3QUMP

Crystal structure of human prostate specific antigen (psa) in fab sandwich with a high affinity and a pca selective antibody
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
237
structure length
237
Chain Sequence
IVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Prostate-specific antigen
publication title Crystal structure of human prostate-specific antigen in a sandwich antibody complex.
pubmed doi rcsb
total genus 33
structure length 237
sequence length 237
chains with identical sequence Q
ec nomenclature ec 3.4.21.77: Semenogelase.
pdb deposition date 2011-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3qumP02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3qumP01
1HUTH 1ETRH 2SGPE 2XBYA 3S7KB 4AZ2B 1DLEA 1GJDB 3HPTB 2QXIA 4B71A 4ZKSU 2XWAA 3VEQB 1N6YA 2RG3A 1GL1A 4YZUA 1NRPH 3HK3B 2SNVA 1EKBB 1ZMJA 4UD9H 1O37A 3DD2H 4GCHG 4Y10E 3MH7A 1TONA 2TGTA 1Z6EA 1FMGA 1GMHG 2KAIB 4DW2U 1UTLM 1DWBH 1L1GA 2QXJA 2G55A 2Y5GA 1V3XA 5FCRA 2Z9GA 5DP6A 1IQHA 4MTBA 3TVJB 2AYWA 4Z0KA 2H9EH 1QL9A 4SGBE 5DP4A 2FS8A 2FYQA 1FY3A 1J16A 3QX5H 1QNJA 1UTNA 3QGJA 1C4U2 1ARBA 3PMHB 4E7RG 4JMYA 4Q7ZA 1N1LA 1O5BB 4CH2B 2Q6DA 2A5IA 1DX5M 1TMTH 3M37A 2BVXH 3A87A 1A2CH 2GMTC 3ZV9A 1ANEA 1VCWA 4AFQA 1ZJKA 2ZDMA 4TWWA 3AASA 2STBE 3LH1A 1LHCH 2VU8E 2ODQA 3UWJH 4GSOA 2GCTC 1QHRB 3RXGA 2QY0B 2ZU5A 2BTCE 2VIDA 1MTVA 3SN8A 3VB6A 1CHOF 1J9CH 9LPRA 4FUHA 3VXEH 5JBBS 1G2LA 3MTYA 1GJAB 3E3TA 1C1SA 2A5AA 4NSVA 3CENA 5E0HA 3QTVH 1C1MA 1BMAA 1F0SA 1N6XA 4IS5A 2YNBA 1O2PA 1O3MA 1K1NA 1GI7B 5JBTA 5E8EH 1MAXA 3JZ2B 4MNVA 4MLFB 3V7TA 1TNHA 1AB9C 1D3QB 2BD3A 1P02A 1A0HB 4O9VA 1MMJN 5CHAC 4I33A 1JIRA 1SHYA 1FN6A 2FOCA 2ZO3H 3SV2H 3BV9B 2BQ7B 1UTQA 1AKSA 4OS4A 2FI3E 3A86A 4O3TA 2BDGA 5FHTA 2DE9A 4ZKNU 2FIRH 3TPIZ 1E36B 1GJ4H 2PGBB 2Y5HA 3M5MA 1QL8A 3NKKA 1JMOH 1UHBB 3M36A 2H9TH 1C1QA 1WTGH 2BDHA 1V2PT 2WPIS 1BIOA 3NCLA 3U8TH 1GJ7B 4UFEH 1OWDA 2M5TA 1LO6A 3ZZ9A 1SGCA 2PUXB 1FI8A 1G30B 4X8TH 3D23A 4Y7BA 3KL6A 3Q3KA 5GCHG 2C3SA 2J34A 1QTFA 1TOMH 1P11E 1WAYB 4I8KA 3RXTA 4DG4A 1VR1H 3KEEA 4CR5A 1ZHPA 1TPOA 2PWXA 5EOKA 1TQ7B 1W11U 1F0UA 3SV7A 1HLTH 4NFEA 3DUXH 6CHAB 1DFPA 1P2KA 2A32A 1XUKA 2SFAA 2VIVA 1EXFA 3SU4A 1EOLA 1WCZA 2BD2A 2ESTE 2SGEE 2ZDNA 4ISLA 3T25A 2Z9KA 3TJUA 1UCYH 3RLWH 1OP0A 2YNAA 2XBVA 3I29A 4A7IB 4YESB 1DXPA 1HAIH 2BY6X 5AFZH 1E35B 1LKBA 3NWUA 2HVXA 5C1XA 2VWMA 3LJJA 1FY1A 5B6OA 1S0QA 3R0FA 2GDDA 1BJUA 1Y3VA 4CRCA 1ETSH 4AFZA 2XBXA 2B8OH 1TGSZ 1KXBA 1ZHRA 1EJAA 2PGQB 4UDWH 1EOJA 1GBAA 4BXWA 1ARCA 2A2QH 1AB9B 1SOTA 2PR3A 1F5LA 3EDXB 1JRTA 2K1QA 4X2YA 3EA9A 1MTNB 1WV7H 4FXGH 3T62A 5JB9S 3SW2B 4NA9H 4Q7XA 3PLPA 1TNLA 3P8NA 1XUFA 2GTBA 4FVDA 2NU2E 1VCQA 1ZSKA 3LU9B 1BRCE 3LDXH 1D4PB 3PLKA 1BJVA 1O3KA 1TMUH 2OQUA 1K1MA 5F8ZA 2G51A 2OCVB 2WV4A 2QA9E 1P8VC 3IITA 2TIOA 3K6YA 2HGTH 3A83A 2AGEX 1O36A 4ABFA 4D7FA 1SGFA 5A0CA 1MBMA 1GJ5H 1OYQA 2R0LA 1TA2A 1YYY1 2TRMA 1SGEE 3PMAB 1AVGH 4K69A 2HLCA 1QB6A 1TRNA 2BY9X 5FBEA 3T5FH 2OBOA 1ELVA 2VGCC 1LHEH 3A7WA 5JYIA 1GI0A 1PFXC 1A5GH 1GHAF 1EB1H 1ORFA 1GPZA 4GUXA 4AG1A 4ABHA 4YLUA 4CRBA 4M7GA 3UR6A 1QBNA 2ALPA 1CHOG 1EPTA 1V2WT 1O2WA 4BAHB 1DS2E 4DIHH 4YOGA 3S9CA 2ZI2H 3TITA 3T28A 1WTHD 1A61H 1GHZA 2ZG0H 1P06A 1GI5A 1J17T 1UVSH 2KAIA 1HRTH 1NROH 3C1KA 1O3EA 1SR5C 3I78A 2V6NA 4HFPB 1OWEA 1GBMA 1WYKA 1QBOA 3DFLA 1MQ6A 4JZDH 2ILNA 5C2ZA 4NWKA 3KQCA 5TCAA 2AGIX 3UREA 2TGAA 1RTFB 1C9TA 2A5KA 3OY6U 1GBKA 1Z8IB 4CRAA 4X8SH 4AG2A 3RXAA 3T26A 2UWLA 3PWCA 1H9LB 1XXFA 2UWOA 1HAPH 1NU9A 3P92A 2Y82A 1ZRBA 3RXOA 5I46H 4X1SU 2HWLB 2ZQ2A 4LK4A 2P95A 3P8OA 1YPEH 1RTKA 2GZ7A 2UUYA 2XTTB 1O2MA 5C5NA 3RC4A 3O8RA 2FLRH 2J94A 1Z8GA 2GV6A 3ATWA 1CA0C 3KHVA 1E38B 1FPCH 3STIA 4A5TS 1P2MA 1FAKH 2BM2A 3ENSB 5F8XA 1RXPA 4YOJA 2VGCB 3SOSA 4Y8YA 3NK8A 3PLBA 3SQEE 2BDIA 2H1UA 4ZXXH 1WSSH 2CF9H 4ISNA 5AHGH 5DO4H 2A2XH 4VGCB 3RXIA 5GWZA 1S6FA 1C1VH 1U6QA 2Q1JA 3LONA 1LPKB 3BTWE 3WY8A 3KN2A 3PWBA 2DUCA 3S7HB 5C67A 1O3CA 3LGTA 2P94A 1UHBA 4R0IA 3KIDU 1GBEA 4MNWA 4ASHA 2R3YA 1C5UA 1ZTJA 2BVRH 2PKSC 1SGYE 3E16B 1GBJA 1LMWB 1GDQA 1MZAA 3SUDA 5T6DA 4B1TA 2IOTA 1GBHA 2D2DA 3MI4A 3SHCH 1MKWH 2Z94A 1V2QT 1O35A 1K1IA 2IJOB 1C1PA 2H2ZA 4HTCH 1TA6A 1W8BH 1MBQA 1BQYA 3TK6A 2OUAA 1HAXB 1ZGVA 1Y3UA 3P6ZB 4K5ZA 4X1NU 3SI3H 1C5MD 1C9PA 1QRXA 3E90B 1NO9H 1YCPK 1DSTA 1HDTH 1V2LT 1K1LA 2QYIA 1YPHC 4NWLA 1FXYA 1IQLA 3B8JA 4LOYH 4YM9A 1FIWA 3RLYH 1OP2A 1YPLH 2B5TB 1S82A 4KKDA 1GHAG 3NPSA 1HJ9A 1MTUA 3ZZ6A 1HJAB 4YOIA 2ZEBA 2ZF0H 3A7ZA 1D3DB 1HPGA 3TU7H 1BRBE 2ZHQH 1UTJA 3GY5A 4ZKRU 1RIWC 4ZHAA 2RA3A 1ZMNA 3EYDA 6LPRA 1BMMH 1BTPA 2V35A 1O2IA 2ZPSA 1KSNA 2VWOA 1CA8B 1BHXB 1Y3XA 3ZZBA 3SNEA 4O3UA 1G32B 5FCKA 2O8WA 1D6RA 1ANDA 1JRSA 1VJAU 4JK6A 3BN9A 1NFYA 1UVPA 2CV3A 1FZZA 3E91A 2EA3A 5E0GA 1B5GH 2FOHA 2FOFA 2BDAA 4X6PA 2PKSB 1AD8H 2XWBI 1QURH 1UTKA 5LPFA 4NIWA 1ESTA 4TY7A 3A80A 3ATKA 2Y7ZA 4U32A 1ACBE 1EQ9A 2FM2A 2BQWB 3AAUA 1HAYB 2ZP0H 1H1BA 1C1TA 2H5DA 5G4BA 4BTUB 2I6QA 3UR9A 1LVBA 4AFUA 2FLBH 2QIQA 1PPFE 4BTIB 5T3HA 1ZTKA 1IAUA 3ZZ7A 1QFKH 5EPNA 4XDEA 2BDBA 3IWMA 1QB9A 4SGAE 5EU8A 1EZQA 5H4IB 3FP8E 2ZU2A 3RUOA 1SGQE 3E0NB 1GG6C 2BLWA 2ZHDA 3OX7U 4INKA 2Z7FE 5C1UA 4X6OA 1CO7E 1LVMA 1NN6A 1O5GH 1SVPA 3JZ1B 1W0ZU 1DWDH 1ZSJA 4IBLH 3GY7A 1GMCF 2J92A 1C2HA 3LGUA 3Q3XA 3P8FA 1TGNA 1LTOA 1OP8A 2BDYA 1CT4E 5AVDA 2SGDE 2XBWA 4UE7H 5HM9A 2Y81A 3LC5A 1QQUA 5BPEA 1GBBA 2GCHF 1ELAA 3LC3A 2J9NA 1VITF 3Q76A 4FUEA 4ESTE 1ANCA 4DVAU 4IC5A 2SNWA 1V2JT 4B76A 1TPAE 4TYDA 1CU1A 2VVVA 3EA7A 5HM2A 2SGAA 4KTCA 1Y8TA 3MO6A 4X0WU 1BTXA 3P8GA 4MPWA 4WMFA 2VIPA 1SQOA 1V2ST 1LVYA 3ZVGA 1O2TA 1FY8E 1MTSA 1QBVH 4J1YA 1V2RT 4TWYA 5CMXH 3SGBE 1D9IA 2ZTXA 3ZZDA 4CRDA 3MFJA 1H9IE 4ABJA 4AGJA 2BHGA 4D9QA 1BOQA 2VH6A 4O03A 1AHTH 4IGDA 4WY3A 3EA8A 4INLA 1F0RA 1FONA 1F2SE 1VGCB 2F83A 3Q77A 9ESTA 2C8ZB 2B0FA 2VB0A 4H6SB 3SBKA 1N8OC 3AW1A 3Q00A 2R0KA 4I31A 1Z7KA 1P0SH 1SQTA 1W7XH 4F49A 4I8HA 4D76A 4K2YA 2BDCA 1MTWA 1GJ8B 3A89A 1XX9A 2FX6A 1GVZA 1BTYA 3GY3A 1O3DA 1BITA 1TX6A 1S84A 3TJVA 3ZYDA 5DK1A 1GG6B 1MZDA 2W7UA 1ZLRA 3CS0A 3GISB 1DY8A 3TNSA 1AQ7A 1KY9A 1O31A 1UCYE 3HATH 4XBBA 8KME2 2ZWLH 2W7SA 1O5DH 1O2OA 4F4OC 6CHAC 2C90B 1W13U 1HAVA 4NCYA 5A0AE 1MU6B 4JZFH 2TGDA 4LZ4B 1WQVH 1LHGH 4WMEA 2EI7A 1A3EH 3DFJA 2BLVA 3RU4T 3EE0B 1P2NA 4D7GA 4IN2A 1P3CA 1LCYA 1J15A 1PPGE 2ZTYA 2ZC9H 1GDNA 1SGFG 3TGJE 1ELTA 4MPVA 2AMDA 5EQQA 1O2JA 3G01A 1V2KT 1PYTC 1WOFA 3QWCH 1UK4A 2ZA5A 2ULLA 2Z3DA 5ABWA 5A8YA 2XCNA 1HFDA 2QF3A 4CHAC 3QTOH 4DY7B 2TPIZ 1TOCB 1FAXA 1KLTA 1TGBA 3FAOA 1MTNC 3VB5A 2F3CE 1DICA 5E2OA 1SLWB 1UK2A 1WBGB 1OWKA 1ZZZA 5AF9H 2XCFA 5FAHA 1GHBF 1FIZA 1A0JA 4NA8A 2R9PA 1N8OB 1B7XB 3DT0H 4AX9H 3ZZCA 5HGGA 4FU7A 1CHGA 1EJMA 1C5NH 3SGQE 1MQ5A 3A7VA 3SORA 2WPMS 4NZQA 3BF6H 4NA7A 1CE5A 4BOHA 4IMZA 3ZVAA 3BIUH 3H7OA 4H42U 1GMCG 3A8CA 1HAOH 4R8TB 1C4V2 2WPLS 3TGKE 1KTTB 4DT7B 2O8UA 5DKMA 4AORA 1K1JA 4MNYA 2ZHWH 1DSUA 2NU0E 3ZZ3A 4X1QU 2B7DH 4AGKA 4JZIA 3V12A 1OYTH 2GCHG 2GX4A 1VITG 1V2UT 3BIVH 2Z3CA 5DP5A 1W7GH 1IQMA 3ZZ4A 1S83A 1QGFA 2OQ5A 4ZH8A 1T7CA 4AB9A 1IQFA 2Z3EA 3E1XB 4NSYA 3MNCA 1O2XA 3UUZA 4X1RU 3FVFB 2HOBA 3MU0A 1TFXA 1JIMA 4DIIH 1HIAA 1KXEA 1GI4A 5JBCS 4NIVA 1TNGA 1Y59T 3EQ0H 4WH8A 3SNBA 3E6PH 2JKHA 1K1PA 1S5SA 2FMJA 1O3GA 1NRSH 3BTEE 3S9AA 1W0YH 2F9PA 4DOQA 1BB0B 3MU5A 1XM1A 1C1RA 4CHAB 1GBFA 2VWLA 1PPEE 4BANB 1KTSB 1WU1A 1ZHMA 4A1XA 1WQSA 3B9FH 4UEHH 1A46H 1NTPA 1TX8A 5HMAA 3RU4E 1M9UA 3IG6B 3BTHE 5L2ZH 3HK6B 2GZ9A 3SJ9A 5FPTA 4AB8A 1TNKA 4ZKOU 2BX3A 3ODDA 4B2CA 2GP9B 2F9BH 1A5IA 1KDQB 2NU1E 2OC1A 1TX7A 1QJ1B 2VVUA 3MO9A 1YKTA 5EODA 5LPEA 3GCTF 1YC0A 1YP9A 4K8BA 1P10A 2FODA 1BDAA 3P95A 3SNDA 2FYRA 3GICB 4NFFA 1IHSH 4Z6AH 1L4ZA 1YPHE 3D49H 3GOVB 1DITH 5DGJA 4ZXYH 1BRUP 1H8DH 2B9LA 2FI4E 3ESTA 3SO3A 1HAGE 1Y5AT 4XBCA 4VGCC 1J14A 2THFB 3MNBA 1F7ZA 1T8MA 1UCYK 1G2MA 4ISHH 3MH4A 2NU3E 3A8DA 3PYHA 3DA9B 1GL0E 2WPJS 3LKWA 4YO9A 2YOLA 4X2WA 1NRNH 2J38A 1Z8RA 1MD8A 1EAXA 1O39A 2ANYA 4MVNA 4RN6A 1KXDA 2FXRA 4TPYA 6ESTA 2R2MB 2FTMA 3F68H 2J2UA 1ZMLA 4ZUHA 3CS7A 1PQ7A 1OWIA 2HRVA 3ZVCA 1C2LA 1ETTH 2GVFA 4GHQA 2RCEA 1HXEH 2WUBA 3RM2H 3ZVBA 4X6MA 1GHBG 2ZPQA 1YLCA 2SGFE 5K0HA 3ODFA 4OGXA 1AN1E 4I8GA 2BB4A 2VINA 2O9QA 2FI5E 3SU5A 3KF2A 3BEFB 3R3GB 1Z8JB 1O3BA 1EJNA 4Q2KA 2VIWA 2PKAB 2C93B 1LQEA 1OSSA 2A45B 1YPJH 2QC2A 4IMQA 1P12E 4BXSA 2O8MA 1AVXA 3UNQA 4FUCA 1AFQC 1XUJA 1KIGH 1NFXA 4AOQA 3BTTE 7ESTE 3V3MA 5DPAA 1C5RA 5E0JA 2HPPH 5F6MA 1DY9A 4A92A 3GDVA 1ABIH 3SU3A 1FY4A 1L4DA 1F5RA 2AGGX 4ZHLU 3LGYA 1V2OT 3RU4D 5J4SA 3MU8A 1OS8A 1O2ZA 1GJCB 5DP8A 1DPOA 1YPMH 3KGPA 3RC5A 1WUNH 1GBCA 1HJAC 3ZZ5A 4ABEA 2BXUH 1THRH 3UOPA 1CBWC 1G3DA 2FEQH 1O2GH 1K22H 3A81A 1GCTC 3SUGA 5C5OA 1CQQA 1QJ7B 2P59A 2BOKA 1QB1A 1EX3A 1DANH 1RGQA 2ZIQH 3LOXA 4X1PU 1BTWA 1GI3A 1FPHH 1TIOA 1MCVA 1C2MA 2FTLE 1C2KA 3QGNB 3AW0A 2ZKSA 4GHTA 3SJIA 4Q80A 3ATIA 1SFIA 2ASUB 3PMBB 1BMLA 3QO6A 5LPRA 3PTNA 4MPXA 3A7XA 1QR3E 3RMMH 1BHXF 4UFDH 1C5SA 1QRWA 1BUIA 3ZVEA 1ELGA 3OU0A 3GCHB 4ABGA 1P2IA 4MPUA 2W3IA 3BG8A 4FU8A 1W2KH 5JB8S 1EUFA 1G3BA 4HGCA 3SQHE 3FZZA 5EXMA 4B75A 1P09A 1EAWA 2C8YB 1W10U 3RXJA 1G3EA 3V13A 1UMAH 2JH5D 2G52A 4MQAA 3S69A 3ATMA 1SPJA 3SI4H 3RXUA 1C2EA 1FNIA 3MYWA 2FOMB 1TLDA 2A0QB 2FS9A 5IYTA 1UVOA 3SJKA 2EC9H 2J95A 3RXCA 2UWPA 1Q31A 2A4GA 3FFGA 1ID5H 4NG9H 2OC8A 4O97A 4WJG2 2CHAB 3U9AH 2P3FH 4WMDA 1AFQB 3O8BA 3TGIE 1IHTH 1C5XB 3GCTG 1P57B 1P9UA 1L1NA 5EW2H 2PV9B 1GGDB 4TY6A 1AO5A 1SC8U 2A4OA 1O3FA 3UPEA 3A82A 1BTHH 2ODYB 1IOEA 1DM4B 3M5LA 4KELA 1ELBA 2V3HH 1CBWB 2FOAA 1SLUB 4ZMAH 4YLQH 2P8OC 1DUAA 1GCTB 1YGCH 1E0FD 5C20A 3LH3A 3RC6A 3M3TA 3BEUA 1S85A 1H4WA 2XNIA 1NC6A 2WPKS 4JZ1A 3URDA 3VGCC 5ETXA 3D65E 2BD8A 1J8AA 5EQRA 2H9HA 1UJ1A 4X2XA 3MMGA 1O3HA 4RKJB 2P16A 3NZIA 4NIYA 4WXVA 1QRZA 1DUEA 1BRAA 3RXPA 1D6WA 1E34B 3M61U 1AIXH 2ZGBH 1TPSA 2AMPA 2VWNA 3V0XA 1ZRKA 3K9XB 1AFEH 3TIUA 5A0BA 1F0TA 3QZQA 1GHXH 2ZFRH 1UO6A 3M5NA 3KCGH 4K1EA 4MNXA 4GPGA 5FPSA 5I25A 2Z9LA 1O2YA 4DCDA 1GI8B 1TABE 2BOHB 2VNTA 3MH5A 2ZU1A 2H5CA 2A7CA 3W94A 2ZFQH 3F6UH 3QN7A 1MKWK 1Y5BT 2ANKH 3RXEA 3SV6A 1VGCC 2ZGCA 4OS1A 5JBAS 2XC0A 5L30H 1O38A 1HGTH 2O8TA 1NFWA 3SNCA 2G4UA 1QQ4A 4D9RA 2W3KA 3VB4A 1FLEE 6GCHF 1D3TB 1EPTC 1QIXB 3QDZB 1GVLA 1C5PA 4Y8ZA 1FV9A 2AIPA 1GDUA 3GYMA 1T4UH 1TRYA 2BXTH 2BZAA 2ODPA 1OOKB 1Q3XA 3A88A 3A8AA 2GT7A 3SU2A 2FZZA 2DE8A 5C1YA 2Z9IA 3GY6A 3MOCA 4H6TA 5AFYH 3SUEA 3MO3A 4A1VA 1HAZB 2QN5T 1AE5A 5JPMH 2GT8A 1ZJDA 3ELAH 4FUJA 4HI3A 4XFQA 1P05A 4FUIA 2P8OB 1B0EA 4KGAA 3OY5U 1FJSA 3L6PA 1GBLA 1UTMA 2RA0A 1SL3A 1DOJA 1C1NA 1JWTA 1C2IA 2R3UA 1IQIA 3FP7E 1BBRE 3VGCB 3T2NA 3F9FA 4OS5A 1RTLA 2P3TB 4CRFA 1GCDA 3RXBA 1BTUA 2ZPRA 4ABDA 1EP6A 1T32A 2V3OH 1MD7A 1FQ3A 2WYGA 3UTUH 3F9EA 5L6NH 3TJNA 1TNIA 1RD3B 2D26C 1DDJA 1AWFH 2WPHS 4YT7H 1ABJH 1GI2A 2OC7A 1QCPA 1SGRE 1V6DA 2ZTZA 1PQ5A 4E06H 4JZEH 1EB2A 2QXGA 4Y79A 1XUHA 4AYYB 4CR9A 3SUFA 3GY2A 4K60A 1SI5H 1G9IE 3HGPA 4RKOB 1MU8B 2ZZUH 2ALVA 2BVSH 1FDPA 1TQ0B 3GDSA 3VXFH 2R2WU 2GDEH 2ZGHA 1KXFA 4ABBA 5IDKA 1NY22 1TBQH 2H6MA 2Q6FA 3A7YA 2ZQ1A 1GVKB 1ESBA 2F9VA 1PYTD 1CSOE 5LGOA 1CGIE 2AFQB 4WF8A 2Z6BD 3P70B 4TPIZ 3UOUA 1HCGA 1P3EA 1OKXA 1EPTB 3UNSA 3M3VA 1YF4A 4B74A 3LGIA 1OWJA 1DWEH 1C2JA 2GV7A 1YPKH 1NRRH 2CMYA 1INCA 2BD9A 1AUJA 4JYTA 4ZAEA 2JETC 1F92A 2GD4B 2QGRA 1XKAC 3C27B 2I6SA 1LVOA 3LT3A 3ITIA 2G00A 2ZU4A 2VIOA 1O32A 2PTNA 2HNTE 1NFUA 4DGJA 1A1RA 2CJIA 4AYVB 1LQDB 4X8UH 3RXDA 2ZCHP 3ZV8A 1S6HA 1NM6A 4E05H 4UFFH 1O5EH 4ISIH 1C5TA 4CBNA 1JOUB 1LDTT 1KXAA 3H7TA 2A4RA 2EI8A 2AIQA 2ZU3A 3U1JB 2FDAA 2PUQH 1O5AB 3GY4A 2Q6GA 1ZR0A 3PTBA 5EGMA 2XW9A 1Z6JH 3GCNA 3RP2A 3KQEA 4JCNA 1BBRH 1E37B 1QL7A 1XUGA 5BRRE 1SBWA 4B2AA 1YCPM 3VPKA 1NU7B 3OTJE 5TCCA 1LPGB 3U69H 2ZCLP 1EZUC 3URCA 4PROA 1IQJA 1SGPE 4I7YH 1DWCH 1O3AA 2A4QA 1AY6H 1ZGIA 2ZHEH 3RXLA 3D62A 5FBIA 2F9UA 1C5YB 5SGAE 4DJZB 1C1OA 6GCHG 2PFEA 1H8IH 2VVCA 1G3CA 1L0ZA 1THPB 3RXSA 5DP7A 2LNCA 3L33A 1EP5A 5DG6A 3MNXA 3STJA 2RDLA 1JXPA 1YBWA 2OD3B 1NS3A 3M7TA 1RJXB 1FUJA 2BQ6B 2J4IA 4ZHMU 1Y5UT 2OLGA 3RMOH 1HXFH 1BT7A 3TK9A 5EXLA 5F03A 3RXFA 1LHFH 3VB7A 4FUFA 4X8VH 1ELDE 4BAOB 4YT6H 2JETB 4Y0ZE 3U8OH 1TNJA 2C8XB 2PW8H 4NZLA 1ESAA 3MU1A 2QCYA 1K28D 2PSXA 4MG3A 4BTTB 1A0LA 2CF8H 2BY8X 1GJBB 3FANA 2ZDKA 2D1JA 2PTCE 3PM3A 1HB0B 2NWNA 3BTFE 3T27A 1BTZA 2XC5A 1T31A 7GCHF 4NIXA 1DT2A 2Y80A 4AN7A 1SGDE 2A7HA 1YM0A 5F8TA 4K1TA 2FP7B 8ESTE 1PQAA 1AGJA 1TYNA 1Z71A 3UQOA 2A7JA 3SV9A 3RXKA 5TJXA 2OC0A 5FX5A 4IW4E 4Y6DA 2GMTB 1BBRK 1O30A 3SJOA 5GPIB 1SSXA 1H9HE 1G37A 1O33A 2BLQA 5EQSA 2GCTB 2EEKA 2P93A 4CREA 5PTPA 4J2YB 1ZPCA 1GMDF 4INHA 2FO9A 5C3NA 1G36A 2QAAA 3ZZAA 2VH0A 1CGHA 1ELFA 1LKAA 4ABIA 2BYAX 3QK1A 4FUBA 2F9OA 3PROA 4I8LA 4OS2A 1DLKB 3A8BA 1AU8A 3PO1C 3ZVFA 1C5VA 3E0PB 1QA0A 2TGPZ 2VIQA 3BG4C 5CE1A 4IC6A 3SV8A 1YLDA 4OS7A 4B73A 1ELEE 5CHAB 1VJ9U 4B2BA 2JH6D 1YPGH 2ZFTA 3DHKH 1V2TT 1TGCA 2OTVA 4D8NA 1C5ZB 2ZFSA 1P9SA 5EPYA 1OXGA 3M3SA 3H5CB 2HNTC 1GI6A 3RMLH 5GIBA 3F9HA 3SNAA 3W95A 3GYLB 2W26A 1QA7A 1O3IA 1P2QA 1L1JA 2IPHA 2TBSA 3SZNA 2ZDVH 2F91A 4YTAA 3ZVDA 4E7NA 1AMHA 2FESH 1PPHE 1O3JA 2HNTF 2ZNKH 1TALA 1IQGA 1W14U 1MKXH 4ZROA 5A8XA 4WVPE 2ZDLA 1V2NT 3AAVA 1EAUA 1SLXB 1K2I1 2XRCA 1P01A 2VJ1A 2WYJA 3VB3A 3KNXA 4GLYA 1V2MT 1CT2E 1CVWH 4A1TA 3TH4H 4XE4A 1MCTA 2CXVA 3EAJA 1ZTLA 4WXIA 1O2SA 1T8NA 1GJ6A 2OINA 3EGKH 3OYPA 4JYVH 1TB6H 2UUJB 1UK3A 3BTKE 4FVBA 1C1WH 4FUDA 1F5KU 2FOGA 3M35A 4U2WA 3L3TA 1AE8H 1EATA 2BX4A 3GCHC 4LZ1H 7KMEH 1O3NA 1GHVH 1EZSC 3A85A 1TE0A 2O8LA 1OX1A 2BD5A 3NXPA 1P03A 4BNRA 4Y0YE 1AWHB 1GI1A 1KLIH 4AFSA 4X2VA 1S81A 2V0BA 1UTOA 2C8WB 4Y11E 3RXRA 2ANMH 2BY7X 4Y71A 2FOBA 1TPPA 1ELCA 2BD7A 1B0FA 1W12U 3MWIU 3K2UA 4IN1A 3SU6A 2CHAC 3PO1B 1Z1IA 2G5VA 1ZPZA 1SQAA 1P2JA 3F9GA 3BG4B 1DVAH 1GGDC 3MHWU 4BAKB 7LPRA 1SOZA 5FXLA 3RXVA 3RMNH 4KP0A 3BTGE 1O2VA 4JYUH 1O34A 3U1IB 2G5NA 5ESTE 3M7UA 1O3LA 1RRKA 3LPRA 3MNSA 4UFGH 2IN2A 1MH0A 2WUCA 3K6ZA 4GAWA 5FX6A 3A84A 5FPYA 3LGVA 1W3CA 1HAHH 4Y8XA 5LH8A 1A5HA 1XMNB 1Q2WA 1CT0E 3HKJB 4RSPA 1CGJE 2PLXA 3S0NA 2NU4E 1LHDH 2QF0A 1TRMA 1YCPH 4BAQB 5GXPA 1QJ6B 4QT8C 7GCHG 3M5OA 1MAYA 1MKXK 4FUGA 4KTUA 4NGAH 3GCOA 3GDUA 3RM0H 1GBDA 1Z1JA 2FOEA 1PPCE 3TH3H 3UNRA 1C2FA 1O3PB 5DJ7A 1P2OA 3TH2H 1BA8B 1IQNA 4HZHA 1C2GA 3N7OA 1HBTH 5DP9A 5A2MH 1HJ8A 3VFEA 4WWYA 2OP9A 1GBIA 3P17H 2D8WA 1T8OA 2F9NA 4K1SA 1SLVB 1THSH 1GMDG 4KTSA 3SJ8A 1EAIA 1PPBH 4CRGA 2Z9JA 1SFQB 2W5EA 1FN8A 3MU4A 1BMNH 3PV4A 2FWWA 2ZDAH 8GCHF 1GHYH 5E2PA 2BZ6H 1RS0A 3A7TA 1ANBA 3FZDA 1C5QA 1O3OA 1UVUH 3UQVA 2ZFFH 1PPZA 1UVTH 2CN0H 4XOJA 2SGQE 2FPZA 4XSKU 1C4Y2 1NPMA 2A31A 3AVZA 3I77A 1HAVB 2FX4A 4K3JA 3O8CA 3KQDA 5DP3A 1XVMA 3BTQE 1C2DA 1UTPA 3RDZA 5A8ZA 2HALA 3RXMA 4CH8B 1VZQH 4Q7YA 1O5CB 2OBQA 3QUMP 3ZZ8A 5HXFA 2Y5FA 4UONA 5EXNA 1EZXC 1L2EA 2CGAA 1GJ9B 1GI9B 3F1SB 3FP6E 1JBUH 3RXHA 3TK5A 1O2UA 3BEIB 1QY6A 3LJOA 3PB1E 1ZSLA 4FU9A 2G4TA 5JDUB 2PSYA 4GCHF 1GHWH 2C4FH 1KLJH 1Y3YA 1FY5A 3U8RH 1GMHF 3B23B 3UWIA 4CBOA 5T6FA 1CA0B 2G8TA 3ATLA 4BAMB 1X7AC 1XXDA 1LPZB 1AKSB 3NUMA 1AZZA 2AMQA 2BLOA 2XYAA 1DXWA 2QXHA 2AS9A 1IQKA 1PJPA 2UUKB 1O2QA 3GY8A 4Y7AA 1NRQH 3PMJA 1K9OE 1SHHB 3M7QA 1AZ8A 1O2RA 1KDQA 2LPRA 2ZHFH 5T6GA 1PQ8A 2BY5X 1SG8B 2XXLA 1TBZH 1K1OA 3TNTA 1XKBC 3ZYEA 3TJOA 1C5LH 2UUFB 1C1UH 1NT1A 1VITH 1O2KA 1O2HA 1XVOA 1Y3WA 1NESE 4U01A 4Y76A 2ZGJA 1GBTA 2HPQH 3LGWA 1DE7H 1HNEE 1O5FH 1ZYOA 3CP7A 1TMBH 4WH6A 2Y6TA 2ZGXH 1XUIA 4LXBH 2GZ8A 1AUTC 1AI8H 2PHBA 4I32A 3U98H 2BD4A 1C5OH 1V2VT 2EI6A 1KYNA 4A6LA 2JH0D 1HYLA 1NZQH 2A1DB 1ZPBA 4THNH 4U30A 3RXQA 2STAE 1A4WH 2OXSA 1HIAB 1SGIB 1K21H 3S9BA 1O0DH 4JK5A 1TWXB 1TAWA 2ZCKP 1TBRH 2GGVB 4ABAA 2WINI 3HKIB 5J4QA 4GVUA 4MDSA 1D3PB 2ANWA 4OS6A 2BMGB 3BSQA 3E8LA 1O2NA 1RFNA 1O2LA 3K65B 2ZECA 1BCUH 2G81E 1SB1H 5K7RA 5GDSH 8LPRA 1P04A 3SU1A 3LIWA 2PKAA 1HV7A 5L2YH 3SU0A 3BTME 5GCHF 1VCPA 3QZRA 3T29A 2Y7XA 1IQEA 3KQBA 5HYOA 3SHAH 3TLOA 2AERH 1SMFE 1OPHB 1RIWB 4I8JA 4ISOA 4DURA 1C5WB 1GWAA 2AH4X 3BTDE 4OGYA 5A09A 8GCHG 1A7SA 2P3UB 2ZFPH 2GKVE 1T4VH 4K8YA 1AVWA 4H4FA 3OSYA 1TGTA 2XC4A 2AEIH 3UIRA 3HGNA 1ZOMA 3UFAA 4XBDA 3QLPH 5EG4A 5GJ4B 1EASA 4X6NA 5EW1H 3Q3YA 1A3BH 1OWHA 1T8LA 5ESBA 1KXCA 3O8DA 3MH6A 1S0RA 3SGAE 1BZXE 1SGNE 3UY9A 2QV1A 1SGTA 1MUEB 2WV5A
chains in the Genus database with same CATH superfamily
1HUTH 1ETRH 2SGPE 2XBYA 3S7KB 4AZ2B 1DLEA 1GJDB 3HPTB 2QXIA 4B71A 4ZKSU 2XWAA 3VEQB 1N6YA 2RG3A 1GL1A 4YZUA 1NRPH 3HK3B 2SNVA 1EKBB 1ZMJA 4UD9H 1O37A 3DD2H 4GCHG 4Y10E 3MH7A 1TONA 2TGTA 1Z6EA 3DCLA 1FMGA 1GMHG 2KAIB 4DW2U 1UTLM 1DWBH 1L1GA 2QXJA 2G55A 2Y5GA 1V3XA 5FCRA 1E1QD 2Z9GA 5DP6A 2K0QA 1IQHA 4MTBA 3TVJB 2AYWA 4Z0KA 2H9EH 1QL9A 4SGBE 5DP4A 2FS8A 2FYQA 3FO8D 1FY3A 1J16A 3QX5H 1QNJA 1UTNA 3QGJA 1C4U2 1ARBA 3PMHB 4E7RG 4JMYA 4Q7ZA 1N1LA 1O5BB 4CH2B 2Q6DA 2A5IA 1DX5M 1TMTH 3M37A 2BVXH 3A87A 1A2CH 2GMTC 4ZCNA 3ZV9A 1ANEA 1VCWA 4AFQA 1ZJKA 2ZDMA 4TWWA 3AASA 2STBE 3LH1A 1LHCH 2VU8E 2ODQA 1EFRD 3UWJH 4GSOA 2GCTC 1QHRB 3RXGA 2QY0B 2ZU5A 2BTCE 2VIDA 1MTVA 3SN8A 3VB6A 1CHOF 1J9CH 9LPRA 4FUHA 3VXEH 5JBBS 1G2LA 3MTYA 1GJAB 3E3TA 1C1SA 2A5AA 4NSVA 3CENA 5E0HA 3QTVH 1C1MA 1F0SA 1BMAA 1N6XA 4IS5A 2CK3D 1UW7A 2YNBA 1O2PA 1O3MA 1K1NA 1GI7B 5JBTA 5E8EH 1MAXA 3JZ2B 4MNVA 4MLFB 3V7TA 1TNHA 1AB9C 1D3QB 2BD3A 1P02A 1A0HB 4O9VA 1MMJN 5CHAC 4I33A 1JIRA 1SHYA 1FN6A 2FOCA 2ZO3H 3OEED 3SV2H 3BV9B 2BQ7B 1UTQA 1AKSA 4OS4A 2FI3E 3A86A 4O3TA 2BDGA 5FHTA 2DE9A 4ZKNU 2FIRH 3TPIZ 1E36B 1GJ4H 2PGBB 2Y5HA 3M5MA 1QL8A 3NKKA 1JMOH 1UHBB 3M36A 2H9TH 1C1QA 1WTGH 2BDHA 1V2PT 2WPIS 1BIOA 3NCLA 3U8TH 1GJ7B 4UFEH 3KYFA 1OWDA 2M5TA 1LO6A 4I86A 3ZZ9A 1SGCA 2PUXB 1FI8A 1G30B 4X8TH 3D23A 4Y7BA 3KL6A 3Q3KA 5GCHG 2C3SA 2J34A 1QTFA 1TOMH 1P11E 1WAYB 4I8KA 3RXTA 4DG4A 1VR1H 3KEEA 4CR5A 1ZHPA 1TPOA 2PWXA 5EOKA 1TQ7B 1W11U 1F0UA 3SV7A 1HLTH 4NFEA 3DUXH 6CHAB 1DFPA 1P2KA 2A32A 1XUKA 2SFAA 2GJGA 2VIVA 1EXFA 3SU4A 1EOLA 1WCZA 2BD2A 2ESTE 4B6EA 2SGEE 2ZDNA 4ISLA 3T25A 2Z9KA 3TJUA 1UCYH 3RLWH 1OP0A 2YNAA 2XBVA 2M2AA 3I29A 4A7IB 4YESB 1DXPA 1HAIH 2BY6X 5AFZH 1E35B 1LKBA 3NWUA 2HVXA 5C1XA 2VWMA 3LJJA 1FY1A 5B6OA 1S0QA 3R0FA 2GDDA 1BJUA 1Y3VA 4CRCA 1ETSH 4AFZA 2XBXA 2HVYB 2B8OH 1TGSZ 1KXBA 1ZHRA 1EJAA 2PGQB 2RDEA 1EOJA 1GBAA 3DSPA 4UDWH 4BXWA 1ARCA 2A2QH 2L74A 1AB9B 1SOTA 2PR3A 1F5LA 4HG6A 3EDXB 1JRTA 2K1QA 4X2YA 3EA9A 1MTNB 1WV7H 4FXGH 3T62A 5JB9S 3SW2B 4NA9H 4Q7XA 3PLPA 1TNLA 3P8NA 1XUFA 2GTBA 4FVDA 1VKYA 2NU2E 1VCQA 1ZSKA 3LU9B 1BRCE 3LDXH 1D4PB 3PLKA 1BJVA 1O3KA 1TMUH 2OQUA 2WV9A 1K1MA 5F8ZA 2G51A 2OCVB 2WV4A 2QA9E 2EY4C 1P8VC 3IITA 2TIOA 3K6YA 2HGTH 3A83A 2AGEX 1O36A 4ABFA 4D7FA 1SGFA 5A0CA 1MBMA 1GJ5H 1OYQA 2R0LA 1TA2A 1YYY1 2TRMA 1SGEE 3PMAB 1AVGH 4K69A 2HLCA 1QB6A 2KR7A 1TRNA 1BMFD 2BY9X 5FBEA 3T5FH 2YMSD 2OBOA 1ELVA 2VGCC 1LHEH 3A7WA 5JYIA 1GI0A 1PFXC 1A5GH 1GHAF 1EB1H 1ORFA 1GPZA 4GUXA 4AG1A 4ABHA 2LP6A 4YLUA 4CRBA 4M7GA 3UR6A 1QBNA 2ALPA 1CHOG 1EPTA 1V2WT 1O2WA 4BAHB 1DS2E 4DIHH 4YOGA 3S9CA 2ZI2H 3TITA 3T28A 1WTHD 1A61H 1GHZA 2ZG0H 5KECA 1P06A 1GI5A 1J17T 1UVSH 2KAIA 4ACBA 1HRTH 1NROH 3C1KA 1O3EA 1SR5C 3I78A 3FKSD 2V6NA 4HFPB 1OWEA 1GBMA 1WYKA 1QBOA 3DFLA 1MQ6A 4JZDH 2ILNA 5C2ZA 4NWKA 3KQCA 5TCAA 2AGIX 3UREA 2TGAA 1RTFB 1C9TA 2A5KA 3OY6U 1GBKA 1Z8IB 5FL7D 4X8SH 4CRAA 4AG2A 3RXAA 3T26A 2UWLA 3PWCA 1H9LB 1XXFA 2UWOA 1HAPH 1NU9A 3P92A 2Y82A 1ZRBA 3RXOA 5I46H 4X1SU 2HWLB 2ZQ2A 4LK4A 2P95A 3P8OA 1YPEH 1RTKA 2GZ7A 2UUYA 2XTTB 1O2MA 5C5NA 3RC4A 3O8RA 2FLRH 2J94A 1Z8GA 2GV6A 3ATWA 1CA0C 3KHVA 1E38B 1FPCH 3STIA 4A5TS 1P2MA 1FAKH 2BM2A 3ENSB 5F8XA 1RXPA 4YOJA 2QE7D 2VGCB 3SOSA 4Y8YA 3WWBA 3NK8A 3PLBA 3SQEE 2BDIA 2H1UA 4ZXXH 1WSSH 2CF9H 4ISNA 5AHGH 5DO4H 2A2XH 4RT0A 4VGCB 3RXIA 1S6FA 5GWZA 2F43B 1C1VH 1U6QA 2Q1JA 1SKYE 3LONA 1LPKB 1YY3A 3BTWE 3WY8A 3KN2A 3PWBA 2DUCA 3S7HB 5C67A 1O3CA 3LGTA 2P94A 1UHBA 4R0IA 3KIDU 1GBEA 4MNWA 4ASHA 2R3YA 1C5UA 1ZTJA 2BVRH 2PKSC 1SGYE 3E16B 4XD7D 1GBJA 1LMWB 1GDQA 1MZAA 3SUDA 5T6DA 4B1TA 2IOTA 2EQNA 1GBHA 2D2DA 3MI4A 3SHCH 1MKWH 2Z94A 1V2QT 4F48B 1O35A 1K1IA 2IJOB 1C1PA 2H2ZA 4HTCH 1TA6A 1W8BH 1MBQA 1BQYA 3TK6A 2OUAA 1HAXB 1ZGVA 1Y3UA 3P6ZB 2KZ4A 4K5ZA 4X1NU 3SI3H 1C5MD 1C9PA 1QRXA 3E90B 1NO9H 1YCPK 1DSTA 1HDTH 3PRBA 1V2LT 1K1LA 2W6JD 2QYIA 1YPHC 4NWLA 1FXYA 1IQLA 3B8JA 4LOYH 4YM9A 1FIWA 3RLYH 1OP2A 1YPLH 2B5TB 1S82A 4KKDA 1GHAG 3NPSA 1HJ9A 1MTUA 3ZZ6A 1HJAB 4YOIA 2ZEBA 2ZF0H 3A7ZA 1D3DB 1HPGA 3TU7H 1BRBE 2ZHQH 1UTJA 3GY5A 4ZKRU 1RIWC 4ZHAA 2RA3A 3CNRA 1ZMNA 3EYDA 6LPRA 1BMMH 1BTPA 2V35A 1O2IA 2ZPSA 1KSNA 2VWOA 1CA8B 1BHXB 1Y3XA 3ZZBA 3SNEA 4O3UA 1G32B 5FCKA 2O8WA 1D6RA 1ANDA 1JRSA 1VJAU 4JK6A 3BN9A 1NFYA 1UVPA 2CV3A 1FZZA 3E91A 2EA3A 5E0GA 1B5GH 2FOHA 2FOFA 2BDAA 4X6PA 2PKSB 1AD8H 2XWBI 1QURH 1UTKA 5LPFA 4NIWA 1ESTA 4TY7A 3A80A 3ATKA 2Y7ZA 4U32A 1ACBE 1EQ9A 2FM2A 2BQWB 3AAUA 1HAYB 2ZP0H 1H1BA 1C1TA 2H5DA 5G4BA 4BTUB 2I6QA 3UR9A 1LVBA 4AFUA 2FLBH 2QIQA 1PPFE 4BTIB 5T3HA 1ZTKA 1IAUA 3ZZ7A 1QFKH 5EPNA 4XDEA 2BDBA 3IWMA 1QB9A 4SGAE 5EU8A 1EZQA 5H4IB 3FP8E 2ZU2A 3RUOA 1SGQE 3E0NB 1GG6C 2BLWA 1H8ED 2ZHDA 3OX7U 4INKA 2Z7FE 3OEHD 5C1UA 4X6OA 1CO7E 1LVMA 1NN6A 1O5GH 1SVPA 3JZ1B 1W0ZU 1DWDH 1ZSJA 4IBLH 3GY7A 4Q63A 1GMCF 3WWFA 2J92A 1C2HA 3LGUA 3Q3XA 3P8FA 1TGNA 1LTOA 1OP8A 2BDYA 1COWD 1CT4E 5AVDA 2SGDE 2XBWA 4UE7H 5HM9A 2Y81A 3LC5A 1QQUA 5BPEA 1GBBA 2GCHF 1ELAA 2XNDD 2J9NA 3LC3A 1VITF 3Q76A 4FUEA 4ESTE 1ANCA 4DVAU 4IC5A 2SNWA 1V2JT 4B76A 5C0TA 1TPAE 4TYDA 1CU1A 2VVVA 3EA7A 3F0PA 2SGAA 4KTCA 5HM2A 1Y8TA 3MO6A 4X0WU 1BTXA 2KCYA 3P8GA 4MPWA 4WMFA 2VIPA 2VBCA 1SQOA 1V2ST 1LVYA 3ZVGA 1O2TA 1FY8E 1MTSA 1QBVH 4J1YA 1V2RT 4TWYA 5CMXH 4P02A 1W0JD 5HIZA 3SGBE 1D9IA 2ZTXA 3ZZDA 4CRDA 3MFJA 1H9IE 4ABJA 4AGJA 2BHGA 4D9QA 1BOQA 2VH6A 4O03A 5HIYA 1AHTH 4IGDA 4WY3A 3EA8A 4INLA 1F0RA 1FONA 1F2SE 1VGCB 2F83A 3Q77A 9ESTA 2C8ZB 2B0FA 2VB0A 4H6SB 3SBKA 1N8OC 3AW1A 3Q00A 2R0KA 4I31A 1Z7KA 1P0SH 1SQTA 1W7XH 4F49A 4I8HA 2WHXA 4D76A 4K2YA 2BDCA 1MTWA 1GJ8B 3F2GA 3A89A 1XX9A 2FX6A 1GVZA 1BTYA 3GY3A 1O3DA 1BITA 1TX6A 1S84A 3NRLA 3TJVA 3GS9A 3ZYDA 5DK1A 1GG6B 1MZDA 2W7UA 2XOKD 1ZLRA 3CS0A 3GISB 1DY8A 3TNSA 1AQ7A 1KY9A 1O31A 1UCYE 3HATH 4XBBA 8KME2 2ZWLH 3N7EA 2W7SA 2JJ2D 1O5DH 1O2OA 4F4OC 6CHAC 2C90B 1W13U 1HAVA 4NCYA 5A0AE 1MU6B 4JZFH 2TGDA 4LZ4B 1WQVH 1LHGH 4WMEA 2EI7A 1A3EH 5GNDA 3DFJA 2BLVA 3RU4T 3EE0B 1P2NA 4D7GA 4IN2A 1P3CA 1LCYA 1J15A 1PPGE 2ZTYA 2ZC9H 1GDNA 1SGFG 3TGJE 1ELTA 4MPVA 2AMDA 5EQQA 1O2JA 3G01A 2JJ1D 1V2KT 1PYTC 1WOFA 5EJLA 3QWCH 2WPDD 1UK4A 2ZA5A 2ULLA 2Z3DA 5ABWA 5A8YA 2XCNA 4ASUD 1HFDA 2QF3A 4CHAC 3QTOH 4DY7B 2TPIZ 1TOCB 1FAXA 1KLTA 1TGBA 3EE7A 1MTNC 3FAOA 3VB5A 2F3CE 3FN8A 1DICA 5E2OA 1SLWB 4AC9A 1UK2A 1WBGB 1OWKA 1ZZZA 5AF9H 2XCFA 5FAHA 1GHBF 2QF4A 1FIZA 1A0JA 2PP6A 4NA8A 1MABB 2R9PA 1N8OB 1B7XB 3DT0H 4AX9H 3ZZCA 5HGGA 4FU7A 1CHGA 1EJMA 1SQRA 1C5NH 3SGQE 5EJZA 1MQ5A 3N7DA 3A7VA 3SORA 2WPMS 4NZQA 3BF6H 4NA7A 1CE5A 4BOHA 4IMZA 3ZVAA 3BIUH 3H7OA 4H42U 1GMCG 3A8CA 1HAOH 4R8TB 1C4V2 2WPLS 3TGKE 3SZEA 5EJ1A 1KTTB 4DT7B 2O8UA 5DKMA 4AORA 1K1JA 4MNYA 2ZHWH 1DSUA 2NU0E 3ZZ3A 4X1QU 2B7DH 4AGKA 4JZIA 3V12A 1OYTH 2GCHG 2GX4A 1VITG 5KGOA 3MQKC 2KM0A 1V2UT 3BIVH 2Z3CA 5DP5A 1W7GH 1IQMA 3ZZ4A 1S83A 1QGFA 2OQ5A 4ZH8A 1T7CA 4AB9A 1IQFA 2Z3EA 3E1XB 4NSYA 3MNCA 4Q4LA 1O2XA 3UUZA 4X1RU 3FVFB 2HOBA 3MU0A 1TFXA 1JIMA 4DIIH 1HIAA 1KXEA 2RFKC 1GI4A 3KYGA 4NIVA 5JBCS 1TNGA 1Y59T 3EQ0H 4WH8A 3SNBA 3E6PH 1FX0B 2JKHA 1K1PA 1S5SA 2FMJA 1O3GA 1NRSH 3BTEE 3S9AA 1W0YH 2F9PA 4DOQA 1BB0B 3MU5A 1XM1A 1C1RA 4CHAB 1GBFA 2VWLA 1PPEE 2KCOA 4BANB 1KTSB 1WU1A 1ZHMA 4A1XA 1WQSA 3B9FH 4UEHH 1A46H 1NTPA 1TX8A 5HMAA 3RU4E 3PRDA 1M9UA 3IG6B 3BTHE 5L2ZH 3HK6B 2GZ9A 3SJ9A 5FPTA 4AB8A 1TNKA 4ZKOU 1NBME 2BX3A 3ODDA 4B2CA 2GP9B 2F9BH 1A5IA 1KDQB 2NU1E 2OC1A 1TX7A 1QJ1B 2VVUA 3MO9A 1YKTA 5EODA 5LPEA 3GCTF 1YC0A 1YP9A 4K8BA 1P10A 2FODA 1BDAA 3P95A 3SNDA 2FYRA 3GICB 4NFFA 1IHSH 4Z6AH 1L4ZA 1YPHE 3D49H 3GOVB 1DITH 5DGJA 4ZXYH 1BRUP 1H8DH 2B9LA 2FI4E 3ESTA 3SO3A 1HAGE 1Y5AT 4XBCA 4VGCC 1J14A 2THFB 3MNBA 1F7ZA 1T8MA 1UCYK 1G2MA 4ISHH 3MH4A 2NU3E 3A8DA 3PYHA 3DA9B 1GL0E 2WPJS 3LKWA 4YO9A 2YOLA 4X2WA 1NRNH 2J38A 1Z8RA 5F53A 1MD8A 1EAXA 1O39A 2ANYA 4MVNA 4RN6A 1KXDA 2FXRA 4TPYA 6ESTA 2R2MB 2FTMA 3F68H 1QZ8A 2J2UA 1ZMLA 2KCPA 4ZUHA 3CS7A 1PQ7A 1OWIA 2HRVA 3ZVCA 1C2LA 1ETTH 2GVFA 4GHQA 2RCEA 1HXEH 2WUBA 3RM2H 3ZVBA 4X6MA 1GHBG 2ZPQA 1YLCA 2SGFE 5K0HA 3ODFA 4OGXA 1AN1E 4I8GA 2BB4A 2VINA 2O9QA 2FI5E 3SU5A 3KF2A 2J98B 3BEFB 3R3GB 1Z8JB 1O3BA 1EJNA 4Q2KA 2VIWA 2PKAB 2C93B 1LQEA 1OSSA 2A45B 1YPJH 2QC2A 4IMQA 1P12E 4BXSA 2O8MA 1AVXA 3UNQA 4FUCA 1AFQC 1XUJA 1KIGH 1NFXA 4AOQA 3BTTE 7ESTE 3V3MA 5DPAA 1C5RA 5E0JA 2HPPH 5C0UA 5F6MA 1DY9A 4A92A 3GDVA 1ABIH 3SU3A 1FY4A 1L4DA 1F5RA 2AGGX 4ZHLU 3LGYA 1V2OT 3RU4D 5J4SA 3MU8A 1OS8A 1O2ZA 1GJCB 5DP8A 1DPOA 1YPMH 3KGPA 3RC5A 1WUNH 1NBMD 1GBCA 1HJAC 2K8IA 3ZZ5A 2WZQA 4ABEA 2BXUH 1THRH 3UOPA 1CBWC 1G3DA 2FEQH 1O2GH 1K22H 3A81A 1GCTC 3SUGA 5C5OA 1CQQA 1QJ7B 2P59A 2BOKA 1QB1A 1EX3A 1DANH 1RGQA 2ZIQH 3LOXA 4X1PU 1BTWA 1GI3A 1FPHH 1TIOA 1MCVA 1C2MA 2FTLE 1C2KA 3QGNB 3AW0A 2ZKSA 4GHTA 3SJIA 4Q80A 3ATIA 1SFIA 2ASUB 3PMBB 1BMLA 3OE7D 3QO6A 5LPRA 3PTNA 4MPXA 3A7XA 1QR3E 3RMMH 1BHXF 4UFDH 1C5SA 1QRWA 1BUIA 3ZVEA 1ELGA 3OU0A 3GCHB 4ABGA 1P2IA 4MPUA 2W3IA 3BG8A 4FU8A 1W2KH 3U28C 5JB8S 1EUFA 1G3BA 4HGCA 3SQHE 3FZZA 5EXMA 4B75A 1P09A 1EAWA 2C8YB 1W10U 3RXJA 1G3EA 3V13A 1UMAH 2JH5D 2G52A 4MQAA 3S69A 3ATMA 5HKKD 1SPJA 1YWUA 3SI4H 3RXUA 1C2EA 1FNIA 3MYWA 2FOMB 1TLDA 2A0QB 2FS9A 5IYTA 1UVOA 3SJKA 2EC9H 2J95A 3RXCA 2UWPA 1Q31A 2A4GA 3FFGA 1ID5H 4NG9H 2OC8A 4O97A 4WJG2 2CHAB 3U9AH 2P3FH 4WMDA 1AFQB 3O8BA 3TGIE 3ZIAD 1IHTH 1C5XB 3GCTG 1P57B 1P9UA 1L1NA 5EW2H 2PV9B 1GGDB 4TY6A 1AO5A 1K0HA 1YLNA 1SC8U 2A4OA 1O3FA 3UPEA 3A82A 1BTHH 2ODYB 1IOEA 1DM4B 3M5LA 4KELA 4Z1MD 1ELBA 2V3HH 1CBWB 2FOAA 1SLUB 4ZMAH 4YLQH 2P8OC 1DUAA 1GCTB 1YGCH 1E0FD 5C20A 3LH3A 3RC6A 3M3TA 3BEUA 1S85A 1H4WA 2XNIA 1NC6A 2WPKS 4JZ1A 3URDA 3VGCC 5ETXA 3D65E 2BD8A 1J8AA 5EQRA 2H9HA 1UJ1A 4X2XA 3MMGA 1O3HA 4RKJB 2P16A 3NZIA 4NIYA 4WXVA 1QRZA 1DUEA 1BRAA 3RXPA 1D6WA 1E34B 3M61U 1AIXH 2ZGBH 1TPSA 2AMPA 4F55A 2VWNA 3V0XA 1ZRKA 3K9XB 1W0KD 1AFEH 3TIUA 5A0BA 1F0TA 3QZQA 1GHXH 2ZFRH 1UO6A 3M5NA 3KCGH 4K1EA 4MNXA 4GPGA 5FPSA 5I25A 2Z9LA 1O2YA 3PV2A 4DCDA 1GI8B 1TABE 2BOHB 2VNTA 3MH5A 2ZU1A 2H5CA 2A7CA 3W94A 2ZFQH 3F6UH 3QN7A 1MKWK 1Y5BT 2ANKH 2V7QD 3RXEA 3SV6A 1VGCC 2ZGCA 4OS1A 5JBAS 1E1RD 2XC0A 5L30H 1O38A 1HGTH 2O8TA 1NFWA 3SNCA 2G4UA 1QQ4A 4D9RA 2W3KA 3VB4A 1FLEE 6GCHF 1D3TB 1EPTC 1QIXB 3QDZB 1GVLA 1C5PA 4Y8ZA 1FV9A 2AIPA 1GDUA 3GYMA 1T4UH 1TRYA 2BXTH 2BZAA 2ODPA 1OOKB 1Q3XA 3A88A 2AHME 3A8AA 2GT7A 3SU2A 2FZZA 2DE8A 5C1YA 2Z9IA 3GY6A 3MOCA 4H6TA 5AFYH 3SUEA 3MO3A 4A1VA 1HAZB 2QN5T 1AE5A 5JPMH 2GT8A 1ZJDA 3ELAH 4FUJA 4HI3A 4XFQA 1P05A 4FUIA 2P8OB 1B0EA 4KGAA 3OY5U 5IK2D 1FJSA 3KQ5A 3L6PA 1GBLA 1UTMA 2RA0A 1SL3A 1DOJA 1C1NA 1JWTA 1C2IA 2R3UA 1IQIA 3FP7E 1BBRE 3VGCB 3T2NA 3F9FA 4OS5A 1RTLA 2P3TB 3PV5A 4CRFA 1GCDA 3RXBA 1BTUA 2ZPRA 4ABDA 1EP6A 1T32A 5C94A 2V3OH 5C17A 1MD7A 5CHBA 1FQ3A 2WYGA 2HLDD 3F9EA 3UTUH 5L6NH 3TJNA 1TNIA 1RD3B 2D26C 2WSSD 1DDJA 1AWFH 2WPHS 5DSFA 4YT7H 1ABJH 1GI2A 2OC7A 1QCPA 1SGRE 1V6DA 2ZTZA 1PQ5A 4E06H 4JZEH 2KX4A 1EB2A 2QXGA 4Y79A 1XUHA 4AYYB 4CR9A 3SUFA 1KMHB 3GY2A 4OM9A 4K60A 1SI5H 1G9IE 3HGPA 4RKOB 1MU8B 2ZZUH 2ALVA 2BVSH 1FDPA 1TQ0B 3GDSA 3VXFH 2R2WU 2GDEH 2ZGHA 1KXFA 4ABBA 5IDKA 1NY22 1TBQH 2H6MA 2Q6FA 3A7YA 2ZQ1A 1GVKB 1ESBA 2F9VA 1PYTD 1CSOE 5LGOA 3N99A 1CGIE 2AFQB 1WXRA 4WF8A 2Z6BD 3P70B 4TPIZ 3UOUA 1HCGA 1P3EA 1OKXA 1EPTB 3UNSA 3M3VA 1YF4A 4B74A 3LGIA 3W1EA 1OWJA 1DWEH 1C2JA 2GV7A 1YPKH 4DT4A 1NRRH 2CMYA 1INCA 2BD9A 1AUJA 4JYTA 4ZAEA 2JETC 1F92A 2GD4B 2QGRA 1XKAC 4RI0A 3C27B 2I6SA 1LVOA 3LT3A 3ITIA 1H8HD 2G00A 2VIOA 1O32A 2ZU4A 2PTNA 2HNTE 1NFUA 4DGJA 1A1RA 2CJIA 4AYVB 1LQDB 4X8UH 3RXDA 2ZCHP 3ZV8A 1S6HA 1NM6A 4E05H 4UFFH 1O5EH 4ISIH 1C5TA 4CBNA 1JOUB 1LDTT 1KXAA 3H7TA 2A4RA 2EI8A 2AIQA 2ZU3A 2KFWA 3U1JB 2FDAA 2PUQH 1O5AB 3GY4A 2Q6GA 1ZR0A 3PTBA 5EGMA 2XW9A 1Z6JH 3GCNA 3RP2A 3KQEA 4JCNA 1BBRH 1E37B 1QL7A 1XUGA 5BRRE 1SBWA 4B2AA 1YCPM 3VPKA 1NU7B 2JDID 3OTJE 5TCCA 1LPGB 3U69H 2ZCLP 1EZUC 3URCA 4PROA 1IQJA 1SGPE 4I7YH 1DWCH 1O3AA 2A4QA 1AY6H 1ZGIA 2ZHEH 3RXLA 3D62A 5FBIA 2F9UA 1C5YB 5SGAE 4DJZB 1C1OA 6GCHG 2PFEA 1H8IH 2VVCA 1G3CA 1L0ZA 1THPB 3RXSA 5DP7A 2LNCA 3L33A 1EP5A 5DG6A 3MNXA 3STJA 2RDLA 1JXPA 1YBWA 2OD3B 1NS3A 1S6LA 3M7TA 1RJXB 1FUJA 2BQ6B 2J4IA 4ZHMU 1Y5UT 2OLGA 3RMOH 1HXFH 2V3MA 1BT7A 3TK9A 5EXLA 5F03A 3RXFA 1LHFH 3UB0A 3VB7A 4FUFA 4X8VH 1ELDE 4BAOB 4YT6H 2JETB 4Y0ZE 3U8OH 1TNJA 2C8XB 2PW8H 4NZLA 1ESAA 3MU1A 2QCYA 3OFND 1K28D 2PSXA 4MG3A 4BTTB 1A0LA 2CF8H 2BY8X 1GJBB 3FANA 2ZDKA 3OAAD 2D1JA 2PTCE 3PM3A 1HB0B 2NWNA 5KEDA 3BTFE 3T27A 1BTZA 2XC5A 1T31A 7GCHF 4NIXA 1DT2A 2Y80A 4AN7A 1SGDE 2A7HA 1YM0A 5F8TA 4K1TA 2FP7B 8ESTE 1PQAA 1AGJA 1TYNA 1Z71A 3UQOA 2A7JA 3SV9A 3RXKA 5TJXA 2OC0A 5FX5A 4IW4E 4Y6DA 2GMTB 1BBRK 1O30A 3SJOA 2W6ID 5GPIB 1SSXA 1H9HE 1G37A 1O33A 2BLQA 5EQSA 2GCTB 2EEKA 2P93A 4CREA 5PTPA 4J2YB 1ZPCA 1GMDF 4INHA 2FO9A 5C3NA 1G36A 2QAAA 3ZZAA 2VH0A 1CGHA 1ELFA 1LKAA 4ABIA 2BYAX 3QK1A 4FUBA 2F9OA 3PROA 4I8LA 4OS2A 1DLKB 3A8BA 1AU8A 3PO1C 3ZVFA 1C5VA 3E0PB 1QA0A 2TGPZ 4FETA 2VIQA 3BG4C 5CE1A 4IC6A 3SV8A 1YLDA 4OS7A 4B73A 1ELEE 5CHAB 1VJ9U 4B2BA 2JH6D 1YPGH 2ZFTA 3DHKH 1V2TT 1TGCA 2OTVA 4D8NA 1C5ZB 2ZFSA 1P9SA 5EPYA 1OXGA 3M3SA 3H5CB 2HNTC 1GI6A 3RMLH 5GIBA 3F9HA 3SNAA 3W95A 3GYLB 2W26A 3F3BA 1QA7A 1O3IA 1P2QA 1L1JA 2IPHA 2TBSA 3SZNA 2ZDVH 2F91A 4YTAA 3ZVDA 1OHHD 4E7NA 1E79D 1AMHA 2FESH 1PPHE 1O3JA 2HNTF 2ZNKH 1TALA 1IQGA 1W14U 1MKXH 4ZROA 5A8XA 4WVPE 2ZDLA 3UAIC 1V2NT 3AAVA 1EAUA 1SLXB 1K2I1 2XRCA 1P01A 2VJ1A 2WYJA 3VB3A 3KNXA 4GLYA 1V2MT 1CT2E 1CVWH 2KCAA 4A1TA 3TH4H 4XE4A 1MCTA 2CXVA 3EAJA 1ZTLA 4WXIA 1O2SA 1T8NA 1GJ6A 2OINA 3EGKH 3OYPA 4JYVH 1TB6H 2UUJB 1UK3A 3BTKE 4FVBA 1C1WH 4FUDA 1F5KU 2FOGA 3M35A 4U2WA 3L3TA 1AE8H 1EATA 2BX4A 3GCHC 4LZ1H 7KMEH 1O3NA 1GHVH 2J97A 1EZSC 3A85A 1TE0A 2O8LA 1OX1A 2BD5A 3NXPA 1P03A 4BNRA 4Y0YE 1AWHB 1GI1A 1KLIH 4AFSA 4X2VA 1S81A 2V0BA 1UTOA 2C8WB 4Y11E 3RXRA 2ANMH 2BY7X 4Y71A 2FOBA 1TPPA 1ELCA 2BD7A 1B0FA 1W12U 3MWIU 3K2UA 4IN1A 3SU6A 2CHAC 2LELA 3PO1B 1Z1IA 2G5VA 1ZPZA 1SQAA 1P2JA 3F9GA 3BG4B 1DVAH 1GGDC 3MHWU 4BAKB 7LPRA 1SOZA 5FXLA 3RXVA 3RMNH 4KP0A 5B6LA 3BTGE 1O2VA 4JYUH 1O34A 3U1IB 2G5NA 2J5UA 5ESTE 3M7UA 1O3LA 1RRKA 3LPRA 3MNSA 4UFGH 2IN2A 1MH0A 2WUCA 3K6ZA 4GAWA 5FX6A 3A84A 5FPYA 3LGVA 2YMSC 2F4LA 1W3CA 1HAHH 4Y8XA 5LH8A 1A5HA 1XMNB 1Q2WA 1CT0E 3HKJB 4RSPA 1CGJE 2PLXA 3S0NA 2NU4E 1LHDH 2QF0A 1TRMA 1YCPH 4BAQB 5GXPA 1QJ6B 4QT8C 7GCHG 3M5OA 1MAYA 1MKXK 4FUGA 4KTUA 4NGAH 3GCOA 3GDUA 3RM0H 1GBDA 1Z1JA 2FOEA 1PPCE 3TH3H 4FOUC 3UNRA 1C2FA 1O3PB 5DJ7A 1P2OA 3TH2H 1BA8B 1IQNA 4HZHA 1C2GA 3N7OA 3AK5A 1HBTH 5DP9A 5A2MH 3VG8A 1HJ8A 3VFEA 4WWYA 2OP9A 1GBIA 3P17H 2D8WA 1T8OA 2F9NA 4K1SA 2QF5A 5T1VA 1SLVB 1THSH 1GMDG 3FOAA 4KTSA 3SJ8A 1EAIA 1PPBH 4CRGA 2Z9JA 1SFQB 2W5EA 1FN8A 3MU4A 1BMNH 3PV4A 2FWWA 2ZDAH 8GCHF 1GHYH 5E2PA 4ACAA 2BZ6H 4M9FA 1RS0A 3A7TA 4RT1A 1ANBA 3FZDA 1C5QA 1O3OA 1UVUH 3UQVA 2ZFFH 1PPZA 3F0OA 1UVTH 2CN0H 4XOJA 2SGQE 2FPZA 4XSKU 1C4Y2 1NPMA 2A31A 3AVZA 3I77A 1HAVB 2FX4A 4K3JA 2IPQX 3O8CA 3KQDA 5DP3A 1XVMA 3BTQE 1C2DA 1UTPA 3RDZA 1WDIA 5A8ZA 2HALA 3RXMA 4CH8B 1VZQH 4YXWD 4P00A 4Q7YA 1O5CB 2OBQA 3QUMP 3ZZ8A 5HXFA 2Y5FA 4UONA 5EXNA 1EZXC 3DSOA 1L2EA 2CGAA 1GJ9B 1GI9B 3F1SB 3FP6E 2YMSB 1JBUH 3RXHA 3TK5A 1O2UA 3BEIB 1QY6A 3LJOA 3PB1E 1ZSLA 4FU9A 2G4TA 5JDUB 2PSYA 4GCHF 1GHWH 4TT3D 2C4FH 1KLJH 1Y3YA 1FY5A 3U8RH 1GMHF 3B23B 3UWIA 2L6OA 4CBOA 5T6FA 1CA0B 2G8TA 3ATLA 4BAMB 1X7AC 1XXDA 1LPZB 1AKSB 3NUMA 1AZZA 3F2FA 2AMQA 2BLOA 2XYAA 1DXWA 2QXHA 2AS9A 1IQKA 1PJPA 2UUKB 1O2QA 3GY8A 4Y7AA 1NRQH 3PMJA 1K9OE 1SHHB 3M7QA 1AZ8A 1O2RA 1KDQA 2LPRA 2ZHFH 5T6GA 1PQ8A 2BY5X 1SG8B 2XXLA 1TBZH 1K1OA 3TNTA 1XKBC 5CDFE 3ZYEA 3TJOA 1C5LH 2UUFB 1C1UH 1NT1A 1VITH 1O2KA 1O2HA 1XVOA 1Y3WA 1NESE 4U01A 4Y76A 3SYJA 2ZGJA 1GBTA 2HPQH 3LGWA 1DE7H 1HNEE 1O5FH 1ZYOA 3CP7A 1TMBH 4WH6A 2Y6TA 2ZGXH 1XUIA 4LXBH 2GZ8A 1AUTC 2JIZD 1AI8H 3H09A 2PHBA 4I32A 3U98H 2BD4A 1C5OH 1V2VT 2EI6A 1KYNA 4A6LA 2JH0D 1HYLA 1NZQH 2A1DB 1ZPBA 4THNH 4U30A 3RXQA 2STAE 1A4WH 2OXSA 1HIAB 1SGIB 1K21H 3S9BA 1O0DH 4JK5A 1TWXB 2OK5A 1TAWA 2ZCKP 1TBRH 2GGVB 4ABAA 2WINI 3HKIB 2IJD1 5J4QA 5EIYA 4GVUA 4MDSA 1D3PB 2ANWA 4OS6A 2BMGB 3BSQA 3E8LA 1O2NA 1RFNA 1O2LA 3DSGA 3WW7A 3K65B 2ZECA 1BCUH 2G81E 2J98A 1SB1H 5K7RA 5GDSH 8LPRA 5DN6D 1P04A 3SU1A 3LIWA 4B6FA 2PKAA 1HV7A 3OTPA 3SU0A 5L2YH 3BTME 5GCHF 1VCPA 3QZRA 3T29A 2Y7XA 1IQEA 3KQBA 4XRNA 5HYOA 3SHAH 3TLOA 2AERH 1SMFE 1OPHB 1RIWB 4I8JA 4ISOA 4DURA 1C5WB 1GWAA 2AH4X 3BTDE 4OGYA 5A09A 8GCHG 1A7SA 2P3UB 2ZFPH 2GKVE 1T4VH 4K8YA 1AVWA 4H4FA 4TSFD 3OSYA 1TGTA 2XC4A 2AEIH 3UIRA 3HGNA 1ZOMA 3UFAA 4XBDA 3QLPH 5EG4A 5GJ4B 1EASA 4X6NA 5EW1H 3Q3YA 1A3BH 1OWHA 1T8LA 5ESBA 1KXCA 3F2HA 3O8DA 3MH6A 1S0RA 3SGAE 1BZXE 1SGNE 3UY9A 2QV1A 1SGTA 1MUEB 2WV5A
chains in the Genus database with same CATH topology
1HUTH 1ETRH 2SGPE 2XBYA 3S7KB 4AZ2B 1DLEA 1GJDB 3HPTB 2QXIA 4B71A 4ZKSU 2XWAA 3VEQB 1N6YA 2RG3A 1GL1A 4YZUA 1NRPH 3HK3B 2SNVA 1EKBB 1ZMJA 4UD9H 1O37A 3DD2H 4GCHG 4Y10E 3MH7A 1TONA 2TGTA 1Z6EA 1FMGA 1GMHG 2KAIB 4DW2U 1UTLM 1DWBH 1L1GA 2QXJA 2G55A 2Y5GA 1V3XA 5FCRA 2Z9GA 5DP6A 1IQHA 4MTBA 3TVJB 2AYWA 4Z0KA 2H9EH 1QL9A 4SGBE 5DP4A 2FS8A 2FYQA 1FY3A 1J16A 3QX5H 1QNJA 1UTNA 3QGJA 1C4U2 1ARBA 3PMHB 4E7RG 4JMYA 4Q7ZA 1N1LA 1O5BB 4CH2B 2Q6DA 2A5IA 1DX5M 1TMTH 3M37A 2BVXH 3A87A 1A2CH 2GMTC 3ZV9A 1ANEA 1VCWA 4AFQA 1ZJKA 2ZDMA 4TWWA 3AASA 2STBE 3LH1A 1LHCH 2VU8E 2ODQA 3UWJH 4GSOA 2GCTC 1QHRB 3RXGA 2QY0B 2ZU5A 2BTCE 2VIDA 1MTVA 3SN8A 3VB6A 1CHOF 1J9CH 9LPRA 4FUHA 3VXEH 5JBBS 1G2LA 3MTYA 1GJAB 3E3TA 1C1SA 2A5AA 4NSVA 3CENA 5E0HA 3QTVH 1C1MA 1BMAA 1F0SA 1N6XA 4IS5A 2YNBA 1O2PA 1O3MA 1K1NA 1GI7B 5JBTA 5E8EH 1MAXA 3JZ2B 4MNVA 4MLFB 3V7TA 1TNHA 1AB9C 1D3QB 2BD3A 1P02A 1A0HB 4O9VA 1MMJN 5CHAC 4I33A 1JIRA 1SHYA 1FN6A 2FOCA 2ZO3H 3SV2H 3BV9B 2BQ7B 1UTQA 1AKSA 4OS4A 2FI3E 3A86A 4O3TA 2BDGA 5FHTA 2DE9A 4ZKNU 2FIRH 3TPIZ 1E36B 1GJ4H 2PGBB 2Y5HA 3M5MA 1QL8A 3NKKA 1JMOH 1UHBB 3M36A 2H9TH 1C1QA 1WTGH 2BDHA 1V2PT 2WPIS 1BIOA 3NCLA 3U8TH 1GJ7B 4UFEH 1OWDA 2M5TA 1LO6A 3ZZ9A 1SGCA 2PUXB 1FI8A 1G30B 4X8TH 3D23A 4Y7BA 3KL6A 3Q3KA 5GCHG 2C3SA 2J34A 1QTFA 1TOMH 1P11E 1WAYB 4I8KA 3RXTA 4DG4A 1VR1H 3KEEA 4CR5A 1ZHPA 1TPOA 2PWXA 5EOKA 1TQ7B 1W11U 1F0UA 3SV7A 1HLTH 4NFEA 3DUXH 6CHAB 1DFPA 1P2KA 2A32A 1XUKA 2SFAA 2VIVA 1EXFA 3SU4A 1EOLA 1WCZA 2BD2A 2ESTE 2SGEE 2ZDNA 4ISLA 3T25A 2Z9KA 3TJUA 1UCYH 3RLWH 1OP0A 2YNAA 2XBVA 3I29A 4A7IB 4YESB 1DXPA 1HAIH 2BY6X 5AFZH 1E35B 1LKBA 3NWUA 2HVXA 5C1XA 2VWMA 3LJJA 1FY1A 5B6OA 1S0QA 3R0FA 2GDDA 1BJUA 1Y3VA 4CRCA 1ETSH 4AFZA 2XBXA 2B8OH 1TGSZ 1KXBA 1ZHRA 1EJAA 2PGQB 4UDWH 1EOJA 1GBAA 4BXWA 1ARCA 2A2QH 1AB9B 1SOTA 2PR3A 1F5LA 3EDXB 1JRTA 2K1QA 4X2YA 3EA9A 1MTNB 1WV7H 4FXGH 3T62A 5JB9S 3SW2B 4NA9H 4Q7XA 3PLPA 1TNLA 3P8NA 1XUFA 2GTBA 4FVDA 2NU2E 1VCQA 1ZSKA 3LU9B 1BRCE 3LDXH 1D4PB 3PLKA 1BJVA 1O3KA 1TMUH 2OQUA 1K1MA 5F8ZA 2G51A 2OCVB 2WV4A 2QA9E 1P8VC 3IITA 2TIOA 3K6YA 2HGTH 3A83A 2AGEX 1O36A 4ABFA 4D7FA 1SGFA 5A0CA 1MBMA 1GJ5H 1OYQA 2R0LA 1TA2A 1YYY1 2TRMA 1SGEE 3PMAB 1AVGH 4K69A 2HLCA 1QB6A 1TRNA 2BY9X 5FBEA 3T5FH 2OBOA 1ELVA 2VGCC 1LHEH 3A7WA 5JYIA 1GI0A 1PFXC 1A5GH 1GHAF 1EB1H 1ORFA 1GPZA 4GUXA 4AG1A 4ABHA 4YLUA 4CRBA 4M7GA 3UR6A 1QBNA 2ALPA 1CHOG 1EPTA 1V2WT 1O2WA 4BAHB 1DS2E 4DIHH 4YOGA 3S9CA 2ZI2H 3TITA 3T28A 1WTHD 1A61H 1GHZA 2ZG0H 1P06A 1GI5A 1J17T 1UVSH 2KAIA 1HRTH 1NROH 3C1KA 1O3EA 1SR5C 3I78A 2V6NA 4HFPB 1OWEA 1GBMA 1WYKA 1QBOA 3DFLA 1MQ6A 4JZDH 2ILNA 5C2ZA 4NWKA 3KQCA 5TCAA 2AGIX 3UREA 2TGAA 1RTFB 1C9TA 2A5KA 3OY6U 1GBKA 1Z8IB 4CRAA 4X8SH 4AG2A 3RXAA 3T26A 2UWLA 3PWCA 1H9LB 1XXFA 2UWOA 1HAPH 1NU9A 3P92A 2Y82A 1ZRBA 3RXOA 5I46H 4X1SU 2HWLB 2ZQ2A 4LK4A 2P95A 3P8OA 1YPEH 1RTKA 2GZ7A 2UUYA 2XTTB 1O2MA 5C5NA 3RC4A 3O8RA 2FLRH 2J94A 1Z8GA 2GV6A 3ATWA 1CA0C 3KHVA 1E38B 1FPCH 3STIA 4A5TS 1P2MA 1FAKH 2BM2A 3ENSB 5F8XA 1RXPA 4YOJA 2VGCB 3SOSA 4Y8YA 3NK8A 3PLBA 3SQEE 2BDIA 2H1UA 4ZXXH 1WSSH 2CF9H 4ISNA 5AHGH 5DO4H 2A2XH 4VGCB 3RXIA 5GWZA 1S6FA 1C1VH 1U6QA 2Q1JA 3LONA 1LPKB 3BTWE 3WY8A 3KN2A 3PWBA 2DUCA 3S7HB 5C67A 1O3CA 3LGTA 2P94A 1UHBA 4R0IA 3KIDU 1GBEA 4MNWA 4ASHA 2R3YA 1C5UA 1ZTJA 2BVRH 2PKSC 1SGYE 3E16B 1GBJA 1LMWB 1GDQA 1MZAA 3SUDA 5T6DA 4B1TA 2IOTA 1GBHA 2D2DA 3MI4A 3SHCH 1MKWH 2Z94A 1V2QT 1O35A 1K1IA 2IJOB 1C1PA 2H2ZA 4HTCH 1TA6A 1W8BH 1MBQA 1BQYA 3TK6A 2OUAA 1HAXB 1ZGVA 1Y3UA 3P6ZB 4K5ZA 4X1NU 3SI3H 1C5MD 1C9PA 1QRXA 3E90B 1NO9H 1YCPK 1DSTA 1HDTH 1V2LT 1K1LA 2QYIA 1YPHC 4NWLA 1FXYA 1IQLA 3B8JA 4LOYH 4YM9A 1FIWA 3RLYH 1OP2A 1YPLH 2B5TB 1S82A 4KKDA 1GHAG 3NPSA 1HJ9A 1MTUA 3ZZ6A 1HJAB 4YOIA 2ZEBA 2ZF0H 3A7ZA 1D3DB 1HPGA 3TU7H 1BRBE 2ZHQH 1UTJA 3GY5A 4ZKRU 1RIWC 4ZHAA 2RA3A 1ZMNA 3EYDA 6LPRA 1BMMH 1BTPA 2V35A 1O2IA 2ZPSA 1KSNA 2VWOA 1CA8B 1BHXB 1Y3XA 3ZZBA 3SNEA 4O3UA 1G32B 5FCKA 2O8WA 1D6RA 1ANDA 1JRSA 1VJAU 4JK6A 3BN9A 1NFYA 1UVPA 2CV3A 1FZZA 3E91A 2EA3A 5E0GA 1B5GH 2FOHA 2FOFA 2BDAA 4X6PA 2PKSB 1AD8H 2XWBI 1QURH 1UTKA 5LPFA 4NIWA 1ESTA 4TY7A 3A80A 3ATKA 2Y7ZA 4U32A 1ACBE 1EQ9A 2FM2A 2BQWB 3AAUA 1HAYB 2ZP0H 1H1BA 1C1TA 2H5DA 5G4BA 4BTUB 2I6QA 3UR9A 1LVBA 4AFUA 2FLBH 2QIQA 1PPFE 4BTIB 5T3HA 1ZTKA 1IAUA 3ZZ7A 1QFKH 5EPNA 4XDEA 2BDBA 3IWMA 1QB9A 4SGAE 5EU8A 1EZQA 5H4IB 3FP8E 2ZU2A 3RUOA 1SGQE 3E0NB 1GG6C 2BLWA 2ZHDA 3OX7U 4INKA 2Z7FE 5C1UA 4X6OA 1CO7E 1LVMA 1NN6A 1O5GH 1SVPA 3JZ1B 1W0ZU 1DWDH 1ZSJA 4IBLH 3GY7A 1GMCF 2J92A 1C2HA 3LGUA 3Q3XA 3P8FA 1TGNA 1LTOA 1OP8A 2BDYA 1CT4E 5AVDA 2SGDE 2XBWA 4UE7H 5HM9A 2Y81A 3LC5A 1QQUA 5BPEA 1GBBA 2GCHF 1ELAA 3LC3A 2J9NA 1VITF 3Q76A 4FUEA 4ESTE 1ANCA 4DVAU 4IC5A 2SNWA 1V2JT 4B76A 1TPAE 4TYDA 1CU1A 2VVVA 3EA7A 5HM2A 2SGAA 4KTCA 1Y8TA 3MO6A 4X0WU 1BTXA 3P8GA 4MPWA 4WMFA 2VIPA 1SQOA 1V2ST 1LVYA 3ZVGA 1O2TA 1FY8E 1MTSA 1QBVH 4J1YA 1V2RT 4TWYA 5CMXH 3SGBE 1D9IA 2ZTXA 3ZZDA 4CRDA 3MFJA 1H9IE 4ABJA 4AGJA 2BHGA 4D9QA 1BOQA 2VH6A 4O03A 1AHTH 4IGDA 4WY3A 3EA8A 4INLA 1F0RA 1FONA 1F2SE 1VGCB 2F83A 3Q77A 9ESTA 2C8ZB 2B0FA 2VB0A 4H6SB 3SBKA 1N8OC 3AW1A 3Q00A 2R0KA 4I31A 1Z7KA 1P0SH 1SQTA 1W7XH 4F49A 4I8HA 4D76A 4K2YA 2BDCA 1MTWA 1GJ8B 3A89A 1XX9A 2FX6A 1GVZA 1BTYA 3GY3A 1O3DA 1BITA 1TX6A 1S84A 3TJVA 3ZYDA 5DK1A 1GG6B 1MZDA 2W7UA 1ZLRA 3CS0A 3GISB 1DY8A 3TNSA 1AQ7A 1KY9A 1O31A 1UCYE 3HATH 4XBBA 8KME2 2ZWLH 2W7SA 1O5DH 1O2OA 4F4OC 6CHAC 2C90B 1W13U 1HAVA 4NCYA 5A0AE 1MU6B 4JZFH 2TGDA 4LZ4B 1WQVH 1LHGH 4WMEA 2EI7A 1A3EH 3DFJA 2BLVA 3RU4T 3EE0B 1P2NA 4D7GA 4IN2A 1P3CA 1LCYA 1J15A 1PPGE 2ZTYA 2ZC9H 1GDNA 1SGFG 3TGJE 1ELTA 4MPVA 2AMDA 5EQQA 1O2JA 3G01A 1V2KT 1PYTC 1WOFA 3QWCH 1UK4A 2ZA5A 2ULLA 2Z3DA 5ABWA 5A8YA 2XCNA 1HFDA 2QF3A 4CHAC 3QTOH 4DY7B 2TPIZ 1TOCB 1FAXA 1KLTA 1TGBA 3FAOA 1MTNC 3VB5A 2F3CE 1DICA 5E2OA 1SLWB 1UK2A 1WBGB 1OWKA 1ZZZA 5AF9H 2XCFA 5FAHA 1GHBF 1FIZA 1A0JA 4NA8A 2R9PA 1N8OB 1B7XB 3DT0H 4AX9H 3ZZCA 5HGGA 4FU7A 1CHGA 1EJMA 1C5NH 3SGQE 1MQ5A 3A7VA 3SORA 2WPMS 4NZQA 3BF6H 4NA7A 1CE5A 4BOHA 4IMZA 3ZVAA 3BIUH 3H7OA 4H42U 1GMCG 3A8CA 1HAOH 4R8TB 1C4V2 2WPLS 3TGKE 1KTTB 4DT7B 2O8UA 5DKMA 4AORA 1K1JA 4MNYA 2ZHWH 1DSUA 2NU0E 3ZZ3A 4X1QU 2B7DH 4AGKA 4JZIA 3V12A 1OYTH 2GCHG 2GX4A 1VITG 1V2UT 3BIVH 2Z3CA 5DP5A 1W7GH 1IQMA 3ZZ4A 1S83A 1QGFA 2OQ5A 4ZH8A 1T7CA 4AB9A 1IQFA 2Z3EA 3E1XB 4NSYA 3MNCA 1O2XA 3UUZA 4X1RU 3FVFB 2HOBA 3MU0A 1TFXA 1JIMA 4DIIH 1HIAA 1KXEA 1GI4A 5JBCS 4NIVA 1TNGA 1Y59T 3EQ0H 4WH8A 3SNBA 3E6PH 2JKHA 1K1PA 1S5SA 2FMJA 1O3GA 1NRSH 3BTEE 3S9AA 1W0YH 2F9PA 4DOQA 1BB0B 3MU5A 1XM1A 1C1RA 4CHAB 1GBFA 2VWLA 1PPEE 4BANB 1KTSB 1WU1A 1ZHMA 4A1XA 1WQSA 3B9FH 4UEHH 1A46H 1NTPA 1TX8A 5HMAA 3RU4E 1M9UA 3IG6B 3BTHE 5L2ZH 3HK6B 2GZ9A 3SJ9A 5FPTA 4AB8A 1TNKA 4ZKOU 2BX3A 3ODDA 4B2CA 2GP9B 2F9BH 1A5IA 1KDQB 2NU1E 2OC1A 1TX7A 1QJ1B 2VVUA 3MO9A 1YKTA 5EODA 5LPEA 3GCTF 1YC0A 1YP9A 4K8BA 1P10A 2FODA 1BDAA 3P95A 3SNDA 2FYRA 3GICB 4NFFA 1IHSH 4Z6AH 1L4ZA 1YPHE 3D49H 3GOVB 1DITH 5DGJA 4ZXYH 1BRUP 1H8DH 2B9LA 2FI4E 3ESTA 3SO3A 1HAGE 1Y5AT 4XBCA 4VGCC 1J14A 2THFB 3MNBA 1F7ZA 1T8MA 1UCYK 1G2MA 4ISHH 3MH4A 2NU3E 3A8DA 3PYHA 3DA9B 1GL0E 2WPJS 3LKWA 4YO9A 2YOLA 4X2WA 1NRNH 2J38A 1Z8RA 1MD8A 1EAXA 1O39A 2ANYA 4MVNA 4RN6A 1KXDA 2FXRA 4TPYA 6ESTA 2R2MB 2FTMA 3F68H 2J2UA 1ZMLA 4ZUHA 3CS7A 1PQ7A 1OWIA 2HRVA 3ZVCA 1C2LA 1ETTH 2GVFA 4GHQA 2RCEA 1HXEH 2WUBA 3RM2H 3ZVBA 4X6MA 1GHBG 2ZPQA 1YLCA 2SGFE 5K0HA 3ODFA 4OGXA 1AN1E 4I8GA 2BB4A 2VINA 2O9QA 2FI5E 3SU5A 3KF2A 3BEFB 3R3GB 1Z8JB 1O3BA 1EJNA 4Q2KA 2VIWA 2PKAB 2C93B 1LQEA 1OSSA 2A45B 1YPJH 2QC2A 4IMQA 1P12E 4BXSA 2O8MA 1AVXA 3UNQA 4FUCA 1AFQC 1XUJA 1KIGH 1NFXA 4AOQA 3BTTE 7ESTE 3V3MA 5DPAA 1C5RA 5E0JA 2HPPH 5F6MA 1DY9A 4A92A 3GDVA 1ABIH 3SU3A 1FY4A 1L4DA 1F5RA 2AGGX 4ZHLU 3LGYA 1V2OT 3RU4D 5J4SA 3MU8A 1OS8A 1O2ZA 1GJCB 5DP8A 1DPOA 1YPMH 3KGPA 3RC5A 1WUNH 1GBCA 1HJAC 3ZZ5A 4ABEA 2BXUH 1THRH 3UOPA