3S9AA

Russell's viper venom serine proteinase, rvv-v (closed-form)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
234
structure length
234
Chain Sequence
VVGGDECNINEHPFLVALYTSASSTIHCAGALINREWVLTAAHCDRRNIRIKLGMHSKNIRNEDEQIRVPRGKYFCLNTKFPNGLDKDIMLIRLRRPVTYSTHIAPVSLPSRSRGVGSRCRIMGWGKISTTTYPDVPHCTNIFIVKHKWCEPLYPWVPADSRTLCAGILKGGRDTCHGDSGGPLICNGEMHGIVAGGSEPCGQHLKPAVYTKVFDYNNWIQSIIAGNRTVTCPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Vipera russelli proteinase RVV-V gamma
publication title Structural basis of coagulation factor V recognition for cleavage by RVV-V
pubmed doi rcsb
total genus 56
structure length 234
sequence length 234
ec nomenclature ec 3.4.21.95: Snake venom factor V activator.
pdb deposition date 2011-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3s9aA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3s9aA02
3A7YA 1XXFA 1ZGVA 4K3JA 1YPEH 2GKVE 3E91A 5GPIB 2ZFFH 3ESTA 1FNIA 1T8OA 1D3PB 4GAWA 1XKBC 2OC8A 4UDWH 1HAZB 2EI6A 2ZHEH 3SU6A 1P04A 2R2MB 1IQJA 4ZUHA 2FODA 1KDQB 1CHOG 3RXRA 1LPGB 4JCNA 3GY5A 4Q7XA 2FOAA 3F9GA 4BTIB 1C1OA 2EI7A 1ABIH 1M9UA 4ZXYH 2JH6D 1ZTJA 3UNRA 2FX4A 2ZECA 1P2IA 3ZVBA 2Z9LA 1EPTA 4K1EA 1OWKA 1NRSH 2LNCA 1O3IA 2BD2A 1QQ4A 1DPOA 1C4U2 1P2OA 4FUBA 1MBQA 2G8TA 2PTNA 1A61H 3ZVEA 2BQ6B 2RA0A 1TBZH 1HXFH 1Y8TA 1SBWA 4WMEA 1FMGA 4ZHMU 1W11U 4IC6A 2GD4B 4X1NU 3QLPH 3MU8A 1TMUH 4CRAA 4CBOA 3PMAB 1O3CA 1C2IA 1VCWA 2SGQE 2ODYB 1ZMNA 4O97A 3NXPA 2GZ8A 2GZ7A 1KIGH 2BDHA 2FDAA 2BZ6H 1PQAA 2CHAB 1QA0A 1DE7H 1TPPA 1UHBB 2GCHF 3LH3A 5HXFA 3SV9A 4B75A 2JH5D 4U01A 1VR1H 1O5BB 2GX4A 4NIVA 4A6LA 2ASUB 4NA9H 1GG6C 4XBDA 1LDTT 1SGNE 1GWAA 1C2HA 5EOKA 3OX7U 1FXYA 2VH6A 2VB0A 2FWWA 1NRRH 1MKXK 4YLUA 1L0ZA 1PPZA 3SUGA 4ABFA 3T2NA 3RC5A 3AVZA 3GCHC 2BXTH 2BOHB 1GMCG 3ATMA 3OY6U 4FU9A 2BY9X 4K2YA 2DE9A 2QV1A 3QTOH 3S0NA 1HAIH 1AFQC 1LKBA 3OTJE 1MU8B 1TGSZ 3T5FH 2QF0A 1AMHA 3EE0B 1NRPH 1H8IH 3TH3H 2FOCA 2PTCE 5GJ4B 4TWYA 5TJXA 4Y11E 2XCNA 3FP8E 3BEUA 1GHWH 1UTPA 3TITA 5ESTE 5FPYA 4H42U 1QL9A 3HATH 1SGEE 3PTBA 1EX3A 4I8KA 4AFZA 2H9HA 3MNXA 1SC8U 1UJ1A 4JYTA 3UWIA 1ZTKA 1AZZA 2BVSH 1HAHH 1CE5A 1T4UH 2RA3A 3ZZDA 1BIOA 2Q6DA 1GJ9B 4Q80A 1GJDB 2A7CA 2W26A 3KQEA 4WH8A 2QY0B 1FUJA 3UOUA 2VH0A 2BDBA 2ZNKH 1HB0B 1AIXH 3A7WA 3T62A 3SU1A 2BMGB 2PKAA 1Y3XA 1ELAA 2XCFA 4I7YH 1F0SA 1O32A 3A8DA 3GICB 1O37A 4X1RU 3P17H 2XXLA 1Y5UT 2ESTE 4Q7YA 4GUXA 3SUDA 1D3DB 3L33A 5E0GA 3ZVFA 1RS0A 3SGQE 4YOJA 3SORA 1C1WH 1HAYB 1LHDH 1N8OC 2WPHS 4BNRA 2OC1A 3H5CB 1XM1A 1F7ZA 1C5PA 1OKXA 4AX9H 3GY3A 1GBTA 2Z9JA 3AASA 2Q1JA 2GCTB 4ISHH 3VXFH 3S9BA 1GVZA 1CGIE 1YC0A 1FV9A 1YYY1 4E7NA 7LPRA 1AB9B 3UPEA 1VZQH 4UFDH 1IQMA 1Z8RA 1O31A 2A4RA 2B9LA 1TX7A 3P8GA 4RN6A 5DK1A 1D6RA 1K1PA 1PQ8A 4WXVA 3UOPA 1KLJH 2UWLA 3O8BA 5EPNA 2ZU1A 3ATKA 1ELBA 1OOKB 2F9NA 3A82A 3C1KA 4YT6H 1GJ4H 4X6MA 1KYNA 2J2UA 1K21H 2H9EH 5K0HA 1DSUA 1MKXH 2VIVA 4K60A 2STAE 1FLEE 1K1IA 1PFXC 1CT4E 1T4VH 1GBFA 1DXPA 1MCTA 2ZU4A 1P12E 2H2ZA 4OS2A 3BG4C 1YM0A 1O3HA 5AFYH 3CS0A 2WINI 3FAOA 3SNAA 2GT7A 2W7UA 3HGPA 1UTKA 2V3OH 4FVBA 4TYDA 1GHXH 4I31A 3H7OA 2QXGA 1C5RA 2Z94A 1GI4A 1OWEA 2PKAB 1P2QA 2NU2E 1CA0C 1WTHD 1XX9A 3RLWH 4FUCA 2WYGA 5J4QA 3NWUA 1OP2A 4H4FA 4TPYA 1CU1A 3GY2A 4ZKOU 1LQDB 1MH0A 4INKA 4DOQA 3DUXH 1ZRBA 1T31A 3EA7A 4KTCA 3SZNA 1YCPM 1BZXE 1PPBH 3VFEA 2WUCA 4X8VH 1S81A 2D2DA 3FFGA 1BHXB 1PPHE 2EEKA 1O3MA 1SGIB 1WAYB 3BTWE 4X2WA 4RKJB 1EUFA 1GBMA 5HYOA 1KSNA 5E8EH 2WUBA 3A7ZA 1BTYA 1C2GA 3ZZ8A 3SI4H 3HK3B 3E1XB 3M35A 2O8WA 1FQ3A 1LQEA 1V2LT 1Y5BT 1O3EA 1TRNA 1JWTA 1GVLA 4HGCA 3GDSA 3P95A 3P8FA 1J14A 2O8TA 1GHVH 2A2XH 3MYWA 7GCHG 3RXLA 4CHAB 2ZCHP 1UVPA 1FJSA 3R0FA 1MD8A 1THRH 4CREA 5EG4A 1ZHPA 5FCKA 3K6YA 3GCOA 4I33A 1GMCF 1TX8A 1TLDA 2GTBA 3TH2H 4IN2A 1KLTA 2BD7A 2UWPA 5B6OA 1RFNA 2UUKB 2P3UB 6GCHG 2ZU2A 1SQTA 3MO9A 2ZGBH 3QN7A 1P2NA 3PWBA 5F8TA 4YESB 1UO6A 1DWDH 2VVCA 1HAPH 2FP7B 4OGXA 2VWOA 4FXGH 5F8ZA 3TIUA 1SGFG 3RDZA 5JBAS 4NSYA 1PQ7A 1F5LA 3QUMP 3RXJA 3EYDA 5F6MA 4O9VA 4DVAU 4AGJA 2BLQA 4LXBH 2C8YB 1C2LA 5EW2H 2O8UA 2D8WA 1BTWA 5ABWA 1HIAB 3BTHE 1VJ9U 1V3XA 1J16A 1TBRH 1A3BH 5EQSA 1ZZZA 2B0FA 4MG3A 4YTAA 5J4SA 3E6PH 1DVAH 1QRXA 2UUFB 2H5CA 1ANEA 5FBEA 1XUKA 1O2LA 4GSOA 4ISNA 3SN8A 4NWLA 3DD2H 1ZRKA 3RXSA 1OX1A 1BDAA 3ENSB 1MZAA 1SGYE 1VGCB 8GCHF 2B7DH 3P8OA 2A5AA 3A8AA 1ZPCA 4K8BA 2BDIA 1V6DA 2ANMH 5JBBS 1TONA 1AUJA 2P8OC 8KME2 1O2WA 1K1MA 1QR3E 1YF4A 1CHGA 2Z9KA 4JZDH 2BLOA 3BG8A 2QIQA 4HTCH 3GY4A 2AYWA 1BBRE 3A81A 5JYIA 4QT8C 1BRCE 2WPMS 1RTLA 3QGJA 1ZMLA 3SNCA 1K22H 4ABEA 1ELCA 2TBSA 4GCHG 1KXCA 1GJ6A 5DPAA 5AF9H 1SQOA 5JBCS 4X0WU 5GXPA 3VB4A 3T25A 4OS4A 1XVMA 1RD3B 2VVVA 3PWCA 3SJ9A 1P3CA 2Y5FA 2YOLA 1NN6A 3FANA 1ARCA 1EOLA 2GV7A 1GI8B 4AFUA 2K1QA 1FIWA 5F8XA 1SLVB 4WVPE 1RIWC 2BY8X 1C2JA 3O8CA 1O3JA 1W10U 1SPJA 2ZHWH 2OD3B 3QTVH 1O2MA 3K9XB 2GCHG 3AW1A 5L2YH 4BAOB 3RXTA 1HV7A 1XUJA 3SV8A 4XSKU 1D9IA 1TPSA 4AB8A 4ABDA 4IS5A 5K7RA 1EP6A 2D26C 5PTPA 2A32A 4YT7H 1DLEA 1Q31A 4AYYB 2CJIA 5AFZH 4K5ZA 2BYAX 4DIHH 2FLBH 1GGDC 3M5MA 1DXWA 5BPEA 2J34A 1KXBA 2PWXA 1TPOA 2G81E 1TNKA 4U30A 2I6QA 3GY6A 3RU4E 3ATLA 5T6GA 3U8OH 4MPWA 6LPRA 3I77A 2HWLB 4AB9A 1DSTA 1LHFH 1Q3XA 2FOFA 3UY9A 3MNSA 3ZYDA 4D7FA 3MU4A 1C2EA 1AE5A 4Y10E 4KGAA 1QNJA 1ZYOA 2ZDVH 1GI1A 1V2ST 3PROA 1CO7E 1GI5A 2JETB 1ETTH 1UVSH 2UUJB 1SGCA 7GCHF 2Z3CA 1IQLA 1JOUB 3TH4H 1K28D 1QGFA 3SHCH 3MI4A 3OY5U 5TCCA 2P3FH 4BAHB 1CT0E 1DOJA 5C67A 9LPRA 1S82A 2R3UA 4INHA 3BF6H 2Z6BD 2XC0A 1A5IA 1C5OH 1B0FA 2GDEH 1SGFA 2RDLA 2FTLE 6GCHF 3E8LA 4MNXA 2J4IA 4CR5A 2WPKS 4HZHA 1AO5A 3U9AH 2FOHA 3ZV9A 2ZDAH 4NGAH 1O2PA 1X7AC 3B9FH 2VIWA 3M7QA 4B73A 1RJXB 2QYIA 4OS6A 4Y7AA 1G3BA 2Y5GA 1HRTH 1ELFA 1Z6JH 3SV7A 3PTNA 1ZPZA 4FU7A 2ZHQH 1MBMA 1AVGH 3A89A 1C1PA 5A8YA 2OC7A 3IITA 1TQ0B 1GBKA 1ZSKA 3UWJH 5EXLA 5JB9S 2QXIA 3KQDA 1K1OA 1EZSC 1O5AB 1RRKA 3M37A 1GHAF 1QFKH 2F91A 3LC3A 4WF8A 1GI2A 2CF8H 1O3FA 6CHAB 3MH5A 2A4GA 1EASA 1TYNA 2PGBB 5LPRA 2Z7FE 3GISB 3LU9B 3VPKA 4LZ1H 1EXFA 2C8XB 1S85A 2ZFTA 2GV6A 4Y8YA 1FY1A 1TAWA 1C5UA 1FN6A 1FDPA 5EPYA 1INCA 2GDDA 3NUMA 3OU0A 1E36B 1O2JA 5C1UA 2V35A 1HAVA 4JK5A 3ZVGA 4DG4A 1TGBA 3SGAE 3BEFB 1HJAB 5AHGH 1MTNB 1NC6A 3ODFA 1ELVA 2F9UA 4NFEA 1N1LA 2OTVA 1ESAA 1BTPA 1GMDF 3SU4A 1CT2E 1P02A 1WUNH 4DY7B 2H5DA 4MDSA 1NTPA 1C2MA 1FPCH 1TIOA 3ZZ9A 3SJ8A 4WJG2 3VGCB 3C27B 4Z0KA 1J8AA 4GCHF 2P59A 9ESTA 1GI6A 1GCTC 1V2QT 3IG6B 1GVKB 4AN7A 3PMHB 1DY9A 1H9IE 1WQSA 1QB6A 4D7GA 4XOJA 5HMAA 2OBQA 4K1TA 5G4BA 4ABBA 2AH4X 1QA7A 2XBVA 2VNTA 1F5KU 2QN5T 2VU8E 2C90B 2BVXH 3ZZBA 1D3QB 1ZJDA 3SJIA 1IAUA 4AG2A 2C8ZB 4BXSA 2F9PA 1UCYK 2QCYA 3RMMH 1C2KA 2A7JA 2NU1E 2PKSB 2ZFSA 1O2NA 2FOEA 1IHSH 3Q76A 2BDCA 3UNSA 3SOSA 3U69H 1W0ZU 2ZFQH 1Z8JB 1C5TA 1Z1IA 2AGEX 2W3KA 1WSSH 1L1JA 2R9PA 1WCZA 1GL0E 2GMTB 3A7VA 2FEQH 1W12U 2FI3E 4VGCB 3HKIB 4CRGA 3MO6A 1YCPK 4B2AA 1DY8A 2W5EA 3RUOA 1GHZA 1UVUH 3UTUH 2VVUA 2VWLA 1SVPA 1UVOA 3WY8A 1O2QA 1T32A 4D9QA 1PPEE 1IQIA 4PROA 1TGTA 3SU0A 1YKTA 1BMMH 1HAVB 2FOBA 2RCEA 3HKJB 1QB9A 1HPGA 3V13A 1V2RT 4B1TA 1SGPE 1OWDA 1XKAC 1FAXA 1EAUA 1T8MA 5EXMA 2BQ7B 1Z8GA 3U8RH 1ZMJA 1O2SA 3EDXB 3M5LA 3T27A 1YPKH 4ZKSU 3UFAA 3V7TA 1VJAU 1O2RA 3LOXA 1ZJKA 3SJOA 1DT2A 1EJMA 1BA8B 1O2KA 1O2YA 1AD8H 1E35B 1MTSA 3QGNB 1SB1H 1UCYE 1EPTB 3TJOA 5ETXA 4ABIA 5CMXH 1ANBA 1TMBH 3D23A 3BV9B 2ILNA 4UONA 3NCLA 1PYTC 2TGDA 3RXEA 3PV4A 1TNJA 1SG8B 1OWIA 3RXDA 2O8LA 1YPMH 1UK3A 3A8BA 1DICA 3RXUA 1BCUH 5C1XA 3P70B 4TPIZ 1ELTA 1P06A 1NFUA 2BX4A 2ZI2H 2SFAA 1NT1A 2AGIX 3K65B 2TRMA 3V0XA 1P03A 3F68H 4E7RG 1GBHA 1FY3A 1CBWC 2KAIA 1QIXB 1B5GH 2VIDA 4ISLA 2GP9B 1P3EA 8GCHG 2H9TH 1GBAA 1XUFA 1TABE 1G3CA 2O8MA 4JZEH 2BD5A 3VB6A 2ANWA 3D65E 2XYAA 1BB0B 3GDVA 4AG1A 4M7GA 1C5MD 1LVBA 2AERH 1QJ6B 3DA9B 2GGVB 1UCYH 1H8DH 1TOCB 5HGGA 4GVUA 5C3NA 1T8LA 2WYJA 2XBXA 4FUJA 4IMQA 1O3GA 3BIVH 1PJPA 2QXJA 1GI7B 1TNLA 1P9UA 4YZUA 4AORA 1HGTH 3S9AA 3U1IB 1O3KA 1E34B 2ZZUH 3SW2B 5JDUB 4CRFA 3SV2H 1AVWA 1YCPH 2ZP0H 1AUTC 2R0LA 3RMOH 3MTYA 1UK2A 2ZTYA 1KY9A 2WPIS 1K9OE 3QZQA 1BJVA 1O30A 5EQQA 4R0IA 3MH4A 4WMFA 1QTFA 1WTGH 2BY7X 3PYHA 2FXRA 4GLYA 1BTUA 1KXAA 2AFQB 2OC0A 2ZDKA 4DURA 1O2HA 5LPEA 3M3SA 1PQ5A 5CHAC 1CVWH 1MZDA 3E16B 5T6FA 4RKOB 1J17T 4WY3A 1QBVH 4B76A 3TK6A 2FYQA 1GBCA 1FZZA 2WV4A 4JK6A 2BQWB 2OXSA 3A85A 2ZCKP 2BD4A 3P8NA 3V12A 1JRSA 2F83A 2BOKA 2KAIB 1GG6B 1AWHB 3GOVB 2FOMB 2ZG0H 2YNBA 1SLXB 5EQRA 5E0HA 4B71A 2ZGCA 3ZZ3A 2JKHA 1H4WA 3L6PA 1GHBG 3GYMA 2ZA5A 2ZHFH 1QB1A 3GCHB 7ESTE 1BMAA 3RXGA 1O3DA 1ZHRA 3SU5A 2OBOA 3SNBA 2A1DB 1GBLA 1N6XA 2G5VA 3UQVA 3ZZ6A 1F0UA 1FI8A 2GZ9A 3E3TA 1AFQB 4FUIA 2ZF0H 3RP2A 1F2SE 1ZLRA 1D3TB 1PPCE 2OQUA 2Q6FA 1OSSA 4AZ2B 1DANH 3S9CA 4Y7BA 4HFPB 3T29A 3RC4A 4ABHA 2QGRA 4FUGA 3FZDA 4MNYA 1ACBE 1FY8E 1GHYH 1W7XH 4AGKA 1GCDA 5AVDA 1LPKB 1GI0A 1GJAB 5FX5A 4FUEA 2V0BA 3RXHA 2J92A 1YP9A 1P01A 3ITIA 4FU8A 3T26A 4O3TA 4IW4E 2WPJS 2XBYA 3EA9A 1EAIA 3S7KB 1UTNA 1HAGE 1V2VT 1Z6EA 2PFEA 2AIQA 2D1JA 1BRUP 1DUAA 3K6ZA 4TY7A 1KTTB 1ARBA 1O3LA 2IPHA 1C2DA 1LMWB 2VGCC 4E05H 1O3AA 4CR9A 2BDGA 4X6OA 1MAXA 1NESE 1HFDA 3KHVA 4I8GA 2QXHA 5A2MH 4IMZA 1BBRK 1IHTH 3LGTA 4AYVB 1EZXC 3I78A 1N8OB 3GY8A 1L1GA 3MH7A 4MPXA 3RXKA 1LVMA 1O38A 4Y6DA 2AS9A 2BTCE 2FESH 1BMLA 1GHAG 2FOGA 4ZHAA 1TPAE 4NIXA 4AFQA 2Y82A 2WPLS 1MKWK 4WMDA 1O34A 1C5LH 1HLTH 2TGAA 2FZZA 2CXVA 3ZZ7A 3A7TA 2XNIA 2XC5A 3G01A 3ZZ4A 2Y80A 1AN1E 1SL3A 1MMJN 2Z9IA 1OP8A 1BT7A 3ZVAA 5C20A 1IQGA 1O35A 1WV7H 2ZU5A 2R2WU 1G2MA 4X1PU 1H1BA 4WH6A 2J38A 1DWBH 3RM0H 3TJNA 4MQAA 2LPRA 4Y79A 1ELEE 1F0RA 2G51A 4BTTB 4D9RA 2ZDMA 1W2KH 2OLGA 3AW0A 2SGEE 1KXFA 4ZAEA 3BG4B 1FPHH 2G4UA 5GDSH 2ZPSA 5EODA 1GMDG 1UK4A 2AEIH 1C1TA 1YPGH 1V2NT 2FYRA 3P92A 1MQ5A 4YOGA 2FM2A 3ZYEA 4X8UH 2W7SA 1P10A 3STIA 1CA0B 2WV5A 4X2XA 2ZWLH 4CH2B 3KQCA 1J9CH 1BTZA 2BD8A 1O5EH 3MHWU 3TJUA 2STBE 4NSVA 2XRCA 3W95A 2ZTZA 4U2WA 1GDUA 3ATWA 4THNH 1C2FA 3ZVCA 2XW9A 2NU0E 3PO1B 1JXPA 1LPZB 4ABGA 3LT3A 3VB3A 3PLKA 4ZKNU 5DJ7A 1RTFB 1MTVA 3SQEE 1LCYA 1QRZA 3N7OA 1HAOH 1EQ9A 2TGTA 3O8DA 3SHAH 4X1SU 1O0DH 1SQAA 5IDKA 3TLOA 3KGPA 1NY22 2A4QA 4TY6A 2ZDLA 1AI8H 5E2OA 1QJ7B 1YBWA 5HM2A 1KLIH 3MWIU 2FLRH 1E0FD 1SGRE 3RU4D 1Z1JA 4F4OC 2HLCA 1BBRH 1GHBF 5C2ZA 3BTME 1TNHA 1CA8B 2BVRH 2FPZA 1PPGE 5LPFA 3MU1A 4Y76A 3KIDU 4NG9H 4OS1A 3UQOA 4GHQA 1TX6A 1JMOH 2G52A 1SOZA 3RXMA 1HJ8A 2BY6X 2G5NA 2OINA 3F9FA 1A7SA 2BD3A 1G3EA 3RC6A 1GL1A 4BAKB 1MKWH 3CS7A 2P93A 1SGTA 2UUYA 1OYTH 3SJKA 2A7HA 2O9QA 1PPFE 3U98H 1MTWA 2FI4E 3SO3A 4BTUB 5A0AE 3SU3A 1UTLM 2FS9A 3PM3A 1ETSH 1GMHG 1ZR0A 5FBIA 1W8BH 1P8VC 1LHGH 5F03A 1NFYA 2BD9A 3DFJA 5DKMA 1A2CH 1IQKA 2CHAC 4JZ1A 1EKBB 4O03A 2NU4E 1EATA 1J15A 1LHEH 1L4DA 4DT7B 1UMAH 1SLUB 3QDZB 4ABJA 3TGJE 3ELAH 4K69A 1C5SA 2BHGA 3EGKH 1D4PB 1LVYA 3KEEA 4FUFA 1TNGA 1C1QA 1MAYA 2THFB 1B7XB 3LGWA 1BUIA 1OWHA 1F0TA 1O39A 1XVOA 1TRMA 1P2MA 1C9PA 3JZ1B 3E0NB 1JIRA 2PUQH 4BAQB 2ZGJA 3SV6A 1O2UA 2OP9A 2ZU3A 1W14U 2G55A 1AKSA 3EQ0H 3KCGH 2P8OB 2W3IA 1ESTA 1Y3UA 1YPJH 2ZO3H 2HNTE 1Y5AT 1ETRH 2Z3EA 1MTUA 5FPSA 1EPTC 1C5NH 1TB6H 1JIMA 1QL8A 3PMJA 1CGHA 1G9IE 1WQVH 4F49A 1Y3WA 1UTQA 1QURH 1AVXA 1O3NA 1W13U 3GCTF 6ESTA 2IOTA 1VCPA 2XWBI 2ZCLP 3TPIZ 1ANCA 1Y3VA 3LPRA 1LO6A 3UNQA 1GBBA 1H9LB 4BAMB 1G30B 1EB1H 1HJ9A 1N6YA 2P16A 2XBWA 4NWKA 4NZLA 1C5YB 1A0JA 1A0LA 3PLBA 3BTDE 2TIOA 2ZQ2A 1DS2E 1LVOA 1NPMA 2QC2A 1L2EA 3ZZCA 2IJOB 1FY5A 2PV9B 1C5WB 1MD7A 2CGAA 4MPUA 1IQEA 1YLDA 1L4ZA 1YLCA 1O5FH 1A1RA 1TQ7B 2SGAA 1RIWB 4DGJA 2ZDNA 3HPTB 4I8HA 1EZQA 1OS8A 1O33A 2FO9A 3L3TA 1EP5A 5FCRA 4B2BA 4JZIA 3VXEH 1NFWA 4B2CA 1O2OA 2ZFPH 1VCQA 1C1VH 1EAWA 4X8SH 4A7IB 1K1NA 3PMBB 4Y0ZE 1TMTH 5FAHA 1C1NA 1C5ZB 3AAVA 3BTTE 5FHTA 4ZXXH 1A0HB 1ZOMA 4LOYH 2ALVA 1THPB 2GCTC 3M5OA 1IQHA 3ZV8A 1D6WA 1GGDB 4AFSA 1YPLH 5A8XA 1AB9C 2VWMA 1AKSB 2ZPQA 4TWWA 1EZUC 2PR3A 3TK5A 1ELDE 1SLWB 1VITF 3FVFB 3DT0H 2Q6GA 1O3PB 1C4Y2 1W3CA 2Z9GA 1T7CA 1IQFA 1P2JA 3BEIB 2FI5E 3FP7E 3RXBA 1V2PT 4B74A 5A0BA 1BMNH 1OP0A 2BZAA 4HI3A 2QAAA 2XTTB 2FMJA 3ATIA 3Q3KA 2EI8A 3H7TA 5C1YA 4BXWA 3LJOA 3F9HA 1GPZA 3BTKE 3KN2A 1C1UH 2NWNA 1Y3YA 3S7HB 1C5VA 2HOBA 4UFGH 4WXIA 1V2JT 2ZQ1A 4FVDA 1YPHE 2J94A 3NZIA 2G00A 1MUEB 1U6QA 2CV3A 1UTMA 1DX5M 2PSYA 2PLXA 1UTJA 2Y6TA 4ISIH 3CP7A 5TCAA 5A09A 4KELA 2DUCA 2P94A 8LPRA 2ZFRH 3SNEA 1P9SA 3GY7A 1C1RA 1QCPA 1QHRB 2I6SA 2Y7ZA 1E38B 4NCYA 2VIOA 4I8JA 1G3DA 2P3TB 3M5NA 1GMHF 1XUIA 3TNSA 1AZ8A 4UFFH 1P09A 5DGJA 3A8CA 3P6ZB 1NM6A 4MLFB 1OXGA 1NRQH 1TA6A 1QL7A 3LGYA 5DG6A 5C5NA 1O36A 3RMNH 4XE4A 1HBTH 1LTOA 1JBUH 4ZROA 2A4OA 4I32A 4KTUA 4E06H 1AY6H 2HRVA 1GBEA 3RMLH 4A1XA 4CHAC 1KTSB 1O2VA 1F5RA 1BJUA 1P2KA 5BRRE 4ESTE 2AMPA 3RLYH 4Y0YE 3MNBA 1SGDE 2H1UA 4ASHA 3T28A 4Q7ZA 2ALPA 4FUHA 3TGKE 5C5OA 2QF3A 3F9EA 4YO9A 1GI9B 5DP8A 2ZC9H 3F1SB 3M3VA 5A8ZA 2SGDE 5A0CA 3Q3XA 3RXVA 2ZKSA 1OYQA 1A5GH 1NFXA 4X6PA 4XFQA 1O2TA 3VB5A 2PGQB 3HK6B 1LKAA 2FS8A 2M5TA 3URDA 2CMYA 3TVJB 2VINA 1AU8A 1W7GH 2PHBA 3CENA 3GCNA 1BRBE 3SUFA 3E90B 2HVXA 1MU6B 1GCTB 3A87A 1E37B 3ZZ5A 2SNWA 3VEQB 1BTHH 1RGQA 1T8NA 1RTKA 5E2PA 1VITH 1XUGA 1C1MA 1BHXF 4NA7A 3MFJA 4IGDA 1ZSJA 3M7TA 1C9TA 3A7XA 4Q2KA 4CBNA 3F6UH 1O5GH 2BM2A 2PW8H 4DW2U 1SR5C 2XWAA 1P05A 3KL6A 5ESBA 1GBIA 1SOTA 1VGCC 2HALA 3M7UA 4J2YB 5DP6A 3RXPA 4UD9H 1TALA 4CRDA 1QJ1B 4K1SA 2P95A 2ZGHA 3LIWA 3B8JA 1HUTH 3EA8A 4SGBE 1YGCH 2VIPA 3BN9A 1TRYA 4X2YA 5HM9A 1CHOF 4A1TA 2HPPH 3ZZAA 3PLPA 1WU1A 3JZ2B 4IN1A 5L30H 1WBGB 4A1VA 3S69A 1ID5H 3QWCH 1H9HE 4FUDA 4R8TB 2Y5HA 5DP4A 1F92A 1SFQB 3LKWA 1JRTA 1THSH 1AFEH 2A5KA 3SU2A 1AWFH 5FPTA 1L1NA 5DP5A 1IQNA 4DJZB 3PB1E 2ZEBA 2ANYA 4NIYA 1DDJA 5JBTA 1NO9H 1XMNB 1C4V2 3LDXH 1SHHB 1HIAA 1PYTD 2F9BH 5FX6A 1EAXA 1O5DH 2GVFA 3UUZA 7KMEH 3AAUA 2G4TA 2XC4A 1FONA 2NU3E 2V3HH 4LZ4B 2TGPZ 2AMQA 3PO1C 5DP7A 5GCHG 3RU4T 4ISOA 1AGJA 1SGQE 1TBQH 4JMYA 5I25A 4DCDA 1HNEE 1Q2WA 4YM9A 1S6FA 3I29A 4OS7A 3SUEA 1Y59T 5T6DA 1QBOA 2F9VA 3M36A 3U8TH 1SFIA 3MNCA 2HGTH 4A92A 1S5SA 2ZIQH 4D8NA 3RM2H 3TK9A 5FXLA 2Y7XA 4MNWA 1S84A 2OCVB 4MVNA 1QY6A 2B5TB 3D62A 2SGPE 1CBWB 4OGYA 4K8YA 2R0KA 3R3GB 4Y8XA 2BLVA 1IOEA 1DLKB 2IN2A 4JYVH 3M61U 3SQHE 4JZFH 4XBBA 1UTOA 4A5TS 1ZTLA 3NK8A 2J95A 3A86A 1NRNH 1K1LA 3LGVA 3HGNA 1GBJA 4BOHA 1TNIA 4IBLH 4UEHH 3DFLA 1V2KT 5DO4H 1NROH 1DFPA 3MMGA 3RXOA 1SSXA 1V2TT 3LGUA 2JETC 1DWCH 3SBKA 1S83A 2OQ5A 1RXPA 3GCTG 5EW1H 3TNTA 4AOQA 5GWZA 1CSOE 3A83A 4X6NA 1K1JA 4H6TA 2QA9E 2C4FH 2C8WB 4Y8ZA 3EAJA 2Y81A 2JH0D 4KP0A 3KNXA 4ZKRU 4GHTA 5DP3A 5GIBA 1TWXB 1NS3A 1S6HA 1DUEA 1WYKA 3ZVDA 4ZMAH 2C93B 2BY5X 1BTXA 3ODDA 2HNTC 1G2LA 3Q00A 1GJBB 2R3YA 1ANDA 2ZHDA 1TOMH 1ZHMA 2ZPRA 1BITA 1AHTH 3TU7H 3OSYA 1KXDA 1OWJA 1XUHA 1V2UT 5CHAB 3URCA 2VWNA 2ODQA 5EGMA 3GYLB 3BTQE 1C5QA 2ZGXH 5LGOA 1FN8A 3SGBE 1AE8H 4GPGA 4KTSA 1CQQA 3BSQA 4Z6AH 1MCVA 3Q3YA 3UREA 3KF2A 4UE7H 3RXQA 1BOQA 1DWEH 3V3MA 1GI3A 1ZPBA 2Z3DA 1S0RA 4NZQA 3BTGE 5H4IB 3OYPA 1O2IA 3LH1A 3TJVA 3RXFA 1P11E 1A5HA 6CHAC 3D49H 2A45B 1EJNA 1GJ5H 4MTBA 1HDTH 2ULLA 1B0EA 2HPQH 4X1QU 1SHYA 2YNAA 3QX5H 1WOFA 1QRWA 2BDAA 1VITG 1MQ6A 3QZRA 1HXEH 1O3BA 2FTMA 3DHKH 3A84A 3W94A 1QQUA 2A2QH 4KKDA 3O8RA 4XBCA 4U32A 4OS5A 3M3TA 1DM4B 3RXIA 3KQBA 1EJAA 4XDEA 4CH8B 1GJ8B 1GJCB 1A46H 1HJAC 2H6MA 4I8LA 1G36A 1MTNC 4CRBA 3MU5A 5JB8S 1TGNA 1AQ7A 4DIIH 3STJA 1C5XB 3RXCA 1O2ZA 1NZQH 3LONA 5SGAE 3NPSA 3LJJA 1V2OT 4WWYA 4CRCA 1GBDA 2J9NA 1GDNA 4J1YA 2GT8A 2BDYA 1FY4A 2A0QB 2HNTF 1ESBA 1NU7B 5T3HA 3VGCC 1G37A 1SMFE 1ORFA 3RXAA 1O5CB 2A31A 4ZH8A 2BLWA 2SNVA 1GJ7B 2BB4A 4ABAA 2AIPA 2RG3A 2VGCB 3NKKA 1FIZA 2VJ1A 3A88A 3TGIE 1O2GH 1TFXA 2F3CE 2PUXB 2ANKH 2OUAA 5E0JA 4YLQH 2EA3A 1DITH 1S0QA 2PKSC 4UFEH 1YPHC 1C1SA 1HCGA 4NIWA 4NFFA 4IC5A 4NA8A 4INLA 5GCHF 1BQYA 3LGIA 2C3SA 1QBNA 2GMTC 4JYUH 1HAXB 1ZSLA 5JPMH 1A4WH 1W0YH 3GDUA 1TGCA 4VGCC 1A3EH 2CF9H 2SGFE 5LH8A 3K2UA 4BANB 2BXUH 2F9OA 4Y71A 2DE8A 1G32B 4MPVA 1Z8IB 3U1JB 3LC5A 2A5IA 3A80A 3E0PB 1KDQA 1O3OA 1V2WT 2CN0H 3B23B 5I46H 1SI5H 4X8TH 3IWMA 8ESTE 1Z7KA 4ZHLU 3SNDA 3BTEE 1EOJA 1UVTH 4D76A 1V2MT 2FIRH 5CE1A 3MOCA 2B8OH 3FZZA 2EC9H 4RSPA 3SI3H 1P0SH 1Z71A 1O2XA 1CGJE 3UR6A 1KXEA 1LHCH 1K2I1 3MH6A 1EB2A 1NU9A 1OPHB 2TPIZ 3MO3A 5IYTA 2ODPA 5L2ZH 2AGGX 2UWOA 1ELGA 4MNVA 1FAKH 3MU0A 4H6SB 5EU8A 3VB7A 4LK4A 1BRAA 1GDQA 3UIRA 1XXDA 5DP9A 3Q77A 2ZTXA 1ABJH 5L6NH 2PSXA 4YOIA 3BTFE 3FP6E 3QO6A 4X2VA 2VIQA 1TA2A 1TE0A 5EXNA 4SGAE 2FX6A 1HYLA 1UHBA 3QK1A 3UR9A 2BX3A 2V6NA 2AMDA 3BIUH 1P57B 4O3UA 1ZGIA
chains in the Genus database with same CATH superfamily
3A7YA 1XXFA 1ZGVA 4K3JA 1YPEH 2GKVE 3E91A 5GPIB 2ZFFH 3ESTA 1FNIA 1T8OA 1D3PB 4GAWA 1XKBC 2OC8A 4UDWH 1HAZB 2EI6A 2ZHEH 3SU6A 1P04A 2R2MB 1IQJA 4ZUHA 2FODA 1KDQB 4F55A 1CHOG 3RXRA 1LPGB 4JCNA 3GY5A 4Q7XA 2FOAA 3F9GA 4BTIB 1C1OA 2EI7A 1ABIH 1M9UA 4ZXYH 2JH6D 3FOAA 1ZTJA 3UNRA 2FX4A 2YMSC 2ZECA 1P2IA 3ZVBA 2KR7A 2Z9LA 1EPTA 4K1EA 1OWKA 1NRSH 2LNCA 1O3IA 2BD2A 1QQ4A 1DPOA 1C4U2 1P2OA 4FUBA 1MBQA 2G8TA 2PTNA 1A61H 3ZVEA 2BQ6B 2RA0A 1TBZH 1HXFH 1Y8TA 1SBWA 4WMEA 1FMGA 1MABB 4ZHMU 1W11U 4IC6A 2GD4B 4X1NU 1K0HA 3QLPH 3MU8A 1TMUH 4CRAA 4CBOA 3PMAB 1O3CA 1C2IA 1VCWA 4FOUC 2SGQE 2ODYB 1ZMNA 4O97A 3NXPA 2GZ8A 2GZ7A 1KIGH 2BDHA 2FDAA 2BZ6H 1PQAA 3N7DA 2CHAB 1QA0A 1DE7H 1TPPA 1UHBB 2GCHF 3LH3A 5HXFA 3SV9A 4B75A 2JH5D 4U01A 1VR1H 1O5BB 2GX4A 4NIVA 4A6LA 2ASUB 4NA9H 1GG6C 4XBDA 1LDTT 1SGNE 1GWAA 1C2HA 5EOKA 3OX7U 1FXYA 2VH6A 2VB0A 2FWWA 1NRRH 1MKXK 4YLUA 1L0ZA 1PPZA 3SUGA 4ABFA 3T2NA 3RC5A 3AVZA 3GCHC 2BXTH 5IK2D 2BOHB 1GMCG 3ATMA 3OY6U 4FU9A 2BY9X 4K2YA 2DE9A 2QV1A 3QTOH 3S0NA 1HAIH 1AFQC 1LKBA 3OTJE 1MU8B 1TGSZ 3T5FH 2QF0A 1AMHA 3EE0B 1NRPH 1H8IH 3TH3H 2FOCA 2PTCE 5GJ4B 4TWYA 3FO8D 5TJXA 4Y11E 2XCNA 3FP8E 3BEUA 1GHWH 1UTPA 3TITA 5ESTE 5FPYA 2K8IA 4H42U 1QL9A 3HATH 1SGEE 3PTBA 1EX3A 4I8KA 4AFZA 2H9HA 3MNXA 1SC8U 1UJ1A 4JYTA 3UWIA 1ZTKA 3EE7A 1AZZA 2BVSH 1HAHH 1CE5A 1T4UH 2RA3A 3ZZDA 1BIOA 3F2FA 2Q6DA 2L6OA 1GJ9B 5EJ1A 4Q80A 1GJDB 2A7CA 2W26A 3KQEA 4WH8A 2QY0B 1FUJA 3UOUA 2VH0A 2BDBA 2ZNKH 1HB0B 1AIXH 3A7WA 3T62A 3SU1A 2BMGB 2PKAA 1Y3XA 1ELAA 2XCFA 4I7YH 1F0SA 1O32A 3A8DA 3GICB 1O37A 4X1RU 3P17H 2XXLA 1Y5UT 2ESTE 4Q7YA 4GUXA 2KM0A 3SUDA 1D3DB 3L33A 5E0GA 3ZVFA 1RS0A 3SGQE 4YOJA 3SORA 1C1WH 1HAYB 1LHDH 1N8OC 2WPHS 4BNRA 2OC1A 3H5CB 1XM1A 1F7ZA 1C5PA 2YMSD 1OKXA 4AX9H 3GY3A 1GBTA 3UAIC 2Z9JA 3AASA 2Q1JA 2GCTB 4ISHH 3VXFH 3S9BA 1GVZA 1CGIE 1YC0A 1FV9A 1YYY1 1E79D 4E7NA 7LPRA 1AB9B 3UPEA 1VZQH 4UFDH 1IQMA 1Z8RA 1O31A 2A4RA 2B9LA 1TX7A 3P8GA 4RN6A 5DK1A 1D6RA 1K1PA 1PQ8A 4WXVA 3UOPA 1KLJH 2UWLA 1E1QD 3O8BA 3OAAD 5EPNA 2ZU1A 3ATKA 1ELBA 1SKYE 1OOKB 2F9NA 2IPQX 3A82A 3C1KA 4YT6H 1GJ4H 4X6MA 1KYNA 2J2UA 1K21H 2H9EH 5K0HA 1DSUA 1MKXH 2VIVA 4K60A 2STAE 4Z1MD 1FLEE 3MQKC 1K1IA 1PFXC 1CT4E 1T4VH 1GBFA 1DXPA 1MCTA 2ZU4A 1P12E 2H2ZA 4OS2A 1S6LA 3BG4C 3KYFA 1YM0A 1O3HA 5AFYH 3CS0A 2WINI 3FAOA 3SNAA 2GT7A 2W7UA 3HGPA 1UTKA 2V3OH 4FVBA 4TYDA 1GHXH 4I31A 3H7OA 2QXGA 1C5RA 2Z94A 1GI4A 1OWEA 2NU2E 1P2QA 2PKAB 1CA0C 1WTHD 1XX9A 3RLWH 4FUCA 2WYGA 5J4QA 3NWUA 1OP2A 4H4FA 4TPYA 1CU1A 3GY2A 4ZKOU 1LQDB 1MH0A 4INKA 4DOQA 3DUXH 1ZRBA 1T31A 3EA7A 4KTCA 3SZNA 1YCPM 1BZXE 1PPBH 3VFEA 2WUCA 4X8VH 1S81A 2D2DA 3FFGA 1BHXB 1PPHE 2EEKA 1O3MA 1SGIB 1WAYB 3BTWE 4X2WA 4RKJB 1EUFA 1GBMA 5HYOA 1KSNA 5E8EH 2WUBA 3A7ZA 1BTYA 1C2GA 3ZZ8A 3SI4H 4FETA 3HK3B 3E1XB 3M35A 2O8WA 1FQ3A 1LQEA 1V2LT 1Y5BT 1O3EA 1TRNA 1JWTA 1GVLA 4HGCA 3GDSA 4Q4LA 3P95A 3P8FA 1J14A 2O8TA 1GHVH 2A2XH 3MYWA 7GCHG 3F0PA 3RXLA 4CHAB 2ZCHP 1UVPA 1FJSA 3R0FA 1MD8A 1THRH 4CREA 5EG4A 1ZHPA 5FCKA 3K6YA 3GCOA 4I33A 2KCYA 1GMCF 1TX8A 1TLDA 2GTBA 2VBCA 3TH2H 4IN2A 1KLTA 2BD7A 2UWPA 5B6OA 1RFNA 2UUKB 2P3UB 6GCHG 2ZU2A 1SQTA 3MO9A 2ZGBH 3QN7A 1P2NA 3PWBA 5F8TA 4YESB 1UO6A 1DWDH 2VVCA 1HAPH 2FP7B 4OGXA 2VWOA 4FXGH 5F8ZA 3TIUA 1SGFG 3RDZA 5JBAS 5C94A 4NSYA 1PQ7A 3PV2A 1F5LA 3QUMP 3RXJA 3EYDA 5F6MA 4O9VA 4DVAU 4AGJA 2BLQA 4LXBH 2C8YB 1C2LA 5EW2H 2O8UA 2D8WA 1BTWA 5ABWA 1HIAB 3BTHE 1VJ9U 1V3XA 1J16A 1TBRH 1A3BH 5EQSA 1ZZZA 2B0FA 4MG3A 5CHBA 4YTAA 5J4SA 3E6PH 5HKKD 1DVAH 1QRXA 2UUFB 2KX4A 2H5CA 1ANEA 2XOKD 5FBEA 1XUKA 1O2LA 4GSOA 4ISNA 3SN8A 4NWLA 3DD2H 1ZRKA 5EJLA 3RXSA 1OX1A 1BDAA 2JJ2D 3ENSB 1MZAA 1SGYE 1VGCB 8GCHF 2B7DH 3P8OA 2A5AA 2XNDD 3A8AA 4XD7D 1ZPCA 4K8BA 2BDIA 4RI0A 1V6DA 2ANMH 5JBBS 1TONA 1AUJA 2P8OC 8KME2 1O2WA 1K1MA 1QR3E 1YF4A 1CHGA 2Z9KA 4JZDH 2BLOA 3BG8A 2QIQA 4HTCH 3GY4A 2AYWA 1BBRE 3A81A 5JYIA 4QT8C 1BRCE 2WPMS 1RTLA 3QGJA 1ZMLA 3SNCA 1K22H 4ABEA 1ELCA 2TBSA 4GCHG 1KXCA 1GJ6A 5DPAA 5AF9H 1SQOA 2OK5A 5JBCS 3CNRA 4X0WU 5GXPA 3VB4A 3T25A 3OEHD 5HIZA 4OS4A 1XVMA 1RD3B 2VVVA 3PWCA 3SJ9A 1P3CA 2Y5FA 2YOLA 1NN6A 3FANA 1ARCA 1EOLA 2GV7A 1GI8B 4AFUA 2K1QA 1FIWA 5F8XA 1SLVB 1YY3A 4WVPE 1RIWC 2BY8X 1C2JA 3O8CA 5EIYA 1O3JA 1W10U 1SPJA 2ZHWH 2OD3B 3QTVH 1O2MA 3K9XB 2GCHG 3AW1A 5L2YH 4BAOB 3RXTA 1HV7A 1XUJA 3SV8A 4XSKU 1D9IA 1TPSA 4AB8A 4ABDA 4IS5A 5K7RA 1EP6A 2D26C 5PTPA 2A32A 4YT7H 1DLEA 1Q31A 4AYYB 2CJIA 5CDFE 5AFZH 1VKYA 4K5ZA 2BYAX 4DIHH 2FLBH 1GGDC 3M5MA 1DXWA 5BPEA 2J34A 1KXBA 2PWXA 1TPOA 2G81E 1TNKA 4U30A 2I6QA 3GY6A 3RU4E 3ATLA 5T6GA 3U8OH 4MPWA 6LPRA 3I77A 2HWLB 4AB9A 1DSTA 3UB0A 1LHFH 1Q3XA 2FOFA 3UY9A 3MNSA 3ZYDA 4D7FA 3MU4A 1C2EA 1AE5A 4Y10E 4KGAA 1QNJA 1ZYOA 2ZDVH 1GI1A 1V2ST 3PROA 1CO7E 1GI5A 2JETB 1ETTH 1UVSH 2UUJB 1SGCA 7GCHF 2Z3CA 1IQLA 1JOUB 3TH4H 1K28D 5KECA 1QGFA 3SHCH 3MI4A 3OY5U 5TCCA 2P3FH 4BAHB 1CT0E 1DOJA 5C67A 9LPRA 1S82A 2R3UA 4INHA 3BF6H 2Z6BD 2XC0A 1A5IA 1C5OH 1B0FA 2GDEH 1SGFA 2RDLA 2FTLE 2IJD1 6GCHF 3E8LA 4MNXA 2J4IA 4CR5A 2WPKS 4HZHA 1AO5A 3U9AH 2FOHA 3ZV9A 2ZDAH 4NGAH 1O2PA 1X7AC 3B9FH 2VIWA 3M7QA 4B73A 1RJXB 2QYIA 4OS6A 4Y7AA 1G3BA 2Y5GA 1HRTH 1ELFA 1Z6JH 3SV7A 3PTNA 1ZPZA 4FU7A 2ZHQH 1MBMA 1AVGH 3A89A 1C1PA 5A8YA 2OC7A 3IITA 1TQ0B 1GBKA 1ZSKA 3UWJH 5EXLA 5JB9S 2QXIA 3KQDA 1K1OA 1EZSC 1O5AB 1RRKA 3M37A 1GHAF 1QFKH 2F91A 3LC3A 4WF8A 1NBMD 2QF4A 1GI2A 2CF8H 1O3FA 6CHAB 3MH5A 2A4GA 1EASA 1TYNA 2PGBB 5LPRA 2Z7FE 3GISB 3LU9B 3VPKA 4LZ1H 1EXFA 2C8XB 1S85A 2ZFTA 2HLDD 2GV6A 4Y8YA 1WDIA 1FY1A 1TAWA 1C5UA 1FN6A 1FDPA 5EPYA 1INCA 2GDDA 3NUMA 3OU0A 1E36B 1O2JA 5C1UA 5C0TA 2V35A 1HAVA 4JK5A 3ZVGA 4DG4A 1TGBA 3SGAE 3BEFB 1HJAB 5AHGH 1MTNB 1NC6A 3ODFA 1ELVA 2F9UA 4NFEA 1N1LA 2OTVA 1ESAA 1BTPA 1GMDF 3SU4A 1CT2E 1P02A 1WUNH 4DY7B 2H5DA 4MDSA 1NTPA 1C2MA 1FPCH 1TIOA 3ZZ9A 3SJ8A 4WJG2 3VGCB 3C27B 4Z0KA 1J8AA 4GCHF 2P59A 9ESTA 1GI6A 1GCTC 1V2QT 3IG6B 1GVKB 4AN7A 3PMHB 1DY9A 1H9IE 1WQSA 1QB6A 2F4LA 4D7GA 4XOJA 5HMAA 2OBQA 4K1TA 5G4BA 4ABBA 2AH4X 1QA7A 2XBVA 2VNTA 1F5KU 2QN5T 2VU8E 2C90B 2BVXH 3F2HA 1D3QB 1ZJDA 3ZZBA 3SJIA 1IAUA 4AG2A 2C8ZB 4BXSA 2F9PA 1UCYK 2QCYA 3RMMH 1C2KA 2A7JA 2NU1E 2PKSB 2ZFSA 1O2NA 2FOEA 1IHSH 3Q76A 2BDCA 3UNSA 3SOSA 3U69H 1W0ZU 2ZFQH 1Z8JB 1C5TA 1Z1IA 2AGEX 2W3KA 1WSSH 1L1JA 2R9PA 1WCZA 1GL0E 2GMTB 3A7VA 2FEQH 1W12U 4ACBA 2FI3E 4VGCB 3HKIB 4CRGA 3MO6A 1YCPK 4B2AA 1DY8A 2W5EA 3RUOA 1GHZA 1UVUH 3UTUH 2VVUA 2VWLA 1SVPA 1UVOA 3WY8A 1T32A 1O2QA 4D9QA 1PPEE 1IQIA 1EFRD 1TGTA 4PROA 3SU0A 1YKTA 1BMMH 1HAVB 2FOBA 2RCEA 3HKJB 1QB9A 1HPGA 3V13A 1V2RT 4B1TA 1SGPE 1OWDA 1XKAC 1FAXA 5FL7D 3U28C 1EAUA 1T8MA 5EXMA 2BQ7B 1Z8GA 3U8RH 1ZMJA 1O2SA 3EDXB 3M5LA 3T27A 1YPKH 4ZKSU 3UFAA 3V7TA 1VJAU 1O2RA 3LOXA 1ZJKA 3SJOA 1DT2A 1EJMA 1W0JD 1BA8B 1O2KA 1O2YA 1AD8H 1E35B 1MTSA 3W1EA 3QGNB 1SB1H 1UCYE 1SQRA 1EPTB 3TJOA 5ETXA 4ABIA 4F48B 5CMXH 2WHXA 1ANBA 1TMBH 3D23A 3BV9B 2ILNA 4UONA 3NCLA 1PYTC 2TGDA 3RXEA 3PV4A 1TNJA 1SG8B 1OWIA 3RXDA 2O8LA 1YPMH 1UK3A 3A8BA 1DICA 3RXUA 1BCUH 5C1XA 3P70B 4TPIZ 1ELTA 1P06A 1NFUA 1YLNA 2BX4A 2ZI2H 2SFAA 1NT1A 3SYJA 2AGIX 3K65B 2TRMA 2WV9A 3V0XA 1P03A 3F68H 4E7RG 1GBHA 1FY3A 1CBWC 2KAIA 1QIXB 1B5GH 2VIDA 4ISLA 2GP9B 1P3EA 8GCHG 2H9TH 1GBAA 1XUFA 1TABE 1G3CA 2O8MA 4JZEH 2BD5A 3VB6A 2ANWA 3D65E 2XYAA 1BB0B 3GDVA 4AG1A 4M7GA 1C5MD 1LVBA 2AERH 1QJ6B 3DA9B 2GGVB 1UCYH 1H8DH 1TOCB 5HGGA 4GVUA 5C3NA 2YMSB 1T8LA 2WYJA 2XBXA 4FUJA 4IMQA 1O3GA 3BIVH 1PJPA 2QXJA 1GI7B 1TNLA 4TT3D 1P9UA 4YZUA 4AORA 1HGTH 3S9AA 3U1IB 1O3KA 1E34B 2ZZUH 3SW2B 5JDUB 4CRFA 3SV2H 1AVWA 1YCPH 2ZP0H 1AUTC 2R0LA 3RMOH 3MTYA 1UK2A 2ZTYA 1KY9A 2WPIS 1K9OE 3QZQA 1BJVA 1O30A 5EQQA 4R0IA 3MH4A 4WMFA 1QTFA 1WTGH 2BY7X 4DT4A 3PYHA 2FXRA 4GLYA 2V7QD 1BTUA 1KXAA 2AFQB 2OC0A 2ZDKA 4DURA 1O2HA 5LPEA 3M3SA 1PQ5A 5CHAC 1CVWH 1MZDA 3E16B 5T6FA 4RKOB 1J17T 4WY3A 1QBVH 4B76A 3TK6A 2FYQA 1GBCA 1FZZA 2WV4A 4JK6A 2BQWB 2OXSA 3A85A 2ZCKP 2BD4A 3P8NA 3V12A 1JRSA 2F83A 2BOKA 2KAIB 1GG6B 1AWHB 3GOVB 2RFKC 2FOMB 2ZG0H 2YNBA 1SLXB 5EQRA 5E0HA 4B71A 2ZGCA 3ZZ3A 2JKHA 1H4WA 3L6PA 1GHBG 3GYMA 3WW7A 2RDEA 2ZA5A 2ZHFH 1QB1A 3GCHB 7ESTE 1BMAA 3RXGA 4OM9A 1O3DA 1ZHRA 3SU5A 2OBOA 3SNBA 2A1DB 1GBLA 1N6XA 2G5VA 3UQVA 3ZZ6A 1F0UA 1FI8A 2GZ9A 3E3TA 1AFQB 4FUIA 2ZF0H 3RP2A 1F2SE 1ZLRA 1D3TB 1PPCE 2OQUA 2Q6FA 1OSSA 4AZ2B 3FN8A 1DANH 3S9CA 4Y7BA 4HFPB 3T29A 3RC4A 4ABHA 2QGRA 4FUGA 3FZDA 4MNYA 1ACBE 1FY8E 1GHYH 4XRNA 1W7XH 4AGKA 1GCDA 5AVDA 1LPKB 1GI0A 1GJAB 5FX5A 4FUEA 2V0BA 3RXHA 2J92A 1YP9A 2EQNA 1P01A 3ITIA 4FU8A 3T26A 4O3TA 4IW4E 2WPJS 2XBYA 3EA9A 1EAIA 3S7KB 1UTNA 1HAGE 1V2VT 1Z6EA 2PFEA 2AIQA 2D1JA 1BRUP 1DUAA 3K6ZA 4TY7A 1KTTB 1ARBA 1O3LA 2IPHA 4AC9A 1C2DA 1LMWB 2VGCC 4E05H 4Q63A 1O3AA 4CR9A 2BDGA 4X6OA 1MAXA 1NESE 1HFDA 3KHVA 4I8GA 2QXHA 5A2MH 4IMZA 1BBRK 1IHTH 3LGTA 4AYVB 1EZXC 3I78A 1N8OB 3GY8A 1L1GA 3MH7A 4MPXA 3RXKA 2WPDD 1LVMA 1O38A 4Y6DA 2AS9A 2BTCE 2FESH 1BMLA 1GHAG 2FOGA 4ZHAA 1TPAE 4NIXA 4AFQA 2Y82A 2WPLS 1MKWK 4WMDA 1O34A 1C5LH 1HLTH 2TGAA 2FZZA 2CXVA 3ZZ7A 3A7TA 2XNIA 2XC5A 3G01A 3ZZ4A 2Y80A 1AN1E 1SL3A 1MMJN 2Z9IA 1OP8A 1BT7A 3ZVAA 5C20A 1IQGA 1O35A 1WV7H 2ZU5A 2R2WU 1G2MA 4X1PU 3KYGA 1H1BA 4WH6A 2J38A 1DWBH 3RM0H 3TJNA 2W6JD 4MQAA 2LPRA 4Y79A 3VG8A 1ELEE 1F0RA 2G51A 4BTTB 4D9RA 4ACAA 2ZDMA 1W2KH 2OLGA 3AW0A 2SGEE 1KXFA 4ZAEA 3BG4B 1FPHH 2G4UA 5GDSH 3F3BA 2ZPSA 5EODA 1GMDG 1UK4A 2AEIH 2EY4C 1C1TA 1YPGH 1V2NT 2FYRA 3P92A 1MQ5A 4YOGA 2FM2A 3ZYEA 4X8UH 2W7SA 1P10A 3STIA 1CA0B 2WV5A 4X2XA 2ZWLH 4CH2B 3KQCA 1J9CH 1BTZA 2BD8A 1O5EH 3MHWU 3TJUA 2PP6A 2STBE 2M2AA 5KEDA 4NSVA 2XRCA 3W95A 2ZTZA 4U2WA 1GDUA 3ATWA 4THNH 1C2FA 3ZVCA 2XW9A 2NU0E 4YXWD 3PO1B 1JXPA 1LPZB 4ABGA 3LT3A 3VB3A 3PLKA 4ZKNU 2WSSD 5DJ7A 1RTFB 1MTVA 3SQEE 1LCYA 1QRZA 3N7OA 1HAOH 2KZ4A 1EQ9A 2TGTA 3O8DA 3SHAH 4X1SU 1O0DH 1SQAA 5IDKA 1UW7A 3TLOA 3KGPA 1NY22 2A4QA 4TY6A 2ZDLA 1AI8H 5E2OA 1QJ7B 1YBWA 5HM2A 1KLIH 3MWIU 2FLRH 1E0FD 1SGRE 3RU4D 1Z1JA 4F4OC 2HLCA 1BBRH 1GHBF 5C2ZA 3BTME 1TNHA 1CA8B 2BVRH 1YWUA 1PPGE 2FPZA 5LPFA 3MU1A 4Y76A 3KIDU 4NG9H 4OS1A 3UQOA 4GHQA 1TX6A 1JMOH 2G52A 1SOZA 3RXMA 4I86A 1HJ8A 2BY6X 2G5NA 2OINA 3F9FA 1A7SA 2BD3A 1G3EA 3RC6A 4RT0A 1GL1A 4BAKB 1MKWH 3CS7A 2P93A 3N7EA 1SGTA 2UUYA 1OYTH 3SJKA 2A7HA 2O9QA 1PPFE 3U98H 1MTWA 2FI4E 3SO3A 4BTUB 2W6ID 5A0AE 3SU3A 1UTLM 2FS9A 3PM3A 1ETSH 1GMHG 1ZR0A 5FBIA 1W8BH 1P8VC 1LHGH 5F03A 1NFYA 2BD9A 3DSOA 3DFJA 5DKMA 1A2CH 1IQKA 2CHAC 4JZ1A 1EKBB 4O03A 2NU4E 1EATA 1WXRA 1J15A 4RT1A 1LHEH 2HVYB 1L4DA 4DT7B 1UMAH 1SLUB 3QDZB 4ABJA 3TGJE 3ELAH 4K69A 1C5SA 2BHGA 3EGKH 1D4PB 1LVYA 3KEEA 4FUFA 1BMFD 1TNGA 1C1QA 1MAYA 2THFB 1B7XB 3LGWA 1BUIA 1OWHA 1F0TA 1O39A 4B6EA 1XVOA 1TRMA 1P2MA 1C9PA 3JZ1B 3E0NB 1JIRA 2PUQH 4BAQB 2ZGJA 3SV6A 1O2UA 2OP9A 2ZU3A 1W14U 2G55A 1AKSA 3EQ0H 3KCGH 2P8OB 2W3IA 1ESTA 1Y3UA 1YPJH 2ZO3H 2HNTE 1Y5AT 1ETRH 2Z3EA 3F2GA 1MTUA 5FPSA 1EPTC 1C5NH 1TB6H 1JIMA 1QL8A 3PMJA 1CGHA 3GS9A 1G9IE 1WQVH 4F49A 1Y3WA 1UTQA 1QURH 1AVXA 1O3NA 1W13U 3GCTF 6ESTA 2IOTA 1VCPA 2L74A 2XWBI 2ZCLP 1ANCA 3TPIZ 1Y3VA 3LPRA 1LO6A 3UNQA 1GBBA 1H9LB 4BAMB 1G30B 1EB1H 1HJ9A 1N6YA 2P16A 2XBWA 4NWKA 4NZLA 1C5YB 1A0JA 1A0LA 3PLBA 3BTDE 4B6FA 2TIOA 2ZQ2A 1DS2E 1LVOA 1NPMA 2QC2A 1L2EA 3ZZCA 2IJOB 1FY5A 2PV9B 1C5WB 1MD7A 2CGAA 4MPUA 1IQEA 1YLDA 1L4ZA 1YLCA 1O5FH 1A1RA 1TQ7B 2SGAA 2GJGA 1RIWB 4DGJA 2ZDNA 3HPTB 1NBME 4I8HA 1EZQA 1OS8A 1O33A 3ZIAD 2FO9A 3L3TA 1EP5A 5FCRA 4B2BA 4JZIA 3VXEH 1NFWA 4B2CA 1O2OA 2ZFPH 1VCQA 1C1VH 1FX0B 1EAWA 4X8SH 4A7IB 1K1NA 3PMBB 4Y0ZE 1TMTH 5FAHA 1C1NA 1C5ZB 1W0KD 3AAVA 3BTTE 5FHTA 4ZXXH 1A0HB 1ZOMA 4LOYH 2ALVA 1THPB 2GCTC 3M5OA 1IQHA 3ZV8A 1D6WA 1GGDB 4AFSA 1YPLH 5A8XA 1AB9C 2VWMA 1AKSB 2ZPQA 4TWWA 1EZUC 2PR3A 3TK5A 1ELDE 1SLWB 1VITF 3FVFB 4HG6A 3DT0H 2Q6GA 1O3PB 1C4Y2 1W3CA 2Z9GA 1T7CA 1IQFA 1P2JA 3BEIB 2FI5E 3FP7E 3RXBA 1V2PT 4B74A 5A0BA 1BMNH 1OP0A 2BZAA 4HI3A 2JJ1D 2QAAA 2FMJA 2XTTB 3ATIA 3Q3KA 2EI8A 2WZQA 3H7TA 5C1YA 4BXWA 3LJOA 3F9HA 1GPZA 3BTKE 3KN2A 1C1UH 2NWNA 1Y3YA 3S7HB 1C5VA 2HOBA 4UFGH 4WXIA 1V2JT 2ZQ1A 4FVDA 1YPHE 2J94A 3NZIA 2G00A 1MUEB 1U6QA 2CV3A 1UTMA 1DX5M 2PSYA 2PLXA 1UTJA 2Y6TA 4ISIH 3CP7A 5TCAA 5A09A 4KELA 2DUCA 2P94A 4M9FA 8LPRA 2KCOA 2ZFRH 3SNEA 1P9SA 3GY7A 1C1RA 1QCPA 1QHRB 2I6SA 2Y7ZA 1E38B 4NCYA 2VIOA 4I8JA 1G3DA 2P3TB 3M5NA 3H09A 3DSPA 1GMHF 1XUIA 3TNSA 1AZ8A 4UFFH 1P09A 5DGJA 3A8CA 3P6ZB 1NM6A 4MLFB 1OXGA 1NRQH 1TA6A 1QL7A 3LGYA 5DG6A 5C5NA 1O36A 3RMNH 4XE4A 1HBTH 1LTOA 1JBUH 4ZROA 2A4OA 4I32A 5T1VA 3WWFA 4KTUA 4E06H 1AY6H 2HRVA 1GBEA 2AHME 3RMLH 4A1XA 4CHAC 1KTSB 1O2VA 1F5RA 1BJUA 1P2KA 5BRRE 4ESTE 2AMPA 3RLYH 4Y0YE 3MNBA 1SGDE 2H1UA 4ASHA 3T28A 4Q7ZA 2J97A 2ALPA 4FUHA 3TGKE 5C5OA 2QF3A 3F9EA 4YO9A 1GI9B 5DP8A 2ZC9H 3F1SB 3M3VA 5A8ZA 5B6LA 2SGDE 5A0CA 3Q3XA 3RXVA 2ZKSA 1OYQA 1A5GH 1NFXA 4X6PA 4XFQA 1O2TA 3VB5A 2PGQB 3HK6B 1LKAA 2FS8A 2M5TA 3URDA 2CMYA 3TVJB 2VINA 1AU8A 1W7GH 2PHBA 3CENA 3GCNA 1BRBE 3SUFA 3E90B 2HVXA 1MU6B 1GCTB 3A87A 1E37B 3ZZ5A 2SNWA 3VEQB 1BTHH 1RGQA 1T8NA 1RTKA 5E2PA 1VITH 1XUGA 1C1MA 3DSGA 1BHXF 4NA7A 3MFJA 4IGDA 1ZSJA 3M7TA 1C9TA 3A7XA 3SZEA 2J5UA 4Q2KA 4CBNA 3F6UH 1O5GH 2BM2A 2PW8H 4DW2U 1SR5C 2XWAA 1P05A 3KL6A 5ESBA 1GBIA 1SOTA 1VGCC 3PRBA 2HALA 3M7UA 4J2YB 5DP6A 3RXPA 4UD9H 1TALA 4CRDA 2KCPA 1QJ1B 4K1SA 2P95A 2ZGHA 3LIWA 3B8JA 1HUTH 3EA8A 4SGBE 1YGCH 2VIPA 3BN9A 1TRYA 4X2YA 5HM9A 1CHOF 4A1TA 2HPPH 3ZZAA 2QE7D 3PLPA 1WU1A 3JZ2B 4IN1A 2F43B 5L30H 5EJZA 1WBGB 4A1VA 3S69A 1ID5H 3QWCH 1H9HE 4FUDA 4R8TB 2Y5HA 5DP4A 1F92A 1SFQB 3AK5A 3LKWA 1JRTA 1THSH 1AFEH 2A5KA 3SU2A 1AWFH 5FPTA 1L1NA 5DP5A 1IQNA 4DJZB 3PB1E 2ZEBA 2ANYA 4NIYA 1DDJA 5JBTA 1NO9H 1XMNB 1C4V2 3LDXH 3KQ5A 1SHHB 1HIAA 1PYTD 2F9BH 5FX6A 1EAXA 1O5DH 2GVFA 3UUZA 7KMEH 3AAUA 2G4TA 2XC4A 1FONA 5DSFA 2NU3E 2V3HH 4LZ4B 2TGPZ 2AMQA 3PO1C 5DP7A 5GCHG 3OFND 3RU4T 4ISOA 1AGJA 1SGQE 1TBQH 4JMYA 5I25A 4DCDA 1HNEE 1Q2WA 4YM9A 1S6FA 3I29A 4OS7A 3SUEA 1Y59T 5T6DA 1QBOA 2F9VA 3M36A 3U8TH 1SFIA 3MNCA 2HGTH 4A92A 3N99A 1S5SA 2ZIQH 4D8NA 2LP6A 3RM2H 3TK9A 5FXLA 2Y7XA 4MNWA 1S84A 2OCVB 4MVNA 1QY6A 2B5TB 3D62A 2SGPE 1QZ8A 1CBWB 4OGYA 4K8YA 2R0KA 3R3GB 4Y8XA 1H8HD 1IOEA 1DLKB 2BLVA 2IN2A 4JYVH 3M61U 3SQHE 4JZFH 4XBBA 1UTOA 4A5TS 1ZTLA 3NK8A 2J95A 3A86A 1NRNH 1K1LA 3LGVA 3HGNA 1GBJA 4BOHA 1TNIA 5C17A 4P02A 4IBLH 4UEHH 3DFLA 1V2KT 5DO4H 1NROH 1DFPA 3MMGA 3RXOA 1SSXA 1V2TT 3LGUA 2JETC 1DWCH 3SBKA 1S83A 2OQ5A 1RXPA 3GCTG 5EW1H 3TNTA 2LELA 2KFWA 3OTPA 4AOQA 5GWZA 1CSOE 3A83A 4X6NA 1K1JA 4H6TA 2K0QA 2QA9E 2C4FH 2C8WB 4Y8ZA 3EAJA 2Y81A 2JH0D 4KP0A 3KNXA 4ZKRU 4GHTA 5DP3A 5GIBA 1TWXB 1NS3A 1S6HA 1DUEA 1WYKA 3ZVDA 4ZMAH 2C93B 2BY5X 1BTXA 3ODDA 2HNTC 1G2LA 2KCAA 3Q00A 1GJBB 2R3YA 1ANDA 2ZHDA 1TOMH 1ZHMA 2ZPRA 1BITA 1AHTH 3TU7H 3OSYA 1KXDA 1OWJA 1XUHA 1V2UT 5CHAB 3URCA 2VWNA 2ODQA 5EGMA 3GYLB 3BTQE 1C5QA 2ZGXH 5LGOA 1FN8A 3SGBE 1AE8H 4GPGA 4KTSA 1CQQA 3BSQA 4Z6AH 1MCVA 3Q3YA 3UREA 3KF2A 4UE7H 3RXQA 1BOQA 1DWEH 3V3MA 1GI3A 1ZPBA 2Z3DA 1S0RA 4NZQA 3BTGE 5H4IB 1E1RD 3OYPA 1O2IA 3LH1A 3TJVA 3RXFA 4ZCNA 1P11E 1A5HA 6CHAC 3D49H 2A45B 1EJNA 1GJ5H 4MTBA 1HDTH 2ULLA 1B0EA 2HPQH 4X1QU 1SHYA 2J98A 1KMHB 2V3MA 1WOFA 2YNAA 3NRLA 3QX5H 5C0UA 4P00A 1QRWA 2JIZD 2BDAA 1VITG 1MQ6A 3QZRA 1HXEH 1O3BA 2FTMA 3DHKH 3A84A 3W94A 1QQUA 2A2QH 4KKDA 5HIYA 3O8RA 4XBCA 4U32A 4ASUD 4OS5A 3M3TA 1DM4B 3RXIA 3KQBA 1EJAA 3PV5A 4XDEA 4CH8B 1GJ8B 1GJCB 1A46H 1HJAC 2H6MA 4I8LA 1G36A 1MTNC 5KGOA 4CRBA 3MU5A 5JB8S 1TGNA 1AQ7A 4DIIH 1OHHD 3STJA 1C5XB 3RXCA 1O2ZA 1NZQH 3LONA 5SGAE 5GNDA 3NPSA 3LJJA 1V2OT 4WWYA 4CRCA 1GBDA 2J9NA 1GDNA 4J1YA 2GT8A 2BDYA 1FY4A 2A0QB 2HNTF 1ESBA 1NU7B 5T3HA 3VGCC 1G37A 1SMFE 1ORFA 3RXAA 1O5CB 2A31A 4ZH8A 2BLWA 2SNVA 1GJ7B 2QF5A 2BB4A 4ABAA 2AIPA 2RG3A 2VGCB 3NKKA 1FIZA 2VJ1A 3A88A 3TGIE 1O2GH 1TFXA 2F3CE 2PUXB 2ANKH 2OUAA 5F53A 5E0JA 4YLQH 2EA3A 1DITH 1S0QA 2PKSC 3FKSD 4UFEH 1YPHC 1C1SA 1HCGA 4NIWA 4NFFA 4IC5A 4NA8A 4INLA 5GCHF 2JDID 1BQYA 3LGIA 2C3SA 1QBNA 2GMTC 4JYUH 1HAXB 1ZSLA 5JPMH 1A4WH 1H8ED 1W0YH 4TSFD 2J98B 3GDUA 1TGCA 4VGCC 1A3EH 2CF9H 2SGFE 5LH8A 3K2UA 4BANB 2BXUH 2F9OA 4Y71A 2DE8A 1G32B 4MPVA 1Z8IB 3U1JB 3LC5A 2A5IA 3A80A 3E0PB 1KDQA 1O3OA 1V2WT 2CN0H 3B23B 5I46H 1SI5H 4X8TH 1COWD 3IWMA 8ESTE 1Z7KA 4ZHLU 3SNDA 3BTEE 1EOJA 1UVTH 3WWBA 4D76A 1V2MT 2FIRH 5CE1A 3DCLA 2B8OH 3FZZA 3MOCA 2EC9H 4RSPA 3SI3H 1P0SH 1Z71A 3OE7D 1O2XA 3PRDA 1CGJE 3UR6A 1KXEA 1LHCH 1K2I1 3MH6A 1EB2A 1NU9A 1OPHB 2TPIZ 3MO3A 3OEED 2ODPA 5IYTA 2AGGX 2UWOA 1ELGA 4MNVA 5L2ZH 1FAKH 3MU0A 4H6SB 5EU8A 3VB7A 4LK4A 1BRAA 1GDQA 3UIRA 1XXDA 5DP9A 3Q77A 2ZTXA 1ABJH 3F0OA 5L6NH 2PSXA 4YOIA 3BTFE 3FP6E 3QO6A 5DN6D 4X2VA 2VIQA 1TA2A 1TE0A 5EXNA 4SGAE 2FX6A 1HYLA 1UHBA 3QK1A 3UR9A 2BX3A 2V6NA 2AMDA 3BIUH 1P57B 4O3UA 2CK3D 1ZGIA
chains in the Genus database with same CATH topology
3A7YA 1XXFA 1ZGVA 4K3JA 1YPEH 2GKVE 3E91A 5GPIB 2ZFFH 3ESTA 1FNIA 1T8OA 1D3PB 4GAWA 1XKBC 2OC8A 4UDWH 1HAZB 2EI6A 2ZHEH 3SU6A 1P04A 2R2MB 1IQJA 4ZUHA 2FODA 1KDQB 1CHOG 3RXRA 1LPGB 4JCNA 3GY5A 4Q7XA 2FOAA 3F9GA 4BTIB 1C1OA 2EI7A 1ABIH 1M9UA 4ZXYH 2JH6D 1ZTJA 3UNRA 2FX4A 2ZECA 1P2IA 3ZVBA 2Z9LA 1EPTA 4K1EA 1OWKA 1NRSH 2LNCA 1O3IA 2BD2A 1QQ4A 1DPOA 1C4U2 1P2OA 4FUBA 1MBQA 2G8TA 2PTNA 1A61H 3ZVEA 2BQ6B 2RA0A 1TBZH 1HXFH 1Y8TA 1SBWA 4WMEA 1FMGA 4ZHMU 1W11U 4IC6A 2GD4B 4X1NU 3QLPH 3MU8A 1TMUH 4CRAA 4CBOA 3PMAB 1O3CA 1C2IA 1VCWA 2SGQE 2ODYB 1ZMNA 4O97A 3NXPA 2GZ8A 2GZ7A 1KIGH 2BDHA 2FDAA 2BZ6H 1PQAA 2CHAB 1QA0A 1DE7H 1TPPA 1UHBB 2GCHF 3LH3A 5HXFA 3SV9A 4B75A 2JH5D 4U01A 1VR1H 1O5BB 2GX4A 4NIVA 4A6LA 2ASUB 4NA9H 1GG6C 4XBDA 1LDTT 1SGNE 1GWAA 1C2HA 5EOKA 3OX7U 1FXYA 2VH6A 2VB0A 2FWWA 1NRRH 1MKXK 4YLUA 1L0ZA 1PPZA 3SUGA 4ABFA 3T2NA 3RC5A 3AVZA 3GCHC 2BXTH 2BOHB 1GMCG 3ATMA 3OY6U 4FU9A 2BY9X 4K2YA 2DE9A 2QV1A 3QTOH 3S0NA 1HAIH 1AFQC 1LKBA 3OTJE 1MU8B 1TGSZ 3T5FH 2QF0A 1AMHA 3EE0B 1NRPH 1H8IH 3TH3H 2FOCA 2PTCE 5GJ4B 4TWYA 5TJXA 4Y11E 2XCNA 3FP8E 3BEUA 1GHWH 1UTPA 3TITA 5ESTE 5FPYA 4H42U 1QL9A 3HATH 1SGEE 3PTBA 1EX3A 4I8KA 4AFZA 2H9HA 3MNXA 1SC8U 1UJ1A 4JYTA 3UWIA 1ZTKA 1AZZA 2BVSH 1HAHH 1CE5A 1T4UH 2RA3A 3ZZDA 1BIOA 2Q6DA 1GJ9B 4Q80A 1GJDB 2A7CA 2W26A 3KQEA 4WH8A 2QY0B 1FUJA 3UOUA 2VH0A 2BDBA 2ZNKH 1HB0B 1AIXH 3A7WA 3T62A 3SU1A 2BMGB 2PKAA 1Y3XA 1ELAA 2XCFA 4I7YH 1F0SA 1O32A 3A8DA 3GICB 1O37A 4X1RU 3P17H 2XXLA 1Y5UT 2ESTE 4Q7YA 4GUXA 3SUDA 1D3DB 3L33A 5E0GA 3ZVFA 1RS0A 3SGQE 4YOJA 3SORA 1C1WH 1HAYB 1LHDH 1N8OC 2WPHS 4BNRA 2OC1A 3H5CB 1XM1A 1F7ZA 1C5PA 1OKXA 4AX9H 3GY3A 1GBTA 2Z9JA 3AASA 2Q1JA 2GCTB 4ISHH 3VXFH 3S9BA 1GVZA 1CGIE 1YC0A 1FV9A 1YYY1 4E7NA 7LPRA 1AB9B 3UPEA 1VZQH 4UFDH 1IQMA 1Z8RA 1O31A 2A4RA 2B9LA 1TX7A 3P8GA 4RN6A 5DK1A 1D6RA 1K1PA 1PQ8A 4WXVA 3UOPA 1KLJH 2UWLA 3O8BA 5EPNA 2ZU1A 3ATKA 1ELBA 1OOKB 2F9NA 3A82A 3C1KA 4YT6H 1GJ4H 4X6MA 1KYNA 2J2UA 1K21H 2H9EH 5K0HA 1DSUA 1MKXH 2VIVA 4K60A 2STAE 1FLEE 1K1IA 1PFXC 1CT4E 1T4VH 1GBFA 1DXPA 1MCTA 2ZU4A 1P12E 2H2ZA 4OS2A 3BG4C 1YM0A 1O3HA 5AFYH 3CS0A 2WINI 3FAOA 3SNAA 2GT7A 2W7UA 3HGPA 1UTKA 2V3OH 4FVBA 4TYDA 1GHXH 4I31A 3H7OA 2QXGA 1C5RA 2Z94A 1GI4A 1OWEA 2PKAB 1P2QA 2NU2E 1CA0C 1WTHD 1XX9A 3RLWH 4FUCA 2WYGA 5J4QA 3NWUA 1OP2A 4H4FA 4TPYA 1CU1A 3GY2A 4ZKOU 1LQDB 1MH0A 4INKA 4DOQA 3DUXH 1ZRBA 1T31A 3EA7A 4KTCA 3SZNA 1YCPM 1BZXE 1PPBH 3VFEA 2WUCA 4X8VH 1S81A 2D2DA 3FFGA 1BHXB 1PPHE 2EEKA 1O3MA 1SGIB 1WAYB 3BTWE 4X2WA 4RKJB 1EUFA 1GBMA 5HYOA 1KSNA 5E8EH 2WUBA 3A7ZA 1BTYA 1C2GA 3ZZ8A 3SI4H 3HK3B 3E1XB 3M35A 2O8WA 1FQ3A 1LQEA 1V2LT 1Y5BT 1O3EA 1TRNA 1JWTA 1GVLA 4HGCA 3GDSA 3P95A 3P8FA 1J14A 2O8TA 1GHVH 2A2XH 3MYWA 7GCHG 3RXLA 4CHAB 2ZCHP 1UVPA 1FJSA 3R0FA 1MD8A 1THRH 4CREA 5EG4A 1ZHPA 5FCKA 3K6YA 3GCOA 4I33A 1GMCF 1TX8A 1TLDA 2GTBA 3TH2H 4IN2A 1KLTA 2BD7A 2UWPA 5B6OA 1RFNA 2UUKB 2P3UB 6GCHG 2ZU2A 1SQTA 3MO9A 2ZGBH 3QN7A 1P2NA 3PWBA 5F8TA 4YESB 1UO6A 1DWDH 2VVCA 1HAPH 2FP7B 4OGXA 2VWOA 4FXGH 5F8ZA 3TIUA 1SGFG 3RDZA 5JBAS 4NSYA 1PQ7A 1F5LA 3QUMP 3RXJA 3EYDA 5F6MA 4O9VA 4DVAU 4AGJA 2BLQA 4LXBH 2C8YB 1C2LA 5EW2H 2O8UA 2D8WA 1BTWA 5ABWA 1HIAB 3BTHE 1VJ9U 1V3XA 1J16A 1TBRH 1A3BH 5EQSA 1ZZZA 2B0FA 4MG3A 4YTAA 5J4SA 3E6PH 1DVAH 1QRXA 2UUFB 2H5CA 1ANEA 5FBEA 1XUKA 1O2LA 4GSOA 4ISNA 3SN8A 4NWLA 3DD2H 1ZRKA 3RXSA 1OX1A 1BDAA 3ENSB 1MZAA 1SGYE 1VGCB 8GCHF 2B7DH 3P8OA 2A5AA 3A8AA 1ZPCA 4K8BA 2BDIA 1V6DA 2ANMH 5JBBS 1TONA 1AUJA 2P8OC 8KME2 1O2WA 1K1MA 1QR3E 1YF4A 1CHGA 2Z9KA 4JZDH 2BLOA 3BG8A 2QIQA 4HTCH 3GY4A 2AYWA 1BBRE 3A81A 5JYIA 4QT8C 1BRCE 2WPMS 1RTLA 3QGJA 1ZMLA 3SNCA 1K22H 4ABEA 1ELCA 2TBSA 4GCHG 1KXCA 1GJ6A 5DPAA 5AF9H 1SQOA 5JBCS 4X0WU 5GXPA 3VB4A 3T25A 4OS4A 1XVMA 1RD3B 2VVVA 3PWCA 3SJ9A 1P3CA 2Y5FA 2YOLA 1NN6A 3FANA 1ARCA 1EOLA 2GV7A 1GI8B 4AFUA 2K1QA 1FIWA 5F8XA 1SLVB 4WVPE 1RIWC 2BY8X 1C2JA 3O8CA 1O3JA 1W10U 1SPJA 2ZHWH 2OD3B 3QTVH 1O2MA 3K9XB 2GCHG 3AW1A 5L2YH 4BAOB 3RXTA 1HV7A 1XUJA 3SV8A 4XSKU 1D9IA 1TPSA 4AB8A 4ABDA 4IS5A 5K7RA 1EP6A 2D26C 5PTPA 2A32A 4YT7H 1DLEA 1Q31A 4AYYB 2CJIA 5AFZH 4K5ZA 2BYAX 4DIHH 2FLBH 1GGDC 3M5MA 1DXWA 5BPEA 2J34A 1KXBA 2PWXA 1TPOA 2G81E 1TNKA 4U30A 2I6QA 3GY6A 3RU4E 3ATLA 5T6GA 3U8OH 4MPWA 6LPRA 3I77A 2HWLB 4AB9A 1DSTA 1LHFH 1Q3XA 2FOFA 3UY9A 3MNSA 3ZYDA 4D7FA 3MU4A 1C2EA 1AE5A 4Y10E 4KGAA 1QNJA 1ZYOA 2ZDVH 1GI1A 1V2ST 3PROA 1CO7E 1GI5A 2JETB 1ETTH 1UVSH 2UUJB 1SGCA 7GCHF 2Z3CA 1IQLA 1JOUB 3TH4H 1K28D 1QGFA 3SHCH 3MI4A 3OY5U 5TCCA 2P3FH 4BAHB 1CT0E 1DOJA 5C67A 9LPRA 1S82A 2R3UA 4INHA 3BF6H 2Z6BD 2XC0A 1A5IA 1C5OH 1B0FA 2GDEH 1SGFA 2RDLA 2FTLE 6GCHF 3E8LA 4MNXA 2J4IA 4CR5A 2WPKS 4HZHA 1AO5A 3U9AH 2FOHA 3ZV9A 2ZDAH 4NGAH 1O2PA 1X7AC 3B9FH 2VIWA 3M7QA 4B73A 1RJXB 2QYIA 4OS6A 4Y7AA 1G3BA 2Y5GA 1HRTH 1ELFA 1Z6JH 3SV7A 3PTNA 1ZPZA 4FU7A 2ZHQH 1MBMA 1AVGH 3A89A 1C1PA 5A8YA 2OC7A 3IITA 1TQ0B 1GBKA 1ZSKA 3UWJH 5EXLA 5JB9S 2QXIA 3KQDA 1K1OA 1EZSC 1O5AB 1RRKA 3M37A 1GHAF 1QFKH 2F91A 3LC3A 4WF8A 1GI2A 2CF8H 1O3FA 6CHAB 3MH5A 2A4GA 1EASA 1TYNA 2PGBB 5LPRA 2Z7FE 3GISB 3LU9B 3VPKA 4LZ1H 1EXFA 2C8XB 1S85A 2ZFTA 2GV6A 4Y8YA 1FY1A 1TAWA 1C5UA 1FN6A 1FDPA 5EPYA 1INCA 2GDDA 3NUMA 3OU0A 1E36B 1O2JA 5C1UA 2V35A 1HAVA 4JK5A 3ZVGA 4DG4A 1TGBA 3SGAE 3BEFB 1HJAB 5AHGH 1MTNB 1NC6A 3ODFA 1ELVA 2F9UA 4NFEA 1N1LA 2OTVA 1ESAA 1BTPA 1GMDF 3SU4A 1CT2E 1P02A 1WUNH 4DY7B 2H5DA 4MDSA 1NTPA 1C2MA 1FPCH 1TIOA 3ZZ9A 3SJ8A 4WJG2 3VGCB 3C27B 4Z0KA 1J8AA 4GCHF 2P59A 9ESTA 1GI6A 1GCTC 1V2QT 3IG6B 1GVKB 4AN7A 3PMHB 1DY9A 1H9IE 1WQSA 1QB6A 4D7GA 4XOJA 5HMAA 2OBQA 4K1TA 5G4BA 4ABBA 2AH4X 1QA7A 2XBVA 2VNTA 1F5KU 2QN5T 2VU8E 2C90B 2BVXH 3ZZBA 1D3QB 1ZJDA 3SJIA 1IAUA 4AG2A 2C8ZB 4BXSA 2F9PA 1UCYK 2QCYA 3RMMH 1C2KA 2A7JA 2NU1E 2PKSB 2ZFSA 1O2NA 2FOEA 1IHSH 3Q76A 2BDCA 3UNSA 3SOSA 3U69H 1W0ZU 2ZFQH 1Z8JB 1C5TA 1Z1IA 2AGEX 2W3KA 1WSSH 1L1JA 2R9PA 1WCZA 1GL0E 2GMTB 3A7VA 2FEQH 1W12U 2FI3E 4VGCB 3HKIB 4CRGA 3MO6A 1YCPK 4B2AA 1DY8A 2W5EA 3RUOA 1GHZA 1UVUH 3UTUH 2VVUA 2VWLA 1SVPA 1UVOA 3WY8A 1O2QA 1T32A 4D9QA 1PPEE 1IQIA 4PROA 1TGTA 3SU0A 1YKTA 1BMMH 1HAVB 2FOBA 2RCEA 3HKJB 1QB9A 1HPGA 3V13A 1V2RT 4B1TA 1SGPE 1OWDA 1XKAC 1FAXA 1EAUA 1T8MA 5EXMA 2BQ7B 1Z8GA 3U8RH 1ZMJA 1O2SA 3EDXB 3M5LA 3T27A 1YPKH 4ZKSU 3UFAA 3V7TA 1VJAU 1O2RA 3LOXA 1ZJKA 3SJOA 1DT2A 1EJMA 1BA8B 1O2KA 1O2YA 1AD8H 1E35B 1MTSA 3QGNB 1SB1H 1UCYE 1EPTB 3TJOA 5ETXA 4ABIA 5CMXH 1ANBA 1TMBH 3D23A 3BV9B 2ILNA 4UONA 3NCLA 1PYTC 2TGDA 3RXEA 3PV4A 1TNJA 1SG8B 1OWIA 3RXDA 2O8LA 1YPMH 1UK3A 3A8BA 1DICA 3RXUA 1BCUH 5C1XA 3P70B 4TPIZ 1ELTA 1P06A 1NFUA 2BX4A 2ZI2H 2SFAA 1NT1A 2AGIX 3K65B 2TRMA 3V0XA 1P03A 3F68H 4E7RG 1GBHA 1FY3A 1CBWC 2KAIA 1QIXB 1B5GH 2VIDA 4ISLA 2GP9B 1P3EA 8GCHG 2H9TH 1GBAA 1XUFA 1TABE 1G3CA 2O8MA 4JZEH 2BD5A 3VB6A 2ANWA 3D65E 2XYAA 1BB0B 3GDVA 4AG1A 4M7GA 1C5MD 1LVBA 2AERH 1QJ6B 3DA9B 2GGVB 1UCYH 1H8DH 1TOCB 5HGGA 4GVUA 5C3NA 1T8LA 2WYJA 2XBXA 4FUJA 4IMQA 1O3GA 3BIVH 1PJPA 2QXJA 1GI7B 1TNLA 1P9UA 4YZUA 4AORA 1HGTH 3S9AA 3U1IB 1O3KA 1E34B 2ZZUH 3SW2B 5JDUB 4CRFA 3SV2H 1AVWA 1YCPH 2ZP0H 1AUTC 2R0LA 3RMOH 3MTYA 1UK2A 2ZTYA 1KY9A 2WPIS 1K9OE 3QZQA 1BJVA 1O30A 5EQQA 4R0IA 3MH4A 4WMFA 1QTFA 1WTGH 2BY7X 3PYHA 2FXRA 4GLYA 1BTUA 1KXAA 2AFQB 2OC0A 2ZDKA 4DURA 1O2HA 5LPEA 3M3SA 1PQ5A 5CHAC 1CVWH 1MZDA 3E16B 5T6FA 4RKOB 1J17T 4WY3A 1QBVH 4B76A 3TK6A 2FYQA 1GBCA 1FZZA 2WV4A 4JK6A 2BQWB 2OXSA 3A85A 2ZCKP 2BD4A 3P8NA 3V12A 1JRSA 2F83A 2BOKA 2KAIB 1GG6B 1AWHB 3GOVB 2FOMB 2ZG0H 2YNBA 1SLXB 5EQRA 5E0HA 4B71A 2ZGCA 3ZZ3A 2JKHA 1H4WA 3L6PA 1GHBG 3GYMA 2ZA5A 2ZHFH 1QB1A 3GCHB 7ESTE 1BMAA 3RXGA 1O3DA 1ZHRA 3SU5A 2OBOA 3SNBA 2A1DB 1GBLA 1N6XA 2G5VA 3UQVA 3ZZ6A 1F0UA 1FI8A 2GZ9A 3E3TA 1AFQB 4FUIA 2ZF0H 3RP2A 1F2SE 1ZLRA 1D3TB 1PPCE 2OQUA 2Q6FA 1OSSA 4AZ2B 1DANH 3S9CA 4Y7BA 4HFPB 3T29A 3RC4A 4ABHA 2QGRA 4FUGA 3FZDA 4MNYA 1ACBE 1FY8E 1GHYH 1W7XH 4AGKA 1GCDA 5AVDA 1LPKB 1GI0A 1GJAB 5FX5A 4FUEA 2V0BA 3RXHA