1BRUP

Structure of porcine pancreatic elastase complexed with the elastase inhibitor gr143783
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
241
structure length
241
Chain Sequence
VVGGEDARPNSWPWQVSLQYDSSGQWRHTCGGTLVDQSWVLTAAHCISSSRTYRVVLGRHSLSTNEPGSLAVKVSKLVVHQDWNSNQLSNGNDIALLKLASPVSLTDKIQLGCLPAAGTILPNNYVCYVTGWGRLQTNGASPDILQQGQLLVVDYATCSKPGWWGSTVKTNMICAGGDGIISSCNGDSGGPLNCQGANGQWQVHGIVSFGSSLGCNYYHKPSVFTRVSNYIDWINSVIANN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Serine protease
molecule keywords ELASTASE
total genus 62
structure length 241
sequence length 241
ec nomenclature ec 3.4.21.71: Pancreatic elastase II.
pdb deposition date 1998-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1bruP02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1bruP01
1TRMA 2PWXA 1BTUA 2WPHS 3SHCH 4RKJB 1EZXC 1KDQA 1GI8B 3BTEE 2H9EH 4X2YA 8ESTE 2ZHQH 3MHWU 2ZGBH 1VR1H 3ITIA 3SU4A 1GL0E 2TRMA 1V6DA 2WPIS 4A92A 3A7ZA 5DP9A 1YLDA 2A4OA 3Q77A 1K1NA 1GVKB 4ABFA 1FAXA 2F9BH 2HPPH 1NFXA 2DE9A 4I8JA 1HJAB 1EB1H 4Y79A 1HAXB 3AAUA 1FMGA 4GPGA 1YPHC 1C5NH 2O8WA 1C5QA 2XXLA 3ATIA 3KQDA 1GBLA 5C67A 1D3QB 2GCTB 3RXSA 1DXPA 2CF9H 1K1OA 4WMFA 1IQGA 1GJ9B 2VIVA 3KQCA 1QJ1B 2J2UA 1K9OE 5J4SA 2SNWA 1SB1H 3GCOA 2QYIA 2FI5E 2Y6TA 1CO7E 3BIVH 1NRPH 2F9UA 2GZ8A 2Q6GA 2JETC 1RD3B 3D65E 2BVSH 2XYAA 2ULLA 1ELCA 2ZC9H 1SFQB 1EQ9A 3MU8A 3SNAA 2NU0E 4X6OA 2ZPRA 4Y8YA 4ZROA 1O2TA 1UO6A 5FCRA 2SGQE 2FX6A 4A1TA 3M5MA 1QJ7B 2Y7ZA 1VITH 4FXGH 4B76A 1OPHB 2FOHA 1AB9B 3ATKA 2ZCHP 2XNIA 1Y8TA 1SGIB 2GV6A 3SUFA 4SGAE 2DUCA 2LPRA 4ZAEA 4X1NU 1TPAE 1F0SA 1Q3XA 1LVOA 3VFEA 3SV6A 3V12A 3MNXA 4I8GA 2A5AA 1O3AA 3A7WA 2XWAA 2Y81A 1RIWC 1O2QA 2A7JA 2Q6FA 4MDSA 4M7GA 2ZTXA 1BBRK 1BBRE 4GVUA 3SZNA 2PSYA 1O2VA 1W2KH 1NO9H 4ZMAH 2IOTA 2B9LA 2H6MA 3SV8A 1H9LB 5EQSA 3HKIB 1CHGA 1ELAA 1VITF 4YLQH 1ZSJA 4GHTA 1C5XB 1L4ZA 1V2JT 2CHAC 4TWWA 3SN8A 4YESB 2GD4B 4FUDA 1ZRBA 2IJOB 3A82A 2ZU5A 4ZXYH 1HAGE 1FZZA 1DFPA 5JDUB 2VJ1A 1C5ZB 1HV7A 1EXFA 5BRRE 2FI4E 1E38B 4KGAA 2FTMA 4B74A 2V0BA 3B8JA 3P17H 1C2FA 1J14A 3A86A 3LIWA 4JZ1A 3M3VA 1GHZA 1TA2A 1W10U 1BTPA 1UJ1A 1PQAA 1PQ7A 2WYGA 1GI5A 1FPHH 1QQUA 1W7XH 4O03A 1G36A 5ESTE 1WTHD 4AZ2B 2ZECA 1Z1JA 1D6WA 3ODDA 3QX5H 2QAAA 1FI8A 2VIOA 4INKA 3KNXA 4DCDA 1GBKA 2G52A 2Z9KA 4U30A 1ZMLA 1BTWA 2OQ5A 3SU1A 2R2MB 4O3TA 4ZHAA 3S9CA 4K1EA 1BITA 1THRH 1IHTH 1AU8A 1FLEE 1HBTH 3U98H 2WPLS 2QF0A 1INCA 1VITG 2BM2A 5G4BA 4FUGA 2TGDA 3RXKA 3IG6B 4DGJA 1LPKB 1EATA 3LC5A 2EI7A 1QB9A 1NY22 2QXGA 4DOQA 1C2DA 1O30A 1NFUA 1GMCF 4LXBH 4Z6AH 2SGPE 3NWUA 1QY6A 3DA9B 5C5OA 4MPVA 1W14U 2TGAA 1Q2WA 1IQEA 1HAHH 1P2JA 2ZFRH 3EQ0H 4ABIA 4Q80A 1MCTA 2RCEA 3GY5A 4H6TA 1H4WA 1ZPBA 1KSNA 1BMLA 2OXSA 3RXGA 1O3HA 5SGAE 1DPOA 1TABE 1BTZA 1LHDH 1JOUB 4ISNA 1P9UA 1OYQA 2BB4A 2BXTH 3BTWE 3E3TA 4JK5A 3VGCC 2UUJB 2PW8H 4DT7B 3ZYEA 1HAVB 4YLUA 4AORA 2ODQA 3JZ1B 1OWHA 2BY5X 1GJBB 3A80A 3BG4B 4YT6H 1LKAA 1TIOA 2WUCA 1SOTA 4BXWA 2ZKSA 3I77A 4A7IB 3RXHA 3RXEA 4NCYA 1TPOA 1C2KA 3SO3A 1IQNA 4NWLA 3RXCA 1TBZH 2ZTZA 1GJ8B 1XUFA 1YPEH 1MKWH 4U32A 3S0NA 2FPZA 1D6RA 3QGJA 4VGCB 1GBEA 4HI3A 1ZMNA 2HVXA 3F6UH 1SGEE 1Y59T 4XDEA 4J1YA 3KQEA 4CBNA 5J4QA 3GY3A 1Y5AT 1AWFH 1GG6C 3E90B 4X6MA 1GMCG 1ZGVA 1FV9A 4Z0KA 4FU7A 1F0RA 1ZTLA 4MNWA 3BEIB 1P2QA 1C5SA 2NU3E 2ZU3A 1LPGB 1LPZB 4IMQA 4DIIH 5B6OA 5LGOA 2FDAA 4HZHA 1GHWH 1ELTA 4XBBA 3RXOA 1YPLH 5F8XA 1LHCH 2P3UB 1BRBE 1Y3UA 1HRTH 2P8OC 1A1RA 1YP9A 4ZXXH 2O9QA 1BHXB 1Z8IB 3BTDE 3GY4A 1VCPA 3PO1B 3LDXH 4JZDH 3T5FH 1O3PB 1S5SA 3RXUA 3GYLB 4JYVH 1GCDA 1HAYB 3SU3A 4U01A 1E34B 1P3EA 1QL9A 1KXAA 2VIWA 2BDHA 5DO4H 3RUOA 4ABGA 3LH3A 1GWAA 1OS8A 2ZFSA 1Y3YA 3QGNB 5DP7A 4MLFB 2GCHF 1PPCE 5K0HA 2XC5A 1G2MA 1BMAA 5TCCA 1C5YB 1GDQA 1TNLA 3BTTE 3L6PA 5DPAA 4X8UH 1MTNC 2AMDA 2A1DB 4FUFA 1GBJA 2TIOA 3EA8A 2QF3A 4I8HA 4GCHF 1ZTKA 4OGYA 1TNJA 2R0KA 1EAWA 4HGCA 1CSOE 4RKOB 2STBE 3GCHC 3PLPA 2WUBA 4FUIA 2AIPA 2VVVA 3C1KA 1AE5A 2ZF0H 1MQ6A 3MH5A 3F9HA 3A88A 3KGPA 5AHGH 4X2VA 3ZVBA 1OP8A 4IC6A 1T4VH 4AFSA 3RXDA 1BMMH 1FY3A 5GCHF 1EP5A 1FQ3A 3PLBA 1NRNH 3KQBA 2BYAX 2R3UA 1UK2A 3ZZBA 1TBRH 4O97A 3GDSA 3STJA 1GPZA 4UD9H 1LHFH 5FPTA 1O34A 1QBVH 1C4V2 5CHAB 2ZU2A 1GJAB 1H9IE 1A0HB 1RJXB 1P2KA 2R2WU 3ZZAA 2NU2E 5TCAA 3TJNA 1GI3A 1H9HE 1NRRH 3LJJA 3MU5A 3EAJA 3ZV9A 3DFJA 5A8XA 3Q3XA 1GDUA 4OGXA 3MO6A 2GVFA 6LPRA 1RFNA 2GCHG 9LPRA 4H6SB 3LT3A 3BTHE 3MMGA 1GI2A 1OWKA 1DT2A 3PV4A 1C2MA 2FOFA 3SQHE 2CJIA 1AVXA 1DLKB 4D7GA 3MO9A 2FX4A 1MTVA 2ANYA 4GCHG 4GSOA 3KEEA 2PFEA 5A8YA 1BTHH 3E0PB 3ZYDA 4Y0YE 3URDA 1O39A 3CENA 1W11U 1QL7A 2BD9A 1GHYH 1AZ8A 1MZAA 1Z1IA 3SU6A 9ESTA 4OS1A 4YT7H 1O2OA 2OP9A 2V3HH 1BTYA 1H8IH 4MNXA 3M7UA 4WVPE 2ZWLH 1GHVH 1YPJH 2FM2A 1C2IA 3LGUA 2PKSC 3SU0A 4CHAC 4CR5A 1MU6B 3A8AA 4A6LA 4YZUA 1N8OC 3S7KB 1WV7H 2OBOA 1UTPA 3F68H 1P2IA 1UVTH 1TGNA 4JCNA 1DWBH 5T6FA 4D9QA 3ZZ3A 1QA0A 1ZMJA 4ZH8A 1GBCA 3LGIA 2VVCA 2Y80A 1EOLA 4ISLA 1VGCB 1O2LA 3B9FH 1K1JA 2OQUA 4F4OC 5TJXA 1RTFB 1T8MA 2ZCLP 1WOFA 2A0QB 1C2EA 2Z9JA 1IAUA 2BZAA 1IQJA 1MD8A 1CVWH 1QTFA 1CA0C 1JXPA 1LHEH 1THPB 1O2YA 5A8ZA 1NTPA 2ZHFH 1HPGA 3A8CA 4PROA 1P01A 3FP8E 1ABIH 2W3IA 1DOJA 2I6SA 2B8OH 1XKBC 1ESTA 3QN7A 4I33A 4ABJA 1O3DA 2SGEE 4AFUA 3PWBA 5FXLA 3EA9A 2GP9B 2AYWA 5T3HA 1UCYH 1B5GH 4IMZA 1O37A 1T4UH 1GJCB 2O8UA 1THSH 4K8BA 1O2JA 1K22H 4HTCH 1EAUA 1MU8B 1EZSC 2BDCA 1XUJA 2ZDVH 3P8OA 3TLOA 5L30H 4X2WA 1C5MD 3QTOH 1YM0A 1JIMA 1O2WA 1EZQA 1GBHA 1MTUA 3NK8A 4NIXA 1O32A 1GVLA 2H2ZA 2UWOA 2XBWA 4ZHLU 5HXFA 2QXHA 3GDVA 1Z8GA 3ESTA 1O3CA 4FVBA 3BV9B 2GZ7A 2BD5A 2GGVB 4ZKNU 1YGCH 1FY5A 3MO3A 4MPUA 1DUAA 5HYOA 1TNIA 3SBKA 1AE8H 3GISB 2P95A 2BDBA 4WMEA 2Y7XA 3PTBA 1EJNA 1QB1A 1MH0A 1QCPA 2QXJA 3P70B 4R0IA 1FUJA 1ZPZA 2GDDA 1SGYE 3AASA 1UTMA 3MFJA 2BHGA 3QWCH 3SI4H 1O2XA 2BMGB 1HFDA 1O2MA 2W3KA 3UQVA 2JH0D 3OSYA 2EC9H 1CE5A 5FX5A 1MAXA 3RXJA 3SNDA 1ELGA 1AY6H 3TH4H 1QIXB 2BQ6B 2CV3A 1F5RA 3SGAE 2NWNA 4BAQB 1BA8B 1XXFA 1AUJA 4D76A 2CMYA 2SFAA 1O3NA 3EA7A 1T31A 1C5VA 3P8NA 2ZIQH 4X2XA 1TMUH 1CA8B 1SVPA 2FMJA 1K28D 1TNHA 3PTNA 3PMBB 2WPJS 1AFQB 1HJAC 2GDEH 2HWLB 3O8DA 5LPFA 1G30B 1PQ8A 1X7AC 3RXIA 3S7HB 3RLYH 1AGJA 3PB1E 1UVOA 1BRCE 1GBAA 2VIPA 5EPYA 1MKWK 1SLUB 2GCTC 1KYNA 2H5CA 2PGQB 1GI0A 3UUZA 1MMJN 1XUIA 1TNGA 1NS3A 1MAYA 4X1SU 3EDXB 3DD2H 3QZQA 4GAWA 4AB8A 1O3FA 1E36B 2J38A 1DM4B 1KXFA 2Z9GA 5E8EH 1P9SA 1KXCA 2ZQ1A 5A09A 2OCVB 1GGDB 1JBUH 4Y10E 5F8TA 3C27B 1Z6EA 3K9XB 1UK4A 3GY2A 4B73A 1KIGH 4BXSA 3S9BA 2HPQH 1TBQH 1SL3A 1P2NA 3ZVCA 3LGTA 1LCYA 2B0FA 1MD7A 1AB9C 3MNSA 1RTLA 1OSSA 1WAYB 2ILNA 2ZTYA 1W0YH 4MPWA 1PPFE 4IN1A 4WH8A 1IQLA 3TH2H 3V3MA 3SJOA 3T29A 2ZFPH 1EJAA 1K1PA 2AERH 1GI1A 4Y11E 3SUEA 1HNEE 2C90B 3ZZ7A 1MTWA 1DSUA 5CMXH 1T32A 3QLPH 1GCTB 3ZZCA 2F83A 4UEHH 2CXVA 2J9NA 4KELA 3TGKE 1A4WH 1YPKH 1TGTA 2A32A 4X8SH 3A8DA 3KF2A 3UNRA 1S82A 4NWKA 1ZYOA 2ZHDA 1D3DB 2BXUH 4I8LA 4NGAH 5C1YA 1P05A 1SG8B 1O33A 5FHTA 1DY9A 1SGCA 3U1IB 3VB6A 1HJ8A 3LPRA 3UOUA 1O5BB 1ORFA 1EZUC 1WSSH 2UUKB 1ELBA 4B2CA 1C1TA 2PTCE 5HM2A 2ZZUH 2BDIA 1BRAA 2EEKA 1HCGA 3SU2A 4NIWA 2JH5D 3W95A 1O5DH 2XW9A 4CREA 2HALA 1ZHMA 1HAPH 3FZZA 1SMFE 2HNTF 2O8TA 2A4RA 4ZHMU 2BZ6H 3BEFB 4ABEA 2OUAA 4IC5A 4Q7ZA 3UNSA 1SQOA 1G3CA 4XOJA 2UUFB 2C93B 2Z94A 1J9CH 2ZCKP 1C1UH 1P2OA 5EG4A 2FOMB 4TPIZ 4XE4A 3BG8A 3IITA 4ABDA 4I32A 3QO6A 5EW2H 1VCQA 1G9IE 1BT7A 2FYRA 1GI7B 1G3EA 3UIRA 4KKDA 3F9FA 1MZDA 3U8RH 2CGAA 2FYQA 1SGDE 3M36A 1D3TB 3V7TA 4NIYA 4NA7A 2VINA 1TWXB 3MTYA 4ZKRU 1XKAC 3MU4A 1AI8H 5A0CA 1NRSH 4OS6A 4K5ZA 1TPSA 5ETXA 4Q7YA 1DXWA 1SGFG 1XX9A 4FU9A 1P06A 3ZVFA 1O35A 1RGQA 1O5GH 2OBQA 2PLXA 1DANH 1YKTA 4Y7AA 3VXFH 1LVMA 2BOKA 3A84A 4RSPA 3W94A 3ZVGA 2FXRA 1A5GH 1ELEE 1EOJA 3ZVDA 4Q2KA 2OD3B 2V6NA 4UFFH 1O3LA 1EPTB 1Y5BT 3GCTF 1UK3A 1O3EA 2ESTE 1S85A 5E0HA 3TITA 1QJ6B 1ZZZA 2ZPQA 3NXPA 2HLCA 1TA6A 4IS5A 1A2CH 2THFB 4FUJA 4A5TS 3P92A 2O8MA 1A5IA 3DFLA 2BQWB 4GLYA 2VB0A 3BSQA 3A7XA 4I31A 3OY6U 5EQQA 3UWJH 1ETSH 1UTKA 5FCKA 1V2QT 5AFYH 3BG4C 2IN2A 2G4TA 1P57B 1MKXH 2K1QA 2FESH 3SHAH 1GBDA 3VEQB 4BAKB 3GCNA 2H9TH 2XTTB 2GZ9A 3SV2H 2QIQA 5E0JA 4SGBE 1MQ5A 1TAWA 4H4FA 1ACBE 1UCYK 1GBMA 3M5LA 2FOAA 4VGCC 5DP6A 3BEUA 4J2YB 2ZGJA 1DSTA 2XCNA 3F9EA 2ANKH 1CHOF 1UTQA 4LZ4B 1ZSKA 4AB9A 1S0RA 3MNBA 3Q00A 3GY7A 3HATH 1HLTH 4CRCA 3EE0B 2PUXB 1OX1A 2A2QH 4K1SA 7LPRA 1K21H 5PTPA 1TOMH 2EI8A 1MBMA 3MU0A 3GCTG 1FN8A 1SLWB 2R0LA 4DIHH 4K60A 1G37A 4CRAA 1PQ5A 3F9GA 1IQHA 3ZZ8A 5JBCS 1WYKA 1EB2A 4BOHA 3QUMP 1TQ7B 3K65B 2ZA5A 1FONA 3PO1C 1YLCA 1HAOH 3QDZB 1DE7H 1OOKB 1NC6A 1RRKA 1YPMH 5JPMH 1DICA 3RU4E 3Q3YA 1HXEH 4UFGH 5E2OA 1P09A 3ELAH 3OYPA 1AWHB 1C5RA 1V2LT 3T2NA 1W7GH 4ESTE 4YOGA 3Q3KA 1WQVH 1EJMA 5EXMA 3FZDA 4BAHB 1BDAA 5IYTA 3LGVA 1TB6H 3TPIZ 1A3BH 1O5AB 3TJOA 4OS5A 5T6GA 1WUNH 4NIVA 1CHOG 3NCLA 2Y82A 4JYTA 2Z7FE 1GVZA 2ZI2H 1L4DA 5L2ZH 2ODYB 2J92A 2SGFE 4DJZB 3U1JB 1PPZA 2ANMH 1C9PA 2M5TA 4NFFA 1NZQH 1Z8RA 2BVXH 4INHA 2ZHEH 1GDNA 1Y3XA 2BLVA 2OTVA 3TH3H 1EP6A 4X1PU 2FO9A 1DVAH 3HGPA 3B23B 1C1VH 3A7YA 3SOSA 5K7RA 3A7TA 2XC4A 1TQ0B 1OKXA 1TE0A 1TMBH 2BD4A 1TX8A 2F9OA 5DK1A 5CHAC 7GCHF 1N6XA 4OS4A 4D7FA 2ALVA 1YBWA 1ANBA 2ZNKH 3SV9A 4LZ1H 1W12U 1C4Y2 5JBTA 3JZ2B 2DE8A 1T8OA 1BOQA 4MQAA 1JIRA 3A87A 1AZZA 2SNVA 2ZQ2A 1V3XA 1YYY1 3O8BA 3ATLA 2EI6A 2RA0A 3MI4A 3NKKA 1BQYA 4ABHA 2XWBI 1V2TT 1WQSA 1DWDH 3R3GB 2VVUA 5C3NA 1QHRB 1BCUH 5T6DA 4I8KA 1CBWB 2XRCA 1MUEB 4CRBA 1SGRE 3MH7A 2UUYA 1WCZA 3TNSA 3HK6B 3GY8A 3AVZA 3BTKE 2CF8H 4OS2A 5DP5A 1V2VT 1O3GA 5AVDA 3P6ZB 3RM0H 1BTXA 5DG6A 1TOCB 1BUIA 3M3TA 3ZZ6A 1C1PA 2V35A 3BN9A 1DWEH 1XUKA 3D23A 1XUHA 2ANWA 5JYIA 3S69A 4AFQA 4AYVB 5GCHG 1LQDB 2KAIA 2BY8X 2C8ZB 1FY4A 7GCHG 4E05H 1CT0E 2AGIX 1XUGA 1Y3VA 1GBTA 3UOPA 2BDGA 1EUFA 1D4PB 1PFXC 1ZLRA 1VGCC 3M37A 1DY8A 5CE1A 3KHVA 3TK9A 1OWIA 3FFGA 1A5HA 4X8VH 1GBBA 1O38A 3ZZ9A 1DITH 1S83A 4CH2B 1HGTH 1HAIH 5DP3A 5LPRA 2I6QA 4BTIB 4DY7B 3GYMA 3RXRA 2W7SA 1O3BA 4YOIA 1O0DH 4XBDA 1LVBA 2HGTH 3ATWA 1G2LA 5GPIB 4D8NA 1S0QA 1YCPM 4UDWH 1AMHA 4NZQA 1S81A 5FAHA 2QGRA 2OC7A 1FJSA 2VGCB 1A3EH 1AIXH 4ISHH 1L1NA 1UMAH 3F1SB 6GCHF 1FXYA 1GJ4H 1K1LA 3FP7E 2BDAA 3T25A 1VCWA 2A31A 3O8RA 2PTNA 2WYJA 4X1QU 3H5CB 3BTME 4TPYA 1ETRH 3TNTA 3T28A 1B0EA 3M61U 1ZTJA 3RLWH 1L0ZA 1OP0A 1O2HA 5FPYA 5JB9S 1XM1A 6CHAB 1BJUA 3M3SA 1UVSH 2J4IA 4TY6A 2BD8A 3LH1A 1QURH 1SQTA 1EPTA 2HOBA 1NFYA 1OWDA 3HPTB 1DWCH 2PUQH 4AFZA 5H4IB 1K2I1 5F03A 4K3JA 3CS7A 3UNQA 3I78A 3GDUA 1FIZA 3RC5A 3RXFA 1AN1E 1EKBB 5LPEA 3UR9A 1P12E 2QN5T 5I46H 4CH8B 5JB8S 1HIAB 1ZSLA 2YNAA 3AW1A 2P3TB 1JWTA 4B1TA 3D62A 4A1XA 4Y0ZE 5C20A 5C5NA 1IQFA 1PPHE 2PHBA 3E91A 4HFPB 4TY7A 1B7XB 2B7DH 6GCHG 1CT4E 3PM3A 2ZGCA 3LU9B 3VXEH 5LH8A 2ZG0H 4ABAA 1F92A 1NU7B 2VWOA 1OXGA 1GHAF 2OC1A 2R3YA 1FY8E 3PLKA 1V2NT 3TU7H 8LPRA 4Y8ZA 3PMAB 2AMQA 3SGQE 3A83A 1PJPA 1GJDB 1UHBA 1P8VC 4I7YH 3LONA 3E6PH 3G01A 1C1WH 1MKXK 3TK6A 3VB5A 1AFQC 2GMTB 1GHBF 4AN7A 2FS8A 5F8ZA 1LTOA 5AFZH 4CRDA 1IHSH 2A45B 3A81A 3DHKH 3PROA 1YPGH 3PMHB 4ISIH 1KTTB 3BF6H 2AGEX 4Y71A 3ODFA 1FIWA 8KME2 1QQ4A 4UFDH 2FEQH 2FLBH 2B5TB 1D3PB 1QBOA 1TX7A 5C1UA 4ASHA 1P03A 2F9PA 1F5LA 2BD2A 4AG1A 3FP6E 1SGTA 2FOBA 5JBBS 1A0LA 2C8WB 1V2ST 3STIA 3QZRA 1UTLM 1C1QA 3E0NB 1GI9B 2ODPA 5DKMA 1O3KA 2VNTA 2VH0A 1L1JA 3RU4D 4WF8A 1IQKA 1XXDA 2G55A 2STAE 1GGDC 1SLXB 3RXQA 1OWJA 1NESE 2J34A 2J94A 1HUTH 1TX6A 1HDTH 4JK6A 1AD8H 5GXPA 2PV9B 2Q6DA 3AW0A 1EX3A 2F9VA 2ZU1A 1GHAG 1XMNB 4LOYH 4RN6A 2GTBA 1O2PA 2BDYA 3K6ZA 3IWMA 4CRGA 2A7CA 4K69A 1DUEA 2D26C 1AUTC 4NA9H 3RMLH 3NZIA 5A0AE 1WBGB 2G5VA 6ESTA 3O8CA 5FPSA 1GHBG 3P8GA 5ABWA 3E16B 1HXFH 5L6NH 3SQEE 4A1VA 3ZVAA 1CGHA 1K1IA 2QA9E 3ZZ4A 1GCTC 4K8YA 3S9AA 1KXDA 1RTKA 1TFXA 1GJ6A 4FVDA 5GIBA 4ABBA 2GT8A 4H42U 4ISOA 3CP7A 1W13U 2G4UA 1F0UA 5DJ7A 2Y5GA 3FANA 3RXLA 1T7CA 4FUHA 1TYNA 1D9IA 2JETB 2FOCA 3HGNA 5GWZA 1ELFA 1TNKA 1SPJA 2WINI 1O5EH 1O5FH 1PYTC 2QY0B 1J15A 4FU8A 1AKSB 1QGFA 2PKAB 1OYTH 5FBIA 2AMPA 2W26A 1OP2A 4WJG2 3DUXH 1C2LA 2BD3A 2KAIB 3UREA 1F0TA 1LVYA 5HGGA 1B0FA 1LKBA 2FIRH 3MYWA 3PWCA 2AGGX 2V3OH 1PPBH 7ESTE 5FBEA 2CN0H 4B2AA 2ZGXH 1GJ5H 2A5IA 2OC0A 3RU4T 3SW2B 1A7SA 2P59A 2W5EA 1RIWB 2F91A 5A2MH 1O2SA 1O3OA 1O2GH 1NT1A 1V2RT 1P04A 5HM9A 3LOXA 1C2HA 5GDSH 3SV7A 2BVRH 2VIDA 2D8WA 2FP7B 1S84A 2VWLA 1C1OA 2FLRH 2ZFFH 1JMOH 1UTNA 3A7VA 4Y6DA 3D49H 4E06H 2CHAB 3SNBA 3SJ8A 1DDJA 2WPKS 2FI3E 4ZKOU 2NU1E 1H1BA 3H7OA 3M7QA 1BZXE 1C1RA 3BTFE 1G3DA 1CT2E 1BRUP 1P02A 4ZKSU 3KL6A 4B71A 4CR9A 4BTTB 2FZZA 2FS9A 4UONA 2ZDKA 1C5UA 2P93A 1O2IA 3U8OH 5I25A 2BOHB 2QC2A 1YC0A 1QB6A 2IPHA 2BY9X 2XBXA 1LO6A 3SNEA 3RMOH 4X0WU 4E7NA 2H5DA 3RXPA 1IOEA 1J16A 3FAOA 3SORA 3DT0H 1P10A 1T8LA 3ZZDA 1EPTC 1TGCA 3RMNH 1Z71A 1QA7A 3RP2A 1RS0A 7KMEH 1NU9A 2ZO3H 4NA8A 4XSKU 4BNRA 2ZEBA 2FOEA 1VJAU 4K2YA 1UTOA 2H1UA 3M5NA 3SUGA 4AG2A 1AVWA 1YCPH 3MWIU 1W3CA 1UVPA 3PYHA 8GCHF 1ZOMA 1F5KU 3RMMH 4X8TH 3RM2H 1SGFA 3Q76A 2A7HA 3LGWA 1KY9A 1TMTH 1J8AA 1HJ9A 1SGPE 1C5OH 3TGJE 3E8LA 2BLWA 1TGSZ 2AIQA 2Y5FA 1ANEA 2Z6BD 4KP0A 3RDZA 1C1SA 2Z9IA 2ZDAH 2HRVA 2AEIH 3SJ9A 2UWLA 3OU0A 1P2MA 1ID5H 1GI4A 1LMWB 3K6YA 3TK5A 3UFAA 1FAKH 1U6QA 2BY6X 2R9PA 2TBSA 2QV1A 3ENSB 1CQQA 1ZHRA 1GI6A 4MNYA 3TIUA 4YTAA 4DURA 3UTUH 2P94A 2LNCA 3VPKA 1UCYE 1FN6A 1SGNE 3VB7A 1UHBB 3GICB 5HMAA 1C4U2 3I29A 1E35B 1BB0B 2A2XH 1O3MA 1HYLA 1SFIA 2A5KA 2QXIA 2VH6A 3TGIE 5FX6A 2QCYA 2TGPZ 3VGCB 1O3JA 2GX4A 4XBCA 3SI3H 2SGAA 4MNVA 1SC8U 3VB4A 1KDQB 2FWWA 3OY5U 4JMYA 4U2WA 4XFQA 4X6PA 2ZDLA 3U8TH 1PPEE 3SU5A 3GOVB 3BTQE 1EAIA 4MVNA 8GCHG 1ARBA 2ZHWH 3T26A 1HIAA 2AS9A 1NN6A 4BTUB 4YM9A 2D2DA 4JZIA 1KLJH 2EA3A 3QTVH 1FDPA 1V2KT 1W8BH 1GBFA 3M5OA 4YOJA 2ZGHA 5EW1H 1GMHF 4JYUH 2GV7A 1NFWA 1Q31A 1O2UA 2TPIZ 1GG6B 5EU8A 3L3TA 1GHXH 2G5NA 1SLVB 1DS2E 2VWMA 3RC6A 1SSXA 1SOZA 3GY6A 1MTSA 3UQOA 2Z3DA 3ZV8A 3HK3B 1Y3WA 1Z7KA 3HKJB 1FY1A 1QRXA 1DX5M 2XC0A 3ATMA 4FUCA 2P8OB 4BANB 1TRYA 2RG3A 5IDKA 1SHYA 1XVMA 2BLQA 4GHQA 1O3IA 1BIOA 1N6YA 1GBIA 4Y8XA 5EXNA 3V0XA 2F9NA 1SHHB 4X6NA 3CS0A 1C1MA 1WU1A 2Z9LA 1E37B 5C2ZA 2A4GA 2JH6D 5A0BA 3TJVA 4DVAU 3SUDA 3VB3A 3RXVA 1SQAA 3WY8A 4MG3A 1ANDA 3UPEA 4NSVA 2NU4E 5EGMA 2YOLA 5EQRA 3EYDA 1AQ7A 4GUXA 1A46H 3LKWA 1ETTH 1JRSA 1A0JA 2BY7X 3OTJE 1BBRH 1CGIE 1MTNB 1N1LA 1UVUH 4NG9H 1GMHG 1QRZA 1PYTD 3URCA 3ZVEA 2C8XB 1FPCH 4Y7BA 1HB0B 4IW4E 2BLOA 3GCHB 2G51A 3LJOA 4WWYA 3V13A 1C5TA 2G81E 3LC3A 2ZDNA 2BX4A 3MNCA 3T62A 1QNJA 1V2WT 3R0FA 3RXBA 4AYYB 1ELDE 4WY3A 3UR6A 4YO9A 3KIDU 3NUMA 4AGJA 3P95A 1CBWC 4E7RG 5F6MA 1F7ZA 1T8NA 1ESAA 4TYDA 1QR3E 3NPSA 1FNIA 4WXVA 2P3FH 3A89A 1XVOA 1V2MT 1YF4A 3MH6A 1ZR0A 2OC8A 3MU1A 3N7OA 4LK4A 2G8TA 1EASA 1KLTA 4KTCA 2ASUB 2WV4A 1LHGH 2C3SA 5EODA 1AVGH 4FUEA 1QRWA 1VJ9U 2TGTA 2W7UA 1RXPA 1CU1A 1SI5H 1O5CB 1C2GA 1AKSA 2PKAA 1AHTH 4ZUHA 1ESBA 1EAXA 1PPGE 2AFQB 2XCFA 3H7TA 1LQEA 1F2SE 4CRFA 1HAZB 4NFEA 1J17T 1ANCA 2ZFTA 4INLA 5GJ4B 4MTBA 3U9AH 4IBLH 1TLDA 1GL1A 1ZRKA 4UFEH 1DLEA 4DG4A 1W0ZU 1O2RA 2BX3A 1KLIH 1LDTT 4UE7H 1BMNH 3QK1A 2GKVE 4AX9H 2HNTE 3RXMA 4O3UA 4K1TA 4JZFH 4F49A 3RXTA 3KN2A 3U69H 1SGQE 5EPNA 4NZLA 2RA3A 1JRTA 4B75A 1Z6JH 2Z3EA 5L2YH 2J95A 1C2JA 2UWPA 4FUBA 3BIUH 2VU8E 1GMDF 3K2UA 2WPMS 4WXIA 3LGYA 3RXAA 2BTCE 1P11E 3SGBE 1NROH 1TALA 2F3CE 4BAMB 1TRNA 2JKHA 2VGCC 4AOQA 1L2EA 2PKSB 1KXEA 1ZJDA 2H9HA 3EGKH 3L33A 2G00A 3RC4A 4CHAB 2C4FH 2BD7A 1N8OB 1NRQH 4Q7XA 1TGBA 3BTGE 1C5PA 2FTLE 1TPPA 3FVFB 3E1XB 2A4QA 3TJUA 1C5LH 4TWYA 2VWNA 1H8DH 4O9VA 1ELVA 2YNBA 1ARCA 3SNCA 1AFEH 2Z3CA 1GJ7B 1V2UT 2HNTC 1MBQA 2Q1JA 5DP4A 1V2OT 3SJIA 1SR5C 1UTJA 3M7TA 1QBNA 1QL8A 1ZPCA 1E0FD 1G32B 2O8LA 1MCVA 4X1RU 5ESBA 3T27A 3TVJB 1P0SH 3UWIA 4THNH 6CHAC 1AO5A 1CA0B 4NSYA 1WTGH 2PSXA 4MPXA 5C1XA 1NM6A 2SGDE 1O2KA 5E0GA 1G3BA 1ZGIA 3P8FA 1Y5UT 2ZDMA 2PR3A 2FOGA 2P16A 4CBOA 1O2NA 1O2ZA 1P3CA 1SBWA 3OX7U 1ZJKA 2OINA 4KTUA 1KXBA 1A61H 3SJKA 4JZEH 1IQMA 2FODA 1GMDG 5BPEA 3AAVA 1S6HA 5E2PA 4IGDA 5DGJA 1BHXF 1QFKH 4AGKA 5EOKA 1O31A 4B2BA 4QT8C 1NPMA 4BAOB 3PMJA 3A8BA 3KCGH 3MH4A 1O36A 2BQ7B 1YCPK 2OLGA 1C1NA 2C8YB 3MOCA 2WV5A 4WH6A 2RDLA 4DW2U 1Z8JB 1C5WB 4OS7A 1TONA 2Y5HA 2D1JA 2VIQA 2ZPSA 4R8TB 4WMDA 1BJVA 1OWEA 5DP8A 1ABJH 5JBAS 2PGBB 3UY9A 5AF9H 2ZP0H 4Y76A 2GMTC 2GT7A 4KTSA 2AH4X 1C9TA 1ZHPA 1KTSB 1K1MA 1IQIA 1HAVA 1L1GA 1V2PT 1CGJE 3A85A 3M35A 1YPHE 4IN2A 5EXLA 2ZFQH 3ZZ5A 2XBVA 2ALPA 2ZU4A 1S6FA 4D9RA 2XBYA 1VZQH 1M9UA
chains in the Genus database with same CATH superfamily
1TRMA 2KZ4A 1BTUA 2PWXA 2WPHS 3SHCH 4RKJB 1EZXC 1KDQA 1GI8B 3BTEE 2H9EH 4X2YA 8ESTE 2ZHQH 3FKSD 3MHWU 2ZGBH 1VR1H 3ITIA 3SU4A 1GL0E 2TRMA 1V6DA 2WPIS 4A92A 3A7ZA 5DP9A 1YLDA 2A4OA 3Q77A 1K1NA 1GVKB 4ABFA 1FAXA 2F9BH 2HPPH 1YY3A 1NFXA 2DE9A 4I8JA 1HJAB 1EB1H 5EJLA 4Y79A 1HAXB 3AAUA 1FMGA 4GPGA 1YPHC 1C5NH 2O8WA 3OEHD 1C5QA 2XXLA 3ATIA 3KQDA 1GBLA 5C67A 1D3QB 2GCTB 3RXSA 1DXPA 2CF9H 1K1OA 3FN8A 4YXWD 4WMFA 1IQGA 1GJ9B 2VIVA 3KQCA 1QJ1B 2J2UA 1K9OE 5J4SA 1KMHB 2SNWA 1SB1H 3GCOA 2QYIA 2FI5E 2Y6TA 1OHHD 3CNRA 1CO7E 3BIVH 1NRPH 2F9UA 2GZ8A 2Q6GA 2JETC 1RD3B 3D65E 2BVSH 2XYAA 2ULLA 1ELCA 2ZC9H 1SFQB 1EQ9A 3MU8A 3SNAA 2NU0E 4X6OA 2ZPRA 4Y8YA 4ZROA 1O2TA 1UO6A 5FCRA 2SGQE 5C0UA 2FX6A 4A1TA 3M5MA 1QJ7B 2Y7ZA 1VITH 2KCOA 4FXGH 4B76A 1OPHB 2FOHA 1AB9B 3ATKA 2ZCHP 2XNIA 1Y8TA 1SGIB 2GV6A 3SUFA 4SGAE 2DUCA 2LPRA 4ZAEA 4X1NU 1TPAE 1F0SA 1Q3XA 1LVOA 1SQRA 2QF5A 3VFEA 3SV6A 3V12A 3MNXA 4I8GA 2A5AA 1O3AA 3A7WA 2XWAA 2Y81A 1RIWC 1O2QA 2A7JA 2Q6FA 4MDSA 4M7GA 2ZTXA 1BBRK 1BBRE 4GVUA 3SZNA 2PSYA 1O2VA 1W2KH 1NO9H 4ZMAH 2IOTA 2B9LA 2H6MA 3SV8A 1H9LB 5EQSA 3HKIB 1CHGA 1ELAA 1VITF 4YLQH 1ZSJA 4GHTA 1C5XB 1L4ZA 1V2JT 2CHAC 4TWWA 3SN8A 4YESB 2GD4B 1VKYA 4FUDA 1ZRBA 2IJOB 3A82A 2ZU5A 4ZXYH 1HAGE 4XRNA 1FZZA 1DFPA 5JDUB 2VJ1A 1C5ZB 1HV7A 1EXFA 5BRRE 2KM0A 2FI4E 3KYGA 1E38B 4KGAA 2FTMA 4B74A 2V0BA 3B8JA 3P17H 1C2FA 1J14A 3A86A 3LIWA 4JZ1A 3M3VA 1GHZA 1TA2A 1W10U 1BTPA 1UJ1A 3DSGA 1PQAA 1PQ7A 2WYGA 1GI5A 1FPHH 1QQUA 1W7XH 4O03A 2HLDD 1G36A 5ESTE 1WTHD 4AZ2B 2ZECA 1Z1JA 1D6WA 3ODDA 3QX5H 2QAAA 1FI8A 2VIOA 4XD7D 4INKA 3KNXA 4DCDA 1GBKA 2G52A 2Z9KA 4U30A 1ZMLA 1BTWA 2OQ5A 3SU1A 2R2MB 4O3TA 4ZHAA 3S9CA 4K1EA 1QZ8A 1BITA 1THRH 1IHTH 1AU8A 1FLEE 1HBTH 3U98H 2WPLS 2QF0A 1INCA 1VITG 2BM2A 5G4BA 4FUGA 2TGDA 3RXKA 3IG6B 4DGJA 1LPKB 1EATA 3LC5A 2EI7A 1QB9A 1NY22 2QXGA 4DOQA 1C2DA 1O30A 1NFUA 1GMCF 4LXBH 4Z6AH 2SGPE 3NWUA 1QY6A 3DA9B 5C5OA 4MPVA 1W14U 2TGAA 1Q2WA 1IQEA 1HAHH 1P2JA 2ZFRH 3EQ0H 3KYFA 4ABIA 4Q80A 1MCTA 2RCEA 3GY5A 4H6TA 1H4WA 1ZPBA 1KSNA 1BMLA 2OXSA 3RXGA 1O3HA 4Z1MD 5SGAE 1DPOA 4RT0A 1TABE 1BTZA 1LHDH 1JOUB 3NRLA 4ISNA 1P9UA 1OYQA 2BB4A 2BXTH 3BTWE 3E3TA 4JK5A 3VGCC 2UUJB 2PW8H 4DT7B 3ZYEA 1HAVB 4YLUA 4AORA 2V3MA 2IPQX 2ODQA 3JZ1B 1OWHA 2BY5X 3H09A 1GJBB 3A80A 3BG4B 4YT6H 1LKAA 1TIOA 2WUCA 1SOTA 4BXWA 2ZKSA 3I77A 3AK5A 4A7IB 2YMSD 3RXHA 3RXEA 4NCYA 4RT1A 1TPOA 1C2KA 3SO3A 1IQNA 4NWLA 3RXCA 1TBZH 2ZTZA 1GJ8B 1XUFA 1YPEH 1MKWH 4U32A 3S0NA 2FPZA 1D6RA 3QGJA 4VGCB 1GBEA 4HI3A 1ZMNA 2HVXA 2J98B 2JIZD 3F6UH 1SGEE 1Y59T 4XDEA 4J1YA 3KQEA 4CBNA 5J4QA 3GY3A 1Y5AT 1AWFH 1GG6C 3E90B 4X6MA 1GMCG 1ZGVA 1FV9A 4Z0KA 4FU7A 1F0RA 1ZTLA 4MNWA 3BEIB 1P2QA 4AC9A 1C5SA 2NU3E 2ZU3A 1LPGB 1LPZB 4IMQA 4DIIH 5B6OA 5LGOA 2FDAA 4HZHA 1GHWH 1ELTA 4XBBA 3RXOA 2QE7D 1YPLH 5F8XA 1LHCH 2P3UB 1BRBE 1Y3UA 3FO8D 1HRTH 2P8OC 1A1RA 1YP9A 4ZXXH 2O9QA 1MABB 3F2HA 1BHXB 1Z8IB 3BTDE 3GY4A 2L74A 1VCPA 2CK3D 4F48B 3PO1B 3LDXH 4JZDH 3T5FH 1O3PB 4M9FA 1S5SA 3RXUA 3GYLB 4JYVH 1GCDA 1HAYB 3SU3A 4U01A 1E34B 1P3EA 1QL9A 1KXAA 2VIWA 2BDHA 5DO4H 3RUOA 4ABGA 3LH3A 1GWAA 1OS8A 2ZFSA 1Y3YA 3QGNB 5DP7A 4MLFB 2GCHF 1PPCE 5K0HA 2XC5A 1G2MA 1BMAA 5TCCA 1C5YB 1GDQA 1TNLA 3BTTE 3L6PA 5DPAA 4X8UH 1MTNC 2AMDA 2A1DB 4FUFA 1GBJA 2TIOA 3EA8A 2QF3A 4I8HA 4GCHF 1ZTKA 4OGYA 5HIYA 1TNJA 2R0KA 2V7QD 1EAWA 4HGCA 1CSOE 4RKOB 2STBE 3GCHC 3PLPA 2WUBA 4FUIA 2AIPA 2VVVA 3C1KA 4DT4A 1AE5A 2ZF0H 1MQ6A 3MH5A 3F9HA 3A88A 3KGPA 5AHGH 4X2VA 3ZVBA 1OP8A 4IC6A 1T4VH 4AFSA 3RXDA 1BMMH 1FY3A 5GCHF 1EP5A 1FQ3A 3PLBA 1NRNH 3KQBA 2BYAX 2R3UA 1UK2A 3ZZBA 1TBRH 4O97A 3GDSA 3STJA 1GPZA 4UD9H 1LHFH 5FPTA 1O34A 1QBVH 1C4V2 5CHAB 2ZU2A 1GJAB 1H9IE 1A0HB 1RJXB 1P2KA 2R2WU 3ZZAA 2NU2E 2XOKD 5TCAA 3TJNA 1GI3A 1H9HE 1NRRH 3LJJA 3MU5A 3SYJA 3EAJA 3ZV9A 3DFJA 5A8XA 3Q3XA 1GDUA 4OGXA 3MO6A 2GVFA 6LPRA 1RFNA 2GCHG 9LPRA 4H6SB 4B6EA 3LT3A 3BTHE 3MMGA 1GI2A 5CHBA 1OWKA 1DT2A 3PV4A 1C2MA 2FOFA 3SQHE 2CJIA 1AVXA 1DLKB 4D7GA 3MO9A 2FX4A 1MTVA 2ANYA 4GCHG 4GSOA 3KEEA 2PFEA 5A8YA 1BTHH 3E0PB 3ZYDA 4Y0YE 3URDA 1O39A 3CENA 1W11U 1QL7A 2BD9A 1GHYH 4F55A 1AZ8A 1MZAA 1Z1IA 3SU6A 9ESTA 4OS1A 4YT7H 1O2OA 2OP9A 2V3HH 1BTYA 1H8IH 2W6JD 4MNXA 3M7UA 4WVPE 2ZWLH 1GHVH 1YPJH 2FM2A 1C2IA 3LGUA 2PKSC 3SU0A 5FL7D 4CR5A 1MU6B 4CHAC 3A8AA 4A6LA 4YZUA 1N8OC 3S7KB 1WV7H 2OBOA 2LP6A 1UTPA 3F68H 1P2IA 1UVTH 1TGNA 4JCNA 1DWBH 5T6FA 4D9QA 3ZZ3A 1QA0A 1ZMJA 4ZH8A 1GBCA 3LGIA 2VVCA 2Y80A 1EOLA 4ISLA 1VGCB 1O2LA 3B9FH 1K1JA 2OQUA 4F4OC 5TJXA 1RTFB 1T8MA 2ZCLP 1WOFA 2A0QB 1C2EA 2Z9JA 1IAUA 2BZAA 3UB0A 1IQJA 1MD8A 1CVWH 1QTFA 1CA0C 1JXPA 1LHEH 1THPB 5KEDA 1O2YA 5A8ZA 1NTPA 2ZHFH 1HPGA 3A8CA 4PROA 1P01A 3FP8E 1ABIH 2W3IA 1DOJA 2I6SA 2B8OH 3OAAD 1XKBC 1ESTA 3QN7A 4I33A 4ABJA 3UAIC 1O3DA 2SGEE 4AFUA 3PWBA 5FXLA 5C17A 3EA9A 2GP9B 2AYWA 5T3HA 1UCYH 1B5GH 4IMZA 1O37A 1T4UH 1GJCB 2O8UA 1THSH 4K8BA 1O2JA 1K22H 4HTCH 1EAUA 1MU8B 1EZSC 2BDCA 2VBCA 1XUJA 2ZDVH 3P8OA 3TLOA 3OE7D 5L30H 4X2WA 1C5MD 3QTOH 1YM0A 1JIMA 1O2WA 1BMFD 1EZQA 1GBHA 1MTUA 3NK8A 4NIXA 1O32A 1GVLA 2H2ZA 2UWOA 2XBWA 4ZHLU 5HXFA 2QXHA 3GDVA 1Z8GA 3ESTA 1O3CA 4FVBA 3BV9B 2GZ7A 2BD5A 2GGVB 4ZKNU 1YGCH 1FY5A 3MO3A 4MPUA 1DUAA 2QF4A 5HYOA 1TNIA 3SBKA 1AE8H 3GISB 2P95A 2BDBA 4WMEA 2Y7XA 3PTBA 1EJNA 1QB1A 1MH0A 2KFWA 1QCPA 2QXJA 3P70B 4R0IA 1FUJA 1ZPZA 2GDDA 1SGYE 3AASA 1UTMA 3MFJA 2BHGA 3QWCH 3SI4H 1O2XA 2BMGB 1HFDA 1O2MA 2W3KA 3UQVA 2JH0D 3OSYA 2EC9H 2WHXA 1CE5A 5FX5A 1MAXA 3RXJA 3SNDA 2KX4A 1ELGA 1AY6H 3TH4H 1QIXB 2BQ6B 2CV3A 2EQNA 1F5RA 3SGAE 2NWNA 5GNDA 3SZEA 4BAQB 1BA8B 1XXFA 1AUJA 4D76A 2CMYA 2SFAA 1O3NA 3EA7A 1T31A 1C5VA 3P8NA 2ZIQH 4X2XA 1TMUH 1CA8B 1SVPA 2FMJA 1K28D 2J98A 1TNHA 3PTNA 3PMBB 2WPJS 1AFQB 1HJAC 2GDEH 2HWLB 3O8DA 2YMSB 5LPFA 1G30B 1PQ8A 1X7AC 3RXIA 3S7HB 3RLYH 1AGJA 3PB1E 1UVOA 1BRCE 1GBAA 2VIPA 5EPYA 1MKWK 1SLUB 2WZQA 2GCTC 1KYNA 2H5CA 2PGQB 1GI0A 3UUZA 1MMJN 1XUIA 1TNGA 1NS3A 1MAYA 4X1SU 3EDXB 3DD2H 3QZQA 4GAWA 4AB8A 1O3FA 1E36B 2J38A 1DM4B 1KXFA 2Z9GA 4HG6A 5E8EH 1P9SA 1KXCA 2ZQ1A 5A09A 2OCVB 1GGDB 1JBUH 4Y10E 5F8TA 3ZIAD 3C27B 1Z6EA 3K9XB 3DSOA 1UK4A 3GY2A 4B73A 1KIGH 4BXSA 3S9BA 2HPQH 1TBQH 1SL3A 1P2NA 3ZVCA 3LGTA 1LCYA 4ASUD 2B0FA 1MD7A 1AB9C 3MNSA 1RTLA 1OSSA 1WAYB 2ILNA 2ZTYA 1W0YH 4MPWA 1PPFE 4IN1A 4WH8A 1IQLA 3TH2H 3V3MA 3SJOA 3T29A 2ZFPH 1EJAA 2RDEA 1K1PA 2AERH 1GI1A 4Y11E 3SUEA 1HNEE 2C90B 3ZZ7A 1MTWA 1DSUA 5CMXH 1T32A 3QLPH 1GCTB 3ZZCA 2F83A 4UEHH 2CXVA 2J9NA 4KELA 3TGKE 3OEED 1A4WH 1YPKH 1TGTA 2A32A 4X8SH 3A8DA 3KF2A 3UNRA 1S82A 4NWKA 5B6LA 2K8IA 1ZYOA 2ZHDA 1D3DB 2BXUH 4I8LA 4NGAH 5C1YA 1P05A 1SG8B 1O33A 5FHTA 1DY9A 1SGCA 3U1IB 3VB6A 1HJ8A 3F0OA 3LPRA 3UOUA 2W6ID 5KECA 1O5BB 1ORFA 1EZUC 1WSSH 2JJ2D 2UUKB 1ELBA 1COWD 4B2CA 1C1TA 2PTCE 5HM2A 2ZZUH 2BDIA 1BRAA 2EEKA 1HCGA 3SU2A 4NIWA 2JH5D 5KGOA 1O5DH 2XW9A 3W95A 4CREA 2HALA 1ZHMA 1HAPH 3FZZA 1SMFE 2HNTF 2O8TA 2PP6A 2A4RA 4ZHMU 2BZ6H 3BEFB 4ABEA 2OUAA 4IC5A 4Q7ZA 3UNSA 1SQOA 1G3CA 4XOJA 2UUFB 2C93B 2Z94A 1J9CH 2ZCKP 1C1UH 1P2OA 5EG4A 2FOMB 4TPIZ 4XE4A 3BG8A 3IITA 4ABDA 4I32A 3QO6A 5EW2H 1VCQA 1G9IE 1BT7A 2FYRA 1GI7B 1G3EA 3UIRA 4KKDA 3F9FA 1MZDA 3U8RH 2CGAA 2FYQA 1SGDE 3M36A 1D3TB 2KCYA 3V7TA 4NIYA 4NA7A 2VINA 1TWXB 3MTYA 4ZKRU 1XKAC 3MU4A 1AI8H 5A0CA 1NRSH 4OS6A 4K5ZA 1TPSA 5ETXA 4Q7YA 1DXWA 1SGFG 1XX9A 4FU9A 1P06A 3ZVFA 1O35A 2HVYB 2AHME 1RGQA 1O5GH 2OBQA 2PLXA 1DANH 1YKTA 4Y7AA 3VXFH 1LVMA 2BOKA 3A84A 4RSPA 3W94A 3ZVGA 2FXRA 1A5GH 1ELEE 1EOJA 3ZVDA 4Q2KA 2OD3B 2V6NA 4UFFH 1E79D 1O3LA 1EPTB 4OM9A 1Y5BT 3GCTF 1UK3A 1O3EA 2ESTE 1S85A 5E0HA 3TITA 1QJ6B 1ZZZA 2ZPQA 3NXPA 2HLCA 1TA6A 4IS5A 1A2CH 2THFB 4FUJA 4A5TS 3P92A 2O8MA 1A5IA 4ACBA 3DFLA 2BQWB 4GLYA 2VB0A 3BSQA 3A7XA 5HKKD 4I31A 3OY6U 5EQQA 3UWJH 1ETSH 1UTKA 5FCKA 1V2QT 5AFYH 3BG4C 2IN2A 2G4TA 1P57B 1WXRA 1MKXH 2K1QA 2FESH 3SHAH 1GBDA 3VEQB 4BAKB 3GCNA 2H9TH 2XTTB 2GZ9A 5C94A 3SV2H 2QIQA 5E0JA 4SGBE 1MQ5A 1TAWA 4H4FA 1NBMD 1ACBE 1UCYK 1GBMA 3M5LA 2FOAA 4VGCC 5DP6A 3BEUA 4J2YB 2ZGJA 1DSTA 2XCNA 3F9EA 2ANKH 1CHOF 1UTQA 4LZ4B 1ZSKA 4AB9A 1S0RA 3MNBA 3Q00A 1YWUA 3GY7A 3HATH 1HLTH 4CRCA 3EE0B 2PUXB 1OX1A 2A2QH 4K1SA 7LPRA 1K21H 5PTPA 1TOMH 2EI8A 1MBMA 3MU0A 3GCTG 1FN8A 1SLWB 2R0LA 4DIHH 4K60A 1G37A 4CRAA 1PQ5A 2L6OA 1IQHA 3F9GA 3ZZ8A 4P00A 5JBCS 1WYKA 1EB2A 4BOHA 3QUMP 1TQ7B 3PV5A 3K65B 2ZA5A 1FONA 3PO1C 1YLCA 1HAOH 3QDZB 1DE7H 1OOKB 1NC6A 1RRKA 1YPMH 5JPMH 1DICA 3RU4E 3Q3YA 1HXEH 4UFGH 5E2OA 1P09A 3ELAH 3OYPA 1AWHB 1C5RA 2RFKC 1V2LT 3T2NA 1W7GH 4ESTE 4YOGA 3Q3KA 1WQVH 1EJMA 5EXMA 3FZDA 4BAHB 3OTPA 1BDAA 5IYTA 3LGVA 1TB6H 3TPIZ 3DCLA 1A3BH 1O5AB 3TJOA 4OS5A 5T6GA 1WUNH 4NIVA 4ZCNA 1CHOG 3NCLA 2Y82A 4JYTA 2Z7FE 1GVZA 2ZI2H 1L4DA 5L2ZH 2ODYB 2J92A 2SGFE 4DJZB 3U1JB 1PPZA 2ANMH 1C9PA 2M5TA 4NFFA 3N7EA 1NZQH 1Z8RA 2BVXH 2GJGA 4INHA 2ZHEH 1GDNA 1Y3XA 2BLVA 2OTVA 3TH3H 1EP6A 4X1PU 2FO9A 1DVAH 3HGPA 3WW7A 3GS9A 3B23B 1C1VH 3A7YA 3SOSA 5K7RA 3A7TA 2XC4A 1TQ0B 1OKXA 1TE0A 1TMBH 2BD4A 1TX8A 2F9OA 5DK1A 5CHAC 7GCHF 1N6XA 4OS4A 4D7FA 2ALVA 1YBWA 1ANBA 2ZNKH 3SV9A 4LZ1H 1W12U 1C4Y2 5JBTA 3JZ2B 2DE8A 1T8OA 1BOQA 4MQAA 1JIRA 3A87A 1AZZA 2SNVA 2ZQ2A 3DSPA 1V3XA 1YYY1 3O8BA 3ATLA 3PRBA 2EI6A 2RA0A 3MI4A 3NKKA 1BQYA 4ABHA 2XWBI 1V2TT 1WQSA 1DWDH 3R3GB 2VVUA 3F3BA 4Q4LA 5C3NA 1QHRB 1BCUH 5T6DA 4I8KA 1CBWB 2XRCA 1MUEB 4CRBA 1SGRE 3MH7A 2UUYA 1WCZA 3TNSA 3HK6B 3GY8A 3AVZA 3BTKE 2CF8H 1S6LA 4OS2A 5DP5A 1V2VT 1E1RD 1O3GA 5AVDA 3P6ZB 5EIYA 3RM0H 1BTXA 5DG6A 1TOCB 1BUIA 3M3TA 3ZZ6A 1C1PA 2V35A 3BN9A 1DWEH 1XUKA 3D23A 1XUHA 2ANWA 5JYIA 3S69A 4AFQA 4AYVB 5GCHG 1LQDB 2KAIA 2BY8X 2C8ZB 1FY4A 7GCHG 2OK5A 4E05H 1CT0E 2AGIX 1XUGA 5HIZA 1Y3VA 1GBTA 3UOPA 2BDGA 1EUFA 1D4PB 1PFXC 1ZLRA 1VGCC 3M37A 1DY8A 5CE1A 3KHVA 3TK9A 1OWIA 3FFGA 1A5HA 4X8VH 1GBBA 1O38A 3ZZ9A 1DITH 1S83A 4CH2B 1HGTH 1HAIH 5DP3A 5LPRA 2I6QA 4BTIB 4DY7B 3GYMA 3RXRA 2W7SA 1O3BA 4YOIA 1O0DH 4XBDA 1LVBA 4Q63A 2HGTH 3ATWA 1G2LA 5GPIB 4D8NA 1S0QA 1YCPM 4UDWH 1AMHA 2EY4C 4NZQA 1S81A 5FAHA 2QGRA 2OC7A 1FJSA 2VGCB 1A3EH 1AIXH 3PV2A 4ISHH 1L1NA 1UMAH 3F1SB 6GCHF 1FXYA 1GJ4H 1K1LA 3FP7E 2BDAA 3T25A 1VCWA 2A31A 5DSFA 3O8RA 2PTNA 2WYJA 4X1QU 3H5CB 3BTME 4TPYA 1ETRH 3TNTA 3T28A 1B0EA 3M61U 1ZTJA 2KCPA 3RLWH 1L0ZA 1OP0A 1O2HA 5FPYA 3EE7A 5JB9S 1XM1A 6CHAB 1BJUA 3M3SA 1UVSH 2J4IA 4TY6A 2BD8A 3LH1A 1QURH 1SQTA 1EPTA 2HOBA 1NFYA 1OWDA 3HPTB 1DWCH 2PUQH 4AFZA 5H4IB 1K2I1 5F03A 4K3JA 3CS7A 3UNQA 3I78A 3GDUA 1FIZA 2J5UA 3RC5A 1SKYE 3RXFA 1AN1E 1EKBB 5LPEA 3UR9A 1P12E 2QN5T 5I46H 4CH8B 5JB8S 1HIAB 1ZSLA 2YNAA 3AW1A 2P3TB 1JWTA 4B1TA 3D62A 4A1XA 4Y0ZE 5C20A 5C5NA 1IQFA 1PPHE 2PHBA 3E91A 4HFPB 4TY7A 1B7XB 2B7DH 6GCHG 1CT4E 3PM3A 2ZGCA 3LU9B 3VXEH 5LH8A 2ZG0H 4ABAA 1F92A 1NU7B 2VWOA 1OXGA 1GHAF 2OC1A 2R3YA 1FY8E 3PLKA 1V2NT 3TU7H 8LPRA 4Y8ZA 3PMAB 2AMQA 3SGQE 3A83A 1PJPA 1GJDB 1UHBA 1P8VC 3VG8A 3LONA 3E6PH 4I7YH 3G01A 1C1WH 1MKXK 3TK6A 3VB5A 1AFQC 2GMTB 1GHBF 4AN7A 2YMSC 2FS8A 5F8ZA 2JJ1D 1LTOA 5AFZH 4CRDA 1IHSH 2A45B 3A81A 3DHKH 3PROA 1YPGH 3PMHB 4ISIH 1KTTB 3BF6H 2AGEX 4Y71A 3ODFA 1FIWA 8KME2 3W1EA 1QQ4A 4UFDH 2FEQH 2FLBH 4I86A 2B5TB 1D3PB 1QBOA 1TX7A 5C1UA 4ASHA 1P03A 2F9PA 1F5LA 2BD2A 4AG1A 3FP6E 1SGTA 2FOBA 5JBBS 1A0LA 2C8WB 1V2ST 3STIA 3QZRA 1UTLM 1C1QA 3E0NB 1GI9B 2ODPA 5DKMA 1O3KA 2VNTA 2VH0A 1L1JA 3RU4D 4WF8A 1IQKA 1XXDA 2G55A 2STAE 1GGDC 1SLXB 3RXQA 1OWJA 1NESE 2J34A 2J94A 1HUTH 1TX6A 1HDTH 4JK6A 1AD8H 5GXPA 2PV9B 2Q6DA 3AW0A 1EX3A 2F9VA 2ZU1A 1GHAG 1XMNB 4LOYH 4RN6A 2GTBA 1O2PA 3U28C 2BDYA 3K6ZA 3IWMA 4CRGA 2A7CA 4K69A 1DUEA 2D26C 1AUTC 4NA9H 3RMLH 3NZIA 5A0AE 1WBGB 2G5VA 6ESTA 3O8CA 5FPSA 1GHBG 3P8GA 5ABWA 3E16B 1HXFH 5L6NH 3SQEE 4A1VA 3ZVAA 1CGHA 1K1IA 2QA9E 3ZZ4A 1GCTC 4K8YA 3S9AA 1KXDA 1RTKA 1TFXA 1GJ6A 4FVDA 5GIBA 4ABBA 2GT8A 5F53A 4H42U 4ISOA 3CP7A 1W13U 2G4UA 1F0UA 5DJ7A 2Y5GA 3FANA 3RXLA 1T7CA 2WSSD 4ACAA 4FUHA 1TYNA 1D9IA 2JETB 2FOCA 3HGNA 3MQKC 5GWZA 1ELFA 1TNKA 1SPJA 2WINI 1O5EH 1O5FH 1PYTC 2QY0B 1J15A 4FU8A 1AKSB 1QGFA 2PKAB 1OYTH 5FBIA 2AMPA 1WDIA 2W26A 1OP2A 4WJG2 3DUXH 1C2LA 2BD3A 2KAIB 3UREA 1F0TA 1LVYA 2F4LA 5HGGA 1B0FA 1LKBA 2FIRH 3MYWA 3PWCA 2AGGX 2V3OH 1PPBH 2J97A 7ESTE 5FBEA 2CN0H 4B2AA 2ZGXH 1GJ5H 2A5IA 2OC0A 3RU4T 3SW2B 1A7SA 2P59A 2W5EA 1RIWB 2F91A 5A2MH 1O2SA 1O3OA 1O2GH 1NT1A 1V2RT 3PRDA 1P04A 5HM9A 3LOXA 1C2HA 5GDSH 3SV7A 2BVRH 2VIDA 2D8WA 2FP7B 1S84A 3WWFA 2VWLA 1C1OA 2FLRH 2ZFFH 1JMOH 3OFND 1UTNA 3A7VA 4Y6DA 3D49H 4E06H 2CHAB 3SNBA 3SJ8A 1DDJA 2WPKS 2FI3E 4ZKOU 2NU1E 1H1BA 3H7OA 3M7QA 1BZXE 1C1RA 3BTFE 1G3DA 1CT2E 1BRUP 1P02A 4ZKSU 3KL6A 4B71A 4CR9A 4BTTB 2FZZA 2FS9A 4UONA 2ZDKA 1C5UA 2P93A 1O2IA 3U8OH 5I25A 2BOHB 2QC2A 1YC0A 1QB6A 2IPHA 1YLNA 2BY9X 2XBXA 1LO6A 3SNEA 1EFRD 3RMOH 4X0WU 4E7NA 2H5DA 3RXPA 1IOEA 1J16A 3FAOA 3SORA 3DT0H 1P10A 1T8LA 3ZZDA 1EPTC 1TGCA 3RMNH 1Z71A 1QA7A 3RP2A 1RS0A 7KMEH 1NU9A 2ZO3H 3F2FA 4NA8A 4XSKU 4BNRA 2ZEBA 2FOEA 1VJAU 4K2YA 1UTOA 2H1UA 3M5NA 3SUGA 4AG2A 1AVWA 1YCPH 3MWIU 1W3CA 1UVPA 3PYHA 8GCHF 1ZOMA 1F5KU 3RMMH 4X8TH 2KR7A 3RM2H 1SGFA 3Q76A 2A7HA 5EJ1A 3LGWA 1KY9A 1TMTH 1J8AA 1HJ9A 1SGPE 1C5OH 3TGJE 3E8LA 2BLWA 1TGSZ 2AIQA 2Y5FA 1ANEA 2Z6BD 4KP0A 3RDZA 1C1SA 2Z9IA 2ZDAH 2HRVA 2AEIH 3SJ9A 2UWLA 3OU0A 1P2MA 1ID5H 1GI4A 1LMWB 3K6YA 3TK5A 3UFAA 1FAKH 1U6QA 2BY6X 2R9PA 2TBSA 2QV1A 3ENSB 1CQQA 1ZHRA 1GI6A 3N99A 4MNYA 3TIUA 4YTAA 4DURA 3UTUH 2P94A 2LNCA 3VPKA 1UCYE 1FN6A 1SGNE 3VB7A 1UHBB 3GICB 5HMAA 2LELA 1C4U2 3I29A 2XNDD 1E35B 1UW7A 1BB0B 2A2XH 1O3MA 1HYLA 1SFIA 2A5KA 5EJZA 2QXIA 2VH6A 3TGIE 5FX6A 2QCYA 2TGPZ 3VGCB 1O3JA 2GX4A 4XBCA 3SI3H 2SGAA 4MNVA 1SC8U 3VB4A 1KDQB 2FWWA 3KQ5A 3OY5U 4JMYA 4U2WA 4XFQA 4X6PA 5CDFE 2ZDLA 3U8TH 1PPEE 3SU5A 3GOVB 3BTQE 1EAIA 2IJD1 4MVNA 8GCHG 1ARBA 2ZHWH 3T26A 1HIAA 2AS9A 1NN6A 2KCAA 4BTUB 4YM9A 2D2DA 4JZIA 1KLJH 2EA3A 3QTVH 1FDPA 4RI0A 1V2KT 1W8BH 1GBFA 5C0TA 3M5OA 4YOJA 2ZGHA 5EW1H 1GMHF 4JYUH 2GV7A 1NFWA 1Q31A 1O2UA 2TPIZ 1GG6B 5EU8A 3L3TA 1GHXH 2G5NA 1SLVB 1DS2E 1H8ED 2VWMA 3RC6A 1SSXA 1SOZA 3GY6A 1MTSA 4FETA 3UQOA 2Z3DA 3ZV8A 3HK3B 1Y3WA 1Z7KA 3HKJB 1FY1A 1QRXA 1DX5M 2XC0A 3ATMA 4FUCA 2P8OB 4BANB 1TRYA 2RG3A 5IDKA 1SHYA 1XVMA 2BLQA 4GHQA 1O3IA 1BIOA 1N6YA 1GBIA 4Y8XA 5EXNA 3V0XA 2F9NA 1SHHB 4X6NA 3CS0A 1C1MA 1WU1A 2Z9LA 1E37B 5C2ZA 2A4GA 2JH6D 5A0BA 3TJVA 4DVAU 3SUDA 3VB3A 3RXVA 1SQAA 3WY8A 4MG3A 4FOUC 1ANDA 3UPEA 4NSVA 2NU4E 5EGMA 2YOLA 5EQRA 3EYDA 1AQ7A 4GUXA 1A46H 3LKWA 1ETTH 1JRSA 1A0JA 2BY7X 3OTJE 1BBRH 1CGIE 1MTNB 1N1LA 1UVUH 4NG9H 1GMHG 1QRZA 2WV9A 1PYTD 3URCA 3ZVEA 2C8XB 1FPCH 4Y7BA 1HB0B 4IW4E 2BLOA 3GCHB 2G51A 3LJOA 4TT3D 4WWYA 3V13A 1C5TA 2G81E 3LC3A 2ZDNA 2BX4A 3MNCA 3F2GA 1QNJA 1V2WT 3R0FA 3RXBA 3T62A 4AYYB 1ELDE 4WY3A 3UR6A 5IK2D 4YO9A 3KIDU 3NUMA 4AGJA 3P95A 1CBWC 4E7RG 5F6MA 1F7ZA 1T8NA 1ESAA 4TYDA 1QR3E 1W0JD 3NPSA 1FNIA 4WXVA 2P3FH 3A89A 1XVOA 1V2MT 1YF4A 3MH6A 1ZR0A 2OC8A 3MU1A 3N7OA 4LK4A 2G8TA 1EASA 1KLTA 4KTCA 2ASUB 2WV4A 1LHGH 2C3SA 5EODA 1AVGH 4FUEA 1QRWA 1VJ9U 2TGTA 2W7UA 1RXPA 1CU1A 1SI5H 1O5CB 1C2GA 1AKSA 1AHTH 2PKAA 2JDID 4ZUHA 1ESBA 1EAXA 1PPGE 2AFQB 2XCFA 3H7TA 1LQEA 1F2SE 4CRFA 1HAZB 4NFEA 1J17T 1ANCA 2ZFTA 2WPDD 4INLA 5GJ4B 4MTBA 3U9AH 4IBLH 1TLDA 1GL1A 1ZRKA 4UFEH 1DLEA 4DG4A 1W0ZU 1O2RA 2BX3A 1KLIH 1LDTT 4UE7H 1BMNH 3QK1A 2GKVE 4AX9H 2HNTE 3RXMA 4O3UA 5DN6D 4K1TA 4JZFH 3N7DA 4F49A 3RXTA 3KN2A 3U69H 1SGQE 5EPNA 4NZLA 2RA3A 1JRTA 4B75A 1Z6JH 2Z3EA 5L2YH 2J95A 1C2JA 2UWPA 4FUBA 3BIUH 2VU8E 1GMDF 2F43B 3K2UA 2WPMS 4WXIA 3LGYA 3RXAA 2BTCE 1P11E 3SGBE 1NROH 1TALA 2F3CE 4BAMB 1H8HD 1TRNA 2M2AA 2JKHA 2VGCC 4AOQA 1L2EA 1W0KD 1KXEA 2PKSB 1ZJDA 2H9HA 3EGKH 3L33A 2G00A 3RC4A 4CHAB 2C4FH 2BD7A 1N8OB 1NRQH 4Q7XA 1TGBA 3BTGE 1C5PA 2FTLE 1TPPA 3FVFB 3E1XB 2A4QA 3TJUA 1C5LH 4TWYA 2VWNA 1H8DH 4O9VA 1ELVA 2YNBA 1ARCA 3SNCA 1AFEH 2Z3CA 1GJ7B 1V2UT 2HNTC 3F0PA 1MBQA 2Q1JA 5DP4A 1V2OT 3SJIA 1SR5C 1UTJA 3M7TA 1QBNA 1QL8A 1ZPCA 1E0FD 1G32B 2O8LA 1MCVA 4X1RU 5ESBA 3T27A 3TVJB 1P0SH 3UWIA 4THNH 6CHAC 1AO5A 1CA0B 4NSYA 1WTGH 2PSXA 4MPXA 5C1XA 1NM6A 2SGDE 3FOAA 1O2KA 5E0GA 1G3BA 1ZGIA 5T1VA 3P8FA 1Y5UT 2ZDMA 2PR3A 2K0QA 2FOGA 2P16A 4CBOA 1O2NA 1O2ZA 1P3CA 1SBWA 3OX7U 1ZJKA 2OINA 4KTUA 1KXBA 1E1QD 1A61H 3SJKA 1FX0B 4JZEH 4B6FA 4P02A 1IQMA 1NBME 2FODA 1GMDG 5BPEA 3AAVA 1S6HA 5E2PA 4IGDA 5DGJA 1BHXF 1QFKH 4AGKA 5EOKA 1O31A 4B2BA 4QT8C 1NPMA 4BAOB 3PMJA 3A8BA 3KCGH 3MH4A 1O36A 2BQ7B 1YCPK 2OLGA 1C1NA 2C8YB 3MOCA 2WV5A 4WH6A 2RDLA 4DW2U 1Z8JB 1C5WB 4OS7A 1TONA 1K0HA 2Y5HA 2D1JA 2VIQA 2ZPSA 4R8TB 4WMDA 1BJVA 1OWEA 5DP8A 1ABJH 5JBAS 2PGBB 3UY9A 5AF9H 2ZP0H 4Y76A 2GMTC 2GT7A 4KTSA 2AH4X 1C9TA 1ZHPA 1KTSB 1K1MA 1IQIA 1HAVA 4TSFD 1L1GA 1V2PT 1CGJE 3A85A 3M35A 1YPHE 4IN2A 5EXLA 2ZFQH 3ZZ5A 2XBVA 3WWBA 2ALPA 2ZU4A 1S6FA 4D9RA 2XBYA 1VZQH 1M9UA
chains in the Genus database with same CATH topology
1TRMA 2PWXA 1BTUA 2WPHS 3SHCH 4RKJB 1EZXC 1KDQA 1GI8B 3BTEE 2H9EH 4X2YA 8ESTE 2ZHQH 3MHWU 2ZGBH 1VR1H 3ITIA 3SU4A 1GL0E 2TRMA 1V6DA 2WPIS 4A92A 3A7ZA 5DP9A 1YLDA 2A4OA 3Q77A 1K1NA 1GVKB 4ABFA 1FAXA 2F9BH 2HPPH 1NFXA 2DE9A 4I8JA 1HJAB 1EB1H 4Y79A 1HAXB 3AAUA 1FMGA 4GPGA 1YPHC 1C5NH 2O8WA 1C5QA 2XXLA 3ATIA 3KQDA 1GBLA 5C67A 1D3QB 2GCTB 3RXSA 1DXPA 2CF9H 1K1OA 4WMFA 1IQGA 1GJ9B 2VIVA 3KQCA 1QJ1B 2J2UA 1K9OE 5J4SA 2SNWA 1SB1H 3GCOA 2QYIA 2FI5E 2Y6TA 1CO7E 3BIVH 1NRPH 2F9UA 2GZ8A 2Q6GA 2JETC 1RD3B 3D65E 2BVSH 2XYAA 2ULLA 1ELCA 2ZC9H 1SFQB 1EQ9A 3MU8A 3SNAA 2NU0E 4X6OA 2ZPRA 4Y8YA 4ZROA 1O2TA 1UO6A 5FCRA 2SGQE 2FX6A 4A1TA 3M5MA 1QJ7B 2Y7ZA 1VITH 4FXGH 4B76A 1OPHB 2FOHA 1AB9B 3ATKA 2ZCHP 2XNIA 1Y8TA 1SGIB 2GV6A 3SUFA 4SGAE 2DUCA 2LPRA 4ZAEA 4X1NU 1TPAE 1F0SA 1Q3XA 1LVOA 3VFEA 3SV6A 3V12A 3MNXA 4I8GA 2A5AA 1O3AA 3A7WA 2XWAA 2Y81A 1RIWC 1O2QA 2A7JA 2Q6FA 4MDSA 4M7GA 2ZTXA 1BBRK 1BBRE 4GVUA 3SZNA 2PSYA 1O2VA 1W2KH 1NO9H 4ZMAH 2IOTA 2B9LA 2H6MA 3SV8A 1H9LB 5EQSA 3HKIB 1CHGA 1ELAA 1VITF 4YLQH 1ZSJA 4GHTA 1C5XB 1L4ZA 1V2JT 2CHAC 4TWWA 3SN8A 4YESB 2GD4B 4FUDA 1ZRBA 2IJOB 3A82A 2ZU5A 4ZXYH 1HAGE 1FZZA 1DFPA 5JDUB 2VJ1A 1C5ZB 1HV7A 1EXFA 5BRRE 2FI4E 1E38B 4KGAA 2FTMA 4B74A 2V0BA 3B8JA 3P17H 1C2FA 1J14A 3A86A 3LIWA 4JZ1A 3M3VA 1GHZA 1TA2A 1W10U 1BTPA 1UJ1A 1PQAA 1PQ7A 2WYGA 1GI5A 1FPHH 1QQUA 1W7XH 4O03A 1G36A 5ESTE 1WTHD 4AZ2B 2ZECA 1Z1JA 1D6WA 3ODDA 3QX5H 2QAAA 1FI8A 2VIOA 4INKA 3KNXA 4DCDA 1GBKA 2G52A 2Z9KA 4U30A 1ZMLA 1BTWA 2OQ5A 3SU1A 2R2MB 4O3TA 4ZHAA 3S9CA 4K1EA 1BITA 1THRH 1IHTH 1AU8A 1FLEE 1HBTH 3U98H 2WPLS 2QF0A 1INCA 1VITG 2BM2A 5G4BA 4FUGA 2TGDA 3RXKA 3IG6B 4DGJA 1LPKB 1EATA 3LC5A 2EI7A 1QB9A 1NY22 2QXGA 4DOQA 1C2DA 1O30A 1NFUA 1GMCF 4LXBH 4Z6AH 2SGPE 3NWUA 1QY6A 3DA9B 5C5OA 4MPVA 1W14U 2TGAA 1Q2WA 1IQEA 1HAHH 1P2JA 2ZFRH 3EQ0H 4ABIA 4Q80A 1MCTA 2RCEA 3GY5A 4H6TA 1H4WA 1ZPBA 1KSNA 1BMLA 2OXSA 3RXGA 1O3HA 5SGAE 1DPOA 1TABE 1BTZA 1LHDH 1JOUB 4ISNA 1P9UA 1OYQA 2BB4A 2BXTH 3BTWE 3E3TA 4JK5A 3VGCC 2UUJB 2PW8H 4DT7B 3ZYEA 1HAVB 4YLUA 4AORA 2ODQA 3JZ1B 1OWHA 2BY5X 1GJBB 3A80A 3BG4B 4YT6H 1LKAA 1TIOA 2WUCA 1SOTA 4BXWA 2ZKSA 3I77A 4A7IB 3RXHA 3RXEA 4NCYA 1TPOA 1C2KA 3SO3A 1IQNA 4NWLA 3RXCA 1TBZH 2ZTZA 1GJ8B 1XUFA 1YPEH 1MKWH 4U32A 3S0NA 2FPZA 1D6RA 3QGJA 4VGCB 1GBEA 4HI3A 1ZMNA 2HVXA 3F6UH 1SGEE 1Y59T 4XDEA 4J1YA 3KQEA 4CBNA 5J4QA 3GY3A 1Y5AT 1AWFH 1GG6C 3E90B 4X6MA 1GMCG 1ZGVA 1FV9A 4Z0KA 4FU7A 1F0RA 1ZTLA 4MNWA 3BEIB 1P2QA 1C5SA 2NU3E 2ZU3A 1LPGB 1LPZB 4IMQA 4DIIH 5B6OA 5LGOA 2FDAA 4HZHA 1GHWH 1ELTA 4XBBA 3RXOA 1YPLH 5F8XA 1LHCH 2P3UB 1BRBE 1Y3UA 1HRTH 2P8OC 1A1RA 1YP9A 4ZXXH 2O9QA 1BHXB 1Z8IB 3BTDE 3GY4A 1VCPA 3PO1B 3LDXH 4JZDH 3T5FH 1O3PB 1S5SA 3RXUA 3GYLB 4JYVH 1GCDA 1HAYB 3SU3A 4U01A 1E34B 1P3EA 1QL9A 1KXAA 2VIWA 2BDHA 5DO4H 3RUOA 4ABGA 3LH3A 1GWAA 1OS8A 2ZFSA 1Y3YA 3QGNB 5DP7A 4MLFB 2GCHF 1PPCE 5K0HA 2XC5A 1G2MA 1BMAA 5TCCA 1C5YB 1GDQA 1TNLA 3BTTE 3L6PA 5DPAA 4X8UH 1MTNC 2AMDA 2A1DB 4FUFA 1GBJA 2TIOA 3EA8A 2QF3A 4I8HA 4GCHF 1ZTKA 4OGYA 1TNJA 2R0KA 1EAWA 4HGCA 1CSOE 4RKOB 2STBE 3GCHC 3PLPA 2WUBA 4FUIA 2AIPA 2VVVA 3C1KA 1AE5A 2ZF0H 1MQ6A 3MH5A 3F9HA 3A88A 3KGPA 5AHGH 4X2VA 3ZVBA 1OP8A 4IC6A 1T4VH 4AFSA 3RXDA 1BMMH 1FY3A 5GCHF 1EP5A 1FQ3A 3PLBA 1NRNH 3KQBA 2BYAX 2R3UA 1UK2A 3ZZBA 1TBRH 4O97A 3GDSA 3STJA 1GPZA 4UD9H 1LHFH 5FPTA 1O34A 1QBVH 1C4V2 5CHAB 2ZU2A 1GJAB 1H9IE 1A0HB 1RJXB 1P2KA 2R2WU 3ZZAA 2NU2E 5TCAA 3TJNA 1GI3A 1H9HE 1NRRH 3LJJA 3MU5A 3EAJA 3ZV9A 3DFJA 5A8XA 3Q3XA 1GDUA 4OGXA 3MO6A 2GVFA 6LPRA 1RFNA 2GCHG 9LPRA 4H6SB 3LT3A 3BTHE 3MMGA 1GI2A 1OWKA 1DT2A 3PV4A 1C2MA 2FOFA 3SQHE 2CJIA 1AVXA 1DLKB 4D7GA 3MO9A 2FX4A 1MTVA 2ANYA 4GCHG 4GSOA 3KEEA 2PFEA 5A8YA 1BTHH 3E0PB 3ZYDA 4Y0YE 3URDA 1O39A 3CENA 1W11U 1QL7A 2BD9A 1GHYH 1AZ8A 1MZAA 1Z1IA 3SU6A 9ESTA 4OS1A 4YT7H 1O2OA 2OP9A 2V3HH 1BTYA 1H8IH 4MNXA 3M7UA 4WVPE 2ZWLH 1GHVH 1YPJH 2FM2A 1C2IA 3LGUA 2PKSC 3SU0A 4CHAC 4CR5A 1MU6B 3A8AA 4A6LA 4YZUA 1N8OC 3S7KB 1WV7H 2OBOA 1UTPA 3F68H 1P2IA 1UVTH 1TGNA 4JCNA 1DWBH 5T6FA 4D9QA 3ZZ3A 1QA0A 1ZMJA 4ZH8A 1GBCA 3LGIA 2VVCA 2Y80A 1EOLA 4ISLA 1VGCB 1O2LA 3B9FH 1K1JA 2OQUA 4F4OC 5TJXA 1RTFB 1T8MA 2ZCLP 1WOFA 2A0QB 1C2EA 2Z9JA 1IAUA 2BZAA 1IQJA 1MD8A 1CVWH 1QTFA 1CA0C 1JXPA 1LHEH 1THPB 1O2YA 5A8ZA 1NTPA 2ZHFH 1HPGA 3A8CA 4PROA 1P01A 3FP8E 1ABIH 2W3IA 1DOJA 2I6SA 2B8OH 1XKBC 1ESTA 3QN7A 4I33A 4ABJA 1O3DA 2SGEE 4AFUA 3PWBA 5FXLA 3EA9A 2GP9B 2AYWA 5T3HA 1UCYH 1B5GH 4IMZA 1O37A 1T4UH 1GJCB 2O8UA 1THSH 4K8BA 1O2JA 1K22H 4HTCH 1EAUA 1MU8B 1EZSC 2BDCA 1XUJA 2ZDVH 3P8OA 3TLOA 5L30H 4X2WA 1C5MD 3QTOH 1YM0A 1JIMA 1O2WA 1EZQA 1GBHA 1MTUA 3NK8A 4NIXA 1O32A 1GVLA 2H2ZA 2UWOA 2XBWA 4ZHLU 5HXFA 2QXHA 3GDVA 1Z8GA 3ESTA 1O3CA 4FVBA 3BV9B 2GZ7A 2BD5A 2GGVB 4ZKNU 1YGCH 1FY5A 3MO3A 4MPUA 1DUAA 5HYOA 1TNIA 3SBKA 1AE8H 3GISB 2P95A 2BDBA 4WMEA 2Y7XA 3PTBA 1EJNA 1QB1A 1MH0A 1QCPA 2QXJA 3P70B 4R0IA 1FUJA 1ZPZA 2GDDA 1SGYE 3AASA 1UTMA 3MFJA 2BHGA 3QWCH 3SI4H 1O2XA 2BMGB 1HFDA 1O2MA 2W3KA 3UQVA 2JH0D 3OSYA 2EC9H 1CE5A 5FX5A 1MAXA 3RXJA 3SNDA 1ELGA 1AY6H 3TH4H 1QIXB 2BQ6B 2CV3A 1F5RA 3SGAE 2NWNA 4BAQB 1BA8B 1XXFA 1AUJA 4D76A 2CMYA 2SFAA 1O3NA 3EA7A 1T31A 1C5VA 3P8NA 2ZIQH 4X2XA 1TMUH 1CA8B 1SVPA 2FMJA 1K28D 1TNHA 3PTNA 3PMBB 2WPJS 1AFQB 1HJAC 2GDEH 2HWLB 3O8DA 5LPFA 1G30B 1PQ8A 1X7AC 3RXIA 3S7HB 3RLYH 1AGJA 3PB1E 1UVOA 1BRCE 1GBAA 2VIPA 5EPYA 1MKWK 1SLUB 2GCTC 1KYNA 2H5CA 2PGQB 1GI0A 3UUZA 1MMJN 1XUIA 1TNGA 1NS3A 1MAYA 4X1SU 3EDXB 3DD2H 3QZQA 4GAWA 4AB8A 1O3FA 1E36B 2J38A 1DM4B 1KXFA 2Z9GA 5E8EH 1P9SA 1KXCA 2ZQ1A 5A09A 2OCVB 1GGDB 1JBUH 4Y10E 5F8TA 3C27B 1Z6EA 3K9XB 1UK4A 3GY2A 4B73A 1KIGH 4BXSA 3S9BA 2HPQH 1TBQH 1SL3A 1P2NA 3ZVCA 3LGTA 1LCYA 2B0FA 1MD7A 1AB9C 3MNSA 1RTLA 1OSSA 1WAYB 2ILNA 2ZTYA 1W0YH 4MPWA 1PPFE 4IN1A 4WH8A 1IQLA 3TH2H 3V3MA 3SJOA 3T29A 2ZFPH 1EJAA 1K1PA 2AERH 1GI1A 4Y11E 3SUEA 1HNEE 2C90B 3ZZ7A 1MTWA 1DSUA 5CMXH 1T32A 3QLPH 1GCTB 3ZZCA 2F83A 4UEHH 2CXVA 2J9NA 4KELA 3TGKE 1A4WH 1YPKH 1TGTA 2A32A 4X8SH 3A8DA 3KF2A 3UNRA 1S82A 4NWKA 1ZYOA 2ZHDA 1D3DB 2BXUH 4I8LA 4NGAH 5C1YA 1P05A 1SG8B 1O33A 5FHTA 1DY9A 1SGCA 3U1IB 3VB6A 1HJ8A 3LPRA 3UOUA 1O5BB 1ORFA 1EZUC 1WSSH 2UUKB 1ELBA 4B2CA 1C1TA 2PTCE 5HM2A 2ZZUH 2BDIA 1BRAA 2EEKA 1HCGA 3SU2A 4NIWA 2JH5D 3W95A 1O5DH 2XW9A 4CREA 2HALA 1ZHMA 1HAPH 3FZZA 1SMFE 2HNTF 2O8TA 2A4RA 4ZHMU 2BZ6H 3BEFB 4ABEA 2OUAA 4IC5A 4Q7ZA 3UNSA 1SQOA 1G3CA 4XOJA 2UUFB 2C93B 2Z94A 1J9CH 2ZCKP 1C1UH 1P2OA 5EG4A 2FOMB 4TPIZ 4XE4A 3BG8A 3IITA 4ABDA 4I32A 3QO6A 5EW2H 1VCQA 1G9IE 1BT7A 2FYRA 1GI7B 1G3EA 3UIRA 4KKDA 3F9FA 1MZDA 3U8RH 2CGAA 2FYQA 1SGDE 3M36A 1D3TB 3V7TA 4NIYA 4NA7A 2VINA 1TWXB 3MTYA 4ZKRU 1XKAC 3MU4A 1AI8H 5A0CA 1NRSH 4OS6A 4K5ZA 1TPSA 5ETXA 4Q7YA 1DXWA 1SGFG 1XX9A 4FU9A 1P06A 3ZVFA 1O35A 1RGQA 1O5GH 2OBQA 2PLXA 1DANH 1YKTA 4Y7AA 3VXFH 1LVMA 2BOKA 3A84A 4RSPA 3W94A 3ZVGA 2FXRA 1A5GH 1ELEE 1EOJA 3ZVDA 4Q2KA 2OD3B 2V6NA 4UFFH 1O3LA 1EPTB 1Y5BT 3GCTF 1UK3A 1O3EA 2ESTE 1S85A 5E0HA 3TITA 1QJ6B 1ZZZA 2ZPQA 3NXPA 2HLCA 1TA6A 4IS5A 1A2CH 2THFB 4FUJA 4A5TS 3P92A 2O8MA 1A5IA 3DFLA 2BQWB 4GLYA 2VB0A 3BSQA 3A7XA 4I31A 3OY6U 5EQQA 3UWJH 1ETSH 1UTKA 5FCKA 1V2QT 5AFYH 3BG4C 2IN2A 2G4TA 1P57B 1MKXH 2K1QA 2FESH 3SHAH 1GBDA 3VEQB 4BAKB 3GCNA 2H9TH 2XTTB 2GZ9A 3SV2H 2QIQA 5E0JA 4SGBE 1MQ5A 1TAWA 4H4FA 1ACBE 1UCYK 1GBMA 3M5LA 2FOAA 4VGCC 5DP6A 3BEUA 4J2YB 2ZGJA 1DSTA 2XCNA 3F9EA 2ANKH 1CHOF 1UTQA 4LZ4B 1ZSKA 4AB9A 1S0RA 3MNBA 3Q00A 3GY7A 3HATH 1HLTH 4CRCA 3EE0B 2PUXB 1OX1A 2A2QH 4K1SA 7LPRA 1K21H 5PTPA 1TOMH 2EI8A 1MBMA 3MU0A 3GCTG 1FN8A 1SLWB 2R0LA 4DIHH 4K60A 1G37A 4CRAA 1PQ5A 3F9GA 1IQHA 3ZZ8A 5JBCS 1WYKA 1EB2A 4BOHA 3QUMP 1TQ7B 3K65B 2ZA5A 1FONA 3PO1C 1YLCA 1HAOH 3QDZB 1DE7H 1OOKB 1NC6A 1RRKA 1YPMH 5JPMH 1DICA 3RU4E 3Q3YA 1HXEH 4UFGH 5E2OA 1P09A 3ELAH 3OYPA 1AWHB 1C5RA 1V2LT 3T2NA 1W7GH 4ESTE 4YOGA 3Q3KA 1WQVH 1EJMA 5EXMA 3FZDA 4BAHB 1BDAA 5IYTA 3LGVA 1TB6H 3TPIZ 1A3BH 1O5AB 3TJOA 4OS5A 5T6GA 1WUNH 4NIVA 1CHOG 3NCLA 2Y82A 4JYTA