3CP7A

Crystal structure of a thermostable serine protease al20 from extremophilic microoganism
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
216
structure length
216
Chain Sequence
PADSPHIGKVFFSTNQGDFVCSANIVASANQSTVATAGHCLHDGNGGQFARNFVFAPAYDYGESEHGVWAAEELVTSAEWANRGDFEHDYAFAVLETKGGTTVQQQVGTASPIAFNQPRGQYYSAYGYPAAAPFNGQELHSCHGTATNDPMGSSTQGIPCNMTGGSSGGPWFLGNGTGGAQNSTNSYGYTFLPNVMFGPYFGSGAQQNYNYASTTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alkaline serine protease AL20
publication title Crystal structure of an alkaline serine protease from Nesterenkonia sp. defines a novel family of secreted bacterial proteases
pubmed doi rcsb
molecule tags Hydrolase
total genus 62
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature ec 3.4.21.1: Chymotrypsin.
pdb deposition date 2008-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3cp7A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3cp7A02
1NC6A 4U30A 1HXEH 4O3UA 1G9IE 3URCA 2ZECA 4ZXXH 3ZYDA 4Y8XA 1HV7A 2PKAB 2BOKA 1UVSH 6GCHG 2ZHQH 1MTSA 2ZFTA 1C5OH 1BMAA 1DUEA 2Y5FA 1D3PB 4IS5A 1XM1A 4K8YA 1L1NA 1S85A 1V2WT 3BG8A 2G52A 1J14A 5FPSA 1TWXB 3E6PH 1DSTA 2Y5GA 1CA8B 3W95A 5JBTA 1KLTA 3T29A 3P92A 1AKSA 2BY5X 3M5OA 4DT7B 4A7IB 4ABBA 1QBOA 3P8GA 2ZFQH 1GJ9B 5DJ7A 3ZZ3A 1THPB 1C5UA 4NGAH 1P06A 3SJIA 2C4FH 3LC5A 2Z9KA 3Q77A 2XBXA 3KF2A 5TJXA 3ZVFA 4ABDA 3MMGA 3RMLH 2FESH 4KKDA 3P8NA 3U8OH 5DK1A 2VWLA 1JXPA 2O8WA 4YT6H 1A3BH 2AGEX 2PTCE 3MU4A 1RIWC 1ESAA 3P95A 1BBRE 3EA7A 4X6NA 3H7OA 4MG3A 4AGKA 2Y80A 1GHVH 3A7WA 3NXPA 4X1PU 5PTPA 1MD8A 1YKTA 1K1NA 3P6ZB 1SR5C 2ANMH 4WXVA 1FN8A 4UONA 1PPEE 1ZPBA 3TH4H 2BDGA 1F5LA 1GBFA 3R0FA 2C8XB 1AB9B 1DANH 1OP2A 1XKAC 3C27B 4TY7A 5EW1H 4NSVA 1ZHPA 3MO9A 2BD9A 4X6PA 2OC0A 1GBJA 2F9OA 2WV5A 2A4OA 1OXGA 1DVAH 4ZH8A 4FUIA 3ATIA 4U01A 2ZTXA 3AW1A 1ANEA 4Y0YE 1H9LB 3MWIU 5GIBA 3RC4A 5LGOA 2BQWB 1ELTA 3QWCH 4INKA 1TNKA 2AERH 1O2RA 2LNCA 3P8FA 3GCNA 3BTTE 1K9OE 1SVPA 1EAUA 1GCTB 1AZZA 1P2KA 4UFFH 1CBWB 4ISNA 2C8WB 1MBQA 1FNIA 1GBIA 1L0ZA 1QB9A 2Y82A 1BZXE 1FUJA 2P95A 4AG1A 8LPRA 4BAMB 1HIAB 3VGCC 4D8NA 1SQTA 1Y5UT 1ZHRA 1A1RA 3VB3A 1YPKH 2R0KA 1EPTC 1CGIE 1TAWA 4AFQA 1G32B 3GY5A 1C1OA 1O33A 4XE4A 5DP3A 1LHEH 1W11U 2BQ6B 2HPQH 3GYMA 4B74A 1IAUA 3GY2A 2C90B 1P11E 3HKJB 4DGJA 3TK5A 2GDEH 3SV2H 2AMDA 4BAQB 1C9PA 3M5NA 1GJBB 5FHTA 3PTBA 3EAJA 5EQRA 3Q3YA 1K22H 1DITH 4QT8C 1LMWB 1UK2A 1CHGA 1AKSB 2W7SA 5L2ZH 1O5CB 1QRXA 1FV9A 2R0LA 4J1YA 2ASUB 3MNSA 5E8EH 1UJ1A 1UTNA 1O3JA 1AY6H 1HAXB 4CRCA 4X8SH 2VH0A 3RC5A 4DJZB 1WUNH 1NFYA 1V2UT 1Y3YA 3A83A 1S82A 3UOUA 1NRPH 1LVBA 2ZU2A 3V13A 1D4PB 3ZZ5A 3MH7A 4A1XA 1ZMNA 1VCWA 2G4TA 4CBOA 2STBE 1YLDA 5F8TA 1AN1E 1YYY1 3S0NA 3NPSA 1O3FA 2BM2A 2I6QA 1QL7A 4YOJA 1PPHE 3IWMA 1FN6A 1AFEH 2ZEBA 3GOVB 3G01A 4THNH 2Q1JA 2XC5A 2Z9LA 1WOFA 1GMCG 4K5ZA 1TX7A 3SOSA 1IHTH 5CHAC 2QF3A 1QCPA 2FLRH 1T4VH 2QV1A 1TOMH 3ATKA 1F5KU 1DSUA 4FUEA 2FPZA 1PQAA 3QN7A 1EAIA 3TH2H 1C2JA 3DT0H 2G5NA 4ZXYH 4X8VH 4VGCC 1ZMLA 1L2EA 2ZHWH 3VEQB 1P2MA 4AYYB 4ZKRU 3BIUH 3V7TA 3RLWH 4ZHLU 1WQVH 1YPMH 1PPCE 1UVUH 1AMHA 2J34A 5C2ZA 2GKVE 1TMBH 1H1BA 1Y3UA 4BTTB 2O9QA 3TJNA 1UCYK 1C1RA 3K2UA 1V2LT 3T2NA 5A8ZA 1SMFE 1NU9A 3U8RH 1O5DH 3F9GA 3SORA 2A5IA 1F0RA 2SFAA 2UUJB 1KXAA 4WH8A 3RMMH 1AU8A 1CU1A 4GPGA 3B9FH 4I32A 2NU3E 4YOGA 4WMFA 1OX1A 1EJNA 1AD8H 4Z6AH 1EUFA 2CF8H 4BAHB 1QB6A 4CRGA 1O0DH 1TGTA 2BHGA 3QZRA 4Y7BA 1GHAG 2GCTB 2SNVA 3PWCA 4UFGH 2NU1E 5CE1A 4KGAA 3CS0A 2F9PA 4OS6A 1QY6A 2WYGA 2BD4A 4XBCA 3F9HA 1HUTH 3E0PB 3SU0A 1G30B 4H4FA 4INHA 2GZ8A 1O34A 5BPEA 1DWBH 3U69H 2Z9IA 1NM6A 3PROA 2XWAA 5A0AE 1GL1A 3P70B 3TNTA 1TBZH 1TMUH 1LHFH 2NU0E 1HAYB 1G37A 3I29A 1LTOA 4KTCA 7GCHF 1K1IA 1W13U 1MAXA 2QF0A 2ZDAH 3LH1A 5C1YA 1XUFA 1LHDH 2CJIA 1DT2A 2FOAA 3MYWA 1LPKB 5A09A 1BOQA 3SJKA 3KGPA 1W2KH 2FM2A 1HAIH 2AEIH 4HI3A 2QXIA 4ZMAH 1Z8RA 4AORA 3GY8A 1UCYH 1A3EH 1P2JA 3ATMA 1A5IA 3GYLB 1DS2E 2FOEA 4I8HA 2JH5D 3MU1A 4YOIA 3LJJA 2YNAA 2ZPRA 4RN6A 2EI7A 3BG4B 1O2SA 1TQ0B 1VITG 4NIYA 2XW9A 2YNBA 3BTHE 1HGTH 4DW2U 4CREA 2J2UA 1HYLA 5GJ4B 2OINA 4H6SB 1UHBB 2FLBH 2BXTH 3SNCA 1QIXB 2HLCA 2FZZA 3M7QA 2QYIA 4K3JA 1JBUH 4ESTE 2SNWA 1DICA 3MO6A 4A6LA 3BEFB 1F0TA 5JB8S 1AE8H 1O31A 1ELCA 4BAOB 4U32A 2BDYA 2CV3A 3F9EA 3LGVA 3NK8A 1SC8U 2ZC9H 2QAAA 5FPYA 1Y3WA 1EP6A 2F9UA 1ZSKA 4D7FA 1Z71A 3UUZA 1OKXA 2WUBA 5EPYA 2V3OH 3TU7H 3BTFE 1G2MA 2V6NA 2HNTE 4FUBA 4AOQA 3SNDA 1W7GH 2P94A 3FAOA 4KTUA 2GCHF 2UUFB 1OP8A 1BB0B 5EPNA 1KXBA 2PHBA 4K69A 2QY0B 2JH6D 3SU2A 1C2GA 1LQEA 3GY7A 1ESBA 2FMJA 1J15A 1GJ8B 1MCVA 2FDAA 3PYHA 1PJPA 3PM3A 2AIQA 4CRBA 1TX8A 2J94A 1C2EA 1LKBA 2V0BA 4O9VA 4JYUH 4U2WA 2AMQA 2G51A 1EAWA 2P16A 1GHZA 1IQFA 3BTQE 4BANB 5EG4A 3BV9B 1KSNA 1ETTH 4JZ1A 1BTPA 2OTVA 4I8JA 1DX5M 1N8OB 4Q2KA 3RXJA 2Q6GA 4WJG2 1HFDA 1EB2A 1ELBA 1QURH 3TGKE 4TPYA 1F5RA 1JRSA 3SV9A 1AQ7A 1BJVA 2FOHA 1QQ4A 1Z8GA 4IBLH 1AI8H 4B2CA 3UY9A 5JBCS 1E36B 4LZ4B 1V2MT 3PLBA 1W0ZU 3TPIZ 3M7UA 4A5TS 2OBQA 1MU6B 2C3SA 3PMAB 2FP7B 1GJDB 1XKBC 1ZTLA 3IG6B 2B8OH 1SLXB 5JPMH 4OS7A 3E0NB 2I6SA 1SOTA 1O2TA 4Y79A 1K28D 2C8ZB 4XOJA 1YC0A 1FAKH 1RTKA 1TPPA 4IC5A 1GL0E 5T6FA 1MQ6A 2A7JA 3ZZ6A 2ZPSA 3LGTA 3TGJE 3KQDA 1O3CA 1TIOA 1HRTH 3RLYH 1T8LA 2FX4A 1UTLM 2OQ5A 2SGAA 1MTNC 4ABGA 2CHAC 4JCNA 1WYKA 3BTKE 2P8OB 2BLOA 2BVSH 1O32A 2UUYA 1IQIA 1C4V2 1NU7B 1TYNA 2ZI2H 4MQAA 2ZA5A 1EQ9A 5LPEA 3LDXH 1K1JA 1GI4A 2FOGA 1CVWH 2BD7A 1GJ6A 2STAE 1O2HA 4WMEA 3M3SA 3SBKA 1AGJA 2QCYA 1WTGH 2A2XH 1IHSH 3ZZDA 2PSXA 4INLA 3LJOA 4GAWA 1V2ST 3GY3A 1EZSC 4AFSA 3Q3KA 1TRNA 3M37A 7ESTE 5DKMA 2JETB 1ZTJA 2FIRH 5C1XA 2P59A 5GCHF 1G36A 2AGIX 2BDCA 1FY4A 2C93B 1UK4A 2H2ZA 4AYVB 4JZFH 3RXRA 3ATLA 3A7YA 4WVPE 3LGIA 2RG3A 3RU4E 5EGMA 1CT2E 2G5VA 1UTQA 3VB6A 4DG4A 1GMHF 3LOXA 3FANA 4OGXA 5TCCA 1M9UA 8KME2 1EJAA 1FONA 4I8LA 3LGWA 1N1LA 4LXBH 3HGPA 5AVDA 3LPRA 2GP9B 3UR6A 1O2KA 1VGCC 1ZOMA 1TA6A 5L2YH 2VGCC 1SGQE 1PQ8A 3OY6U 1SQAA 3FP7E 4R0IA 1MAYA 1BRUP 2ZGBH 5DGJA 2ANWA 3TLOA 2DE9A 4GLYA 4AB9A 4AFZA 2VINA 1SOZA 1V2JT 4NCYA 1L1JA 1DE7H 1TBQH 1VCPA 1PQ5A 1QJ1B 2BYAX 1O2MA 2Z3EA 1ANCA 3BTDE 5AFZH 3BEIB 1GG6C 6CHAC 3GCTG 4WXIA 2A31A 1P2IA 2BXUH 3QGJA 1BJUA 1QFKH 5EQQA 3SJ9A 3U1IB 1F7ZA 2HNTF 1C1WH 5G4BA 3UNRA 4B2AA 1HAOH 2PUXB 3AAVA 1BMNH 2RA3A 2JKHA 2ZFPH 1UVTH 1S83A 3O8CA 1O3HA 1GHBF 1S0QA 3LH3A 4FVBA 2Y6TA 1YPGH 1P9UA 3MHWU 3MU0A 5DP6A 4ZKSU 1O3LA 2ZQ1A 3GY4A 3VB4A 2ZP0H 1B0FA 1TA2A 5C5NA 4AZ2B 1Q2WA 4HFPB 3S9CA 5FX5A 2ILNA 4JYTA 2SGEE 1GI6A 1AIXH 4GHTA 4R8TB 1HJ8A 5JBBS 2R9PA 3A85A 1C5NH 1TQ7B 5F03A 1C1VH 3QLPH 2TGTA 2Z3CA 1YBWA 1SGPE 3SZNA 3UR9A 1C5ZB 1UTPA 4CHAB 1O37A 2D2DA 3NKKA 4BXWA 5EW2H 2ZFRH 3SV6A 2XWBI 1THRH 1EASA 1RTLA 5IYTA 2A1DB 1LKAA 1W7XH 2WPKS 3GCOA 5GXPA 1FIZA 5ETXA 1UTKA 3GISB 3Q00A 3JZ2B 2J9NA 2THFB 1KTTB 3K65B 1G3EA 3SGAE 1L1GA 2AGGX 1KY9A 7LPRA 1OWDA 3T62A 1TPOA 2WUCA 2H5CA 2ZDNA 1AO5A 3ENSB 1HJAB 2G8TA 4ZAEA 1BRAA 1Y8TA 5LH8A 1GBLA 1SGEE 1DLEA 4XSKU 4FUFA 4TYDA 4ABFA 2W26A 4UE7H 4AN7A 4H6TA 4NA9H 3STIA 1FPCH 2QXGA 1K21H 1O2WA 3RXDA 4GCHG 1S84A 2XRCA 1TGSZ 1MTUA 2J95A 3MH6A 4DURA 5EXNA 3NCLA 2VVVA 1SSXA 1DFPA 1G3DA 4CRAA 1XX9A 4MNVA 5GPIB 4GHQA 3SI3H 3RUOA 4F4OC 1AB9C 1QHRB 4AG2A 1DWDH 1C2HA 1IOEA 1NRQH 4AX9H 4A92A 4UEHH 4YM9A 1SLUB 1C4U2 3FP6E 1XVMA 2HVXA 4YO9A 4HTCH 1LVMA 6LPRA 4ISHH 1SPJA 2ZCHP 1BTXA 3CS7A 1CA0B 1SGNE 1P10A 2TGPZ 5E0JA 3TITA 1LCYA 1S6HA 3QDZB 2H9TH 4NA7A 1GI1A 2M5TA 5E2OA 1ZPZA 1GCTC 1QBVH 3P17H 4MPXA 3A7VA 1BBRK 4NIXA 1CBWC 1Z7KA 1OWEA 4B73A 1WSSH 1LVOA 2XBVA 4X2VA 5L6NH 1BTZA 3E1XB 2EA3A 3U9AH 1OWJA 1GBMA 3A8CA 1A61H 2H1UA 1RFNA 3E91A 4Y7AA 3A87A 3A82A 2PGQB 1GVLA 1BMMH 1FXYA 2BOHB 2VIWA 1O2ZA 1JOUB 1QRZA 1BHXB 2TGAA 3QZQA 5DPAA 4TWYA 3Q76A 2VVCA 2FXRA 2ULLA 3KQCA 4Y76A 2BZAA 1ZSJA 1VCQA 1NS3A 2AYWA 1HAHH 3GDSA 2O8TA 1AWFH 6GCHF 1TNJA 4IC6A 3H7TA 3A89A 2VVUA 2Z9GA 1FDPA 1F92A 2ZDLA 3ZVDA 4MTBA 1MQ5A 4FU7A 1UHBA 3OYPA 2BZ6H 3TK6A 1O3KA 1LHCH 1O2PA 1LQDB 1ETSH 1O3IA 4VGCB 3UNQA 3RXPA 2XYAA 4NIVA 5GDSH 3SI4H 3V0XA 2FI5E 1HCGA 1O2YA 4KELA 3U98H 1AE5A 1G3CA 2CF9H 1O5AB 1YP9A 3T26A 1C5RA 3OSYA 1RXPA 1JIRA 3RXQA 2RDLA 1H9IE 1E34B 4E05H 1C5QA 1YPHE 1BBRH 1CT0E 2ZCLP 2KAIB 1L4DA 3ESTA 4XDEA 1GI9B 1P9SA 3PWBA 4YZUA 3BF6H 2FOMB 2FX6A 1C4Y2 1W0YH 1C5SA 2BY8X 2XNIA 2FO9A 1TNHA 1BTUA 1O2VA 1TRYA 5LPFA 3F6UH 3QTOH 5FPTA 2HOBA 1UTMA 1CHOG 3LIWA 1P3CA 4NIWA 4LZ1H 1Q3XA 5J4QA 2F9NA 1Z8IB 4Q7YA 4WH6A 2HPPH 3L33A 3C1KA 3L3TA 8GCHG 4IMQA 3A8DA 1Z6EA 1B5GH 1D3DB 1AVGH 3UQVA 1WV7H 1ZR0A 2IOTA 1KXDA 2OC1A 2ZIQH 4YLUA 3PLPA 3B23B 4X2YA 1CGHA 1YPJH 1CGJE 1IQMA 2H5DA 3F68H 9LPRA 1ORFA 1XUIA 1F0SA 4I8KA 4XFQA 2UUKB 5A0BA 1WAYB 2Z3DA 2PV9B 1QA7A 2GTBA 3U8TH 3E3TA 3ITIA 2FWWA 1SGFG 3UPEA 2WPMS 1BTHH 2BD2A 1TGNA 3QGNB 4WF8A 2UWLA 4X1RU 1ZJDA 1O5EH 2VIDA 2W5EA 1BHXF 3SUDA 1GBEA 2ZU3A 3NUMA 3ZVCA 4UFEH 1D6RA 1UTOA 4O97A 1NT1A 2F83A 1P04A 1HAZB 2HWLB 3B8JA 1QGFA 4DY7B 2Z9JA 3DD2H 2EEKA 1MMJN 4NA8A 3U1JB 3GCHB 2H9HA 2A4QA 3KNXA 3PLKA 3A7TA 1YCPK 1TPSA 3ZV9A 1V2VT 5C5OA 1ANBA 2D1JA 4KP0A 1VJAU 3VXEH 3CENA 5T6GA 3S9BA 1YCPM 4ABEA 2H9EH 1QR3E 4NSYA 2PW8H 3ZVAA 1QJ6B 1T31A 1OOKB 2IPHA 1NFUA 2GV6A 4GSOA 1PPFE 1TX6A 4CRDA 3RXSA 1O3NA 1SFQB 2ZQ2A 2PKSB 2FOFA 1P2QA 4X6MA 1GMDG 1LPZB 2FI3E 4CRFA 5JYIA 3HK6B 1OWHA 1O3EA 1EZQA 2P3UB 2QA9E 3PMBB 1TABE 4TY6A 3T28A 4NG9H 1OSSA 1O3DA 1THSH 4K1EA 3RXLA 1LPGB 2A7CA 1XUJA 1ZHMA 3M3VA 1SGDE 1V2RT 3BG4C 3ATWA 1RGQA 1H9HE 3O8RA 1D3QB 3E8LA 1BTWA 1C1QA 1ID5H 3BTEE 3S69A 2QXJA 3TK9A 4NWKA 2GD4B 2F9BH 3SJ8A 1Z8JB 1GGDB 2PUQH 2GV7A 5FCRA 2XC4A 1ELEE 3EDXB 2BTCE 1NO9H 3EE0B 1P09A 1GMCF 1YF4A 1YLCA 2AFQB 1GPZA 1DM4B 4RSPA 1HB0B 1YCPH 3DA9B 1J16A 2Y81A 3BN9A 4MLFB 2FODA 3A84A 4K8BA 4DIIH 2ZTZA 1C1MA 1ZYOA 1T4UH 2FTMA 3SV8A 2B9LA 1O3OA 1XUHA 4FUGA 1DOJA 1O3PB 2ZU1A 3PO1B 4A1VA 4MNXA 1TOCB 1GCDA 1OYQA 3UREA 4LOYH 1T8MA 2BX4A 3BIVH 1GHXH 2ALPA 1TGCA 1HXFH 1SFIA 5T6DA 3T27A 1TPAE 1O5BB 1O2UA 1GI7B 2LPRA 4Q7ZA 5F6MA 3M5MA 2BD3A 2A0QB 2ANKH 3SQHE 3N7OA 3URDA 1G3BA 1MZDA 1AUTC 2BY6X 3OX7U 5FAHA 1MCTA 3RXUA 2H6MA 1X7AC 2ZWLH 1U6QA 1GBCA 1Y3XA 3SJOA 3BTWE 3ODFA 3RM2H 2BMGB 3RXOA 2GZ9A 1O35A 3HATH 2K1QA 2ZHDA 2R2WU 2SGQE 2Z94A 5GWZA 5DO4H 4H42U 2OLGA 1GHAF 2WPJS 2VIPA 2ZDVH 3OTJE 3OY5U 1TB6H 1DXPA 1FLEE 4YTAA 4ASHA 1N8OC 4FUJA 2F91A 3UFAA 3MNXA 3S7KB 1DY9A 1WBGB 1FIWA 1KLIH 2GMTC 4BAKB 1XXDA 1UTJA 1ZLRA 1V2TT 1XXFA 2Y7XA 3ZZ7A 4X6OA 3HPTB 3D65E 2CGAA 2A5AA 1SI5H 1J9CH 2ZO3H 1C2DA 4IW4E 3SU6A 2FYQA 3BSQA 3E16B 1C2IA 1EZXC 2CXVA 4F49A 1O2NA 5K0HA 2PGBB 4YLQH 3ZZ9A 5IDKA 3AAUA 2ZGHA 1F2SE 5CMXH 1J17T 4ZKNU 2A4RA 1FJSA 1ETRH 4O3TA 3V12A 5F8ZA 3GICB 3UWJH 1GBHA 1P8VC 1KLJH 3SGQE 1NN6A 2XCNA 1NROH 4IN2A 2P8OC 1YPEH 1NY22 4CR5A 2V35A 1VITF 2FOCA 3WY8A 5EU8A 2W3IA 3F1SB 4K1SA 2CMYA 3R3GB 1A0HB 1KXCA 1AFQC 1O2JA 3I78A 3LONA 3SNBA 3KEEA 1EPTA 1EXFA 3A86A 3M3TA 5ESBA 3RXHA 2FS9A 1K1MA 1C5TA 1MBMA 3JZ1B 2GX4A 2ZZUH 1SHHB 4X2WA 1DDJA 1V3XA 2A4GA 4CH2B 2ZU4A 3EQ0H 1ELFA 1BITA 1DWEH 1NPMA 4E06H 1T7CA 1BCUH 5C20A 2JETC 4X0WU 1ABIH 5TCAA 1ZGVA 2FS8A 2SGFE 3HKIB 3PMJA 1E38B 3D49H 4GVUA 4DOQA 3TNSA 4JMYA 2G55A 1MTVA 1BQYA 1NTPA 4AFUA 1ZJKA 2Q6FA 1TBRH 1WU1A 4BOHA 1IQHA 1MD7A 4DIHH 1F0UA 1NFWA 2WPIS 1D9IA 1ABJH 3KHVA 1P02A 3I77A 1FZZA 3UNSA 1QTFA 1YPLH 3A80A 3NZIA 5DP5A 1CQQA 1ZTKA 2EC9H 3LC3A 1OWKA 1SB1H 1MKXK 5JB9S 3L6PA 2ZDMA 1SGYE 3SU4A 5FCKA 2ZTYA 2V3HH 4K1TA 1RIWB 1C5PA 3EA8A 2OC7A 4NZLA 1IQLA 3LKWA 4TPIZ 2FYRA 3IITA 1BRCE 1ARCA 2AH4X 3FZZA 1L4ZA 1SBWA 1H4WA 1QB1A 2TBSA 3P8OA 1QJ7B 1YM0A 3D23A 3LGYA 2P3FH 6ESTA 1TNGA 4X8UH 3EGKH 1W8BH 4FU8A 4D9QA 4D9RA 4I7YH 1J8AA 2Z6BD 2VIQA 2HRVA 4D7GA 4I33A 1QL8A 2OD3B 3PTNA 3RXFA 2ZGCA 3S7HB 1UVOA 1C5WB 3SU5A 3KQEA 1GBAA 1C5MD 4ISOA 4OS1A 3UIRA 1ELDE 5A8YA 4ZHMU 1O3MA 1MKWK 1MZAA 1FY3A 4JZEH 4WY3A 3T25A 3UWIA 4B2BA 2DE8A 1GJ7B 4KTSA 1C1PA 2BB4A 1Y5BT 5FXLA 1EOLA 4I31A 1P03A 2BVXH 2VH6A 4CHAC 2KAIA 1GBDA 1KIGH 1SGRE 1TALA 1KXEA 2ZF0H 1E35B 1UO6A 3SUFA 1NESE 3VGCB 1IQEA 1K1PA 4BTUB 1Z6JH 2FTLE 3RU4D 1W12U 3K6ZA 4XBDA 5SGAE 1MKXH 3RXAA 3HGNA 4Q7XA 1C5VA 4ABHA 1T8NA 1EPTB 1O2IA 2GT7A 5T3HA 1QBNA 2ZDKA 4UD9H 2BD8A 2R3UA 1CO7E 4BNRA 1SGCA 1A5HA 1NRSH 1HJAC 1O3GA 1SL3A 3RXIA 5HMAA 3VFEA 1O2QA 4MPWA 3UQOA 5DP4A 4NFEA 3SHAH 1Z1IA 5C67A 1V2PT 4FUCA 5C3NA 5F8XA 1C5XB 1P05A 1FI8A 1S5SA 5EXMA 2TIOA 1KYNA 3BTME 2R3YA 3SUGA 1E37B 4Z0KA 3ELAH 1GHYH 3M36A 2VWOA 7GCHG 2ZGJA 1A2CH 3SUEA 5E0GA 1BT7A 2ODPA 1Y5AT 2XXLA 2GZ7A 2QN5T 1PPBH 1N6YA 3EA9A 1MKWH 1O30A 2ESTE 3GDVA 1O2LA 3TGIE 4OS5A 1NZQH 1OPHB 4JK6A 1FY5A 1SLWB 4NWLA 2F9VA 1EOJA 1SGTA 1UCYE 3VB7A 1GDQA 1ZMJA 4FVDA 5HM9A 3ZZBA 5JBAS 3TIUA 2W3KA 1DWCH 2ZNKH 2WYJA 4B75A 1GI8B 1DXWA 2ODQA 1AHTH 1T8OA 1FPHH 2O8UA 1GI0A 1CA0C 3ZVGA 1IQGA 1SHYA 2XCFA 4TWWA 3FVFB 2TPIZ 3RXKA 1ANDA 5E2PA 3RC6A 1E0FD 5JDUB 4ABAA 2ZKSA 2WV4A 3GCTF 3BEUA 2WINI 4XBBA 1BDAA 5CHAB 3F9FA 2B0FA 1P2NA 3MTYA 3RXMA 1C5LH 1RRKA 1A5GH 2QXHA 4ISLA 4Y6DA 1JRTA 3ZV8A 5BRRE 2B7DH 1V6DA 1SGFA 3Q3XA 2ZCKP 1GVZA 5AFYH 3E90B 5HGGA 1CE5A 1GBBA 2ZHEH 2BD5A 5EQSA 3LT3A 2GCHG 1BMLA 1ZGIA 4D76A 4FUHA 2QGRA 1W14U 5FBEA 1HPGA 2BLVA 4MNWA 3M5LA 3SQEE 4FUDA 4ZHAA 1HNEE 1AVWA 1A46H 5J4SA 1KDQA 4HZHA 1EP5A 5DP8A 1IQNA 1Q31A 2YOLA 2EI6A 1P0SH 2BDAA 3VXFH 2FI4E 4Y10E 4MDSA 1O36A 3MOCA 3QUMP 4HGCA 1FY1A 3QTVH 1BRBE 5HM2A 1HAGE 1C1SA 1O39A 1P2OA 1CT4E 1LVYA 3M61U 2RCEA 3BTGE 2BDIA 1NFXA 1NRRH 3ZYEA 2PWXA 4B1TA 3SHCH 2ZFFH 4IGDA 5I25A 2QC2A 1GBKA 3AASA 2R2MB 1QQUA 4ZROA 1HAVA 2PTNA 3ZZ4A 4O03A 3VPKA 4CH8B 2P93A 3M7TA 4YT7H 2PLXA 1C1TA 2IN2A 3TJVA 2OCVB 5H4IB 1OWIA 4SGAE 1EKBB 1RJXB 1EAXA 4NFFA 3A7ZA 1SGIB 2WPHS 5EOKA 1RS0A 2OC8A 1GJCB 2D8WA 4GCHF 1EATA 3RXVA 2NU4E 2OP9A 1GDUA 1DPOA 2FOBA 2F3CE 1C5YB 4OS2A 5DG6A 3ZZ8A 1VJ9U 4B71A 3KIDU 4IN1A 1GDNA 3KL6A 1WCZA 2G4UA 3A8AA 2BQ7B 2EI8A 1XUGA 3QX5H 3QO6A 4BXSA 1O38A 1DUAA 1ZSLA 3DHKH 2NWNA 5FBIA 2VJ1A 1GVKB 3FZDA 2ZG0H 2TGDA 3LGUA 3RXGA 1JIMA 3A88A 3FFGA 4WWYA 4Y11E 2VWNA 1S81A 1TONA 2GCTC 3PMHB 3KN2A 3SNAA 1O2OA 3PB1E 3RM0H 5A8XA 1FAXA 5B6OA 1ESTA 1B7XB 2A7HA 1GJAB 1P57B 1XUKA 1EX3A 1KXFA 3LU9B 1K1LA 2BLWA 2C8YB 1TFXA 3SV7A 4OS4A 2BLQA 4OGYA 3RP2A 1YPHC 3TJUA 2J4IA 1ELVA 1P12E 1OS8A 2IJOB 2P3TB 3FP8E 3S9AA 2XBYA 1H8DH 2Y5HA 3MU5A 2BDHA 5GCHG 1BA8B 4RKJB 3MH4A 2XBWA 2HGTH 1WTHD 2ALVA 3AW0A 1A7SA 1GMHG 7KMEH 2OXSA 3GCHC 5HXFA 1SLVB 1V2KT 1LHGH 5HYOA 3RU4T 1ZRKA 2BY7X 1KDQB 4ABJA 4ISIH 3STJA 1MTWA 4Y8YA 4UDWH 3H5CB 4DVAU 3TVJB 4ABIA 1GI3A 2WPLS 1W3CA 4JYVH 1O3BA 2O8MA 2ZFSA 4M7GA 1QL9A 1GWAA 3RXBA 1DLKB 3MFJA 3ZVBA 1SG8B 1UK3A 4A1TA 4X8TH 1JMOH 1FY8E 2PKSC 4MNYA 1SQOA 1OYTH 2A5KA 1V2NT 2G00A 2UWOA 1O5GH 3MI4A 1GJ4H 2Z7FE 4I8GA 2BDBA 3RXTA 2AS9A 1CSOE 3RMOH 1ELGA 4J2YB 3SNEA 9ESTA 1TLDA 1AVXA 3PV4A 3UTUH 3T5FH 2DUCA 2NU2E 4FXGH 2VWMA 1HAVB 1ZRBA 3DUXH 1AZ8A 3K6YA 3O8DA 4JZDH 1T32A 2HALA 2VU8E 4K2YA 1Z1JA 3O8BA 5ESTE 1HAPH 1XVOA 1RD3B 2ODYB 3DFLA 4NZQA 1KTSB 3A81A 1ARBA 1GHBG 1S6FA 1XMNB 1C2LA 2ZU5A 1D3TB 2PFEA 1N6XA 3ODDA 3V3MA 2CN0H 2ZGXH 2VIOA 1IQJA 1MH0A 2D26C 1P3EA 1TNIA 2ZPQA 4GUXA 1BIOA 1O5FH 1Y3VA 2AIPA 3RXCA 1OP0A 1MUEB 3M35A 5FX6A 1GGDC 2VIVA 1CHOF 1Y59T 1AWHB 1H8IH 1BTYA 3SGBE 1VZQH 1PPZA 1ZZZA 1K1OA 1LO6A 3GY6A 1TE0A 1GJ5H 8GCHF 5LPRA 3MNBA 4Y0ZE 2PKAA 1QNJA 5L30H 1EZUC 3RXEA 1GBTA 2JH0D 1GI2A 3SU1A 4IMZA 3ZZCA 1YGCH 3SW2B 2UWPA 4JZIA 3SN8A 1PYTC 2PSYA 5E0HA 1MTNB 2CHAB 4CR9A 4ZKOU 1EJMA 1UVPA 1O2XA 4MPUA 1QRWA 2GMTB 4E7RG 1FQ3A 3PO1C 1TGBA 1ZPCA 3KCGH 2SGPE 4E7NA 1B0EA 1S0RA 2XC0A 5K7RA 3TJOA 3MO3A 3TH3H 1C2KA 2G81E 2FEQH 2ANYA 2BX3A 2TRMA 1O2GH 3ZVEA 4Y71A 2RA0A 1PPGE 3QK1A 2BVRH 1PYTD 1HBTH 1A0LA 1FMGA 2OQUA 2J38A 2HNTC 1TNLA 4MVNA 1TRMA 4X1QU 5DP9A 4WMDA 5DP7A 1HJ9A 1A0JA 1V2OT 1C1NA 2GT8A 1A4WH 1GHWH 1RTFB 4LK4A 3SO3A 1DY8A 2BY9X 3K9XB 8ESTE 4Y8ZA 2B5TB 1V2QT 3VB5A 1VITH 2A2QH 4ZUHA 5ABWA 1IQKA 4X2XA 3NWUA 4DCDA 1PQ7A 2OUAA 1AFQB 1UMAH 4MPVA 1JWTA 4RKOB 3W94A 4YESB 1QA0A 1C1UH 4B76A 1O3AA 5EXLA 5EODA 3RDZA 4UFDH 3HK3B 1VGCB 1EB1H 3MU8A 1ELAA 5C1UA 2VGCB 2A32A 3CP7A 1HDTH 3A8BA 3MH5A 2XTTB 2GGVB 3UOPA 3DFJA 1ACBE 3D62A 2GDDA 1GI5A 4X1SU 1P01A 3SU3A 1WQSA 2VNTA 4BTIB 5A0CA 1GMDF 2Q6DA 1C2MA 1TMTH 1HLTH 1K2I1 1MU8B 3EYDA 2Y7ZA 1G2LA 1VR1H 2W7UA 3A7XA 1GG6B 5A2MH 6CHAB 2VB0A 4K60A 2AMPA 1W10U 2O8LA 2GVFA 2PR3A 4JK5A 2QIQA 3ZZAA 1LDTT 4PROA 1D6WA 3OU0A 4AGJA 3GDUA 5I46H 3RMNH 3AVZA 5AHGH 1INCA 2J92A 4X1NU 3MNCA 5AF9H 1C2FA 1HIAA 2ZHFH 1BUIA 4AB8A 4FU9A 2SGDE 1PFXC 2OBOA 1NRNH 3KQBA 1C9TA 4SGBE 4Q80A 2A45B 4CBNA 1AUJA
chains in the Genus database with same CATH superfamily
1NC6A 4U30A 1HXEH 4O3UA 1G9IE 3URCA 2ZECA 4ZXXH 3ZYDA 4Y8XA 1HV7A 2PKAB 2BOKA 1UVSH 6GCHG 2ZHQH 1MTSA 2ZFTA 1C5OH 1BMAA 1DUEA 2EY4C 2Y5FA 1D3PB 4IS5A 1XM1A 4K8YA 1L1NA 1S85A 3CNRA 1V2WT 3BG8A 2G52A 1J14A 5FPSA 1TWXB 3E6PH 1DSTA 2Y5GA 1CA8B 3W95A 5JBTA 1KLTA 3T29A 3P92A 1AKSA 2BY5X 3M5OA 4DT7B 2JJ2D 4A7IB 4ABBA 1QBOA 3P8GA 2ZFQH 1GJ9B 5DJ7A 3ZZ3A 2LELA 1THPB 1C5UA 4NGAH 1P06A 3SJIA 2C4FH 3LC5A 5C0TA 2Z9KA 3Q77A 2XBXA 3KF2A 5TJXA 3ZVFA 4ABDA 3MMGA 3RMLH 2FESH 4KKDA 3P8NA 3U8OH 5DK1A 2VWLA 1JXPA 2O8WA 4YT6H 1A3BH 2AGEX 2PTCE 3MU4A 2F43B 1RIWC 1ESAA 3P95A 1BBRE 3EA7A 4X6NA 3H7OA 3UB0A 4MG3A 4AGKA 2Y80A 1GHVH 3A7WA 3NXPA 4X1PU 5PTPA 1MD8A 1YKTA 1K1NA 3P6ZB 5DN6D 3PV5A 1SR5C 2ANMH 4WXVA 1FN8A 3DSGA 4UONA 1PPEE 1ZPBA 3TH4H 2BDGA 1F5LA 1GBFA 3R0FA 2C8XB 1AB9B 1DANH 1OP2A 1XKAC 3C27B 4TY7A 5EW1H 4NSVA 1ZHPA 3MO9A 2BD9A 4X6PA 2OC0A 1GBJA 2F9OA 2WPDD 2WV5A 2A4OA 1OXGA 1DVAH 4ZH8A 4FUIA 3ATIA 4U01A 2ZTXA 3AW1A 4F55A 1ANEA 4Y0YE 1H9LB 3MWIU 1H8ED 5GIBA 3RC4A 5LGOA 2BQWB 1ELTA 3QWCH 4INKA 1TNKA 2AERH 1O2RA 2LNCA 2XOKD 3P8FA 3GCNA 3BTTE 1K9OE 1SVPA 1EAUA 1GCTB 4OM9A 1AZZA 1P2KA 4UFFH 1CBWB 4ACAA 4ISNA 2C8WB 1MBQA 3DSPA 1FNIA 1GBIA 1L0ZA 1QB9A 2Y82A 1BZXE 1FUJA 2P95A 4AG1A 8LPRA 1VKYA 4BAMB 1HIAB 3VGCC 4D8NA 2W6ID 1SQTA 1Y5UT 1ZHRA 1A1RA 3OFND 3VB3A 1YPKH 2R0KA 1EPTC 1CGIE 1TAWA 4AFQA 1G32B 3GY5A 1C1OA 1O33A 4XE4A 5DP3A 2JDID 1LHEH 1W11U 2BQ6B 2GJGA 2HPQH 3U28C 3GYMA 4B74A 1IAUA 3GY2A 2C90B 1P11E 1SKYE 3HKJB 4DGJA 3TK5A 2GDEH 3SV2H 2AMDA 4BAQB 4Q4LA 1C9PA 3M5NA 1GJBB 5FHTA 3PTBA 3EAJA 5EQRA 3Q3YA 1K22H 1DITH 4QT8C 1LMWB 1UK2A 1CHGA 1AKSB 2W7SA 4RT0A 5L2ZH 1O5CB 2YMSB 1QRXA 1FV9A 2R0LA 2KZ4A 4J1YA 2ASUB 3MNSA 5E8EH 1UJ1A 1UTNA 1O3JA 1AY6H 1HAXB 4CRCA 2CK3D 4X8SH 2VH0A 3RC5A 4DJZB 1WUNH 1NFYA 1V2UT 1Y3YA 3A83A 1S82A 3UOUA 1NRPH 1LVBA 2ZU2A 3V13A 1D4PB 3ZZ5A 3MH7A 4A1XA 1ZMNA 1VCWA 2G4TA 4CBOA 2STBE 1YLDA 5F8TA 5GNDA 1AN1E 1YYY1 3FKSD 3S0NA 3NPSA 1O3FA 2BM2A 2I6QA 1QL7A 1SQRA 4YOJA 5KECA 1PPHE 3IWMA 1FN6A 1AFEH 2ZEBA 3GOVB 3G01A 4THNH 2Q1JA 1MABB 2XC5A 2Z9LA 1WOFA 1GMCG 4K5ZA 1TX7A 3SOSA 1IHTH 5CHAC 2QF3A 1QCPA 2FLRH 1T4VH 2QV1A 1TOMH 3ATKA 1F5KU 1DSUA 4FUEA 2FPZA 1PQAA 3QN7A 1EAIA 2KR7A 1C2JA 3TH2H 3DT0H 3OE7D 2G5NA 4ZXYH 4X8VH 4VGCC 1ZMLA 1L2EA 2ZHWH 3VEQB 1P2MA 4AYYB 4M9FA 3VG8A 4ZKRU 3BIUH 3V7TA 3RLWH 4ZHLU 1WQVH 1E1RD 4DT4A 1YPMH 2V3MA 1PPCE 1UVUH 1AMHA 2J34A 5C2ZA 2GKVE 1TMBH 1H1BA 1Y3UA 4BTTB 2O9QA 3TJNA 1UCYK 1C1RA 3K2UA 1OHHD 1V2LT 3T2NA 5A8ZA 1SMFE 1NU9A 3U8RH 1O5DH 3F9GA 3SORA 2A5IA 1F0RA 2SFAA 2UUJB 1KXAA 3OEED 4WH8A 3FN8A 3RMMH 3WWBA 1AU8A 1CU1A 4GPGA 3B9FH 4I32A 2NU3E 3F0PA 4YOGA 4WMFA 1OX1A 1EJNA 1AD8H 4Z6AH 1EUFA 2CF8H 3PRDA 1QB6A 4BAHB 4CRGA 1O0DH 1TGTA 2F4LA 2BHGA 3QZRA 4Y7BA 1GHAG 2GCTB 2SNVA 3PWCA 4UFGH 2NU1E 5CE1A 4KGAA 3CS0A 2F9PA 4OS6A 1QY6A 2WYGA 2BD4A 4XBCA 3F9HA 1HUTH 3E0PB 3SU0A 1G30B 4H4FA 4INHA 2GZ8A 1O34A 5BPEA 1DWBH 3U69H 2Z9IA 1NM6A 3PROA 2XWAA 5A0AE 1GL1A 3P70B 3TNTA 1TBZH 1TMUH 1LHFH 2NU0E 1HAYB 1G37A 3I29A 1LTOA 4KTCA 7GCHF 1K1IA 1W13U 1MAXA 2QF0A 2ZDAH 3LH1A 5C1YA 1XUFA 1LHDH 2CJIA 1DT2A 2FOAA 3MYWA 1LPKB 5A09A 1BOQA 3SJKA 3KGPA 1W2KH 2FM2A 1HAIH 2AEIH 4HI3A 2QXIA 4ZMAH 1Z8RA 4AORA 3GY8A 1UCYH 1A3EH 1P2JA 3ATMA 1A5IA 3F0OA 3GYLB 1DS2E 2FOEA 4I8HA 2JH5D 3MU1A 4YOIA 3LJJA 2YNAA 2ZPRA 4RN6A 4YXWD 2EI7A 3BG4B 1O2SA 1TQ0B 1VITG 4NIYA 2XW9A 2YNBA 3BTHE 1HGTH 4DW2U 4CREA 3MQKC 2J2UA 1HYLA 5GJ4B 2OINA 4H6SB 1UHBB 2FLBH 2BXTH 3SNCA 1KMHB 1QIXB 2HLCA 2FZZA 3M7QA 2QYIA 4K3JA 1JBUH 2QE7D 4ESTE 2SNWA 1DICA 3MO6A 4A6LA 5HIZA 3BEFB 2PP6A 1F0TA 3OTPA 5JB8S 1AE8H 1O31A 1ELCA 4TT3D 4BAOB 4U32A 2BDYA 2CV3A 3F9EA 3LGVA 3NK8A 1E1QD 1SC8U 2ZC9H 2QAAA 5FPYA 3ZIAD 1Y3WA 1EP6A 2F9UA 1ZSKA 4D7FA 1Z71A 3UUZA 1OKXA 2WUBA 5EPYA 2V3OH 3TU7H 4RI0A 3BTFE 1G2MA 2HVYB 2V6NA 2HNTE 4FUBA 4AOQA 3SNDA 1W7GH 2P94A 3FAOA 4KTUA 2GCHF 1BMFD 2UUFB 1FX0B 1OP8A 1BB0B 5EPNA 1KXBA 2PHBA 2KFWA 4K69A 2QY0B 2JH6D 3SU2A 1C2GA 1LQEA 3GY7A 1ESBA 2FMJA 1J15A 1GJ8B 1MCVA 2FDAA 3PYHA 1PJPA 3PM3A 2AIQA 4CRBA 1TX8A 2J94A 1C2EA 2J97A 1LKBA 2V0BA 4O9VA 4JYUH 4U2WA 2AMQA 2G51A 1EAWA 2P16A 1GHZA 1IQFA 3BTQE 4BANB 5EG4A 4ASUD 3BV9B 1KSNA 1ETTH 4JZ1A 1BTPA 2OTVA 4I8JA 1DX5M 1N8OB 3PV2A 4Q2KA 3RXJA 2Q6GA 4WJG2 1HFDA 1EB2A 1ELBA 1QURH 3TGKE 4TPYA 1F5RA 1JRSA 3SV9A 1AQ7A 1BJVA 2FOHA 1QQ4A 1Z8GA 4IBLH 1AI8H 4B2CA 3UY9A 5JBCS 1E36B 4LZ4B 1V2MT 3PLBA 1W0ZU 3TPIZ 3M7UA 4A5TS 2OBQA 1MU6B 2C3SA 3PMAB 2FP7B 1GJDB 1XKBC 1ZTLA 3IG6B 2B8OH 1SLXB 5JPMH 4OS7A 3E0NB 2I6SA 1SOTA 1O2TA 4Y79A 1K28D 2C8ZB 2L6OA 4XOJA 1YC0A 1FAKH 1RTKA 1TPPA 4IC5A 1GL0E 5T6FA 1MQ6A 2A7JA 3ZZ6A 2ZPSA 3LGTA 3TGJE 3KQDA 1O3CA 1TIOA 1HRTH 3RLYH 1T8LA 2FX4A 1UTLM 2OQ5A 2SGAA 5CDFE 1MTNC 4ABGA 2CHAC 2AHME 4JCNA 1WYKA 2KCOA 3BTKE 2P8OB 2BLOA 2BVSH 1O32A 2UUYA 1IQIA 1C4V2 1NU7B 1TYNA 2LP6A 2ZI2H 4MQAA 2ZA5A 1EQ9A 5LPEA 3LDXH 1K1JA 1GI4A 2FOGA 1CVWH 2BD7A 1GJ6A 2STAE 1O2HA 4P00A 3M3SA 4WMEA 3SBKA 1AGJA 2QCYA 1WTGH 2A2XH 1IHSH 4AC9A 3ZZDA 4Z1MD 2PSXA 4INLA 3LJOA 4GAWA 1V2ST 3GY3A 1EZSC 4AFSA 3Q3KA 1TRNA 3M37A 7ESTE 5DKMA 2JETB 1ZTJA 2FIRH 5C1XA 2P59A 5GCHF 1G36A 2AGIX 2BDCA 2QF4A 3EE7A 1FY4A 2C93B 1UK4A 2H2ZA 4AYVB 4JZFH 3RXRA 3ATLA 3A7YA 4WVPE 3LGIA 2RG3A 3RU4E 5EGMA 1CT2E 2G5VA 1UTQA 3VB6A 4DG4A 1GMHF 3LOXA 3FANA 4OGXA 5TCCA 1M9UA 8KME2 1EJAA 1FONA 4I8LA 3LGWA 1N1LA 4LXBH 3HGPA 5AVDA 3LPRA 2GP9B 5EJ1A 3WWFA 3UR6A 1O2KA 1VGCC 1ZOMA 1TA6A 5L2YH 2VGCC 1SGQE 1PQ8A 3OY6U 1SQAA 3FP7E 4R0IA 1MAYA 1BRUP 2ZGBH 5DGJA 2ANWA 3TLOA 2DE9A 4GLYA 4AB9A 4AFZA 2VINA 1SOZA 1V2JT 4NCYA 1L1JA 1WDIA 1DE7H 1TBQH 1VCPA 1PQ5A 1QJ1B 2BYAX 1O2MA 2Z3EA 1ANCA 3BTDE 5AFZH 3BEIB 1GG6C 6CHAC 3GCTG 4WXIA 2A31A 1P2IA 2BXUH 3QGJA 1BJUA 1QFKH 5EQQA 3SJ9A 3U1IB 1F7ZA 2HNTF 1C1WH 3N7DA 5G4BA 3UNRA 4B2AA 1HAOH 2PUXB 3AAVA 1BMNH 2RA3A 2JKHA 2ZFPH 1UVTH 1S83A 3O8CA 1O3HA 1GHBF 1S0QA 3LH3A 4FVBA 2Y6TA 1YPGH 1P9UA 3MHWU 3MU0A 5DP6A 4ZKSU 1O3LA 2ZQ1A 3GY4A 3VB4A 2ZP0H 1B0FA 1TA2A 5KGOA 5C5NA 4AZ2B 1Q2WA 4HFPB 3S9CA 5FX5A 2ILNA 4JYTA 2SGEE 1GI6A 1AIXH 4GHTA 4R8TB 1HJ8A 5JBBS 2R9PA 3A85A 1C5NH 1TQ7B 5F03A 1C1VH 3QLPH 2TGTA 2Z3CA 1YBWA 1SGPE 3SZNA 3UR9A 1C5ZB 1UTPA 4CHAB 1O37A 2D2DA 3NKKA 4BXWA 5EW2H 4RT1A 2ZFRH 3SV6A 2XWBI 1THRH 1EASA 1EFRD 1RTLA 5IYTA 2A1DB 1LKAA 1W7XH 2WPKS 3GCOA 5GXPA 1FIZA 5ETXA 1UTKA 3GISB 3Q00A 3JZ2B 2J9NA 2THFB 1KTTB 3K65B 1G3EA 2WZQA 3SGAE 1L1GA 2AGGX 1KY9A 7LPRA 1OWDA 3T62A 1TPOA 2WUCA 2H5CA 2ZDNA 1AO5A 3ENSB 1HJAB 2G8TA 4ZAEA 1BRAA 1Y8TA 5LH8A 1GBLA 1SGEE 1DLEA 4XSKU 4FUFA 4TYDA 4ABFA 2W26A 4UE7H 4AN7A 4H6TA 4NA9H 3STIA 3SYJA 1FPCH 2QXGA 1K21H 1O2WA 3RXDA 4GCHG 1S84A 2XRCA 1TGSZ 1MTUA 2J95A 3MH6A 4DURA 3F3BA 5EXNA 3NCLA 2VVVA 1SSXA 1DFPA 1G3DA 4CRAA 1XX9A 4MNVA 3N99A 5GPIB 4GHQA 3SI3H 3RUOA 4F4OC 1AB9C 1QHRB 4AG2A 1DWDH 1C2HA 5CHBA 1IOEA 1NRQH 4AX9H 4A92A 4UEHH 4YM9A 1SLUB 1C4U2 3FP6E 1XVMA 2HVXA 4YO9A 4HTCH 1LVMA 6LPRA 4ISHH 1SPJA 5F53A 2ZCHP 1BTXA 3CS7A 1CA0B 1SGNE 1P10A 2TGPZ 5E0JA 3TITA 1LCYA 1S6HA 3QDZB 2H9TH 4NA7A 1GI1A 2M5TA 5E2OA 3DCLA 1ZPZA 1GCTC 1QBVH 3P17H 4MPXA 3A7VA 1BBRK 4NIXA 1CBWC 1Z7KA 1OWEA 4B73A 1WSSH 1LVOA 2XBVA 4X2VA 5L6NH 1BTZA 3E1XB 2EA3A 5C17A 3U9AH 1OWJA 1GBMA 3A8CA 1A61H 2H1UA 1RFNA 3E91A 4Y7AA 3A87A 3A82A 2PGQB 1GVLA 1BMMH 1FXYA 2BOHB 2VIWA 1O2ZA 1JOUB 1QRZA 1BHXB 2TGAA 3QZQA 5DPAA 4TWYA 5FL7D 3Q76A 2VVCA 2FXRA 2ULLA 3KQCA 4Y76A 2BZAA 1ZSJA 1VCQA 1NS3A 1YY3A 2AYWA 1HAHH 3GDSA 2O8TA 1AWFH 6GCHF 1TNJA 4IC6A 3H7TA 3A89A 2VVUA 2Z9GA 1FDPA 1F92A 2ZDLA 3ZVDA 4MTBA 1MQ5A 3PRBA 4FU7A 1UHBA 3OYPA 2YMSC 2BZ6H 3TK6A 1O3KA 1LHCH 1O2PA 2KCPA 1LQDB 1ETSH 1O3IA 4VGCB 3UNQA 3RXPA 2XYAA 4NIVA 5GDSH 3SI4H 3V0XA 2FI5E 1HCGA 1O2YA 3F2HA 4KELA 3U98H 1AE5A 1G3CA 2CF9H 1O5AB 4B6EA 1YP9A 3T26A 1C5RA 3OSYA 1RXPA 1JIRA 3RXQA 2RDLA 1H9IE 1E34B 4E05H 1C5QA 1YPHE 1BBRH 1CT0E 2ZCLP 2KAIB 1L4DA 3ESTA 2YMSD 4XDEA 1GI9B 1P9SA 3PWBA 4YZUA 3BF6H 2FOMB 2FX6A 5KEDA 1C4Y2 1W0YH 1C5SA 2BY8X 2XNIA 2FO9A 1TNHA 1BTUA 1O2VA 1TRYA 5LPFA 3F6UH 3QTOH 5FPTA 2HOBA 1UTMA 1CHOG 3LIWA 1P3CA 4NIWA 4LZ1H 1Q3XA 5J4QA 2F9NA 1Z8IB 4Q7YA 4WH6A 2HPPH 3L33A 3C1KA 3L3TA 8GCHG 4IMQA 3A8DA 1Z6EA 1B5GH 1D3DB 1AVGH 1H8HD 3UQVA 1WV7H 1ZR0A 2IOTA 1KXDA 2OC1A 2ZIQH 4YLUA 3PLPA 3B23B 4X2YA 1CGHA 1YPJH 1CGJE 1IQMA 2H5DA 3F68H 9LPRA 1ORFA 1XUIA 1F0SA 4I8KA 4XFQA 2UUKB 5A0BA 1WAYB 2Z3DA 2PV9B 1QA7A 2GTBA 3U8TH 3E3TA 5C94A 3ITIA 2FWWA 1SGFG 3UPEA 2WPMS 1BTHH 2BD2A 1TGNA 3QGNB 1COWD 4WF8A 2UWLA 4FETA 4X1RU 1ZJDA 1O5EH 2VIDA 2W5EA 1BHXF 3SUDA 1GBEA 2ZU3A 3NUMA 3ZVCA 4UFEH 1D6RA 1UTOA 4O97A 1NT1A 3N7EA 2F83A 1P04A 1HAZB 2HWLB 3B8JA 1QGFA 4DY7B 2Z9JA 3DD2H 2EEKA 1MMJN 4NA8A 3U1JB 3GCHB 4TSFD 2H9HA 2A4QA 3KNXA 1YLNA 3PLKA 3A7TA 1YCPK 1TPSA 3ZV9A 2J98B 1V2VT 5C5OA 1ANBA 2D1JA 4KP0A 1VJAU 3VXEH 3CENA 5T6GA 4FOUC 3S9BA 1YCPM 4ABEA 2H9EH 4P02A 1QR3E 4NSYA 2PW8H 3ZVAA 1QJ6B 1T31A 1OOKB 2IPHA 1NFUA 2GV6A 4GSOA 1PPFE 1TX6A 4XRNA 3RXSA 4CRDA 1O3NA 1SFQB 2ZQ2A 2PKSB 2FOFA 1P2QA 4X6MA 1GMDG 3F2FA 1LPZB 2FI3E 4CRFA 5JYIA 3HK6B 1OWHA 2KM0A 1O3EA 1EZQA 2P3UB 2QA9E 3PMBB 1TABE 4TY6A 3T28A 4NG9H 1OSSA 3FOAA 1O3DA 1THSH 4K1EA 3RXLA 1LPGB 2A7CA 1XUJA 1ZHMA 3M3VA 1SGDE 1V2RT 3BG4C 3ATWA 1RGQA 1H9HE 3O8RA 1D3QB 3E8LA 1BTWA 1C1QA 1ID5H 3BTEE 3S69A 2QXJA 3TK9A 4NWKA 2GD4B 2F9BH 3SJ8A 1Z8JB 1GGDB 2PUQH 2GV7A 5FCRA 2XC4A 1ELEE 3EDXB 2BTCE 1NO9H 3EE0B 1P09A 1GMCF 1YF4A 1YLCA 3KYFA 2AFQB 1GPZA 1DM4B 2RDEA 4RSPA 1HB0B 1YCPH 3DA9B 1J16A 2Y81A 3BN9A 4MLFB 2FODA 3A84A 4K8BA 4DIIH 2ZTZA 1C1MA 1ZYOA 1T4UH 2FTMA 3SV8A 2B9LA 1O3OA 1XUHA 4FUGA 1DOJA 1O3PB 2ZU1A 2KCAA 3PO1B 4A1VA 4MNXA 1TOCB 1GCDA 1OYQA 3UREA 4LOYH 1T8MA 2BX4A 3BIVH 1GHXH 2ALPA 1TGCA 1HXFH 1SFIA 5T6DA 3T27A 1TPAE 3KYGA 1O5BB 1O2UA 1GI7B 2JJ1D 2LPRA 4Q7ZA 5F6MA 3M5MA 2BD3A 2A0QB 2ANKH 3SQHE 3N7OA 3URDA 1G3BA 1MZDA 1AUTC 2BY6X 3OX7U 5FAHA 1MCTA 3RXUA 2H6MA 1X7AC 2ZWLH 1U6QA 1GBCA 1Y3XA 3SJOA 3BTWE 3ODFA 3RM2H 2BMGB 3RXOA 2GZ9A 1O35A 3HATH 2K1QA 2ZHDA 2R2WU 2SGQE 2Z94A 5GWZA 5DO4H 4H42U 2OLGA 1GHAF 2WPJS 2VIPA 2ZDVH 3OTJE 3OY5U 1TB6H 1DXPA 1FLEE 4YTAA 4ASHA 1N8OC 5EJLA 4FUJA 2F91A 3UFAA 3MNXA 3S7KB 1DY9A 4I86A 1WBGB 1FIWA 1KLIH 2IJD1 4B6FA 2GMTC 4BAKB 5B6LA 1XXDA 1UTJA 1ZLRA 1V2TT 1XXFA 2Y7XA 3ZZ7A 4X6OA 3HPTB 3D65E 2CGAA 2KX4A 2A5AA 1SI5H 1J9CH 2ZO3H 1C2DA 4IW4E 3SU6A 2FYQA 3BSQA 3E16B 1C2IA 1EZXC 2CXVA 4F49A 1O2NA 5K0HA 2PGBB 4YLQH 3ZZ9A 5IDKA 3AAUA 2ZGHA 1F2SE 5CMXH 1J17T 4ZKNU 2A4RA 1FJSA 1ETRH 4O3TA 3V12A 5F8ZA 3GICB 3UWJH 1GBHA 1P8VC 1KLJH 3SGQE 1NN6A 2XCNA 1NROH 4IN2A 2P8OC 1YPEH 4Q63A 1NY22 4CR5A 2V35A 1VITF 2FOCA 3WY8A 5EU8A 2W3IA 3F1SB 4K1SA 2CMYA 3R3GB 1A0HB 5DSFA 1KXCA 1AFQC 1O2JA 3I78A 3LONA 3SNBA 3KEEA 1EPTA 1EXFA 3A86A 3M3TA 5ESBA 3RXHA 2FS9A 1K1MA 1C5TA 1MBMA 3JZ1B 2GX4A 2ZZUH 1SHHB 4X2WA 1DDJA 1V3XA 2A4GA 4CH2B 2ZU4A 1NBMD 3EQ0H 1ELFA 1BITA 1DWEH 1NPMA 4E06H 1T7CA 1BCUH 5C20A 1QZ8A 2JETC 4X0WU 1ABIH 5TCAA 1ZGVA 2FS8A 2SGFE 3HKIB 3PMJA 1E38B 3D49H 4GVUA 4DOQA 3TNSA 2K8IA 4JMYA 2G55A 1MTVA 1BQYA 1NTPA 4AFUA 2OK5A 1ZJKA 2Q6FA 1TBRH 1WU1A 1YWUA 4BOHA 1IQHA 1MD7A 4DIHH 1F0UA 1NFWA 2WPIS 1D9IA 1ABJH 3KHVA 1P02A 4ACBA 2JIZD 3I77A 1FZZA 3UNSA 1QTFA 1YPLH 3A80A 3NZIA 5DP5A 1CQQA 1ZTKA 2EC9H 3W1EA 3LC3A 1OWKA 1SB1H 1MKXK 5JB9S 3L6PA 2ZDMA 2HLDD 1SGYE 3SU4A 5FCKA 2ZTYA 2V3HH 4K1TA 1RIWB 1C5PA 3EA8A 2OC7A 4NZLA 1IQLA 3LKWA 4TPIZ 2FYRA 3IITA 1BRCE 1ARCA 2AH4X 3FZZA 1L4ZA 1SBWA 1H4WA 1QB1A 2TBSA 3P8OA 1QJ7B 1YM0A 3D23A 3LGYA 2P3FH 1W0KD 6ESTA 1TNGA 4X8UH 3EGKH 1W8BH 4FU8A 4D9QA 4D9RA 4I7YH 1J8AA 2Z6BD 2VIQA 2HRVA 4D7GA 4I33A 1QL8A 2OD3B 3H09A 3PTNA 3RXFA 2ZGCA 3S7HB 2QF5A 1UVOA 1C5WB 3SU5A 3KQEA 1GBAA 2K0QA 1UW7A 1C5MD 4ISOA 4OS1A 3UIRA 1ELDE 5A8YA 4ZHMU 1O3MA 1MKWK 1MZAA 1FY3A 4JZEH 4WY3A 3T25A 3UWIA 4B2BA 2DE8A 1GJ7B 4KTSA 1C1PA 2BB4A 1Y5BT 5FXLA 1EOLA 4I31A 2KCYA 1P03A 2BVXH 2VH6A 4CHAC 2KAIA 1GBDA 1KIGH 3AK5A 1SGRE 1TALA 1KXEA 2ZF0H 1E35B 1UO6A 3SUFA 1NESE 3VGCB 1IQEA 1K1PA 4BTUB 1Z6JH 2FTLE 3RU4D 1W12U 3K6ZA 4XBDA 5SGAE 1MKXH 3RXAA 3HGNA 3OEHD 4Q7XA 1C5VA 4ABHA 1T8NA 1EPTB 1O2IA 2GT7A 5T3HA 1QBNA 2ZDKA 4UD9H 2BD8A 2R3UA 1CO7E 4BNRA 1SGCA 1A5HA 1NRSH 1HJAC 1O3GA 1SL3A 3RXIA 5HMAA 3VFEA 1O2QA 2VBCA 4MPWA 3UQOA 5DP4A 4NFEA 3SHAH 1Z1IA 5C67A 1V2PT 4FUCA 5C3NA 5F8XA 1C5XB 1P05A 1FI8A 1S5SA 5EXMA 2TIOA 1KYNA 3BTME 2R3YA 3SUGA 1E37B 4Z0KA 3ELAH 1GHYH 3M36A 2VWOA 7GCHG 2ZGJA 1A2CH 3SUEA 5E0GA 2WHXA 1BT7A 2ODPA 1Y5AT 2XXLA 2GZ7A 2QN5T 1PPBH 1N6YA 3EA9A 1MKWH 1O30A 2ESTE 3GDVA 1O2LA 3TGIE 4OS5A 1NZQH 1OPHB 4JK6A 1FY5A 1SLWB 4NWLA 2F9VA 1EOJA 1SGTA 1UCYE 3VB7A 1GDQA 1ZMJA 4FVDA 5HM9A 3ZZBA 5JBAS 3TIUA 2W3KA 1DWCH 2ZNKH 2WYJA 5IK2D 4B75A 1GI8B 1DXWA 2ODQA 1AHTH 1T8OA 1FPHH 2O8UA 1GI0A 1CA0C 3ZVGA 1IQGA 1SHYA 2XCFA 4TWWA 3FVFB 2TPIZ 3RXKA 1ANDA 5E2PA 3RC6A 1E0FD 5JDUB 4ABAA 2J98A 2ZKSA 2WV4A 3GCTF 3BEUA 2WINI 4XBBA 1BDAA 5CHAB 3F9FA 2B0FA 2L74A 1P2NA 3MTYA 3RXMA 1C5LH 1RRKA 1A5GH 2QXHA 4ISLA 4Y6DA 2M2AA 1JRTA 3ZV8A 5BRRE 2B7DH 1V6DA 1SGFA 3Q3XA 2ZCKP 1GVZA 5AFYH 3E90B 5HGGA 1CE5A 1GBBA 2ZHEH 2BD5A 2EQNA 5EQSA 3LT3A 2GCHG 1BMLA 1ZGIA 4D76A 4FUHA 2QGRA 1W14U 2WV9A 5FBEA 1HPGA 2BLVA 4MNWA 3M5LA 3SQEE 4FUDA 4ZHAA 1HNEE 1AVWA 1A46H 5J4SA 1KDQA 4HZHA 1EP5A 5DP8A 1IQNA 1Q31A 2YOLA 2EI6A 1P0SH 2BDAA 3VXFH 2FI4E 4Y10E 3GS9A 4MDSA 1O36A 3MOCA 3QUMP 4HGCA 1FY1A 3QTVH 1BRBE 5HM2A 1HAGE 1C1SA 1O39A 3SZEA 1P2OA 1CT4E 1LVYA 3M61U 2RCEA 3BTGE 2BDIA 1NFXA 1NRRH 3ZYEA 1WXRA 2J5UA 2PWXA 5HKKD 4B1TA 3SHCH 2ZFFH 5EIYA 4IGDA 5I25A 2QC2A 1GBKA 3FO8D 3AASA 2R2MB 5HIYA 1QQUA 4ZROA 1HAVA 2PTNA 3ZZ4A 4O03A 3VPKA 4CH8B 2P93A 3M7TA 4YT7H 2PLXA 1C1TA 2IN2A 3TJVA 2OCVB 1K0HA 5H4IB 1OWIA 4SGAE 1EKBB 1RJXB 1EAXA 4NFFA 3A7ZA 3WW7A 1SGIB 2WPHS 5EOKA 1RS0A 2OC8A 1GJCB 2V7QD 2D8WA 4GCHF 2RFKC 1EATA 3RXVA 2NU4E 2OP9A 1GDUA 1DPOA 2FOBA 2F3CE 1C5YB 4OS2A 5DG6A 3ZZ8A 1VJ9U 4B71A 3KIDU 4IN1A 1GDNA 3KL6A 1WCZA 2G4UA 3A8AA 2BQ7B 2EI8A 1XUGA 3QX5H 3QO6A 4BXSA 1O38A 1DUAA 1ZSLA 2XNDD 3DHKH 2NWNA 5FBIA 2VJ1A 1GVKB 3FZDA 2ZG0H 2TGDA 3LGUA 3RXGA 4ZCNA 1JIMA 3A88A 3FFGA 4WWYA 4Y11E 2VWNA 1S81A 1TONA 2GCTC 3PMHB 3KN2A 3SNAA 1O2OA 3PB1E 3RM0H 5A8XA 1FAXA 5B6OA 1ESTA 1B7XB 2A7HA 1GJAB 3F2GA 1P57B 1XUKA 1EX3A 1KXFA 3LU9B 1K1LA 2BLWA 2C8YB 1TFXA 3SV7A 4OS4A 2BLQA 4OGYA 2W6JD 3NRLA 3RP2A 1YPHC 3TJUA 2J4IA 1ELVA 1P12E 1OS8A 2IJOB 2P3TB 3FP8E 3S9AA 5C0UA 2XBYA 1H8DH 2Y5HA 3MU5A 2BDHA 5GCHG 1BA8B 4RKJB 3MH4A 2XBWA 2HGTH 1WTHD 2ALVA 3AW0A 1A7SA 4HG6A 1GMHG 3UAIC 7KMEH 2OXSA 3GCHC 5HXFA 1SLVB 1V2KT 1LHGH 5HYOA 3RU4T 1ZRKA 2BY7X 1KDQB 4ABJA 4ISIH 3STJA 1MTWA 4Y8YA 4UDWH 3H5CB 4DVAU 3TVJB 4ABIA 1GI3A 2WPLS 1W3CA 4JYVH 1O3BA 2O8MA 2ZFSA 4M7GA 1QL9A 1GWAA 3RXBA 1DLKB 3MFJA 3ZVBA 1SG8B 1UK3A 4A1TA 4X8TH 1JMOH 1FY8E 2PKSC 4MNYA 1SQOA 1S6LA 1OYTH 2A5KA 1V2NT 2G00A 2UWOA 1O5GH 3MI4A 1GJ4H 2Z7FE 4I8GA 2BDBA 3RXTA 2AS9A 1CSOE 3RMOH 1ELGA 4J2YB 3SNEA 3OAAD 9ESTA 1TLDA 1AVXA 3PV4A 3UTUH 3T5FH 2DUCA 2NU2E 4FXGH 2VWMA 1HAVB 1ZRBA 3DUXH 1AZ8A 3K6YA 3O8DA 4JZDH 1T32A 2HALA 2VU8E 4K2YA 1Z1JA 3O8BA 5ESTE 1HAPH 1XVOA 1RD3B 2ODYB 3DFLA 4NZQA 3KQ5A 1KTSB 3A81A 1ARBA 1GHBG 1S6FA 1XMNB 1C2LA 2ZU5A 1D3TB 2PFEA 1N6XA 3ODDA 3V3MA 2CN0H 2ZGXH 1NBME 1IQJA 2VIOA 1MH0A 2D26C 1P3EA 1TNIA 2ZPQA 4GUXA 1BIOA 1O5FH 1Y3VA 2AIPA 3RXCA 1OP0A 1MUEB 3M35A 5FX6A 1GGDC 2VIVA 1E79D 1CHOF 1Y59T 1AWHB 1H8IH 1BTYA 3SGBE 1VZQH 1PPZA 1ZZZA 1K1OA 5T1VA 1LO6A 3GY6A 1TE0A 1GJ5H 8GCHF 5LPRA 3MNBA 4Y0ZE 2PKAA 1QNJA 5L30H 1EZUC 3RXEA 1GBTA 2JH0D 2IPQX 1GI2A 5EJZA 3SU1A 4IMZA 3ZZCA 1YGCH 3SW2B 2UWPA 4JZIA 3SN8A 1PYTC 2PSYA 5E0HA 1MTNB 2CHAB 4CR9A 4ZKOU 1EJMA 1UVPA 1O2XA 4MPUA 1QRWA 2GMTB 4E7RG 1FQ3A 3PO1C 1TGBA 1ZPCA 3KCGH 2SGPE 4E7NA 1B0EA 1S0RA 2XC0A 5K7RA 3TJOA 3MO3A 3TH3H 1C2KA 2G81E 2FEQH 2BX3A 2ANYA 2TRMA 4F48B 1O2GH 3ZVEA 4Y71A 2RA0A 1PPGE 3QK1A 2BVRH 1PYTD 1HBTH 1A0LA 1FMGA 2OQUA 2J38A 2HNTC 1TNLA 4MVNA 1TRMA 4X1QU 5DP9A 4WMDA 5DP7A 1HJ9A 1A0JA 1V2OT 1C1NA 2GT8A 1A4WH 1GHWH 1RTFB 4LK4A 3SO3A 1DY8A 2BY9X 3K9XB 8ESTE 4Y8ZA 2B5TB 1V2QT 3VB5A 1VITH 2A2QH 4ZUHA 5ABWA 1IQKA 4X2XA 1W0JD 3NWUA 4DCDA 1PQ7A 2OUAA 1AFQB 1UMAH 4MPVA 1JWTA 4RKOB 3W94A 4YESB 1QA0A 1C1UH 4B76A 1O3AA 5EXLA 5EODA 3RDZA 4UFDH 3HK3B 1VGCB 1EB1H 3MU8A 1ELAA 5C1UA 2VGCB 2A32A 4XD7D 2WSSD 3CP7A 1HDTH 3A8BA 3MH5A 2XTTB 2GGVB 3UOPA 3DFJA 1ACBE 3D62A 2GDDA 1GI5A 4X1SU 1P01A 3SU3A 1WQSA 2VNTA 4BTIB 5A0CA 1GMDF 2Q6DA 1C2MA 1TMTH 1HLTH 1K2I1 1MU8B 3EYDA 2Y7ZA 1G2LA 1VR1H 2W7UA 3A7XA 1GG6B 5A2MH 6CHAB 2VB0A 4K60A 2AMPA 1W10U 2O8LA 2GVFA 2PR3A 4JK5A 2QIQA 3DSOA 3ZZAA 1LDTT 4PROA 1D6WA 3OU0A 4AGJA 3GDUA 5I46H 3RMNH 3AVZA 5AHGH 1INCA 2J92A 4X1NU 3MNCA 5AF9H 1C2FA 1HIAA 2ZHFH 1BUIA 4AB8A 4FU9A 2SGDE 1PFXC 2OBOA 1NRNH 3KQBA 1C9TA 4SGBE 4Q80A 2A45B 4CBNA 1AUJA
chains in the Genus database with same CATH topology
1NC6A 4U30A 1HXEH 4O3UA 1G9IE 3URCA 2ZECA 4ZXXH 3ZYDA 4Y8XA 1HV7A 2PKAB 2BOKA 1UVSH 6GCHG 2ZHQH 1MTSA 2ZFTA 1C5OH 1BMAA 1DUEA 2Y5FA 1D3PB 4IS5A 1XM1A 4K8YA 1L1NA 1S85A 1V2WT 3BG8A 2G52A 1J14A 5FPSA 1TWXB 3E6PH 1DSTA 2Y5GA 1CA8B 3W95A 5JBTA 1KLTA 3T29A 3P92A 1AKSA 2BY5X 3M5OA 4DT7B 4A7IB 4ABBA 1QBOA 3P8GA 2ZFQH 1GJ9B 5DJ7A 3ZZ3A 1THPB 1C5UA 4NGAH 1P06A 3SJIA 2C4FH 3LC5A 2Z9KA 3Q77A 2XBXA 3KF2A 5TJXA 3ZVFA 4ABDA 3MMGA 3RMLH 2FESH 4KKDA 3P8NA 3U8OH 5DK1A 2VWLA 1JXPA 2O8WA 4YT6H 1A3BH 2AGEX 2PTCE 3MU4A 1RIWC 1ESAA 3P95A 1BBRE 3EA7A 4X6NA 3H7OA 4MG3A 4AGKA 2Y80A 1GHVH 3A7WA 3NXPA 4X1PU 5PTPA 1MD8A 1YKTA 1K1NA 3P6ZB 1SR5C 2ANMH 4WXVA 1FN8A 4UONA 1PPEE 1ZPBA 3TH4H 2BDGA 1F5LA 1GBFA 3R0FA 2C8XB 1AB9B 1DANH 1OP2A 1XKAC 3C27B 4TY7A 5EW1H 4NSVA 1ZHPA 3MO9A 2BD9A 4X6PA 2OC0A 1GBJA 2F9OA 2WV5A 2A4OA 1OXGA 1DVAH 4ZH8A 4FUIA 3ATIA 4U01A 2ZTXA 3AW1A 1ANEA 4Y0YE 1H9LB 3MWIU 5GIBA 3RC4A 5LGOA 2BQWB 1ELTA 3QWCH 4INKA 1TNKA 2AERH 1O2RA 2LNCA 3P8FA 3GCNA 3BTTE 1K9OE 1SVPA 1EAUA 1GCTB 1AZZA 1P2KA 4UFFH 1CBWB 4ISNA 2C8WB 1MBQA 1FNIA 1GBIA 1L0ZA 1QB9A 2Y82A 1BZXE 1FUJA 2P95A 4AG1A 8LPRA 4BAMB 1HIAB 3VGCC 4D8NA 1SQTA 1Y5UT 1ZHRA 1A1RA 3VB3A 1YPKH 2R0KA 1EPTC 1CGIE 1TAWA 4AFQA 1G32B 3GY5A 1C1OA 1O33A 4XE4A 5DP3A 1LHEH 1W11U 2BQ6B 2HPQH 3GYMA 4B74A 1IAUA 3GY2A 2C90B 1P11E 3HKJB 4DGJA 3TK5A 2GDEH 3SV2H 2AMDA 4BAQB 1C9PA 3M5NA 1GJBB 5FHTA 3PTBA 3EAJA 5EQRA 3Q3YA 1K22H 1DITH 4QT8C 1LMWB 1UK2A 1CHGA 1AKSB 2W7SA 5L2ZH 1O5CB 1QRXA 1FV9A 2R0LA 4J1YA 2ASUB 3MNSA 5E8EH 1UJ1A 1UTNA 1O3JA 1AY6H 1HAXB 4CRCA 4X8SH 2VH0A 3RC5A 4DJZB 1WUNH 1NFYA 1V2UT 1Y3YA 3A83A 1S82A 3UOUA 1NRPH 1LVBA 2ZU2A 3V13A 1D4PB 3ZZ5A 3MH7A 4A1XA 1ZMNA 1VCWA 2G4TA 4CBOA 2STBE 1YLDA 5F8TA 1AN1E 1YYY1 3S0NA 3NPSA 1O3FA 2BM2A 2I6QA 1QL7A 4YOJA 1PPHE 3IWMA 1FN6A 1AFEH 2ZEBA 3GOVB 3G01A 4THNH 2Q1JA 2XC5A 2Z9LA 1WOFA 1GMCG 4K5ZA 1TX7A 3SOSA 1IHTH 5CHAC 2QF3A 1QCPA 2FLRH 1T4VH 2QV1A 1TOMH 3ATKA 1F5KU 1DSUA 4FUEA 2FPZA 1PQAA 3QN7A 1EAIA 3TH2H 1C2JA 3DT0H 2G5NA 4ZXYH 4X8VH 4VGCC 1ZMLA 1L2EA 2ZHWH 3VEQB 1P2MA 4AYYB 4ZKRU 3BIUH 3V7TA 3RLWH 4ZHLU 1WQVH 1YPMH 1PPCE 1UVUH 1AMHA 2J34A 5C2ZA 2GKVE 1TMBH 1H1BA 1Y3UA 4BTTB 2O9QA 3TJNA 1UCYK 1C1RA 3K2UA 1V2LT 3T2NA 5A8ZA 1SMFE 1NU9A 3U8RH 1O5DH 3F9GA 3SORA 2A5IA 1F0RA 2SFAA 2UUJB 1KXAA 4WH8A 3RMMH 1AU8A 1CU1A 4GPGA 3B9FH 4I32A 2NU3E 4YOGA 4WMFA 1OX1A 1EJNA 1AD8H 4Z6AH 1EUFA 2CF8H 4BAHB 1QB6A 4CRGA 1O0DH 1TGTA 2BHGA 3QZRA 4Y7BA 1GHAG 2GCTB 2SNVA 3PWCA 4UFGH 2NU1E 5CE1A 4KGAA 3CS0A 2F9PA 4OS6A 1QY6A 2WYGA 2BD4A 4XBCA 3F9HA 1HUTH 3E0PB 3SU0A 1G30B 4H4FA 4INHA 2GZ8A 1O34A 5BPEA 1DWBH 3U69H 2Z9IA 1NM6A 3PROA 2XWAA 5A0AE 1GL1A 3P70B 3TNTA 1TBZH 1TMUH 1LHFH 2NU0E 1HAYB 1G37A 3I29A 1LTOA 4KTCA 7GCHF 1K1IA 1W13U 1MAXA 2QF0A 2ZDAH 3LH1A 5C1YA 1XUFA 1LHDH 2CJIA 1DT2A 2FOAA 3MYWA 1LPKB 5A09A 1BOQA 3SJKA 3KGPA 1W2KH 2FM2A 1HAIH 2AEIH 4HI3A 2QXIA 4ZMAH 1Z8RA 4AORA 3GY8A 1UCYH 1A3EH 1P2JA 3ATMA 1A5IA 3GYLB 1DS2E 2FOEA 4I8HA 2JH5D 3MU1A 4YOIA 3LJJA 2YNAA 2ZPRA 4RN6A 2EI7A 3BG4B 1O2SA 1TQ0B 1VITG 4NIYA 2XW9A 2YNBA 3BTHE 1HGTH 4DW2U 4CREA 2J2UA 1HYLA 5GJ4B 2OINA 4H6SB 1UHBB 2FLBH 2BXTH 3SNCA 1QIXB 2HLCA 2FZZA 3M7QA 2QYIA 4K3JA 1JBUH 4ESTE 2SNWA 1DICA 3MO6A 4A6LA 3BEFB 1F0TA 5JB8S 1AE8H 1O31A 1ELCA 4BAOB 4U32A 2BDYA 2CV3A 3F9EA 3LGVA 3NK8A 1SC8U 2ZC9H 2QAAA 5FPYA 1Y3WA 1EP6A 2F9UA 1ZSKA 4D7FA 1Z71A 3UUZA 1OKXA 2WUBA 5EPYA 2V3OH 3TU7H 3BTFE 1G2MA 2V6NA 2HNTE 4FUBA 4AOQA 3SNDA 1W7GH 2P94A 3FAOA 4KTUA 2GCHF 2UUFB 1OP8A 1BB0B 5EPNA 1KXBA 2PHBA 4K69A 2QY0B 2JH6D 3SU2A 1C2GA 1LQEA 3GY7A 1ESBA 2FMJA 1J15A 1GJ8B 1MCVA 2FDAA 3PYHA 1PJPA 3PM3A 2AIQA 4CRBA 1TX8A 2J94A 1C2EA 1LKBA 2V0BA 4O9VA 4JYUH 4U2WA 2AMQA 2G51A 1EAWA 2P16A 1GHZA 1IQFA 3BTQE 4BANB 5EG4A 3BV9B 1KSNA 1ETTH 4JZ1A 1BTPA 2OTVA 4I8JA 1DX5M 1N8OB 4Q2KA 3RXJA 2Q6GA 4WJG2 1HFDA 1EB2A 1ELBA 1QURH 3TGKE 4TPYA 1F5RA 1JRSA 3SV9A 1AQ7A 1BJVA 2FOHA 1QQ4A 1Z8GA 4IBLH 1AI8H 4B2CA 3UY9A 5JBCS 1E36B 4LZ4B 1V2MT 3PLBA 1W0ZU 3TPIZ 3M7UA 4A5TS 2OBQA 1MU6B 2C3SA 3PMAB 2FP7B 1GJDB 1XKBC 1ZTLA 3IG6B 2B8OH 1SLXB 5JPMH 4OS7A 3E0NB 2I6SA 1SOTA 1O2TA 4Y79A 1K28D 2C8ZB 4XOJA 1YC0A 1FAKH 1RTKA 1TPPA 4IC5A 1GL0E 5T6FA 1MQ6A 2A7JA 3ZZ6A 2ZPSA 3LGTA 3TGJE 3KQDA 1O3CA 1TIOA 1HRTH 3RLYH 1T8LA 2FX4A 1UTLM 2OQ5A 2SGAA 1MTNC 4ABGA 2CHAC 4JCNA 1WYKA 3BTKE 2P8OB 2BLOA 2BVSH 1O32A 2UUYA 1IQIA 1C4V2 1NU7B 1TYNA 2ZI2H 4MQAA 2ZA5A 1EQ9A 5LPEA 3LDXH 1K1JA 1GI4A 2FOGA 1CVWH 2BD7A 1GJ6A 2STAE 1O2HA 4WMEA 3M3SA 3SBKA 1AGJA 2QCYA 1WTGH 2A2XH 1IHSH 3ZZDA 2PSXA 4INLA 3LJOA 4GAWA 1V2ST 3GY3A 1EZSC 4AFSA 3Q3KA 1TRNA 3M37A 7ESTE 5DKMA 2JETB 1ZTJA 2FIRH 5C1XA 2P59A 5GCHF 1G36A 2AGIX 2BDCA 1FY4A 2C93B 1UK4A 2H2ZA 4AYVB 4JZFH 3RXRA 3ATLA 3A7YA 4WVPE 3LGIA 2RG3A 3RU4E 5EGMA 1CT2E 2G5VA 1UTQA 3VB6A 4DG4A 1GMHF 3LOXA 3FANA 4OGXA 5TCCA 1M9UA 8KME2 1EJAA 1FONA 4I8LA 3LGWA 1N1LA 4LXBH 3HGPA 5AVDA 3LPRA 2GP9B 3UR6A 1O2KA 1VGCC 1ZOMA 1TA6A 5L2YH 2VGCC 1SGQE 1PQ8A 3OY6U 1SQAA 3FP7E 4R0IA 1MAYA 1BRUP 2ZGBH 5DGJA 2ANWA 3TLOA 2DE9A 4GLYA 4AB9A 4AFZA 2VINA 1SOZA 1V2JT 4NCYA 1L1JA 1DE7H 1TBQH 1VCPA 1PQ5A 1QJ1B 2BYAX 1O2MA 2Z3EA 1ANCA 3BTDE 5AFZH 3BEIB 1GG6C 6CHAC 3GCTG 4WXIA 2A31A 1P2IA 2BXUH 3QGJA 1BJUA 1QFKH 5EQQA 3SJ9A 3U1IB 1F7ZA 2HNTF 1C1WH 5G4BA 3UNRA 4B2AA 1HAOH 2PUXB 3AAVA 1BMNH 2RA3A 2JKHA 2ZFPH 1UVTH 1S83A 3O8CA 1O3HA 1GHBF 1S0QA 3LH3A 4FVBA 2Y6TA 1YPGH 1P9UA 3MHWU 3MU0A 5DP6A 4ZKSU 1O3LA 2ZQ1A 3GY4A 3VB4A 2ZP0H 1B0FA 1TA2A 5C5NA 4AZ2B 1Q2WA 4HFPB 3S9CA 5FX5A 2ILNA 4JYTA 2SGEE 1GI6A 1AIXH 4GHTA 4R8TB 1HJ8A 5JBBS 2R9PA 3A85A 1C5NH 1TQ7B 5F03A 1C1VH 3QLPH 2TGTA 2Z3CA 1YBWA 1SGPE 3SZNA 3UR9A 1C5ZB 1UTPA 4CHAB 1O37A 2D2DA 3NKKA 4BXWA 5EW2H 2ZFRH 3SV6A 2XWBI 1THRH 1EASA 1RTLA 5IYTA 2A1DB 1LKAA 1W7XH 2WPKS 3GCOA 5GXPA 1FIZA 5ETXA 1UTKA 3GISB 3Q00A 3JZ2B 2J9NA 2THFB 1KTTB 3K65B 1G3EA 3SGAE 1L1GA 2AGGX 1KY9A 7LPRA 1OWDA 3T62A 1TPOA 2WUCA 2H5CA 2ZDNA 1AO5A 3ENSB 1HJAB 2G8TA 4ZAEA 1BRAA 1Y8TA 5LH8A 1GBLA 1SGEE 1DLEA 4XSKU 4FUFA 4TYDA 4ABFA 2W26A 4UE7H 4AN7A 4H6TA 4NA9H 3STIA 1FPCH 2QXGA 1K21H 1O2WA 3RXDA 4GCHG 1S84A 2XRCA 1TGSZ 1MTUA 2J95A 3MH6A 4DURA 5EXNA 3NCLA 2VVVA 1SSXA 1DFPA 1G3DA 4CRAA 1XX9A 4MNVA 5GPIB 4GHQA 3SI3H 3RUOA 4F4OC 1AB9C 1QHRB 4AG2A 1DWDH 1C2HA 1IOEA 1NRQH 4AX9H 4A92A 4UEHH 4YM9A 1SLUB 1C4U2 3FP6E 1XVMA 2HVXA 4YO9A 4HTCH 1LVMA 6LPRA 4ISHH 1SPJA 2ZCHP 1BTXA 3CS7A 1CA0B 1SGNE 1P10A 2TGPZ 5E0JA 3TITA 1LCYA 1S6HA 3QDZB 2H9TH 4NA7A 1GI1A 2M5TA 5E2OA 1ZPZA 1GCTC 1QBVH 3P17H 4MPXA 3A7VA 1BBRK 4NIXA 1CBWC 1Z7KA 1OWEA 4B73A 1WSSH 1LVOA 2XBVA 4X2VA 5L6NH 1BTZA 3E1XB 2EA3A 3U9AH 1OWJA 1GBMA 3A8CA 1A61H 2H1UA 1RFNA 3E91A 4Y7AA 3A87A 3A82A 2PGQB 1GVLA 1BMMH 1FXYA 2BOHB 2VIWA 1O2ZA 1JOUB 1QRZA 1BHXB 2TGAA 3QZQA 5DPAA 4TWYA 3Q76A 2VVCA 2FXRA 2ULLA 3KQCA 4Y76A 2BZAA 1ZSJA 1VCQA 1NS3A 2AYWA 1HAHH 3GDSA 2O8TA 1AWFH 6GCHF 1TNJA 4IC6A 3H7TA 3A89A 2VVUA 2Z9GA 1FDPA 1F92A 2ZDLA 3ZVDA 4MTBA 1MQ5A 4FU7A 1UHBA 3OYPA 2BZ6H 3TK6A 1O3KA 1LHCH 1O2PA 1LQDB 1ETSH 1O3IA 4VGCB 3UNQA 3RXPA 2XYAA 4NIVA 5GDSH 3SI4H 3V0XA 2FI5E 1HCGA 1O2YA 4KELA 3U98H 1AE5A 1G3CA 2CF9H 1O5AB 1YP9A 3T26A 1C5RA 3OSYA 1RXPA 1JIRA 3RXQA 2RDLA 1H9IE 1E34B 4E05H 1C5QA 1YPHE 1BBRH 1CT0E 2ZCLP 2KAIB 1L4DA 3ESTA 4XDEA 1GI9B 1P9SA 3PWBA 4YZUA 3BF6H 2FOMB 2FX6A 1C4Y2 1W0YH 1C5SA 2BY8X 2XNIA 2FO9A 1TNHA 1BTUA 1O2VA 1TRYA 5LPFA 3F6UH 3QTOH 5FPTA 2HOBA 1UTMA 1CHOG 3LIWA 1P3CA 4NIWA 4LZ1H 1Q3XA 5J4QA 2F9NA 1Z8IB 4Q7YA 4WH6A 2HPPH 3L33A 3C1KA 3L3TA 8GCHG 4IMQA 3A8DA 1Z6EA 1B5GH 1D3DB 1AVGH 3UQVA 1WV7H 1ZR0A 2IOTA 1KXDA 2OC1A 2ZIQH 4YLUA 3PLPA 3B23B 4X2YA 1CGHA 1YPJH 1CGJE 1IQMA 2H5DA 3F68H 9LPRA 1ORFA 1XUIA 1F0SA 4I8KA 4XFQA 2UUKB 5A0BA 1WAYB 2Z3DA 2PV9B 1QA7A 2GTBA 3U8TH 3E3TA 3ITIA 2FWWA 1SGFG 3UPEA 2WPMS 1BTHH 2BD2A 1TGNA 3QGNB 4WF8A 2UWLA 4X1RU 1ZJDA 1O5EH 2VIDA 2W5EA 1BHXF 3SUDA 1GBEA 2ZU3A 3NUMA 3ZVCA 4UFEH 1D6RA 1UTOA 4O97A 1NT1A 2F83A 1P04A 1HAZB 2HWLB