3CP7A

Crystal structure of a thermostable serine protease al20 from extremophilic microoganism
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
216
structure length
216
Chain Sequence
b'PADSPHIGKVFFSTNQGDFVCSANIVASANQSTVATAGHCLHDGNGGQFARNFVFAPAYDYGESEHGVWAAEELVTSAEWANRGDFEHDYAFAVLETKGGTTVQQQVGTASPIAFNQPRGQYYSAYGYPAAAPFNGQELHSCHGTATNDPMGSSTQGIPCNMTGGSSGGPWFLGNGTGGAQNSTNSYGYTFLPNVMFGPYFGSGAQQNYNYASTTN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alkaline serine protease AL20
publication title Crystal structure of an alkaline serine protease from Nesterenkonia sp. defines a novel family of secreted bacterial proteases
pubmed doi rcsb
molecule tags Hydrolase
total genus 62
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature ec 3.4.21.1: Chymotrypsin.
pdb deposition date 2008-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3cp7A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3cp7A02
1C2MA 2AYWA 1GI4A 3BG8A 1TAWA 3RU4E 5I46H 1OWIA 1P57B 1EAUA 1SFIA 1ACBE 2FXRA 1CA0B 1TNLA 2FIRH 1LVYA 3GDUA 1ZTJA 4OS7A 2GCHG 1G3CA 1TQ0B 4E7NA 3SU2A 1O2VA 2V3OH 1MTUA 4DGJA 2BY5X 4ABBA 1BIOA 3BTME 3F9HA 2OD3B 1P9UA 1E0FD 3GY5A 3RC6A 1KXAA 1QJ6B 1UTKA 2H1UA 2BDBA 3GCNA 3GDVA 2QXHA 2LPRA 2ZFQH 1O2JA 2OTVA 1WSSH 2J34A 1CT4E 4NA9H 5GWZA 1JRSA 1BJUA 4Y76A 2ZGHA 1K1JA 1ZMNA 2XBYA 4B2BA 3LDXH 2IOTA 3EE0B 1TIOA 5DP8A 1T32A 1BTPA 1GBLA 3U1JB 2ZCKP 2ANKH 3V0XA 3MU4A 1FY3A 1L0ZA 1WUNH 2ZHEH 2ZIQH 1VR1H 5FBIA 1XKAC 3A7ZA 3BTWE 3KNXA 3RDZA 1TOCB 2TGAA 1RXPA 3P6ZB 1H1BA 3QX5H 1D6RA 4K60A 3LGIA 4X6NA 1JXPA 2F9NA 1GCDA 3R3GB 3V7TA 4AYVB 5FXLA 8GCHG 1DPOA 1FJSA 1AUTC 1OOKB 2VNTA 5A8ZA 4K69A 1SGNE 4X2WA 3KQBA 4I33A 3ZVBA 1EP6A 2P59A 5BRRE 3LH3A 1GI0A 3TJNA 1GGDC 3LGUA 4FUEA 1GBEA 1LPGB 1L4DA 1UVSH 1NFWA 1UHBB 1Y3UA 1UMAH 1MQ6A 2SGDE 2P3FH 4M7GA 2RA3A 4LZ4B 3LKWA 4LK4A 3L3TA 4ABDA 3ZZ8A 4UFGH 2TGDA 4Y79A 3MO6A 1XXFA 3LONA 5ETXA 1BUIA 3SW2B 1BTZA 1Y59T 2WPIS 5GCHG 4CBOA 5F6MA 1A3BH 1MQ5A 1K1LA 2PGQB 1GCTB 1NO9H 2G52A 4JMYA 1TYNA 3U98H 1O2OA 3SU5A 1O3KA 1MKXH 1DXPA 1MAXA 2P95A 1MU8B 1MZDA 3A85A 1QB6A 1K1PA 1TPPA 2R2MB 2ANYA 5FCRA 3TITA 2A4QA 3QGJA 3PB1E 1INCA 2ZTYA 1ZGIA 4NCYA 1GBJA 1O2KA 2D1JA 1O2NA 1DE7H 1QL9A 1QBOA 2BOHB 2BYAX 2HWLB 3UQVA 1BZXE 1GVZA 3NKKA 3TGJE 3E1XB 2ANWA 4VGCB 4IC5A 4OS5A 1ZMJA 2XWBI 1ELFA 1HAVA 3KN2A 3TGIE 3KEEA 3SU3A 2WUCA 1C2IA 5LPEA 1O33A 1TABE 2PTNA 1O5FH 4K1EA 2HNTF 2BD4A 1H8DH 1NRNH 4DOQA 1MTWA 1O5DH 1GI2A 1BCUH 4NIVA 4XSKU 1OKXA 3SU6A 6GCHG 1ELVA 1DLKB 1GBAA 3M5NA 1C2EA 4NZLA 1WAYB 2ZFRH 1J9CH 4AN7A 3DD2H 1BBRH 1GL0E 1TA2A 1TNIA 1GMHG 4B71A 2H9EH 5L6NH 1BBRE 4B2AA 3HPTB 1Z8IB 1KDQA 2OQ5A 3NZIA 2J9NA 2C3SA 1GWAA 2R0LA 3AAVA 2UUKB 3VB6A 2BD7A 3V3MA 4WJG2 1P01A 1GGDB 2A4OA 3I77A 1QJ1B 1AZZA 2A5IA 1C5XB 3OSYA 2HPQH 1DUAA 1BHXB 2AIQA 2BB4A 3MI4A 3MNXA 5FPTA 1NTPA 1ZOMA 1C1VH 3FFGA 4FUCA 3MOCA 1KLTA 3SI3H 2O8LA 3QLPH 1S85A 8ESTE 2IPHA 2W7UA 1EAWA 3QK1A 2F9BH 4WMFA 3GISB 3MO3A 5T3HA 1TRYA 4NSVA 1FY8E 2QXJA 1C4U2 1EQ9A 2FODA 5DP4A 1SGFA 1A1RA 2VWNA 1O36A 2ZQ2A 4Y8ZA 4K1SA 1IAUA 2SNVA 2SGEE 3RXPA 2YNAA 3LC5A 3RXUA 3ZYDA 4F4OC 3ZVAA 2M5TA 2Y7XA 3ZYEA 3LH1A 4ABFA 4WH8A 1GBTA 1MKWH 1V2TT 3SJ8A 4YT6H 1QFKH 3RXCA 3PYHA 4IN1A 4J1YA 1DANH 2BHGA 4K8YA 4A5TS 2FWWA 4JYUH 1MTVA 2G81E 1TMUH 2Q1JA 1BB0B 1G30B 1EAIA 2OC7A 2R9PA 3GDSA 4FU7A 5FBEA 3LJJA 2VWLA 1FPHH 3MFJA 3GCHC 3TK5A 1C1RA 1B0FA 1MUEB 1FPCH 2VINA 3MNBA 2ZGCA 5A0BA 4FVDA 3K9XB 5DG6A 1NESE 2BY9X 3TH4H 3B23B 5E0JA 1PPFE 1NY22 4ZHMU 1SGIB 2XC0A 1QRZA 1TQ7B 2PV9B 1L1NA 1A3EH 1O32A 2A31A 5EPYA 1MTNB 5AFYH 3NK8A 2JKHA 3BG4C 1GJ7B 2XBVA 5LH8A 2XBWA 1O3EA 1O5GH 2BDCA 4NFEA 3RXJA 2QIQA 1E35B 3PWCA 4NIWA 2O8TA 2ZTXA 1THPB 2UUYA 4AFQA 2VIWA 4HGCA 2QC2A 3UFAA 1O3DA 2ZFSA 5EPNA 2FDAA 2I6QA 1DICA 1EPTB 2Y6TA 3Q77A 3RXKA 2ZHWH 3K2UA 1E36B 4DJZB 2QF0A 4R0IA 2SGAA 3MO9A 2Q6FA 3ZZDA 4THNH 2EI6A 5JBBS 2ZO3H 3VGCC 3SNBA 1QURH 1Y5BT 1ABJH 4XE4A 3E6PH 2ZF0H 1WTHD 4F49A 1DFPA 3A83A 1SGYE 4K1TA 1HJAC 3PV4A 3E16B 1C2GA 2F9PA 1SL3A 2WPJS 1O3GA 4AB9A 3BIVH 5E0HA 3VPKA 1PPEE 1Y5AT 3A81A 2A7JA 2IN2A 3UNSA 1D6WA 3ZV9A 1GBMA 3UWJH 1TALA 2ZHQH 2ZFTA 1P02A 3PO1C 4I8KA 1IOEA 5H4IB 2BVSH 4ZKSU 3MWIU 1O5EH 1GMDG 1OSSA 1SGRE 1WCZA 3GYLB 3IWMA 2PSYA 1FV9A 1ZMLA 1O2GH 2OC8A 4ZMAH 4AORA 2FOAA 1DUEA 4ABGA 4ISLA 1NPMA 3D65E 1V2WT 3ODDA 1OYTH 4ZROA 2J38A 3A84A 2VWMA 1O30A 1QHRB 2DE9A 4IBLH 1B5GH 3BTEE 4X6MA 1O3LA 1OP8A 2STBE 4O03A 4RSPA 2H9HA 1EZQA 3T29A 1DSTA 4JZ1A 1V2VT 4JZEH 4YOIA 2I6SA 1UK4A 6LPRA 3ITIA 6CHAC 1BMAA 5EQSA 1HAPH 2H9TH 2ZI2H 1ANEA 4OGYA 2BLWA 2CHAC 1SLXB 1AFEH 1JIMA 3RLYH 4NA8A 1XVOA 2FI4E 2GT7A 1FY5A 3QDZB 1A5GH 1CHGA 1P04A 1RD3B 5C20A 1YPMH 1W0YH 4BANB 3MHWU 3PWBA 3PMBB 3F6UH 2VIPA 3SBKA 2VIDA 1P2IA 1EJAA 4CRFA 1S5SA 1SQOA 2P94A 7GCHF 1K2I1 3SQHE 3ZVGA 1T4VH 3QTVH 1ARBA 2BQ6B 3QZRA 4NFFA 5L2ZH 1ZSLA 1EB1H 3HK6B 1TPSA 1IQHA 3AW1A 1C9PA 1X7AC 2Y82A 5EQQA 2FOEA 2Y5FA 2BZAA 2W26A 5PTPA 3RMMH 3TJVA 1DY8A 3M7TA 3URDA 4O3TA 1YCPK 1SOZA 2FX6A 1C2KA 1YM0A 2BLQA 1GJBB 4MG3A 1OWJA 3ZVEA 1GI1A 4GCHF 3CP7A 2A1DB 2PTCE 4NIYA 1SFQB 1VGCB 3TJUA 2GZ8A 1JMOH 1CA8B 1MCTA 4FU8A 4B75A 4X1QU 1O3PB 2FYQA 1O2PA 4ISNA 3URCA 1GJAB 1PYTD 2VGCC 4ZKOU 3BEUA 3CS7A 3HATH 1FAKH 3PTBA 4Q7ZA 4AZ2B 2ALVA 1CT0E 5FPYA 3SGAE 5FCKA 1ETRH 3DHKH 1CHOG 2W7SA 4AG2A 1GMCG 3S7KB 4NZQA 1SGFG 4K5ZA 3BTHE 3EA9A 4JZFH 1RRKA 4X1NU 4UD9H 4FUDA 1SB1H 2A4GA 1VZQH 1UCYE 1OWHA 2AFQB 2QA9E 2ZGXH 1YP9A 1D3TB 1NS3A 3M5OA 1PPZA 3E91A 2B9LA 1THSH 1QQUA 5EG4A 1YPGH 1A4WH 1SQAA 3GYMA 1ABIH 4O9VA 4CR5A 5E8EH 1NFXA 1C1OA 2JETC 1GBBA 4SGAE 1KLIH 2PUQH 1GJ6A 2Y80A 2PFEA 5DP9A 1WQVH 3ELAH 1UTOA 2GMTC 2TGTA 2SNWA 3EYDA 1HJ9A 2F9OA 3MU8A 2AH4X 5DP5A 5E2PA 1S83A 2ALPA 4JYTA 1O2ZA 1SGCA 3BEFB 1W7XH 3UNQA 1TB6H 3VXEH 5ESTE 2VB0A 1GHBG 4HFPB 2AEIH 2P3UB 2CHAB 2FPZA 5FX6A 1K22H 3H5CB 3S0NA 2VVCA 1ZZZA 3W95A 1W2KH 2BXTH 1TMBH 1F2SE 3SJKA 3SUFA 4NWKA 1UO6A 2BQWB 4ABEA 2PKAA 4B73A 3LGWA 1TX8A 2BMGB 1IHSH 3MU1A 1BITA 2FI3E 3ZZBA 1FLEE 3RC5A 2BD9A 1NZQH 3GY2A 2ZHFH 3SUEA 3DUXH 2VWOA 3HKJB 2WPMS 1TLDA 3UTUH 1G2LA 1K1IA 2ZDKA 2OINA 2STAE 5EW1H 8LPRA 4NSYA 2O8WA 1EATA 4CHAB 3SGBE 2EC9H 2GZ7A 3KCGH 1F0SA 2GKVE 1K21H 3M35A 3KL6A 1KY9A 5DKMA 1UTLM 1TWXB 1ELGA 3SU1A 4AX9H 3CENA 2H2ZA 3SUGA 4E05H 5DGJA 3QZQA 1Y3YA 3UOPA 5TCAA 2VGCB 2FO9A 3I29A 3TU7H 1EXFA 1YYY1 4KTUA 1HJ8A 1O3BA 1BTXA 1Y3WA 3Q3XA 1GBFA 2EI8A 2PR3A 4I7YH 3A7YA 2ZC9H 1P2JA 5JDUB 1C5QA 4TPIZ 1CQQA 1O31A 2Z3EA 1AVWA 1ZRKA 4GAWA 2XRCA 3SJ9A 2AS9A 2BDGA 3NXPA 4LOYH 3IITA 2GGVB 2ZDLA 2QAAA 1FXYA 2NU1E 1KIGH 1AHTH 1OWEA 1V2NT 1DITH 2VIOA 2RA0A 4JK6A 2WPLS 5A8XA 4R8TB 3SV9A 4BOHA 2JETB 1NRPH 2GMTB 3PMJA 2ZEBA 1WYKA 1Z1IA 3RMNH 4IS5A 3ZZ9A 3KQDA 2A5AA 1DOJA 1TPAE 3R0FA 3SORA 3MU0A 4DVAU 4X8VH 3T26A 5A09A 1QBNA 1H9LB 1TBQH 2BX4A 4U01A 5SGAE 1AU8A 1P3CA 1CU1A 1LHEH 1LPKB 5ESBA 2ZDAH 2PKSB 4YTAA 1HAXB 2W3IA 3RXLA 3NPSA 1YGCH 3ODFA 1ZTKA 2V35A 4O97A 3M3SA 4Z0KA 3QTOH 5C67A 1SGEE 1GL1A 1ETSH 1C1PA 2ZQ1A 1FN8A 2FYRA 2UWLA 3EQ0H 1J8AA 5C1YA 2BVRH 3SV8A 2A7HA 1ZYOA 1V2KT 2HLCA 3FVFB 1O0DH 4X1PU 2FS8A 4GHQA 4NG9H 4LZ1H 1LCYA 2WPHS 3SNAA 3UOUA 3OU0A 1GI7B 1W8BH 4WY3A 1ZGVA 5AHGH 4GHTA 1H8IH 1HXEH 1O38A 4OS2A 1VCPA 1FN6A 2BY7X 5CHAC 1GHZA 1WU1A 2FMJA 1T8NA 1UHBA 4IW4E 1C5UA 2TIOA 4BNRA 2CMYA 2H6MA 3B8JA 4MPXA 3V12A 2C8XB 3FAOA 3TK6A 1J17T 2P8OC 1N6YA 1TGSZ 3A89A 1O2XA 1DX5M 3RP2A 3P8GA 1C5WB 1TNJA 2ZZUH 1QB9A 3TNTA 1ELCA 4NA7A 4DG4A 4TY6A 4WMDA 1F92A 3TLOA 3SHCH 2EI7A 5C1XA 2SGQE 2AGEX 2G00A 2BD2A 3M37A 1ZPBA 1CE5A 3RXTA 1BOQA 1QL7A 3VFEA 5C5NA 1S6FA 1PPCE 1AI8H 1C2JA 4X2XA 3RXBA 2CF9H 4XOJA 3BIUH 3SJOA 1W7GH 1KXBA 4FXGH 1G3DA 1V2PT 3BTFE 2ILNA 4ISHH 4H4FA 2DE8A 3PMAB 2IJOB 4BTTB 1MH0A 1B0EA 1GHAF 1B7XB 1FQ3A 4I8JA 1KTTB 1V2OT 1A7SA 3UUZA 2ZDVH 4ZAEA 1BTWA 3OYPA 2ANMH 3VB7A 5EQRA 5F8ZA 3A8DA 1F5LA 1UK3A 4E06H 4INKA 1C5YB 1MKXK 1GBKA 2OC0A 3C27B 3IG6B 4AGKA 1IQKA 5E0GA 1UK2A 1HGTH 2OP9A 2GCTC 1JIRA 1J15A 1O2WA 2OC1A 1C2HA 1IQJA 4YT7H 3RMLH 3MH6A 2C4FH 2NWNA 3SJIA 3SNDA 3ZZ6A 3BTKE 5C3NA 1YC0A 1P03A 2ODYB 3FZZA 2ZWLH 3O8CA 2J4IA 1NU9A 3SV7A 1OPHB 5C1UA 1SHYA 3RXAA 3SZNA 1TE0A 2ZU2A 2FOMB 1NC6A 3SN8A 2ZG0H 4CR9A 3EGKH 2AMPA 4FUIA 2NU3E 2A5KA 2GVFA 4DCDA 1EKBB 1V3XA 2TPIZ 2TRMA 1HPGA 1BMNH 1PJPA 1UTJA 3AVZA 2D2DA 1QRWA 1DDJA 1YLDA 3PLKA 5EXMA 1C2LA 1P2KA 5IDKA 2P8OB 1T8OA 2GX4A 1LVBA 4DT7B 2ASUB 4AOQA 4OGXA 4DIIH 4Y6DA 2R3UA 3ZZCA 1MU6B 1HIAA 1BBRK 2A7CA 4X8TH 1MBQA 1G32B 1GDUA 4QT8C 2CN0H 1Q3XA 2OCVB 3SNCA 3KF2A 4DW2U 1QBVH 1K1NA 1XX9A 1PFXC 1LKBA 1SPJA 1O2QA 3RXFA 3GCTF 1FUJA 5DK1A 3LGYA 1LVMA 2BXUH 2QXGA 5B6OA 4FUJA 1C2FA 1M9UA 3HGPA 1QGFA 4FUBA 2RCEA 1W0ZU 3T25A 3OTJE 3SO3A 1O5BB 3ATKA 4KTSA 3L6PA 4CRGA 4MNYA 2GP9B 4CH2B 4NIXA 1MCVA 5EW2H 4J2YB 1FONA 1V2MT 3A80A 4GVUA 1P05A 2WYJA 1AGJA 2QY0B 4IMZA 4YZUA 5LGOA 4A1TA 2SGFE 1LO6A 4Z6AH 3P17H 1TGNA 4MPVA 2ZKSA 3P95A 3SI4H 2BTCE 3P8OA 1V2UT 1F0RA 2HNTC 1SOTA 3BTTE 5T6GA 4YLQH 4AFUA 4XBCA 1TGCA 1ZPCA 1GI3A 2JH0D 4ABAA 1TOMH 1TPOA 2OUAA 1OXGA 1PYTC 5G4BA 1S6HA 2F9VA 3M7UA 4DURA 1ESTA 1C1MA 1HAHH 2Y5HA 3STJA 3S69A 1FMGA 3QWCH 1QQ4A 2KAIB 1T7CA 1SGQE 3FZDA 3PM3A 3DFLA 2A32A 1EOLA 2XTTB 1IQIA 2HRVA 3EA8A 1WOFA 1GVKB 2ODQA 1MKWK 1FY1A 1ZJDA 2YNBA 1VITG 1GBHA 5AF9H 3T28A 1H9HE 5J4SA 2D26C 2FS9A 2ULLA 1W12U 1DWEH 1P8VC 1C5NH 2G8TA 2XW9A 3GCOA 5T6FA 2WYGA 4AFSA 4YOGA 2C93B 1LDTT 4D9RA 1GBIA 1ORFA 1YPKH 3KHVA 3MNSA 2O9QA 5A8YA 3ATWA 4CRCA 5LPFA 2FP7B 5JB9S 1C5ZB 3I78A 2PLXA 1PPBH 3T2NA 2K1QA 1V6DA 2FX4A 1OS8A 4BAMB 3TVJB 1J14A 1G3BA 2Q6DA 4TY7A 1NRSH 1P11E 2WPKS 5A0CA 2P93A 4BAQB 4CBNA 1O34A 5HM2A 3F9FA 2XCFA 3PROA 1HAOH 4A7IB 1YKTA 2GDEH 3UPEA 3GCHB 3U8TH 1DVAH 1P2QA 1AE5A 3D62A 1O3HA 1OYQA 2VVVA 2CXVA 2CJIA 3BTDE 3RXVA 1S0RA 1GVLA 2G4UA 1OX1A 1LVOA 1N8OC 1O2TA 1RTKA 1SLVB 1SLUB 1P2OA 2BQ7B 1AKSA 3GY8A 1BA8B 1ZR0A 1PPHE 3O8RA 1HNEE 3BG4B 4X1SU 1GHVH 4JZIA 3PLPA 4ZHLU 1BRUP 4H6SB 4Y8YA 1NRQH 4IMQA 3A87A 3LC3A 1HB0B 1QR3E 1CBWC 1MMJN 1SHHB 1S82A 1TRNA 3RXEA 4GPGA 2CGAA 3A7WA 3TNSA 2RG3A 2AGIX 4BTIB 1KXCA 5BPEA 3ZV8A 3ZZ3A 3P8NA 4CRBA 2VJ1A 3D23A 1ZTLA 1EB2A 1QIXB 4KTCA 4MPWA 3VGCB 3UNRA 4KELA 2ZU1A 1Z8GA 4A1VA 4WF8A 1C5TA 2EEKA 1ID5H 3U8RH 4YOJA 1AN1E 2FLRH 4D76A 1AUJA 1GBCA 1HJAB 3A7VA 7LPRA 3HKIB 1ETTH 3A7XA 2V3HH 5AFZH 1P2MA 1DY9A 1F0TA 2BLOA 3P8FA 1TBRH 3S9AA 1JBUH 1BMMH 1AB9C 3T27A 4X8UH 2VVUA 1CA0C 2QN5T 5TCCA 1S0QA 1A0JA 3N7OA 3TJOA 1G37A 4Y8XA 1BT7A 1NT1A 1ELEE 1KYNA 1AO5A 3PO1B 1W13U 4UONA 2ZPSA 1UCYH 1XKBC 5DO4H 2QXIA 1O2IA 4X6PA 1F5RA 1VCWA 1RGQA 1L2EA 9LPRA 4BAHB 2V0BA 1UVOA 1UVPA 2QYIA 4MTBA 2OQUA 3UQOA 2BDIA 3L33A 1A0HB 1RFNA 3FP6E 1YCPM 3LOXA 2G5VA 4NGAH 5JPMH 1GI8B 4ISOA 4FUGA 1MBMA 3A8AA 4Y7AA 3BSQA 4AGJA 3FANA 4JYVH 2QGRA 4A1XA 4B74A 1XVMA 2Z9KA 1S81A 3ZZ7A 3ZZ4A 1G2MA 3MH4A 1O3MA 3RXHA 1HAGE 6CHAB 5J4QA 2Z3CA 5LPRA 1PQAA 1O3IA 1BHXF 4D7GA 1N8OB 3TGKE 1ZPZA 4MNWA 2XC4A 6ESTA 1V2ST 2J94A 4OS4A 2SGPE 1HDTH 2ZTZA 3SGQE 3NUMA 4D8NA 3A8BA 1GDQA 1IQNA 3F1SB 4Q80A 1VCQA 2DUCA 2ESTE 1RS0A 1Y3XA 5DJ7A 4ASHA 3ZZAA 1ANDA 1K1MA 1UVTH 3KIDU 1CBWB 3BTQE 1N1LA 3QO6A 1SI5H 2ZU5A 1P2NA 2FOBA 2ZGJA 2FESH 1FNIA 2Y5GA 1BDAA 3P92A 1XUFA 1ZHPA 4YLUA 2C8ZB 3RMOH 3BF6H 1O3CA 2XYAA 1KSNA 1HBTH 1TMTH 3SU4A 1PQ7A 4YM9A 1O2YA 4B76A 1O37A 2AMQA 1FDPA 1Z1JA 1C9TA 3WY8A 1LHDH 1GCTC 1GBDA 2ZFPH 2BD8A 2A2XH 2G55A 1D3QB 2ODPA 2UUJB 1SGPE 3GY3A 1D9IA 1SQTA 1ZSKA 4ABHA 5C5OA 3UIRA 1DWDH 1AB9B 2Y81A 1O2SA 1QB1A 4INLA 1UJ1A 3ESTA 4I8HA 3SV6A 2ZCHP 1O3AA 2B7DH 2BM2A 1EP5A 2VU8E 5DP7A 4ZHAA 1N6XA 1TONA 2W3KA 4I31A 1SVPA 1HCGA 4D9QA 1A46H 4CRAA 3RXGA 5A2MH 3H7OA 1U6QA 4AFZA 2AERH 1OWDA 3TPIZ 2ZU3A 2R0KA 4UDWH 1AWHB 1C5SA 2FOFA 3RXRA 3DA9B 1HUTH 1BTYA 1AVGH 4OS1A 4WMEA 4VGCC 2Z9IA 2NU4E 3UY9A 1T8MA 2BX3A 1HAZB 2GCHF 3BV9B 1XXDA 1FI8A 1IQLA 3LIWA 1ESBA 1AQ7A 1GPZA 5FX5A 2OBOA 1JOUB 5EGMA 2A0QB 3U69H 1TA6A 1XUIA 1GHYH 2GZ9A 2HOBA 4CRDA 2B0FA 1HAYB 4CREA 4PROA 4BAOB 1C1QA 1CSOE 2UUFB 1Z8RA 5TJXA 1O5CB 3Q3KA 1D3DB 3UR6A 1EJNA 1KXEA 1ANBA 1C5RA 2CV3A 2NU0E 2PHBA 3M7QA 4WWYA 5HGGA 3P70B 4MVNA 5I25A 1LHGH 2A45B 1C4Y2 1AMHA 1O2UA 3C1KA 2P16A 3DFJA 2HNTE 1VJ9U 1YPJH 3AASA 1A5IA 1V2LT 2ZPRA 4FUFA 3S9CA 3GY6A 1TNKA 1FZZA 2BVXH 4TYDA 5K0HA 1BQYA 3OY6U 1L1GA 5IYTA 1WQSA 3F9EA 3MNCA 5GIBA 3VB4A 4KP0A 1ARCA 3SUDA 8GCHF 1O2LA 3STIA 4X8SH 2WINI 3QUMP 1DSUA 1ESAA 5EXNA 1HAVB 4UFFH 4H42U 1RIWC 1QY6A 2FTMA 3RLWH 3QGNB 3TK9A 5FHTA 1BRAA 4XFQA 3H7TA 1Z8JB 4TWWA 7ESTE 1TBZH 3GICB 3TH2H 3BN9A 3V13A 1PQ8A 1E38B 1Y8TA 1Y3VA 1E34B 1LKAA 1OP2A 4U30A 5T6DA 5HMAA 1VJAU 2VIVA 1TGBA 1KTSB 4RN6A 5GCHF 1TX7A 4K3JA 1C5LH 5C2ZA 3ENSB 4TWYA 5GJ4B 3E0NB 2TBSA 4IC6A 2C90B 5GPIB 1GHXH 1T8LA 4GUXA 1GHAG 1YLCA 2ZFFH 1KDQB 2J95A 1LMWB 1BRCE 5DPAA 5JB8S 3JZ1B 3M5MA 4K2YA 1AIXH 2Z6BD 3E0PB 2Z3DA 5F03A 2QV1A 1HXFH 3GY7A 1A5HA 3Q76A 4Y71A 5HYOA 1CGHA 3S9BA 2XWAA 1O35A 2FLBH 2JH5D 3BTGE 1C1SA 5F8XA 1CVWH 1CGIE 3B9FH 3NCLA 1HLTH 1DLEA 4D7FA 1K28D 1TNGA 1SGTA 4HI3A 2BLVA 3K65B 2CF8H 4WXIA 2EA3A 4IGDA 1C1UH 3JZ2B 1BTHH 1EJMA 4RKJB 1F0UA 3SNEA 3LJOA 3VB3A 4XDEA 1O3OA 2FZZA 1G3EA 1MTNC 2GT8A 2ZP0H 3M36A 5DP6A 1V2RT 4ESTE 4FVBA 1YF4A 1KLJH 8KME2 4Q7YA 1YPEH 1YPHC 2SFAA 2PGBB 1XM1A 2G51A 4XBDA 3A8CA 1HV7A 5GDSH 4JCNA 3MYWA 4WVPE 1T4UH 1SC8U 1EPTC 3BEIB 5EODA 4CH8B 1SLWB 1W3CA 3TH3H 6GCHF 1QRXA 1RTLA 1LTOA 2UWOA 2WV4A 2Y7ZA 4U2WA 5FPSA 1NM6A 3D49H 4UFEH 1AZ8A 2GTBA 3U8OH 1PQ5A 4BXSA 4OS6A 2QF3A 3RC4A 1GMHF 1JRTA 3A86A 3PTNA 1EZSC 1ELTA 1HIAB 2ZECA 2OXSA 3LGTA 2PUXB 2FOCA 1RIWB 5CHAB 1UTMA 3RXQA 1EX3A 1GJ5H 1TGTA 3RXIA 3GCTG 1LQDB 1DM4B 1MD7A 2FM2A 4BXWA 2F3CE 4DIHH 3DT0H 3F68H 1P10A 5CE1A 4Y7BA 1A2CH 1NN6A 3RUOA 3RU4T 2W5EA 3VB5A 1MD8A 4X1RU 5DP3A 1DXWA 2O8MA 3W94A 1UTQA 1LHFH 1Z71A 4JK5A 3U9AH 4Q7XA 1C5OH 1G36A 1IQMA 1V2QT 5A0AE 2R2WU 4A92A 1XUGA 2H5DA 1AE8H 2Z9GA 4DY7B 3QN7A 2HALA 1MZAA 1ELDE 1F5KU 2QCYA 2ZPQA 3LT3A 1H9IE 3RM0H 1XUJA 1IQFA 1EZUC 1DS2E 1SMFE 2XNIA 1NFYA 2XCNA 9ESTA 1GJDB 1VITH 1GI5A 1D3PB 2VIQA 1C1WH 1RJXB 2GD4B 2HPPH 1V2JT 4UFDH 3A88A 1K9OE 3LPRA 1LPZB 4FUHA 2J2UA 4X0WU 2Q6GA 4GLYA 2FEQH 2ZCLP 2HVXA 4FU9A 1C5PA 4ZKRU 1GJ9B 1EUFA 3SOSA 1BJVA 3E8LA 1K1OA 5EOKA 3UR9A 1QCPA 4BAKB 1HAIH 2GCTB 5ABWA 5JYIA 1BRBE 2FOHA 3SHAH 3KGPA 3VXFH 1NROH 2Z9LA 4O3UA 1ZJKA 5L2YH 1C5MD 2B5TB 1IQGA 4MDSA 2BD5A 1WTGH 3UREA 2ZDMA 3NWUA 3T5FH 1O3NA 2LNCA 1W11U 2H5CA 1CT2E 1TX6A 2WUBA 1G9IE 2XBXA 3E3TA 1KXFA 1P0SH 4ZXXH 5EXLA 3M5LA 1IHTH 1W10U 1EPTA 1VGCC 4MLFB 1A0LA 3PMHB 5HXFA 1MTSA 2BOKA 1O5AB 3A82A 4INHA 3E90B 3M3TA 2ZHDA 1W14U 3RU4D 5JBAS 1TRMA 5E2OA 2AMDA 1OWKA 1SBWA 2BZ6H 1Z6JH 2KAIA 3Q00A 1L4ZA 5CMXH 4JZDH 4WH6A 1O3FA 1KXDA 1YCPH 1AKSB 1FIZA 1LHCH 1UTNA 2PWXA 4K8BA 2P3TB 5F8TA 1Z6EA 1O39A 3Q3YA 4Y10E 1O2MA 4MNVA 1GG6C 3K6ZA 4ABIA 2VH6A 4A6LA 3FP8E 4AB8A 1VITF 1AD8H 3U1IB 7GCHG 2UWPA 1JWTA 4SGBE 3PLBA 5FAHA 3F9GA 4AYYB 1QA0A 1E37B 1P06A 3AAUA 4IN2A 3O8BA 2BDYA 2GV6A 3MMGA 2A4RA 1L1JA 1RTFB 1P9SA 3RXDA 1EZXC 4B2CA 2A2QH 3T62A 2JH6D 4Y0YE 2V6NA 1YPLH 1ZHRA 4AG1A 5AVDA 4X6OA 4GSOA 1GMDF 4LXBH 1MAYA 1WV7H 1FY4A 4GCHG 2F83A 3AW0A 1BMLA 1Q2WA 1AFQC 4I8GA 3M3VA 1SGDE 1F7ZA 2BDHA 4Y0ZE 1T31A 4XBBA 1HYLA 4ISIH 4ZH8A 1XMNB 1P3EA 1QJ7B 3UWIA 3VEQB 4B1TA 3OX7U 3TIUA 4I8LA 4HZHA 4X2YA 3MU5A 3ZVCA 3A7TA 1PPGE 3S7HB 4MNXA 1TNHA 2OLGA 1LQEA 1ELAA 1SG8B 3HGNA 5L30H 1DT2A 3LGVA 3LU9B 1Z7KA 3RM2H 2BY6X 3HK3B 1C1NA 1FIWA 2TGPZ 1S84A 1C1TA 4CHAC 1BTUA 1GI6A 4UE7H 1O2RA 1SSXA 1TFXA 3K6YA 2ZDNA 1AY6H 3EAJA 4KKDA 5HM9A 4NWLA 3KQCA 1C5VA 1HFDA 3MTYA 3GOVB 1HRTH 4ZKNU 4MQAA 1NU7B 4RKOB 1ZRBA 4YO9A 1DWCH 2Z7FE 3KQEA 3RXOA 2F91A 1YBWA 2RDLA 2THFB 1EOJA 2HGTH 1NFUA 2XC5A 3CS0A 4BTUB 2O8UA 3ATIA 7KMEH 1GJCB 1XUHA 2GDDA 1OP0A 3SQEE 5EU8A 1D4PB 4E7RG 4Q2KA 3ZVFA 3RXSA 3ZZ5A 1C4V2 2ZU4A 2G4TA 2NU2E 1AWFH 5GXPA 1P12E 1GG6B 2PKAB 2ZA5A 2PSXA 1WBGB 4MPUA 3SU0A 1CGJE 4H6TA 1H4WA 2WV5A 1EAXA 4ZXYH 1ZHMA 3MH7A 4YESB 2PW8H 1NRRH 3RXMA 3ATLA 1QL8A 1THRH 1Y5UT 2D8WA 1UVUH 1QTFA 1GJ4H 1Q31A 1ZLRA 1CHOF 1GMCF 1IQEA 2XXLA 4HTCH 2B8OH 1GDNA 1QNJA 1SR5C 4TPYA 1O3JA 2GV7A 2ZNKH 5JBCS 3EA7A 4UEHH 1A61H 2BD3A 2AGGX 4ABJA 2C8YB 2AIPA 3MH5A 2Z94A 3GY4A 2R3YA 4Y11E 3O8DA 1AFQB 1FAXA 3M61U 3FP7E 1ELBA 1DWBH 1UTPA 2FTLE 3ATMA 4U32A 3ZVDA 2BY8X 3OY5U 2OBQA 3SV2H 2PKSC 2C8WB 2F9UA 1AVXA 2ZGBH 4I32A 2J92A 1O2HA 1J16A 1QA7A 4WXVA 2YOLA 1GI9B 1ANCA 1EASA 1GJ8B 5JBTA 4X2VA 1YPHE 3EDXB 2BDAA 1UCYK 1ZSJA 1XUKA 2FI5E 2VH0A 4ZUHA 1P09A 5K7RA 1GHBF 2Z9JA 1C2DA 2G5NA 1GHWH 2FOGA 1CO7E 3G01A 4KGAA
chains in the Genus database with same CATH superfamily
1C2MA 2AYWA 1GI4A 3BG8A 1TAWA 3RU4E 5I46H 1OWIA 1P57B 1EAUA 1SFIA 1ACBE 2FXRA 1CA0B 1TNLA 2FIRH 1LVYA 3GDUA 1ZTJA 4OS7A 2GCHG 1G3CA 1TQ0B 4E7NA 3SU2A 1O2VA 2V3OH 1MTUA 4DGJA 2BY5X 4ABBA 1BIOA 3F2HA 3BTME 3F9HA 2OD3B 1P9UA 1E0FD 3GY5A 3RC6A 1KXAA 1QJ6B 1UTKA 3W1EA 2H1UA 2BDBA 3GCNA 3GDVA 2QXHA 2LPRA 2ZFQH 1O2JA 2OTVA 1WSSH 2J34A 1CT4E 4NA9H 5GWZA 1JRSA 1BJUA 4Y76A 2ZGHA 1K1JA 1ZMNA 2XBYA 4B2BA 3LDXH 2IOTA 3EE0B 1TIOA 5DP8A 1T32A 1BTPA 1GBLA 3U1JB 2ZCKP 2ANKH 3V0XA 3MU4A 1FY3A 1L0ZA 1WUNH 2ZHEH 2ZIQH 2KCYA 1KMHB 1VR1H 5FBIA 1XKAC 3A7ZA 3BTWE 3KNXA 3RDZA 1TOCB 2TGAA 5KGOA 1RXPA 3P6ZB 1H1BA 3QX5H 1D6RA 4K60A 3LGIA 4X6NA 1JXPA 2F9NA 1GCDA 3R3GB 3V7TA 4AYVB 5FXLA 8GCHG 1DPOA 1FJSA 1AUTC 1OOKB 2VNTA 5A8ZA 4K69A 1SGNE 4X2WA 3KQBA 3UAIC 4I33A 3ZVBA 1EP6A 2P59A 5BRRE 3LH3A 1GI0A 3TJNA 1GGDC 3LGUA 4FUEA 1GBEA 1LPGB 1L4DA 1S6LA 1UVSH 1NFWA 1UHBB 1Y3UA 1UMAH 1MQ6A 2SGDE 2P3FH 4M7GA 2RA3A 4LZ4B 3LKWA 4LK4A 3L3TA 4ABDA 3ZZ8A 4UFGH 2TGDA 4Y79A 3MO6A 1XXFA 3LONA 5CHBA 5ETXA 1BUIA 3SW2B 1BTZA 1Y59T 2WPIS 1UW7A 3CNRA 5GCHG 5F6MA 4CBOA 1A3BH 1MQ5A 1K1LA 2PGQB 1GCTB 1NO9H 2G52A 4JMYA 1TYNA 3U98H 1O2OA 3SU5A 1O3KA 1MKXH 1DXPA 4F48B 1MAXA 2P95A 1MU8B 1MZDA 3A85A 1QB6A 3DCLA 1K1PA 1TPPA 2R2MB 2ANYA 2JJ1D 5FCRA 3TITA 2A4QA 3QGJA 3PB1E 1INCA 2ZTYA 1ZGIA 4NCYA 1GBJA 1O2KA 2D1JA 1O2NA 3H09A 1DE7H 1QL9A 1QBOA 2BOHB 2BYAX 2HWLB 3UQVA 1BZXE 1GVZA 3NKKA 3TGJE 3E1XB 2ANWA 4VGCB 4IC5A 4OS5A 1ZMJA 2XWBI 1ELFA 1HAVA 3KN2A 3TGIE 3KEEA 3SU3A 2WUCA 1C2IA 5LPEA 1O33A 1TABE 1W0JD 1O5FH 2PTNA 4K1EA 2HNTF 2BD4A 1H8DH 1NRNH 4DOQA 1MTWA 1O5DH 1GI2A 3OEED 1BCUH 4NIVA 4XSKU 1OKXA 3SU6A 6GCHG 1ELVA 1DLKB 1GBAA 3M5NA 1C2EA 4NZLA 1WAYB 2ZFRH 1J9CH 4AN7A 3DD2H 1BBRH 1GL0E 1TA2A 1TNIA 1GMHG 3N7DA 4B71A 2H9EH 5L6NH 1BBRE 4B2AA 3HPTB 1Z8IB 1KDQA 2OQ5A 3NZIA 2J9NA 2C3SA 1GWAA 2R0LA 3AAVA 2UUKB 3VB6A 2BD7A 3V3MA 4WJG2 1P01A 1GGDB 2A4OA 3I77A 1QJ1B 3OAAD 1AZZA 2A5IA 1C5XB 3OSYA 5KEDA 2HPQH 1DUAA 1BHXB 2AIQA 2BB4A 3MI4A 3MNXA 5FPTA 1NTPA 1ZOMA 1C1VH 3FFGA 4FUCA 3MOCA 1KLTA 3SI3H 3MQKC 2O8LA 3QLPH 1S85A 8ESTE 2IPHA 2W7UA 1EAWA 3QK1A 2F9BH 4WMFA 3GISB 3MO3A 3SZEA 5T3HA 1TRYA 4NSVA 1FY8E 2QXJA 1C4U2 1EQ9A 2FODA 5DP4A 1SGFA 1A1RA 2VWNA 1O36A 2ZQ2A 3WWFA 4Y8ZA 4K1SA 1IAUA 2SNVA 2SGEE 3RXPA 2YNAA 3LC5A 3RXUA 3ZYDA 4F4OC 3ZVAA 2M5TA 2Y7XA 3ZYEA 3LH1A 3AK5A 4ABFA 4WH8A 1GBTA 1MKWH 1V2TT 3SJ8A 4YT6H 1QFKH 3RXCA 3PYHA 4IN1A 4J1YA 1YWUA 1DANH 2BHGA 4K8YA 4A5TS 2FWWA 5EJLA 4JYUH 1MTVA 2G81E 1TMUH 2Q1JA 1BB0B 1G30B 1EAIA 2OC7A 2R9PA 3GDSA 4FU7A 5FBEA 3LJJA 2VWLA 1FPHH 3MFJA 3GCHC 3TK5A 1C1RA 1B0FA 1MUEB 1FPCH 2KM0A 2VINA 3MNBA 2ZGCA 5A0BA 1E1RD 4FVDA 3K9XB 5DG6A 1NESE 2BY9X 3TH4H 3B23B 5E0JA 1PPFE 1NY22 2W6JD 3F2FA 4ZHMU 1SGIB 2XC0A 1QRZA 1TQ7B 2PV9B 1L1NA 1A3EH 1O32A 2A31A 5EPYA 1MTNB 5AFYH 2KCPA 3NK8A 4RT1A 2JKHA 3BG4C 1GJ7B 2XBVA 5LH8A 2XBWA 2YMSB 1O3EA 1O5GH 2BDCA 4NFEA 3RXJA 2QIQA 1E35B 3PWCA 4NIWA 2O8TA 2ZTXA 1THPB 2UUYA 3OEHD 4AFQA 2VIWA 4HGCA 2QC2A 3UFAA 1O3DA 2ZFSA 5EPNA 2FDAA 2I6QA 1DICA 1EPTB 4ACBA 2Y6TA 3Q77A 3DSPA 2ZHWH 3RXKA 3K2UA 1E36B 4DJZB 2QF0A 4R0IA 3WWBA 2SGAA 3MO9A 2Q6FA 3ZZDA 4THNH 2EI6A 5JBBS 2ZO3H 3VGCC 3SNBA 1QURH 1Y5BT 1ABJH 4XE4A 3E6PH 2ZF0H 1WTHD 4F49A 1DFPA 3A83A 1SGYE 4K1TA 1HJAC 3PV4A 3E16B 1WXRA 2V3MA 1C2GA 2F9PA 1SL3A 2WPJS 1O3GA 4AB9A 3BIVH 5E0HA 3VPKA 1PPEE 1Y5AT 3A81A 2A7JA 2IN2A 3UNSA 1D6WA 3ZV9A 1GBMA 3UWJH 1TALA 2ZHQH 2ZFTA 1P02A 3PO1C 4I8KA 1IOEA 5H4IB 2BVSH 2J98B 2KR7A 4ZKSU 3MWIU 1O5EH 1GMDG 1OSSA 1SGRE 1WCZA 3GYLB 3IWMA 4RI0A 2PSYA 1FV9A 1ZMLA 1O2GH 2OC8A 4ZMAH 4AORA 2FOAA 1DUEA 4ABGA 4ISLA 1NPMA 3D65E 1V2WT 3ODDA 1OYTH 4ZROA 2J38A 3A84A 2VWMA 1O30A 1QHRB 2DE9A 4IBLH 1B5GH 3BTEE 4X6MA 1O3LA 1OP8A 2STBE 4O03A 4RSPA 2H9HA 1EZQA 3T29A 1DSTA 4JZ1A 1V2VT 4JZEH 4YOIA 3U28C 2I6SA 1UK4A 6LPRA 3ITIA 6CHAC 1BMAA 5EQSA 1HAPH 2H9TH 2ZI2H 3F0PA 1ANEA 4OGYA 2BLWA 2CHAC 1SLXB 1AFEH 1JIMA 3RLYH 4NA8A 1XVOA 2FI4E 2GT7A 1FY5A 3QDZB 1A5GH 1CHGA 1P04A 1RD3B 5C20A 1YPMH 1W0YH 4BANB 3MHWU 3PWBA 3PMBB 3F6UH 2VIPA 3SBKA 2VIDA 1P2IA 1EJAA 4CRFA 1S5SA 1SQOA 2P94A 7GCHF 1K2I1 3SQHE 3ZVGA 1T4VH 3QTVH 1ARBA 2BQ6B 3QZRA 4NFFA 5L2ZH 1ZSLA 2WHXA 1EB1H 2L6OA 3HK6B 1TPSA 1IQHA 3AW1A 1C9PA 1X7AC 2Y82A 5EQQA 2FOEA 2Y5FA 2BZAA 2W26A 5PTPA 3RMMH 3TJVA 1DY8A 3M7TA 3URDA 4O3TA 1YCPK 1SOZA 2FX6A 1C2KA 1YM0A 2BLQA 1GJBB 4MG3A 1OWJA 3ZVEA 1GI1A 4GCHF 3CP7A 2A1DB 5C94A 2PTCE 4NIYA 3PV2A 1SFQB 1VGCB 3TJUA 2GZ8A 1JMOH 1CA8B 1MCTA 4FU8A 4B75A 4X1QU 1O3PB 2FYQA 1O2PA 4ISNA 3URCA 1GJAB 1PYTD 2J5UA 2VGCC 4ZKOU 3BEUA 3CS7A 3HATH 1FAKH 3PTBA 4Q7ZA 4AZ2B 2ALVA 1CT0E 5FPYA 3SGAE 4DT4A 1ETRH 5FCKA 3DHKH 1CHOG 2W7SA 4AG2A 1GMCG 3S7KB 4NZQA 1SGFG 4K5ZA 3BTHE 3EA9A 4JZFH 1RRKA 4X1NU 4P02A 4UD9H 4FUDA 1SB1H 2A4GA 1VZQH 1UCYE 1OWHA 2AFQB 2QA9E 2ZGXH 1YP9A 1D3TB 1NS3A 3M5OA 1PPZA 3E91A 2B9LA 1THSH 1QQUA 5EG4A 1YPGH 1A4WH 1SQAA 3GYMA 1ABIH 4O9VA 4CR5A 5E8EH 1NFXA 1C1OA 2JETC 1GBBA 4SGAE 1KLIH 2PP6A 2PUQH 1GJ6A 2Y80A 2PFEA 5DP9A 1WQVH 3ELAH 2GMTC 1UTOA 2TGTA 2SNWA 3EYDA 1HJ9A 2F9OA 3MU8A 2AH4X 5DP5A 5E2PA 1S83A 2ALPA 4JYTA 1O2ZA 1SGCA 3BEFB 1W7XH 3UNQA 1TB6H 3VXEH 2WZQA 5ESTE 2VB0A 1GHBG 4HFPB 2AEIH 2KFWA 2P3UB 2CHAB 2FPZA 5FX6A 1K22H 3H5CB 3S0NA 2VVCA 1ZZZA 4AC9A 3W95A 1W2KH 2BXTH 1TMBH 1F2SE 3SJKA 3SUFA 4NWKA 1UO6A 2BQWB 4ABEA 2PKAA 4B73A 3LGWA 1TX8A 4Q4LA 2BMGB 1IHSH 3MU1A 1BITA 2FI3E 3ZZBA 1FLEE 3RC5A 2BD9A 1NZQH 3GY2A 2ZHFH 3SUEA 3DUXH 2VWOA 3HKJB 2WPMS 1TLDA 3UTUH 1G2LA 1K1IA 2XNDD 2ZDKA 2OINA 2STAE 5EW1H 8LPRA 4NSYA 2O8WA 1EATA 4CHAB 1E1QD 3SGBE 2EC9H 1WDIA 2GZ7A 3KCGH 1F0SA 2GKVE 1K21H 3M35A 2RDEA 3KL6A 1KY9A 5DKMA 1UTLM 1TWXB 1ELGA 3SU1A 4AX9H 3CENA 2H2ZA 3SUGA 4E05H 4ZCNA 1W0KD 3QZQA 1Y3YA 5DGJA 5TCAA 2VGCB 3UOPA 2FO9A 3I29A 3TU7H 1EXFA 1YYY1 4KTUA 1HJ8A 1O3BA 1BTXA 1Y3WA 3Q3XA 2XOKD 4M9FA 4YXWD 1GBFA 2EI8A 2PR3A 4I7YH 3A7YA 2ZC9H 2QE7D 1P2JA 5JDUB 1C5QA 4TPIZ 1CQQA 1O31A 2Z3EA 1AVWA 1ZRKA 4GAWA 2XRCA 3SJ9A 2AS9A 2BDGA 3NXPA 4LOYH 3IITA 2GGVB 4OM9A 2ZDLA 2QAAA 1FXYA 2NU1E 1KIGH 1AHTH 1NBMD 1OWEA 1V2NT 1DITH 2VIOA 2RA0A 4JK6A 2WPLS 5A8XA 4R8TB 3SV9A 4BOHA 2JETB 2LP6A 1NRPH 2GMTB 3PMJA 2ZEBA 1WYKA 1Z1IA 3RMNH 4IS5A 3ZZ9A 3KQDA 2A5AA 1DOJA 1TPAE 3R0FA 3SORA 3MU0A 4DVAU 4X8VH 3T26A 3F3BA 5A09A 5HIYA 1QBNA 1H9LB 1TBQH 2BX4A 4U01A 5SGAE 1AU8A 1P3CA 1CU1A 1LHEH 1LPKB 5ESBA 2ZDAH 2PKSB 4YTAA 1HAXB 2W3IA 3RXLA 3NPSA 1YGCH 3ODFA 1ZTKA 2V35A 4O97A 3VG8A 3M3SA 4Z0KA 3QTOH 5C67A 1SGEE 1GL1A 1ETSH 1C1PA 2ZQ1A 1FN8A 3N7EA 2FYRA 2UWLA 3EQ0H 1J8AA 5C1YA 2BVRH 3SV8A 2A7HA 1ZYOA 1V2KT 2HLCA 3ZIAD 3FVFB 1O0DH 4X1PU 2FS8A 4GHQA 4NG9H 4LZ1H 1LCYA 2WPHS 3SNAA 3UOUA 3OU0A 1GI7B 1W8BH 4WY3A 1ZGVA 5AHGH 4GHTA 1H8IH 1HXEH 1O38A 2V7QD 4OS2A 1VCPA 1FN6A 2BY7X 5CHAC 1GHZA 1WU1A 2FMJA 1T8NA 1UHBA 4IW4E 1C5UA 2TIOA 4BNRA 2CMYA 2H6MA 3B8JA 4MPXA 3V12A 2C8XB 3FAOA 3TK6A 1J17T 2P8OC 2J97A 1N6YA 1TGSZ 3A89A 1O2XA 1DX5M 3RP2A 3P8GA 1C5WB 1TNJA 2ZZUH 1QB9A 3TNTA 1ELCA 4NA7A 4DG4A 4TY6A 2JJ2D 3KYFA 4WMDA 1F92A 3TLOA 3SHCH 2EI7A 5C1XA 2SGQE 2AGEX 2G00A 2BD2A 3M37A 1ZPBA 5B6LA 2W6ID 1CE5A 3F0OA 3RXTA 1BOQA 5EJZA 1QL7A 3VFEA 5C5NA 1S6FA 1PPCE 1AI8H 1C2JA 4X2XA 3RXBA 2CF9H 4XOJA 3BIUH 3SJOA 1W7GH 1KXBA 4FXGH 1G3DA 1V2PT 3BTFE 2ILNA 2VBCA 4ISHH 4H4FA 2DE8A 3PMAB 2IJOB 4BTTB 1MH0A 1B0EA 1GHAF 1B7XB 1FQ3A 4I8JA 1KTTB 1V2OT 1A7SA 3UUZA 2ZDVH 4ZAEA 1BTWA 3OYPA 2ANMH 3VB7A 5EQRA 5F8ZA 3A8DA 1F5LA 1UK3A 4E06H 4INKA 1C5YB 1MKXK 1GBKA 2OC0A 3C27B 3IG6B 4AGKA 2KCAA 1IQKA 5E0GA 1UK2A 1HGTH 2OP9A 2GCTC 1JIRA 1J15A 1O2WA 2OC1A 1C2HA 1IQJA 4YT7H 4FOUC 3RMLH 3MH6A 2C4FH 2NWNA 3SJIA 3SNDA 3ZZ6A 3BTKE 5C3NA 1YC0A 1P03A 2ODYB 3FZZA 3OFND 2ZWLH 3O8CA 2J4IA 5C0UA 2WV9A 1NU9A 3SV7A 1OPHB 5C1UA 1SHYA 3RXAA 3SZNA 1TE0A 2ZU2A 2FOMB 1NC6A 3SN8A 5IK2D 1FX0B 2ZG0H 4CR9A 3EGKH 2AMPA 4FUIA 2NU3E 2A5KA 2GVFA 4DCDA 1EKBB 1V3XA 2TPIZ 2TRMA 1HPGA 1BMNH 1PJPA 1UTJA 3AVZA 2D2DA 1QRWA 1DDJA 1YLDA 3PLKA 5EXMA 1C2LA 1P2KA 5IDKA 2P8OB 1T8OA 2GX4A 1LVBA 4DT7B 2ASUB 5EJ1A 4AOQA 1NBME 4OGXA 4DIIH 4Y6DA 5CDFE 2R3UA 3ZZCA 1MU6B 1HIAA 1BBRK 2A7CA 4X8TH 1MBQA 1G32B 1GDUA 4QT8C 2CN0H 1Q3XA 2OCVB 3SNCA 3KF2A 4B6EA 4DW2U 1QBVH 1K1NA 1XX9A 1PFXC 2EY4C 1LKBA 2F4LA 1SPJA 1O2QA 3RXFA 3GCTF 1FUJA 5DK1A 3LGYA 1LVMA 2BXUH 2QXGA 5B6OA 4FUJA 1C2FA 1M9UA 3HGPA 1QGFA 4FUBA 2RCEA 1W0ZU 3T25A 3OTJE 3SO3A 1O5BB 3ATKA 4KTSA 1EFRD 2HVYB 3L6PA 4CRGA 4MNYA 2GP9B 4CH2B 4NIXA 1MCVA 5EW2H 4J2YB 1FONA 1V2MT 2CK3D 3A80A 4GVUA 1P05A 2WYJA 1AGJA 2QY0B 4IMZA 4YZUA 5LGOA 4A1TA 2SGFE 1COWD 4TSFD 1LO6A 4Z6AH 3P17H 1TGNA 4MPVA 2ZKSA 3P95A 3SI4H 2BTCE 3P8OA 1V2UT 1F0RA 2HNTC 1SOTA 3BTTE 5T6GA 4YLQH 4AFUA 4XBCA 1TGCA 1ZPCA 1GI3A 2JH0D 4ABAA 1TOMH 1TPOA 2OUAA 1OXGA 1PYTC 5G4BA 1S6HA 2F9VA 3M7UA 3OTPA 1ESTA 4DURA 1C1MA 1HAHH 2Y5HA 3STJA 3S69A 1FMGA 3QWCH 3PV5A 1QQ4A 2KAIB 1T7CA 1SGQE 3FZDA 3PM3A 3DFLA 2A32A 1EOLA 2XTTB 1IQIA 2HRVA 3EA8A 1WOFA 1GVKB 2ODQA 1MKWK 1FY1A 1ZJDA 2YNBA 1VITG 1GBHA 5AF9H 4XRNA 3T28A 1H9HE 5J4SA 2D26C 3DSGA 2FS9A 2ULLA 1W12U 1DWEH 1P8VC 1C5NH 2G8TA 2XW9A 3GCOA 5T6FA 2WYGA 4AFSA 5KECA 4YOGA 2C93B 1LDTT 4D9RA 1GBIA 1ORFA 1YPKH 3KHVA 3MNSA 2O9QA 5A8YA 2KCOA 2GJGA 3ATWA 4CRCA 5LPFA 2FP7B 5F53A 5JB9S 1C5ZB 3I78A 2PLXA 1PPBH 3T2NA 2K1QA 1V6DA 2FX4A 1OS8A 4BAMB 3TVJB 1J14A 1G3BA 2Q6DA 4TY7A 1NRSH 1P11E 2WPKS 5A0CA 2P93A 4BAQB 4CBNA 1O34A 5HM2A 3F9FA 2XCFA 3PROA 1HAOH 4A7IB 1YKTA 2GDEH 2LELA 3UPEA 3GCHB 3U8TH 1DVAH 1P2QA 1AE5A 3D62A 1O3HA 1OYQA 2VVVA 2CXVA 2CJIA 3BTDE 3RXVA 1S0RA 1GVLA 2G4UA 1OX1A 1LVOA 5DSFA 1N8OC 1O2TA 1RTKA 1SLVB 1SLUB 3PRBA 1P2OA 2BQ7B 1AKSA 3GY8A 1BA8B 1ZR0A 1PPHE 2J98A 3WW7A 3O8RA 1HNEE 3BG4B 4X1SU 1GHVH 4JZIA 3PLPA 4ZHLU 1MABB 1BRUP 3EE7A 4H6SB 4Y8YA 1NRQH 4IMQA 3A87A 3LC3A 1HB0B 3DSOA 1QR3E 1CBWC 1MMJN 1SHHB 1S82A 1TRNA 3RXEA 4GPGA 2CGAA 3A7WA 3TNSA 2RG3A 2AGIX 5HIZA 4BTIB 1KXCA 5BPEA 3ZV8A 3ZZ3A 3P8NA 5T1VA 4CRBA 2VJ1A 3D23A 1ZTLA 1EB2A 1QIXB 4KTCA 4MPWA 3VGCB 3UNRA 1H8ED 4KELA 2ZU1A 1Z8GA 4A1VA 4WF8A 4B6FA 1C5TA 2EEKA 1ID5H 3U8RH 4YOJA 1AN1E 2FLRH 4D76A 1AUJA 1GBCA 1HJAB 3A7VA 7LPRA 3HKIB 1ETTH 3A7XA 2V3HH 5AFZH 1P2MA 1DY9A 1F0TA 2BLOA 3P8FA 1TBRH 3S9AA 1JBUH 1BMMH 1AB9C 3T27A 4X8UH 2VVUA 1CA0C 2QN5T 5TCCA 1S0QA 1A0JA 3N7OA 3TJOA 1G37A 4Y8XA 1BT7A 1NT1A 1ELEE 1KYNA 1AO5A 3PO1B 1W13U 4UONA 2ZPSA 1UCYH 1XKBC 5DO4H 2QXIA 1O2IA 4X6PA 1F5RA 1VCWA 1RGQA 1L2EA 9LPRA 4BAHB 2V0BA 1UVOA 1UVPA 2QYIA 2IPQX 4MTBA 1K0HA 2OQUA 3UQOA 2BDIA 2IJD1 3L33A 1A0HB 1RFNA 3FP6E 1YCPM 3LOXA 2G5VA 4NGAH 5JPMH 1GI8B 4ISOA 4FUGA 1MBMA 3A8AA 4Y7AA 3BSQA 4AGJA 3FANA 4JYVH 2QGRA 4A1XA 4B74A 1XVMA 2Z9KA 1S81A 3ZZ7A 3ZZ4A 1G2MA 3MH4A 1O3MA 3RXHA 1HAGE 6CHAB 5J4QA 2KZ4A 2Z3CA 4FETA 1PQAA 1O3IA 5LPRA 1BHXF 4D7GA 1N8OB 3TGKE 1ZPZA 4MNWA 2XC4A 6ESTA 1V2ST 2J94A 4OS4A 2SGPE 1HDTH 2ZTZA 3SGQE 3NUMA 4D8NA 3A8BA 1GDQA 1IQNA 3F1SB 4Q80A 1VCQA 2DUCA 2ESTE 1RS0A 1Y3XA 5DJ7A 4ASHA 3ZZAA 1ANDA 1K1MA 1UVTH 3KIDU 1CBWB 1QZ8A 3BTQE 1N1LA 3QO6A 1SI5H 2ZU5A 1P2NA 2FOBA 2ZGJA 2FESH 1FNIA 2WPDD 2Y5GA 1BDAA 3P92A 1XUFA 1ZHPA 4YLUA 2C8ZB 3RMOH 3BF6H 1O3CA 2XYAA 1KSNA 1HBTH 1TMTH 3SU4A 1PQ7A 4YM9A 1O2YA 4B76A 1O37A 2AMQA 1FDPA 1Z1JA 1C9TA 3WY8A 1LHDH 1GCTC 1GBDA 2ZFPH 2BD8A 2A2XH 2G55A 2JDID 1D3QB 2ODPA 2UUJB 1SGPE 3GY3A 1D9IA 1SQTA 1ZSKA 4ABHA 5C5OA 3UIRA 1DWDH 1AB9B 2Y81A 1O2SA 1QB1A 3OE7D 1UJ1A 3ESTA 4I8HA 4INLA 3SV6A 2ZCHP 1O3AA 2B7DH 2BM2A 1EP5A 2VU8E 5DP7A 4ZHAA 1N6XA 1TONA 2W3KA 4I31A 1SVPA 1HCGA 4D9QA 1A46H 4CRAA 3RXGA 2AHME 3H7OA 5A2MH 2M2AA 1U6QA 4AFZA 2AERH 1OWDA 3TPIZ 2ZU3A 2R0KA 4UDWH 3FO8D 1AWHB 1C5SA 2FOFA 3RXRA 4RT0A 3DA9B 1HUTH 1BTYA 1AVGH 4OS1A 4WMEA 4VGCC 2Z9IA 2NU4E 3UY9A 1T8MA 2BX3A 1HAZB 2GCHF 3BV9B 1XXDA 1FI8A 3F2GA 1IQLA 3LIWA 1ESBA 1AQ7A 1GPZA 5FX5A 2OBOA 1JOUB 5EGMA 2A0QB 3U69H 1TA6A 1XUIA 1GHYH 2GZ9A 2HOBA 4CRDA 2B0FA 1HAYB 4CREA 4PROA 4BAOB 1C1QA 1CSOE 2UUFB 1Z8RA 5TJXA 1O5CB 3Q3KA 1D3DB 3UR6A 1EJNA 1KXEA 1ANBA 1C5RA 2CV3A 2NU0E 2PHBA 3M7QA 3KQ5A 4WWYA 5HGGA 1YLNA 3P70B 4MVNA 1SQRA 5I25A 1LHGH 2A45B 1C4Y2 1AMHA 1O2UA 3C1KA 2P16A 3DFJA 2HNTE 1VJ9U 1YPJH 3AASA 1A5IA 1V2LT 2ZPRA 4FUFA 3S9CA 3GY6A 1TNKA 1FZZA 2BVXH 4TYDA 5K0HA 1BQYA 3OY6U 1L1GA 5IYTA 1VKYA 1WQSA 3F9EA 3MNCA 5GIBA 3VB4A 4KP0A 1ARCA 3SUDA 8GCHF 1O2LA 3STIA 4X8SH 2WINI 3QUMP 1DSUA 1ESAA 2WSSD 5EXNA 1HAVB 4UFFH 4H42U 1RIWC 1QY6A 2FTMA 3RLWH 3QGNB 3TK9A 5FHTA 1BRAA 3FOAA 4XFQA 3H7TA 5C17A 1Z8JB 4TWWA 7ESTE 1TBZH 3GICB 3TH2H 3BN9A 3V13A 4TT3D 1PQ8A 1E38B 1Y8TA 1Y3VA 1E34B 1LKAA 1OP2A 4U30A 5T6DA 5HMAA 1VJAU 2VIVA 1TGBA 1KTSB 4RN6A 5GCHF 1TX7A 4K3JA 1C5LH 5C2ZA 3ENSB 4TWYA 5GJ4B 3E0NB 2TBSA 4IC6A 2C90B 2F43B 5GPIB 1GHXH 1T8LA 4GUXA 1GHAG 1YLCA 2ZFFH 1KDQB 2J95A 1LMWB 1BRCE 4ACAA 5DPAA 5JB8S 3JZ1B 3PRDA 3M5MA 4K2YA 1AIXH 2QF4A 2Z6BD 3E0PB 2Z3DA 5F03A 2QV1A 1HXFH 3GY7A 1A5HA 3Q76A 4Y71A 5HYOA 1CGHA 3S9BA 2XWAA 1O35A 2FLBH 2JH5D 3BTGE 1C1SA 1E79D 1CVWH 5F8XA 1CGIE 3B9FH 3NCLA 1HLTH 1DLEA 4D7FA 1K28D 1TNGA 1SGTA 4HI3A 2BLVA 3K65B 2CF8H 4WXIA 2EA3A 4IGDA 1C1UH 3JZ2B 1BTHH 1EJMA 4RKJB 1F0UA 3SNEA 3LJOA 3VB3A 4XDEA 1O3OA 2FZZA 1G3EA 1MTNC 2GT8A 2ZP0H 3M36A 5DP6A 1V2RT 4ESTE 4FVBA 1YF4A 2YMSC 1KLJH 8KME2 2K8IA 4Q7YA 1YPEH 1YPHC 2SFAA 2PGBB 1XM1A 2G51A 4P00A 4XBDA 3A8CA 1HV7A 5GDSH 4JCNA 3MYWA 4WVPE 1T4UH 1SC8U 1EPTC 3BEIB 5EODA 4CH8B 1SLWB 1W3CA 3TH3H 6GCHF 1QRXA 1RTLA 1LTOA 2UWOA 2WV4A 2Y7ZA 4U2WA 5FPSA 1NM6A 3D49H 4UFEH 1AZ8A 2GTBA 3U8OH 1PQ5A 4BXSA 4OS6A 2QF3A 3RC4A 1GMHF 1JRTA 3A86A 3PTNA 1EZSC 1ELTA 1HIAB 2ZECA 2OXSA 3LGTA 2PUXB 2FOCA 1RIWB 5CHAB 1UTMA 3RXQA 1EX3A 1GJ5H 3NRLA 1TGTA 3RXIA 3SYJA 3GCTG 1LQDB 1DM4B 1MD7A 2FM2A 4BXWA 2F3CE 4DIHH 3DT0H 3FN8A 3F68H 1P10A 5CE1A 4Y7BA 1A2CH 1NN6A 3RUOA 3RU4T 2W5EA 3VB5A 1MD8A 4X1RU 5DP3A 1DXWA 2O8MA 3W94A 1UTQA 1LHFH 1Z71A 4JK5A 3U9AH 5EIYA 4Q7XA 1C5OH 1G36A 1IQMA 1V2QT 5A0AE 2R2WU 4A92A 5HKKD 1XUGA 2H5DA 1AE8H 2Z9GA 4DY7B 3QN7A 2HALA 1MZAA 1ELDE 1F5KU 2QCYA 2ZPQA 3LT3A 1H9IE 3RM0H 3GS9A 1XUJA 1IQFA 1EZUC 1DS2E 1SMFE 2XNIA 1NFYA 2XCNA 9ESTA 1GJDB 1VITH 1GI5A 1D3PB 2VIQA 1C1WH 1RJXB 2GD4B 2HPPH 1V2JT 4UFDH 3A88A 1K9OE 3LPRA 1LPZB 4FUHA 2J2UA 4HG6A 4X0WU 4GLYA 2Q6GA 2FEQH 2RFKC 2ZCLP 2HVXA 2L74A 4FU9A 1C5PA 4ZKRU 1GJ9B 1EUFA 3SOSA 1BJVA 3E8LA 1K1OA 5EOKA 3UR9A 1QCPA 4BAKB 1HAIH 2GCTB 5ABWA 5JYIA 1BRBE 2FOHA 3SHAH 4XD7D 3KGPA 3VXFH 1NROH 2Z9LA 4O3UA 5GNDA 1ZJKA 5L2YH 1C5MD 2B5TB 1IQGA 4MDSA 2BD5A 1WTGH 3UREA 2ZDMA 3NWUA 3T5FH 4F55A 1O3NA 2K0QA 2LNCA 1W11U 2H5CA 1CT2E 1TX6A 2WUBA 1G9IE 2XBXA 3E3TA 2YMSD 1KXFA 1P0SH 4ZXXH 5EXLA 3M5LA 1IHTH 1W10U 1EPTA 1VGCC 4MLFB 1A0LA 3PMHB 5HXFA 1MTSA 2BOKA 1O5AB 3A82A 4INHA 3E90B 3M3TA 2ZHDA 1YY3A 1W14U 3RU4D 5JBAS 1TRMA 5E2OA 2AMDA 1OWKA 1SBWA 2BZ6H 1Z6JH 2KAIA 3Q00A 1L4ZA 5CMXH 4JZDH 4WH6A 1O3FA 1KXDA 1YCPH 1AKSB 1FIZA 1LHCH 1UTNA 2PWXA 4K8BA 2P3TB 5F8TA 1Z6EA 1O39A 3Q3YA 4Y10E 4Z1MD 1O2MA 4MNVA 1GG6C 3K6ZA 4ABIA 2VH6A 4A6LA 3FP8E 4AB8A 1VITF 1AD8H 3U1IB 7GCHG 2UWPA 1JWTA 4SGBE 3PLBA 5FAHA 3F9GA 4AYYB 1QA0A 1E37B 1P06A 3AAUA 4IN2A 2HLDD 3O8BA 2EQNA 2BDYA 2GV6A 3MMGA 2A4RA 1L1JA 1RTFB 1P9SA 3RXDA 1EZXC 4B2CA 2A2QH 3T62A 2JH6D 4Y0YE 2V6NA 1YPLH 1BMFD 1ZHRA 4AG1A 5AVDA 4X6OA 4GSOA 1GMDF 4LXBH 1MAYA 3UB0A 1WV7H 1FY4A 4GCHG 2F83A 3AW0A 1BMLA 1Q2WA 1AFQC 4I8GA 3M3VA 1SGDE 1F7ZA 2BDHA 4Y0ZE 1T31A 4XBBA 1HYLA 4ISIH 4ZH8A 1XMNB 5FL7D 1P3EA 1QJ7B 3UWIA 3VEQB 4B1TA 3OX7U 3TIUA 4I8LA 4HZHA 4X2YA 3MU5A 3ZVCA 3A7TA 1PPGE 3S7HB 4MNXA 2QF5A 5C0TA 1TNHA 2OLGA 1LQEA 1ELAA 1SG8B 3N99A 3HGNA 5L30H 1DT2A 3LGVA 3LU9B 1Z7KA 3RM2H 2BY6X 3KYGA 3HK3B 1C1NA 1FIWA 2TGPZ 1S84A 1C1TA 4CHAC 4Q63A 1BTUA 1GI6A 4UE7H 1O2RA 1SSXA 1TFXA 3K6YA 2ZDNA 1AY6H 3EAJA 4KKDA 5HM9A 4NWLA 3KQCA 1C5VA 1HFDA 3MTYA 3GOVB 1HRTH 4ZKNU 4MQAA 1NU7B 4RKOB 1ZRBA 4YO9A 1DWCH 2Z7FE 3KQEA 3RXOA 2F91A 1YBWA 2RDLA 2THFB 1EOJA 2HGTH 1NFUA 2XC5A 3CS0A 3FKSD 4BTUB 2O8UA 3ATIA 7KMEH 1GJCB 1XUHA 2GDDA 1OP0A 3SQEE 5EU8A 1D4PB 4E7RG 4Q2KA 3ZVFA 3RXSA 3ZZ5A 1C4V2 2KX4A 2ZU4A 2G4TA 2NU2E 1AWFH 5GXPA 1P12E 1GG6B 2PKAB 2ZA5A 2PSXA 1H8HD 1WBGB 4MPUA 3SU0A 1CGJE 4H6TA 1H4WA 2WV5A 1EAXA 4ZXYH 1ZHMA 3MH7A 4YESB 2PW8H 1NRRH 3RXMA 4ASUD 3ATLA 1QL8A 1THRH 1Y5UT 2D8WA 1UVUH 1QTFA 1GJ4H 2OK5A 1Q31A 1ZLRA 1CHOF 1GMCF 1IQEA 4I86A 5DN6D 2XXLA 4HTCH 2B8OH 2JIZD 1GDNA 1QNJA 1SR5C 4TPYA 1O3JA 2GV7A 2ZNKH 5JBCS 3EA7A 4UEHH 1A61H 2BD3A 2AGGX 4ABJA 2C8YB 2AIPA 3MH5A 1SKYE 2Z94A 3GY4A 2R3YA 4Y11E 3O8DA 1AFQB 1FAXA 3M61U 3FP7E 1ELBA 1DWBH 1UTPA 2FTLE 3ATMA 4U32A 3ZVDA 2BY8X 3OY5U 2OBQA 3SV2H 2PKSC 2C8WB 2F9UA 1OHHD 1AVXA 2ZGBH 4I32A 2J92A 1O2HA 1J16A 1QA7A 4WXVA 2YOLA 1GI9B 1ANCA 1EASA 1GJ8B 5JBTA 4X2VA 1YPHE 3EDXB 2BDAA 1UCYK 1ZSJA 1XUKA 2FI5E 2VH0A 4ZUHA 1P09A 5K7RA 1GHBF 2Z9JA 1C2DA 2G5NA 1GHWH 2FOGA 1CO7E 3G01A 4KGAA
chains in the Genus database with same CATH topology
1C2MA 2AYWA 1GI4A 3BG8A 1TAWA 3RU4E 5I46H 1OWIA 1P57B 1EAUA 1SFIA 1ACBE 2FXRA 1CA0B 1TNLA 2FIRH 1LVYA 3GDUA 1ZTJA 4OS7A 2GCHG 1G3CA 1TQ0B 4E7NA 3SU2A 1O2VA 2V3OH 1MTUA 4DGJA 2BY5X 4ABBA 1BIOA 3BTME 3F9HA 2OD3B 1P9UA 1E0FD 3GY5A 3RC6A 1KXAA 1QJ6B 1UTKA 2H1UA 2BDBA 3GCNA 3GDVA 2QXHA 2LPRA 2ZFQH 1O2JA 2OTVA 1WSSH 2J34A 1CT4E 4NA9H 5GWZA 1JRSA 1BJUA 4Y76A 2ZGHA 1K1JA 1ZMNA 2XBYA 4B2BA 3LDXH 2IOTA 3EE0B 1TIOA 5DP8A 1T32A 1BTPA 1GBLA 3U1JB 2ZCKP 2ANKH 3V0XA 3MU4A 1FY3A 1L0ZA 1WUNH 2ZHEH 2ZIQH 1VR1H 5FBIA 1XKAC 3A7ZA 3BTWE 3KNXA 3RDZA 1TOCB 2TGAA 1RXPA 3P6ZB 1H1BA 3QX5H 1D6RA 4K60A 3LGIA 4X6NA 1JXPA 2F9NA 1GCDA 3R3GB 3V7TA 4AYVB 5FXLA 8GCHG 1DPOA 1FJSA 1AUTC 1OOKB 2VNTA 5A8ZA 4K69A 1SGNE 4X2WA 3KQBA 4I33A 3ZVBA 1EP6A 2P59A 5BRRE 3LH3A 1GI0A 3TJNA 1GGDC 3LGUA 4FUEA 1GBEA 1LPGB 1L4DA 1UVSH 1NFWA 1UHBB 1Y3UA 1UMAH 1MQ6A 2SGDE 2P3FH 4M7GA 2RA3A 4LZ4B 3LKWA 4LK4A 3L3TA 4ABDA 3ZZ8A 4UFGH 2TGDA 4Y79A 3MO6A 1XXFA 3LONA 5ETXA 1BUIA 3SW2B 1BTZA 1Y59T 2WPIS 5GCHG 4CBOA 5F6MA 1A3BH 1MQ5A 1K1LA 2PGQB 1GCTB 1NO9H 2G52A 4JMYA 1TYNA 3U98H 1O2OA 3SU5A 1O3KA 1MKXH 1DXPA 1MAXA 2P95A 1MU8B 1MZDA 3A85A 1QB6A 1K1PA 1TPPA 2R2MB 2ANYA 5FCRA 3TITA 2A4QA 3QGJA 3PB1E 1INCA 2ZTYA 1ZGIA 4NCYA 1GBJA 1O2KA 2D1JA 1O2NA 1DE7H 1QL9A 1QBOA 2BOHB 2BYAX 2HWLB 3UQVA 1BZXE 1GVZA 3NKKA 3TGJE 3E1XB 2ANWA 4VGCB 4IC5A 4OS5A 1ZMJA 2XWBI 1ELFA 1HAVA 3KN2A 3TGIE 3KEEA 3SU3A 2WUCA 1C2IA 5LPEA 1O33A 1TABE 2PTNA 1O5FH 4K1EA 2HNTF 2BD4A 1H8DH 1NRNH 4DOQA 1MTWA 1O5DH 1GI2A 1BCUH 4NIVA 4XSKU 1OKXA 3SU6A 6GCHG 1ELVA 1DLKB 1GBAA 3M5NA 1C2EA 4NZLA 1WAYB 2ZFRH 1J9CH 4AN7A 3DD2H 1BBRH 1GL0E 1TA2A 1TNIA 1GMHG 4B71A 2H9EH 5L6NH 1BBRE 4B2AA 3HPTB 1Z8IB 1KDQA 2OQ5A 3NZIA 2J9NA 2C3SA 1GWAA 2R0LA 3AAVA 2UUKB 3VB6A 2BD7A 3V3MA 4WJG2 1P01A 1GGDB 2A4OA 3I77A 1QJ1B 1AZZA 2A5IA 1C5XB 3OSYA 2HPQH 1DUAA 1BHXB 2AIQA 2BB4A 3MI4A 3MNXA 5FPTA 1NTPA 1ZOMA 1C1VH 3FFGA 4FUCA 3MOCA 1KLTA 3SI3H 2O8LA 3QLPH 1S85A 8ESTE 2IPHA 2W7UA 1EAWA 3QK1A 2F9BH 4WMFA 3GISB 3MO3A 5T3HA 1TRYA 4NSVA 1FY8E 2QXJA 1C4U2 1EQ9A 2FODA 5DP4A 1SGFA 1A1RA 2VWNA 1O36A 2ZQ2A 4Y8ZA 4K1SA 1IAUA 2SNVA 2SGEE 3RXPA 2YNAA 3LC5A 3RXUA 3ZYDA 4F4OC 3ZVAA 2M5TA 2Y7XA 3ZYEA 3LH1A 4ABFA 4WH8A 1GBTA 1MKWH 1V2TT 3SJ8A 4YT6H 1QFKH 3RXCA 3PYHA 4IN1A 4J1YA 1DANH 2BHGA 4K8YA 4A5TS 2FWWA 4JYUH 1MTVA 2G81E 1TMUH 2Q1JA 1BB0B 1G30B 1EAIA 2OC7A 2R9PA 3GDSA 4FU7A 5FBEA 3LJJA 2VWLA 1FPHH 3MFJA 3GCHC 3TK5A 1C1RA 1B0FA 1MUEB 1FPCH 2VINA 3MNBA 2ZGCA 5A0BA 4FVDA 3K9XB 5DG6A 1NESE 2BY9X 3TH4H 3B23B 5E0JA 1PPFE 1NY22 4ZHMU 1SGIB 2XC0A 1QRZA 1TQ7B 2PV9B 1L1NA 1A3EH 1O32A 2A31A 5EPYA 1MTNB 5AFYH 3NK8A 2JKHA 3BG4C 1GJ7B 2XBVA 5LH8A 2XBWA 1O3EA 1O5GH 2BDCA 4NFEA 3RXJA 2QIQA 1E35B 3PWCA 4NIWA 2O8TA 2ZTXA 1THPB 2UUYA 4AFQA 2VIWA 4HGCA 2QC2A 3UFAA 1O3DA 2ZFSA 5EPNA 2FDAA 2I6QA 1DICA 1EPTB 2Y6TA 3Q77A 3RXKA 2ZHWH 3K2UA 1E36B 4DJZB 2QF0A 4R0IA 2SGAA 3MO9A 2Q6FA 3ZZDA 4THNH 2EI6A 5JBBS 2ZO3H 3VGCC 3SNBA 1QURH 1Y5BT 1ABJH 4XE4A 3E6PH 2ZF0H 1WTHD 4F49A 1DFPA 3A83A 1SGYE 4K1TA 1HJAC 3PV4A 3E16B 1C2GA 2F9PA 1SL3A 2WPJS 1O3GA 4AB9A 3BIVH 5E0HA 3VPKA 1PPEE 1Y5AT 3A81A 2A7JA 2IN2A 3UNSA 1D6WA 3ZV9A 1GBMA 3UWJH 1TALA 2ZHQH 2ZFTA 1P02A 3PO1C 4I8KA 1IOEA 5H4IB 2BVSH 4ZKSU 3MWIU 1O5EH 1GMDG 1OSSA 1SGRE 1WCZA 3GYLB 3IWMA 2PSYA 1FV9A 1ZMLA 1O2GH 2OC8A 4ZMAH 4AORA 2FOAA 1DUEA 4ABGA 4ISLA 1NPMA 3D65E 1V2WT 3ODDA 1OYTH 4ZROA 2J38A 3A84A 2VWMA 1O30A 1QHRB 2DE9A 4IBLH 1B5GH 3BTEE 4X6MA 1O3LA 1OP8A 2STBE 4O03A 4RSPA 2H9HA 1EZQA 3T29A 1DSTA 4JZ1A 1V2VT 4JZEH 4YOIA 2I6SA 1UK4A 6LPRA 3ITIA 6CHAC 1BMAA 5EQSA 1HAPH 2H9TH 2ZI2H 1ANEA 4OGYA 2BLWA 2CHAC 1SLXB 1AFEH 1JIMA 3RLYH 4NA8A 1XVOA 2FI4E 2GT7A 1FY5A 3QDZB 1A5GH 1CHGA 1P04A 1RD3B 5C20A 1YPMH 1W0YH 4BANB 3MHWU 3PWBA 3PMBB 3F6UH 2VIPA 3SBKA 2VIDA 1P2IA 1EJAA 4CRFA 1S5SA 1SQOA 2P94A 7GCHF 1K2I1 3SQHE 3ZVGA 1T4VH 3QTVH 1ARBA 2BQ6B 3QZRA 4NFFA 5L2ZH 1ZSLA 1EB1H 3HK6B 1TPSA 1IQHA 3AW1A 1C9PA 1X7AC 2Y82A 5EQQA 2FOEA 2Y5FA 2BZAA 2W26A 5PTPA 3RMMH 3TJVA 1DY8A 3M7TA 3URDA 4O3TA 1YCPK 1SOZA 2FX6A 1C2KA 1YM0A 2BLQA 1GJBB 4MG3A 1OWJA 3ZVEA 1GI1A 4GCHF 3CP7A 2A1DB 2PTCE 4NIYA 1SFQB 1VGCB 3TJUA 2GZ8A 1JMOH 1CA8B 1MCTA 4FU8A 4B75A 4X1QU 1O3PB 2FYQA 1O2PA 4ISNA 3URCA 1GJAB 1PYTD 2VGCC 4ZKOU 3BEUA 3CS7A 3HATH 1FAKH 3PTBA 4Q7ZA 4AZ2B 2ALVA 1CT0E 5FPYA 3SGAE 5FCKA 1ETRH 3DHKH 1CHOG 2W7SA 4AG2A 1GMCG 3S7KB 4NZQA 1SGFG 4K5ZA 3BTHE 3EA9A 4JZFH 1RRKA 4X1NU 4UD9H 4FUDA 1SB1H 2A4GA 1VZQH 1UCYE 1OWHA 2AFQB 2QA9E 2ZGXH 1YP9A 1D3TB 1NS3A 3M5OA 1PPZA 3E91A 2B9LA 1THSH 1QQUA 5EG4A 1YPGH 1A4WH 1SQAA 3GYMA 1ABIH 4O9VA 4CR5A 5E8EH 1NFXA 1C1OA 2JETC 1GBBA 4SGAE 1KLIH 2PUQH 1GJ6A 2Y80A 2PFEA 5DP9A 1WQVH 3ELAH 1UTOA 2GMTC 2TGTA 2SNWA 3EYDA 1HJ9A 2F9OA 3MU8A 2AH4X 5DP5A 5E2PA 1S83A 2ALPA 4JYTA 1O2ZA 1SGCA 3BEFB 1W7XH 3UNQA 1TB6H 3VXEH 5ESTE 2VB0A 1GHBG 4HFPB 2AEIH 2P3UB 2CHAB 2FPZA 5FX6A 1K22H 3H5CB 3S0NA 2VVCA 1ZZZA 3W95A 1W2KH 2BXTH 1TMBH 1F2SE 3SJKA 3SUFA 4NWKA 1UO6A 2BQWB 4ABEA 2PKAA 4B73A 3LGWA 1TX8A 2BMGB 1IHSH 3MU1A 1BITA 2FI3E 3ZZBA 1FLEE 3RC5A 2BD9A 1NZQH 3GY2A 2ZHFH 3SUEA 3DUXH 2VWOA 3HKJB 2WPMS 1TLDA 3UTUH 1G2LA 1K1IA 2ZDKA 2OINA 2STAE 5EW1H 8LPRA 4NSYA 2O8WA 1EATA 4CHAB 3SGBE 2EC9H 2GZ7A 3KCGH 1F0SA 2GKVE 1K21H 3M35A 3KL6A 1KY9A 5DKMA 1UTLM 1TWXB 1ELGA 3SU1A 4AX9H 3CENA 2H2ZA 3SUGA 4E05H 5DGJA 3QZQA 1Y3YA 3UOPA 5TCAA 2VGCB 2FO9A 3I29A 3TU7H 1EXFA 1YYY1 4KTUA 1HJ8A 1O3BA 1BTXA 1Y3WA 3Q3XA 1GBFA 2EI8A 2PR3A 4I7YH 3A7YA 2ZC9H 1P2JA 5JDUB 1C5QA 4TPIZ 1CQQA 1O31A 2Z3EA 1AVWA 1ZRKA 4GAWA 2XRCA 3SJ9A 2AS9A 2BDGA 3NXPA 4LOYH 3IITA 2GGVB 2ZDLA 2QAAA 1FXYA 2NU1E 1KIGH 1AHTH 1OWEA 1V2NT 1DITH 2VIOA 2RA0A 4JK6A 2WPLS 5A8XA 4R8TB 3SV9A 4BOHA 2JETB 1NRPH 2GMTB 3PMJA 2ZEBA 1WYKA 1Z1IA 3RMNH 4IS5A 3ZZ9A 3KQDA 2A5AA 1DOJA 1TPAE 3R0FA 3SORA 3MU0A 4DVAU 4X8VH 3T26A 5A09A 1QBNA 1H9LB 1TBQH 2BX4A 4U01A 5SGAE 1AU8A 1P3CA 1CU1A 1LHEH 1LPKB 5ESBA 2ZDAH 2PKSB 4YTAA 1HAXB 2W3IA 3RXLA 3NPSA 1YGCH 3ODFA 1ZTKA 2V35A 4O97A 3M3SA 4Z0KA 3QTOH 5C67A 1SGEE 1GL1A 1ETSH 1C1PA 2ZQ1A 1FN8A 2FYRA 2UWLA 3EQ0H 1J8AA 5C1YA 2BVRH 3SV8A 2A7HA 1ZYOA 1V2KT 2HLCA 3FVFB 1O0DH 4X1PU 2FS8A 4GHQA 4NG9H 4LZ1H 1LCYA 2WPHS 3SNAA 3UOUA 3OU0A 1GI7B 1W8BH 4WY3A 1ZGVA 5AHGH 4GHTA 1H8IH 1HXEH 1O38A 4OS2A 1VCPA 1FN6A 2BY7X 5CHAC 1GHZA 1WU1A 2FMJA 1T8NA 1UHBA 4IW4E 1C5UA 2TIOA 4BNRA 2CMYA 2H6MA 3B8JA 4MPXA 3V12A 2C8XB 3FAOA 3TK6A 1J17T 2P8OC 1N6YA 1TGSZ 3A89A 1O2XA 1DX5M 3RP2A 3P8GA 1C5WB 1TNJA 2ZZUH 1QB9A 3TNTA 1ELCA 4NA7A 4DG4A 4TY6A 4WMDA 1F92A 3TLOA 3SHCH 2EI7A 5C1XA 2SGQE 2AGEX 2G00A 2BD2A 3M37A 1ZPBA 1CE5A 3RXTA 1BOQA 1QL7A 3VFEA 5C5NA 1S6FA 1PPCE 1AI8H 1C2JA 4X2XA 3RXBA 2CF9H 4XOJA 3BIUH 3SJOA 1W7GH 1KXBA 4FXGH 1G3DA 1V2PT 3BTFE 2ILNA 4ISHH 4H4FA 2DE8A 3PMAB 2IJOB 4BTTB 1MH0A 1B0EA 1GHAF 1B7XB 1FQ3A 4I8JA 1KTTB 1V2OT 1A7SA 3UUZA 2ZDVH 4ZAEA 1BTWA 3OYPA 2ANMH 3VB7A 5EQRA 5F8ZA 3A8DA 1F5LA 1UK3A 4E06H 4INKA 1C5YB 1MKXK 1GBKA 2OC0A 3C27B 3IG6B 4AGKA 1IQKA 5E0GA 1UK2A 1HGTH 2OP9A 2GCTC 1JIRA 1J15A 1O2WA 2OC1A 1C2HA 1IQJA 4YT7H 3RMLH 3MH6A 2C4FH 2NWNA 3SJIA 3SNDA 3ZZ6A 3BTKE 5C3NA 1YC0A 1P03A 2ODYB 3FZZA 2ZWLH 3O8CA 2J4IA 1NU9A 3SV7A 1OPHB 5C1UA 1SHYA 3RXAA 3SZNA 1TE0A 2ZU2A 2FOMB 1NC6A 3SN8A 2ZG0H 4CR9A 3EGKH 2AMPA 4FUIA 2NU3E 2A5KA 2GVFA 4DCDA 1EKBB 1V3XA 2TPIZ 2TRMA 1HPGA 1BMNH 1PJPA 1UTJA 3AVZA 2D2DA 1QRWA 1DDJA 1YLDA 3PLKA 5EXMA 1C2LA 1P2KA 5IDKA 2P8OB 1T8OA 2GX4A 1LVBA 4DT7B 2ASUB 4AOQA 4OGXA 4DIIH 4Y6DA 2R3UA 3ZZCA 1MU6B 1HIAA 1BBRK 2A7CA 4X8TH 1MBQA 1G32B 1GDUA 4QT8C 2CN0H 1Q3XA 2OCVB 3SNCA 3KF2A 4DW2U 1QBVH 1K1NA 1XX9A 1PFXC 1LKBA 1SPJA 1O2QA 3RXFA 3GCTF 1FUJA 5DK1A 3LGYA 1LVMA 2BXUH 2QXGA 5B6OA 4FUJA 1C2FA 1M9UA 3HGPA 1QGFA 4FUBA 2RCEA 1W0ZU 3T25A 3OTJE 3SO3A 1O5BB 3ATKA 4KTSA 3L6PA 4CRGA 4MNYA 2GP9B 4CH2B 4NIXA 1MCVA 5EW2H 4J2YB 1FONA 1V2MT 3A80A 4GVUA 1P05A 2WYJA 1AGJA 2QY0B 4IMZA 4YZUA 5LGOA 4A1TA 2SGFE 1LO6A 4Z6AH 3P17H 1TGNA 4MPVA 2ZKSA <