3CP7A

Crystal structure of a thermostable serine protease al20 from extremophilic microoganism
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
216
structure length
216
Chain Sequence
PADSPHIGKVFFSTNQGDFVCSANIVASANQSTVATAGHCLHDGNGGQFARNFVFAPAYDYGESEHGVWAAEELVTSAEWANRGDFEHDYAFAVLETKGGTTVQQQVGTASPIAFNQPRGQYYSAYGYPAAAPFNGQELHSCHGTATNDPMGSSTQGIPCNMTGGSSGGPWFLGNGTGGAQNSTNSYGYTFLPNVMFGPYFGSGAQQNYNYASTTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords alkaline serine protease AL20
publication title Crystal structure of an alkaline serine protease from Nesterenkonia sp. defines a novel family of secreted bacterial proteases
pubmed doi rcsb
total genus 62
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature ec 3.4.21.1: Chymotrypsin.
pdb deposition date 2008-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3cp7A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3cp7A02
3SU2A 4FUIA 5G4BA 1MTVA 1AMHA 1BTZA 3A84A 1IQIA 5ABWA 2CMYA 2WPHS 1T31A 3GY4A 2BOHB 1UCYK 3BTQE 4KKDA 3GY2A 3ZV9A 1T8MA 4KP0A 4UEHH 2FZZA 4D76A 1MBQA 3QTVH 3UQOA 2Q1JA 3IITA 3OX7U 2G5NA 4LZ1H 3LC5A 3SU0A 2PSYA 2QYIA 4Z0KA 1SGNE 3TJUA 1U6QA 1Z71A 4B1TA 8GCHF 5DGJA 3KQCA 3TNSA 1GI6A 3V0XA 1Q3XA 3STJA 2OXSA 2B7DH 1Z6EA 2PW8H 2GZ7A 3U1JB 1TNLA 5E0JA 5ETXA 1O3AA 4INKA 1FDPA 2ZECA 3RC5A 4ABEA 1EZUC 4M7GA 4ZKOU 4Y8YA 1SC8U 1UVOA 1EKBB 1THSH 1WAYB 4YT7H 3SNBA 1NN6A 2ODPA 1SLWB 2RCEA 2RG3A 5T6DA 8LPRA 2ZI2H 4CRCA 1EX3A 6GCHG 1BTWA 2GT8A 2TGPZ 1B0FA 1A5HA 2GCTC 3V12A 4ABDA 1HB0B 2C8WB 2J95A 3MFJA 1EZXC 5DP8A 5HM9A 1F5KU 1S0RA 3RM2H 3F9HA 1ZPZA 1ZHRA 1UK4A 1GI3A 1P2KA 4B76A 3A83A 2Y7ZA 1PQ5A 1O5AB 2FO9A 1GHXH 3PMJA 1L0ZA 1YKTA 2GMTB 4XBCA 1ELBA 3URCA 4ABBA 3M36A 1OWDA 4X2WA 1DUEA 4CBNA 2QA9E 2EEKA 1P57B 3F9EA 1NROH 2OINA 1MAYA 1SR5C 1MZAA 2A31A 2ZCKP 4UFFH 4ESTE 3RP2A 1WTHD 1J17T 1A61H 1RJXB 2NWNA 3TGIE 1GMCG 3EA8A 4NIXA 4CR9A 3P8OA 4OS1A 3STIA 3RMMH 1YPHE 1XXDA 3ZZ9A 1FV9A 3PWCA 1XM1A 1ID5H 3K9XB 1KYNA 1OP0A 4HTCH 5EODA 1S81A 1UTPA 2UWOA 3A8BA 2VVCA 1CGJE 2A0QB 2XBVA 1Y3YA 9ESTA 1DLEA 2A45B 4R0IA 3QUMP 1K1LA 4JZDH 2PSXA 1XUFA 5DK1A 3GDSA 3V7TA 3SNEA 2Z9JA 4BXSA 3BEUA 4ISOA 1DY8A 4JMYA 4WVPE 2B9LA 1OYTH 3QX5H 3UNSA 1O35A 4IN1A 1C2KA 3BTFE 1O2GH 3TPIZ 1TB6H 3QK1A 2ZA5A 5HGGA 1SQOA 2ZQ2A 2A32A 1N8OB 4AYYB 1GVLA 1BMAA 3V13A 3CS0A 3UWJH 3RUOA 3M7UA 5C3NA 1UJ1A 1AB9C 1AD8H 1O5DH 2HRVA 3O8BA 3MU0A 1BTHH 3E8LA 1JWTA 3SUFA 1IQHA 3TK6A 2ZFFH 1HRTH 1SGIB 2BDYA 5AVDA 2H9EH 1QL7A 5C20A 5FPSA 3LT3A 2IPHA 4WXVA 1DM4B 1P12E 2AERH 1ZLRA 1BUIA 1Z8JB 3SHAH 2FOGA 1CT4E 1D6RA 1O2VA 4NCYA 2UWPA 1CGHA 1PPEE 5A09A 2GCHF 4GUXA 4B2BA 3ZVEA 2WUBA 3SN8A 1P2IA 1DY9A 1G32B 1DXPA 3U8RH 2Q6DA 1DX5M 4U01A 4U32A 3U1IB 5SGAE 1SGDE 4TWYA 1XVMA 3B8JA 1Q2WA 3E0PB 1O2SA 2Y5FA 3VB5A 1F7ZA 3EA9A 4CREA 1W12U 2HVXA 1NPMA 3RXUA 2ZG0H 3RXKA 4DGJA 3A8DA 1NFYA 3UFAA 4Q7XA 3PMHB 3PO1B 1C1SA 2PUQH 4D9QA 4Y6DA 3GISB 5FPTA 2J38A 2PTNA 1EZQA 1XKAC 2AH4X 1LHGH 2VH6A 5GJ4B 1A3EH 1D4PB 3VB7A 4BTUB 5C5OA 2FOBA 4F49A 1PQ7A 3RXEA 1QJ6B 2FYQA 5HXFA 2SGPE 1W13U 2WUCA 2ZDVH 2PHBA 1ZYOA 1C4U2 1SMFE 2PTCE 4JK5A 3TK9A 5C1UA 2FOEA 2TPIZ 4TPIZ 1C2IA 1ZJDA 2BD4A 4NSVA 5HYOA 4ZROA 4BAHB 1A2CH 1D3PB 2QIQA 1SFQB 3FP8E 3QTOH 3A88A 1WUNH 1ZPBA 1O3NA 3P70B 3U8TH 5C1XA 2Z9KA 4K8YA 2ZHEH 3LOXA 2BQ6B 3SU1A 1QGFA 8KME2 4OGYA 3A7TA 1KLJH 5BRRE 4CRDA 3BTGE 3E91A 4ZAEA 1GHAG 2ZO3H 3SOSA 5LGOA 2WINI 5F8TA 1QY6A 1TRYA 1ZTKA 2ZU5A 3EE0B 3FZZA 1L1GA 3QGJA 1EAWA 1GBAA 3KF2A 1QHRB 1UO6A 2G52A 1NRQH 4J2YB 2W5EA 3E6PH 3UQVA 2BY8X 2PV9B 1GBEA 1ZSLA 4RKOB 4UDWH 1O2YA 4IBLH 4K1EA 4ZMAH 3RU4E 2PUXB 1SGPE 2F9UA 2B8OH 1G37A 2OUAA 4BXWA 1GHBF 3ZVFA 3BF6H 1V2VT 2YNAA 4RSPA 3GOVB 1EASA 1THPB 1EAXA 4K2YA 4LXBH 3P8FA 2Z3DA 1TBQH 3OY5U 1O0DH 7KMEH 3ZVAA 1MD7A 3NZIA 1YGCH 1A5GH 1NFXA 2H2ZA 1FMGA 2VIVA 2NU3E 4K1SA 4ABGA 4SGBE 3BV9B 1HUTH 1QRZA 4ABFA 1XXFA 2VGCB 3RLYH 1LVOA 3MNSA 1YP9A 1GGDC 5L6NH 1FAXA 2QAAA 3GY7A 3A86A 2WYJA 1GJCB 5EXNA 1F0SA 1O5BB 3N7OA 3EDXB 1Y3VA 2BD2A 3GY5A 2OBOA 5A8ZA 1A0JA 2Z3CA 5CE1A 1AWFH 3ENSB 2O8UA 1CHOF 2WYGA 1QRWA 5FX6A 2EI6A 1QRXA 1FONA 1NY22 1QQ4A 1GBKA 4Y76A 1TWXB 4Y8XA 2IN2A 2BVRH 4DY7B 2O8LA 1TABE 5A0CA 1FY3A 1TFXA 5FXLA 1A5IA 4XBDA 2PKSC 5FCRA 5GPIB 2XXLA 5FBIA 3M5OA 4DOQA 3ELAH 2BDIA 1KXFA 4MDSA 3QZRA 1ABJH 1PPHE 5FPYA 3DFJA 3ZZBA 1K1JA 1GMDG 1TGSZ 2EC9H 2ZCLP 1YM0A 2CF8H 4FU8A 2OC7A 2OQ5A 3KEEA 3HPTB 1EATA 1P10A 2IOTA 5GCHF 4Y71A 3A8AA 5JB9S 2QXGA 3KQDA 4X6MA 3M5NA 1P03A 2HPPH 1WCZA 2AFQB 2ZTZA 1YLCA 1BQYA 9LPRA 2R9PA 5L2ZH 3A81A 3T26A 2BQ7B 2ZDAH 2ZKSA 3SJIA 2VWLA 1PPGE 1MKXH 1TNKA 1DUAA 3MO3A 3BTWE 5AHGH 2BMGB 1P04A 3BTTE 3MNBA 1YPJH 4Q7YA 1SHHB 1RD3B 2NU2E 3M5LA 1W0ZU 5DP9A 4MNVA 4BTIB 3LC3A 1FIWA 1HJAC 1SGFA 2A7CA 1GJAB 1QJ1B 1FQ3A 1FJSA 2ODQA 5L30H 5A8YA 2K1QA 1P9UA 1GI9B 4RN6A 4XE4A 3ZZ3A 1H9IE 2D2DA 1O34A 3M61U 2WPMS 1O2HA 4AOQA 1O37A 1HAYB 1T8LA 4A6LA 1F92A 4XSKU 2QXHA 2QN5T 1W3CA 2V3OH 2W26A 4O3TA 3LH3A 5ESTE 2ANKH 1O2TA 3RDZA 1CE5A 1TPSA 2VIDA 4GLYA 1A1RA 3RLWH 1AWHB 1LCYA 1WSSH 2H9HA 4AFUA 2OCVB 3RMLH 2THFB 1SLUB 1E38B 2OC0A 4GCHG 4K8BA 1UHBA 5A0BA 2CV3A 3L3TA 1MD8A 3EQ0H 1H9HE 2EA3A 1C5RA 3BEFB 4X1SU 4NA8A 5ESBA 1O2ZA 1A0LA 4O3UA 1H8IH 2G4UA 2JETB 5JDUB 1GCTB 1TQ0B 1SGYE 1G3DA 1P8VC 3UR9A 1S82A 4JYVH 1GHZA 4IMZA 5DKMA 2AIPA 3P8GA 4MTBA 2F9NA 3ESTA 3TJOA 1E0FD 1ELAA 1SQAA 4D9RA 1C5LH 3MO6A 2WPKS 1K1NA 1HDTH 3IG6B 1L4DA 2EI8A 4NGAH 2A5IA 1J14A 1TNGA 1O3LA 2QF0A 3T25A 3LKWA 1C1WH 1GBTA 3SJOA 3VPKA 3RXIA 1BTPA 1C2DA 4I33A 2SFAA 5F8XA 4ZH8A 1C5PA 2FX4A 5JBTA 2ZIQH 4O03A 1ANBA 1MAXA 1OKXA 4JYUH 3SJKA 1C1VH 4GHQA 4GHTA 3S7HB 4E05H 4DG4A 1FPCH 2VIPA 2BXTH 4JCNA 3LJJA 4NWLA 4Q80A 3ZZ4A 4A1TA 1MH0A 1OWHA 1AFEH 3DUXH 1B5GH 3ZYDA 1YC0A 1ZSKA 4YESB 3MOCA 2GZ9A 5LPEA 3EA7A 3TU7H 1VITF 3GCNA 2O8TA 1O5EH 1OXGA 4CH8B 3BG4B 1TBZH 1TGNA 1UHBB 3PLKA 2RA0A 3QWCH 2FLRH 1O3OA 2UUFB 1W8BH 2ZC9H 1VCWA 4TY6A 3PM3A 1BHXB 1PQ8A 1AU8A 1GI1A 1VGCC 3RXJA 1ARCA 2OC1A 4IN2A 2VWNA 1FNIA 2F9VA 2FIRH 1EJAA 1O3IA 4THNH 1TLDA 2A4QA 4JZIA 2ZFRH 3RXLA 1K1OA 1AGJA 4YOJA 4CR5A 2BD8A 2F9PA 1ZHPA 4D7GA 1C1OA 4ZHAA 2BDGA 4AG2A 2Y7XA 4X1RU 1P3CA 1ELEE 1UVPA 3NKKA 1CGIE 4SGAE 1NU7B 1P2QA 1AZZA 2G8TA 1FLEE 4I8GA 2BDAA 2ZEBA 5CHAB 4UFGH 1MCVA 2Z7FE 1O3MA 1Y5BT 1UVTH 4MQAA 1GJ9B 4U30A 5EPNA 1BRAA 4CRGA 4E06H 3S69A 1C4V2 1DSTA 3MNXA 4Y79A 1YF4A 1ABIH 1O2KA 1Y3WA 1NU9A 1V2TT 2GCTB 4MNXA 2ZFPH 5F6MA 1C2HA 2FI3E 1VZQH 4WY3A 2UUJB 3HKIB 1ESBA 2G81E 1AHTH 1P11E 3MTYA 3M3SA 2HNTC 1Y3UA 1IQEA 5EQSA 2ODYB 1O2XA 4JZFH 1S85A 1O3BA 1ANEA 1GI8B 1GJ7B 3QDZB 1TQ7B 2QV1A 4MNWA 4OS5A 3QN7A 1WYKA 2GGVB 3TGKE 2GD4B 3PMAB 4Y7AA 1TMUH 5HMAA 3VB3A 6CHAB 3RMNH 3A7ZA 2O8MA 1EP6A 1QFKH 1UTNA 2A5AA 2B0FA 2P8OB 1EUFA 3AVZA 3ZZ7A 1NRRH 4XBBA 2Y5HA 5FX5A 2AIQA 2FPZA 1C5NH 3BN9A 2JH5D 1AN1E 1BRUP 1PJPA 3M5MA 5EPYA 1J8AA 2SGFE 1P2OA 2QXIA 1JIMA 1O5CB 4BTTB 2FOFA 4CRAA 5DP6A 3SZNA 1AVWA 3SO3A 2A4RA 1Z6JH 3A7XA 3ZZ8A 2TRMA 1EJMA 3UOUA 2ZPSA 1ELDE 1FY1A 1Y5AT 3SNAA 4AX9H 3AAVA 3S7KB 2VVVA 4RKJB 8GCHG 1WOFA 4I8JA 1ZRBA 1UMAH 3SU5A 1IQMA 3A7WA 2ZPRA 1Z8IB 3RXAA 2R0KA 5A2MH 1PPBH 2F3CE 4HZHA 1FI8A 4UFDH 4TYDA 3ZYEA 1MUEB 2FODA 2ZNKH 1HAPH 1G3EA 1C2MA 4FUFA 1O3JA 5E8EH 4A92A 4YLUA 1VITH 3M7TA 4Y11E 2TBSA 4ZUHA 1ESAA 2C8YB 1GBFA 1GVZA 1IQJA 2SGEE 3PV4A 2WV5A 3DD2H 3CP7A 4TPYA 2AS9A 5IDKA 4Z6AH 1LHCH 4X8SH 1EOLA 1LDTT 4DJZB 4KELA 3EYDA 2J2UA 2R2WU 1GI2A 1T4UH 2A2QH 1BJUA 2C3SA 2NU4E 1TNIA 3GY8A 1MQ6A 4JZEH 4A7IB 2QXJA 1ELTA 1NTPA 1SLXB 2BZAA 3TIUA 3UTUH 1TYNA 3RXBA 1MQ5A 2A7JA 1T8OA 2GDEH 3UREA 2PGQB 1TA2A 1BITA 1THRH 6ESTA 2CN0H 1ORFA 1KXAA 3SORA 1O5FH 3Q3YA 2G55A 1K22H 2F9OA 2BLVA 1GI7B 3GCHC 2STBE 1TNHA 4K3JA 1ELGA 2ZGHA 5E2PA 1HAOH 2ZHFH 2R2MB 3SU4A 4AYVB 1AIXH 1WV7H 3SJ8A 1BMLA 1QJ7B 4WF8A 4NG9H 3ZVGA 1WU1A 1GI4A 2A2XH 2D26C 4OS4A 2XWBI 1BIOA 1C1RA 4ZKRU 1KDQA 1O2NA 4OS2A 4IC6A 1TX8A 4O97A 1TAWA 1MMJN 2ZPQA 1OP8A 1WQSA 1NS3A 2F83A 2PGBB 5I25A 2OLGA 2ZGXH 4NA9H 3LU9B 1CBWC 1DXWA 1TALA 3LGWA 2BX3A 2OD3B 4E7NA 2A4GA 5FCKA 2CHAC 1MTSA 4XOJA 2BDBA 1F0RA 2YNBA 3O8CA 3T62A 2V35A 3I29A 4VGCC 4ASHA 2ZWLH 1YPLH 3ODDA 1HYLA 2ZGBH 1S84A 2DE8A 1GBDA 2PWXA 3T5FH 2ZCHP 1P02A 1KSNA 2OBQA 3VGCC 3FP6E 5H4IB 1HAGE 3KHVA 3RXPA 1Y3XA 2PR3A 2BLQA 1N6XA 1BTYA 4I8KA 5FBEA 2P3TB 4DT7B 3TK5A 4UD9H 4X8UH 3FANA 5J4SA 1RTFB 1Y8TA 3MU4A 3RXHA 4YO9A 1KXCA 1GBIA 2ZDNA 4LZ4B 1SHYA 2ZZUH 4Y0YE 2AGGX 2Q6GA 1FN6A 1CA0C 2P95A 1C2LA 2QC2A 1K21H 2Z6BD 4FU7A 4UONA 1LQEA 3CENA 7GCHF 5EW1H 1QB6A 3WY8A 3EAJA 4H6SB 1BZXE 1KDQB 2AEIH 1BJVA 2W3KA 4CBOA 1DPOA 1GI5A 5EGMA 5EOKA 1UTOA 2G5VA 1N6YA 3BG8A 2ZHQH 1QBNA 3FAOA 4BNRA 1KTTB 1VCQA 1FY4A 3PYHA 4AGJA 1C4Y2 4AB8A 1RTKA 4CHAC 1K1IA 2VB0A 2A5KA 1XUIA 2PLXA 1OOKB 2OP9A 1K28D 1V2OT 5GXPA 5C5NA 1F2SE 1O3CA 1GBJA 4I31A 1DICA 1C9PA 2HLCA 1NC6A 1FIZA 1O3DA 1KLTA 3A7YA 1IQGA 3A85A 4NIYA 2HGTH 4ISLA 1H8DH 1BMMH 3GCTG 2XC0A 1GDUA 1UTMA 1LKAA 1MU6B 1TX7A 2STAE 1LHFH 3U98H 1OWKA 3KNXA 4X6PA 1GMDF 5L2YH 3L6PA 1GGDB 1ZTJA 1OS8A 2BQWB 5GWZA 2LNCA 1YYY1 1MU8B 3F9FA 2ANMH 1ZZZA 5EU8A 1ELVA 2VIWA 1OWJA 1XVOA 4YT6H 1BA8B 2XTTB 3E0NB 1HNEE 5GDSH 3SUDA 2BY5X 2GV7A 4B2AA 2GT7A 1S6FA 2ZQ1A 1G2MA 2BXUH 4FUHA 2G00A 4J1YA 1S5SA 3MU1A 4ABJA 1E37B 1B7XB 1H4WA 3UNRA 3BTHE 2J9NA 2HPQH 1UTKA 1ETRH 5LPFA 3UY9A 1GBCA 2ANYA 2J94A 1DWCH 1EPTC 2FS8A 2VH0A 1AVGH 4Y10E 2PKSB 3S9BA 1E35B 4X1QU 3SGQE 3OU0A 3SV6A 1J16A 2I6SA 3T2NA 1T8NA 2RA3A 4JZ1A 2Z9GA 3JZ1B 1A46H 1QR3E 4NWKA 3R0FA 4FUJA 4QT8C 2P94A 1W2KH 1HAHH 1EXFA 2BLWA 3TJVA 1TBRH 1G3CA 1FUJA 3UOPA 4KGAA 1HBTH 2DUCA 1GL1A 4BAOB 1T7CA 2ASUB 1OWEA 2XBYA 4AGKA 4X6OA 3M35A 1CVWH 1ZMLA 1AFQC 5HM2A 1GJ4H 4WH8A 1OX1A 1J9CH 1TGBA 4AFQA 2XW9A 3TH4H 1DS2E 1BRCE 1AE5A 4NZLA 5AF9H 1GBLA 1TX6A 4IGDA 1Y59T 4HFPB 1NRNH 3EGKH 4B2CA 1V2ST 2QF3A 1Z7KA 5JBAS 1W7GH 1JXPA 3HKJB 1HJAB 3P92A 3ZZDA 1ARBA 4NFFA 3SUGA 3S9AA 1TMTH 2TIOA 5TJXA 1OWIA 3GYLB 1C5UA 1DFPA 1GMHF 2KAIA 3P8NA 1IHSH 1PPCE 3ZZAA 1K1MA 1O2RA 1V2LT 1W7XH 1J15A 3D65E 5EW2H 1C1NA 1BOQA 2ZTXA 3NK8A 1XMNB 2GVFA 1V2KT 1FPHH 4H6TA 1P06A 2TGDA 1DDJA 3MH4A 1BT7A 1ZMNA 1AY6H 1IHTH 1O3KA 1FAKH 3LONA 3LGUA 1KXEA 4AB9A 2SGAA 3HGNA 4ISHH 1CHOG 1GDNA 1KY9A 2FTMA 1S83A 2D1JA 2BY9X 4XFQA 1JBUH 1RIWC 4FVBA 1WQVH 2JH6D 4ZKSU 1S6HA 4IC5A 2IJOB 1CT0E 1QTFA 1QURH 1DOJA 3GY6A 1FXYA 2FP7B 1LPKB 3Q77A 5JBBS 1TRMA 3VXEH 2FM2A 1Z1IA 1HPGA 3QZQA 1QNJA 4Q2KA 1P9SA 3E90B 1LMWB 1D3QB 1XUHA 1YPMH 5E2OA 1BRBE 1V2QT 1HIAA 1VJAU 1S0QA 3BTDE 2P93A 3Q76A 2G4TA 5LH8A 4XDEA 1NM6A 4HGCA 5JB8S 4ZHLU 1EQ9A 2ZF0H 3LIWA 1BHXF 1P2NA 1HJ9A 1IAUA 1NT1A 1K2I1 2Z9IA 2BY7X 2C90B 1SGRE 1YCPK 3MI4A 2KAIB 4WMFA 4MPXA 3D23A 3ZZ5A 4UE7H 2P3FH 2OQUA 3BIVH 4MLFB 4BAQB 1ACBE 4AN7A 3Q3KA 2FX6A 2BYAX 1C5ZB 1D3TB 3P95A 3ZVDA 1PPZA 5J4QA 4ISIH 1RS0A 2FESH 3B9FH 2O8WA 2F9BH 2QCYA 2W7UA 4TY7A 3V3MA 4X2VA 5E0GA 4OS7A 1XUGA 3SV9A 4NZQA 4DIIH 2ALVA 3LGYA 3TNTA 2O9QA 1GG6C 1UCYE 2BD9A 1IQNA 3K6YA 1C2EA 2XCFA 3SQHE 1HV7A 7LPRA 1LPGB 1GBBA 4WH6A 1C5MD 1KIGH 1EOJA 1ZMJA 1D6WA 2Y5GA 2CJIA 3C27B 3SV2H 1TA6A 1O3PB 1VGCB 2G51A 1BMNH 2P3UB 4DURA 3RU4D 1DSUA 1YPKH 5T6GA 3RC4A 1TMBH 2UUKB 3KQEA 4NIVA 3RXTA 1YPHC 3U8OH 2BOKA 1INCA 6GCHF 1B0EA 1MKWH 1AQ7A 4DW2U 4YOGA 3T27A 1SI5H 1HIAB 2ZU3A 2FOCA 1MTNC 4KTUA 4JK6A 2BM2A 2XWAA 3IWMA 3TLOA 2PKAB 3URDA 1GL0E 2GKVE 3MU5A 4I8LA 1OPHB 1ETSH 1P09A 1C5XB 2Y81A 1ZHMA 1A0HB 1V2RT 2Y6TA 1UTJA 3FFGA 3T28A 1ZGVA 4PROA 1UTQA 1ZSJA 2WV4A 3BG4C 1H1BA 1O2QA 1V2UT 2XNIA 3TITA 1TPPA 2ZFSA 3RXVA 8ESTE 1YPEH 1C9TA 1GBHA 4NIWA 1FZZA 3LPRA 4ZKNU 1Y5UT 1LO6A 3ATMA 4YTAA 3MH6A 1GMCF 2ZFQH 4GAWA 1LVBA 2FYRA 1C5QA 5C67A 2BY6X 3H7TA 4WJG2 4ABHA 3F68H 2BHGA 1C1MA 5F03A 4OGXA 3DA9B 3PLBA 1LHDH 2M5TA 3VB4A 3TVJB 4MPVA 4WMDA 2ZGCA 1O2WA 2BB4A 2C93B 2QY0B 5DO4H 1MCTA 2V3HH 2Y82A 2C8ZB 5C1YA 1XUJA 2JKHA 3M37A 1C1PA 3HK3B 1HAVA 1O3FA 1O32A 2BDHA 2OC8A 4WMEA 4MPUA 1CU1A 1QQUA 4K69A 1DE7H 2BZ6H 3LGIA 4X2XA 4GVUA 2ANWA 1AZ8A 1CO7E 1VITG 3RXSA 5CHAC 1HXEH 3KCGH 5B6OA 2I6QA 4R8TB 5JBCS 5A8XA 4D7FA 4YM9A 1WBGB 4UFEH 3F9GA 3ZVBA 2XC4A 2GV6A 1MTWA 1EB2A 1EJNA 1NESE 3DT0H 1PYTD 1AE8H 2FDAA 1L2EA 1AVXA 1P0SH 1E36B 4E7RG 3RMOH 2CF9H 3LGVA 5EG4A 2ZP0H 1QCPA 3LGTA 3PROA 2AGEX 3BIUH 3BTME 3MMGA 1O3GA 1C2FA 4WXIA 1C2JA 2FMJA 3VXFH 5DP3A 4HI3A 2BTCE 1TGTA 2J34A 2GDDA 4K60A 4DVAU 1SGCA 3MH7A 5DPAA 1L1JA 3M3VA 1MKWK 1CSOE 1WTGH 1L1NA 3P17H 1O5GH 6CHAC 1AI8H 2SGDE 2GMTC 5K7RA 2P8OC 1X7AC 1TPOA 2BDCA 2BD7A 4INLA 4INHA 3T29A 1DWEH 1CT2E 3R3GB 4U2WA 2FOMB 1GVKB 1M9UA 3SGBE 3OYPA 2BD3A 3MNCA 1ZTLA 2A1DB 1SFIA 1JRSA 1LQDB 1A3BH 4CRFA 3A82A 1MZDA 1UK2A 1HAVB 1TIOA 1ANDA 2P16A 3GICB 3RXMA 1HCGA 1LKBA 1AB9B 3M7QA 2UUYA 3FVFB 1XUKA 1DWDH 4X8VH 3S0NA 6LPRA 3PB1E 3TJNA 2WPJS 4LOYH 1F5RA 3Q00A 2FI4E 3KL6A 3OSYA 3E3TA 4K1TA 3SI4H 2ZTYA 1GWAA 3GCHB 4H42U 1G30B 1JRTA 3AW1A 3UIRA 2XRCA 1TPAE 1O2IA 1V2WT 4Q7ZA 1C5WB 1F0TA 1GCDA 1YBWA 2EI7A 1ZGIA 3G01A 2B5TB 4ZXYH 5DJ7A 1N8OC 3RM0H 1SB1H 1P3EA 4X6NA 4DCDA 5EQRA 4BANB 1JIRA 2GTBA 3NUMA 5T3HA 1F0UA 1GJBB 3ATKA 5E0HA 1OYQA 2CXVA 4I32A 4KTCA 1BTXA 2HNTE 1HAXB 4OS6A 1C5TA 3A80A 3K65B 1QBOA 1SQTA 4WWYA 1C5YB 1CBWB 4LK4A 1HAIH 1YLDA 1D9IA 2VWOA 3U69H 1Z8RA 2AGIX 2CHAB 2VWMA 1RGQA 3A89A 1ANCA 3OY6U 1CHGA 1TRNA 2ZFTA 4VGCB 3MU8A 1G2LA 3DHKH 1LHEH 4NSYA 1GHAF 2R0LA 3MYWA 1QB9A 2FXRA 2FOAA 2ZU1A 4ABAA 1O38A 5DP7A 4X1NU 4MVNA 2ZHDA 3VGCB 1YPGH 3HK6B 1VCPA 3JZ2B 1LTOA 3F1SB 1E34B 5AFZH 1GI0A 1VR1H 1GHYH 4NA7A 1K9OE 2VU8E 1IQFA 4YZUA 1JOUB 4FUEA 1BTUA 5IYTA 4NFEA 3D49H 4IMQA 3O8RA 5BPEA 1OP2A 1GPZA 2SNVA 2AMDA 1SSXA 2OTVA 1TGCA 1NO9H 1CA0B 1QBVH 3BSQA 4BOHA 3RC6A 1UK3A 1FY5A 2SGQE 3GCTF 1V2PT 5I46H 1ELCA 3BTEE 3PO1C 1W0YH 3E1XB 2UWLA 4YOIA 1TE0A 2FI5E 3HGPA 1SOTA 1EPTA 3A8CA 4GPGA 4FUCA 3BTKE 2V6NA 1HXFH 2PFEA 2XYAA 4CRBA 2GCHG 1ESTA 3FZDA 3LJOA 4CHAB 3ITIA 1O2OA 5EQQA 1V3XA 3D62A 2FWWA 5FHTA 5LPRA 5F8ZA 3RU4T 3SBKA 4A5TS 3UPEA 2BVXH 3UR6A 3QGNB 3W94A 1PYTC 3TH3H 3ODFA 3OTJE 1C1QA 1FN8A 3K6ZA 3MH5A 3SJ9A 2A4OA 3GDVA 5PTPA 3PWBA 1BB0B 5CMXH 3SNCA 1QA7A 2D8WA 1O2PA 1PFXC 4B73A 1CA8B 1O39A 3RXGA 1CQQA 1ETTH 3A87A 3SGAE 2H6MA 1HAZB 1O3HA 2CGAA 2VIQA 1V2NT 2NU0E 3GY3A 4Y8ZA 1EAUA 1JMOH 2XC5A 3C1KA 4IW4E 1H9LB 1GJDB 3SUEA 1GJ8B 3TGJE 3VFEA 1DITH 1V6DA 1KXBA 3QO6A 3UUZA 2H5CA 4B74A 4FU9A 2LPRA 1KXDA 2VJ1A 1C5VA 2ZU4A 1QA0A 4GSOA 4A1XA 2P59A 3SV8A 2H9TH 5GIBA 1EPTB 2ILNA 1AKSA 2ZDKA 2FEQH 3H5CB 1A4WH 1QB1A 2BX4A 3GCOA 4H4FA 2AMQA 7GCHG 2VINA 4I7YH 1SGEE 4ABIA 1T32A 1UTLM 3NCLA 1DLKB 5AFYH 4JYTA 2VNTA 3RXOA 1C1UH 2ULLA 4CH2B 2WPLS 2Z94A 3W95A 4MG3A 2R3UA 2WPIS 3SU3A 1EB1H 3AW0A 3RXQA 3MWIU 2VGCC 1SL3A 1SLVB 1BDAA 2FTLE 1GJ5H 4FUDA 1GHVH 2Z3EA 1AFQB 3PTNA 1DVAH 1C5SA 5T6FA 2R3YA 2XBXA 1DT2A 1RRKA 3VEQB 5K0HA 1YCPH 1RFNA 1L4ZA 3KQBA 1G3BA 1GHBG 3HATH 3ZZ6A 4X8TH 3UNQA 3SI3H 1EP5A 2BD5A 3SV7A 1IOEA 1C2GA 3RXRA 3ATWA 1NFUA 1NFWA 1ELFA 1P01A 1T4VH 4GCHF 2ESTE 4B71A 1K1PA 2J92A 2AMPA 1OSSA 2VIOA 1SGTA 4YLQH 1W10U 1GDQA 1O3EA 2FOHA 2FS9A 2Q6FA 3AASA 3H7OA 1QL9A 3GYMA 3L33A 4FVDA 1A7SA 4K5ZA 1G9IE 2YOLA 1GJ6A 1PQAA 3ZV8A 4AG1A 2ZU2A 1EAIA 1SGQE 3SU6A 3KGPA 3NPSA 2H5DA 4AFSA 2A7HA 1HLTH 3RXCA 1AKSB 2Z9LA 1BCUH 3UWIA 3ATIA 5TCAA 1Z8GA 5JYIA 2HOBA 1XX9A 3NXPA 4MNYA 1VJ9U 3O8DA 1W14U 4D8NA 1RIWB 1AUJA 1ZPCA 4X0WU 1KLIH 4X1PU 4O9VA 3KIDU 1TOCB 2HWLB 3DFLA 5DP4A 2TGTA 3NWUA 1MBMA 4ISNA 2VVUA 1PPFE 1ZOMA 5C2ZA 1BBRH 1O36A 3SW2B 4KTSA 1SPJA 3I77A 3RXFA 2XCNA 3P6ZB 1SOZA 3PLPA 1F5LA 4ZHMU 5GCHG 3SQEE 2ZGJA 1UCYH 2GP9B 4BAMB 3LDXH 4I8HA 5A0AE 1Q31A 3F6UH 3GDUA 1KTSB 2PKAA 5EXLA 1D3DB 2F91A 3SHCH 2BLOA 4F4OC 3QLPH 1FY8E 2RDLA 2XBWA 1ZJKA 1DWBH 4Y0ZE 1AUTC 1O31A 3ZVCA 3Q3XA 2ZDLA 4X2YA 5JPMH 3AAUA 3K2UA 1GMHG 4AZ2B 2H1UA 2HALA 1P2JA 3MHWU 1G36A 3PMBB 1NRPH 2GX4A 1SVPA 2ZDMA 5DG6A 5DP5A 1YCPM 3FP7E 1V2JT 2J4IA 5TCCA 2C4FH 2C8XB 1NRSH 1Z1JA 3KN2A 1IQLA 4IS5A 4FUBA 2JETC 3A7VA 3LH1A 1GCTC 4BAKB 1TOMH 2ZHWH 3ZZCA 1NZQH 1EZSC 1BBRE 1O2JA 1V2MT 1UVSH 1GG6B 1RTLA 1SG8B 5EXMA 3E16B 2TGAA 1HGTH 1SGFG 3U9AH 2SNWA 2Y80A 2DE9A 1O2MA 3BEIB 1O30A 4FXGH 1AO5A 1O2UA 3SNDA 1IQKA 1P2MA 1GBMA 1O2LA 4Y7BA 3B23B 1W11U 3VB6A 4AORA 4MPWA 1MKXK 1RXPA 1XKBC 4B75A 1MTUA 1HJ8A 2QGRA 4ZXXH 3PTBA 4FUGA 2HNTF 1ZRKA 2V0BA 1ZR0A 2GZ8A 1SBWA 1MTNB 1LPZB 3ATLA 3M3TA 2FLBH 1QIXB 1GHWH 3MO9A 5FAHA 1TONA 1HFDA 2JH0D 3I78A 4TWWA 1LVYA 3CS7A 1C5OH 2AYWA 2NU1E 3RXDA 3TH2H 1P05A 2BVSH 1N1LA 1UVUH 1TNJA 4DIHH 1DANH 1QL8A 7ESTE 1LVMA 2ALPA 2W7SA 4A1VA 1C1TA 1BBRK 1O33A 3S9CA 2W3IA 4AFZA
chains in the Genus database with same CATH superfamily
1MABB 3SU2A 4FUIA 5G4BA 1MTVA 1AMHA 2L74A 1BTZA 3A84A 1IQIA 5ABWA 2CMYA 2WPHS 1T31A 3GY4A 2BOHB 1UCYK 3BTQE 4KKDA 3GY2A 3ZV9A 3OFND 1T8MA 4KP0A 4UEHH 2FZZA 4D76A 1MBQA 3QTVH 3UQOA 2Q1JA 3IITA 3OX7U 2G5NA 4LZ1H 3LC5A 3SU0A 2PSYA 2QYIA 4Z0KA 1SGNE 3TJUA 1U6QA 1Z71A 3AK5A 4B1TA 8GCHF 5DGJA 3KQCA 5EJLA 3TNSA 5B6LA 1GI6A 3V0XA 1Q3XA 3STJA 2OXSA 2B7DH 1Z6EA 2M2AA 2PW8H 2GZ7A 3U1JB 1TNLA 5E0JA 5ETXA 1O3AA 4INKA 1FDPA 2ZECA 3RC5A 4ABEA 1EZUC 4YXWD 1E1QD 4M7GA 4ZKOU 4Y8YA 1SC8U 1UVOA 1EKBB 1THSH 1WAYB 4YT7H 3SNBA 1NN6A 2ODPA 1SLWB 2RCEA 2RG3A 5T6DA 8LPRA 2ZI2H 4CRCA 1EX3A 6GCHG 1BTWA 2GT8A 2TGPZ 1B0FA 1A5HA 2GCTC 3V12A 4ABDA 1HB0B 2C8WB 2J95A 3FO8D 3MFJA 1EZXC 5DP8A 5HM9A 1F5KU 1S0RA 3RM2H 2KM0A 3F9HA 1ZPZA 1ZHRA 1UK4A 2KCAA 1GI3A 1P2KA 4B76A 3A83A 2Y7ZA 1PQ5A 1O5AB 2FO9A 2JDID 1GHXH 3PMJA 1L0ZA 1YKTA 2GMTB 4XBCA 1ELBA 3URCA 4ABBA 3M36A 1OWDA 4X2WA 1DUEA 4CBNA 2QA9E 2EEKA 1P57B 3F9EA 1NROH 2OINA 1MAYA 1SR5C 1MZAA 2A31A 2ZCKP 4UFFH 4ESTE 3RP2A 1WTHD 1J17T 1A61H 1RJXB 2NWNA 3TGIE 1GMCG 3EA8A 4NIXA 4CR9A 3P8OA 4OS1A 3STIA 3RMMH 1YPHE 2QF4A 1XXDA 3ZZ9A 1FV9A 3PWCA 1XM1A 1ID5H 2J97A 1KYNA 1OP0A 3K9XB 4HTCH 5EODA 1S81A 1UTPA 2UWOA 3A8BA 2CK3D 4Q4LA 2VVCA 1CGJE 2A0QB 2XBVA 1Y3YA 9ESTA 1DLEA 2A45B 4R0IA 3QUMP 1K1LA 4JZDH 2PSXA 1XUFA 5DK1A 3GDSA 3V7TA 3SNEA 2Z9JA 4BXSA 3BEUA 4ISOA 1DY8A 4JMYA 4WVPE 2B9LA 1OYTH 3QX5H 3UNSA 1O35A 4IN1A 1C2KA 3BTFE 1O2GH 3TPIZ 5KGOA 1TB6H 3QK1A 2ZA5A 5HGGA 1SQOA 2ZQ2A 2A32A 1N8OB 4AYYB 1GVLA 1BMAA 3V13A 3CS0A 3UWJH 3RUOA 3M7UA 5C3NA 5EJ1A 1UJ1A 1AB9C 1AD8H 1O5DH 3F2HA 2HRVA 3O8BA 3MU0A 1BTHH 3E8LA 1JWTA 3SUFA 1IQHA 3TK6A 2ZFFH 1HRTH 1SGIB 2BDYA 5AVDA 2H9EH 1QL7A 5C20A 5FPSA 3LT3A 2IPHA 4WXVA 1DM4B 1P12E 2AERH 1ZLRA 2IJD1 1BUIA 1Z8JB 3SHAH 3WWFA 2FOGA 1CT4E 1D6RA 1O2VA 3F0PA 4NCYA 2UWPA 1CGHA 1PPEE 5A09A 2GCHF 4GUXA 4B2BA 3ZVEA 2WUBA 3SN8A 2HVYB 1P2IA 1DY9A 1G32B 3SYJA 1DXPA 3U8RH 2Q6DA 1DX5M 4U01A 4U32A 3U1IB 5SGAE 1SGDE 4TWYA 1XVMA 3B8JA 1Q2WA 3E0PB 1O2SA 2Y5FA 3VB5A 1F7ZA 3EA9A 4CREA 1W12U 2HVXA 1NPMA 3RXUA 5C17A 2ZG0H 3RXKA 4DGJA 3A8DA 1NFYA 3UFAA 4Q7XA 3PMHB 3PO1B 1C1SA 2PUQH 4D9QA 4Y6DA 3GISB 5FPTA 2J38A 2PTNA 1EZQA 1XKAC 2AH4X 4B6FA 1LHGH 2VH6A 5GJ4B 1A3EH 1D4PB 3VB7A 4BTUB 5C5OA 1W0JD 2FOBA 4F49A 1PQ7A 3RXEA 1QJ6B 2FYQA 5HXFA 2SGPE 4AC9A 1W13U 2WUCA 2ZDVH 2PHBA 1ZYOA 1C4U2 1SMFE 2PTCE 4JK5A 3TK9A 5C1UA 2FOEA 2TPIZ 4TPIZ 1C2IA 1ZJDA 2BD4A 4NSVA 5HYOA 4ZROA 4BAHB 1A2CH 1D3PB 2QIQA 1SFQB 3FP8E 3QTOH 3A88A 1WUNH 3DSOA 1ZPBA 1O3NA 2XNDD 3P70B 2PP6A 3U8TH 5C1XA 2Z9KA 4K8YA 2ZHEH 4FOUC 3LOXA 2BQ6B 3SU1A 1QGFA 8KME2 4OGYA 3A7TA 1KLJH 5BRRE 4CRDA 3BTGE 3E91A 4ZAEA 1GHAG 2ZO3H 3SOSA 5LGOA 2WINI 5F8TA 1E1RD 1QY6A 1TRYA 1ZTKA 2ZU5A 3EE0B 3FZZA 1L1GA 3QGJA 1EAWA 1GBAA 3KF2A 1QHRB 1UO6A 2G52A 1NRQH 3FN8A 2W5EA 3E6PH 4J2YB 3UQVA 4RT1A 2BY8X 3N7DA 2PV9B 1GBEA 1ZSLA 1NBME 4RKOB 4UDWH 1O2YA 4IBLH 4K1EA 4ZMAH 3RU4E 2PUXB 1SGPE 2F9UA 2B8OH 1G37A 2OUAA 4BXWA 1GHBF 3ZVFA 2KR7A 3BF6H 1V2VT 2YNAA 4RSPA 3GOVB 1EASA 1THPB 1EAXA 4K2YA 4LXBH 3P8FA 2Z3DA 1TBQH 3OY5U 1O0DH 7KMEH 3ZVAA 1MD7A 3NZIA 1YGCH 1A5GH 1NFXA 2H2ZA 1FMGA 2VIVA 2NU3E 4K1SA 4ABGA 4SGBE 3BV9B 1HUTH 1QRZA 4ABFA 1XXFA 2VGCB 3RLYH 1LVOA 2V3MA 3MNSA 1YP9A 1GGDC 5L6NH 1FAXA 2QAAA 3GY7A 3A86A 2WYJA 1GJCB 5EXNA 1F0SA 1O5BB 3N7OA 3EDXB 1Y3VA 2BD2A 3GY5A 2OBOA 5A8ZA 1A0JA 2Z3CA 5CE1A 1AWFH 3ENSB 2O8UA 1CHOF 2WYGA 1QRWA 5FX6A 2EI6A 1QRXA 1FONA 1NY22 1QQ4A 1GBKA 4Y76A 1TWXB 4Y8XA 2IN2A 2BVRH 4DY7B 2O8LA 1TABE 5A0CA 1FY3A 1TFXA 5FXLA 1A5IA 4XBDA 2PKSC 5FCRA 5GPIB 2XXLA 5FBIA 3M5OA 4DOQA 3ELAH 1H8ED 2BDIA 1KXFA 4MDSA 2GJGA 3QZRA 1ABJH 1PPHE 5FPYA 3DFJA 3ZZBA 1K1JA 1GMDG 1TGSZ 2EC9H 2ZCLP 1YM0A 2CF8H 4FU8A 2OC7A 2OQ5A 3KEEA 3HPTB 1EATA 1P10A 2IOTA 5GCHF 4Y71A 3A8AA 5JB9S 2QXGA 3KQDA 4X6MA 3M5NA 1P03A 2HPPH 1WCZA 2AFQB 2ZTZA 1YLCA 1BQYA 9LPRA 2R9PA 1OHHD 5L2ZH 3A81A 3T26A 2BQ7B 2ZDAH 2ZKSA 3SJIA 4DT4A 2VWLA 1PPGE 1MKXH 1TNKA 1DUAA 3MO3A 3BTWE 2LELA 2BMGB 1P04A 5AHGH 3BTTE 3MNBA 1YPJH 4Q7YA 1SHHB 1RD3B 2NU2E 3M5LA 1W0ZU 5DP9A 4MNVA 4BTIB 3LC3A 1FIWA 1HJAC 1SGFA 2A7CA 1GJAB 1QJ1B 1FQ3A 2W6ID 2QE7D 1FJSA 2ODQA 5L30H 5A8YA 2K1QA 1P9UA 1GI9B 4RN6A 4XE4A 3PV2A 3ZZ3A 1H9IE 2RFKC 2D2DA 1O34A 3M61U 2L6OA 2WPMS 1O2HA 4AOQA 1O37A 1HAYB 1T8LA 4A6LA 1F92A 4XSKU 3N99A 2QXHA 2QN5T 1W3CA 2V3OH 2W26A 4O3TA 3LH3A 5ESTE 2ANKH 1O2TA 3RDZA 1CE5A 4OM9A 4RI0A 1TPSA 2VIDA 4GLYA 1A1RA 3RLWH 5F53A 1AWHB 1LCYA 1WSSH 2H9HA 4AFUA 2OCVB 3RMLH 2THFB 1SLUB 1E38B 2OC0A 4GCHG 2AHME 4K8BA 1UHBA 5A0BA 2CV3A 3L3TA 1MD8A 3EQ0H 5C0UA 1H9HE 2EA3A 1C5RA 3BEFB 4X1SU 4NA8A 5ESBA 1O2ZA 1A0LA 4O3UA 1H8IH 2G4UA 2JETB 5JDUB 1GCTB 1TQ0B 1SGYE 1G3DA 1P8VC 3UR9A 1S82A 4JYVH 1GHZA 4IMZA 5DKMA 1W0KD 2AIPA 3P8GA 4MTBA 3UB0A 2F9NA 3ESTA 3TJOA 1E0FD 1ELAA 1SQAA 2YMSB 4D9RA 1C5LH 3MO6A 1WXRA 2WPKS 1K1NA 1HDTH 3IG6B 4ACAA 1L4DA 2EI8A 4NGAH 2A5IA 1J14A 1TNGA 1O3LA 2QF0A 3T25A 3LKWA 1C1WH 1GBTA 3SJOA 3VPKA 3RXIA 1BTPA 1C2DA 4I33A 2SFAA 5F8XA 4ZH8A 1C5PA 2FX4A 5JBTA 2ZIQH 4O03A 1ANBA 1MAXA 1OKXA 5DSFA 4JYUH 3SJKA 1C1VH 4GHQA 4GHTA 3S7HB 4E05H 4DG4A 1FPCH 2VIPA 2BXTH 4JCNA 3LJJA 4NWLA 4Q80A 3KYFA 3ZZ4A 4A1TA 1MH0A 1OWHA 1AFEH 3DUXH 1B5GH 3ZYDA 1YC0A 1ZSKA 4YESB 1NBMD 3MOCA 2GZ9A 5LPEA 3EA7A 3TU7H 1WDIA 1VITF 3GCNA 2O8TA 1O5EH 1OXGA 4CH8B 3BG4B 1TBZH 1TGNA 1UHBB 3PLKA 2RA0A 3QWCH 2FLRH 1O3OA 2UUFB 1W8BH 2ZC9H 1VCWA 4TY6A 3PM3A 1BHXB 1PQ8A 1AU8A 1GI1A 1VGCC 3RXJA 1ARCA 2OC1A 4IN2A 2VWNA 1FNIA 2F9VA 2FIRH 1EJAA 1O3IA 4THNH 1TLDA 5CHBA 2A4QA 4JZIA 2ZFRH 3RXLA 1K1OA 1AGJA 4YOJA 4CR5A 2BD8A 2F9PA 1ZHPA 4D7GA 1C1OA 4ZHAA 2BDGA 4AG2A 2Y7XA 4X1RU 1P3CA 1ELEE 1UVPA 3NKKA 1CGIE 4SGAE 1NU7B 1P2QA 1AZZA 2G8TA 2F43B 1FLEE 4I8GA 2BDAA 2ZEBA 5CHAB 4UFGH 1MCVA 2Z7FE 1O3MA 1Y5BT 1UVTH 4MQAA 1GJ9B 4U30A 5EPNA 1BRAA 4CRGA 4E06H 3S69A 1C4V2 1DSTA 3MNXA 4Y79A 1YF4A 1ABIH 1O2KA 1Y3WA 1NU9A 1V2TT 2GCTB 4MNXA 2ZFPH 5F6MA 1C2HA 2FI3E 1VZQH 4WY3A 2UUJB 3HKIB 1ESBA 5HKKD 2G81E 1AHTH 1P11E 3MTYA 3M3SA 5KEDA 2HNTC 5EJZA 1Y3UA 1IQEA 5EQSA 2ODYB 1O2XA 4JZFH 1S85A 1O3BA 1ANEA 1GI8B 1GJ7B 3QDZB 1TQ7B 2QV1A 4MNWA 4OS5A 3QN7A 1WYKA 2GGVB 4Q63A 3TGKE 2GD4B 3PMAB 4Y7AA 1TMUH 5HMAA 3VB3A 6CHAB 3RMNH 3A7ZA 2O8MA 1EP6A 1QFKH 1UTNA 2A5AA 2B0FA 2P8OB 1EUFA 3AVZA 3ZZ7A 1NRRH 4XBBA 2Y5HA 5FX5A 2AIQA 2FPZA 1C5NH 3BN9A 2JH5D 1AN1E 1BRUP 1PJPA 3M5MA 5EPYA 1J8AA 2SGFE 1P2OA 2QXIA 1JIMA 1O5CB 4BTTB 2FOFA 4CRAA 5DP6A 2KX4A 1AVWA 3SO3A 3SZNA 2A4RA 1Z6JH 3A7XA 3ZZ8A 2TRMA 1EJMA 3UOUA 2ZPSA 1ELDE 1FY1A 1Y5AT 4FETA 3SNAA 4AX9H 3F0OA 2WZQA 3AAVA 3S7KB 2VVVA 4RKJB 8GCHG 1WOFA 4I8JA 1ZRBA 1UMAH 3SU5A 1IQMA 3A7WA 2ZPRA 1Z8IB 3RXAA 2R0KA 5A2MH 1PPBH 2F3CE 4HZHA 1FI8A 4UFDH 4TYDA 3ZYEA 1MUEB 2FODA 2ZNKH 1HAPH 1G3EA 1C2MA 4FUFA 1O3JA 4RT0A 5E8EH 4A92A 4YLUA 1VITH 3M7TA 4Y11E 2TBSA 4ZUHA 1ESAA 2C8YB 1GBFA 1GVZA 1IQJA 2SGEE 3PV4A 2WV5A 3DD2H 3CP7A 3PRBA 4TPYA 2AS9A 5IDKA 4Z6AH 1LHCH 4X8SH 1EOLA 1LDTT 2K8IA 4DJZB 4KELA 3EYDA 2J2UA 2R2WU 1GI2A 1T4UH 2A2QH 3OE7D 1BJUA 2C3SA 2NU4E 1TNIA 3GY8A 1MQ6A 4JZEH 4A7IB 2QXJA 1ELTA 1NTPA 1SLXB 2BZAA 3TIUA 3UTUH 1TYNA 4XD7D 3RXBA 1MQ5A 2A7JA 1T8OA 2GDEH 3UREA 2PGQB 1TA2A 4F55A 1BITA 1THRH 6ESTA 2CN0H 1ORFA 1KXAA 3SORA 4Z1MD 1O5FH 3Q3YA 2G55A 1K22H 2F9OA 2BLVA 1GI7B 3GCHC 2LP6A 2STBE 2EY4C 1TNHA 4K3JA 1ELGA 2ZGHA 5E2PA 1HAOH 2ZHFH 2R2MB 3SU4A 4AYVB 1AIXH 1WV7H 3SJ8A 1BMLA 1QJ7B 4WF8A 4NG9H 3ZVGA 1WU1A 1GI4A 2A2XH 2D26C 4OS4A 2XWBI 4I86A 1BIOA 1C1RA 4ZKRU 1KDQA 1O2NA 4OS2A 4IC6A 1TX8A 4O97A 1TAWA 1MMJN 2ZPQA 1OP8A 1WQSA 1NS3A 2F83A 2PGBB 5I25A 2OLGA 2ZGXH 4NA9H 3LU9B 1CBWC 1DXWA 1TALA 3LGWA 2BX3A 2OD3B 4E7NA 2A4GA 5FCKA 2CHAC 1MTSA 4XOJA 5EIYA 2BDBA 1F0RA 2YNBA 3O8CA 3T62A 2V35A 3I29A 4VGCC 4ASHA 2ZWLH 1YPLH 3ODDA 1HYLA 3KYGA 2ZGBH 3F2FA 1S84A 2DE8A 1GBDA 2PWXA 3T5FH 2ZCHP 1P02A 2OK5A 1KSNA 2OBQA 3VGCC 3FP6E 5H4IB 1HAGE 3KHVA 3RXPA 1Y3XA 2PR3A 2BLQA 1N6XA 1BTYA 4I8KA 5FBEA 2P3TB 4DT7B 4HG6A 3TK5A 4UD9H 3DSPA 4X8UH 3FANA 5J4SA 1RTFB 1Y8TA 3FOAA 3MU4A 1YY3A 3RXHA 4YO9A 1KXCA 1GBIA 2ZDNA 4LZ4B 4XRNA 1SHYA 1SKYE 2ZZUH 4Y0YE 2AGGX 2Q6GA 1FN6A 1CA0C 2P95A 4ASUD 1C2LA 2QC2A 1K21H 2Z6BD 4FU7A 4UONA 1LQEA 2QF5A 3CENA 7GCHF 5EW1H 1QB6A 3WY8A 1QZ8A 3EAJA 4H6SB 1BZXE 1KDQB 2AEIH 1BJVA 2W3KA 4CBOA 1DPOA 1GI5A 5EGMA 5EOKA 1UTOA 2G5VA 1N6YA 3BG8A 2ZHQH 1QBNA 3FAOA 4BNRA 1KTTB 1VCQA 4ACBA 1FY4A 3PYHA 3MQKC 4AGJA 1C4Y2 4AB8A 1RTKA 5HIZA 4CHAC 1K1IA 2VB0A 2A5KA 1XUIA 2PLXA 1OOKB 2OP9A 1K28D 1V2OT 5GXPA 5C5NA 1F2SE 1O3CA 3WWBA 1GBJA 4I31A 1DICA 1C9PA 2HLCA 1NC6A 1FIZA 1O3DA 2VBCA 1KLTA 3A7YA 1IQGA 3A85A 4NIYA 2HGTH 4ISLA 5CDFE 1H8DH 1BMMH 3GCTG 2XC0A 1GDUA 1UTMA 1EFRD 1LKAA 1MU6B 1TX7A 2STAE 1LHFH 3U98H 1OWKA 3KNXA 4X6PA 1GMDF 5L2YH 3L6PA 1GGDB 1ZTJA 1OS8A 2BQWB 5GWZA 2LNCA 1YYY1 1MU8B 3F9FA 2ANMH 1ZZZA 5EU8A 1ELVA 2VIWA 1OWJA 1XVOA 4YT6H 1BA8B 2XTTB 3E0NB 1HNEE 5GDSH 3SUDA 2BY5X 2GV7A 4B2AA 2GT7A 1S6FA 2ZQ1A 1G2MA 5GNDA 2BXUH 4FUHA 2G00A 4J1YA 1S5SA 3MU1A 4ABJA 1E37B 1B7XB 1H4WA 3UNRA 3BTHE 2J9NA 5T1VA 2HPQH 1UTKA 1ETRH 5LPFA 3UY9A 1GBCA 2ANYA 2J94A 1DWCH 1EPTC 2FS8A 2VH0A 1AVGH 4Y10E 2PKSB 3S9BA 1E35B 4X1QU 3SGQE 3OU0A 3SV6A 1J16A 2I6SA 3T2NA 1T8NA 2RA3A 4JZ1A 2Z9GA 3JZ1B 1A46H 1QR3E 4NWKA 3R0FA 4FUJA 4QT8C 2P94A 1W2KH 1HAHH 1EXFA 2F4LA 1YWUA 2BLWA 3TJVA 3DSGA 1TBRH 1G3CA 1FUJA 3UOPA 4KGAA 1HBTH 2DUCA 1GL1A 4BAOB 1T7CA 2ASUB 1OWEA 2XBYA 4AGKA 4X6OA 3M35A 2WHXA 1CVWH 1ZMLA 1AFQC 5HM2A 1GJ4H 4WH8A 1OX1A 1J9CH 1TGBA 4AFQA 2XW9A 3TH4H 1DS2E 1BRCE 1AE5A 4NZLA 5AF9H 1GBLA 1TX6A 4IGDA 1Y59T 4HFPB 1NRNH 3EGKH 4B2CA 1V2ST 2QF3A 1Z7KA 5JBAS 1W7GH 1JXPA 3HKJB 1HJAB 3P92A 3ZZDA 1ARBA 4NFFA 3SUGA 3S9AA 1TMTH 2TIOA 5TJXA 1OWIA 3GYLB 1C5UA 1DFPA 1GMHF 2KAIA 3P8NA 1IHSH 1PPCE 3ZZAA 1K1MA 1O2RA 1V2LT 1W7XH 1J15A 3D65E 5EW2H 1C1NA 1BOQA 2ZTXA 3NK8A 1XMNB 2GVFA 1V2KT 1FPHH 4H6TA 1P06A 2TGDA 1DDJA 3MH4A 1BT7A 1ZMNA 1AY6H 1IHTH 1O3KA 1FAKH 3LONA 3LGUA 1KXEA 4AB9A 2SGAA 3HGNA 2WPDD 1CHOG 4ISHH 1GDNA 1KY9A 2FTMA 1S83A 2D1JA 2BY9X 4XFQA 1JBUH 1RIWC 4FVBA 1WQVH 2JH6D 4ZKSU 1BMFD 1S6HA 4IC5A 2IJOB 1CT0E 1QTFA 1QURH 1DOJA 3GY6A 1FXYA 2FP7B 1LPKB 3Q77A 5JBBS 1TRMA 3VXEH 2FM2A 1Z1IA 1HPGA 3QZQA 1QNJA 4Q2KA 1P9SA 3E90B 1LMWB 1D3QB 1XUHA 1YPMH 5E2OA 1BRBE 1V2QT 1HIAA 1VJAU 1S0QA 3BTDE 2P93A 3Q76A 2G4TA 5LH8A 4XDEA 1NM6A 4HGCA 5JB8S 4ZHLU 1EQ9A 2ZF0H 3LIWA 1BHXF 1P2NA 1HJ9A 1IAUA 1NT1A 1K2I1 2Z9IA 2BY7X 2C90B 1SGRE 2WV9A 1YCPK 3MI4A 2KAIB 4WMFA 4MPXA 3D23A 3ZZ5A 4UE7H 2P3FH 2OQUA 3BIVH 4MLFB 4BAQB 1ACBE 4AN7A 3Q3KA 2FX6A 2BYAX 1C5ZB 1D3TB 3P95A 3ZVDA 1PPZA 5J4QA 4ISIH 1RS0A 2FESH 3B9FH 2O8WA 2F9BH 2QCYA 2W7UA 4TY7A 1S6LA 3V3MA 4X2VA 5E0GA 4OS7A 1XUGA 3SV9A 4NZQA 4DIIH 3W1EA 2ALVA 3LGYA 3TNTA 2O9QA 1GG6C 3DCLA 1UCYE 2BD9A 3F2GA 1IQNA 3K6YA 1C2EA 2XCFA 3SQHE 1HV7A 7LPRA 1LPGB 1GBBA 4WH6A 1C5MD 1KIGH 1EOJA 1ZMJA 1D6WA 2Y5GA 2CJIA 3C27B 3SV2H 1TA6A 1O3PB 1VGCB 2G51A 1BMNH 3GS9A 2P3UB 4DURA 3RU4D 1DSUA 1YPKH 5T6GA 3RC4A 1TMBH 2UUKB 3KQEA 4NIVA 3RXTA 1YPHC 3U8OH 2BOKA 1INCA 6GCHF 1B0EA 1MKWH 1AQ7A 4DW2U 4YOGA 3T27A 1SI5H 1HIAB 2ZU3A 2FOCA 1MTNC 4KTUA 4JK6A 2BM2A 2XWAA 2J98A 3IWMA 3TLOA 2PKAB 3URDA 1GL0E 2GKVE 3MU5A 4I8LA 1OPHB 1ETSH 1P09A 1C5XB 2Y81A 1ZHMA 1A0HB 1V2RT 2Y6TA 1UTJA 3FFGA 3T28A 3NRLA 1ZGVA 4PROA 1UTQA 1ZSJA 2K0QA 2WV4A 3BG4C 1H1BA 1O2QA 1V2UT 2XNIA 3TITA 1TPPA 2ZFSA 3RXVA 5C0TA 8ESTE 1YPEH 1C9TA 1GBHA 4NIWA 1FZZA 3LPRA 4ZKNU 1Y5UT 1LO6A 3ATMA 4YTAA 3MH6A 1GMCF 2ZFQH 4GAWA 1LVBA 2FYRA 1C5QA 5C67A 2BY6X 3H7TA 4WJG2 4ABHA 3F68H 2BHGA 1C1MA 5F03A 4OGXA 3DA9B 3PLBA 1LHDH 2M5TA 3VB4A 3TVJB 4MPVA 4WMDA 2ZGCA 1O2WA 2BB4A 2C93B 2QY0B 5DO4H 1MCTA 2V3HH 2Y82A 2C8ZB 5C1YA 1XUJA 2JKHA 3M37A 1C1PA 3HK3B 1HAVA 1O3FA 1O32A 2BDHA 2OC8A 4WMEA 3UAIC 4MPUA 1CU1A 1QQUA 4K69A 1DE7H 2BZ6H 3LGIA 4X2XA 4GVUA 2ANWA 1AZ8A 1CO7E 1VITG 3RXSA 5CHAC 1HXEH 3U28C 5DN6D 3KCGH 5B6OA 2I6QA 4R8TB 5JBCS 5A8XA 5HIYA 4D7FA 4YM9A 1WBGB 4UFEH 3F9GA 3ZVBA 2XC4A 2GV6A 1MTWA 2KZ4A 1EB2A 3F3BA 1EJNA 1NESE 3DT0H 1PYTD 3FKSD 1AE8H 2J98B 2FDAA 1L2EA 1AVXA 1P0SH 1E36B 4E7RG 3RMOH 2CF9H 3LGVA 5EG4A 2ZP0H 1QCPA 3LGTA 3PROA 2AGEX 3BIUH 3BTME 3MMGA 1O3GA 1C2FA 4WXIA 1C2JA 2FMJA 3SZEA 3VXFH 5DP3A 4HI3A 2BTCE 1TGTA 2J34A 2GDDA 4K60A 4DVAU 1SGCA 5IK2D 3MH7A 5DPAA 1L1JA 3M3VA 1MKWK 1CSOE 1WTGH 1L1NA 3P17H 1O5GH 6CHAC 1AI8H 2SGDE 2GMTC 5K7RA 2P8OC 1X7AC 1TPOA 2BDCA 2BD7A 4INLA 4INHA 3T29A 1DWEH 1CT2E 3N7EA 3R3GB 4U2WA 2FOMB 1GVKB 1M9UA 3SGBE 3OYPA 2BD3A 3MNCA 1ZTLA 2A1DB 1SFIA 1JRSA 1LQDB 1A3BH 4CRFA 3A82A 1MZDA 1UK2A 1HAVB 1TIOA 1ANDA 2P16A 3GICB 3RXMA 2V7QD 1HCGA 1LKBA 1AB9B 3M7QA 3EE7A 2UUYA 3FVFB 1XUKA 1DWDH 4X8VH 3S0NA 6LPRA 3PB1E 3TJNA 2WPJS 4LOYH 1F5RA 3Q00A 2FI4E 3KL6A 3OSYA 3E3TA 4K1TA 4B6EA 3SI4H 2IPQX 2RDEA 2ZTYA 1GWAA 3GCHB 4H42U 1G30B 1JRTA 3AW1A 3UIRA 2XRCA 5FL7D 2JJ1D 1TPAE 5C94A 1O2IA 1YLNA 2JJ2D 1V2WT 4Q7ZA 1C5WB 1F0TA 1GCDA 1YBWA 1SQRA 2EI7A 1ZGIA 3G01A 2B5TB 4ZXYH 5DJ7A 1N8OC 3RM0H 1SB1H 3PV5A 1P3EA 4X6NA 4DCDA 5EQRA 4BANB 3OTPA 1JIRA 2GTBA 3NUMA 5T3HA 1F0UA 1GJBB 3ATKA 5E0HA 1OYQA 2CXVA 4I32A 4KTCA 1BTXA 2EQNA 2HNTE 1HAXB 4OS6A 1C5TA 3A80A 3K65B 1QBOA 1SQTA 4WWYA 1C5YB 1CBWB 4LK4A 1HAIH 1YLDA 1D9IA 2VWOA 3U69H 1Z8RA 2AGIX 2CHAB 2VWMA 1RGQA 3A89A 1ANCA 3OY6U 4TT3D 1CHGA 1TRNA 2ZFTA 4VGCB 3MU8A 1G2LA 3DHKH 4TSFD 1LHEH 4NSYA 1GHAF 2R0LA 3MYWA 1QB9A 2FXRA 2FOAA 2ZU1A 4ABAA 1O38A 5DP7A 4X1NU 4MVNA 2ZHDA 3VGCB 1YPGH 3HK6B 1VCPA 3JZ2B 1LTOA 3F1SB 1E34B 5AFZH 1GI0A 1VR1H 3OEED 1GHYH 4NA7A 1K9OE 2VU8E 1IQFA 4YZUA 1JOUB 4FUEA 1BTUA 5IYTA 4NFEA 3D49H 4IMQA 3O8RA 5BPEA 1OP2A 1GPZA 2SNVA 2AMDA 1SSXA 2OTVA 1TGCA 1NO9H 1CA0B 1QBVH 3BSQA 4BOHA 3RC6A 1UK3A 1FY5A 3OEHD 2SGQE 3GCTF 1V2PT 5I46H 1ELCA 3BTEE 3PO1C 1W0YH 3E1XB 2UWLA 4YOIA 1TE0A 2FI5E 3HGPA 1SOTA 1EPTA 3A8CA 4GPGA 4FUCA 1COWD 3BTKE 2V6NA 1HXFH 2PFEA 2XYAA 4CRBA 2GCHG 3WW7A 1ESTA 3FZDA 3LJOA 4CHAB 3ITIA 1O2OA 5EQQA 1V3XA 3D62A 2FWWA 5FHTA 5LPRA 5KECA 5F8ZA 3RU4T 3SBKA 4A5TS 3UPEA 2BVXH 3UR6A 3QGNB 3W94A 1PYTC 3TH3H 3ODFA 3OTJE 1C1QA 2J5UA 1FN8A 3K6ZA 3MH5A 3SJ9A 2A4OA 1H8HD 3GDVA 5PTPA 3PWBA 4P00A 1BB0B 5CMXH 3SNCA 1QA7A 1UW7A 2D8WA 4ZCNA 1O2PA 1PFXC 4B73A 1CA8B 1O39A 3H09A 3RXGA 1CQQA 1ETTH 3A87A 3SGAE 2H6MA 1HAZB 1O3HA 2CGAA 2VIQA 1V2NT 2YMSD 2NU0E 3GY3A 4Y8ZA 1EAUA 1JMOH 2XC5A 1E79D 3C1KA 4IW4E 1H9LB 2XOKD 1GJDB 3SUEA 1GJ8B 3TGJE 3VFEA 1DITH 1V6DA 1KXBA 3QO6A 3UUZA 2H5CA 4B74A 4FU9A 2LPRA 1KXDA 2VJ1A 1C5VA 2ZU4A 1QA0A 4GSOA 4A1XA 2P59A 3SV8A 2H9TH 5GIBA 1EPTB 2ILNA 1AKSA 2ZDKA 2FEQH 3H5CB 1A4WH 1QB1A 2BX4A 3GCOA 4H4FA 2AMQA 7GCHG 2VINA 4I7YH 1SGEE 4ABIA 1T32A 1UTLM 3NCLA 1DLKB 5AFYH 4JYTA 2VNTA 3RXOA 1C1UH 2ULLA 4CH2B 2WPLS 2Z94A 3W95A 4MG3A 2R3UA 2WPIS 3SU3A 1EB1H 3AW0A 3RXQA 3MWIU 2VGCC 1SL3A 1SLVB 1BDAA 2FTLE 1GJ5H 4FUDA 1GHVH 2Z3EA 1AFQB 3PTNA 1DVAH 1C5SA 5T6FA 2R3YA 2XBXA 1DT2A 1RRKA 3VEQB 5K0HA 1YCPH 1RFNA 1L4ZA 1KMHB 3KQBA 1G3BA 1GHBG 3HATH 3ZZ6A 2KCPA 4X8TH 3UNQA 3SI3H 1EP5A 2BD5A 3SV7A 3ZIAD 1IOEA 1C2GA 3RXRA 3ATWA 1NFUA 1NFWA 1ELFA 1P01A 1T4VH 4GCHF 2ESTE 4B71A 1K1PA 2J92A 2AMPA 1OSSA 2VIOA 1SGTA 4YLQH 1W10U 1GDQA 1O3EA 2FOHA 2FS9A 2Q6FA 3AASA 3H7OA 1QL9A 3GYMA 3L33A 4FVDA 1A7SA 4K5ZA 1G9IE 2WSSD 2YOLA 1GJ6A 1PQAA 3ZV8A 4AG1A 2ZU2A 1EAIA 1SGQE 3SU6A 3KGPA 3NPSA 2H5DA 4F48B 4AFSA 2A7HA 1HLTH 3RXCA 1AKSB 2Z9LA 1BCUH 3UWIA 3ATIA 5TCAA 1Z8GA 5JYIA 2HOBA 1XX9A 3NXPA 4MNYA 1VJ9U 3O8DA 1W14U 4D8NA 1RIWB 1AUJA 1ZPCA 4X0WU 1KLIH 4X1PU 2KCOA 4O9VA 3KIDU 1TOCB 2HWLB 3DFLA 5DP4A 2TGTA 3NWUA 1MBMA 4ISNA 2VVUA 1PPFE 1ZOMA 1K0HA 5C2ZA 1BBRH 1O36A 3SW2B 1FX0B 4KTSA 1SPJA 3I77A 3RXFA 2XCNA 3P6ZB 1SOZA 3PLPA 1F5LA 4ZHMU 2W6JD 3CNRA 5GCHG 3PRDA 3SQEE 2ZGJA 1UCYH 2GP9B 4BAMB 3LDXH 4I8HA 5A0AE 1Q31A 3F6UH 3GDUA 1KTSB 2PKAA 5EXLA 1D3DB 2F91A 3SHCH 2BLOA 4F4OC 3OAAD 3QLPH 1FY8E 2RDLA 2XBWA 1ZJKA 1DWBH 4Y0ZE 1AUTC 1O31A 3ZVCA 3Q3XA 2ZDLA 2KFWA 4X2YA 5JPMH 3AAUA 3K2UA 1GMHG 4AZ2B 2H1UA 2HALA 1P2JA 3MHWU 1G36A 3PMBB 1NRPH 2GX4A 1SVPA 2ZDMA 5DG6A 5DP5A 1YCPM 3FP7E 1V2JT 2J4IA 1VKYA 5TCCA 2C4FH 2C8XB 1NRSH 1Z1JA 3KN2A 1IQLA 4IS5A 4FUBA 2JETC 3A7VA 3LH1A 1GCTC 4BAKB 1TOMH 2ZHWH 3ZZCA 1NZQH 1EZSC 1BBRE 1O2JA 1V2MT 1UVSH 1GG6B 4P02A 1RTLA 1SG8B 5EXMA 3E16B 2TGAA 1HGTH 1SGFG 3U9AH 2SNWA 2Y80A 2DE9A 1O2MA 2KCYA 3BEIB 1O30A 4FXGH 1AO5A 1O2UA 3SNDA 1IQKA 1P2MA 1GBMA 1O2LA 2YMSC 4Y7BA 3B23B 1W11U 3VB6A 4AORA 4MPWA 1MKXK 1RXPA 1XKBC 4B75A 1MTUA 1HJ8A 2QGRA 4ZXXH 3PTBA 4FUGA 2HNTF 1ZRKA 2V0BA 1ZR0A 2GZ8A 1SBWA 1MTNB 1LPZB 3ATLA 3M3TA 2FLBH 1QIXB 1GHWH 2JIZD 2HLDD 3MO9A 5FAHA 1TONA 1HFDA 2JH0D 3I78A 4TWWA 1LVYA 3CS7A 1C5OH 2AYWA 2NU1E 3RXDA 3TH2H 1P05A 2BVSH 1N1LA 1UVUH 1TNJA 4DIHH 1DANH 1QL8A 7ESTE 1LVMA 2ALPA 3KQ5A 2W7SA 3VG8A 1C1TA 4A1VA 1BBRK 4M9FA 1O33A 3S9CA 2W3IA 4AFZA
chains in the Genus database with same CATH topology
3SU2A 4FUIA 5G4BA 1MTVA 1AMHA 1BTZA 3A84A 1IQIA 5ABWA 2CMYA 2WPHS 1T31A 3GY4A 2BOHB 1UCYK 3BTQE 4KKDA 3GY2A 3ZV9A 1T8MA 4KP0A 4UEHH 2FZZA 4D76A 1MBQA 3QTVH 3UQOA 2Q1JA 3IITA 3OX7U 2G5NA 4LZ1H 3LC5A 3SU0A 2PSYA 2QYIA 4Z0KA 1SGNE 3TJUA 1U6QA 1Z71A 4B1TA 8GCHF 5DGJA 3KQCA 3TNSA 1GI6A 3V0XA 1Q3XA 3STJA 2OXSA 2B7DH 1Z6EA 2PW8H 2GZ7A 3U1JB 1TNLA 5E0JA 5ETXA 1O3AA 4INKA 1FDPA 2ZECA 3RC5A 4ABEA 1EZUC 4M7GA 4ZKOU 4Y8YA 1SC8U 1UVOA 1EKBB 1THSH 1WAYB 4YT7H 3SNBA 1NN6A 2ODPA 1SLWB 2RCEA 2RG3A 5T6DA 8LPRA 2ZI2H 4CRCA 1EX3A 6GCHG 1BTWA 2GT8A 2TGPZ 1B0FA 1A5HA 2GCTC 3V12A 4ABDA 1HB0B 2C8WB 2J95A 3MFJA 1EZXC 5DP8A 5HM9A 1F5KU 1S0RA 3RM2H 3F9HA 1ZPZA 1ZHRA 1UK4A 1GI3A 1P2KA 4B76A 3A83A 2Y7ZA 1PQ5A 1O5AB 2FO9A 1GHXH 3PMJA 1L0ZA 1YKTA 2GMTB 4XBCA 1ELBA 3URCA 4ABBA 3M36A 1OWDA 4X2WA 1DUEA 4CBNA 2QA9E 2EEKA 1P57B 3F9EA 1NROH 2OINA 1MAYA 1SR5C 1MZAA 2A31A 2ZCKP 4UFFH 4ESTE 3RP2A 1WTHD 1J17T 1A61H 1RJXB 2NWNA 3TGIE 1GMCG 3EA8A 4NIXA 4CR9A 3P8OA 4OS1A 3STIA 3RMMH 1YPHE 1XXDA 3ZZ9A 1FV9A 3PWCA 1XM1A 1ID5H 3K9XB 1KYNA 1OP0A 4HTCH 5EODA 1S81A 1UTPA 2UWOA 3A8BA 2VVCA 1CGJE 2A0QB 2XBVA 1Y3YA 9ESTA 1DLEA 2A45B 4R0IA 3QUMP 1K1LA 4JZDH 2PSXA 1XUFA 5DK1A 3GDSA 3V7TA 3SNEA 2Z9JA 4BXSA 3BEUA 4ISOA 1DY8A 4JMYA 4WVPE 2B9LA 1OYTH 3QX5H 3UNSA 1O35A 4IN1A 1C2KA 3BTFE 1O2GH 3TPIZ 1TB6H 3QK1A 2ZA5A 5HGGA 1SQOA 2ZQ2A 2A32A 1N8OB 4AYYB 1GVLA 1BMAA 3V13A 3CS0A 3UWJH 3RUOA 3M7UA 5C3NA 1UJ1A 1AB9C 1AD8H 1O5DH 2HRVA 3O8BA 3MU0A 1BTHH 3E8LA 1JWTA 3SUFA 1IQHA 3TK6A 2ZFFH 1HRTH 1SGIB 2BDYA 5AVDA 2H9EH 1QL7A 5C20A 5FPSA 3LT3A 2IPHA 4WXVA 1DM4B 1P12E 2AERH 1ZLRA 1BUIA 1Z8JB 3SHAH 2FOGA 1CT4E 1D6RA 1O2VA 4NCYA 2UWPA 1CGHA 1PPEE 5A09A 2GCHF 4GUXA 4B2BA 3ZVEA 2WUBA 3SN8A 1P2IA 1DY9A 1G32B 1DXPA 3U8RH 2Q6DA 1DX5M 4U01A 4U32A 3U1IB 5SGAE 1SGDE 4TWYA 1XVMA 3B8JA 1Q2WA 3E0PB 1O2SA 2Y5FA 3VB5A 1F7ZA 3EA9A 4CREA 1W12U 2HVXA 1NPMA 3RXUA 2ZG0H 3RXKA 4DGJA 3A8DA 1NFYA 3UFAA 4Q7XA 3PMHB 3PO1B 1C1SA 2PUQH 4D9QA 4Y6DA 3GISB 5FPTA 2J38A 2PTNA 1EZQA 1XKAC 2AH4X 1LHGH 2VH6A 5GJ4B 1A3EH 1D4PB 3VB7A 4BTUB 5C5OA 2FOBA 4F49A 1PQ7A 3RXEA 1QJ6B 2FYQA 5HXFA 2SGPE 1W13U 2WUCA 2ZDVH 2PHBA 1ZYOA 1C4U2 1SMFE 2PTCE 4JK5A 3TK9A 5C1UA 2FOEA 2TPIZ 4TPIZ 1C2IA 1ZJDA 2BD4A 4NSVA 5HYOA 4ZROA 4BAHB 1A2CH 1D3PB 2QIQA 1SFQB 3FP8E 3QTOH 3A88A 1WUNH 1ZPBA 1O3NA 3P70B 3U8TH 5C1XA 2Z9KA 4K8YA 2ZHEH 3LOXA 2BQ6B 3SU1A 1QGFA 8KME2 4OGYA 3A7TA 1KLJH 5BRRE 4CRDA 3BTGE 3E91A 4ZAEA 1GHAG 2ZO3H 3SOSA 5LGOA 2WINI 5F8TA 1QY6A 1TRYA 1ZTKA 2ZU5A 3EE0B 3FZZA 1L1GA 3QGJA 1EAWA 1GBAA 3KF2A 1QHRB 1UO6A 2G52A 1NRQH 4J2YB 2W5EA 3E6PH 3UQVA 2BY8X 2PV9B 1GBEA 1ZSLA 4RKOB 4UDWH 1O2YA 4IBLH 4K1EA 4ZMAH 3RU4E 2PUXB 1SGPE 2F9UA 2B8OH 1G37A 2OUAA 4BXWA 1GHBF 3ZVFA 3BF6H 1V2VT 2YNAA 4RSPA 3GOVB 1EASA 1THPB 1EAXA 4K2YA 4LXBH 3P8FA 2Z3DA 1TBQH 3OY5U 1O0DH 7KMEH 3ZVAA 1MD7A 3NZIA 1YGCH 1A5GH 1NFXA 2H2ZA 1FMGA 2VIVA 2NU3E 4K1SA 4ABGA 4SGBE 3BV9B 1HUTH 1QRZA 4ABFA 1XXFA 2VGCB 3RLYH 1LVOA 3MNSA 1YP9A 1GGDC 5L6NH 1FAXA 2QAAA 3GY7A 3A86A 2WYJA 1GJCB 5EXNA 1F0SA 1O5BB 3N7OA 3EDXB 1Y3VA 2BD2A 3GY5A 2OBOA 5A8ZA 1A0JA 2Z3CA 5CE1A 1AWFH 3ENSB 2O8UA 1CHOF 2WYGA 1QRWA 5FX6A 2EI6A 1QRXA 1FONA 1NY22 1QQ4A 1GBKA 4Y76A 1TWXB 4Y8XA 2IN2A 2BVRH 4DY7B 2O8LA 1TABE 5A0CA 1FY3A 1TFXA 5FXLA 1A5IA 4XBDA 2PKSC 5FCRA 5GPIB 2XXLA 5FBIA 3M5OA 4DOQA 3ELAH 2BDIA 1KXFA 4MDSA 3QZRA 1ABJH 1PPHE 5FPYA 3DFJA 3ZZBA 1K1JA 1GMDG 1TGSZ 2EC9H 2ZCLP 1YM0A 2CF8H 4FU8A 2OC7A 2OQ5A 3KEEA 3HPTB 1EATA 1P10A 2IOTA 5GCHF 4Y71A 3A8AA 5JB9S 2QXGA 3KQDA 4X6MA 3M5NA 1P03A 2HPPH 1WCZA 2AFQB 2ZTZA 1YLCA 1BQYA 9LPRA 2R9PA 5L2ZH 3A81A 3T26A 2BQ7B 2ZDAH 2ZKSA 3SJIA 2VWLA 1PPGE 1MKXH 1TNKA 1DUAA 3MO3A 3BTWE 5AHGH 2BMGB 1P04A 3BTTE 3MNBA 1YPJH 4Q7YA 1SHHB 1RD3B 2NU2E 3M5LA 1W0ZU 5DP9A 4MNVA 4BTIB 3LC3A 1FIWA 1HJAC 1SGFA 2A7CA 1GJAB 1QJ1B 1FQ3A 1FJSA 2ODQA 5L30H 5A8YA 2K1QA 1P9UA 1GI9B 4RN6A 4XE4A 3ZZ3A 1H9IE 2D2DA 1O34A 3M61U 2WPMS 1O2HA 4AOQA 1O37A 1HAYB 1T8LA 4A6LA 1F92A 4XSKU 2QXHA 2QN5T 1W3CA 2V3OH 2W26A 4O3TA 3LH3A 5ESTE 2ANKH 1O2TA 3RDZA 1CE5A 1TPSA 2VIDA 4GLYA 1A1RA 3RLWH 1AWHB 1LCYA 1WSSH 2H9HA 4AFUA 2OCVB 3RMLH 2THFB 1SLUB 1E38B 2OC0A 4GCHG 4K8BA 1UHBA 5A0BA 2CV3A 3L3TA 1MD8A 3EQ0H 1H9HE 2EA3A 1C5RA 3BEFB 4X1SU 4NA8A 5ESBA 1O2ZA 1A0LA 4O3UA 1H8IH 2G4UA 2JETB 5JDUB 1GCTB 1TQ0B 1SGYE 1G3DA 1P8VC 3UR9A 1S82A 4JYVH 1GHZA 4IMZA 5DKMA 2AIPA 3P8GA 4MTBA 2F9NA 3ESTA 3TJOA 1E0FD 1ELAA 1SQAA 4D9RA 1C5LH 3MO6A 2WPKS 1K1NA 1HDTH 3IG6B 1L4DA 2EI8A 4NGAH 2A5IA 1J14A 1TNGA 1O3LA 2QF0A 3T25A 3LKWA 1C1WH 1GBTA 3SJOA 3VPKA 3RXIA 1BTPA 1C2DA 4I33A 2SFAA 5F8XA 4ZH8A 1C5PA 2FX4A 5JBTA 2ZIQH 4O03A 1ANBA 1MAXA 1OKXA 4JYUH 3SJKA 1C1VH 4GHQA 4GHTA 3S7HB 4E05H 4DG4A 1FPCH 2VIPA 2BXTH 4JCNA 3LJJA 4NWLA 4Q80A 3ZZ4A 4A1TA 1MH0A 1OWHA 1AFEH 3DUXH 1B5GH 3ZYDA 1YC0A 1ZSKA 4YESB 3MOCA 2GZ9A 5LPEA 3EA7A 3TU7H 1VITF 3GCNA 2O8TA 1O5EH 1OXGA 4CH8B 3BG4B 1TBZH 1TGNA 1UHBB 3PLKA 2RA0A 3QWCH 2FLRH 1O3OA 2UUFB 1W8BH 2ZC9H 1VCWA 4TY6A 3PM3A 1BHXB 1PQ8A 1AU8A 1GI1A 1VGCC 3RXJA 1ARCA 2OC1A 4IN2A 2VWNA 1FNIA 2F9VA 2FIRH 1EJAA 1O3IA 4THNH 1TLDA 2A4QA 4JZIA 2ZFRH 3RXLA 1K1OA 1AGJA 4YOJA 4CR5A 2BD8A 2F9PA 1ZHPA 4D7GA 1C1OA 4ZHAA 2BDGA 4AG2A 2Y7XA 4X1RU 1P3CA 1ELEE 1UVPA 3NKKA 1CGIE 4SGAE 1NU7B 1P2QA 1AZZA 2G8TA 1FLEE 4I8GA 2BDAA 2ZEBA 5CHAB 4UFGH 1MCVA 2Z7FE 1O3MA 1Y5BT 1UVTH 4MQAA 1GJ9B 4U30A 5EPNA 1BRAA 4CRGA 4E06H 3S69A 1C4V2 1DSTA 3MNXA 4Y79A 1YF4A 1ABIH 1O2KA 1Y3WA 1NU9A 1V2TT 2GCTB 4MNXA 2ZFPH 5F6MA 1C2HA 2FI3E 1VZQH 4WY3A 2UUJB 3HKIB 1ESBA 2G81E 1AHTH 1P11E 3MTYA 3M3SA 2HNTC 1Y3UA 1IQEA 5EQSA 2ODYB 1O2XA 4JZFH 1S85A 1O3BA 1ANEA 1GI8B 1GJ7B 3QDZB 1TQ7B 2QV1A 4MNWA 4OS5A 3QN7A 1WYKA 2GGVB 3TGKE 2GD4B 3PMAB 4Y7AA 1TMUH 5HMAA 3VB3A 6CHAB 3RMNH 3A7ZA 2O8MA 1EP6A 1QFKH 1UTNA 2A5AA 2B0FA 2P8OB 1EUFA 3AVZA 3ZZ7A 1NRRH 4XBBA 2Y5HA 5FX5A 2AIQA 2FPZA 1C5NH 3BN9A 2JH5D 1AN1E 1BRUP 1PJPA 3M5MA 5EPYA 1J8AA 2SGFE 1P2OA 2QXIA 1JIMA 1O5CB 4BTTB 2FOFA 4CRAA 5DP6A 3SZNA 1AVWA 3SO3A 2A4RA 1Z6JH 3A7XA 3ZZ8A 2TRMA 1EJMA 3UOUA 2ZPSA 1ELDE 1FY1A 1Y5AT 3SNAA 4AX9H 3AAVA 3S7KB 2VVVA 4RKJB 8GCHG 1WOFA 4I8JA 1ZRBA 1UMAH 3SU5A 1IQMA 3A7WA 2ZPRA 1Z8IB 3RXAA 2R0KA 5A2MH 1PPBH 2F3CE 4HZHA 1FI8A 4UFDH 4TYDA 3ZYEA 1MUEB 2FODA 2ZNKH 1HAPH 1G3EA 1C2MA 4FUFA 1O3JA 5E8EH 4A92A 4YLUA 1VITH 3M7TA 4Y11E 2TBSA 4ZUHA 1ESAA 2C8YB 1GBFA 1GVZA 1IQJA 2SGEE 3PV4A 2WV5A 3DD2H 3CP7A 4TPYA 2AS9A 5IDKA 4Z6AH 1LHCH 4X8SH 1EOLA 1LDTT 4DJZB 4KELA 3EYDA 2J2UA 2R2WU 1GI2A 1T4UH 2A2QH 1BJUA 2C3SA 2NU4E 1TNIA 3GY8A 1MQ6A 4JZEH 4A7IB 2QXJA 1ELTA 1NTPA 1SLXB 2BZAA 3TIUA 3UTUH 1TYNA 3RXBA 1MQ5A 2A7JA 1T8OA 2GDEH 3UREA 2PGQB 1TA2A 1BITA 1THRH 6ESTA 2CN0H 1ORFA 1KXAA 3SORA 1O5FH 3Q3YA 2G55A 1K22H 2F9OA 2BLVA 1GI7B 3GCHC 2STBE 1TNHA 4K3JA 1ELGA 2ZGHA 5E2PA 1HAOH 2ZHFH 2R2MB 3SU4A 4AYVB 1AIXH 1WV7H 3SJ8A 1BMLA 1QJ7B 4WF8A 4NG9H 3ZVGA 1WU1A 1GI4A 2A2XH 2D26C 4OS4A 2XWBI 1BIOA 1C1RA 4ZKRU 1KDQA 1O2NA 4OS2A 4IC6A 1TX8A 4O97A 1TAWA 1MMJN 2ZPQA 1OP8A 1WQSA 1NS3A 2F83A 2PGBB 5I25A 2OLGA 2ZGXH 4NA9H 3LU9B 1CBWC 1DXWA 1TALA 3LGWA 2BX3A 2OD3B 4E7NA 2A4GA 5FCKA 2CHAC 1MTSA 4XOJA 2BDBA 1F0RA 2YNBA 3O8CA 3T62A 2V35A 3I29A 4VGCC 4ASHA 2ZWLH 1YPLH 3ODDA 1HYLA 2ZGBH 1S84A 2DE8A 1GBDA 2PWXA 3T5FH 2ZCHP 1P02A 1KSNA 2OBQA 3VGCC 3FP6E 5H4IB 1HAGE 3KHVA 3RXPA 1Y3XA 2PR3A 2BLQA 1N6XA 1BTYA 4I8KA 5FBEA 2P3TB 4DT7B 3TK5A 4UD9H 4X8UH 3FANA 5J4SA 1RTFB 1Y8TA 3MU4A 3RXHA 4YO9A 1KXCA 1GBIA 2ZDNA 4LZ4B 1SHYA 2ZZUH 4Y0YE 2AGGX 2Q6GA 1FN6A 1CA0C 2P95A 1C2LA 2QC2A 1K21H 2Z6BD 4FU7A 4UONA 1LQEA 3CENA 7GCHF 5EW1H 1QB6A 3WY8A 3EAJA 4H6SB 1BZXE 1KDQB 2AEIH 1BJVA 2W3KA 4CBOA 1DPOA 1GI5A 5EGMA 5EOKA 1UTOA 2G5VA 1N6YA 3BG8A 2ZHQH 1QBNA 3FAOA 4BNRA 1KTTB 1VCQA 1FY4A 3PYHA 4AGJA 1C4Y2 4AB8A 1RTKA 4CHAC 1K1IA 2VB0A 2A5KA 1XUIA 2PLXA 1OOKB 2OP9A 1K28D 1V2OT 5GXPA 5C5NA 1F2SE 1O3CA 1GBJA 4I31A 1DICA 1C9PA 2HLCA 1NC6A 1FIZA 1O3DA 1KLTA 3A7YA 1IQGA 3A85A 4NIYA 2HGTH