3S9AA

Russell's viper venom serine proteinase, rvv-v (closed-form)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
234
structure length
234
Chain Sequence
VVGGDECNINEHPFLVALYTSASSTIHCAGALINREWVLTAAHCDRRNIRIKLGMHSKNIRNEDEQIRVPRGKYFCLNTKFPNGLDKDIMLIRLRRPVTYSTHIAPVSLPSRSRGVGSRCRIMGWGKISTTTYPDVPHCTNIFIVKHKWCEPLYPWVPADSRTLCAGILKGGRDTCHGDSGGPLICNGEMHGIVAGGSEPCGQHLKPAVYTKVFDYNNWIQSIIAGNRTVTCPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vipera russelli proteinase RVV-V gamma
publication title Structural basis of coagulation factor V recognition for cleavage by RVV-V
pubmed doi rcsb
molecule tags Hydrolase
total genus 56
structure length 234
sequence length 234
ec nomenclature ec 3.4.21.95: Snake venom factor V activator.
pdb deposition date 2011-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3s9aA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3s9aA02
3FZZA 3V7TA 2ZU4A 2OXSA 1KDQB 4JK5A 2PKSB 1LVYA 4JZDH 2ZFQH 3AAUA 1O37A 1DLEA 5EOKA 3TH4H 3DD2H 1GJ4H 1W2KH 3BTHE 4I8KA 2ZFFH 2ZU2A 4GSOA 1SI5H 2A1DB 1C9PA 1WUNH 2YNBA 3MYWA 4XBDA 3ZZ6A 2O8WA 4NIWA 1W8BH 1ELBA 4X8SH 2HRVA 1TAWA 2Y5FA 3HGNA 1AQ7A 4R8TB 5K0HA 1O5FH 4ABDA 3H7TA 1A0JA 1MZDA 2OBQA 2GD4B 1IAUA 1UVPA 4B74A 4A6LA 4FUDA 3VB7A 2CGAA 1P3EA 4ZHMU 1L1NA 1YCPK 4IMZA 3M7QA 2FS9A 1C5SA 3P8OA 2C8WB 2OC7A 1MBMA 1UTQA 5FBIA 2O8MA 4X1QU 3TGJE 4K69A 1BHXB 1PYTD 1OWIA 1ZSKA 1XKAC 2NWNA 2Y5GA 2B9LA 3KL6A 2R2WU 4AFQA 1OWKA 4XFQA 1GVKB 1GGDB 1P05A 4FVDA 1O3LA 3SHAH 1OX1A 2GDDA 2PKAB 3U9AH 2WV5A 1T8NA 2ZHDA 1MQ6A 2O8TA 3BEIB 1GI6A 2WPLS 3MO6A 3T62A 1EQ9A 1GPZA 2OCVB 3URDA 3KQBA 2EEKA 2W5EA 3TK9A 1CGIE 2W7UA 3QUMP 2ZKSA 2QV1A 3UWJH 2BY5X 1O3EA 3KCGH 4NGAH 3ODDA 2GZ7A 1UMAH 2AIQA 3LC5A 1XVMA 3RLWH 1A46H 1PPBH 1TGCA 5J4QA 2VIOA 2XTTB 1GBAA 2B7DH 2VIWA 4FUEA 2XBVA 2WV4A 3TJNA 1ACBE 2BM2A 2B8OH 4UFFH 3KN2A 1XMNB 1BTWA 5A0AE 2PGQB 1FN8A 4FUFA 2BVXH 1O3JA 3RUOA 2FZZA 3Q76A 1AB9B 1ZGVA 4A5TS 1F0TA 1H1BA 4X2YA 2CN0H 2H9TH 1GWAA 3U1IB 1DT2A 1LQDB 2O9QA 2NU3E 3L6PA 5GIBA 1EXFA 1F7ZA 2WPJS 4ISOA 2AH4X 1X7AC 3BIVH 3ZZ9A 1EAWA 1ELGA 1HBTH 2ALPA 4K5ZA 4RSPA 8GCHF 3PLKA 1BHXF 4JYUH 5T3HA 2PW8H 4ZROA 1TMUH 4MPVA 3CS7A 4X1PU 1RS0A 1EOJA 1DITH 4OS5A 3RC6A 2HPQH 4IMQA 4Y79A 3BIUH 1DVAH 1YCPH 1TQ7B 4NG9H 1U6QA 3BTME 4AG1A 2SGQE 3FVFB 1DY9A 1O2QA 4ABGA 1IQKA 1Z7KA 2DE9A 1IQLA 4Y0YE 1G2MA 1LHEH 1FONA 5DJ7A 1L1GA 1PQ8A 5CMXH 1CHGA 1FI8A 1P2KA 1O2IA 1RD3B 4IGDA 5HM9A 3O8CA 3VB3A 4NIYA 2BYAX 3PLBA 3PYHA 4NA9H 1BRCE 5GWZA 2Q1JA 2ZHEH 3E0PB 2ULLA 4BANB 3P92A 3U1JB 1C2KA 1NRSH 2FOBA 1V2PT 2H2ZA 4X0WU 1BTZA 1DPOA 1UVSH 1KXBA 1QQUA 4ZAEA 3ENSB 2BMGB 2A31A 5E2OA 4U32A 1NPMA 1S85A 4IBLH 3V12A 3TGKE 2VWMA 2VWOA 3GCTG 1T31A 1A5HA 1G2LA 1HXEH 1ANCA 3SGBE 1MD8A 1T4UH 1M9UA 5EG4A 2AMQA 4OGXA 2GKVE 2ZPQA 1BMLA 4ZH8A 2TBSA 5I46H 4KELA 3MH7A 3RC4A 1KLTA 4ZHAA 2SGEE 4GCHG 1FY4A 1ZSLA 2FOCA 1O38A 3KQEA 1KY9A 1TX8A 1O3MA 2A5AA 5EQQA 4B71A 2PKSC 1ABJH 3VXFH 1IQFA 3P8NA 2V0BA 3LKWA 3ATLA 1E38B 1SGYE 4X2VA 2A45B 3EA8A 5BRRE 3Q3XA 1OWHA 2I6QA 2F83A 1O5BB 1UVUH 3LH1A 3B23B 4KTSA 3A7ZA 1O2MA 1FJSA 1XUKA 4YO9A 1BOQA 1G3CA 1GCDA 4NSVA 1WU1A 5DP3A 2W26A 3F1SB 1FZZA 1A3BH 3FP7E 1YP9A 1GBKA 1TABE 1MTNB 1DFPA 9LPRA 2XBXA 3QN7A 1Y3VA 2F9VA 3BV9B 3V0XA 5C5NA 2Q6FA 2C90B 1XKBC 3MO9A 2WINI 4WY3A 3P17H 3SU4A 4CREA 1GHAG 1PQ7A 1O2JA 4B1TA 3FP8E 3D49H 2VU8E 1VJAU 1Y5UT 1UTLM 5EODA 4MLFB 2PGBB 2AERH 3RM2H 1O5CB 4GUXA 5T6GA 2BY7X 2A32A 2AMDA 1QRZA 3SI4H 2BY8X 2F91A 3RU4T 2XCNA 1XX9A 2BLOA 3RXTA 2FLRH 3ZZ3A 1SC8U 3SBKA 1W12U 3VPKA 4AN7A 1PPZA 2CHAB 2P59A 1AVXA 2FS8A 1HFDA 2PHBA 1WBGB 1C1VH 1GJAB 1CE5A 2QC2A 3EE0B 1BQYA 1PQ5A 1DOJA 6GCHG 4YOGA 1HV7A 4DY7B 2F9BH 3KQDA 5FPSA 4U2WA 3HK6B 2BD5A 4MNYA 1V2NT 1ZZZA 2B0FA 1OOKB 2OLGA 2XBYA 8LPRA 4GCHF 4WMDA 2J34A 1UTMA 4Y71A 4BOHA 1NTPA 5GPIB 1HGTH 2TGAA 1YYY1 2PV9B 1VGCB 1AB9C 4K1EA 1F5LA 1P06A 1WTHD 4E7NA 5HMAA 3BTEE 2TGPZ 3TGIE 1ZPBA 1KXCA 2QAAA 1ARBA 4TWYA 4D76A 1W7GH 1GHBG 4UEHH 1G3EA 3RMMH 5JBCS 3K9XB 2ZCHP 4ABBA 1HJ8A 2V6NA 1W14U 2FI5E 3DUXH 2HNTE 3M5NA 1QIXB 3E90B 3RMOH 1INCA 3BG8A 4AB9A 3S0NA 1MKXK 1O2WA 3TPIZ 2OC0A 3O8DA 1P8VC 1NU7B 1EJMA 2BDCA 2PSXA 2RDLA 4CRBA 1GHAF 1XM1A 1O3AA 1V2UT 4HTCH 3SI3H 1FAXA 4JMYA 4CBNA 1TONA 2UUJB 3NK8A 1XVOA 3TIUA 1AHTH 1EAIA 1GJBB 4YOJA 2ZGJA 1TNIA 4X1NU 3M36A 5AVDA 3A81A 3A86A 1AD8H 4AX9H 3Q77A 4NIXA 1V2OT 3E16B 4J2YB 1EASA 3WY8A 3CP7A 2FOFA 1UK4A 1EAUA 1GBFA 2XWBI 2BY6X 4BAKB 3STIA 5C3NA 1XUGA 3M35A 2BOHB 3FP6E 1AWFH 3R0FA 2AS9A 4GHTA 2PR3A 2AGIX 3KIDU 4M7GA 1C1PA 2CJIA 2ZA5A 4K2YA 1BIOA 3TNTA 5GCHF 2G52A 1CGHA 4I8JA 1TLDA 2FX6A 3DHKH 1O32A 2G8TA 1RTKA 1QA0A 2VVUA 1RTFB 1TX6A 1D3DB 3A89A 4X8VH 2ZQ1A 3SN8A 1NU9A 1HAHH 3SORA 2WUCA 1TMBH 2IOTA 2PUXB 1C5NH 4TWWA 4YM9A 5C1XA 1WSSH 2FTLE 3IITA 5DP5A 3P95A 1TQ0B 4MDSA 2BLVA 3RXOA 1QB9A 1MU6B 3BSQA 1Z8GA 3MWIU 3CS0A 3ZYEA 1P9SA 3BG4B 1Z6EA 2SGPE 2SGDE 2JKHA 3MI4A 1SSXA 4XBCA 2XC5A 4Q80A 1ZMNA 1P2MA 2XWAA 3AW1A 4CR9A 1DWBH 1C5TA 1PJPA 3PMJA 4NIVA 3O8BA 4O3TA 3Q3KA 1K21H 1KXFA 3MU8A 4WMFA 3ZZDA 1C5OH 2GT7A 1FUJA 2WPHS 4Y7BA 2LNCA 1W0YH 2PLXA 4I8HA 3RLYH 1AIXH 2WUBA 3SV2H 1MKXH 1MTNC 1OP0A 3L33A 2FESH 2ZC9H 1D3TB 1IQEA 2WYJA 3I29A 5FPYA 3TJOA 3TJUA 2STBE 3M5OA 1ELFA 1DSUA 1V2MT 4FUCA 4A1VA 3PMAB 3SJOA 3TK5A 3L3TA 3GY7A 2A4RA 3VEQB 1TNHA 1SGFG 1K1NA 1E36B 1EX3A 5JBTA 2ODPA 2J95A 4XE4A 4ABFA 2ZDMA 2EI8A 3K2UA 2F9PA 1XUFA 3KF2A 4F4OC 1DWEH 2DE8A 2XC0A 2OP9A 2G81E 4OS1A 2VIDA 2FTMA 2RA3A 4YLQH 2C3SA 2A7CA 1YC0A 3I78A 2ZPSA 3JZ1B 4MVNA 2QY0B 3A80A 1GI8B 3ITIA 1P2JA 1SHHB 1BMMH 1AZZA 2CHAC 1P02A 5DP8A 1FV9A 4MQAA 3UQOA 3EA7A 5EU8A 4WJG2 1AO5A 3MHWU 4GVUA 1P01A 5FPTA 1GL0E 2FM2A 4DCDA 2ZP0H 2QF0A 6CHAB 2BVSH 2P3TB 3S9BA 1ESAA 2ZCKP 2Y81A 3RXQA 4K1TA 1O2PA 1O2XA 3RXAA 3TITA 1TPAE 1BITA 1P2OA 1CBWB 5E0JA 1EPTA 1ANDA 1PPEE 1GI4A 4BAQB 2ZF0H 1BDAA 1AKSB 1EZQA 1VGCC 5LPEA 2PFEA 1OS8A 1N6XA 3NXPA 4UFEH 1CSOE 4NFFA 3PMHB 1NRQH 1PPFE 3SUFA 1NFXA 2BZ6H 4R0IA 3S7KB 2UUFB 3BN9A 4I31A 3HKJB 2GTBA 4NFEA 4E06H 1GJDB 1P9UA 4AFUA 4KKDA 3UIRA 2SNVA 1QRXA 3P8FA 2EI6A 3T29A 7ESTE 2M5TA 1O2YA 2WPIS 1UK2A 3HATH 3VFEA 1FLEE 2R9PA 5A0CA 1QBNA 4CRAA 3E6PH 1DXPA 1GBTA 2STAE 3T26A 7GCHF 3GISB 1B7XB 4O03A 2FOAA 5TJXA 1AI8H 3TU7H 2O8LA 2A2XH 5TCAA 4D9RA 1O3GA 4JCNA 3LJJA 1IQNA 2ZPRA 4ESTE 2KAIB 1P10A 1G30B 3EYDA 3SGAE 3FAOA 3RXDA 1HAVA 3C1KA 3GCOA 5C1UA 2J9NA 5C2ZA 1SLWB 1GJCB 2VJ1A 4D7GA 1PYTC 5JYIA 3MO3A 4DG4A 1LKBA 1C2HA 1TGSZ 4XSKU 1N1LA 2RG3A 2BQ7B 2FPZA 2XRCA 1EB2A 2R0LA 5E0HA 5FXLA 1YPHE 1L0ZA 2VVCA 1NROH 1T32A 3UNQA 1EZSC 4VGCB 1KXAA 3GCHB 1BJVA 1YPJH 5CE1A 1UHBA 2VIVA 1IQGA 1SL3A 1O39A 4MPXA 1OWJA 4JK6A 2FX4A 4KP0A 2GMTC 1GBDA 1O33A 2DUCA 4D9QA 1AVGH 1Y59T 3RXMA 1SGNE 1OWEA 5JB8S 1TPOA 1A5GH 4IW4E 3STJA 1AN1E 2P94A 1WV7H 1V2LT 4DJZB 1HJAB 1RXPA 4AYYB 1SFQB 3T25A 1C2DA 1O2ZA 1QJ7B 3D65E 3BG4C 2Z9LA 2ZZUH 3LT3A 2FWWA 3SU6A 3BTQE 2RCEA 1DSTA 3A7WA 3ATMA 9ESTA 5L2YH 1HXFH 5LPRA 2UUKB 1C4U2 4XBBA 4Y8YA 2Z3CA 2BXUH 5EW2H 4IN2A 4A1TA 1NRRH 2BY9X 3P6ZB 2FEQH 1HIAA 3A7VA 4X2XA 3A8CA 1O2OA 1EOLA 1C2GA 2QXJA 1ZRBA 1FY1A 4B73A 5JBBS 1VZQH 1LVOA 1ABIH 2ZDLA 3URCA 2FMJA 1DS2E 4MPUA 1CT4E 1FN6A 4TY7A 2XC4A 3GY2A 1V2JT 1DUEA 3SQEE 1F5RA 3RDZA 2BTCE 4B2AA 2R3YA 1TIOA 2ZU1A 4FUGA 4NA7A 4ZKSU 2J4IA 3SU0A 5C67A 1IQJA 4O3UA 3VB5A 5ETXA 1NY22 2ZO3H 3M3VA 1V3XA 1QJ6B 1H9LB 1GBLA 4YTAA 1UCYH 3RXJA 2WYGA 1C5MD 3GYMA 3SHCH 2OD3B 2BX4A 3LC3A 3LGTA 1O2SA 1UO6A 2ZGXH 1GDUA 3FZDA 3PWCA 2A2QH 2BX3A 4AORA 1S0QA 2HWLB 3M61U 5ESTE 1GMCG 1O3DA 2GV7A 3PO1B 3RXBA 1ZHPA 2V3HH 1VITH 3LH3A 3MH4A 1GJ6A 3RXGA 6CHAC 4Q7ZA 1S5SA 1S84A 1O3NA 5SGAE 1FNIA 2VB0A 4Y6DA 5DK1A 1C5QA 1GMHG 1Q2WA 4I33A 3W94A 4X1RU 4ZKRU 2BD2A 1TNKA 5EXNA 1DICA 1CBWC 3K6YA 2QIQA 3MFJA 1O2UA 3VXEH 2BHGA 1BA8B 2HPPH 1B0EA 1K28D 1S81A 2J2UA 3BEFB 5T6FA 3UOUA 2QA9E 4WXIA 3TNSA 3CENA 2CMYA 4GAWA 1AWHB 1SGRE 2J94A 4MPWA 4NZQA 4H42U 1QTFA 3PTBA 2ANMH 4GHQA 4ISHH 1ETSH 1P04A 1QCPA 1ELDE 2GGVB 3SU5A 4AYVB 1AUTC 4A1XA 2GCHG 2BQ6B 1GHWH 1EPTC 4HGCA 1ELVA 3RXEA 3B8JA 5BPEA 5A8YA 4H6SB 1LVBA 3LOXA 3EAJA 5DKMA 1DX5M 1YLDA 2CF9H 1KIGH 4K8YA 2OUAA 2GCTC 1SGQE 1F0SA 3RXHA 5EPNA 1QL7A 3A8DA 1JRTA 4Z0KA 1FY8E 5EW1H 2G5NA 4AB8A 1D9IA 1E35B 1LHCH 2Z6BD 2WPMS 2G5VA 1GJ8B 4Y8XA 3RXCA 1G3BA 2ZG0H 1O3FA 2ZGCA 3LGWA 3M5MA 5C5OA 3HK3B 1UJ1A 1GHVH 1TNJA 2ODYB 4O97A 2H1UA 2Y82A 5GJ4B 3ZV9A 3Q00A 4VGCC 4KTUA 3A84A 3GCHC 3OYPA 4OS2A 1CT0E 1W11U 1YF4A 1O36A 1DANH 2GZ9A 3O8RA 4MNWA 1LPGB 2C8ZB 5E8EH 1QA7A 3F9HA 4RKJB 1DLKB 3GY5A 1YPLH 1ZPCA 2YNAA 4Y8ZA 4TYDA 1SGTA 2G00A 1O3CA 4KGAA 3UOPA 1PPHE 1SBWA 1PQAA 1K1MA 3T28A 2FYQA 1RRKA 5L6NH 1SVPA 1WAYB 3DFLA 3LIWA 1GMHF 3RP2A 1TFXA 1P2QA 1QQ4A 3SW2B 1QGFA 1HAIH 4BXWA 1HJAC 2JH0D 4ASHA 3RXFA 2HVXA 1SR5C 1J8AA 2LPRA 1BZXE 2ZI2H 3GCTF 1SB1H 5EXMA 1NRPH 1YPGH 2R0KA 3RMNH 1VJ9U 1O3PB 4FVBA 1GBJA 1TOCB 5AFZH 1DDJA 2F9OA 1FY5A 2FOGA 1A0HB 3P70B 3UFAA 4YT6H 1B5GH 2ZHFH 4A7IB 2W3KA 5HM2A 2SGFE 2H6MA 1QB6A 1EZUC 3EA9A 3GDVA 5FX6A 1LHDH 3VB4A 1C1QA 1BRAA 3E0NB 3PTNA 4DGJA 2GCHF 1OYTH 2NU4E 3E1XB 3GYLB 1HAZB 2ZHQH 3A82A 1KXDA 4Q7XA 3PMBB 1GI5A 2Z94A 4ABAA 2P8OB 5JDUB 1EJNA 1K1LA 3A85A 2HALA 2VWNA 3P8GA 3UPEA 2F9UA 1VR1H 1ZOMA 3UR6A 4DIHH 2YOLA 1P03A 5E2PA 3LGYA 1BBRK 1FDPA 3QO6A 3S9AA 3UNSA 2BD4A 3MNBA 1GVLA 1IHTH 5FX5A 1Z71A 1S0RA 1S6FA 2GP9B 1XUIA 1CT2E 2NU0E 1CHOG 1NFUA 1BB0B 3QX5H 1ZTKA 1T8LA 1CA0B 1SOTA 3MNCA 1C2EA 5T6DA 3BF6H 5ABWA 1CA8B 2NU2E 3T5FH 1IHSH 1SGPE 8ESTE 4UONA 5A8ZA 1ELEE 3SQHE 4LZ1H 4KTCA 1RTLA 2ZHWH 1EAXA 1BJUA 1TGNA 2AMPA 3PO1C 1V2VT 2H9EH 3ZZCA 1J14A 4AGJA 1P2IA 1TBRH 3S69A 1D6RA 2GZ8A 3D23A 3ODFA 1GI3A 4RKOB 3LONA 1EP6A 1O2GH 3GY4A 4Y7AA 4ISNA 5AFYH 1IQHA 4LK4A 1LO6A 3SNEA 1ZJDA 2OTVA 3MH5A 2GMTB 2JETB 5DP4A 2F3CE 3NWUA 6GCHF 2C93B 3K6ZA 3NZIA 2IN2A 1JRSA 4BAMB 1A2CH 4AZ2B 1K1OA 1A4WH 2QF3A 4MNXA 4LOYH 1Y3WA 2OBOA 5LH8A 2IPHA 4B76A 3SNBA 2FOMB 1GBIA 4CH2B 1C5YB 1FPHH 1K1PA 3QWCH 3ZZAA 1A3EH 3GY8A 1Y3XA 8KME2 1SFIA 1MUEB 1MCVA 4E05H 6LPRA 1QRWA 4ISIH 1O2HA 1P57B 2VWLA 3BTTE 1TALA 3GCNA 2VGCB 2K1QA 1F92A 1AY6H 4BTUB 1MQ5A 1TA6A 1GHBF 1TPPA 1OYQA 1Q3XA 4J1YA 1BBRH 1AGJA 3H7OA 1GHZA 2XW9A 1EATA 3HGPA 3IG6B 2BD7A 3UWIA 3RXKA 3OX7U 4X1SU 5DP7A 1GI9B 3BTGE 1TX7A 1J17T 2UWLA 5F6MA 3OY6U 2ZGBH 4UD9H 1QNJA 3NCLA 3AW0A 2NU1E 1O2LA 1OP2A 4AFZA 3FFGA 1VCPA 3SUDA 5EQSA 2ZU3A 3UY9A 1JOUB 2ANYA 3A88A 4THNH 1JBUH 1AFEH 3LJOA 2TPIZ 4BNRA 3PROA 2FXRA 3UUZA 3QDZB 2OQUA 1ZGIA 1T8MA 2AFQB 5HXFA 1O5GH 5FAHA 2ZWLH 2UUYA 1JWTA 1C5UA 3AVZA 1LHGH 2AGEX 2EC9H 3RU4D 3F6UH 3F9GA 3M3SA 5A2MH 2JH5D 1ESBA 2PTCE 3TH2H 1ORFA 3ZVAA 2ZCLP 4ISLA 3B9FH 3NUMA 3ZVBA 1TA2A 4X8UH 4YLUA 2QXIA 2O8UA 1NM6A 4HFPB 5GXPA 3G01A 3PB1E 5JBAS 2PUQH 1GJ9B 1L2EA 3RXRA 1TNLA 3A83A 1MD7A 2CV3A 3MH6A 4FUJA 4ABIA 2A7HA 2XYAA 1C1MA 5HGGA 1TRMA 3KEEA 3VGCC 4NWKA 3QGJA 2QXHA 1H9HE 2SGAA 5J4SA 5AHGH 1HDTH 1BBRE 1RFNA 1GHYH 4GPGA 3JZ2B 4CH8B 1ID5H 1ETRH 1IQIA 2EI7A 2P8OC 1QBVH 1OKXA 3U8RH 1C1NA 4O9VA 4ZKOU 4Y11E 1KDQA 2ZFPH 1UTNA 3SUEA 1Y5AT 1C1UH 4XDEA 5K7RA 2HNTC 3RXIA 3LGVA 3BEUA 1THSH 4H6TA 1MBQA 4UFGH 1GMDG 4OS4A 2A4GA 2IJOB 4DT7B 1EPTB 1C2MA 3QTOH 1E37B 1GBMA 3H5CB 3R3GB 1XXDA 4X2WA 2H5DA 3UR9A 1CA0C 1V2WT 3GDSA 3SJIA 1UTKA 1O5DH 1O5EH 3OU0A 3AASA 4SGBE 3U69H 3SUGA 2GCTB 2ZTYA 1MTVA 1KXEA 2FODA 2ZDNA 3ZVFA 4TPYA 1EZXC 2HGTH 2CF8H 1J15A 2PSYA 3BTDE 1OWDA 2JH6D 2Z3EA 1TPSA 3AAVA 4AOQA 1SHYA 1HAXB 1UCYK 2XCFA 1ZTLA 3KNXA 1S82A 3KQCA 1HRTH 4OGYA 3GOVB 1GL1A 3A7YA 1K9OE 2FI4E 1AFQC 2ZQ2A 1ANBA 8GCHG 1KTTB 4OS7A 2VIPA 1AMHA 1GI2A 1C1WH 2PKAA 1P2NA 2H9HA 5G4BA 2G55A 4AGKA 1G3DA 5DO4H 1HJ9A 2JETC 1C2LA 1HAVB 1XUJA 4B2CA 3UQVA 3I77A 1NO9H 1BTYA 1C2JA 1GI7B 3UTUH 1SGCA 1THPB 1A7SA 4D7FA 1LPZB 3TLOA 1GVZA 1GJ5H 1SG8B 2ZNKH 1QL9A 2V3OH 3VB6A 1H9IE 5LGOA 1NFYA 3ZZ5A 1C9TA 1Z6JH 2CXVA 4D8NA 1FIZA 1UHBB 3M37A 1C2FA 1MH0A 1TWXB 1NN6A 2C8YB 1L4DA 4X6PA 3A8AA 3MU1A 1RIWB 2FYRA 2OINA 1FPCH 2ZDAH 2ZFSA 1BTXA 1NT1A 1A0LA 4X6MA 1YBWA 2VGCC 1TGTA 1O3KA 4DW2U 1HAOH 3BTKE 4NCYA 1MKWK 4NZLA 5IYTA 3U8TH 1DXWA 1V2KT 1J9CH 2W3IA 1AUJA 2ZECA 2D1JA 1TOMH 1HNEE 1O3OA 3EGKH 3W95A 1GMDF 3IWMA 1Z1IA 1DE7H 1LHFH 2Q6GA 2Y7ZA 5B6OA 4ZMAH 4BTIB 5A8XA 1T8OA 2AGGX 5L30H 1TE0A 1GDNA 1IOEA 1QHRB 2G51A 1SGDE 1NC6A 3FANA 1HYLA 3TVJB 1HCGA 4U01A 1BTHH 5FCRA 4WH8A 1K1IA 2F9NA 5F8TA 1ZTJA 3KHVA 1GBEA 2G4UA 4Y76A 2BQWB 2THFB 4DIIH 3MTYA 4CHAB 2GVFA 4PROA 2ODQA 3GDUA 1HIAB 5A0BA 2Y5HA 3SU1A 3V13A 4HZHA 1Y8TA 2QXGA 1YKTA 1SMFE 3LU9B 1Z8JB 3RC5A 4I8GA 1KLIH 2XXLA 1L4ZA 3ZYDA 3SNCA 1ELAA 5DPAA 4MNVA 1O2VA 3LPRA 1Y3UA 4LXBH 4ZXXH 1F0RA 4WXVA 2J38A 4WF8A 1XXFA 2BD8A 1DWCH 1OP8A 3MNXA 5IDKA 3ESTA 1AZ8A 2FI3E 1S6HA 1G9IE 3RMLH 1AU8A 4FU8A 4BTTB 2EA3A 2Z7FE 4U30A 1B0FA 2D2DA 3RXSA 1YPMH 3E8LA 5CHAB 1AE5A 1C1TA 2ASUB 1KTSB 1LMWB 1WCZA 2J92A 2A0QB 1WQSA 2ZU5A 4Y10E 1HAGE 2GV6A 4BAOB 1E0FD 1TYNA 5EPYA 1UTPA 3ELAH 5FCKA 2FOEA 1YPKH 1EB1H 2BDYA 1YGCH 2Z9JA 2A4QA 1ELTA 2AIPA 1YLCA 1NESE 1HAYB 4CRGA 2TRMA 3F9FA 3OTJE 4IS5A 2GDEH 1MKWH 3DFJA 1GG6C 1GCTB 5EQRA 3ZVDA 4ABHA 3ZVGA 1ANEA 1T4VH 1ZLRA 5JPMH 4NSYA 7KMEH 1KYNA 3UNRA 4YOIA 3RXLA 4DOQA 3TK6A 2Y6TA 1CU1A 5AF9H 4LZ4B 1F0UA 1PPCE 2ALVA 3F9EA 2P16A 1BT7A 4IN1A 3TJVA 1TRYA 1ZPZA 1W7XH 1FMGA 2I6SA 5EXLA 2RA0A 1W0ZU 1Z1JA 4CRDA 4K60A 2SNWA 1Z8IB 2VVVA 2ANWA 1GI0A 3RXVA 1VITG 1RJXB 2TGDA 1DY8A 1ZMLA 3S9CA 4QT8C 4I8LA 4H4FA 1EUFA 2TIOA 1UCYE 2ZTXA 1QY6A 2WPKS 3BTFE 1G36A 2ZGHA 1SQOA 3OY5U 1F5KU 3ZZ7A 1ZHRA 1T7CA 3LGUA 1C1OA 1YPHC 2BXTH 3GY6A 1W10U 2FO9A 5DG6A 4YZUA 4ABJA 1UVOA 1C4V2 1ZMJA 1GJ7B 4FUIA 5ESBA 4JZEH 1P09A 1C5LH 1MAYA 1GMCF 1N8OB 1LPKB 2SFAA 5HYOA 1SLXB 1QL8A 3A7XA 4CR5A 2C8XB 5F8ZA 2HOBA 3RU4E 2ILNA 4NWLA 1UVTH 3OSYA 3GICB 1UK3A 1C2IA 1O35A 4FU9A 3NPSA 3KGPA 1O3HA 1D3PB 4YESB 1HLTH 4FUHA 1Q31A 1VCWA 1GBBA 1BRUP 3SV9A 2BD9A 3ATKA 1GGDC 2D8WA 1C5RA 1TBZH 1Y3YA 2ANKH 2Y7XA 4INHA 3ZVCA 1SLUB 4SGAE 1SGEE 1OXGA 3PLPA 4ZXYH 1G37A 1C4Y2 1QR3E 1RIWC 1E34B 1O3IA 1BTUA 3A87A 4AFSA 4IC5A 2FDAA 3SGQE 1LCYA 3DT0H 1CGJE 2ZFRH 2FP7B 1HAPH 2GX4A 2XBWA 1C5XB 4JZFH 5C1YA 3QZRA 4GLYA 1SQAA 3U8OH 5GCHG 2G4TA 3VGCB 3MU4A 2W7SA 1DUAA 2R2MB 4WMEA 1O2KA 1ZR0A 3SJKA 4E7RG 3DA9B 4NA8A 1GHXH 1P0SH 1TGBA 3BTWE 4INKA 1P11E 3NKKA 4JZ1A 5E0GA 4B75A 1ZRKA 4JZIA 1VITF 1O5AB 1C5VA 2P3FH 4XOJA 3A7TA 1EP5A 4B2BA 3SO3A 3K65B 1O31A 2A4OA 1NFWA 5DP9A 1MTUA 1F2SE 1UTOA 2ESTE 4CHAC 3SJ9A 3M5LA 1AVWA 1QB1A 1ZSJA 2BDIA 1GDQA 1FIWA 2ZTZA 5DP6A 3HPTB 4FXGH 4Y0ZE 4I32A 1S83A 4WH6A 2QGRA 3ZV8A 1OPHB 3SOSA 1MU8B 4MTBA 3MU0A 1LVMA 1N6YA 2VINA 2BDGA 4K1SA 2FOHA 1SOZA 2P3UB 1MMJN 4X8TH 3MU5A 1ZYOA 3TH3H 3SU3A 5FHTA 5F03A 2PTNA 4ZHLU 1PPGE 5I25A 1AFQB 5CHAC 4TPIZ 1EJAA 4FUBA 1BMAA 1BUIA 1YM0A 3LGIA 1MCTA 3SV8A 1W3CA 3SJ8A 4IC6A 3SNAA 1PFXC 1WYKA 2BDAA 1KSNA 3MNSA 1MAXA 3ATWA 2B5TB 5EGMA 1GI1A 1QURH 1QFKH 2Z3DA 1EKBB 1AE8H 2BDHA 1RGQA 1TMTH 1HB0B 1GCTC 5LPFA 1C5PA 4K3JA 1TB6H 1C1RA 4Q2KA 2H5CA 3QGNB 3ZZBA 3U98H 3MOCA 2HNTF 4INLA 7LPRA 1SGIB 3PWBA 4CRCA 1ETTH 3UREA 3QLPH 2R3UA 4Q7YA 1HPGA 4UFDH 2QYIA 4A92A 1YCPM 1D4PB 3E91A 1D6WA 2FIRH 1TNGA 4JYTA 3S7HB 3EDXB 1QBOA 5GDSH 1NS3A 1ELCA 4BXSA 4YT7H 2AYWA 2OC1A 3HKIB 4OS6A 2GT8A 1C1SA 4UE7H 3LDXH 1IQMA 1Z8RA 4K8BA 1J16A 2BDBA 1K2I1 2ZIQH 1FXYA 1BRBE 2AEIH 2VH0A 4JYVH 2Z9KA 3SV6A 3ATIA 4DURA 1BMNH 1CHOF 1NZQH 2UWOA 2VNTA 1C5WB 4CBOA 5L2ZH 1FY3A 5JB9S 1P12E 2BD3A 2ZDKA 2ZDVH 3QK1A 4FU7A 4F49A 3Q3YA 3T27A 1OSSA 1CO7E 3RXPA 2XNIA 2Z9IA 1UTJA 5FBEA 1JIMA 1HUTH 1K1JA 4CRFA 1O2TA 5C20A 1N8OC 3V3MA 1YPEH 1ARCA 1FAKH 1A1RA 1O2RA 1W13U 5DGJA 1V2TT 1MTWA 1O34A 7GCHG 3T2NA 2C4FH 1L1JA 1SLVB 1QJ1B 1SGFA 3SU2A 5PTPA 2OQ5A 1WTGH 1KLJH 3N7OA 4WVPE 4HI3A 1ESTA 1SQTA 3QZQA 1V2QT 1V2RT 1V6DA 1FQ3A 1H8DH 3ZZ4A 1G32B 2BZAA 2A5KA 3PM3A 1WQVH 4X6OA 4MG3A 2BVRH 1CVWH 1THRH 4I7YH 2TGTA 3M7UA 1CQQA 3SV7A 3D62A 1JXPA 3GY3A 1C5ZB 1GBHA 1H4WA 5H4IB 2P93A 1XUHA 2V35A 1NRNH 2FLBH 3QTVH 1DWDH 1AKSA 1K22H 3C27B 3M3TA 1LTOA 2P95A 5F8XA 2A7JA 4ZUHA 4UDWH 2QN5T 5A09A 2QCYA 2ZEBA 1Y5BT 2A5IA 3A8BA 3EQ0H 1SPJA 4DVAU 1O30A 1WOFA 2UWPA 2Z9GA 4AG2A 1GG6B 1JIRA 1LKAA 1ZHMA 2D26C 1TRNA 2BOKA 3M7TA 2ZFTA 1LDTT 4TY6A 1DM4B 2OC8A 3E3TA 3SZNA 1D3QB 2Y80A 1MZAA 3ZVEA 5TCCA 1O3BA 1TBQH 3PV4A 4ABEA 3MMGA 1BTPA 1V2ST 1GBCA 1O0DH 2BB4A 3SNDA 2BLQA 2HLCA 4Z6AH 1VCQA 1LQEA 4ZKNU 3RXUA 2BLWA 4X6NA 1JMOH 2KAIA 2Q6DA 1P3CA 2VIQA 1A5IA 4BAHB 1BCUH 1H8IH 1MTSA 4RN6A 3RM0H 6ESTA 2PWXA 1A61H 3ZZ8A 4WWYA 1ZJKA 2VH6A 1O2NA 3F68H
chains in the Genus database with same CATH superfamily
3FZZA 3V7TA 2ZU4A 2OXSA 1KDQB 4JK5A 2PKSB 1LVYA 4JZDH 2ZFQH 2K0QA 3AAUA 1O37A 1DLEA 5EOKA 3TH4H 3DD2H 1GJ4H 1W2KH 3BTHE 3KYFA 4I8KA 2ZFFH 2ZU2A 4GSOA 1SI5H 2A1DB 1C9PA 1WUNH 2YNBA 2QF4A 3MYWA 4XBDA 2OK5A 3ZZ6A 2O8WA 4NIWA 1W8BH 1ELBA 4X8SH 2HRVA 1TAWA 2Y5FA 3HGNA 1AQ7A 4R8TB 5K0HA 1O5FH 4ABDA 3H7TA 1A0JA 3DCLA 1MZDA 2OBQA 2GD4B 1IAUA 1UVPA 4B74A 4A6LA 4FUDA 3VB7A 2CGAA 1P3EA 4ZHMU 1L1NA 1YCPK 4IMZA 3W1EA 3M7QA 2FS9A 1C5SA 3P8OA 2C8WB 2OC7A 1MBMA 1UTQA 5FBIA 2O8MA 4X1QU 3VG8A 3TGJE 4K69A 1BHXB 1PYTD 1OWIA 1ZSKA 1XKAC 2NWNA 2Y5GA 2B9LA 3KL6A 2R2WU 4AFQA 1OWKA 4XFQA 1GVKB 1GGDB 1P05A 2PP6A 4FVDA 1O3LA 3SHAH 1OX1A 2GDDA 3OE7D 2PKAB 3U9AH 2WV5A 1T8NA 4DT4A 2ZHDA 1MQ6A 2O8TA 3BEIB 1GI6A 2WPLS 3KQ5A 3MO6A 3T62A 1EQ9A 1GPZA 2OCVB 3URDA 3KQBA 2EEKA 2W5EA 3TK9A 1CGIE 2W7UA 3QUMP 2ZKSA 2QV1A 3UWJH 2BY5X 1O3EA 3KCGH 4NGAH 3ODDA 2GZ7A 1UMAH 2AIQA 3LC5A 3PV5A 1XVMA 3RLWH 1A46H 1PPBH 1TGCA 5J4QA 2VIOA 2XTTB 1GBAA 2B7DH 2VIWA 4FUEA 2XBVA 2WV4A 3TJNA 1ACBE 2BM2A 2B8OH 4UFFH 3KN2A 1XMNB 1BTWA 5A0AE 2PGQB 1WXRA 1FN8A 4FUFA 3PRDA 2BVXH 1O3JA 3RUOA 2FZZA 3Q76A 1AB9B 1ZGVA 4A5TS 1F0TA 1H1BA 4X2YA 2CN0H 2H9TH 1GWAA 3U1IB 1DT2A 1LQDB 2O9QA 2NU3E 3L6PA 5GIBA 1EXFA 1F7ZA 2WPJS 4ISOA 2AH4X 1X7AC 3BIVH 3ZZ9A 1EAWA 1ELGA 1HBTH 2ALPA 4K5ZA 4RSPA 8GCHF 3PLKA 1BHXF 4JYUH 5T3HA 2PW8H 4ZROA 1TMUH 4MPVA 3CS7A 1SKYE 4X1PU 1RS0A 1EOJA 1DITH 4OS5A 3RC6A 3OTPA 2HPQH 4IMQA 4Y79A 3BIUH 1DVAH 1YCPH 1TQ7B 4NG9H 2QF5A 1U6QA 3BTME 4AG1A 2SGQE 3FVFB 1DY9A 1O2QA 4ABGA 1IQKA 1Z7KA 2DE9A 1IQLA 4Y0YE 1G2MA 1LHEH 1FONA 5DJ7A 1L1GA 1PQ8A 5CMXH 4B6EA 1CHGA 1FI8A 1P2KA 1O2IA 1RD3B 4IGDA 5HM9A 3O8CA 3VB3A 2VBCA 4NIYA 2BYAX 3PLBA 3PYHA 4NA9H 1BRCE 5GWZA 2Q1JA 2ZHEH 3E0PB 2ULLA 4BANB 3P92A 3U1JB 1C2KA 1NRSH 2FOBA 1V2PT 2H2ZA 4X0WU 2IPQX 1BTZA 1DPOA 1UVSH 2W6JD 2YMSD 1KXBA 1QQUA 4ZAEA 3ENSB 2BMGB 2A31A 5E2OA 4U32A 1NPMA 1S85A 4IBLH 3V12A 3TGKE 2VWMA 2VWOA 3GCTG 2KM0A 1T31A 1A5HA 1G2LA 1HXEH 1ANCA 3SGBE 5HIZA 4P00A 1MD8A 1T4UH 1M9UA 5EG4A 2AMQA 4OGXA 2GKVE 2ZPQA 1BMLA 4ZH8A 2TBSA 5I46H 4KELA 3MH7A 3RC4A 1KLTA 4ZHAA 2SGEE 4GCHG 1FY4A 1ZSLA 2FOCA 1O38A 3KQEA 1KY9A 4F55A 1TX8A 1O3MA 2A5AA 5EQQA 4B71A 2PKSC 1ABJH 3VXFH 1IQFA 3P8NA 2V0BA 3LKWA 3ATLA 1E38B 1SGYE 4X2VA 5EIYA 2A45B 3EA8A 5BRRE 3Q3XA 1OWHA 2I6QA 2F83A 1O5BB 1UVUH 3LH1A 3B23B 4KTSA 3A7ZA 1O2MA 1FJSA 1XUKA 4YO9A 1BOQA 1G3CA 1GCDA 4NSVA 1WU1A 5DP3A 2W26A 3F1SB 1FZZA 1A3BH 3FP7E 1YP9A 1GBKA 1TABE 1MTNB 1DFPA 9LPRA 2XBXA 3QN7A 1Y3VA 2F9VA 3BV9B 3V0XA 5C5NA 2Q6FA 2F43B 2C90B 1XKBC 3MO9A 2WINI 4WY3A 3P17H 3SU4A 4CREA 1GHAG 1PQ7A 1O2JA 4B1TA 3FP8E 3D49H 2VU8E 1VJAU 1Y5UT 1UTLM 5EODA 4MLFB 2PGBB 2AERH 5KGOA 3RM2H 1O5CB 4GUXA 2JJ1D 5T6GA 2BY7X 2A32A 2AMDA 1QRZA 3SI4H 2BY8X 2F91A 3RU4T 2XCNA 1XX9A 2BLOA 3RXTA 2FLRH 3ZZ3A 1SC8U 3SBKA 1W12U 4XRNA 3VPKA 4AN7A 1PPZA 2CHAB 2P59A 1AVXA 2FS8A 1HFDA 2PHBA 1WBGB 1C1VH 1GJAB 1CE5A 2QC2A 3EE0B 1BQYA 1PQ5A 1DOJA 6GCHG 4YOGA 1HV7A 4DY7B 2F9BH 3KQDA 5FPSA 2KCYA 4U2WA 3HK6B 2BD5A 4MNYA 1V2NT 1ZZZA 2B0FA 1OOKB 2OLGA 2XBYA 8LPRA 4GCHF 4WMDA 2J34A 1UTMA 4Y71A 4BOHA 1NTPA 5GPIB 1HGTH 2TGAA 1YYY1 2PV9B 1VGCB 1AB9C 4K1EA 1F5LA 3WWFA 4ACBA 1P06A 1WTHD 4E7NA 5HMAA 3BTEE 2TGPZ 3TGIE 1ZPBA 1KXCA 2QAAA 1ARBA 4TWYA 4D76A 1W7GH 1GHBG 4UEHH 1G3EA 3RMMH 5JBCS 3K9XB 2ZCHP 2KZ4A 4ABBA 1HJ8A 2V6NA 1W14U 2FI5E 4Q4LA 3DUXH 2HNTE 3M5NA 3F2FA 1QIXB 1H8HD 3E90B 3RMOH 1INCA 3BG8A 4AB9A 3S0NA 1MKXK 1O2WA 2KCPA 3TPIZ 2OC0A 3O8DA 1P8VC 1NU7B 1EJMA 2BDCA 2PSXA 2RDLA 4CRBA 1GHAF 1XM1A 1O3AA 1V2UT 4HTCH 3SI3H 1FAXA 4JMYA 4CBNA 1TONA 2UUJB 3NK8A 1XVOA 3TIUA 1AHTH 1EAIA 1GJBB 4YOJA 2ZGJA 1TNIA 4X1NU 3M36A 5AVDA 3A81A 3A86A 1AD8H 4AX9H 3Q77A 4NIXA 1V2OT 3E16B 4J2YB 1EASA 3WY8A 3CP7A 2FOFA 1UK4A 1EAUA 1GBFA 2XWBI 2BY6X 4BAKB 3STIA 5C3NA 1XUGA 3M35A 2BOHB 3FP6E 3OEHD 1AWFH 3R0FA 2AS9A 4GHTA 2PR3A 2AGIX 3KIDU 4M7GA 1C1PA 2CJIA 2ZA5A 4K2YA 1BIOA 3TNTA 5GCHF 2G52A 1CGHA 4I8JA 1TLDA 2FX6A 3DHKH 2L6OA 1O32A 3F3BA 2G8TA 1RTKA 1QA0A 2VVUA 1RTFB 1TX6A 1D3DB 3UAIC 3A89A 4X8VH 2ZQ1A 3SN8A 1NU9A 1HAHH 3SORA 2WUCA 2LP6A 1TMBH 2IOTA 2PUXB 1C5NH 4TWWA 4YM9A 5C1XA 1WSSH 2FTLE 3IITA 5DP5A 1SQRA 3P95A 1TQ0B 4MDSA 2BLVA 3RXOA 1QB9A 1MU6B 3BSQA 1Z8GA 3MWIU 1YY3A 3CS0A 3ZYEA 1P9SA 3BG4B 1Z6EA 2SGPE 2SGDE 2JKHA 3MI4A 5C17A 1SSXA 4XBCA 2XC5A 4Q80A 1ZMNA 3OEED 1P2MA 2XWAA 3AW1A 4CR9A 1DWBH 1C5TA 1PJPA 3PMJA 4NIVA 3O8BA 4O3TA 3Q3KA 1K21H 1KXFA 3MU8A 4WMFA 3ZZDA 1C5OH 2GT7A 5C94A 1FUJA 2WPHS 3NRLA 4Y7BA 2LNCA 1W0YH 2PLXA 4I8HA 3RLYH 1AIXH 2CK3D 2WUBA 3SV2H 1MKXH 1MTNC 1OP0A 3L33A 2FESH 2ZC9H 1D3TB 1IQEA 2WYJA 3I29A 5FPYA 3TJOA 3TJUA 2STBE 3M5OA 1ELFA 1DSUA 1V2MT 4FUCA 4A1VA 3PMAB 4TSFD 3SJOA 3TK5A 3L3TA 3GY7A 2A4RA 3VEQB 1TNHA 1SGFG 3MQKC 1K1NA 1E36B 1EX3A 5JBTA 2ODPA 2J95A 4XE4A 4ABFA 2ZDMA 2EI8A 3K2UA 2F9PA 1XUFA 3N99A 3KF2A 4F4OC 2KX4A 1DWEH 2DE8A 2XC0A 2OP9A 2G81E 4OS1A 2VIDA 2FTMA 2RA3A 3U28C 4YLQH 2C3SA 2A7CA 1YC0A 3I78A 2ZPSA 3JZ1B 4MVNA 2QY0B 3A80A 1GI8B 3ITIA 1P2JA 1SHHB 1BMMH 1AZZA 2CHAC 1P02A 5DP8A 1FV9A 4MQAA 3UQOA 3EA7A 5EU8A 4WJG2 1AO5A 3MHWU 4GVUA 1P01A 5FPTA 1GL0E 2FM2A 4DCDA 2EY4C 2ZP0H 2QF0A 3DSGA 6CHAB 2BVSH 2P3TB 3S9BA 1ESAA 2ZCKP 2Y81A 3RXQA 4K1TA 1O2PA 1O2XA 3RXAA 3TITA 1TPAE 3OAAD 1BITA 2L74A 1P2OA 1CBWB 5E0JA 1EPTA 1ANDA 1PPEE 1GI4A 4BAQB 2ZF0H 1BDAA 1AKSB 1EZQA 1VGCC 5LPEA 2PFEA 1OS8A 1N6XA 3NXPA 4UFEH 1CSOE 4NFFA 3PMHB 1NRQH 1PPFE 3SUFA 1NFXA 2BZ6H 4R0IA 3S7KB 2UUFB 3BN9A 4I31A 3HKJB 2GTBA 4NFEA 4E06H 1GJDB 5KEDA 1P9UA 4P02A 4AFUA 4KKDA 3UIRA 2SNVA 1QRXA 3P8FA 2EI6A 3T29A 7ESTE 2M5TA 1O2YA 2WPIS 1UK2A 3HATH 3VFEA 1FLEE 2R9PA 5A0CA 1QBNA 4CRAA 3E6PH 1DXPA 1GBTA 2STAE 3T26A 4ASUD 7GCHF 3GISB 3PRBA 1B7XB 4O03A 2FOAA 5TJXA 1AI8H 3TU7H 2O8LA 2A2XH 5TCAA 4D9RA 1O3GA 3FN8A 4JCNA 3LJJA 1IQNA 2ZPRA 4ESTE 2KAIB 1P10A 1G30B 3EYDA 3SGAE 3FAOA 3RXDA 1HAVA 3C1KA 3GCOA 5C1UA 2J9NA 5C2ZA 1SLWB 1GJCB 2VJ1A 4D7GA 1PYTC 5JYIA 3MO3A 4DG4A 1LKBA 1C2HA 1TGSZ 4XSKU 1N1LA 2RG3A 2BQ7B 2FPZA 2XRCA 1EB2A 2R0LA 5E0HA 5FXLA 1YPHE 1L0ZA 2VVCA 1NROH 1T32A 3UNQA 1EZSC 4VGCB 1KXAA 3GCHB 1BJVA 1YPJH 5CE1A 1UHBA 2VIVA 1IQGA 1SL3A 1E1QD 1O39A 2AHME 4MPXA 1OWJA 4JK6A 2FX4A 4KP0A 2GMTC 1GBDA 1O33A 2DUCA 4D9QA 1AVGH 1Y59T 3RXMA 1SGNE 1OWEA 5JB8S 1TPOA 1A5GH 4IW4E 3STJA 1AN1E 2P94A 1WV7H 1V2LT 4DJZB 1HJAB 1RXPA 4AYYB 1SFQB 3T25A 1C2DA 1O2ZA 1QJ7B 3F0PA 3D65E 3BG4C 2Z9LA 2ZZUH 3LT3A 2FWWA 3SU6A 3BTQE 2RCEA 1DSTA 3A7WA 3ATMA 9ESTA 5L2YH 1HXFH 5LPRA 1W0KD 2UUKB 1C4U2 4XBBA 4Y8YA 2Z3CA 2BXUH 5EW2H 4IN2A 4A1TA 1NRRH 2BY9X 3P6ZB 2FEQH 1HIAA 3A7VA 4X2XA 3A8CA 1O2OA 1EOLA 1C2GA 2QXJA 1ZRBA 1FY1A 4B73A 5JBBS 1VZQH 1LVOA 1ABIH 2ZDLA 3URCA 2FMJA 1DS2E 4MPUA 1CT4E 1FN6A 4TY7A 2XC4A 3GY2A 1V2JT 1E1RD 1DUEA 2RFKC 3SQEE 1F5RA 3FO8D 3RDZA 2BTCE 4B2AA 2R3YA 1TIOA 2ZU1A 4FUGA 4NA7A 2JIZD 4ZKSU 2J4IA 3SU0A 5C67A 1IQJA 4O3UA 3VB5A 5ETXA 1NY22 2ZO3H 3M3VA 1V3XA 1QJ6B 4Z1MD 1H9LB 1GBLA 4YTAA 1UCYH 3RXJA 2WYGA 1C5MD 3GYMA 3SHCH 2M2AA 2OD3B 2BX4A 3LC3A 3LGTA 1O2SA 1UO6A 5HIYA 2ZGXH 1GDUA 3FZDA 3PWCA 2A2QH 2EQNA 2BX3A 4AORA 1S0QA 2HWLB 3M61U 5ESTE 1GMCG 1O3DA 3DSOA 2GV7A 3PO1B 3RXBA 1ZHPA 2V3HH 1VITH 3LH3A 3MH4A 1GJ6A 3RXGA 6CHAC 4Q7ZA 1S5SA 1S84A 1O3NA 5SGAE 1FNIA 2VB0A 4Y6DA 5DK1A 2KCOA 1C5QA 1GMHG 1Q2WA 4I33A 3W94A 4X1RU 4ZKRU 5CDFE 2BD2A 1TNKA 5EXNA 1DICA 1CBWC 3K6YA 1K0HA 2QIQA 3MFJA 1O2UA 3VXEH 2BHGA 1BA8B 2HPPH 1B0EA 1K28D 1S81A 2J2UA 3BEFB 5T6FA 3UOUA 2QA9E 4WXIA 3TNSA 3CENA 1OHHD 2CMYA 4GAWA 1AWHB 4AC9A 1SGRE 2J94A 4MPWA 4NZQA 4H42U 1QTFA 3PTBA 2ANMH 4GHQA 4ISHH 3EE7A 1ETSH 1P04A 1QCPA 1ELDE 2GGVB 3SU5A 4AYVB 1AUTC 4YXWD 4A1XA 2GCHG 2BQ6B 1GHWH 1EPTC 4HGCA 1ELVA 3RXEA 3B8JA 5BPEA 5A8YA 4H6SB 1LVBA 3LOXA 3EAJA 5EJZA 2GJGA 5DKMA 1DX5M 1YLDA 2CF9H 1KIGH 2J5UA 2RDEA 4K8YA 4B6FA 2OUAA 2GCTC 1SGQE 1UW7A 1F0SA 3RXHA 3N7EA 5EPNA 1QL7A 3A8DA 1JRTA 4Z0KA 1FY8E 5EW1H 1MABB 2G5NA 4AB8A 1D9IA 1E35B 1LHCH 2Z6BD 2WPMS 2G5VA 1GJ8B 4Y8XA 3RXCA 1G3BA 2ZG0H 1O3FA 2ZGCA 3LGWA 3M5MA 5C5OA 3HK3B 1UJ1A 1GHVH 1TNJA 2ODYB 4O97A 2H1UA 2Y82A 5GJ4B 3ZV9A 3Q00A 4VGCC 4KTUA 3A84A 4XD7D 3GCHC 3OYPA 4OS2A 1CT0E 1W11U 1YF4A 1O36A 1DANH 2GZ9A 3O8RA 4MNWA 1LPGB 2K8IA 2C8ZB 5E8EH 2J98A 2J97A 1QA7A 3F9HA 4RKJB 1DLKB 3GY5A 1YPLH 1ZPCA 2YNAA 4Y8ZA 4TYDA 1SGTA 2G00A 1O3CA 4KGAA 3UOPA 1PPHE 1SBWA 1PQAA 2LELA 1K1MA 3T28A 2FYQA 1RRKA 5L6NH 1SVPA 1WAYB 3DFLA 3LIWA 1GMHF 3RP2A 1TFXA 1P2QA 1QQ4A 3SW2B 1QGFA 3ZIAD 1HAIH 4BXWA 1HJAC 2JH0D 4ASHA 3RXFA 2HVXA 1SR5C 1J8AA 2LPRA 1BZXE 2ZI2H 3WWBA 3GCTF 1SB1H 5EXMA 1NRPH 1YPGH 2R0KA 3RMNH 1VJ9U 1O3PB 4FVBA 1GBJA 1TOCB 5AFZH 1DDJA 2F9OA 1FY5A 2FOGA 1A0HB 3P70B 3UFAA 4YT6H 1B5GH 2ZHFH 4A7IB 2W3KA 5HM2A 2SGFE 2H6MA 1QB6A 1EZUC 3EA9A 3GDVA 5FX6A 1LHDH 5B6LA 3VB4A 1C1QA 3F0OA 1BRAA 3E0NB 3PTNA 4DGJA 2GCHF 1OYTH 2NU4E 3E1XB 4RT0A 3GYLB 1HAZB 2ZHQH 3A82A 1KXDA 4Q7XA 3PMBB 1GI5A 2Z94A 4ABAA 2P8OB 5JDUB 1EJNA 1K1LA 3A85A 2JJ2D 2HALA 2VWNA 3P8GA 3UPEA 2F9UA 1VR1H 1ZOMA 3UR6A 4DIHH 2YOLA 1P03A 2WZQA 5E2PA 3LGYA 1BBRK 1FDPA 3QO6A 3S9AA 3UNSA 2BD4A 3MNBA 1GVLA 1IHTH 5FX5A 1Z71A 1S0RA 1S6FA 2GP9B 1XUIA 1CT2E 5EJ1A 2NU0E 1CHOG 1NFUA 1BB0B 3QX5H 4Q63A 3GS9A 1ZTKA 1T8LA 1CA0B 1SOTA 3MNCA 1C2EA 5T6DA 3BF6H 5ABWA 1CA8B 2NU2E 3T5FH 1IHSH 1SGPE 8ESTE 1H8ED 4UONA 5A8ZA 3DSPA 1ELEE 3SQHE 4LZ1H 4KTCA 1RTLA 2ZHWH 1EAXA 3SYJA 1BJUA 1TGNA 1NBME 2AMPA 3PO1C 1V2VT 2H9EH 3ZZCA 1J14A 4AGJA 1P2IA 1TBRH 3S69A 1D6RA 2GZ8A 3D23A 3ODFA 1GI3A 4RKOB 3LONA 1EP6A 1O2GH 3GY4A 4Y7AA 4ISNA 5AFYH 1IQHA 4LK4A 1LO6A 3SNEA 1ZJDA 2OTVA 3MH5A 2GMTB 2JETB 5DP4A 5DSFA 2F3CE 3NWUA 6GCHF 2C93B 3K6ZA 1W0JD 2IN2A 3NZIA 1JRSA 4BAMB 4F48B 1A2CH 4AZ2B 1K1OA 1A4WH 2QF3A 4MNXA 4LOYH 1Y3WA 2OBOA 3F2HA 4TT3D 2IPHA 4B76A 5LH8A 3SNBA 2FOMB 1GBIA 4ACAA 4CH2B 1C5YB 1FPHH 1K1PA 3QWCH 3ZZAA 1A3EH 3GY8A 1Y3XA 8KME2 1SFIA 1MUEB 1MCVA 4E05H 6LPRA 1QRWA 4ISIH 1O2HA 1P57B 2VWLA 1S6LA 3BTTE 1TALA 3GCNA 2VGCB 2K1QA 1F92A 1AY6H 4BTUB 1MQ5A 1TA6A 1GHBF 1TPPA 1OYQA 1Q3XA 4J1YA 1BBRH 1AGJA 3H7OA 1GHZA 2XW9A 1EATA 3HGPA 3IG6B 2BD7A 3UWIA 3RXKA 3OX7U 4X1SU 5DP7A 1GI9B 3BTGE 1TX7A 1J17T 2UWLA 5F6MA 1BMFD 3OY6U 2ZGBH 4UD9H 1QNJA 3NCLA 3AW0A 2NU1E 1O2LA 1OP2A 4AFZA 3FFGA 1VCPA 3SUDA 5EQSA 2ZU3A 3UY9A 1JOUB 2ANYA 3A88A 4THNH 1JBUH 4OM9A 3CNRA 1AFEH 3LJOA 2TPIZ 4BNRA 3PROA 3OFND 2FXRA 3UUZA 3QDZB 2OQUA 1ZGIA 1T8MA 2AFQB 5HXFA 4FOUC 1O5GH 5FAHA 2ZWLH 2UUYA 1JWTA 1C5UA 1WDIA 3AVZA 1LHGH 2AGEX 2EC9H 3RU4D 3F6UH 3F9GA 3M3SA 5A2MH 2JH5D 3SZEA 1ESBA 2PTCE 3TH2H 1ORFA 3ZVAA 2YMSB 2ZCLP 4ISLA 3B9FH 3NUMA 3ZVBA 1TA2A 4X8UH 4YLUA 2QXIA 2O8UA 1NM6A 4HFPB 5GXPA 3G01A 3H09A 3PB1E 5JBAS 2PUQH 1GJ9B 1L2EA 3RXRA 1TNLA 3A83A 1MD7A 2CV3A 3MH6A 4FUJA 4ABIA 2A7HA 2XYAA 1C1MA 5HGGA 3AK5A 1TRMA 3KEEA 3VGCC 4NWKA 3QGJA 2QXHA 1H9HE 3F2GA 2SGAA 5J4SA 5AHGH 1HDTH 1BBRE 1RFNA 1GHYH 4GPGA 3JZ2B 4CH8B 1ID5H 1ETRH 1IQIA 2EI7A 2P8OC 1QBVH 1OKXA 3U8RH 1C1NA 4O9VA 4ZKOU 3PV2A 2KCAA 4Y11E 1KDQA 2ZFPH 1UTNA 3SUEA 1Y5AT 1C1UH 4XDEA 5K7RA 2HNTC 3RXIA 3LGVA 3BEUA 5CHBA 1THSH 4H6TA 1MBQA 4UFGH 1GMDG 4OS4A 2A4GA 2IJOB 4DT7B 1EPTB 1C2MA 3QTOH 1E37B 1GBMA 3H5CB 3R3GB 1XXDA 4X2WA 2H5DA 3UR9A 1CA0C 1V2WT 3GDSA 3SJIA 1UTKA 1O5DH 1O5EH 3OU0A 3AASA 4SGBE 3U69H 3SUGA 2GCTB 2ZTYA 1MTVA 1KXEA 2FODA 2ZDNA 2WV9A 3ZVFA 4TPYA 1EZXC 2HGTH 2CF8H 1J15A 2PSYA 3BTDE 1OWDA 2JH6D 2Z3EA 1TPSA 3AAVA 4AOQA 1SHYA 1HAXB 1UCYK 2XCFA 1ZTLA 3KNXA 1S82A 3KQCA 1HRTH 4OGYA 3GOVB 1GL1A 3A7YA 1K9OE 2FI4E 1AFQC 2ZQ2A 1ANBA 8GCHG 1KTTB 4OS7A 1NBMD 2VIPA 1AMHA 1GI2A 1C1WH 2PKAA 1COWD 1P2NA 2H9HA 4M9FA 5G4BA 2G55A 4AGKA 1G3DA 5DO4H 1HJ9A 2JETC 1C2LA 1HAVB 1XUJA 4B2CA 5IK2D 3I77A 3UQVA 5HKKD 1NO9H 1BTYA 1C2JA 1GI7B 3UTUH 1SGCA 1THPB 1A7SA 4D7FA 1LPZB 3TLOA 1GVZA 1GJ5H 1SG8B 2ZNKH 1QL9A 2V3OH 3VB6A 5F53A 1H9IE 5LGOA 1NFYA 3ZZ5A 1C9TA 1Z6JH 2CXVA 4D8NA 1FIZA 1UHBB 3M37A 1C2FA 1MH0A 1TWXB 1NN6A 2C8YB 1L4DA 4X6PA 3A8AA 3MU1A 1RIWB 2FYRA 2OINA 3WW7A 1FPCH 2ZDAH 2ZFSA 1BTXA 1NT1A 1A0LA 4X6MA 1YBWA 2VGCC 1TGTA 1O3KA 4DW2U 1HAOH 3BTKE 4NCYA 1MKWK 4NZLA 5IYTA 3U8TH 1DXWA 1V2KT 1J9CH 2W3IA 1AUJA 2ZECA 2D1JA 1TOMH 1HNEE 1O3OA 3EGKH 3W95A 1GMDF 3IWMA 1Z1IA 1DE7H 1LHFH 2Q6GA 2Y7ZA 5B6OA 4ZMAH 4BTIB 5A8XA 1T8OA 2V3MA 2AGGX 5L30H 1TE0A 1GDNA 1IOEA 1QHRB 2G51A 1SGDE 1NC6A 3FANA 1HYLA 3TVJB 1HCGA 4U01A 1BTHH 5FCRA 4WH8A 1K1IA 2F9NA 5F8TA 1ZTJA 3KHVA 1GBEA 2G4UA 4Y76A 2BQWB 2THFB 4DIIH 3MTYA 4CHAB 2GVFA 4PROA 2ODQA 3GDUA 1HIAB 5A0BA 2Y5HA 2QE7D 3SU1A 3V13A 4HZHA 1Y8TA 2QXGA 1YKTA 1SMFE 3LU9B 1Z8JB 3RC5A 2WPDD 4I8GA 1KLIH 2XXLA 1L4ZA 3ZYDA 3SNCA 1ELAA 5DPAA 4MNVA 1O2VA 3LPRA 1Y3UA 4LXBH 4ZXXH 1F0RA 4WXVA 2J38A 4WF8A 1XXFA 2BD8A 1DWCH 1OP8A 3MNXA 5IDKA 2XNDD 3ESTA 2KFWA 1AZ8A 2FI3E 1S6HA 2YMSC 1G9IE 3RMLH 1AU8A 4FU8A 4BTTB 2EA3A 2Z7FE 4U30A 1B0FA 2D2DA 3RXSA 1YPMH 3E8LA 5CHAB 1AE5A 1C1TA 2ASUB 1KTSB 1LMWB 1WCZA 2J92A 2A0QB 1WQSA 2ZU5A 4Y10E 1HAGE 2GV6A 4BAOB 1E0FD 1TYNA 5EPYA 1UTPA 3ELAH 5FCKA 2FOEA 1YPKH 1EB1H 2BDYA 1YGCH 2Z9JA 2A4QA 1ELTA 2W6ID 2AIPA 1YLCA 1NESE 1HAYB 4CRGA 2TRMA 3F9FA 3OTJE 4IS5A 2GDEH 1MKWH 3DFJA 1GG6C 1GCTB 5EQRA 3ZVDA 4ABHA 3ZVGA 1ANEA 1T4VH 1ZLRA 5JPMH 4NSYA 7KMEH 1KYNA 3UNRA 4YOIA 3RXLA 4DOQA 3TK6A 2Y6TA 1CU1A 5AF9H 4LZ4B 1F0UA 1PPCE 2ALVA 3F9EA 2P16A 1BT7A 4IN1A 3TJVA 1E79D 1TRYA 1ZPZA 1W7XH 1FMGA 2I6SA 5EXLA 2RA0A 1W0ZU 1Z1JA 4CRDA 2JDID 4K60A 2SNWA 1Z8IB 2VVVA 2ANWA 1GI0A 3RXVA 1VITG 1RJXB 2TGDA 1YLNA 1DY8A 1ZMLA 3S9CA 4RT1A 4QT8C 4I8LA 4H4FA 1EUFA 2TIOA 1UCYE 2ZTXA 1QY6A 2WPKS 3BTFE 1G36A 2ZGHA 1SQOA 3OY5U 1F5KU 3ZZ7A 1ZHRA 1T7CA 3LGUA 1C1OA 1YPHC 2BXTH 3GY6A 1W10U 2FO9A 5DG6A 4YZUA 4ABJA 1UVOA 1C4V2 1ZMJA 4I86A 1GJ7B 4FUIA 5ESBA 4JZEH 1P09A 1C5LH 1MAYA 1GMCF 2WHXA 1N8OB 1LPKB 2SFAA 5HYOA 1SLXB 1QL8A 3A7XA 4CR5A 2C8XB 5F8ZA 2HOBA 3RU4E 2ILNA 4NWLA 1UVTH 3OSYA 3GICB 1UK3A 1C2IA 1O35A 4FU9A 3NPSA 3KGPA 1O3HA 1D3PB 4YESB 1HLTH 4FUHA 1Q31A 1VCWA 1GBBA 1BRUP 3SV9A 2BD9A 3ATKA 1GGDC 2D8WA 1C5RA 1TBZH 1Y3YA 2ANKH 2Y7XA 4INHA 3ZVCA 1SLUB 4SGAE 1SGEE 1OXGA 2J98B 3PLPA 4ZXYH 1G37A 1C4Y2 1QR3E 1RIWC 1E34B 1O3IA 1BTUA 3A87A 4AFSA 4IC5A 2FDAA 3SGQE 1LCYA 2KR7A 2HLDD 3FOAA 3DT0H 1CGJE 2ZFRH 2FP7B 1HAPH 2GX4A 2XBWA 1C5XB 4JZFH 5C1YA 3QZRA 4GLYA 1SQAA 3U8OH 5GCHG 2G4TA 3VGCB 3MU4A 2W7SA 3FKSD 1DUAA 2R2MB 4WMEA 1O2KA 1ZR0A 3SJKA 4E7RG 3DA9B 4NA8A 1GHXH 1P0SH 1TGBA 3BTWE 4INKA 1P11E 3NKKA 4JZ1A 5E0GA 4B75A 1ZRKA 4JZIA 1VITF 1O5AB 1C5VA 2P3FH 4XOJA 3A7TA 1EP5A 4B2BA 3SO3A 3K65B 1O31A 2A4OA 1NFWA 5DP9A 1MTUA 1F2SE 1UTOA 2ESTE 4CHAC 3SJ9A 3M5LA 1AVWA 1QB1A 1ZSJA 5FL7D 2BDIA 1GDQA 1FIWA 2ZTZA 5DP6A 3HPTB 4HG6A 4FXGH 4Y0ZE 4I32A 1S83A 4WH6A 5KECA 2QGRA 3ZV8A 1OPHB 3SOSA 5GNDA 1MU8B 4MTBA 3MU0A 1LVMA 1N6YA 2VINA 2BDGA 4K1SA 2FOHA 1SOZA 1EFRD 2P3UB 1MMJN 4X8TH 3MU5A 1ZYOA 3TH3H 5C0UA 3SU3A 5FHTA 5F03A 2PTNA 4ZHLU 1PPGE 5I25A 1AFQB 5CHAC 4TPIZ 1EJAA 4FUBA 1BMAA 1BUIA 1YM0A 3LGIA 1MCTA 3SV8A 1W3CA 3SJ8A 4IC6A 3SNAA 4FETA 1PFXC 1WYKA 2BDAA 1KSNA 3MNSA 1MAXA 3ATWA 2B5TB 5EGMA 1GI1A 1QURH 1QFKH 2Z3DA 4ZCNA 1EKBB 1AE8H 2BDHA 1RGQA 1TMTH 1HB0B 1KMHB 1GCTC 5LPFA 1C5PA 4K3JA 1TB6H 1C1RA 4Q2KA 2H5CA 3QGNB 3ZZBA 3U98H 3MOCA 2HNTF 4INLA 7LPRA 1SGIB 2XOKD 3PWBA 4CRCA 1ETTH 3UREA 3QLPH 2R3UA 4Q7YA 1HPGA 4UFDH 2QYIA 4A92A 1YCPM 1D4PB 3E91A 1D6WA 2FIRH 1TNGA 4JYTA 3S7HB 3EDXB 1QBOA 5GDSH 1NS3A 1ELCA 4BXSA 4YT7H 2AYWA 5EJLA 2OC1A 3HKIB 4OS6A 2GT8A 1C1SA 4UE7H 3LDXH 1IQMA 1Z8RA 4K8BA 1J16A 1QZ8A 2BDBA 1K2I1 2ZIQH 1FXYA 1BRBE 2AEIH 2VH0A 4JYVH 2Z9KA 3SV6A 3ATIA 4DURA 1BMNH 1CHOF 1NZQH 1FX0B 2UWOA 2IJD1 1C5WB 2VNTA 4CBOA 5L2ZH 1FY3A 5JB9S 1P12E 2BD3A 2ZDKA 2ZDVH 3QK1A 4FU7A 4F49A 3Q3YA 3T27A 1OSSA 1CO7E 3RXPA 2F4LA 2XNIA 2Z9IA 1UTJA 5FBEA 1JIMA 1HUTH 1K1JA 3N7DA 4CRFA 1O2TA 5C20A 1N8OC 3V3MA 1YPEH 1ARCA 1FAKH 1A1RA 1O2RA 1W13U 5DGJA 1V2TT 1MTWA 1O34A 7GCHG 3T2NA 2C4FH 1L1JA 1SLVB 1QJ1B 1SGFA 3SU2A 5PTPA 2OQ5A 1WTGH 1KLJH 3N7OA 1YWUA 4HI3A 4WVPE 1ESTA 1SQTA 3QZQA 1V2QT 1V2RT 1V6DA 1FQ3A 1H8DH 3ZZ4A 1G32B 2BZAA 2A5KA 3PM3A 1WQVH 4X6OA 4MG3A 2BVRH 1CVWH 1THRH 4I7YH 2TGTA 3M7UA 1CQQA 3SV7A 3D62A 1JXPA 3GY3A 3KYGA 1C5ZB 1GBHA 1VKYA 1H4WA 5H4IB 5T1VA 2P93A 1XUHA 2V35A 1NRNH 2FLBH 3QTVH 1DWDH 1AKSA 1K22H 2HVYB 3C27B 3M3TA 1LTOA 2P95A 5F8XA 2A7JA 4ZUHA 4UDWH 2QN5T 5A09A 2QCYA 2ZEBA 1Y5BT 2A5IA 3A8BA 3EQ0H 1SPJA 4DVAU 1O30A 1WOFA 5DN6D 2UWPA 2Z9GA 4AG2A 1GG6B 1JIRA 1LKAA 1ZHMA 2D26C 1TRNA 2BOKA 3M7TA 2ZFTA 1LDTT 4TY6A 1DM4B 2OC8A 3E3TA 3SZNA 1D3QB 2Y80A 1MZAA 3UB0A 3ZVEA 5TCCA 1O3BA 1TBQH 3PV4A 4ABEA 3MMGA 1BTPA 1V2ST 1GBCA 1O0DH 2BB4A 3SNDA 2BLQA 2HLCA 4Z6AH 1VCQA 1LQEA 4ZKNU 3RXUA 5C0TA 2WSSD 2BLWA 4X6NA 1JMOH 2KAIA 2Q6DA 1P3CA 2VIQA 1A5IA 4BAHB 1BCUH 1H8IH 1MTSA 4RN6A 2V7QD 3RM0H 6ESTA 2PWXA 1A61H 3ZZ8A 4RI0A 4WWYA 1ZJKA 2VH6A 1O2NA 3F68H
chains in the Genus database with same CATH topology
3FZZA 3V7TA 2ZU4A 2OXSA 1KDQB 4JK5A 2PKSB 1LVYA 4JZDH 2ZFQH 3AAUA 1O37A 1DLEA 5EOKA 3TH4H 3DD2H 1GJ4H 1W2KH 3BTHE 4I8KA 2ZFFH 2ZU2A 4GSOA 1SI5H 2A1DB 1C9PA 1WUNH 2YNBA 3MYWA 4XBDA 3ZZ6A 2O8WA 4NIWA 1W8BH 1ELBA 4X8SH 2HRVA 1TAWA 2Y5FA 3HGNA 1AQ7A 4R8TB 5K0HA 1O5FH 4ABDA 3H7TA 1A0JA 1MZDA 2OBQA 2GD4B 1IAUA 1UVPA 4B74A 4A6LA 4FUDA 3VB7A 2CGAA 1P3EA 4ZHMU 1L1NA 1YCPK 4IMZA 3M7QA 2FS9A 1C5SA 3P8OA 2C8WB 2OC7A 1MBMA 1UTQA 5FBIA 2O8MA 4X1QU 3TGJE 4K69A 1BHXB 1PYTD 1OWIA 1ZSKA 1XKAC 2NWNA 2Y5GA 2B9LA 3KL6A 2R2WU 4AFQA 1OWKA 4XFQA 1GVKB 1GGDB 1P05A 4FVDA 1O3LA 3SHAH 1OX1A 2GDDA 2PKAB 3U9AH 2WV5A 1T8NA 2ZHDA 1MQ6A 2O8TA 3BEIB 1GI6A 2WPLS 3MO6A 3T62A 1EQ9A 1GPZA 2OCVB 3URDA 3KQBA 2EEKA 2W5EA 3TK9A 1CGIE 2W7UA 3QUMP 2ZKSA 2QV1A 3UWJH 2BY5X 1O3EA 3KCGH 4NGAH 3ODDA 2GZ7A 1UMAH 2AIQA 3LC5A 1XVMA 3RLWH 1A46H 1PPBH 1TGCA 5J4QA 2VIOA 2XTTB 1GBAA 2B7DH 2VIWA 4FUEA 2XBVA 2WV4A 3TJNA 1ACBE 2BM2A 2B8OH 4UFFH 3KN2A 1XMNB 1BTWA 5A0AE 2PGQB 1FN8A 4FUFA 2BVXH 1O3JA 3RUOA 2FZZA 3Q76A 1AB9B 1ZGVA 4A5TS 1F0TA 1H1BA 4X2YA 2CN0H 2H9TH 1GWAA 3U1IB 1DT2A 1LQDB 2O9QA 2NU3E 3L6PA 5GIBA 1EXFA 1F7ZA 2WPJS 4ISOA 2AH4X 1X7AC 3BIVH 3ZZ9A 1EAWA 1ELGA 1HBTH 2ALPA 4K5ZA 4RSPA 8GCHF 3PLKA 1BHXF 4JYUH 5T3HA 2PW8H 4ZROA 1TMUH 4MPVA 3CS7A 4X1PU 1RS0A 1EOJA 1DITH 4OS5A 3RC6A 2HPQH 4IMQA 4Y79A 3BIUH 1DVAH 1YCPH 1TQ7B 4NG9H 1U6QA 3BTME 4AG1A 2SGQE 3FVFB 1DY9A 1O2QA 4ABGA 1IQKA 1Z7KA 2DE9A 1IQLA 4Y0YE 1G2MA 1LHEH 1FONA 5DJ7A 1L1GA 1PQ8A 5CMXH 1CHGA 1FI8A 1P2KA 1O2IA 1RD3B 4IGDA 5HM9A 3O8CA 3VB3A 4NIYA 2BYAX 3PLBA 3PYHA 4NA9H 1BRCE 5GWZA 2Q1JA 2ZHEH 3E0PB 2ULLA 4BANB 3P92A 3U1JB 1C2KA 1NRSH 2FOBA 1V2PT 2H2ZA 4X0WU 1BTZA 1DPOA 1UVSH 1KXBA 1QQUA 4ZAEA 3ENSB 2BMGB 2A31A 5E2OA 4U32A 1NPMA 1S85A 4IBLH 3V12A 3TGKE 2VWMA 2VWOA 3GCTG 1T31A 1A5HA 1G2LA 1HXEH 1ANCA 3SGBE 1MD8A 1T4UH 1M9UA 5EG4A 2AMQA 4OGXA 2GKVE 2ZPQA 1BMLA 4ZH8A 2TBSA 5I46H 4KELA 3MH7A 3RC4A 1KLTA 4ZHAA 2SGEE 4GCHG 1FY4A 1ZSLA 2FOCA 1O38A 3KQEA 1KY9A 1TX8A 1O3MA 2A5AA 5EQQA 4B71A 2PKSC 1ABJH 3VXFH 1IQFA 3P8NA 2V0BA 3LKWA 3ATLA 1E38B 1SGYE 4X2VA 2A45B 3EA8A 5BRRE 3Q3XA 1OWHA 2I6QA 2F83A 1O5BB 1UVUH 3LH1A 3B23B 4KTSA 3A7ZA 1O2MA 1FJSA 1XUKA 4YO9A 1BOQA 1G3CA 1GCDA 4NSVA 1WU1A 5DP3A 2W26A 3F1SB 1FZZA 1A3BH 3FP7E 1YP9A 1GBKA 1TABE 1MTNB 1DFPA 9LPRA 2XBXA 3QN7A 1Y3VA 2F9VA 3BV9B 3V0XA 5C5NA 2Q6FA 2C90B 1XKBC 3MO9A 2WINI 4WY3A 3P17H 3SU4A 4CREA 1GHAG 1PQ7A 1O2JA 4B1TA 3FP8E 3D49H 2VU8E 1VJAU 1Y5UT 1UTLM 5EODA 4MLFB 2PGBB 2AERH 3RM2H 1O5CB 4GUXA 5T6GA 2BY7X 2A32A 2AMDA 1QRZA 3SI4H 2BY8X 2F91A 3RU4T 2XCNA 1XX9A 2BLOA 3RXTA 2FLRH 3ZZ3A 1SC8U 3SBKA 1W12U 3VPKA 4AN7A 1PPZA 2CHAB 2P59A 1AVXA 2FS8A 1HFDA 2PHBA 1WBGB 1C1VH 1GJAB 1CE5A 2QC2A 3EE0B 1BQYA 1PQ5A 1DOJA 6GCHG 4YOGA 1HV7A 4DY7B 2F9BH 3KQDA 5FPSA 4U2WA 3HK6B 2BD5A 4MNYA 1V2NT 1ZZZA 2B0FA 1OOKB 2OLGA 2XBYA 8LPRA 4GCHF 4WMDA 2J34A 1UTMA 4Y71A 4BOHA 1NTPA 5GPIB 1HGTH 2TGAA 1YYY1 2PV9B 1VGCB 1AB9C 4K1EA 1F5LA 1P06A 1WTHD 4E7NA 5HMAA 3BTEE 2TGPZ 3TGIE 1ZPBA 1KXCA 2QAAA 1ARBA 4TWYA 4D76A 1W7GH 1GHBG 4UEHH 1G3EA 3RMMH 5JBCS 3K9XB 2ZCHP 4ABBA 1HJ8A 2V6NA 1W14U 2FI5E 3DUXH 2HNTE 3M5NA 1QIXB 3E90B 3RMOH 1INCA 3BG8A 4AB9A 3S0NA 1MKXK 1O2WA 3TPIZ 2OC0A 3O8DA 1P8VC 1NU7B 1EJMA 2BDCA 2PSXA 2RDLA 4CRBA 1GHAF 1XM1A 1O3AA 1V2UT 4HTCH 3SI3H 1FAXA 4JMYA 4CBNA 1TONA 2UUJB 3NK8A 1XVOA 3TIUA 1AHTH 1EAIA 1GJBB 4YOJA 2ZGJA 1TNIA 4X1NU 3M36A 5AVDA 3A81A 3A86A 1AD8H 4AX9H 3Q77A 4NIXA 1V2OT 3E16B 4J2YB 1EASA 3WY8A 3CP7A 2FOFA 1UK4A 1EAUA 1GBFA 2XWBI 2BY6X 4BAKB 3STIA 5C3NA 1XUGA 3M35A 2BOHB 3FP6E 1AWFH 3R0FA 2AS9A 4GHTA 2PR3A 2AGIX 3KIDU 4M7GA 1C1PA 2CJIA 2ZA5A 4K2YA 1BIOA 3TNTA 5GCHF 2G52A 1CGHA 4I8JA 1TLDA 2FX6A 3DHKH 1O32A 2G8TA 1RTKA 1QA0A 2VVUA 1RTFB 1TX6A 1D3DB 3A89A 4X8VH 2ZQ1A 3SN8A 1NU9A 1HAHH 3SORA 2WUCA 1TMBH 2IOTA 2PUXB 1C5NH 4TWWA 4YM9A 5C1XA 1WSSH 2FTLE 3IITA 5DP5A 3P95A 1TQ0B 4MDSA 2BLVA 3RXOA 1QB9A 1MU6B 3BSQA 1Z8GA 3MWIU 3CS0A 3ZYEA 1P9SA 3BG4B 1Z6EA 2SGPE 2SGDE 2JKHA 3MI4A 1SSXA 4XBCA 2XC5A 4Q80A 1ZMNA 1P2MA 2XWAA 3AW1A 4CR9A 1DWBH 1C5TA 1PJPA 3PMJA 4NIVA 3O8BA 4O3TA 3Q3KA 1K21H 1KXFA 3MU8A 4WMFA 3ZZDA 1C5OH 2GT7A 1FUJA 2WPHS 4Y7BA 2LNCA 1W0YH 2PLXA 4I8HA 3RLYH 1AIXH 2WUBA 3SV2H 1MKXH 1MTNC 1OP0A 3L33A 2FESH 2ZC9H 1D3TB 1IQEA 2WYJA 3I29A 5FPYA 3TJOA 3TJUA 2STBE 3M5OA 1ELFA 1DSUA 1V2MT 4FUCA 4A1VA 3PMAB 3SJOA 3TK5A 3L3TA 3GY7A 2A4RA 3VEQB 1TNHA 1SGFG 1K1NA 1E36B 1EX3A 5JBTA 2ODPA 2J95A 4XE4A 4ABFA 2ZDMA 2EI8A 3K2UA 2F9PA 1XUFA 3KF2A 4F4OC 1DWEH 2DE8A 2XC0A 2OP9A 2G81E 4OS1A 2VIDA 2FTMA 2RA3A 4YLQH 2C3SA 2A7CA 1YC0A 3I78A 2ZPSA 3JZ1B 4MVNA 2QY0B 3A80A 1GI8B 3ITIA 1P2JA 1SHHB 1BMMH 1AZZA 2CHAC 1P02A 5DP8A 1FV9A 4MQAA 3UQOA 3EA7A 5EU8A 4WJG2 1AO5A 3MHWU 4GVUA 1P01A 5FPTA 1GL0E 2FM2A 4DCDA 2ZP0H 2QF0A 6CHAB 2BVSH 2P3TB 3S9BA 1ESAA 2ZCKP 2Y81A 3RXQA 4K1TA 1O2PA 1O2XA 3RXAA 3TITA 1TPAE 1BITA 1P2OA 1CBWB 5E0JA 1EPTA 1ANDA 1PPEE 1GI4A 4BAQB 2ZF0H 1BDAA 1AKSB 1EZQA 1VGCC 5LPEA 2PFEA 1OS8A 1N6XA 3NXPA 4UFEH 1CSOE 4NFFA 3PMHB 1NRQH 1PPFE 3SUFA 1NFXA 2BZ6H 4R0IA 3S7KB 2UUFB 3BN9A 4I31A 3HKJB 2GTBA 4NFEA 4E06H 1GJDB 1P9UA 4AFUA 4KKDA 3UIRA 2SNVA 1QRXA 3P8FA 2EI6A 3T29A 7ESTE 2M5TA 1O2YA 2WPIS 1UK2A 3HATH 3VFEA 1FLEE 2R9PA 5A0CA 1QBNA 4CRAA 3E6PH 1DXPA 1GBTA 2STAE 3T26A 7GCHF 3GISB 1B7XB 4O03A 2FOAA 5TJXA 1AI8H 3TU7H 2O8LA 2A2XH 5TCAA 4D9RA 1O3GA 4JCNA 3LJJA 1IQNA 2ZPRA 4ESTE 2KAIB 1P10A 1G30B 3EYDA 3SGAE 3FAOA 3RXDA 1HAVA 3C1KA 3GCOA 5C1UA 2J9NA 5C2ZA 1SLWB 1GJCB 2VJ1A 4D7GA 1PYTC 5JYIA 3MO3A 4DG4A 1LKBA 1C2HA 1TGSZ 4XSKU 1N1LA 2RG3A 2BQ7B 2FPZA 2XRCA 1EB2A 2R0LA 5E0HA 5FXLA 1YPHE 1L0ZA 2VVCA 1NROH 1T32A 3UNQA 1EZSC 4VGCB 1KXAA 3GCHB 1BJVA 1YPJH 5CE1A 1UHBA 2VIVA 1IQGA 1SL3A 1O39A 4MPXA 1OWJA 4JK6A 2FX4A 4KP0A 2GMTC 1GBDA 1O33A 2DUCA 4D9QA 1AVGH 1Y59T 3RXMA 1SGNE 1OWEA 5JB8S 1TPOA 1A5GH 4IW4E 3STJA 1AN1E 2P94A 1WV7H 1V2LT 4DJZB 1HJAB 1RXPA 4AYYB 1SFQB 3T25A 1C2DA 1O2ZA 1QJ7B 3D65E 3BG4C 2Z9LA 2ZZUH 3LT3A 2FWWA 3SU6A 3BTQE 2RCEA 1DSTA 3A7WA 3ATMA 9ESTA 5L2YH 1HXFH 5LPRA 2UUKB 1C4U2 4XBBA 4Y8YA 2Z3CA 2BXUH 5EW2H 4IN2A 4A1TA 1NRRH 2BY9X 3P6ZB 2FEQH 1HIAA 3A7VA 4X2XA 3A8CA 1O2OA 1EOLA 1C2GA 2QXJA 1ZRBA 1FY1A 4B73A 5JBBS 1VZQH 1LVOA 1ABIH 2ZDLA 3URCA 2FMJA 1DS2E 4MPUA 1CT4E 1FN6A 4TY7A 2XC4A 3GY2A 1V2JT 1DUEA 3SQEE 1F5RA 3RDZA 2BTCE 4B2AA 2R3YA 1TIOA 2ZU1A 4FUGA 4NA7A 4ZKSU 2J4IA 3SU0A 5C67A 1IQJA 4O3UA 3VB5A 5ETXA 1NY22 2ZO3H 3M3VA 1V3XA 1QJ6B 1H9LB 1GBLA 4YTAA 1UCYH 3RXJA 2WYGA 1C5MD 3GYMA 3SHCH 2OD3B 2BX4A 3LC3A 3LGTA 1O2SA 1UO6A 2ZGXH 1GDUA 3FZDA 3PWCA 2A2QH 2BX3A 4AORA 1S0QA 2HWLB 3M61U 5ESTE 1GMCG 1O3DA 2GV7A 3PO1B 3RXBA 1ZHPA 2V3HH 1VITH 3LH3A 3MH4A 1GJ6A 3RXGA 6CHAC 4Q7ZA 1S5SA 1S84A 1O3NA 5SGAE 1FNIA 2VB0A 4Y6DA 5DK1A 1C5QA 1GMHG 1Q2WA 4I33A 3W94A 4X1RU 4ZKRU 2BD2A 1TNKA 5EXNA 1DICA 1CBWC 3K6YA 2QIQA 3MFJA 1O2UA 3VXEH 2BHGA 1BA8B 2HPPH 1B0EA 1K28D 1S81A 2J2UA 3BEFB 5T6FA 3UOUA 2QA9E 4WXIA 3TNSA 3CENA 2CMYA 4GAWA 1AWHB 1SGRE 2J94A 4MPWA 4NZQA 4H42U 1QTFA 3PTBA 2ANMH 4GHQA 4ISHH 1ETSH 1P04A 1QCPA 1ELDE 2GGVB 3SU5A 4AYVB 1AUTC 4A1XA 2GCHG 2BQ6B 1GHWH 1EPTC 4HGCA 1ELVA 3RXEA 3B8JA 5BPEA 5A8YA 4H6SB 1LVBA 3LOXA 3EAJA 5DKMA 1DX5M 1YLDA 2CF9H 1KIGH 4K8YA 2OUAA 2GCTC 1SGQE 1F0SA 3RXHA 5EPNA 1QL7A 3A8DA 1JRTA 4Z0KA 1FY8E 5EW1H 2G5NA 4AB8A 1D9IA 1E35B 1LHCH 2Z6BD 2WPMS 2G5VA 1GJ8B 4Y8XA 3RXCA 1G3BA 2ZG0H 1O3FA 2ZGCA 3LGWA 3M5MA 5C5OA 3HK3B 1UJ1A 1GHVH 1TNJA 2ODYB 4O97A 2H1UA 2Y82A 5GJ4B 3ZV9A 3Q00A 4VGCC 4KTUA 3A84A 3GCHC 3OYPA 4OS2A 1CT0E 1W11U 1YF4A 1O36A 1DANH 2GZ9A 3O8RA 4MNWA 1LPGB 2C8ZB 5E8EH 1QA7A 3F9HA 4RKJB 1DLKB 3GY5A 1YPLH 1ZPCA 2YNAA 4Y8ZA 4TYDA 1SGTA 2G00A 1O3CA 4KGAA 3UOPA 1PPHE 1SBWA 1PQAA 1K1MA 3T28A 2FYQA 1RRKA 5L6NH 1SVPA 1WAYB 3DFLA 3LIWA 1GMHF 3RP2A 1TFXA 1P2QA 1QQ4A 3SW2B 1QGFA 1HAIH 4BXWA 1HJAC 2JH0D 4ASHA 3RXFA 2HVXA 1SR5C 1J8AA 2LPRA 1BZXE 2ZI2H 3GCTF 1SB1H 5EXMA 1NRPH 1YPGH 2R0KA 3RMNH 1VJ9U 1O3PB 4FVBA 1GBJA 1TOCB