H 2WUCA 1BJVA 3SYJA 3GY8A 1AFQB 1M9UA 2FO9A 2ZU2A 3A89A 2PR3A 4ZKNU 2STAE 3F2GA 1OWJA 1O5BB 1J16A 1FLEE 1C9TA 2GGVB 1IQMA 1CGIE 1O5EH 1SOTA 1AD8H 1GJAB 4OS7A 3KQEA 5F8ZA 2FOAA 3PB1E 3TGIE 1GHAF 1CBWC 5EJZA 5DJ7A 1D3QB 1O2VA 2W7SA 2BDHA 2B9LA 2IN2A 1C1SA 1DVAH 2WPHS 2ASUB 1W12U 4HTCH 1FDPA 1FNIA 5KECA 1OWIA 4ISOA 1CA0C 3EA7A 4M9FA 4FUFA 4TWWA 1CGHA 1NU7B 4H6TA 3SU3A 4MG3A 5K7RA 5HYOA 2WPDD 4OS4A 1AU8A 2ALVA 3PO1C 1EJMA 1TPPA 2EI7A 2AFQB 2ZI2H 5JBAS 4X1RU 3ZZBA 1CA8B 1T8LA 5GCHF 3SUFA 1E35B 1TNGA 2JH6D 2W7UA 1HJ9A 3ATLA 2QIQA 3U69H 1TOCB 3PMJA 3TJOA 4XBBA 4BAOB 1W0KD 1C2KA 5HM2A 2YNAA 1UVPA 1Z8RA 1PQ7A 2ZQ1A 3F9GA 1E34B 2H5CA 4AN7A 1K28D 3BG8A 3TK6A 5L2ZH 1LPKB 1C1NA 1JXPA 3A8AA 3AASA 3EA8A 1O3JA 4FU8A 3SV7A 4ABGA 1K21H 2ZEBA 2ZPQA 5GPIB 1O2HA 2Y81A 3BTDE 4AB8A 4MTBA 1TABE 1GCTB 1DFPA 1IQNA 2JETB 1TIOA 2UWPA 3T25A 3PLBA 1DITH 3PTNA 4NWKA 2ZC9H 1MZDA 3AAUA 3VPKA 2F9OA 1HUTH 4B2AA 4RKOB 3QGNB 2F9NA 1XMNB 3TU7H 1N8OC 1XX9A 3ZZ9A 3S9AA 3MNCA 3PV4A 4KP0A 2VGCB 5C5OA 1V2WT 2VIOA 2ZF0H 2PGBB 1H9IE 4F49A 2SNWA 1C1WH 3W95A 4D9QA 3ZZ4A 4ZHLU 3GYLB 1YM0A 1SFIA 2BVRH 2R3UA 2FX6A 3Q77A 2ZFSA 1O2TA 2XC4A 2RDLA 3PYHA 4Q2KA 5EGMA 2WV4A 2BOHB 2TGTA 1LDTT 5DP6A 3IITA 1O2SA 2XC5A 1A1RA 3BIUH 1O3BA 4TY7A 3LC5A 1FY4A 1P2MA 1O3NA 1ELDE 1V2MT 1P10A 1OOKB 3FVFB 1FY1A 3SI4H 4CREA 4AOQA 1GI6A 1XVMA 1QJ1B 1HIAB 1GBJA 5T6FA 4XRNA 1V3XA 3CNRA 4FU7A 1E1RD 3UNQA 3W94A 4BANB 3P8FA 1PYTD 3M35A 2EC9H 1GI9B 1BQYA 2P94A 2D26C 4J2YB 3VGCB 1LCYA 1QQ4A 1W10U 3D23A 1HNEE 4AFUA 1EOLA 2AGIX 3MMGA 1C5NH 2ZDKA 4AFSA 2WYJA 3GY2A 3U9AH 2CN0H 4OS2A 4ZCNA 1ZLRA 3D62A 4WXVA 3QK1A 1TYNA 3E8LA 5FPTA 2VINA 3MOCA 2VIQA 3B23B 3ZZ7A 5JYIA 1O2RA 1EQ9A 1QBNA 1LVMA 4ESTE 3VXEH 1VITG 1BTWA 2GCHF 2OBOA 2AGEX 2P3FH 3RC6A 5AFYH 3GY5A 1MTNC 3B9FH 1O2GH 1EP6A 2GT7A 2YMSC 1O2JA 1MBQA 1GVKB 1XUIA 1YPHC 1CE5A 1MUEB 1GI5A 1C9PA 1F0TA 1ZYOA 1YPKH 2ZO3H 3SJKA 4CR5A 1XUHA 2J94A 2FTLE 2BDIA 3U8TH 3E90B 3BIVH 5JB9S 3CP7A 1O2UA 2WHXA 4CH8B 1LHEH 4CR9A 3QN7A 3MH7A 2A7JA 1BRUP 1O2LA 1O0DH 2V6NA 1WXRA 4KTUA 4ABAA 2FYRA 1KXBA 4ABEA 1EZXC 3KYGA 1C5PA 1O2XA 3RM2H 4I8KA 4JZ1A 3BTKE 4ABDA 1AB9B 1KDQA 2NU1E 4MNXA 1RIWC 2A2XH 2KCOA 1DUEA 3NKKA 4CRDA 2VU8E 4BNRA 1GBAA 2AEIH 1V2KT 4BTIB 3KIDU 2B7DH 2XXLA 1AB9C 1IQFA 3LC3A 5CHAC 3OSYA 2A4RA 2IPHA 3UOUA 5E2OA 1Z1JA 1VR1H 1G3BA 5FPSA 2PSYA 3V3MA 4B74A 5FHTA 1NROH 1ZMLA 2ILNA 5E8EH 3TNSA 3ZZ6A 2BZ6H 1LMWB 1TBRH 1EAWA 1MKXK 2BXTH 1S6HA 4YTAA 3SU4A 1TNHA 1O3HA 1SG8B 1GHYH 4CHAC 2H6MA 4WVPE 1C5RA 4WXIA 2TRMA 2RFKC 1E1QD 1YLCA 3E16B 2ZPRA 2Z3DA 1DWCH 1EP5A 1F0RA 4OGXA 4NFEA 1P06A 1ZRBA 2A5IA 1O31A 2M2AA 3M7TA 4ZUHA 1Y5UT 3ZZ3A 1SOZA 2F9UA 1MH0A 4Z0KA 1YYY1 1IHSH 1D9IA 3CENA 2FZZA 2CHAB 3BTME 1A2CH 1MD7A 4ZHMU 3UOPA 2ZA5A 3C1KA 5EW1H 2J5UA 3EAJA 2QY0B 1TX8A 2G4UA 5GNDA 5E0HA 4JCNA 1QGFA 1S84A 3Q3YA 1LQDB 1DY8A 2CHAC 4ASUD 3SOSA 1F92A 1ELFA 1HXEH 1ZPCA 3MU8A 3E3TA 2WPKS 1XUFA 1NC6A 5C3NA 4BAQB 1EB1H 4MPXA 2QC2A 3A7VA 3TK9A 3A88A 1CT0E 1O2MA 2GDEH 3FO8D 5H4IB 3TH3H 1O3DA 5BRRE 1KXFA 1TMUH 1LTOA 5CDFE 3SV6A 1BBRE 1A46H 2F83A 2OCVB 4GHTA 1GVZA 1FV9A 3S0NA 4JYVH 3OY6U 1FIZA 3BEIB 5EODA 1FUJA 4IC6A 3VEQB 4LZ1H 3D49H 2KCAA 3S69A 1Z8JB 3ODFA 5EPYA 5C0UA 2H9TH 3M36A 5JB8S 1ZTJA 5DPAA 3TJNA 3PTBA 1A5IA 1VZQH 1Q31A 3RXPA 4TPYA 3UFAA 1RTLA 2BLWA 1GBIA 1KY9A 1P2QA 1E79D 1W7XH 2XCNA 4BXSA 2BYAX 3L3TA 4B2BA 4YOJA 2HVYB 1ELEE 1SGPE 3EGKH 3NWUA 2WPJS 5AFZH 3FP6E 4GCHG 3SGQE 1OSSA 1NS3A 1TRYA 1C2JA 4UDWH 2C8WB 3N7EA 2OC8A 3M5OA 2ZWLH 2PWXA 4HI3A 2K8IA 1KXAA 4Y8YA 2KAIA 1G9IE 1DXWA 2GX4A 3QZQA 5HM9A 2BM2A 2LPRA 1IQLA 1ZGVA 3ZZDA 1F0UA 5GWZA 6ESTA 2BQWB 1UVOA 1VITF 5C1YA 5FAHA 1ZPBA 2TIOA 2VVVA 1OP0A 4VGCB 2Q6FA 2D8WA 2ZGCA 1E38B 1O5AB 1SGQE 1Y5AT 2C90B 3KEEA 3NZIA 1GHWH 1BHXB 1BRBE 4J1YA 2ZFPH 3SUGA 3W1EA 1AKSA 1CHGA 5F8TA 1D3DB 1O33A 3KNXA 3KHVA 8KME2 4I8HA 2AMQA 3M61U 1FMGA 1SL3A 1O2YA 4NIXA 1OYTH 1DDJA 5J4QA 3A86A 2BHGA 1YBWA 1ZPZA 1CO7E 1D3TB 1TNLA 3RXCA 3E91A 4OS5A 3Q76A 4JZFH 1TGBA 1IQEA 1Q3XA 5F6MA 1GI7B 3SU0A 3QO6A 3ZZ5A 1V2NT 4AYVB 1O30A 4ACBA 1OP2A 2PW8H 3FFGA 2ZNKH 4INHA 4KTSA 1BB0B 5A0AE 1O39A 4JZIA 5GIBA 1SGIB 4Y7AA 3SJ9A 1QRXA 4BTUB 4Y76A 2AHME 2HWLB 1BTZA 9LPRA 1V2QT 4CRAA 1S81A 3O8DA 1NZQH 1KLTA 2ZHQH 3ATIA 3BTWE 3GISB 1P2OA 1D6WA 3QUMP 3SU5A 5HGGA 1WOFA 1FN8A 2SFAA 1T4VH 4FU9A 4K2YA 4NSYA 2AGGX 1P9SA 4UE7H 1XXFA 2VIPA 3K2UA 1KLJH 1KIGH 1DWDH 3EE7A 2FOHA 2BD4A 6CHAC 2BD7A 2G81E 1HJ8A 2A1DB 4JK6A 3K6ZA 1HFDA 2FDAA 4IN2A 1FAKH 4DW2U 4B75A 1O5GH 2Q6GA 1GHXH 2VVUA 1NFXA 2WSSD 2FYQA 4TY6A 1TNKA 3ESTA 2P95A 2TPIZ 3AW1A 3U1IB 1ELTA 1EZSC 3HK3B 1KXCA 2VWMA 3RXQA 2J95A 3JZ2B 1XKAC 3S7KB 1ZSLA 3RXLA 2ZKSA 2R2WU 3LU9B 1X7AC 1WSSH 1SGFG 1E37B 2R3YA 7GCHG 3P17H 1HAHH 4KELA 3LH3A 2BX4A 1DWEH 2A32A 2PKSC 1UMAH 4U2WA 1DS2E 1O37A 3I77A 2G8TA 4CBOA 2Y5GA 4FUDA 1ARBA 4AG2A 1SFQB 4X2YA 1IQIA 3V0XA 3NCLA 1BOQA 1SLXB 1NRQH 1TBQH 3JZ1B 2H1UA 2FOBA 5C20A 1UTJA 3GS9A 1CU1A 1ZJDA 2WZQA 4Y0ZE 4DT7B 1NFWA 1HXFH 1BT7A 3C27B 1BRAA 3BTHE 1TPAE 2V35A 3P95A 1ZHMA 1YPLH 3RXFA 4AFZA 3RXVA 3RMOH 1EKBB 1AZZA 1L2EA 2SGEE 4MPUA 2C8XB 1DOJA 3ELAH 1NESE 3WWFA 1DPOA 1A0HB 1G36A 1GDQA 3SZNA 2GMTC 1NPMA 2F9VA 1Z7KA 1THSH 3ZZCA 3UNRA 2WPMS 1O36A 2FP7B 5GXPA 5GDSH 1GI2A 2CXVA 3ENSB 3S9BA 3GYMA 1MCVA 1P03A 2W3KA 2H2ZA 3WY8A 1AHTH 1COWD 1ETTH 1GBMA 2BLVA 1ZSKA 2KCYA 3DA9B 3OTJE 1MTUA 5A09A 5DP5A 5L30H 2JH0D 1GI8B 1CBWB 1KYNA 4BAHB 4XSKU 4GCHF 4Q63A 1OXGA 2A0QB 1C1OA 1P05A 3FZZA 3P8GA 4K5ZA 2J98A 3RXHA 2VH0A 1CA0B 1SMFE 1JRTA 2C3SA 3L33A 2W26A 1BTHH 4ZKRU 4QT8C 4YLUA 3H7TA 1YKTA 5EPNA 3FN8A 4IC5A 3LIWA 2GZ7A 1BJUA 1W0ZU 5CMXH 4Y0YE 3LH1A 1BTPA 3PO1B 5A0BA 3RXEA 1C5UA 1O5DH 1EZQA 2V7QD 5FCRA 2ZDLA 4UFDH 6GCHG 1DLKB 1KTSB 1TALA 1P12E 1THRH 3PWBA 1TRMA 2G00A 2BDGA 1ABIH 3H09A 1RRKA 3RXBA 2G51A 3QGJA 1EXFA 1T31A 3T2NA 2H9HA 7KMEH 4XD7D 2Z9GA 2BOKA 1H8IH 2Z7FE 1QHRB 2XYAA 2FEQH 2QE7D 2VIVA 4IGDA 2C93B 3B8JA 1OWDA 1LQEA 1TQ0B 3K6YA 5A2MH 1VCQA 3MO9A 4HZHA 4IMQA 4K1TA 1O3FA 3LDXH 1CSOE 3RXTA 3QWCH 3MH5A 2R0LA 4KKDA 1P01A 3T62A 3IWMA 1N8OB 4CRGA 1YF4A 4NIVA 1C2LA 4CRFA 4X0WU 4AG1A 3KF2A 5C17A 3MQKC 1SLWB 3GDSA 1O2ZA 2FM2A 2PKAB 4TSFD 1DM4B 1TA2A 3T5FH 2FWWA 2OC1A 5C1UA 2NU2E 2BB4A 1Y5BT 3NXPA 2ZU1A 1C2HA 3PMHB 1CQQA 3A84A 2JDID 1SKYE 2DE9A 1A5GH 2J34A 3OFND 1B0FA 1ANBA 1LHDH 3NRLA 2NU3E 2Y6TA 3LONA 3DSPA 5IK2D 1HCGA 5L2YH 4OS6A 4DURA 2ANKH 4NFFA 4X1NU 4MNWA 3P6ZB 4E05H 1YY3A 1L1JA 1GI0A 1BIOA 1EFRD 1EB2A 1TGTA 3BF6H 2GVFA 1C5QA 5PTPA 1MKWH 1GG6C 5DP3A 3TJUA 4A6LA 1O34A 4WWYA 5JPMH 2IJOB 3A8CA 5EJ1A 2W6JD 2BVSH 1Y59T 1PPCE 1OPHB 2FESH 3IG6B 4NIWA 4GVUA 2R9PA 2A31A 5LPFA 1MU8B 1C5MD 3M37A 2G5VA 1S0RA 7GCHF 3FZDA 3A82A 1UHBB 4ABBA 2GJGA 3STIA 2YMSD 2FLRH 1UVUH 2P93A 1KTTB 3OAAD 1UTKA 1NU9A 2P59A 3VXFH 2A7CA 2ULLA 1TMBH 1W2KH 1S6FA 4ZROA 4YXWD 2ESTE 1MTNB 3BTFE 2XCFA 1HAVA 4UFGH 4IN1A 2YMSB 3GCHC 3BTQE 4NSVA 2O8UA 3F2FA 4FXGH 1QRWA 1GBTA 4K1SA 3LGYA 1XUKA 1AMHA 4P00A 3OE7D 1LKBA 2HVXA 5HIZA 1TE0A 4GLYA 4BTTB 5A8XA 2Z3EA 2Z94A 5DP8A 2W6ID 2J92A 3MYWA 1SHHB 2A2QH 1DWBH 1U6QA 2HRVA 4JZDH 2WINI 2D2DA 5F53A 4AYYB 1BMLA 2OC7A 2R2MB 3BSQA 1K1JA 3K65B 4TT3D 3AVZA 1VGCC 1PPEE 4OGYA 2P8OC 1ELGA 1HAPH 2H9EH 3SJIA 4O3UA 1DUAA 5HMAA 3TGKE 4SGBE 4PROA 1LVYA 2PUQH 1K0HA 4XFQA 1AVWA 5BPEA 1RIWB 3VB6A 2NWNA 1TWXB 1F5RA 3TK5A 3URDA 1K1IA 2OUAA 4I8LA 5KEDA 1MD8A 1ID5H 2IPQX 4K8YA 3M3SA 1UVSH 3P92A 5K0HA 1OS8A 1TGNA 3MI4A 1C4U2 3P70B 4GAWA 5CHAB 3RXAA 2QN5T 4RSPA 3SGAE 3OYPA 2FODA 4NA9H 3N99A 2P16A 2GD4B 1LVOA 1O3IA 4LK4A 3UREA 1K22H 3UNSA 1QBOA 3EYDA 1TOMH 1ETRH 3RXSA 4YT7H 4YM9A 1GHVH 3DCLA 3F3BA 1GBBA 2VH6A 3M3VA 4BXWA 1FPCH 1AUTC 1HGTH 1G37A 1MMJN 2Z3CA 5CHBA 1G3CA 2EI6A 4Y11E 1E0FD 2EA3A 2PHBA 5E2PA 4CHAB 2FOMB 1ELAA 3UQVA 1SGFA 3E0NB 1SB1H 3MH4A 1YLDA 4HFPB 3SU2A 4F48B 6LPRA 1QR3E 2HNTE 4LZ4B 4UD9H 2OINA 1UVTH 3ZVBA 5AVDA 1UK4A 4ZH8A 3HGNA 1FZZA 4DCDA 1WQSA 2BQ6B 2RA0A 4B73A 1H9LB 1OHHD 2O8WA 3GCNA 4H42U 1MBMA 2LNCA 4HGCA 6GCHF 3NUMA 1P2JA 4WF8A 5EXMA 2QF4A 8LPRA 2HGTH 5DKMA 2Y7XA 3OU0A 4ZMAH 3SQHE 2EEKA 4GSOA 3TITA 1ARCA 1K9OE 1H4WA 2AMPA 3PWCA 3TPIZ 3ZVFA 5IDKA 1SQTA 3UQOA 3DSOA 2HPQH 2VNTA 1G3EA 3MU4A 1RXPA 2F4LA 1GMCG 1ZJKA 2FOCA 4ABHA 1N6XA 1HYLA 2G4TA 3OTPA 4ISNA 1YWUA 4X6OA 3EE0B 4GUXA 1NY22 1P02A 2JJ1D 2ZECA 3F6UH 4X8UH 1H8ED 3EA9A 3DT0H 2IJD1 1QB6A 1AVXA 1V2PT 1ESAA 2BY7X 1JOUB 3V13A 3LJOA 4D76A 2XWBI 1Y3XA 1NTPA 1A4WH 1GMDG 3TLOA 1AZ8A 4LXBH 1XUJA 2FS8A 4UONA 4B6FA 1EJNA 1A5HA 4FETA 1GJ4H 1A61H 3U8RH 3LGIA 2XW9A 2G5NA 1BITA 1AUJA 4X1SU 5KGOA 4A1VA 3ZZ8A 5L6NH 2FIRH 3WW7A 1KMHB 1JIMA 1E36B 1T4UH 1V2VT 2CV3A 1JIRA 1GGDC 1SLVB 3BTGE 3VB4A 3PLKA 1KDQB 3BG4C 1QJ6B 1ANEA 3A81A 2ZCHP 1IHTH 1KXDA 1O2OA 1PQ5A 2ZIQH 1V2JT 1VCWA 4ABIA 2AIQA 5HXFA 2ZTYA 5A8ZA 3RXGA 5C94A 3VB3A 2BY5X 8GCHG 1HDTH 1NRRH 5C67A 5AF9H 1BMNH 1WDIA 3RDZA 1TQ7B 2QF3A 3RLWH 2OD3B 2OC0A 2BY8X 1IQGA 1QB1A 4ACAA 4YO9A 3H7OA 3UUZA 1HAGE 1UTOA 3TVJB 1GDUA 3UR6A 3T27A 4HG6A 1MKXH 1QURH 1WTHD 3LOXA 7LPRA 1BBRH 4X2VA 4RT0A 3TH4H 3VB5A 1P8VC 3PM3A 4TPIZ 4FVBA 4NA7A 4ZXYH 1WBGB 3PRDA 1BMAA 4AGJA 3VFEA 4NIYA 1O3EA 2NU4E 2FX4A 2ZHFH 3RXUA 2GP9B 4AC9A 2TGPZ 5C0TA 4I31A 2B0FA 1W3CA 2BDBA 2RA3A 1CHOG 2QXJA 3A80A 5JBCS 3RXJA 1C5XB 1NN6A 3A7TA 2ZGXH 2CK3D 4Y6DA 3A7YA 1EPTA 2Y80A 2EQNA 3S7HB 1J14A 1LPGB 1O35A 1P3CA 2Y82A 2ZU5A 1TNIA 4D7FA 3R0FA 2WV9A 4MQAA 1VJAU 3ZV8A 1QTFA 5E0GA 8ESTE 1WAYB 2UWOA 2ZCKP 2OP9A 3KCGH 3SZEA 1T8OA 1H9HE 1IAUA 1BZXE 1YPJH 4WMEA 3A85A 1P0SH 2GV7A 4B71A 2B8OH 4Q7XA 5C2ZA 1C2FA 2Y5HA 3DD2H 1P3EA 1GHBG 2FOFA 4WH8A 1JMOH 1DSTA 2OXSA 1Y8TA 3SW2B 1WUNH 5GCHG 1FQ3A 1T32A 3PROA 1QBVH 5ETXA 2JH5D 2K0QA 3MNBA 3F0PA 2OTVA 2FOGA 2GCTC 1PFXC 2FI4E 3RXRA 2PTCE 1QL9A 1ABJH 3HPTB 5TCCA 4NG9H 1O3MA 4I86A 6CHAB 1YC0A 2V3HH 1NBME 1B5GH 1SQOA 3NK8A 2WV5A 5ABWA 2YOLA 1MCTA 4X1PU 2UUYA 3RU4T 2PTNA 3L6PA 2KCPA 4Y71A 2J4IA 4Q80A 2M5TA 3MU0A 3M5MA 3MTYA 4JYTA 3RP2A 4WY3A 4M7GA 1NM6A 4D8NA 1O2WA 1S82A 5FPYA 3GICB 3VG8A 3SORA 3FP8E 1Z6EA 1ORFA 4UFFH 3GY7A 3KYFA 4ISHH 3OX7U 2CGAA 5E0JA 2G52A 2ZP0H 3ZV9A 1PJPA 2QF0A 3HK6B 2PP6A 1G2LA 2OQ5A 1UK2A 1ELVA 4LOYH 4DVAU 3Q00A 1XVOA 1HLTH 2K1QA 1HAZB 2Z9IA 2ZGBH 2KAIB 3BEUA 3RXOA 4X6PA 5LPEA 1SGEE 1O5FH 1XM1A 1W0YH 3P8NA 1P11E 1HJAC 2QA9E 4TYDA 4U30A 3SI3H 3TH2H 5LGOA 2QXHA 5GJ4B 2PKSB 1K2I1 4DY7B 4WH6A 1GMCF 5EW2H 1C4Y2 4MLFB 2XBVA 2O8MA 1UTPA 2HPPH 4KTCA 1K1NA 1O2NA 4X1QU 3V7TA 2BDAA 1L4ZA 1JBUH 3LPRA 2BY6X 1TRNA 4O03A 1GHZA 1TX7A 1C2IA 1V2OT 1C5OH 2JKHA 3EDXB 4JMYA 4ABFA 1C1UH 1YCPH 1ZSJA 1ESBA 1V2TT 3ATKA 1EOJA 1TPOA 1EPTC 1ESTA 1GMDF 4A1XA 1HV7A 1OWEA 4AFQA 3I78A 2QAAA 4BAMB 1QZ8A 1B0EA 1RTFB 4DG4A 1NFUA 2BTCE 1OP8A 2ZHDA 4JYUH 2GMTB 2UUKB 4MDSA 1EX3A 1MAYA 1MQ6A 4XE4A 1C2MA 1GI4A 2F3CE 1O2PA 3KQCA 1V2LT 1SGNE 3AAVA 2FMJA 3A7ZA 3CS7A 3GCTG 3O8BA 1MABB 1UCYE 5A8YA 3I29A 4I8GA 4F55A 3KQBA 3TGJE 4IW4E 1YPHE 1ZRKA 1OWKA 2JIZD 1UK3A 3RXDA 3SN8A 2BD5A 2AIPA 8GCHF 2FPZA 3SUEA 2I6SA 4XBCA 1ACBE 1C2EA 4FOUC 1C1TA 1FX0B 1HAIH 2VWLA 1HRTH 3E1XB 3M7UA 3STJA 2TGDA 3UPEA 2BVXH 1O2QA 5DK1A 1G2MA 3ZVDA 3BTEE 5G4BA 1GJ6A 4DIIH 1DX5M 2WPLS 2STBE 3FAOA 1KLIH 2AH4X 2AYWA 1C5YB 2XC0A 1F7ZA 2ZDVH 3BV9B 2F91A 1HAYB 2C8ZB 1LHGH 3TIUA 1CT2E 1EZUC 1LHFH 2V3OH 3SNBA 3SNAA 1W11U 1Z8GA 1DY9A 3M3TA 1LVBA 1DT2A 1YP9A 1C4V2 2PFEA 1AFQC 1OYQA 1W7GH 4O3TA 1UCYH 1SVPA 3U1JB 2OQUA 1CHOF 1O3KA 2JJ2D 1WU1A 2ODPA 1MKWK 1PPZA 4CBNA 1LHCH 2ZZUH 1QL7A 3A7XA 3F0OA 2HALA 1BA8B 1J9CH 3RC5A 2PLXA 5EXLA 3ZZAA 1QB9A 3SNCA 2W3IA 3KN2A 1NBMD 5AHGH 2R0KA 1HIAA 5SGAE 2ANWA 3A7WA 3MFJA 2A5KA 3DFJA 1H1BA 5DO4H 1FIWA 3SHAH 2ALPA 3OEED 5EOKA 4FUBA 1W14U 4B76A 4YESB 5EIYA 3OEHD 1UHBA 1P9UA 2AS9A 4A92A 3RM0H 1SHYA 4YLQH 1YPMH 2BMGB 3HKIB 4NGAH 3AW0A 4AX9H 2ANMH 1GHBF 2FOEA 2GV6A 2BD2A 3MH6A 2OLGA 3SV2H 1GVLA 1AVGH 5LPRA 1ZGIA 4Z6AH 3QZRA 3F1SB 1RS0A 1VCPA 1FAXA 3QLPH 1UTMA 1AGJA 1GMHG 1J17T 1C5LH 4WJG2 3UY9A 4ZHAA 3TJVA 2Y7ZA 2SGPE 2SGFE 1TGSZ 1C1QA 4AZ2B 2V3MA 4RT1A 2UUFB 3G01A 4F4OC 1DSUA 2Q1JA 5FX5A 4DIHH 1WYKA 2ZU3A 4NZLA 2ZDNA 3PV2A 1C1MA 3ODDA 5FXLA 1G32B 4B2CA 1NFYA 2ZGJA 1Q2WA 1G30B 1KXEA 1XXDA 3T28A 1GBDA 1OWHA 2A5AA 3DFLA 3SJOA 3UWIA 1TGCA 1ZZZA 2VWNA 1FY8E 1FN6A 4NWLA 5DP7A 3LT3A 5C1XA 4RN6A 1GCTC 1GJDB 1V2UT 4DT4A 2JETC 5TJXA 1GG6B 3M7QA 4O97A 4YZUA 1TONA 1AE8H 3QTOH 4JK5A 5CE1A 4X2XA 5HIYA 3ZVCA 2J98B 4THNH 1SGCA 1FI8A 2F9BH 3KGPA 2O8LA 1S83A 1FJSA 2Q6DA 1AQ7A 1QA7A 2ZCLP 4MVNA 3ZVAA 1RGQA 1ZR0A 3LJJA 9ESTA 1A3EH 2VGCC 3T29A 1F0SA 1VKYA 1UO6A 3AK5A 1SR5C 4OM9A 2DE8A 3QTVH 3S9CA 1YCPM 3DUXH 4NA8A 2FI3E 4DGJA 1XKBC 1ZOMA 2FLBH 1AIXH 2XBXA 1IQJA 4ABJA 2F43B 3GCHB 2BLQA 1XUGA 5T6DA 1TB6H 1UJ1A 1HBTH 2XBYA 2C8YB 2QGRA 1W13U 2J38A 5EQRA 1O2KA 2TGAA 4YOIA 3N7OA 5EXNA 1NRNH 3BN9A 2AERH 3GY6A 3UR9A 4B6EA 1P57B 1QL8A 4RI0A 3RLYH 1SGTA 1GBEA 1VGCB 2P8OB 1NRPH 3GDUA 3RMLH 1G3DA 2VIDA 3SUDA 4A7IB 2ZDAH 3TNTA 1MTSA 3VGCC 3SU6A 5ESTE 1D6RA 2ANYA 5FX6A 4Q4LA 1PYTC 2Z9JA 4Y8ZA 1SI5H 2A45B 1QY6A 1CT4E 1J15A 2VWOA 2UWLA 2CMYA 4RKJB 4WMFA 3WWBA 4FUEA 4MNVA 4DOQA 1QA0A 3HATH 1A0LA 4X8SH 3ZYDA 3D65E 3GCTF 2RCEA 4SGAE 1T8NA 4X6NA 5FBIA 1RJXB 1O32A 1DICA 1Z6JH 2ODYB 1MU6B 2CF9H 4R0IA 1KSNA 3FOAA 5TCAA 1BHXF 1GBKA 5EQSA 4Z1MD 3SV8A 4X2WA 1SQAA 1TMTH 2KFWA 1FPHH 4X6MA 1BTUA 1J8AA 2A4QA 1ZTKA 4U01A 5EQQA 5DP9A 3U8OH 1BTYA 1BMFD 1SGYE 1UW7A 2AMDA 3A87A 3SU1A 1Y3UA 1QQUA 3RUOA 1BRCE 3KQ5A 2QXGA 3UB0A 2TBSA 3Q3XA 1LKAA 4P02A 1O3GA 1PQAA 2YNBA 7ESTE 3A83A 3KL6A 2NU0E 3BEFB 3ZYEA 1YLNA 1BDAA 2GZ8A 1GJCB 2HNTF 1AY6H 2QXIA 4AB9A 2XWAA 1Z71A 1ELBA 2G55A 3QX5H 2ZG0H 1O38A 3V12A 1PPHE 4WMDA 3KQDA 5FBEA 4ISLA 5DG6A 1L0ZA 1GBLA 3GDVA 4FUHA 1HAOH 2Z6BD 3PLPA 1BTXA 1SSXA 1YGCH 1MTWA 2WYGA 2ZHEH 1BCUH 4ASHA 1W8BH 3GOVB 5HKKD 2KR7A 3LGWA 1F2SE 4CRBA 1O5CB 1SQRA 5JBBS 2J9NA 5B6OA 1BBRK 1Y3WA 1HAXB 2ZU4A 1INCA 4K60A 1HAVB 1TNJA 1SGRE 2XRCA 1CGJE 2EI8A 2PUXB 4Y7BA 3U28C 1N1LA 2RG3A 1P2IA 2BY9X 1UTNA 1QRZA 2FTMA 4I32A 2BD9A 3RU4E 4O9VA 3QDZB 2FS9A 4K8BA 1DE7H 3SV9A 4I7YH 4ZKSU 1IQKA 1B7XB 2SGAA 1GMHF 5T1VA 2J97A 5A0CA 1GGDB 4FUIA 1HB0B 1BMMH 2GZ9A 5DP4A 3BG4B 1GPZA 1QNJA 1WCZA 3E0PB 1C1VH 1GJ5H 3CS0A 4AORA 3EQ0H 3HKJB 1P2NA 2FI5E 1EAUA 2BD3A 2ZQ2A 3ZVEA 1C1RA 1TPSA 5T3HA 2ZTZA 3A8DA 1AN1E 1GJ8B 3T26A 4TWYA 4Y79A 1O3CA 2QF5A 1EUFA 1SPJA 1L4DA 1C1PA 2VB0A 2XNIA 1WQVH 4K1EA 4B1TA 3F9FA 1ZMNA 1AFEH 2J2UA 3PRBA 1OX1A 5F03A 4UEHH 2GTBA 2L6OA 1F5KU 2FXRA 3MU5A 2P3TB 2B5TB 2ZGHA 4INLA 3RXIA 1AE5A 2DUCA 1QIXB 2QYIA 3HGPA 3MHWU 1L1NA 4I8JA 3LGTA 4MPVA 1EASA 3PV5A 3OY5U 1SC8U 3M5NA 1ANDA 3MO6A 4IS5A 2HLCA 1HPGA 1GL1A 2EY4C 5JBTA 1GI3A 1L1GA 1UTQA 2OBQA 1IQHA 4H4FA 3H5CB 1V6DA 2ZPSA 4XDEA 4XOJA 4Y10E 5ESBA 2H5DA 3SNDA 5EG4A 2HOBA 4YOGA 2W5EA 5DGJA 5LH8A 4IMZA 2HLDD 4E06H 3GY4A 1GBHA 3U98H 4YT6H 4JZEH 4X8VH 4FUJA 1GJ9B 1LPZB 1GBCA 1EAIA 1GDNA 3F9EA 4ZAEA 1O3PB 1GHAG 1ZHRA 3SO3A 1JRSA 2A4GA 1K1PA 3PMAB 1TBZH 2ZFTA 4A1TA 2VIWA 1C5WB 1C2GA 4GPGA 1P04A 3LGVA 1MAXA 1C5VA 3O8RA 4INKA 3NPSA 3SJ8A 1C5ZB 4ZXXH 2C4FH 5F8XA 1AWHB 1FY3A 1O3AA 1ELCA 2VVCA 1YCPK 2THFB 2GCTB 3GCOA 1PPBH 2Z9KA 1D4PB 1AI8H 1A3BH 1GJBB 3RXKA 2Y5FA 1BUIA 2ZDMA 4VGCC 1ZHPA 4Y8XA 3UWJH 3N7DA 1SLUB 3R3GB 4KGAA 4R8TB 4Q7ZA 2BX3A 2BQ7B 1DXPA
chains in the Genus database with same CATH topology
2BXUH 1S0QA 3LGUA 2SGDE 3UTUH 3ZVGA 2PV9B 3FANA 1D3PB 1ANCA 1Y3VA 2GKVE 1T8MA 4UFEH 2O8TA 1NT1A 1C5SA 3BTTE 3DHKH 2D1JA 2SNVA 1GL0E 1OKXA 1IOEA 3RC4A 2WUBA 4FVDA 1PPGE 1YPEH 3SQEE 2P3UB 5J4SA 1VJ9U 1JWTA 3MU1A 3RU4D 1QFKH 3RMMH 4U32A 1FONA 2HNTC 1CVWH 1VITH 1T7CA 4ISIH 1GI1A 1ZTLA 2XBWA 1MQ5A 3RMNH 1O3OA 1S85A 2VJ1A 3P8OA 4NZQA 1GCDA 1HJAB 1WTGH 5JDUB 2PSXA 1S5SA 1SBWA 4GHQA 1TAWA 4FUCA 3Q3KA 3M5LA 3ATWA 5EU8A 1RFNA 1GBFA 1Y3YA 1MZAA 2ZFRH 1K1LA 1K1OA 3K9XB 2QCYA 4E7NA 1LO6A 4AGKA 1QJ7B 2O9QA 1Z1IA 3ATMA 1V2RT 4BOHA 2ZFFH 2CJIA 1EATA 2BLOA 3MNSA 3O8CA 3UIRA 1UCYK 2WPIS 3URCA 1EPTB 1AO5A 4MNYA 2A4OA 1EAXA 2A7HA 1NRSH 1C2DA 4ZKOU 1AKSB 2ZFQH 3RXMA 1H8DH 3VB7A 1O3LA 5C5NA 1ETSH 1C5TA 2UUJB 5I25A 3A8BA 4CH2B 4FUGA 1NO9H 3SNEA 4I33A 1DLEA 1TLDA 1AWFH 4K3JA 1P2KA 1DANH 2CF8H 1O2IA 1MTVA 4IBLH 1WV7H 2V0BA 4X8TH 4K69A 2BDYA 1A7SA 1GJ7B 3GY3A 4CRCA 2GCHG 5I46H 4H6SB 1K1MA 2BDCA 1Z8IB 3FP7E 4BAKB 1GWAA 1N6YA 2GT8A 2ZHWH 1P09A 4XBDA 5IYTA 1QCPA 2PGQB 3LKWA 1ZMJA 3ITIA 4Q7YA 1THPB 3MNXA 4D9RA 1YPGH 1UTLM 3SBKA 1RD3B 2SGQE 2BD8A 3F9HA 2Z9LA 4A5TS 1V2ST 2I6QA 3PMBB 4OS1A 4E7RG 2XTTB 5T6GA 1PQ8A 1SGDE 1RTKA 2ODQA 1PPFE 2GDDA 1TX6A 5FCKA 1FXYA 3SHCH 3MWIU 4DJZB 3MO3A 1TA6A 3SGBE 1TFXA 2ZTXA 2PKAA 1F5LA 1EJAA 2BZAA 2QV1A 3E6PH 4NCYA 4D7GA 1FY5A 1A0JA 4MPWA 2IOTA 2F9PA 3F68H 2WUCA 1BJVA 3GY8A 1AFQB 1M9UA 2FO9A 2ZU2A 3A89A 2PR3A 4ZKNU 2STAE 1OWJA 1O5BB 1J16A 1FLEE 1C9TA 2GGVB 1IQMA 1CGIE 1O5EH 1SOTA 1AD8H 1GJAB 4OS7A 3KQEA 5F8ZA 2FOAA 3PB1E 3TGIE 1GHAF 1CBWC 5DJ7A 1D3QB 1O2VA 2W7SA 2BDHA 2B9LA 2IN2A 1C1SA 1DVAH 2WPHS 2ASUB 1W12U 4HTCH 1FDPA 1FNIA 1OWIA 4ISOA 1CA0C 3EA7A 4FUFA 4TWWA 1CGHA 1NU7B 4H6TA 3SU3A 4MG3A 5K7RA 5HYOA 4OS4A 1AU8A 2ALVA 3PO1C 1EJMA 1TPPA 2EI7A 2AFQB 2ZI2H 5JBAS 4X1RU 3ZZBA 1CA8B 1T8LA 5GCHF 3SUFA 1E35B 1TNGA 2JH6D 2W7UA 1HJ9A 3ATLA 2QIQA 3U69H 1TOCB 3PMJA 3TJOA 4XBBA 4BAOB 1C2KA 5HM2A 2YNAA 1UVPA 1Z8RA 1PQ7A 2ZQ1A 3F9GA 1E34B 2H5CA 4AN7A 1K28D 3BG8A 3TK6A 5L2ZH 1LPKB 1C1NA 1JXPA 3A8AA 3AASA 3EA8A 1O3JA 4FU8A 3SV7A 4ABGA 1K21H 2ZEBA 2ZPQA 5GPIB 1O2HA 2Y81A 3BTDE 4AB8A 4MTBA 1TABE 1GCTB 1DFPA 1IQNA 2JETB 1TIOA 2UWPA 3T25A 3PLBA 1DITH 3PTNA 4NWKA 2ZC9H 1MZDA 3AAUA 3VPKA 2F9OA 1HUTH 4B2AA 4RKOB 3QGNB 2F9NA 1XMNB 3TU7H 1N8OC 1XX9A 3ZZ9A 3S9AA 3MNCA 3PV4A 4KP0A 2VGCB 5C5OA 1V2WT 2VIOA 2ZF0H 2PGBB 1H9IE 4F49A 2SNWA 1C1WH 3W95A 4D9QA 3ZZ4A 4ZHLU 3GYLB 1YM0A 1SFIA 2BVRH 2R3UA 2FX6A 3Q77A 2ZFSA 1O2TA 2XC4A 2RDLA 3PYHA 4Q2KA 5EGMA 2WV4A 2BOHB 2TGTA 1LDTT 5DP6A 3IITA 1O2SA 2XC5A 1A1RA 3BIUH 1O3BA 4TY7A 3LC5A 1FY4A 1P2MA 1O3NA 1ELDE 1V2MT 1P10A 1OOKB 3FVFB 1FY1A 3SI4H 4CREA 4AOQA 1GI6A 1XVMA 1QJ1B 1HIAB 1GBJA 5T6FA 1V3XA 4FU7A 3W94A 3UNQA 4BANB 3P8FA 1PYTD 3M35A 2EC9H 1GI9B 1BQYA 2P94A 2D26C 4J2YB 3VGCB 1LCYA 1QQ4A 1W10U 3D23A 1HNEE 4AFUA 1EOLA 2AGIX 3MMGA 1C5NH 2ZDKA 4AFSA 2WYJA 3GY2A 3U9AH 2CN0H 4OS2A 1ZLRA 3D62A 4WXVA 3QK1A 1TYNA 3E8LA 5FPTA 2VINA 3MOCA 2VIQA 3B23B 3ZZ7A 5JYIA 1O2RA 1EQ9A 1QBNA 1LVMA 4ESTE 3VXEH 1VITG 1BTWA 2GCHF 2OBOA 2AGEX 2P3FH 3RC6A 5AFYH 3GY5A 1MTNC 3B9FH 1O2GH 1EP6A 2GT7A 1O2JA 1MBQA 1GVKB 1XUIA 1YPHC 1CE5A 1MUEB 1GI5A 1C9PA 1F0TA 1ZYOA 1YPKH 2ZO3H 3SJKA 4CR5A 1XUHA 2J94A 2FTLE 2BDIA 3U8TH 3E90B 3BIVH 5JB9S 3CP7A 1O2UA 4CH8B 1LHEH 4CR9A 3QN7A 3MH7A 2A7JA 1BRUP 1O2LA 1O0DH 2V6NA 4KTUA 4ABAA 2FYRA 1KXBA 4ABEA 1EZXC 1C5PA 1O2XA 3RM2H 4I8KA 4JZ1A 3BTKE 4ABDA 1AB9B 1KDQA 2NU1E 4MNXA 1RIWC 2A2XH 4CRDA 1DUEA 3NKKA 2VU8E 4BNRA 1GBAA 2AEIH 1V2KT 4BTIB 3KIDU 2B7DH 2XXLA 1AB9C 1IQFA 3LC3A 5CHAC 3OSYA 2A4RA 2IPHA 3UOUA 5E2OA 1Z1JA 1VR1H 1G3BA 5FPSA 2PSYA 3V3MA 4B74A 5FHTA 1NROH 1ZMLA 2ILNA 5E8EH 3TNSA 3ZZ6A 2BZ6H 1LMWB 1TBRH 1EAWA 1MKXK 2BXTH 1S6HA 4YTAA 3SU4A 1TNHA 1O3HA 1SG8B 1GHYH 4CHAC 2H6MA 4WVPE 1C5RA 4WXIA 2TRMA 1YLCA 3E16B 2ZPRA 2Z3DA 1DWCH 1EP5A 1F0RA 4OGXA 4NFEA 1P06A 1ZRBA 2A5IA 1O31A 4ZUHA 3M7TA 3ZZ3A 1Y5UT 1SOZA 2F9UA 1MH0A 4Z0KA 1YYY1 1IHSH 1D9IA 3CENA 2FZZA 2CHAB 3BTME 1A2CH 1MD7A 4ZHMU 3UOPA 2ZA5A 3C1KA 5EW1H 3EAJA 2QY0B 1TX8A 2G4UA 5E0HA 4JCNA 1QGFA 1S84A 3Q3YA 1LQDB 1DY8A 2CHAC 3SOSA 1F92A 1ELFA 1HXEH 1ZPCA 3MU8A 3E3TA 2WPKS 1XUFA 1NC6A 5C3NA 4BAQB 1EB1H 4MPXA 2QC2A 3A7VA 3TK9A 3A88A 1CT0E 1O2MA 2GDEH 5H4IB 3TH3H 1O3DA 5BRRE 1KXFA 1TMUH 1LTOA 3SV6A 1BBRE 1A46H 2F83A 2OCVB 4GHTA 1GVZA 1FV9A 3S0NA 4JYVH 3OY6U 1FIZA 3BEIB 5EODA 1FUJA 4IC6A 3VEQB 4LZ1H 3D49H 3S69A 1Z8JB 3ODFA 5EPYA 2H9TH 3M36A 5JB8S 1ZTJA 5DPAA 3TJNA 3PTBA 1A5IA 1VZQH 1Q31A 3RXPA 4TPYA 3UFAA 1RTLA 2BLWA 1GBIA 1KY9A 1P2QA 1W7XH 2XCNA 4BXSA 2BYAX 3L3TA 4B2BA 4YOJA 1ELEE 1SGPE 3EGKH 3NWUA 2WPJS 5AFZH 3FP6E 4GCHG 3SGQE 1OSSA 1NS3A 1TRYA 1C2JA 4UDWH 2C8WB 2OC8A 3M5OA 2ZWLH 2PWXA 4HI3A 1KXAA 4Y8YA 2KAIA 1G9IE 1DXWA 2GX4A 3QZQA 5HM9A 2BM2A 2LPRA 1IQLA 1ZGVA 3ZZDA 1F0UA 5GWZA 6ESTA 2BQWB 1UVOA 1VITF 5C1YA 5FAHA 1ZPBA 2TIOA 2VVVA 1OP0A 4VGCB 2Q6FA 2D8WA 2ZGCA 1E38B 1O5AB 1SGQE 1Y5AT 2C90B 3KEEA 3NZIA 1GHWH 1BHXB 1BRBE 4J1YA 2ZFPH 3SUGA 1AKSA 1CHGA 5F8TA 1D3DB 1O33A 3KNXA 3KHVA 8KME2 4I8HA 2AMQA 3M61U 1FMGA 1SL3A 1O2YA 4NIXA 1OYTH 1DDJA 5J4QA 3A86A 2BHGA 1YBWA 1ZPZA 1CO7E 1D3TB 1TNLA 3RXCA 3E91A 4OS5A 3Q76A 4JZFH 1TGBA 1IQEA 1Q3XA 5F6MA 1GI7B 3SU0A 3QO6A 3ZZ5A 1V2NT 4AYVB 1O30A 1OP2A 2PW8H 3FFGA 2ZNKH 4INHA 4KTSA 1BB0B 5A0AE 1O39A 4JZIA 5GIBA 1SGIB 4Y7AA 3SJ9A 1QRXA 4BTUB 4Y76A 2HWLB 1BTZA 9LPRA 1V2QT 4CRAA 1S81A 3O8DA 1NZQH 1KLTA 2ZHQH 3ATIA 3BTWE 3GISB 1P2OA 1D6WA 3QUMP 3SU5A 5HGGA 1WOFA 1FN8A 2SFAA 1T4VH 4FU9A 4K2YA 4NSYA 2AGGX 1P9SA 4UE7H 1XXFA 2VIPA 3K2UA 1KLJH 1KIGH 1DWDH 2FOHA 2BD4A 6CHAC 2BD7A 2G81E 1HJ8A 2A1DB 4JK6A 3K6ZA 1HFDA 2FDAA 4IN2A 1FAKH 4DW2U 4B75A 1O5GH 2Q6GA 1GHXH 2VVUA 1NFXA 2FYQA 4TY6A 1TNKA 3ESTA 2P95A 2TPIZ 3AW1A 3U1IB 1ELTA 1EZSC 3HK3B 1KXCA 2VWMA 3RXQA 2J95A 3JZ2B 1XKAC 3S7KB 1ZSLA 3RXLA 2ZKSA 2R2WU 3LU9B 1X7AC 1WSSH 1SGFG 1E37B 2R3YA 7GCHG 3P17H 1HAHH 4KELA 3LH3A 2BX4A 1DWEH 2A32A 2PKSC 1UMAH 4U2WA 1DS2E 1O37A 3I77A 2G8TA 4CBOA 2Y5GA 4FUDA 1ARBA 4AG2A 1SFQB 4X2YA 1IQIA 3V0XA 3NCLA 1BOQA 1SLXB 1NRQH 1TBQH 3JZ1B 2H1UA 2FOBA 5C20A 1UTJA 1CU1A 1ZJDA 4Y0ZE 4DT7B 1NFWA 1HXFH 1BT7A 3C27B 1BRAA 3BTHE 1TPAE 2V35A 3P95A 1ZHMA 1YPLH 3RXFA 4AFZA 3RXVA 3RMOH 1EKBB 1AZZA 1L2EA 2SGEE 4MPUA 2C8XB 1DOJA 3ELAH 1NESE 1DPOA 1A0HB 1G36A 1GDQA 3SZNA 2GMTC 1NPMA 2F9VA 1Z7KA 1THSH 3ZZCA 3UNRA 2WPMS 1O36A 2FP7B 5GXPA 5GDSH 1GI2A 2CXVA 3ENSB 3S9BA 3GYMA 1MCVA 1P03A 2W3KA 2H2ZA 3WY8A 1AHTH 1ETTH 1GBMA 2BLVA 1ZSKA 3DA9B 3OTJE 1MTUA 5A09A 5DP5A 5L30H 2JH0D 1GI8B 1CBWB 1KYNA 4BAHB 4XSKU 4GCHF 1OXGA 2A0QB 1C1OA 1P05A 3FZZA 3P8GA 4K5ZA 3RXHA 2VH0A 1CA0B 1SMFE 1JRTA 2C3SA 3L33A 2W26A 1BTHH 4ZKRU 4QT8C 4YLUA 3H7TA 1YKTA 5EPNA 4IC5A 3LIWA 2GZ7A 1BJUA 1W0ZU 5CMXH 4Y0YE 3LH1A 1BTPA 3PO1B 5A0BA 3RXEA 1C5UA 1O5DH 1EZQA 5FCRA 2ZDLA 4UFDH 6GCHG 1DLKB 1KTSB 1TALA 1P12E 1THRH 3PWBA 1TRMA 2G00A 2BDGA 1ABIH 1RRKA 3RXBA 2G51A 3QGJA 1EXFA 1T31A 3T2NA 2H9HA 7KMEH 2Z9GA 2BOKA 1H8IH 2Z7FE 1QHRB 2XYAA 2FEQH 2VIVA 4IGDA 2C93B 3B8JA 1OWDA 1LQEA 1TQ0B 3K6YA 5A2MH 1VCQA 3MO9A 4HZHA 4IMQA 4K1TA 1O3FA 3LDXH 1CSOE 3RXTA 3QWCH 3MH5A 2R0LA 4KKDA 1P01A 3T62A 3IWMA 1N8OB 4CRGA 1YF4A 4NIVA 1C2LA 4CRFA 4X0WU 4AG1A 3KF2A 1SLWB 3GDSA 1O2ZA 2FM2A 2PKAB 1DM4B 1TA2A 3T5FH 2FWWA 2OC1A 5C1UA 2NU2E 2BB4A 1Y5BT 3NXPA 2ZU1A 1C2HA 3PMHB 1CQQA 3A84A 2DE9A 1A5GH 2J34A 1B0FA 1ANBA 1LHDH 2NU3E 2Y6TA 3LONA 1HCGA 5L2YH 4OS6A 4DURA 2ANKH 4NFFA 4X1NU 4MNWA 3P6ZB 4E05H 1L1JA 1GI0A 1BIOA 1EB2A 1TGTA 3BF6H 2GVFA 1C5QA 5PTPA 1MKWH 1GG6C 5DP3A 3TJUA 4A6LA 1O34A 4WWYA 5JPMH 2IJOB 3A8CA 2BVSH 1Y59T 1PPCE 1OPHB 2FESH 3IG6B 4NIWA 4GVUA 2R9PA 2A31A 5LPFA 1MU8B 1C5MD 3M37A 2G5VA 1S0RA 7GCHF 3FZDA 3A82A 1UHBB 4ABBA 3STIA 2FLRH 1UVUH 2P93A 1KTTB 1UTKA 1NU9A 2P59A 3VXFH 2A7CA 2ULLA 1TMBH 1W2KH 1S6FA 4ZROA 2ESTE 1MTNB 3BTFE 2XCFA 1HAVA 4UFGH 4IN1A 3GCHC 3BTQE 4NSVA 2O8UA 4FXGH 1QRWA 1GBTA 4K1SA 3LGYA 1XUKA 1AMHA 1LKBA 2HVXA 1TE0A<