1BRUP

Structure of porcine pancreatic elastase complexed with the elastase inhibitor gr143783
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
241
structure length
241
Chain Sequence
VVGGEDARPNSWPWQVSLQYDSSGQWRHTCGGTLVDQSWVLTAAHCISSSRTYRVVLGRHSLSTNEPGSLAVKVSKLVVHQDWNSNQLSNGNDIALLKLASPVSLTDKIQLGCLPAAGTILPNNYVCYVTGWGRLQTNGASPDILQQGQLLVVDYATCSKPGWWGSTVKTNMICAGGDGIISSCNGDSGGPLNCQGANGQWQVHGIVSFGSSLGCNYYHKPSVFTRVSNYIDWINSVIANN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ELASTASE
molecule tags Serine protease
total genus 62
structure length 241
sequence length 241
ec nomenclature ec 3.4.21.71: Pancreatic elastase II.
pdb deposition date 1998-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1bruP02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1bruP01
2FOMB 1C1UH 1D3PB 3MHWU 1FAKH 1ZHRA 4NIWA 3TJVA 2CJIA 2FI4E 3TVJB 3VB6A 4DIHH 5LH8A 4O3TA 4MPUA 2FTMA 1V2UT 1GBTA 2ZFPH 1GG6C 1MBQA 1T4UH 4DT7B 1P2QA 2R2MB 2ZFRH 4GAWA 1C5ZB 1OPHB 1ZSJA 1UTJA 1XUIA 1C5NH 4ZKRU 4LZ4B 1O3MA 2ZZUH 1HAVB 1MUEB 3TU7H 2FOFA 2F9UA 1QJ7B 1N6YA 4AFSA 4ISOA 5K7RA 1LKBA 1WAYB 3TPIZ 4GUXA 1V2WT 2F9NA 1JOUB 1MTNC 1ANCA 3A8AA 4WVPE 1EASA 1ZHMA 3KCGH 3A80A 2HWLB 3L33A 3RM2H 4JYUH 4AOQA 5DJ7A 2AEIH 1C4U2 2ULLA 1MTNB 4GSOA 3TH2H 1H8DH 3Q00A 1F5LA 1NT1A 1P2IA 3GDUA 3CENA 1GMHG 1C1WH 4D9RA 2O8TA 1FN8A 1EZXC 3RXBA 5DP5A 3O8CA 4ZKNU 2ZI2H 4YM9A 1KLJH 4NA8A 2ZF0H 1RJXB 5EQRA 3MO9A 2C4FH 1NN6A 2ODYB 1C1TA 3SUFA 3V7TA 3TITA 3RXGA 4NZQA 3BTKE 1D3DB 3RXAA 3P6ZB 1BQYA 3EA7A 1G30B 3S9CA 1BRUP 1FY4A 2YNAA 4DW2U 2Y5GA 1YP9A 2Z3EA 1QBOA 3KL6A 3AAVA 4K5ZA 2BY8X 2GKVE 4AG1A 3A7TA 1C5XB 1TX8A 3OX7U 2OXSA 3QTVH 5JB8S 3RXRA 2GMTC 3R0FA 6GCHG 5SGAE 3ATLA 1TLDA 1MCTA 5AVDA 3AAUA 1EB2A 5A0CA 1BMNH 1JRTA 1OSSA 3CS7A 4RN6A 2VVVA 4BTIB 5FAHA 1O2PA 5K0HA 4INKA 3RXCA 2WPLS 1J16A 5EW2H 2SGAA 2PGQB 1CHOG 1C2JA 2F9VA 3MNXA 3SBKA 1Y5BT 3ZVEA 1FY1A 2BX3A 1TMTH 1AHTH 4IMZA 4ABHA 1FIWA 1P04A 2OQUA 3KIDU 1QL7A 1V2VT 1IQLA 3RXPA 2SGEE 1QRZA 1TGBA 4NIXA 4FVDA 3RU4T 4WH8A 3FZDA 1NRRH 1GL0E 2F9PA 2ZCKP 1UTQA 1RFNA 4BXWA 3LJJA 1MTSA 1BMAA 4ZXXH 4NWLA 3QUMP 1BA8B 1JXPA 1ZYOA 4IBLH 1SHYA 2Q6DA 2JH5D 2XCFA 3HGNA 1WTHD 2ZTZA 3QZQA 1TNLA 1P02A 5TCCA 5JBBS 1SQTA 4X8VH 4ABIA 4MDSA 2WV5A 2GT8A 4K1EA 1P3EA 3I78A 1Z71A 3ODFA 3FVFB 1DS2E 5E0HA 4DGJA 3LDXH 1O5EH 3B23B 1FDPA 3UQVA 1BHXB 4BAMB 4ABAA 4O9VA 1A5HA 1Q31A 2OQ5A 4GCHG 2UWPA 1ELTA 4DCDA 2BY6X 2VVCA 1V2JT 1V3XA 1BCUH 3UIRA 5A2MH 2BLOA 3Q3XA 1ARCA 1GVZA 1LMWB 1ELDE 2JH6D 1EAXA 1A1RA 4FXGH 1ETTH 5FCRA 1O38A 1C9TA 2PFEA 2Q6GA 3T27A 2I6QA 1CQQA 1GI7B 4CH8B 3DHKH 2Q1JA 1BRBE 5DGJA 1DVAH 2WPMS 1FPHH 3RXKA 1S5SA 2OC0A 2H5CA 3SGQE 2C8XB 3OY5U 3SU6A 2VWNA 1TOCB 2FX6A 1XVOA 4X2VA 1P8VC 1BTWA 1WCZA 3MWIU 1P12E 3F6UH 1F0RA 4ASHA 1BBRH 4OS6A 2ZDNA 3PMJA 1QBNA 1O3PB 1YC0A 3DFJA 5TCAA 1UCYK 1WSSH 1ZSKA 2BDHA 4FUBA 4INLA 3ZVDA 2QYIA 1OWKA 4DG4A 1AB9C 2ZDVH 4DOQA 2H9EH 2ZFSA 5JPMH 2PHBA 2R9PA 1GHAG 2A4RA 1S85A 2ZPQA 1G3EA 1DM4B 2TIOA 5C3NA 3GCTG 1DY8A 1OWJA 4J1YA 3QO6A 2O8UA 1P10A 4CBNA 2RCEA 5CE1A 1BRCE 2C3SA 1C5LH 2D26C 3TGIE 4Y7AA 3OU0A 1TIOA 1KYNA 3A81A 4ISLA 4INHA 1LHCH 1SG8B 1EJAA 1O2GH 1S0RA 1GBDA 3PB1E 2EI6A 2YOLA 2FEQH 1FQ3A 3V12A 1IQIA 1CA8B 3K65B 5EQQA 2ZO3H 1VR1H 1UCYE 1EAIA 5ABWA 1GI9B 1L0ZA 3SJOA 3BTDE 1IQFA 1BTHH 2HNTC 2GX4A 3VB4A 2R3YA 4K1TA 2ANWA 1G3BA 2BDYA 1E34B 1ETSH 1EATA 1HIAA 1HIAB 2GDEH 4ISNA 1TRMA 3RXMA 1SLVB 3SV8A 1C5RA 1GGDB 2WYJA 5EPNA 3SO3A 1SR5C 1RXPA 2AYWA 5JYIA 2SGPE 1AFQC 3NUMA 1GBFA 3M61U 3DD2H 5DP4A 1NFYA 1NY22 3HKJB 3MH4A 3B9FH 2WPJS 3ZZ6A 4FUGA 2FOHA 2BD7A 4WWYA 1CGIE 1FI8A 1HJAB 3Q3YA 2BMGB 2JKHA 3ELAH 1EP5A 1H8IH 2ODQA 5AFZH 2GVFA 1DFPA 5HXFA 1XKAC 1V2NT 1NRSH 1O3NA 2FOAA 1GBIA 1GBEA 3TJUA 1DUEA 1KTTB 3BEIB 1IQNA 4TPIZ 3SI3H 1TMUH 2A5AA 4HGCA 1WBGB 3S69A 1TFXA 4B2CA 5L30H 4I32A 2Z3CA 1JIRA 5DPAA 4AN7A 2QA9E 4AGJA 4WXIA 4IC5A 3UNSA 4XE4A 3SNBA 5I46H 1X7AC 2W26A 1O3IA 1UK2A 3D49H 1GHVH 4IW4E 1P3CA 2FESH 2R0LA 3K6ZA 1AGJA 1ANEA 3RMNH 3BIVH 4X1NU 5I25A 1UCYH 2PTCE 3M35A 4UONA 2FOBA 3KQCA 2OP9A 3N7OA 3IG6B 4IN1A 1XUHA 4X2XA 1YCPK 1P06A 5FPSA 4ZHAA 2JETC 1RRKA 3K9XB 2ZP0H 1PJPA 4X1SU 3AASA 1E0FD 3PO1B 1T8LA 1GBJA 4NCYA 5E0JA 5TJXA 4ABFA 3URCA 3HK3B 1E37B 1T8NA 3U1IB 2PGBB 1CGHA 1VITH 3UY9A 3O8RA 1CHGA 2TGAA 1C1NA 1ZRKA 5FCKA 2V3HH 4ZUHA 2ILNA 2A4OA 1HPGA 1PPBH 3ZV9A 4X2WA 3MFJA 3MU4A 3EDXB 4BANB 1VGCC 2OCVB 2VGCB 1MKWK 1QURH 3T29A 2J2UA 2C90B 3IITA 2OD3B 1CT0E 1BRAA 2ZDLA 3M7UA 1B5GH 2VINA 1O2LA 1CO7E 1DITH 2XBWA 3BF6H 1GI5A 2QCYA 2CGAA 1A61H 1YF4A 1SGCA 1Z8JB 2ZDMA 3QGJA 1GPZA 4UFGH 7GCHF 3GY4A 3UREA 3ZZBA 1MQ5A 1QL9A 2QXJA 4ABEA 4MNYA 5C1XA 3P92A 4H6TA 2QXGA 1TGNA 1YPMH 3Q77A 3FP6E 1GHBF 1AUJA 1SGRE 2ZGCA 4KKDA 3AVZA 3TGKE 3GCOA 4FUEA 1VZQH 3TLOA 5AFYH 1C5SA 4CRGA 1J8AA 1DXPA 1O2OA 3Q76A 3AW1A 1MH0A 2R2WU 9ESTA 1W7XH 4IGDA 1Y3WA 2ZPSA 3M37A 2VIPA 3VB7A 5C1YA 2XTTB 1CGJE 1NRPH 2VVUA 2GTBA 3ZZ8A 1AVGH 1DWEH 4B2AA 4GHTA 3RXFA 1O2SA 4OGYA 1MAYA 4Y11E 2Z9LA 1Y8TA 1CA0C 3PMHB 4VGCC 2A7JA 1HCGA 1GDNA 4YLUA 3NPSA 4KP0A 1S82A 1ZGVA 4Y0YE 1Y3YA 1W14U 2XWBI 2I6SA 1ELCA 1ZPCA 1NPMA 3FFGA 3RU4E 1TE0A 2IJOB 1P0SH 5FPYA 3D65E 2PUQH 2XBYA 4YOIA 2ANKH 4GLYA 3SHAH 4HI3A 2BD3A 1HAIH 1ID5H 1CSOE 1O5BB 1KSNA 2BD4A 3E0NB 1Y59T 5LPFA 4O03A 1QFKH 3HATH 2FP7B 3MNBA 5DK1A 1C2MA 4KGAA 1GBMA 4Q7YA 1L2EA 1ACBE 5JB9S 4B74A 8ESTE 1ORFA 1GI2A 3BG4C 3LGUA 4NA7A 1ZZZA 4X6OA 4XFQA 1EPTC 1HGTH 1L4ZA 3SU1A 1L1JA 3RXTA 2QF0A 4HZHA 1E36B 2A2QH 1UMAH 1YCPH 1ZTKA 3BG4B 1K1MA 3KGPA 1C5TA 1OYQA 1S81A 1TALA 2BQWB 4FU8A 2UUYA 2NWNA 4NIYA 2PV9B 5FBIA 3A7XA 1SGEE 1AO5A 1LKAA 2W7UA 1C2FA 2GGVB 2Z94A 3LOXA 1A0HB 2GD4B 3RUOA 1K9OE 1PQAA 1O3HA 3U98H 1MKWH 3OTJE 1BTXA 1PYTD 4X8TH 5DKMA 1LVOA 1TA6A 5JDUB 3A84A 1IQGA 3VXFH 1B7XB 4A1TA 1ZSLA 1EZQA 2H9TH 3ZVAA 1O3AA 4X2YA 3DFLA 3SI4H 4CRBA 3M36A 1MU8B 3EGKH 5C5OA 4H42U 1ELVA 1INCA 1DLKB 1C2GA 1W3CA 1MU6B 2STBE 3CS0A 4NG9H 1ZPZA 2BHGA 1J9CH 1UTKA 4ZXYH 3LONA 4WMFA 2DE9A 5AF9H 3BIUH 3ENSB 3SJKA 1KLTA 3B8JA 1HV7A 2YNBA 3K6YA 4E7NA 5PTPA 5H4IB 1HAVA 4OGXA 3TNTA 2FMJA 3LH1A 1GG6B 1SGNE 1MD8A 1DT2A 1BTPA 1BUIA 1YLDA 1TNKA 1AMHA 1EOJA 2ZNKH 4GPGA 4E7RG 1C2KA 2BQ7B 3MMGA 2BDAA 4U32A 1QB9A 2V6NA 3A88A 3LPRA 3EAJA 1TBRH 1THSH 2ZU2A 2OLGA 1PPCE 2BTCE 2Y7ZA 3TJOA 2HALA 1GJ8B 4FUCA 3BTFE 1GHZA 3A82A 1TA2A 4BAQB 4CRFA 2ZHQH 5E8EH 3ATWA 2R3UA 6ESTA 1EZUC 3TNSA 1JIMA 3NK8A 4AORA 1AE5A 3R3GB 1NU9A 2XYAA 3ATMA 2FLBH 3SNDA 3LGWA 1IQMA 4JYTA 1HAZB 4UDWH 3SU5A 1SOTA 3KNXA 1V6DA 2FI3E 1O2UA 3GCNA 5DP8A 3F9FA 1MD7A 3ZZ3A 1FV9A 1DE7H 4LOYH 3GY2A 2ZG0H 1QRXA 4OS4A 1LVYA 1HAXB 5DP9A 2FPZA 3SW2B 1K1PA 3SNEA 1NU7B 1DWBH 2OUAA 3KEEA 5F8XA 1BBRK 3GISB 4AB9A 4XBDA 1QNJA 1XUKA 3TH4H 3S7HB 3NKKA 1Z7KA 3E1XB 4Y76A 3PTBA 3GICB 2W7SA 4X8SH 1ZPBA 2ZTYA 2O8WA 1YPHC 1BITA 3VPKA 1O30A 3DT0H 4WMEA 1GVLA 3SGAE 3M7TA 3LH3A 4DVAU 2GMTB 1P2MA 5JBTA 2FLRH 4YESB 1QBVH 2VH6A 3BTGE 5EXMA 1QL8A 4UFFH 2GCTC 3GY8A 5EXNA 4MVNA 1QQUA 3QLPH 1ZMLA 1C5MD 2BD5A 1LQDB 3H5CB 2F9OA 3LC3A 1OXGA 5GIBA 1LPKB 1N6XA 1AFEH 1PPGE 2XC0A 2BY7X 2GCTB 1OP2A 1OP8A 3BTME 1ZJDA 1GMCG 2ANMH 3ZZ4A 1BBRE 1W11U 1H9LB 1F92A 4Y79A 3KHVA 4NSYA 1JWTA 2HNTE 2LNCA 1HAYB 1H4WA 3S7KB 1Z8IB 1ETRH 3V3MA 2HRVA 3NCLA 1Q2WA 2OC8A 2BDGA 3U8OH 2Z9IA 2RG3A 1EUFA 2EI8A 2XC4A 2OBOA 1EJMA 2FX4A 3I77A 1K22H 1JRSA 2B9LA 1ELAA 3BN9A 1GBKA 2OTVA 3ZZ9A 4D7FA 1P9SA 2EEKA 5J4SA 1O2JA 4AX9H 3RXDA 2ZC9H 1IQEA 7GCHG 2CMYA 1TBQH 1HAOH 3T26A 3KF2A 1EAWA 2AGEX 1SQOA 1BIOA 1GHBG 3M7QA 4Y7BA 3SU4A 1O36A 3M3SA 4F49A 1BTUA 1O3BA 2C8WB 3SJIA 2BY9X 1QRWA 2NU3E 3RLYH 3EQ0H 3VFEA 3A89A 2WYGA 1LVMA 2A2XH 1EKBB 4OS2A 2ZDAH 2ZEBA 2PWXA 1T8MA 1TAWA 1TQ7B 4QT8C 4BAKB 4K8BA 1V2QT 3MH7A 1O0DH 2ZA5A 2J92A 1P01A 1YM0A 2BOHB 2ZECA 1LPZB 1W13U 3RMLH 4E06H 5A09A 2ZFFH 4CR9A 1GBAA 3OY6U 2ZWLH 1CT2E 3E0PB 1DDJA 3GYLB 3M3VA 2GZ9A 4NFEA 2FWWA 3QZRA 5F8ZA 2ZHEH 4I8HA 2GDDA 3MH6A 3RXVA 4LZ1H 3W95A 1GBHA 2GCHF 3NXPA 2UUKB 3ZZ7A 1AUTC 1ELGA 4DURA 1HAGE 2G81E 2B7DH 2A7CA 1G37A 4CR5A 2G51A 3E16B 1DXWA 5ETXA 4D8NA 2D8WA 1C1PA 1SFQB 2VH0A 1C2HA 2G52A 3S9BA 1IQHA 2ZGHA 4WJG2 2QAAA 4AZ2B 5EU8A 1ZGIA 1AB9B 2D1JA 2Z9GA 1MKXK 3OSYA 3FP7E 1G36A 1O3EA 5A8ZA 1O33A 1A2CH 1GVKB 2FODA 2KAIA 3TJNA 1C1OA 4A1XA 1BTZA 1T31A 8KME2 2AMQA 2HVXA 2KAIB 1OKXA 2ZKSA 1HRTH 1UVSH 1NTPA 1A0LA 1MZDA 1O37A 1FZZA 1O35A 2XNIA 1BZXE 1DPOA 5HM9A 4B1TA 2AMDA 3E3TA 3Q3KA 1SPJA 2QIQA 2ZCHP 1L1NA 3SQEE 5AHGH 4NIVA 5GDSH 2ZU1A 3MOCA 4AFZA 2WPKS 5E0GA 3SUEA 2O8LA 1DUAA 2EA3A 4FUFA 1ELBA 3QX5H 1O2WA 2A32A 1W0ZU 2J95A 2VNTA 3QWCH 2BVRH 1DLEA 3MH5A 2J4IA 1F0UA 1B0FA 1A3EH 1MMJN 2A5IA 5DG6A 1SB1H 5DP3A 4FUJA 2VIDA 2ALVA 1QJ1B 2Z3DA 2C8YB 3IWMA 4YOJA 2GV6A 3MU5A 2Y7XA 1THPB 1FMGA 4O97A 1HYLA 1AVWA 3LGTA 1CU1A 5FXLA 1O39A 4ZROA 3VB3A 3VGCC 4ZAEA 3SORA 1BDAA 4ABGA 5EQSA 1UTLM 4OS5A 4WF8A 5T6DA 4H4FA 1GI0A 2A5KA 4K3JA 2P59A 1AFQB 3VGCB 2ANYA 2ZCLP 1QY6A 2FS9A 1ELFA 4K2YA 1W10U 1VJAU 1P57B 2XXLA 2W3IA 4BTUB 4NZLA 3F1SB 3EE0B 2PUXB 1FNIA 5L2YH 3A7ZA 2G4TA 2SFAA 3A8BA 1C4V2 2VIVA 1NROH 1T4VH 2CHAC 1TMBH 5GXPA 3ZVFA 5FHTA 1C4Y2 1QTFA 1C5WB 4XDEA 1FY5A 1M9UA 2HPPH 1HBTH 3RXIA 4ISHH 1QB1A 1P09A 1IAUA 4Y10E 3GCHC 2ZFQH 1O5GH 3A8CA 2XRCA 5JBAS 4TY7A 2VWOA 1DX5M 5A0BA 2ZQ2A 2F83A 2J9NA 5GCHF 1NESE 1J17T 2TRMA 3TK9A 4JZFH 2BYAX 1Y3XA 1PQ5A 2HGTH 3RMMH 3STJA 2ZU3A 4SGBE 1YKTA 1WU1A 2ZHWH 1K1NA 1Q3XA 4SGAE 1T32A 3RXSA 3AW0A 1P2JA 1O2KA 4DJZB 1GI1A 1TPOA 1DOJA 1NRQH 1WTGH 3ZZCA 2BX4A 2XC5A 1K2I1 1FJSA 2DUCA 1MKXH 1CHOF 4E05H 2WUBA 1DICA 1C5YB 3MYWA 1C5UA 2SNVA 2JETB 5LPRA 2J94A 3SUGA 1BHXF 4TYDA 3FAOA 4IC6A 2F91A 3U69H 1IQJA 2BQ6B 5A0AE 1YBWA 1NO9H 3O8BA 2J34A 1NC6A 1QA0A 4YT7H 2VIQA 4MNVA 3E90B 4HFPB 4Z6AH 1FXYA 4X6MA 3ZYEA 1SFIA 1G2MA 1H1BA 1C5VA 1VGCB 4MNWA 1ESBA 3SV2H 1WV7H 4LK4A 4ESTE 2NU0E 3T28A 3K2UA 1OS8A 2QXIA 3A87A 4TWYA 3LU9B 2ESTE 4UEHH 3VB5A 1KXEA 5IYTA 1V2MT 4B71A 1ELEE 1GJBB 3GY3A 4A7IB 3LIWA 1RD3B 2P3FH 1DANH 1GJDB 2NU4E 4BTTB 1ZMJA 5HMAA 1GDQA 2ZDKA 3H7TA 1O2NA 2BB4A 1GBBA 1HJ9A 4MLFB 1WYKA 1QQ4A 2ZGXH 1O5CB 2PKAA 3GY6A 5C2ZA 1QA7A 2P95A 2PKAB 1RGQA 1MZAA 5F6MA 1L4DA 3V0XA 4GCHF 1SL3A 1F5RA 1EXFA 3P95A 1PYTC 1VCWA 3D62A 4BNRA 1RIWC 3A8DA 1D6WA 1KXCA 3RXOA 1OWIA 1JBUH 2GP9B 1J14A 3PMAB 3TIUA 2LPRA 4B2BA 2ZU4A 2OC1A 1SGTA 1QHRB 2VIWA 1P11E 2CN0H 4CHAC 1RIWB 3JZ2B 1F0SA 1UVTH 4IMQA 5B6OA 1GI6A 1OWHA 4DY7B 1PPFE 4AB8A 1SVPA 3UWIA 1V2KT 1GHYH 1H9HE 2P8OC 1THRH 4X0WU 3SQHE 5T6FA 4AG2A 1SLXB 1CA0B 3LKWA 3ATIA 1KXDA 3LGIA 2A4GA 1YPLH 2Y5HA 2A1DB 2WUCA 4VGCB 1N8OC 1TGSZ 1ZTLA 3KN2A 2J38A 3L6PA 4X6PA 4Y8ZA 1LHGH 2VWLA 5GJ4B 4Y6DA 3M5NA 1N8OB 2B0FA 1PPHE 2WV4A 1SLUB 4GHQA 2OC7A 3ZVBA 2Y6TA 2R0KA 1BMLA 1FN6A 3OYPA 1XXDA 1AZZA 1A7SA 2BD2A 1O3GA 4AYVB 4GVUA 3PV4A 3TGJE 1G32B 3M5LA 3A7YA 1GWAA 1TB6H 3O8DA 1VCQA 4XOJA 1ZR0A 1QGFA 4I8KA 4AFQA 3CP7A 1EPTA 3T62A 4X6NA 2CV3A 1SGPE 1EPTB 2P3UB 3MNCA 3GOVB 1YPHE 3P8FA 4MG3A 1KY9A 1AVXA 5CMXH 2HPQH 4YO9A 1HJ8A 1SGQE 1D6RA 1OX1A 1P9UA 3SOSA 3RP2A 1O3OA 3EYDA 1GBLA 2ZQ1A 4OS7A 3URDA 2ZGBH 1W12U 3BTTE 1EJNA 1Z1IA 1K28D 5JBCS 3HK6B 1KLIH 2GCHG 2FTLE 1O3KA 1O5FH 1GI4A 1JMOH 2G4UA 2NU1E 2QXHA 1TNGA 1SHHB 1KIGH 5DP7A 1KDQA 3GY7A 1O3JA 3RC5A 1D3TB 1KDQB 3FP8E 5C67A 2QGRA 4R0IA 1QCPA 1T8OA 3SNCA 1A4WH 1BMMH 2AIQA 1ARBA 4RKOB 4MPVA 3U8RH 1O3LA 4M7GA 2FOCA 1UK4A 4ZHLU 1ESTA 3VEQB 1D3QB 3GDSA 3SV9A 5T6GA 4CRDA 1AN1E 1HB0B 5ESBA 4B75A 2UUJB 2AGGX 4I8GA 2FIRH 1AI8H 1SQAA 2FM2A 5EW1H 1D9IA 1NM6A 3ZZDA 1Z8RA 1RTFB 4PROA 1IHSH 1TNHA 4B76A 2B5TB 5HM2A 3T25A 2BXUH 3E91A 2ZIQH 1XVMA 3A85A 4MPWA 2BZ6H 3SZNA 1TOMH 3MI4A 1GJ7B 5C5NA 1AU8A 3QK1A 4X1PU 1EP6A 1TWXB 3BSQA 3SGBE 4ABDA 6CHAC 1Z8GA 1XM1A 1YGCH 1ZMNA 1U6QA 3ODDA 1ZJKA 1O2MA 1O2XA 3SV6A 3RXUA 2ZFTA 3MNSA 1XUGA 2BZAA 4KTSA 2FS8A 6CHAB 4Y71A 1KXBA 1TX7A 2AFQB 2TGDA 2BDBA 2TGPZ 3RXLA 8GCHF 2VWMA 3QN7A 3V13A 1MTUA 1YPEH 2OBQA 3U9AH 3MU0A 4WMDA 1ZLRA 1YPGH 2W3KA 2RDLA 2BLWA 1HXEH 7KMEH 1O2QA 1LTOA 1UJ1A 1W8BH 3A86A 2Y82A 4JZ1A 3ZYDA 3RXEA 4WXVA 1E38B 5FPTA 1W0YH 5HGGA 1AY6H 3FANA 2BLQA 3BV9B 4O3UA 2K1QA 2ZHDA 1ZOMA 1O32A 3SJ8A 2W5EA 4MNXA 2BOKA 1RS0A 1QB6A 1NFXA 4KTCA 1GJ9B 1YLCA 1EZSC 4KTUA 3GDVA 1A0JA 2XWAA 3BTWE 2AGIX 2AH4X 1G2LA 5EXLA 1C2DA 1GCTC 1QIXB 2V3OH 2UWOA 4TPYA 1A5IA 4CRAA 1FLEE 5GCHG 1VITF 4FU7A 1CVWH 1PPZA 5HYOA 2VIOA 4ISIH 4I33A 1GCTB 1E35B 4JK5A 1GMDF 1PQ7A 4Y8YA 4FUHA 1F5KU 1J15A 2WPIS 4YOGA 7LPRA 3UR6A 4K60A 4A1VA 4B73A 1TGTA 1G9IE 4NWKA 1Z6EA 5A8XA 1V2PT 3ZVGA 1W7GH 1XUFA 3PLPA 1OP0A 1PPEE 5E2PA 1HNEE 3VXEH 3P8GA 3UUZA 4ABBA 3I29A 4X1QU 5G4BA 2XW9A 4YT6H 1AQ7A 1O34A 3RC6A 1LHFH 3C1KA 3GY5A 3QTOH 1AE8H 4UFDH 1UTPA 1UTMA 3UFAA 3E6PH 2XCNA 4J2YB 4XBCA 3P17H 2STAE 2ALPA 1FAXA 1C5OH 1S84A 1DSTA 4JZEH 3ZZAA 5E2OA 5BPEA 1GHWH 1UVPA 1W2KH 3PYHA 1MBMA 2PKSC 3RU4D 1S6HA 4Y8XA 4WH6A 4MQAA 3TK5A 1N1LA 2Z6BD 2A0QB 2Y80A 2Q6FA 2PKSB 1ZTJA 2PR3A 1EOLA 1DY9A 3ITIA 1O2ZA 3HGPA 3SHCH 5FBEA 3P8OA 3PLBA 4JK6A 3F9GA 3NWUA 4X1RU 2QN5T 4I31A 1GI3A 1TPAE 3T2NA 3DUXH 3ATKA 2BD8A 3UNQA 2XBXA 2ASUB 4A5TS 3QDZB 2V35A 1H9IE 1LO6A 3SU3A 2G8TA 1UTOA 3MU8A 2CXVA 4JMYA 1WQVH 1Y5AT 2XBVA 4UE7H 2PSYA 3BTHE 3RM0H 1OYTH 1Z1JA 2ZHFH 4F4OC 2P16A 1C1RA 3PTNA 3BTEE 4DIIH 1AWFH 1YPKH 2G5VA 4JZIA 4BAHB 4XBBA 3KQBA 1ZRBA 2IPHA 1FONA 2ZPRA 3S9AA 2P3TB 2QV1A 3LT3A 3M5MA 4AFUA 1O2RA 1TNJA 2BDCA 2O8MA 2ZTXA 4MPXA 1UK3A 1XXFA 3P8NA 1P2NA 1MAXA 4I8JA 2Y81A 2CF9H 4BAOB 3SUDA 1Y3VA 1AD8H 1NS3A 1SBWA 1SGYE 2O9QA 1LDTT 1P05A 4YZUA 1TX6A 1DSUA 3UOPA 2ZU5A 1UTNA 1YYY1 1SI5H 3RDZA 3RXHA 1HAPH 4NSVA 2F3CE 1C5QA 4FUIA 3D23A 1C1QA 1SMFE 2VU8E 3U8TH 1C9PA 1CE5A 4D7GA 2GT7A 5EOKA 3BEFB 2GZ7A 1BJVA 3RLWH 1IQKA 1ESAA 4Y0ZE 1C1SA 1O2TA 1TGCA 2F9BH 3FZZA 1D4PB 4FUDA 3BG8A 3F9HA 3M5OA 4D9QA 1AWHB 1GJCB 2B8OH 4CH2B 1GJ6A 1HDTH 1HUTH 1DWDH 2FDAA 3STIA 2TPIZ 4A92A 1SGDE 2G55A 3BTQE 2BY5X 4K1SA 4YLQH 7ESTE 2H9HA 1RTLA 1MTWA 9LPRA 4ZHMU 8LPRA 1GGDC 1XKBC 2CF8H 2FOEA 2AERH 4XSKU 1NZQH 1TNIA 4JZDH 5LPEA 1FIZA 5LGOA 1C2LA 4BOHA 4JYVH 6LPRA 1EAUA 4IN2A 2PSXA 1BT7A 3SU0A 3MO3A 1RTKA 1O3CA 1GMHF 1O2VA 3PROA 4Q2KA 4K69A 3EA8A 1HJAC 3DA9B 2FI5E 1SOZA 1V2ST 2M5TA 1GBCA 2H6MA 1C1MA 1OWDA 2H5DA 4FU9A 5C20A 1V2RT 3SNAA 3MTYA 2FYRA 1AKSA 1KXFA 1AKSB 1SSXA 4MTBA 2EC9H 3WY8A 1TABE 2CHAB 1ABJH 1KTSB 1WUNH 3UR9A 2A45B 1PFXC 2FOGA 4Q7XA 2A4QA 2G5NA 1UVOA 3U1JB 3KQDA 3F68H 3UWJH 1B0EA 2P94A 1P2KA 1HFDA 2GV7A 1GJAB 4CREA 3LJOA 1CBWC 4A6LA 5EGMA 3GCHB 3SJ9A 1K1IA 6GCHF 1LPGB 2BLVA 5J4QA 4LXBH 1YPJH 1Y3UA 5ESTE 1ABIH 1K1LA 4RKJB 3S0NA 2JH0D 1CBWB 1DWCH 3GYMA 3PWCA 4AGKA 4WY3A 1A3BH 2UWLA 8GCHG 1IHTH 1OOKB 2NU2E 1CT4E 4OS1A 1GI8B 2AMPA 2AIPA 4IS5A 2BXTH 2IOTA 1V2TT 1S0QA 3UTUH 1TQ0B 2D2DA 4CBOA 3RC4A 2QY0B 1VCPA 2Z9KA 4THNH 1P2OA 3UOUA 1GMCF 3PO1C 4HTCH 1UO6A 2Y5FA 1TPPA 1LQEA 2BD9A 3SN8A 3ZV8A 2PTNA 1LHDH 1O2IA 3ZVCA 3A7WA 2P93A 2VB0A 1SGFG 2SNWA 1Z6JH 3PLKA 5F03A 1S6FA 1QJ6B 1BOQA 2BM2A 1AZ8A 1SGIB 2VGCC 2VJ1A 1HLTH 3UPEA 4FVBA 5FX6A 5L6NH 1G3DA 2C93B 3QGNB 5IDKA 1HAHH 1UVUH 3HKIB 2H1UA 2UUFB 1GHXH 2HLCA 4K8YA 3RMOH 1VITG 1YCPM 1GDUA 1FY3A 4I7YH 1XX9A 1UHBA 1TYNA 1UHBB 3M3TA 1GMDG 1G3CA 1NFWA 1WOFA 3F9EA 3LC5A 1K1OA 4ABJA 1GCDA 4TY6A 1BTYA 1ZHPA 3RXQA 4Q7ZA 3HPTB 3TH3H 1NRNH 2OINA 1L1GA 4Q80A 4UD9H 2A31A 1ANBA 1FY8E 2H2ZA 3P70B 1C2EA 3UNRA 4U2WA 3TK6A 1MCVA 1O3DA 1F7ZA 1SGFA 2HOBA 3MO6A 1TBZH 4H6SB 4I8LA 5T3HA 1IOEA 4CRCA 4NA9H 1LCYA 5EPYA 1V2OT 3EA9A 1A5GH 5L2ZH 3JZ1B 2BVSH 4ZKOU 1GJ5H 1Y5UT 5A8YA 3E8LA 1GL1A 4CHAB 1O2YA 2RA3A 5BRRE 2SGFE 2QC2A 2G00A 1BB0B 5FX5A 3C27B 2P8OB 5EODA 2Z7FE 1XUJA 3T5FH 3SV7A 3SU2A 1O2HA 1O3FA 1S83A 1MQ6A 1T7CA 3A83A 2A7HA 1FPCH 1BJUA 3PWBA 1SLWB 4D76A 2FYQA 1K21H 2SGDE 1HXFH 1LVBA 2Z9JA 1PQ8A 4U01A 1GHAF 1TONA 5CHAC 2WPHS 3GCTF 2HNTF 1P03A 2FZZA 4UFEH 1O5DH 1AIXH 4NGAH 2EI7A 5GWZA 1ANDA 5F8TA 2FO9A 5CHAB 4AYYB 5DP6A 1FUJA 2PW8H 4Z0KA 2DE8A 1A46H 2FXRA 3L3TA 4YTAA 3W94A 1C1VH 5C1UA 2GZ8A 1WQSA 3RXJA 2IN2A 5EG4A 1GJ4H 3PMBB 1QR3E 1KXAA 1O5AB 1LHEH 3KQEA 1TRYA 4R8TB 4TWWA 3ZZ5A 2C8ZB 4X8UH 1F0TA 4NFFA 2SGQE 5GPIB 1EX3A 2AS9A 1SC8U 1V2LT 3LGVA 3BEUA 3NZIA 1VJ9U 1XMNB 1MTVA 4JCNA 1O31A 1EB1H 2QF3A 2TBSA 5DO4H 3LGYA 4ZKSU 3UQOA 3G01A 4ZMAH 1TPSA 1NFUA 2PLXA 3PM3A 4RSPA 2RA0A 2V0BA 4U30A 2ODPA 1TRNA 1OWEA 4KELA 1C5PA 1K1JA 1F2SE 4ZH8A 2WINI 3A7VA 3MU1A 2TGTA 1C2IA 2BVXH 2THFB 1EQ9A 3ESTA 4BXSA 2ZGJA 3H7OA 2BDIA
chains in the Genus database with same CATH superfamily
2FOMB 1C1UH 1D3PB 3MHWU 1FAKH 1ZHRA 4NIWA 3TJVA 2CJIA 2FI4E 3TVJB 3VB6A 4DIHH 5LH8A 4O3TA 4MPUA 2FTMA 1V2UT 1GBTA 2ZFPH 1GG6C 1MBQA 1T4UH 4DT7B 1P2QA 2R2MB 2ZFRH 3PRDA 4GAWA 1C5ZB 1OPHB 1ZSJA 1UTJA 1XUIA 1C5NH 4ZKRU 4LZ4B 1O3MA 2ZZUH 1HAVB 1MUEB 2L6OA 3TU7H 2FOFA 2F9UA 3F0OA 1QJ7B 1N6YA 4AFSA 4ISOA 5K7RA 1LKBA 1WAYB 3TPIZ 4GUXA 3UB0A 4P00A 1SKYE 1V2WT 2F9NA 1JOUB 1MTNC 1ANCA 3A8AA 4WVPE 1EASA 1ZHMA 2WHXA 3KCGH 3N7EA 3A80A 2HWLB 3L33A 3RM2H 4JYUH 4AOQA 5DJ7A 2AEIH 1C4U2 3U28C 2ULLA 1MTNB 4GSOA 3TH2H 1H8DH 3Q00A 1QZ8A 1F5LA 1NT1A 1P2IA 3GDUA 3CENA 1GMHG 1C1WH 4D9RA 2O8TA 1FN8A 1EZXC 3RXBA 5DP5A 3O8CA 4ZKNU 2ZI2H 4YM9A 1KLJH 4NA8A 2ZF0H 1RJXB 5EQRA 3MO9A 2C4FH 1NN6A 2ODYB 1C1TA 3SUFA 3V7TA 3TITA 1NBMD 3RXGA 4NZQA 3BTKE 1D3DB 3RXAA 3P6ZB 1BQYA 3EA7A 1G30B 3S9CA 1BRUP 1FY4A 2KCPA 2YNAA 4DW2U 2Y5GA 1YP9A 1YLNA 2Z3EA 1QBOA 3KL6A 3AAVA 4K5ZA 2BY8X 2GKVE 4RT1A 4AG1A 3A7TA 1C5XB 4F48B 1TX8A 3OX7U 2OXSA 3QTVH 5JB8S 3RXRA 2GMTC 3R0FA 6GCHG 5SGAE 3ATLA 1TLDA 1MCTA 5AVDA 5B6LA 3AAUA 1EB2A 5A0CA 1BMNH 1JRTA 1OSSA 3CS7A 4RN6A 5KGOA 2VVVA 4BTIB 5FAHA 1O2PA 5K0HA 4INKA 3RXCA 2WPLS 1J16A 5EW2H 2SGAA 2PGQB 1CHOG 1C2JA 2F9VA 3MNXA 3SBKA 2J5UA 1Y5BT 5CDFE 3ZVEA 1FY1A 2BX3A 3H09A 1TMTH 5IK2D 1AHTH 4IMZA 4ABHA 1FIWA 1P04A 2OQUA 3KIDU 2KR7A 1QL7A 1V2VT 1IQLA 3RXPA 2SGEE 1QRZA 1TGBA 4NIXA 4FVDA 3RU4T 4WH8A 3FZDA 1NRRH 1GL0E 2F9PA 2ZCKP 1UTQA 1RFNA 4BXWA 3LJJA 1MTSA 1BMAA 4ZXXH 4NWLA 3QUMP 1BA8B 1JXPA 1ZYOA 4IBLH 1SHYA 2Q6DA 2JH5D 2XCFA 3HGNA 1WTHD 2ZTZA 3QZQA 4Z1MD 1TNLA 1P02A 2L74A 5TCCA 5JBBS 1SQTA 4X8VH 4ABIA 4MDSA 2WV5A 2GT8A 4K1EA 1P3EA 3I78A 1Z71A 3ODFA 3FVFB 1DS2E 5E0HA 4DGJA 3LDXH 1O5EH 3B23B 1FDPA 3UQVA 1BHXB 4BAMB 4ABAA 4O9VA 1A5HA 1Q31A 2OQ5A 4GCHG 2UWPA 1ELTA 4DCDA 2BY6X 2VVCA 1V2JT 1V3XA 1BCUH 3UIRA 5A2MH 2BLOA 3Q3XA 1ARCA 1GVZA 1LMWB 1ELDE 2JH6D 1EAXA 1A1RA 4FXGH 1ETTH 5FCRA 1O38A 1C9TA 2PFEA 2Q6GA 3T27A 2I6QA 1CQQA 2WZQA 1GI7B 5EIYA 4CH8B 3DHKH 2Q1JA 1BRBE 5DGJA 3WWBA 1DVAH 2WPMS 2GJGA 1FPHH 3RXKA 1S5SA 2OC0A 2H5CA 3SGQE 2C8XB 3OY5U 3SU6A 2VWNA 1TOCB 2FX6A 1XVOA 4X2VA 1P8VC 1BTWA 1WCZA 3MWIU 1P12E 3F6UH 1F0RA 4ASHA 1BBRH 4OS6A 2ZDNA 3PMJA 1QBNA 1O3PB 1YC0A 3DFJA 5TCAA 1UCYK 1WSSH 1ZSKA 2BDHA 4FUBA 4INLA 3ZVDA 2QYIA 1OWKA 4DG4A 1AB9C 2ZDVH 4DOQA 2H9EH 2ZFSA 5JPMH 2PHBA 2R9PA 1GHAG 2A4RA 1S85A 2ZPQA 1G3EA 1DM4B 2TIOA 5C3NA 3GCTG 1DY8A 1OWJA 4J1YA 3QO6A 2O8UA 1P10A 4CBNA 2RCEA 5CE1A 1BRCE 2C3SA 1C5LH 2D26C 3TGIE 4Y7AA 3OU0A 1TIOA 1KYNA 3A81A 4ISLA 4INHA 1LHCH 1SG8B 1EJAA 1O2GH 4AC9A 2YMSB 1S0RA 1GBDA 3PB1E 2EI6A 2YOLA 2FEQH 1FQ3A 4RT0A 3V12A 3FN8A 1IQIA 1CA8B 3K65B 5EQQA 5HIYA 2ZO3H 1VR1H 1UCYE 1EAIA 5ABWA 1GI9B 1L0ZA 3SJOA 3BTDE 1IQFA 1BTHH 2HNTC 2GX4A 3VB4A 2R3YA 4K1TA 2ANWA 1G3BA 2BDYA 1E34B 1ETSH 1EATA 1HIAA 1HIAB 2GDEH 4ISNA 1TRMA 3RXMA 1SLVB 3SV8A 1C5RA 1GGDB 2WYJA 5EPNA 3SO3A 1SR5C 1RXPA 2AYWA 5JYIA 2SGPE 1AFQC 3NUMA 2HVYB 1GBFA 3M61U 3DD2H 5DP4A 1NFYA 1NY22 3HKJB 3MH4A 3B9FH 2WPJS 3ZZ6A 4FUGA 2FOHA 2BD7A 4WWYA 1CGIE 1FI8A 1HJAB 3Q3YA 2BMGB 3OEHD 2JKHA 3ELAH 1EP5A 1H8IH 2JJ2D 2ODQA 5AFZH 2GVFA 1DFPA 5HXFA 1XKAC 1V2NT 1NRSH 1O3NA 2QF5A 2FOAA 1GBIA 1GBEA 3TJUA 1DUEA 3DSOA 1KTTB 3BEIB 1IQNA 4TPIZ 3SI3H 1TMUH 2A5AA 4HGCA 1WBGB 3S69A 1TFXA 4B2CA 5L30H 4I32A 2Z3CA 1JIRA 5DPAA 4AN7A 2QA9E 4AGJA 4WXIA 4IC5A 3UNSA 4XE4A 3SNBA 5I46H 1X7AC 2W26A 1O3IA 1UK2A 3D49H 1GHVH 4IW4E 1P3CA 2FESH 2R0LA 4FETA 3K6ZA 5FL7D 1AGJA 1ANEA 3RMNH 3BIVH 4X1NU 5I25A 3CNRA 1UCYH 2PTCE 3M35A 4UONA 2FOBA 3KQCA 2OP9A 3N7OA 3IG6B 4IN1A 1XUHA 4X2XA 1YCPK 1P06A 5FPSA 4ZHAA 2JETC 1RRKA 3K9XB 2ZP0H 3F2FA 1PJPA 4X1SU 3AASA 1E0FD 3PO1B 1T8LA 1GBJA 4NCYA 5E0JA 5TJXA 4ABFA 3URCA 3HK3B 1E37B 1T8NA 3U1IB 2PGBB 1YY3A 1CGHA 1VITH 5EJLA 3UY9A 1CHGA 2TGAA 3O8RA 1C1NA 1ZRKA 5FCKA 2V3HH 4ZUHA 2ILNA 2A4OA 1HPGA 1PPBH 3ZV9A 4X2WA 3MFJA 3MU4A 3EDXB 4BANB 1VGCC 2OCVB 2VGCB 1MKWK 1QURH 3T29A 2J2UA 2C90B 3IITA 2OD3B 1CT0E 1BRAA 2ZDLA 3M7UA 1B5GH 2VINA 1O2LA 1CO7E 1DITH 2XBWA 3BF6H 1GI5A 2QCYA 2CGAA 1A61H 1YF4A 1SGCA 1Z8JB 2ZDMA 3QGJA 1GPZA 4UFGH 7GCHF 3GY4A 3UREA 3ZZBA 1MQ5A 1QL9A 2QXJA 3OEED 4ABEA 4MNYA 5C1XA 3P92A 4H6TA 2QXGA 1TGNA 1YPMH 3Q77A 3FP6E 1GHBF 1AUJA 1SGRE 2ZGCA 4KKDA 3AVZA 4ZCNA 3TGKE 3GCOA 4FUEA 1VZQH 3TLOA 5AFYH 1C5SA 4CRGA 1J8AA 1DXPA 1O2OA 3Q76A 3AW1A 1MH0A 2R2WU 9ESTA 1W7XH 4IGDA 1Y3WA 2ZPSA 3M37A 2VIPA 3VB7A 5C1YA 2XTTB 1CGJE 1NRPH 2VVUA 2GTBA 3ZZ8A 1AVGH 1DWEH 4B2AA 2WPDD 4YXWD 4GHTA 3RXFA 1O2SA 3GS9A 4OGYA 1MAYA 4Y11E 2Z9LA 1Y8TA 1CA0C 3PMHB 4VGCC 2A7JA 1HCGA 1GDNA 4YLUA 3NPSA 4KP0A 1S82A 1ZGVA 4Y0YE 1Y3YA 3PV5A 1W14U 2XWBI 2I6SA 1ELCA 1ZPCA 1NPMA 2W6JD 3FFGA 1TE0A 3RU4E 2IJOB 1P0SH 5FPYA 3D65E 2PUQH 2XBYA 4YOIA 2ANKH 4GLYA 3SHAH 4HI3A 3KYFA 2BD3A 1HAIH 1ID5H 1CSOE 1O5BB 1KSNA 2BD4A 3E0NB 1Y59T 5LPFA 4O03A 1QFKH 3HATH 2FP7B 2WSSD 3MNBA 5DK1A 1C2MA 4KGAA 1GBMA 4Q7YA 1L2EA 1ACBE 5JB9S 4B74A 8ESTE 1ORFA 1GI2A 3BG4C 3LGUA 4NA7A 2EY4C 1ZZZA 4X6OA 4XFQA 1EPTC 1HGTH 1L4ZA 3SU1A 1L1JA 3RXTA 2QF0A 4HZHA 1E36B 2A2QH 1UMAH 1YCPH 1ZTKA 3BG4B 1K1MA 3KGPA 1UW7A 1C5TA 1OYQA 1S81A 1TALA 2BQWB 4FU8A 2UUYA 3SYJA 2NWNA 4NIYA 2PV9B 5FBIA 3A7XA 1SGEE 1AO5A 1LKAA 2W7UA 1C2FA 2V7QD 2GGVB 2Z94A 3LOXA 1A0HB 2GD4B 3RUOA 1K9OE 1PQAA 1O3HA 3U98H 1MKWH 3OTJE 1BTXA 1PYTD 4X8TH 5DKMA 1LVOA 1TA6A 5JDUB 3A84A 1IQGA 5F53A 1B7XB 3VXFH 4A1TA 1ZSLA 1EZQA 5C0UA 2H9TH 3ZVAA 1O3AA 4X2YA 3DFLA 3SI4H 4CRBA 3FOAA 3M36A 1MU8B 3EGKH 5C5OA 4H42U 1ELVA 1INCA 1DLKB 3NRLA 1C2GA 1W3CA 1MU6B 2STBE 3CS0A 4NG9H 1ZPZA 2BHGA 1J9CH 1UTKA 4ZXYH 3LONA 4WMFA 2DE9A 5AF9H 3BIUH 2KZ4A 3ENSB 3SJKA 1KLTA 3B8JA 1HV7A 2YNBA 3K6YA 4E7NA 5PTPA 5H4IB 1HAVA 4OGXA 3TNTA 2FMJA 3LH1A 1GG6B 1SGNE 1MD8A 2K8IA 1DT2A 2WV9A 1BTPA 1BUIA 1YLDA 1TNKA 1AMHA 1EOJA 2ZNKH 4GPGA 4E7RG 1C2KA 2BQ7B 3MMGA 2BDAA 1WXRA 4U32A 1QB9A 2V6NA 3A88A 1H8HD 3LPRA 3EAJA 1TBRH 1THSH 2ZU2A 2OLGA 1PPCE 2BTCE 2Y7ZA 3TJOA 2HALA 1GJ8B 4FUCA 3BTFE 1GHZA 3A82A 1TA2A 4BAQB 4CRFA 2ZHQH 5E8EH 3ATWA 2R3UA 6ESTA 1EZUC 3TNSA 1JIMA 3W1EA 3NK8A 4AORA 1AE5A 3R3GB 1NU9A 2XYAA 3ATMA 2FLBH 3SNDA 3LGWA 1IQMA 4JYTA 1HAZB 2LELA 4UDWH 3SU5A 1SOTA 3KNXA 1V6DA 2FI3E 1O2UA 3GCNA 5DP8A 3F9FA 1MD7A 3ZZ3A 1FV9A 1DE7H 4LOYH 3GY2A 2ZG0H 1QRXA 4OS4A 1LVYA 1HAXB 5DP9A 2FPZA 3SW2B 1K1PA 3N7DA 1NU7B 1DWBH 3SNEA 2OUAA 3KEEA 5F8XA 1BBRK 3GISB 4AB9A 4XBDA 1QNJA 1XUKA 3TH4H 3S7HB 3NKKA 1Z7KA 3E1XB 4Y76A 3PTBA 3GICB 2W7SA 4X8SH 3OFND 5HKKD 1ZPBA 2ZTYA 2O8WA 1YPHC 1BITA 3VPKA 1O30A 3DT0H 4WMEA 1GVLA 3SGAE 3M7TA 3LH3A 4DVAU 2GMTB 1P2MA 5JBTA 2FLRH 4YESB 1QBVH 2VH6A 3BTGE 5EXMA 1QL8A 4UFFH 2GCTC 3GY8A 5EXNA 4MVNA 1QQUA 3QLPH 1ZMLA 1C5MD 1WDIA 2BD5A 1LQDB 3H5CB 2F9OA 3LC3A 1OXGA 5GIBA 1LPKB 1N6XA 1AFEH 1PPGE 2XC0A 2BY7X 2GCTB 1OP2A 1OP8A 3BTME 1ZJDA 1GMCG 2ANMH 3ZZ4A 1BBRE 1W11U 1H9LB 1F92A 4Y79A 3KHVA 4NSYA 1JWTA 2HNTE 2LNCA 1HAYB 1H4WA 3S7KB 1Z8IB 1ETRH 3V3MA 2HRVA 2JIZD 3NCLA 1Q2WA 2OC8A 2BDGA 2IJD1 3U8OH 2Z9IA 3AK5A 2RG3A 1EUFA 2CK3D 2EI8A 2XC4A 2OBOA 1EJMA 2FX4A 3I77A 1K22H 1JRSA 2B9LA 1ELAA 3BN9A 1GBKA 2OTVA 3ZZ9A 1FX0B 4D7FA 1P9SA 2EEKA 5J4SA 1O2JA 4AX9H 3RXDA 2ZC9H 1IQEA 7GCHG 2CMYA 1TBQH 1HAOH 3T26A 3KF2A 2PP6A 1EAWA 2AGEX 1SQOA 1BIOA 1GHBG 3M7QA 4Y7BA 3SU4A 1O36A 3M3SA 4F49A 1BTUA 1O3BA 2C8WB 3SJIA 2BY9X 1QRWA 2NU3E 3RLYH 3EQ0H 3VFEA 3A89A 2WYGA 1LVMA 3KQ5A 2A2XH 1EKBB 4OS2A 2ZDAH 2ZEBA 2PWXA 1T8MA 1TAWA 1TQ7B 4QT8C 4BAKB 4K8BA 1V2QT 3MH7A 1O0DH 2ZA5A 2J92A 1P01A 1YM0A 2BOHB 2ZECA 1LPZB 1W13U 3RMLH 4XRNA 4E06H 5A09A 2ZFFH 4CR9A 3OAAD 1GBAA 3OY6U 2ZWLH 1CT2E 3E0PB 1DDJA 3GYLB 3M3VA 2GZ9A 2LP6A 4NFEA 2FWWA 3QZRA 5F8ZA 2ZHEH 4I8HA 2GDDA 3MH6A 3RXVA 4LZ1H 3W95A 1GBHA 2GCHF 3NXPA 2UUKB 3ZZ7A 1AUTC 1ELGA 4DURA 1HAGE 2G81E 2B7DH 2A7CA 1G37A 4CR5A 2G51A 3E16B 1DXWA 5ETXA 4D8NA 2D8WA 1C1PA 1SFQB 2VH0A 1C2HA 2G52A 3S9BA 1IQHA 2ZGHA 4WJG2 2QAAA 4AZ2B 5EU8A 1ZGIA 1AB9B 2D1JA 2Z9GA 1MKXK 3OSYA 3FP7E 1G36A 1O3EA 4XD7D 5A8ZA 1O33A 1A2CH 1GVKB 2FODA 2KAIA 3TJNA 1C1OA 4A1XA 1BTZA 1T31A 8KME2 2AMQA 2HVXA 2KAIB 1OKXA 2ZKSA 1HRTH 3PRBA 1UVSH 1NTPA 1A0LA 1MZDA 1O37A 1FZZA 1O35A 2XNIA 1BZXE 1DPOA 4TT3D 1EFRD 5HM9A 4B1TA 2AMDA 3E3TA 3Q3KA 1SPJA 2QIQA 2ZCHP 1L1NA 3SQEE 5AHGH 4NIVA 5GDSH 2ZU1A 3MOCA 4AFZA 2WPKS 5E0GA 3SUEA 2O8LA 3DSGA 1DUAA 2EA3A 4FUFA 1ELBA 3QX5H 1O2WA 2A32A 1W0ZU 2J95A 2JDID 2VNTA 3QWCH 2BVRH 1DLEA 3MH5A 2J4IA 1F0UA 1B0FA 1A3EH 1MMJN 2A5IA 5DG6A 1SB1H 5DP3A 3OTPA 4FUJA 2VIDA 2ALVA 1QJ1B 2Z3DA 2C8YB 2W6ID 3IWMA 4YOJA 2GV6A 3MU5A 2Y7XA 1THPB 1FMGA 4O97A 1HYLA 1AVWA 3LGTA 1CU1A 5FXLA 1O39A 4ZROA 3VB3A 3VGCC 4ZAEA 3SORA 1BDAA 4ABGA 5EQSA 1UTLM 4OS5A 4WF8A 5T6DA 4H4FA 1GI0A 2A5KA 4K3JA 2P59A 1AFQB 3VGCB 2ANYA 2ZCLP 1QY6A 2FS9A 1ELFA 4K2YA 1W10U 1VJAU 1P57B 2XXLA 2W3IA 4BTUB 4NZLA 3F1SB 4P02A 3EE0B 2PUXB 1FNIA 5L2YH 3A7ZA 2G4TA 2SFAA 3A8BA 1C4V2 2VIVA 1NROH 1T4VH 2CHAC 1TMBH 5GXPA 3ZVFA 5FHTA 1C4Y2 1QTFA 3OE7D 1C5WB 4XDEA 4ACBA 1FY5A 1M9UA 2HPPH 1HBTH 3RXIA 4ISHH 1QB1A 1P09A 1IAUA 4Y10E 3GCHC 2ZFQH 1O5GH 3A8CA 2XRCA 5JBAS 4TY7A 2VWOA 1DX5M 1YWUA 2ZQ2A 5A0BA 2F83A 2J9NA 5GCHF 1NESE 1J17T 2TRMA 3TK9A 4JZFH 2BYAX 1Y3XA 1PQ5A 2HGTH 3RMMH 3STJA 2YMSD 2ZU3A 5CHBA 4SGBE 1YKTA 5C0TA 1WU1A 5DN6D 2ZHWH 1K1NA 1Q3XA 2M2AA 4SGAE 1T32A 3RXSA 3AW0A 1P2JA 1O2KA 4DJZB 1GI1A 1TPOA 1DOJA 1NRQH 1WTGH 3ZZCA 2BX4A 2XC5A 1K2I1 1FJSA 2DUCA 1MKXH 1CHOF 4E05H 2WUBA 1DICA 1C5YB 3MYWA 1C5UA 2SNVA 3SZEA 2JETB 3WWFA 5LPRA 2J94A 3SUGA 1NBME 1BHXF 4TYDA 3FAOA 4IC6A 2F91A 3U69H 1IQJA 2BQ6B 5A0AE 1YBWA 1NO9H 3O8BA 2J34A 1NC6A 1QA0A 1KMHB 4YT7H 2VIQA 4MNVA 3E90B 4HFPB 4Z6AH 1FXYA 4X6MA 3ZYEA 1SFIA 1G2MA 4DT4A 1H1BA 1C5VA 1VGCB 4MNWA 1ESBA 3SV2H 1WV7H 4LK4A 4ESTE 2NU0E 3T28A 3K2UA 1OS8A 2QXIA 3A87A 4TWYA 3MQKC 3LU9B 2ESTE 4UEHH 3VB5A 1KXEA 5IYTA 1V2MT 4B71A 1ELEE 1GJBB 3GY3A 4A7IB 3LIWA 1RD3B 2P3FH 1DANH 3F2GA 1GJDB 2NU4E 4BTTB 1ZMJA 5HMAA 3N99A 1GDQA 2ZDKA 3H7TA 1O2NA 2BB4A 1GBBA 1HJ9A 4MLFB 1WYKA 1QQ4A 2ZGXH 1O5CB 2PKAA 3GY6A 5C2ZA 1QA7A 2P95A 2PKAB 1RGQA 1MZAA 5F6MA 1L4DA 3V0XA 4GCHF 1SL3A 1F5RA 1EXFA 3PV2A 3P95A 1PYTC 1VCWA 3D62A 4BNRA 1RIWC 3A8DA 1D6WA 1KXCA 3RXOA 1OWIA 1JBUH 2GP9B 1J14A 3PMAB 3TIUA 2LPRA 4B2BA 2ZU4A 2OC1A 1SGTA 1QHRB 2VIWA 1P11E 2CN0H 4CHAC 1RIWB 3JZ2B 1F0SA 1UVTH 4IMQA 5B6OA 1GI6A 1OWHA 4DY7B 1PPFE 4AB8A 1SVPA 3UWIA 1K0HA 1V2KT 1GHYH 1H9HE 2P8OC 1THRH 4X0WU 3SQHE 5T6FA 4AG2A 1SLXB 1CA0B 3LKWA 1SQRA 1KXDA 3ATIA 2A4GA 1YPLH 2Y5HA 2A1DB 3LGIA 2WUCA 4VGCB 1N8OC 1TGSZ 1ZTLA 3KN2A 2J38A 3L6PA 4FOUC 4X6PA 4Y8ZA 1LHGH 2VWLA 5GJ4B 4Y6DA 3M5NA 1N8OB 2B0FA 1PPHE 2WV4A 1SLUB 4GHQA 2OC7A 3ZVBA 2Y6TA 2R0KA 1BMLA 1FN6A 3ZIAD 3OYPA 1XXDA 1AZZA 1A7SA 2BD2A 1O3GA 4AYVB 5T1VA 4GVUA 3PV4A 3TGJE 1G32B 3M5LA 3A7YA 1GWAA 1TB6H 3O8DA 1VCQA 4XOJA 1ZR0A 1QGFA 3F2HA 4I8KA 4AFQA 3CP7A 1EPTA 3T62A 4X6NA 2CV3A 1SGPE 1EPTB 2P3UB 3MNCA 3GOVB 1YPHE 3P8FA 4MG3A 1KY9A 2OK5A 2KM0A 1AVXA 5CMXH 2HPQH 4YO9A 1HJ8A 5KECA 1SGQE 1D6RA 1OX1A 1P9UA 3SOSA 3RP2A 1O3OA 3EYDA 3FKSD 1GBLA 2ZQ1A 4OS7A 3URDA 2ZGBH 1W12U 2V3MA 3BTTE 1EJNA 1Z1IA 1K28D 5JBCS 3HK6B 1KLIH 2GCHG 2FTLE 3VG8A 1O3KA 1O5FH 1GI4A 1JMOH 2G4UA 2NU1E 2QXHA 4TSFD 1TNGA 1SHHB 1KIGH 5DP7A 1KDQA 3GY7A 1O3JA 3RC5A 1D3TB 1KDQB 3FP8E 4ACAA 5C67A 2QGRA 4R0IA 1QCPA 1T8OA 3SNCA 1A4WH 1BMMH 2AIQA 1ARBA 4RKOB 4MPVA 3U8RH 1O3LA 4M7GA 2FOCA 1UK4A 4ZHLU 1ESTA 3VEQB 1D3QB 3GDSA 3SV9A 5T6GA 4CRDA 1AN1E 1HB0B 5ESBA 4B75A 2UUJB 2AGGX 4I8GA 2FIRH 2RFKC 1AI8H 1SQAA 2FM2A 5EW1H 1D9IA 1NM6A 3ZZDA 1Z8RA 1RTFB 4PROA 1IHSH 1TNHA 4B76A 2B5TB 5HM2A 3T25A 2BXUH 3E91A 2ZIQH 1XVMA 3A85A 4MPWA 2BZ6H 3SZNA 1TOMH 3MI4A 1GJ7B 5C5NA 1AU8A 3QK1A 4X1PU 1EP6A 1TWXB 3BSQA 3SGBE 4ABDA 6CHAC 1Z8GA 1XM1A 1YGCH 1ZMNA 1U6QA 3ODDA 1ZJKA 1O2MA 1O2XA 3SV6A 3RXUA 2ZFTA 3MNSA 1XUGA 2BZAA 4KTSA 2FS8A 6CHAB 4Y71A 1KXBA 1TX7A 2KCOA 2AFQB 2TGDA 2BDBA 2TGPZ 3RXLA 8GCHF 2VWMA 3QN7A 3V13A 1MTUA 1YPEH 2OBQA 3U9AH 3MU0A 4WMDA 1ZLRA 1YPGH 2W3KA 2RDLA 2BLWA 1HXEH 7KMEH 1O2QA 1LTOA 1UJ1A 2KX4A 4ASUD 1W8BH 3A86A 2Y82A 4JZ1A 3ZYDA 3RXEA 1E1RD 4WXVA 1E38B 5FPTA 1W0YH 5HGGA 1AY6H 3FANA 2BLQA 3BV9B 4O3UA 2K1QA 1MABB 2ZHDA 1ZOMA 1O32A 3SJ8A 2W5EA 4MNXA 2BOKA 1RS0A 1QB6A 1NFXA 4KTCA 1GJ9B 1YLCA 1EZSC 4KTUA 3GDVA 1A0JA 2XWAA 3BTWE 2AGIX 2AH4X 1G2LA 4Q4LA 2EQNA 5EXLA 1C2DA 1GCTC 1QIXB 2V3OH 2UWOA 4TPYA 1A5IA 4CRAA 1FLEE 5GCHG 5HIZA 1VITF 2QE7D 4FU7A 1CVWH 1PPZA 5HYOA 2VIOA 4ISIH 4I33A 1GCTB 1E35B 4JK5A 1GMDF 1PQ7A 2XOKD 4Y8YA 4FUHA 1F5KU 1J15A 2WPIS 4YOGA 7LPRA 3UR6A 4K60A 4A1VA 4M9FA 4B73A 1TGTA 1G9IE 4NWKA 1Z6EA 5A8XA 5EJZA 1V2PT 3ZVGA 1W7GH 1XUFA 3PLPA 1OP0A 1PPEE 5E2PA 1HNEE 3VXEH 3P8GA 3UUZA 4ABBA 3I29A 4X1QU 5G4BA 2XW9A 4YT6H 1AQ7A 1O34A 3RC6A 1LHFH 3C1KA 3GY5A 3QTOH 1AE8H 4UFDH 1UTPA 1UTMA 3UFAA 3E6PH 2XCNA 4J2YB 4XBCA 3P17H 2STAE 2ALPA 1FAXA 1C5OH 1S84A 1DSTA 4JZEH 3ZZAA 5E2OA 5BPEA 1GHWH 1UVPA 1W2KH 3PYHA 1MBMA 2PKSC 3RU4D 1S6HA 4Y8XA 4WH6A 4MQAA 3TK5A 5C17A 1N1LA 2Z6BD 2A0QB 2Y80A 2Q6FA 2PKSB 1ZTJA 2PR3A 1EOLA 1DY9A 3ITIA 1O2ZA 3HGPA 3SHCH 5FBEA 3P8OA 2JJ1D 3PLBA 4JK6A 3F9GA 3NWUA 4X1RU 2QN5T 4I31A 2VBCA 1GI3A 1TPAE 3T2NA 2XNDD 3DUXH 3ATKA 2BD8A 1COWD 3UNQA 2XBXA 2ASUB 4A5TS 3QDZB 2V35A 1H9IE 1LO6A 3SU3A 2G8TA 1UTOA 3DSPA 3MU8A 2CXVA 4JMYA 2HLDD 2KCYA 1WQVH 2RDEA 2IPQX 1Y5AT 2XBVA 4UE7H 2PSYA 3BTHE 3RM0H 1OYTH 1Z1JA 2ZHFH 4F4OC 2P16A 1C1RA 3PTNA 3BTEE 4DIIH 1AWFH 1YPKH 2G5VA 4HG6A 4JZIA 4BAHB 4XBBA 3KQBA 1ZRBA 2IPHA 1FONA 2ZPRA 3S9AA 2P3TB 2QV1A 3LT3A 2F43B 3M5MA 4AFUA 1O2RA 1E79D 1TNJA 2BDCA 2O8MA 2ZTXA 4MPXA 1UK3A 1XXFA 3P8NA 1P2NA 1MAXA 4I8JA 2Y81A 2CF9H 4BAOB 3SUDA 1Y3VA 1AD8H 1NS3A 1SBWA 1SGYE 2O9QA 1LDTT 1P05A 4YZUA 1TX6A 1DSUA 3UOPA 2ZU5A 1UTNA 1YYY1 1SI5H 3RDZA 3RXHA 1HAPH 4NSVA 2F3CE 1C5QA 4FUIA 3D23A 1C1QA 1SMFE 2VU8E 3U8TH 1C9PA 1CE5A 4D7GA 2GT7A 3KYGA 5EOKA 3BEFB 2YMSC 2GZ7A 1BJVA 3RLWH 1IQKA 1ESAA 4Y0ZE 1C1SA 1O2TA 1TGCA 2F9BH 3FZZA 1D4PB 4FUDA 3BG8A 3F9HA 3M5OA 2F4LA 4D9QA 1AWHB 1GJCB 4Q63A 2B8OH 4CH2B 1GJ6A 1HDTH 1HUTH 1DWDH 2FDAA 3STIA 2TPIZ 4A92A 1SGDE 2G55A 3BTQE 2BY5X 4K1SA 4YLQH 7ESTE 2H9HA 1RTLA 1MTWA 9LPRA 4ZHMU 8LPRA 1GGDC 1XKBC 2CF8H 2FOEA 2AERH 4XSKU 1NZQH 1TNIA 1BMFD 4JZDH 5LPEA 1FIZA 5LGOA 1C2LA 4BOHA 4JYVH 6LPRA 1EAUA 4IN2A 2PSXA 1BT7A 3SU0A 3MO3A 1RTKA 1O3CA 1GMHF 1O2VA 3PROA 4Q2KA 4K69A 3EA8A 1HJAC 3DA9B 2FI5E 1SOZA 1V2ST 2M5TA 1GBCA 2H6MA 5EJ1A 1C1MA 1W0JD 1OWDA 4F55A 2H5DA 4FU9A 5C20A 1V2RT 3EE7A 3SNAA 3MTYA 2FYRA 1AKSA 1KXFA 1AKSB 1SSXA 4MTBA 2EC9H 3WY8A 1TABE 2CHAB 1ABJH 2K0QA 1KTSB 1WUNH 3UR9A 2A45B 1VKYA 1PFXC 2FOGA 4Q7XA 2A4QA 2G5NA 1UVOA 3U1JB 3KQDA 3F68H 1S6LA 3UWJH 1B0EA 4I86A 2P94A 5KEDA 1P2KA 1HFDA 2GV7A 1GJAB 4CREA 3LJOA 1CBWC 4A6LA 5EGMA 3GCHB 3SJ9A 1K1IA 6GCHF 1LPGB 2BLVA 5J4QA 4LXBH 1YPJH 1OHHD 1Y3UA 5ESTE 1ABIH 1K1LA 4RKJB 3S0NA 2JH0D 1CBWB 1DWCH 3GYMA 3PWCA 4AGKA 4WY3A 1A3BH 2UWLA 8GCHG 1IHTH 1OOKB 2NU2E 1CT4E 1H8ED 4OS1A 1GI8B 2AMPA 2AIPA 4IS5A 2BXTH 2IOTA 1V2TT 1S0QA 3WW7A 3UTUH 1TQ0B 2D2DA 4CBOA 3RC4A 2QY0B 1VCPA 3UAIC 2Z9KA 4THNH 1P2OA 5DSFA 3UOUA 1GMCF 3PO1C 2QF4A 4HTCH 1UO6A 2Y5FA 1TPPA 1LQEA 2BD9A 3SN8A 3ZV8A 2PTNA 1LHDH 1O2IA 3ZVCA 3A7WA 2P93A 2VB0A 1SGFG 2SNWA 1Z6JH 3PLKA 5F03A 1S6FA 1QJ6B 1BOQA 2BM2A 1AZ8A 1SGIB 2VGCC 2VJ1A 1HLTH 3UPEA 4FVBA 5FX6A 5L6NH 1G3DA 2C93B 3QGNB 5IDKA 1HAHH 1UVUH 3HKIB 2H1UA 2UUFB 1GHXH 2HLCA 4K8YA 3RMOH 1VITG 1YCPM 1GDUA 1FY3A 4I7YH 1XX9A 1UHBA 1TYNA 1UHBB 3M3TA 1GMDG 1G3CA 1NFWA 1WOFA 3F9EA 3LC5A 5GNDA 1K1OA 4ABJA 1GCDA 4TY6A 1BTYA 1ZHPA 2J98A 3RXQA 4Q7ZA 3HPTB 2J98B 3TH3H 1NRNH 2OINA 1L1GA 4Q80A 4UD9H 2A31A 1ANBA 1FY8E 2H2ZA 3FO8D 1C2EA 3P70B 3UNRA 4U2WA 3TK6A 1MCVA 1O3DA 1W0KD 2KFWA 1F7ZA 1SGFA 2HOBA 3MO6A 1TBZH 4H6SB 4I8LA 5T3HA 1IOEA 4CRCA 4NA9H 1LCYA 1E1QD 5EPYA 1V2OT 3EA9A 1A5GH 5L2ZH 3JZ1B 4B6EA 2BVSH 4ZKOU 1GJ5H 1Y5UT 5A8YA 3E8LA 1GL1A 4CHAB 1O2YA 2RA3A 3DCLA 2SGFE 5BRRE 2QC2A 2G00A 1BB0B 5FX5A 3C27B 2P8OB 5EODA 2Z7FE 1XUJA 3T5FH 3SV7A 3SU2A 1O2HA 1O3FA 1S83A 1MQ6A 1T7CA 3A83A 2A7HA 1FPCH 1BJUA 3PWBA 4RI0A 1SLWB 4D76A 2FYQA 3F0PA 1K21H 2SGDE 1HXFH 5C94A 1LVBA 2Z9JA 1PQ8A 4U01A 1GHAF 1TONA 5CHAC 2WPHS 3GCTF 2HNTF 1P03A 2FZZA 4UFEH 1O5DH 1AIXH 4NGAH 2EI7A 5GWZA 1ANDA 5F8TA 4OM9A 3F3BA 2FO9A 5CHAB 4AYYB 5DP6A 1FUJA 2PW8H 4Z0KA 2DE8A 1A46H 2FXRA 3L3TA 4YTAA 3W94A 1C1VH 5C1UA 2GZ8A 1WQSA 3RXJA 2IN2A 5EG4A 4B6FA 1GJ4H 3PMBB 1QR3E 1KXAA 1O5AB 1LHEH 3KQEA 1TRYA 4R8TB 4TWWA 3ZZ5A 2C8ZB 4X8UH 1F0TA 4NFFA 2SGQE 5GPIB 1EX3A 2AS9A 1SC8U 1V2LT 3LGVA 3BEUA 3NZIA 1VJ9U 1XMNB 1MTVA 2AHME 4JCNA 1O31A 1EB1H 2QF3A 2TBSA 5DO4H 3LGYA 4ZKSU 3UQOA 3G01A 4ZMAH 1TPSA 1NFUA 2PLXA 3PM3A 4RSPA 2RA0A 2J97A 2V0BA 4U30A 2ODPA 1TRNA 1OWEA 4KELA 1C5PA 1K1JA 2KCAA 1F2SE 4ZH8A 2WINI 3A7VA 3MU1A 2TGTA 1C2IA 2BVXH 2THFB 1EQ9A 3ESTA 4BXSA 2ZGJA 3H7OA 2BDIA
chains in the Genus database with same CATH topology
2FOMB 1C1UH 1D3PB 3MHWU 1FAKH 1ZHRA 4NIWA 3TJVA 2CJIA 2FI4E 3TVJB 3VB6A 4DIHH 5LH8A 4O3TA 4MPUA 2FTMA 1V2UT 1GBTA 2ZFPH 1GG6C 1MBQA 1T4UH 4DT7B 1P2QA 2R2MB 2ZFRH 4GAWA 1C5ZB 1OPHB 1ZSJA 1UTJA 1XUIA 1C5NH 4ZKRU 4LZ4B 1O3MA 2ZZUH 1HAVB 1MUEB 3TU7H 2FOFA 2F9UA 1QJ7B 1N6YA 4AFSA 4ISOA 5K7RA 1LKBA 1WAYB 3TPIZ 4GUXA 1V2WT 2F9NA 1JOUB 1MTNC 1ANCA 3A8AA 4WVPE 1EASA 1ZHMA 3KCGH 3A80A 2HWLB 3L33A 3RM2H 4JYUH 4AOQA 5DJ7A 2AEIH 1C4U2 2ULLA 1MTNB 4GSOA 3TH2H 1H8DH 3Q00A 1F5LA 1NT1A 1P2IA 3GDUA 3CENA 1GMHG 1C1WH 4D9RA 2O8TA 1FN8A 1EZXC 3RXBA 5DP5A 3O8CA 4ZKNU 2ZI2H 4YM9A 1KLJH 4NA8A 2ZF0H 1RJXB 5EQRA 3MO9A 2C4FH 1NN6A 2ODYB 1C1TA 3SUFA 3V7TA 3TITA 3RXGA 4NZQA 3BTKE 1D3DB 3RXAA 3P6ZB 1BQYA 3EA7A 1G30B 3S9CA 1BRUP 1FY4A 2YNAA 4DW2U 2Y5GA 1YP9A 2Z3EA 1QBOA 3KL6A 3AAVA 4K5ZA 2BY8X 2GKVE 4AG1A 3A7TA 1C5XB 1TX8A 3OX7U 2OXSA 3QTVH 5JB8S 3RXRA 2GMTC 3R0FA 6GCHG 5SGAE 3ATLA 1TLDA 1MCTA 5AVDA 3AAUA 1EB2A 5A0CA 1BMNH 1JRTA 1OSSA 3CS7A 4RN6A 2VVVA 4BTIB 5FAHA 1O2PA 5K0HA 4INKA 3RXCA 2WPLS 1J16A 5EW2H 2SGAA 2PGQB 1CHOG 1C2JA 2F9VA 3MNXA 3SBKA 1Y5BT 3ZVEA 1FY1A 2BX3A 1TMTH 1AHTH 4IMZA 4ABHA 1FIWA 1P04A 2OQUA 3KIDU 1QL7A 1V2VT 1IQLA 3RXPA 2SGEE 1QRZA 1TGBA 4NIXA 4FVDA 3RU4T 4WH8A 3FZDA 1NRRH 1GL0E 2F9PA 2ZCKP 1UTQA 1RFNA 4BXWA 3LJJA 1MTSA 1BMAA 4ZXXH 4NWLA 3QUMP 1BA8B 1JXPA 1ZYOA 4IBLH 1SHYA 2Q6DA 2JH5D 2XCFA 3HGNA 1WTHD 2ZTZA 3QZQA 1TNLA 1P02A 5TCCA 5JBBS 1SQTA 4X8VH 4ABIA 4MDSA 2WV5A 2GT8A 4K1EA 1P3EA 3I78A 1Z71A 3ODFA 3FVFB 1DS2E 5E0HA 4DGJA 3LDXH 1O5EH 3B23B 1FDPA 3UQVA 1BHXB 4BAMB 4ABAA 4O9VA 1A5HA 1Q31A 2OQ5A 4GCHG 2UWPA 1ELTA 4DCDA 2BY6X 2VVCA 1V2JT 1V3XA 1BCUH 3UIRA 5A2MH 2BLOA 3Q3XA 1ARCA 1GVZA 1LMWB 1ELDE 2JH6D 1EAXA 1A1RA 4FXGH 1ETTH 5FCRA 1O38A 1C9TA 2PFEA 2Q6GA 3T27A 2I6QA 1CQQA 1GI7B 4CH8B 3DHKH 2Q1JA 1BRBE 5DGJA 1DVAH 2WPMS 1FPHH 3RXKA 1S5SA 2OC0A 2H5CA 3SGQE 2C8XB 3OY5U 3SU6A 2VWNA 1TOCB 2FX6A 1XVOA 4X2VA 1P8VC 1BTWA 1WCZA 3MWIU 1P12E 3F6UH 1F0RA 4ASHA 1BBRH 4OS6A 2ZDNA 3PMJA 1QBNA 1O3PB 1YC0A 3DFJA 5TCAA 1UCYK 1WSSH 1ZSKA 2BDHA 4FUBA 4INLA 3ZVDA 2QYIA 1OWKA 4DG4A 1AB9C 2ZDVH 4DOQA 2H9EH 2ZFSA 5JPMH 2PHBA 2R9PA 1GHAG 2A4RA 1S85A 2ZPQA 1G3EA 1DM4B 2TIOA 5C3NA 3GCTG 1DY8A 1OWJA 4J1YA 3QO6A 2O8UA 1P10A 4CBNA 2RCEA 5CE1A 1BRCE 2C3SA 1C5LH 2D26C 3TGIE 4Y7AA 3OU0A 1TIOA 1KYNA 3A81A 4ISLA 4INHA 1LHCH 1SG8B 1EJAA 1O2GH 1S0RA 1GBDA 3PB1E 2EI6A 2YOLA 2FEQH 1FQ3A 3V12A 1IQIA 1CA8B 3K65B 5EQQA 2ZO3H 1VR1H 1UCYE 1EAIA 5ABWA 1GI9B 1L0ZA 3SJOA 3BTDE 1IQFA 1BTHH 2HNTC 2GX4A 3VB4A 2R3YA 4K1TA 2ANWA 1G3BA 2BDYA 1E34B 1ETSH 1EATA 1HIAA 1HIAB 2GDEH 4ISNA 1TRMA 3RXMA 1SLVB 3SV8A 1C5RA 1GGDB 2WYJA 5EPNA 3SO3A 1SR5C 1RXPA 2AYWA 5JYIA 2SGPE 1AFQC 3NUMA 1GBFA 3M61U 3DD2H 5DP4A 1NFYA 1NY22 3HKJB 3MH4A 3B9FH 2WPJS 3ZZ6A 4FUGA 2FOHA 2BD7A 4WWYA 1CGIE 1FI8A 1HJAB 3Q3YA 2BMGB 2JKHA 3ELAH 1EP5A 1H8IH 2ODQA 5AFZH 2GVFA 1DFPA 5HXFA 1XKAC 1V2NT 1NRSH 1O3NA 2FOAA 1GBIA 1GBEA 3TJUA 1DUEA 1KTTB 3BEIB 1IQNA 4TPIZ 3SI3H 1TMUH 2A5AA 4HGCA 1WBGB 3S69A 1TFXA 4B2CA 5L30H 4I32A 2Z3CA 1JIRA 5DPAA 4AN7A 2QA9E 4AGJA 4WXIA 4IC5A 3UNSA 4XE4A 3SNBA 5I46H 1X7AC 2W26A 1O3IA 1UK2A 3D49H 1GHVH 4IW4E 1P3CA 2FESH 2R0LA 3K6ZA 1AGJA 1ANEA 3RMNH 3BIVH 4X1NU 5I25A 1UCYH 2PTCE 3M35A 4UONA 2FOBA 3KQCA 2OP9A 3N7OA 3IG6B 4IN1A 1XUHA 4X2XA 1YCPK 1P06A 5FPSA 4ZHAA 2JETC 1RRKA 3K9XB 2ZP0H 1PJPA 4X1SU 3AASA 1E0FD 3PO1B 1T8LA 1GBJA 4NCYA 5E0JA 5TJXA 4ABFA 3URCA 3HK3B 1E37B 1T8NA 3U1IB 2PGBB 1CGHA 1VITH 3UY9A 3O8RA 1CHGA 2TGAA 1C1NA 1ZRKA 5FCKA 2V3HH 4ZUHA 2ILNA 2A4OA 1HPGA 1PPBH 3ZV9A 4X2WA 3MFJA 3MU4A 3EDXB 4BANB 1VGCC 2OCVB 2VGCB 1MKWK 1QURH 3T29A 2J2UA 2C90B 3IITA 2OD3B 1CT0E 1BRAA 2ZDLA 3M7UA 1B5GH 2VINA 1O2LA 1CO7E 1DITH 2XBWA 3BF6H 1GI5A 2QCYA 2CGAA 1A61H 1YF4A 1SGCA 1Z8JB 2ZDMA 3QGJA 1GPZA 4UFGH 7GCHF 3GY4A 3UREA 3ZZBA 1MQ5A 1QL9A 2QXJA 4ABEA 4MNYA 5C1XA 3P92A 4H6TA 2QXGA 1TGNA 1YPMH 3Q77A 3FP6E 1GHBF 1AUJA 1SGRE 2ZGCA 4KKDA 3AVZA 3TGKE 3GCOA 4FUEA 1VZQH 3TLOA 5AFYH 1C5SA 4CRGA 1J8AA 1DXPA 1O2OA 3Q76A 3AW1A 1MH0A 2R2WU 9ESTA 1W7XH 4IGDA 1Y3WA 2ZPSA 3M37A 2VIPA 3VB7A 5C1YA 2XTTB 1CGJE 1NRPH 2VVUA 2GTBA 3ZZ8A 1AVGH 1DWEH 4B2AA 4GHTA 3RXFA 1O2SA 4OGYA 1MAYA 4Y11E 2Z9LA 1Y8TA 1CA0C 3PMHB 4VGCC 2A7JA 1HCGA 1GDNA 4YLUA 3NPSA 4KP0A 1S82A 1ZGVA 4Y0YE 1Y3YA 1W14U 2XWBI 2I6SA 1ELCA 1ZPCA 1NPMA 3FFGA 3RU4E 1TE0A 2IJOB 1P0SH 5FPYA 3D65E 2PUQH 2XBYA 4YOIA 2ANKH 4GLYA 3SHAH 4HI3A 2BD3A 1HAIH 1ID5H 1CSOE 1O5BB 1KSNA 2BD4A 3E0NB 1Y59T 5LPFA 4O03A 1QFKH 3HATH 2FP7B 3MNBA 5DK1A 1C2MA 4KGAA 1GBMA 4Q7YA 1L2EA 1ACBE 5JB9S 4B74A 8ESTE 1ORFA 1GI2A 3BG4C 3LGUA 4NA7A 1ZZZA 4X6OA 4XFQA 1EPTC 1HGTH 1L4ZA 3SU1A 1L1JA 3RXTA 2QF0A 4HZHA 1E36B 2A2QH 1UMAH 1YCPH 1ZTKA 3BG4B 1K1MA 3KGPA 1C5TA 1OYQA 1S81A 1TALA 2BQWB 4FU8A 2UUYA 2NWNA 4NIYA 2PV9B 5FBIA 3A7XA 1SGEE 1AO5A 1LKAA 2W7UA 1C2FA 2GGVB 2Z94A 3LOXA 1A0HB 2GD4B 3RUOA 1K9OE 1PQAA 1O3HA 3U98H 1MKWH 3OTJE 1BTXA 1PYTD 4X8TH 5DKMA 1LVOA 1TA6A 5JDUB 3A84A 1IQGA 3VXFH 1B7XB 4A1TA 1ZSLA 1EZQA 2H9TH 3ZVAA 1O3AA 4X2YA 3DFLA 3SI4H 4CRBA 3M36A 1MU8B 3EGKH 5C5OA 4H42U 1ELVA 1INCA 1DLKB 1C2GA 1W3CA 1MU6B 2STBE 3CS0A 4NG9H 1ZPZA 2BHGA 1J9CH 1UTKA 4ZXYH 3LONA 4WMFA 2DE9A 5AF9H 3BIUH 3ENSB 3SJKA 1KLTA 3B8JA 1HV7A 2YNBA 3K6YA 4E7NA 5PTPA 5H4IB 1HAVA 4OGXA 3TNTA 2FMJA 3LH1A 1GG6B 1SGNE 1MD8A 1DT2A 1BTPA 1BUIA 1YLDA 1TNKA 1AMHA 1EOJA 2ZNKH 4GPGA 4E7RG 1C2KA 2BQ7B 3MMGA 2BDAA 4U32A 1QB9A 2V6NA 3A88A 3LPRA 3EAJA 1TBRH 1THSH 2ZU2A 2OLGA 1PPCE 2BTCE 2Y7ZA 3TJOA 2HALA 1GJ8B 4FUCA 3BTFE 1GHZA 3A82A 1TA2A 4BAQB 4CRFA 2ZHQH 5E8EH 3ATWA 2R3UA 6ESTA 1EZUC 3TNSA 1JIMA 3NK8A 4AORA 1AE5A 3R3GB 1NU9A 2XYAA 3ATMA 2FLBH 3SNDA 3LGWA 1IQMA 4JYTA 1HAZB 4UDWH 3SU5A 1SOTA 3KNXA 1V6DA 2FI3E 1O2UA 3GCNA 5DP8A 3F9FA 1MD7A 3ZZ3A 1FV9A 1DE7H 4LOYH 3GY2A 2ZG0H 1QRXA 4OS4A 1LVYA 1HAXB 5DP9A 2FPZA 3SW2B 1K1PA 3SNEA 1NU7B 1DWBH 2OUAA 3KEEA 5F8XA 1BBRK 3GISB 4AB9A 4XBDA 1QNJA 1XUKA 3TH4H 3S7HB 3NKKA 1Z7KA 3E1XB 4Y76A 3PTBA 3GICB 2W7SA 4X8SH 1ZPBA 2ZTYA 2O8WA 1YPHC 1BITA 3VPKA 1O30A 3DT0H 4WMEA 1GVLA 3SGAE 3M7TA 3LH3A 4DVAU 2GMTB 1P2MA 5JBTA 2FLRH 4YESB 1QBVH 2VH6A 3BTGE 5EXMA 1QL8A 4UFFH 2GCTC 3GY8A 5EXNA 4MVNA 1QQUA 3QLPH 1ZMLA 1C5MD 2BD5A 1LQDB 3H5CB 2F9OA 3LC3A 1OXGA 5GIBA 1LPKB 1N6XA 1AFEH 1PPGE 2XC0A 2BY7X 2GCTB 1OP2A 1OP8A 3BTME 1ZJDA 1GMCG 2ANMH 3ZZ4A 1BBRE 1W11U 1H9LB 1F92A 4Y79A 3KHVA 4NSYA 1JWTA 2HNTE 2LNCA 1HAYB 1H4WA 3S7KB 1Z8IB 1ETRH 3V3MA 2HRVA 3NCLA 1Q2WA 2OC8A 2BDGA 3U8OH 2Z9IA 2RG3A 1EUFA 2EI8A 2XC4A 2OBOA 1EJMA 2FX4A 3I77A 1K22H 1JRSA 2B9LA 1ELAA 3BN9A 1GBKA 2OTVA 3ZZ9A 4D7FA 1P9SA 2EEKA 5J4SA 1O2JA 4AX9H 3RXDA 2ZC9H 1IQEA 7GCHG 2CMYA 1TBQH 1HAOH 3T26A 3KF2A 1EAWA 2AGEX 1SQOA 1BIOA 1GHBG 3M7QA 4Y7BA 3SU4A 1O36A 3M3SA 4F49A 1BTUA 1O3BA 2C8WB 3SJIA 2BY9X 1QRWA 2NU3E 3RLYH 3EQ0H 3VFEA 3A89A 2WYGA 1LVMA 2A2XH 1EKBB 4OS2A 2ZDAH 2ZEBA 2PWXA 1T8MA 1TAWA 1TQ7B 4QT8C 4BAKB 4K8BA 1V2QT 3MH7A 1O0DH 2ZA5A 2J92A 1P01A 1YM0A 2BOHB 2ZECA 1LPZB 1W13U 3RMLH 4E06H 5A09A 2ZFFH 4CR9A 1GBAA 3OY6U 2ZWLH 1CT2E 3E0PB 1DDJA 3GYLB 3M3VA 2GZ9A 4NFEA 2FWWA 3QZRA 5F8ZA 2ZHEH 4I8HA 2GDDA 3MH6A 3RXVA 4LZ1H 3W95A 1GBHA 2GCHF 3NXPA 2UUKB 3ZZ7A 1AUTC 1ELGA 4DURA 1HAGE 2G81E 2B7DH 2A7CA 1G37A 4CR5A 2G51A 3E16B 1DXWA 5ETXA 4D8NA 2D8WA 1C1PA 1SFQB 2VH0A 1C2HA 2G52A 3S9BA 1IQHA 2ZGHA 4WJG2 2QAAA 4AZ2B 5EU8A 1ZGIA 1AB9B 2D1JA 2Z9GA 1MKXK 3OSYA 3FP7E 1G36A 1O3EA 5A8ZA 1O33A 1A2CH 1GVKB 2FODA 2KAIA 3TJNA 1C1OA 4A1XA 1BTZA 1T31A 8KME2 2AMQA 2HVXA 2KAIB 1OKXA 2ZKSA 1HRTH 1UVSH 1NTPA 1A0LA 1MZDA 1O37A 1FZZA 1O35A 2XNIA 1BZXE 1DPOA 5HM9A 4B1TA 2AMDA 3E3TA 3Q3KA 1SPJA 2QIQA 2ZCHP 1L1NA 3SQEE 5AHGH 4NIVA 5GDSH 2ZU1A 3MOCA 4AFZA 2WPKS 5E0GA 3SUEA 2O8LA 1DUAA 2EA3A 4FUFA 1ELBA 3QX5H 1O2WA 2A32A 1W0ZU 2J95A 2VNTA 3QWCH 2BVRH 1DLEA 3MH5A 2J4IA 1F0UA 1B0FA 1A3EH 1MMJN 2A5IA 5DG6A 1SB1H 5DP3A 4FUJA 2VIDA 2ALVA 1QJ1B 2Z3DA 2C8YB 3IWMA 4YOJA 2GV6A 3MU5A 2Y7XA 1THPB 1FMGA 4O97A 1HYLA 1AVWA 3LGTA 1CU1A 5FXLA 1O39A 4ZROA 3VB3A 3VGCC 4ZAEA 3SORA