3S9AA

Russell's viper venom serine proteinase, rvv-v (closed-form)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
234
structure length
234
Chain Sequence
VVGGDECNINEHPFLVALYTSASSTIHCAGALINREWVLTAAHCDRRNIRIKLGMHSKNIRNEDEQIRVPRGKYFCLNTKFPNGLDKDIMLIRLRRPVTYSTHIAPVSLPSRSRGVGSRCRIMGWGKISTTTYPDVPHCTNIFIVKHKWCEPLYPWVPADSRTLCAGILKGGRDTCHGDSGGPLICNGEMHGIVAGGSEPCGQHLKPAVYTKVFDYNNWIQSIIAGNRTVTCPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of coagulation factor V recognition for cleavage by RVV-V
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Vipera russelli proteinase RVV-V gamma
total genus 56
structure length 234
sequence length 234
ec nomenclature ec 3.4.21.95: Snake venom factor V activator.
pdb deposition date 2011-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3s9aA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3s9aA02
1AHTH 3SNAA 2R9PA 4BAMB 1HCGA 1MAXA 1O2PA 1E36B 1UCYH 2IN2A 3LOXA 2W7SA 1QB6A 3ZVAA 3MH7A 5IYTA 4FUCA 2OC0A 2A7JA 3SU1A 5AFYH 4CRBA 2EI7A 4Y0YE 3ZZ3A 1KY9A 2HPQH 3QTOH 3GYMA 1DXWA 3MO3A 1O5FH 3E91A 2XTTB 1O2OA 3RXBA 5F03A 3BTHE 3EA7A 3MMGA 4BAHB 1TX6A 1SGRE 3UOPA 1TGTA 4A7IB 5E0HA 3KQCA 1DSTA 1NN6A 2BY5X 2FEQH 4X1QU 1O3GA 2FDAA 3LC5A 2JH5D 3RXOA 4SGAE 1GJBB 2BMGB 5AHGH 4WMEA 1P03A 1SSXA 2BOHB 5C20A 2NWNA 2ILNA 3G01A 8GCHF 4Q2KA 1T31A 3T2NA 1THRH 1ZTJA 3EE0B 1G3DA 3F6UH 1GHAG 3GDSA 4GLYA 1DM4B 3SUDA 1C1VH 1WUNH 2JETC 3O8BA 3SUEA 4CRFA 1P2IA 4X0WU 3S7HB 3TIUA 4CRDA 4ABGA 1BRBE 1ELTA 1QA0A 3ODDA 1TOCB 1FIWA 1SGEE 4JK6A 1C2JA 4OS5A 1UTPA 5DP7A 1WTGH 4CRCA 1A61H 2QGRA 3RXUA 3GICB 4LZ4B 3M36A 2ZPRA 4PROA 1ESAA 2NU4E 4ISLA 3QZQA 1P2OA 3Q77A 1SHYA 4X1PU 2GMTB 3SZNA 3P8NA 4MG3A 3PYHA 4YLUA 1WYKA 1AUJA 4Z0KA 2IJOB 5HM9A 2Y81A 5C5OA 5C67A 3U8OH 1AI8H 4AFSA 3S0NA 3ZVEA 2HWLB 4ABBA 2GX4A 2A4QA 1Y8TA 1SLXB 3SJIA 2SGDE 1ZRKA 2AMPA 1GL0E 2H9EH 3L3TA 3QO6A 1CE5A 1GI4A 3Q76A 2A32A 2H1UA 1L4ZA 1CBWC 3UPEA 4YTAA 2VIQA 2VIDA 1O30A 2WUBA 3P17H 3LH1A 1NT1A 1BZXE 1GCTB 1JBUH 2ZFSA 3VFEA 3RC4A 2ZDMA 4X6MA 5FAHA 1HAVA 4IBLH 3LONA 2FXRA 2XBXA 3U9AH 4ABEA 1D6RA 1SBWA 2CHAC 4NIYA 1V3XA 2F3CE 1GL1A 2P94A 2SGAA 1O2UA 2XRCA 1ZPBA 1YPHE 1NFUA 5FPYA 1SGQE 3RMNH 1HBTH 3U69H 1CT0E 4MPWA 3UIRA 4YOGA 2F9PA 3TPIZ 2D1JA 4IN2A 2ZF0H 1TNKA 1YPKH 3SBKA 3MU4A 4ISIH 2EC9H 3I78A 1GMHF 2ZPSA 1AZZA 1E35B 1BBRK 1PQ7A 2UWPA 3FANA 4X1NU 2C90B 3GY2A 3MYWA 4TWYA 1D4PB 4DT7B 1EPTB 1QRXA 1VCWA 5DGJA 1P12E 1D3TB 1NRPH 3T28A 2ODQA 5DO4H 1TGNA 1TAWA 2A31A 4OGXA 3AAVA 4B2BA 1IQHA 1MH0A 2ZGJA 1C2HA 1WBGB 3A81A 2CN0H 4RSPA 4F49A 2VWLA 1SB1H 3FZDA 1HAOH 5EG4A 1GBHA 1BTXA 2CHAB 3SU5A 3STIA 3PTNA 3BTME 4AFZA 2ZQ1A 1EOJA 1SLVB 3RMLH 4FVDA 1MZDA 1AGJA 1NY22 3RXPA 2QF3A 1MCVA 2NU1E 1UO6A 1F0SA 4GHQA 1JXPA 4X2VA 3TVJB 4WH6A 4UEHH 2SNWA 5DKMA 2H5DA 4CBNA 3LGTA 1TBZH 3PMAB 3PTBA 1O3LA 1GHVH 2O8MA 3T62A 2Y6TA 1DXPA 2J92A 1CGIE 1WOFA 1HPGA 4X2YA 1AZ8A 4ZH8A 1TBQH 4AZ2B 1A5HA 4E7RG 1P2NA 2ZGCA 1DICA 4WXIA 1P9UA 1UVSH 2GP9B 3A7YA 3P70B 5BPEA 5A8XA 5EQQA 3ZVFA 1QIXB 4BXSA 3UFAA 2C8ZB 4ZROA 4LK4A 4K69A 2TGAA 3SV9A 3B8JA 2R0KA 1SGTA 2WPKS 3TH2H 1LTOA 3KCGH 4ABAA 2HLCA 3DHKH 4ZHAA 3RXRA 5HXFA 3GOVB 1TMBH 1MU8B 1BIOA 3TLOA 3JZ1B 5LH8A 3K2UA 3Q3KA 1JIMA 4FUFA 2PKAB 1KXCA 2TGTA 4I8JA 1C2FA 3QDZB 1RD3B 1KDQB 1BT7A 1V2VT 3MU8A 2J9NA 1ZJKA 2Y5GA 1HV7A 1GJ6A 3BTGE 1W13U 1Z6JH 3TNTA 1O3KA 4DIIH 2Y5FA 1ZMLA 4K60A 1H8IH 1T8LA 2QF0A 5EPNA 1QQUA 1FZZA 1LVYA 1K22H 2ESTE 2GT7A 1MTVA 2OCVB 1JIRA 1BB0B 1ABIH 2AYWA 2Z3DA 1SGYE 1THSH 2ZDLA 4MNXA 3FP7E 2OC1A 2PWXA 4AGJA 1WSSH 3SN8A 1CGHA 3KEEA 5C1UA 1Q2WA 2IPHA 5FCKA 2EEKA 1TB6H 4ABHA 1W7XH 4Y8XA 3E6PH 3TK6A 6CHAC 4D7GA 3OX7U 3FVFB 4ISOA 1F0RA 1LKBA 4I31A 2C8YB 1WU1A 1GVKB 2JH0D 3LU9B 1LHCH 1QGFA 1BTUA 1EKBB 1MZAA 2XBYA 3QGNB 5JBBS 2PUQH 2VWMA 3CP7A 2O8TA 5FXLA 4B1TA 2O9QA 2FOGA 1SGIB 3RLWH 2ZDKA 1O3FA 3N7OA 3RXCA 1EB1H 2AGIX 4KP0A 1VGCB 1UTOA 2FS8A 4OS2A 2ODPA 3LKWA 3V0XA 3QN7A 4K2YA 5SGAE 4BANB 1C9PA 1EAUA 4FUGA 4ASHA 5DP4A 4B2CA 1O2HA 4ESTE 3ZZDA 4CHAC 2SGQE 2QXGA 2OC8A 1Y5AT 2R2MB 1BHXF 3SV6A 3BEIB 1GI9B 2TRMA 1DT2A 5A0CA 1DVAH 1C2MA 1QL9A 1HJAB 3VXFH 1KLTA 1MQ5A 1O2YA 1Z6EA 5T6DA 3VB7A 1A4WH 1P02A 5E2PA 2PTCE 4A1TA 3C27B 2WPJS 2ZHDA 1C5RA 4ZHMU 4DJZB 3GY7A 1EX3A 1ZGIA 2FTMA 1XXDA 1UHBA 1AY6H 2H6MA 2P3UB 4MPXA 4MNYA 3SJOA 1YKTA 1OYQA 3GY8A 2WV4A 1YPLH 3RXJA 1TALA 1JWTA 5CE1A 4BTIB 1HAIH 1KDQA 5JB8S 1EOLA 1S82A 1FLEE 1ELGA 4U30A 4H42U 1LVOA 3GISB 1V2TT 1TE0A 1ZRBA 2GV7A 1W14U 2Z3EA 3S9AA 2R3UA 1OWJA 1TX8A 1OOKB 4B2AA 3BG4C 1XUGA 1YPGH 1YPHC 2ZGBH 1UCYE 2ZCLP 3MNCA 5T3HA 3MH4A 1P11E 4GAWA 1L1NA 2C3SA 1A0JA 3TK9A 3UREA 4Y79A 1C5MD 3SHAH 1Z71A 1S0QA 1DSUA 3ZZ6A 1TA2A 1RS0A 1C1UH 3ATMA 2W3KA 4Z6AH 2Y7XA 2QY0B 4WF8A 3URDA 4BAQB 1S0RA 1GCTC 1C4Y2 1L1GA 2WPMS 3P6ZB 5DP8A 2PV9B 4B73A 5JBTA 3V3MA 1TNIA 3P92A 1SGNE 1CHOG 1BBRE 1VCPA 2JH6D 2VU8E 2PKAA 1BBRH 3NK8A 1CA8B 2PW8H 1FQ3A 1P9SA 4ZXXH 2XBVA 1UK3A 3ZVDA 1NM6A 1O39A 3AW1A 3DT0H 1DWBH 2ZFPH 2OXSA 2FOHA 2VH0A 1O3PB 3PWCA 4YOIA 3TH4H 1QQ4A 2AH4X 1Q31A 2ZTYA 2BY8X 4NSVA 1SGDE 3TJOA 1T8MA 5JBAS 2TIOA 4ZKRU 1SC8U 2CF8H 2PHBA 2VIPA 3TGIE 2ANWA 1AMHA 3ZZ7A 1VITH 2BDGA 1GBMA 5J4QA 1GG6C 4BTUB 1E0FD 1BTHH 1WQVH 1V2KT 2BDIA 2FZZA 3SGBE 4QT8C 1D6WA 3GY5A 1AWHB 5K7RA 2BOKA 5C2ZA 1VITG 1LPGB 2F91A 3EQ0H 4BTTB 1V2WT 1AIXH 1K2I1 2BQWB 2VH6A 4DVAU 1K1LA 1SOZA 1IQJA 1BOQA 3MHWU 2YNBA 2ZCHP 2D26C 2A4GA 2ZFQH 1VCQA 3A89A 2HNTC 1NRQH 3TH3H 1MTWA 1J17T 1QFKH 3LGVA 1TYNA 3M3SA 1T8OA 4I8HA 1JRTA 1OS8A 3KQDA 5LGOA 1C2GA 1GI8B 5GDSH 3UNQA 2BX3A 1UTKA 1O2SA 1NU7B 3CENA 2DUCA 1H9LB 1UCYK 3A8CA 3W95A 1KTSB 2QXIA 4ABIA 2BQ7B 1O2WA 3VXEH 2QYIA 1LCYA 3HPTB 3F9HA 3M61U 3ITIA 1FUJA 1G2LA 1F92A 2BY9X 2PGBB 3PLBA 1DPOA 3SU0A 1NFWA 1N6YA 1X7AC 3PMBB 4YM9A 1RTKA 5FPSA 2H2ZA 2A7CA 1Z8JB 2NU0E 5DPAA 4YT7H 1F7ZA 2Z9GA 3EA9A 2ZHWH 2XC5A 5GCHG 3L33A 1EB2A 1AB9C 1O2RA 1QBNA 4X8SH 2BDHA 4WY3A 1CGJE 4WXVA 1BRAA 2W26A 1C2EA 1M9UA 3MTYA 4UE7H 1VITF 3D62A 3E0PB 4ISNA 3SUGA 5AF9H 5DJ7A 1ZSLA 1ABJH 2ZWLH 2AMQA 2VGCB 7GCHG 2I6SA 3VB3A 1G3BA 1EASA 2STBE 3A7ZA 1GPZA 3OYPA 1C1RA 3A86A 1HJ8A 4K5ZA 4DOQA 3A7XA 3UWIA 3M35A 2F9BH 5FBEA 4XDEA 2FYRA 4CRGA 1BMLA 1TQ7B 3F9FA 2H9TH 2Z3CA 3KF2A 3UNRA 1GJAB 2WUCA 1IQEA 1GJDB 1GHWH 2HNTF 2VWNA 1BHXB 1SL3A 4X6PA 2ODYB 1HNEE 1Z8RA 3LJOA 3MU0A 2LNCA 4TYDA 1XX9A 2C8WB 1OP2A 1N8OB 4B71A 4UFFH 2FI3E 2RG3A 3ZZ5A 1ACBE 1ELAA 1YP9A 1P01A 1KXDA 3ATIA 5C1XA 1YC0A 1LO6A 1RTFB 2ZECA 1F2SE 3U1JB 1CHGA 5A8YA 2O8UA 3D65E 4X2XA 3O8CA 1XUFA 5E0JA 1ANCA 8GCHG 1ZMJA 2AIPA 3OSYA 3U1IB 1GMDF 4TWWA 1OWDA 3QZRA 1Q3XA 2ALVA 1A0LA 4I8KA 3RU4D 4FU8A 4WVPE 1UK2A 3T29A 4JYUH 4TPIZ 4SGBE 1C1PA 5G4BA 2VNTA 4B75A 2ZGXH 1DITH 1UTNA 2AGEX 5K0HA 1CVWH 1MTNC 8LPRA 5J4SA 5FPTA 1XKAC 2AEIH 5GIBA 1IAUA 1VJ9U 4YOJA 1NFYA 3GY4A 1ANBA 2HRVA 5LPFA 1K1OA 4NGAH 4O03A 8ESTE 2PSYA 3RM0H 1FNIA 2PLXA 4U32A 4MDSA 1EP5A 1C1SA 1PFXC 2GT8A 5HM2A 5GPIB 1BMNH 2A2XH 1SGCA 3P8OA 3SGAE 2WYJA 3E90B 2BYAX 4JYVH 1W3CA 1PPBH 1PPGE 3D49H 1C5WB 4VGCB 1OP8A 3S7KB 1H1BA 1TPSA 1GI7B 4KELA 2B9LA 4R8TB 2C93B 1GWAA 1HJ9A 1GBAA 1P04A 2YOLA 4UD9H 1HFDA 1P05A 3KL6A 3URCA 3A85A 1GHBF 3PO1C 3Q3YA 1C1MA 1C4V2 3FFGA 1CA0B 4VGCC 3ATKA 3TGKE 1LQEA 1O36A 3M3TA 3C1KA 1MKXK 1DY8A 2FOMB 2BDBA 4HGCA 3SV7A 1QJ1B 1HAHH 1KXBA 2RDLA 4UFDH 4CH2B 1T32A 1GI6A 3LGWA 4GCHF 2AERH 2FX4A 1O3HA 1HUTH 5A0AE 1OYTH 1P3CA 1T7CA 4I8GA 4FVBA 1TPPA 2JKHA 1MTSA 3BTEE 2BHGA 4AOQA 1BITA 4AG1A 4K1TA 1P06A 2GD4B 3MNBA 4NIXA 5A09A 1ZTLA 2P8OB 3RXHA 3R3GB 1TFXA 3RXLA 1BJUA 3QGJA 3SQHE 3RXKA 3UUZA 1LHGH 1MKWH 2FO9A 3A8DA 1C2KA 2ALPA 3MFJA 3RXEA 3RC5A 1LVBA 1IOEA 1SG8B 3HKJB 3D23A 5EQSA 3TJVA 2FMJA 2VVUA 4FUIA 4BAKB 3P95A 2GDDA 1SR5C 1ELEE 1GHZA 1CT2E 2A4RA 5F8TA 1VJAU 2P3TB 1GI5A 1V2NT 2QCYA 3DFLA 1FY4A 5L6NH 1E38B 1XUKA 3K6ZA 4B76A 3RXGA 2UWOA 3GCOA 1K1MA 1RRKA 2ANYA 3BIVH 4D9RA 2UWLA 1TOMH 1SQOA 2BXUH 4INHA 1PPCE 1BRCE 1O3EA 6ESTA 1NESE 1GBTA 3QWCH 1FN6A 1K1NA 5EGMA 1CT4E 2BLWA 2A2QH 1O35A 1NFXA 2ZO3H 3RMMH 5L30H 3MU5A 2G4TA 1FJSA 2AFQB 2ZKSA 3BV9B 1TGSZ 3SOSA 4IW4E 1TNHA 4F4OC 1HXEH 3V13A 1ELVA 2UUJB 2C4FH 1TBRH 1GJ4H 2GCHG 3LGIA 3NPSA 4I32A 2ZNKH 4LXBH 7GCHF 4IGDA 4K3JA 1V2OT 1DX5M 1UVTH 5B6OA 3SU3A 1QL8A 4MTBA 5FHTA 2PFEA 1DS2E 1UTLM 3SJ9A 3T25A 4X2WA 1GBLA 2GZ8A 1W8BH 1V2MT 1SQAA 1KIGH 3ZYEA 4DG4A 1FV9A 1FXYA 4CRAA 1OKXA 3SNBA 4AORA 1FDPA 4THNH 2QN5T 1QY6A 2FOAA 1K1PA 1O5EH 1QL7A 1O37A 1IQKA 2B5TB 5A8ZA 4IC6A 1TGCA 5FX5A 3UTUH 1DLKB 5EW1H 1QHRB 1GJCB 1O3IA 1WAYB 2FYQA 4K8YA 2QXJA 5C5NA 1MTNB 1EZUC 4E7NA 2FOFA 3BF6H 1HYLA 1Y3WA 4ZUHA 1NPMA 3T5FH 5HMAA 2M5TA 2ZHFH 3UNSA 3RXMA 1Z1JA 3E8LA 1ESTA 5IDKA 3OY5U 3GDVA 1BJVA 1ZSKA 3QTVH 1LPKB 1QJ7B 3T26A 3MH6A 1KSNA 1IHTH 1OX1A 1ELFA 4AFUA 1GBEA 1SLWB 4D76A 4D8NA 1AO5A 2ZFTA 3RXIA 1OWIA 1A3EH 4NWKA 1HB0B 1VZQH 4KTUA 4ZMAH 4Q7YA 4XOJA 1BTYA 3LGUA 4AB8A 4ZKOU 2XBWA 1MD7A 1GBIA 3RLYH 1ZJDA 1AQ7A 5F6MA 3O8DA 1ELBA 1AVWA 3A88A 2CF9H 4XSKU 2BX4A 4DURA 1A46H 4AN7A 3PLPA 4WH8A 2Q6GA 3QK1A 2P16A 2W7UA 2OQ5A 2AIQA 2QIQA 3UY9A 1QRZA 1B0FA 1C5YB 4UFGH 4JZFH 2ZDNA 1QBOA 1TNJA 2F9NA 1BDAA 1FAXA 1P8VC 1DWEH 3ODFA 3TITA 1ZSJA 3KIDU 3H5CB 2Z9IA 3PMJA 4HTCH 1A3BH 1LHDH 4HZHA 4KGAA 4KTCA 4O97A 2HGTH 1MAYA 3Q00A 2BQ6B 2FX6A 3M7TA 3F68H 1O32A 2PKSB 3E16B 1GI1A 2J2UA 2WPIS 1BTWA 1EPTC 1V6DA 3BTTE 1O5CB 1TGBA 1FY8E 1EQ9A 5ESTE 5CMXH 1T4UH 3UQVA 1O0DH 3W94A 4AYYB 5JPMH 1YCPH 3LJJA 4JZEH 1O5GH 2BD2A 2GZ7A 4INLA 2V35A 1PQ5A 1GDUA 1PPEE 4MNVA 1ZMNA 1F5RA 1O2MA 2QC2A 1QBVH 1EAIA 1K1JA 1Y3YA 1AWFH 2QAAA 1ZYOA 2ZDVH 3SW2B 4HFPB 5GCHF 1C5OH 4OGYA 4KKDA 2BD8A 2ZZUH 3DUXH 3HK3B 4O3TA 1VR1H 1C1TA 1C5ZB 1Z8IB 2SNVA 2OUAA 2XCFA 5EW2H 1O2LA 1BQYA 7ESTE 1C5VA 1KLIH 4ABDA 1SLUB 2EA3A 1GBDA 1MD8A 1O2KA 5JB9S 1XXFA 1W2KH 2ZCKP 3CS7A 1DUAA 3AAUA 4NA9H 5EPYA 1YPMH 1MCTA 1SQTA 3A7WA 2A7HA 1MBQA 3AASA 3VPKA 1KXEA 5EXMA 1G9IE 1HIAB 1LVMA 5AVDA 3MOCA 1AKSB 4NG9H 4RN6A 1FIZA 4JZDH 3E0NB 1GVLA 5DG6A 4NA8A 1O3AA 3ZV9A 2W5EA 3GCNA 1AFEH 2HALA 2PSXA 1J8AA 3FP8E 3GY6A 5BRRE 3ELAH 1V2LT 2ZHEH 5I25A 2DE9A 3RM2H 1ELDE 2Q1JA 3H7TA 4JMYA 1RTLA 1G37A 4NZLA 2NU3E 3ATLA 1ZHPA 1A5IA 4IC5A 1QB9A 2ZC9H 1TIOA 2IOTA 1O2IA 2ZU3A 1S83A 3UWJH 1EPTA 1RGQA 2ASUB 1BTPA 2OBQA 5EQRA 4H6TA 1N8OC 1TNGA 3KGPA 5DK1A 1O2QA 4CH8B 4ABJA 2XC4A 3KN2A 2SGFE 3HKIB 1UTQA 4U01A 1OWEA 1HJAC 1AFQC 2BVXH 1C5NH 4NZQA 2B8OH 4Y8ZA 1Y3UA 4NA7A 1S81A 1G32B 1CU1A 1GBJA 2LPRA 1ZHRA 1AD8H 3DD2H 1CHOF 3ATWA 1FMGA 1LMWB 1YLCA 1ANDA 1P0SH 1MKWK 4GPGA 5JDUB 5JBCS 2WYGA 3EGKH 3UOUA 1NS3A 1TNLA 2FI5E 1IQNA 2BDYA 1RIWB 3RXVA 4Y0ZE 3BTDE 1F0TA 2I6QA 3E1XB 1N6XA 3SUFA 2ZU4A 2ZQ2A 3SJ8A 1E34B 4JCNA 1P2KA 3SI4H 1NRSH 1YBWA 1KXFA 1INCA 1W12U 1LHEH 1QRWA 5E0GA 1HDTH 1ANEA 1NZQH 2Y82A 3A82A 1FPHH 3HGPA 2FLBH 2BLQA 4YZUA 2FPZA 3F9EA 5JYIA 1XM1A 1O2VA 1XUHA 1LQDB 2XWBI 2XNIA 3U8TH 3PB1E 1MTUA 2SGEE 2ANKH 2STAE 1TQ0B 2FWWA 2GCHF 3U8RH 1TLDA 1F0UA 2TGPZ 1NU9A 3TJUA 1HAGE 1YLDA 1HIAA 1O3CA 1BCUH 1NO9H 1QCPA 2VGCC 2Y80A 4A6LA 2RCEA 1AUTC 1QA7A 5I46H 1W10U 6GCHG 2ZIQH 3SNDA 2RA0A 1OSSA 4FUBA 5ABWA 3PMHB 1SPJA 4JZ1A 4UONA 4A1XA 1S6FA 1S84A 4WMFA 4OS4A 2BD3A 4X8TH 4BXWA 4DY7B 1XVMA 2PR3A 4FXGH 1WV7H 1EXFA 1G30B 1LDTT 1ZHMA 1C1NA 1ARCA 4ISHH 2FP7B 1XKBC 1H8DH 2BDCA 3IWMA 3SNEA 1XUJA 1C5QA 1GBFA 1PPZA 1F5KU 1C5XB 1K1IA 3EDXB 1ELCA 3UQOA 2H5CA 1GJ8B 5L2YH 1PYTD 1NROH 4NFEA 1EZQA 4NCYA 2P8OC 4OS7A 3BEUA 5FCRA 3TJNA 4AFQA 1AVXA 2FIRH 1C2DA 1MU6B 1BMMH 1RXPA 2CMYA 1ORFA 3A84A 2XW9A 2THFB 3B9FH 2C8XB 1CO7E 3ZVCA 3PWBA 1O3MA 2BY6X 2OBOA 4Y7BA 2XC0A 2Z7FE 3HATH 1IQLA 1AU8A 1PQAA 3LC3A 1A5GH 5T6GA 4YO9A 1T4VH 1YGCH 5TJXA 3NCLA 5GXPA 2B0FA 4AX9H 1BA8B 1C2IA 4Q80A 2D2DA 1QR3E 4D7FA 1GMCG 2CV3A 2FOCA 4Q7ZA 3SHCH 4INKA 4R0IA 1O5DH 3B23B 1UTJA 1NC6A 2VVCA 1OWHA 5FBIA 1GHAF 3EA8A 4GSOA 2V3HH 3STJA 1PPHE 4A5TS 3A8BA 1C2LA 5AFZH 1J16A 1FY1A 2EI8A 2TPIZ 1O3DA 5GJ4B 2G8TA 1O38A 2BD9A 3ZZAA 3AVZA 1DWDH 1EJMA 2VB0A 2RA3A 5E8EH 2B7DH 6GCHF 1QB1A 2A0QB 2VJ1A 3BTFE 2G5VA 2GZ9A 3LH3A 2Z9JA 3BG8A 1G3CA 5EODA 3A83A 4CHAB 2BD7A 3SQEE 4HI3A 3QX5H 1LKAA 1Z1IA 1C5UA 1GDNA 1Y3VA 2R3YA 2J34A 3K9XB 2BB4A 1O2GH 1TRMA 5CHAB 1DOJA 4Y71A 4O3UA 3SNCA 2WPLS 1MBMA 1OWKA 4AGKA 1GMDG 1KLJH 1SVPA 3H7OA 1C9TA 1V2RT 2BLVA 2JETB 4ZKSU 1SHHB 1ETTH 3BG4B 2G81E 1FAKH 1D9IA 1F5LA 1NRRH 2G52A 5DP3A 1S6HA 1P09A 1EJNA 2XXLA 5ESBA 1DWCH 5A2MH 2FS9A 3LT3A 1KTTB 1Y3XA 2OTVA 3A7VA 4JZIA 3UR6A 4M7GA 3GDUA 1SFIA 2OLGA 2ZTXA 3RMOH 1GDQA 2R2WU 1J14A 3HGNA 4I7YH 2G5NA 7KMEH 1MKXH 2PUXB 2KAIB 1U6QA 1P10A 2F9UA 1DDJA 1D3QB 1KYNA 2W3IA 1C5SA 3KQBA 3M7QA 1GJ9B 1FY5A 2OC7A 2A45B 3BIUH 5LPRA 3S9BA 1BTZA 2QV1A 1V2UT 3GCTG 1GVZA 1OXGA 1GBCA 2XCNA 5E2OA 2A1DB 4YLQH 1UTMA 1RJXB 1DANH 1QNJA 1ESBA 2HOBA 2ZI2H 1HGTH 1AN1E 3LIWA 2CJIA 1O2TA 2P3FH 2WINI 3GY3A 1EAWA 1C1OA 3SV8A 1UMAH 3OY6U 2UUYA 1L2EA 4MQAA 4IMQA 1K21H 5DP9A 3L6PA 2XYAA 3SJKA 3VGCB 1CA0C 1S5SA 3S9CA 1W0ZU 3UR9A 2FESH 3FAOA 1BRUP 2FLRH 3A8AA 3BN9A 2QXHA 3MH5A 1GHBG 3F1SB 3WY8A 1P2MA 2FI4E 4JK5A 1DLEA 3Q3XA 1GBBA 1YYY1 1JRSA 2CGAA 2GCTC 3EYDA 1C1QA 1TMTH 2BVSH 4O9VA 4NFFA 3DA9B 4WWYA 1YPJH 1O2JA 2BVRH 4A92A 5TCAA 1KXAA 4AB9A 1TWXB 1UVPA 3NUMA 4DCDA 2VIOA 3P8FA 3SGQE 3BTKE 3S69A 2VIWA 3M5LA 1G2MA 1AE5A 2GTBA 4A1VA 3ZVGA 2GCTB 1QURH 2P93A 3E3TA 1HAPH 1TRYA 4XE4A 2NU2E 2V3OH 2BZAA 3ZZCA 1O3JA 1Z7KA 1EUFA 2ZTZA 3A87A 2Q6DA 4GHTA 2F83A 2V6NA 3M5NA 5ETXA 5GWZA 1K28D 1YCPM 3M5OA 1MUEB 1THPB 1IQGA 4FUJA 1GJ5H 1V2ST 4UFEH 1C1WH 3V7TA 1EZXC 1TABE 2VVVA 3CS0A 2GV6A 3RDZA 1ZGVA 2FTLE 3TU7H 3SU2A 3QLPH 3JZ2B 2ULLA 1SFQB 2G51A 3ESTA 1T8NA 2V0BA 3IG6B 4I33A 2GGVB 1TPOA 1W11U 4Y11E 3ZZ4A 2HPPH 3GYLB 2BY7X 4NIVA 2GVFA 1D3DB 3O8RA 5C1YA 5HGGA 2ZG0H 2BLOA 3SU4A 2D8WA 3TNSA 5EXLA 4WMDA 2F9VA 4FU9A 4Y8YA 2KAIA 4JYTA 1PJPA 2AS9A 3M5MA 1IQMA 3MO9A 1O2ZA 1JMOH 1SGFA 2J95A 1CBWB 1GI0A 2P59A 3I77A 4NSYA 5F8XA 1EATA 1L0ZA 4FUHA 4GVUA 3K6YA 2AGGX 2WV5A 2VWOA 3PROA 3ENSB 4CR5A 2ZU2A 3SV2H 1V2QT 3VB6A 1CSOE 9LPRA 4ABFA 2YNAA 1FY3A 3PM3A 4Y10E 3MU1A 5HYOA 1DUEA 2G4UA 2ZDAH 3U98H 2Q6FA 1HAZB 1Y59T 3ZZBA 2ZA5A 7LPRA 1P57B 5F8ZA 1PYTC 1HAVB 1PQ8A 1UVUH 2A5IA 3SO3A 1ZPZA 4RKJB 4H4FA 4K8BA 1A2CH 1HLTH 2OD3B 2GDEH 1HAXB 3MNSA 3RXDA 5EOKA 3ZV8A 5PTPA 3I29A 2VIVA 4J1YA 4YESB 4ZKNU 1FONA 1ZR0A 2VINA 5H4IB 1G36A 3A7TA 1AB9B 3NXPA 1O2NA 2AMDA 4J2YB 1A1RA 1GI2A 1SOTA 5T6FA 1O5AB 2Z6BD 2ZGHA 2Y5HA 4OS1A 1B5GH 4Y6DA 2A4OA 1YPEH 3ZYDA 1DFPA 3DFJA 4IN1A 4Y7AA 4H6SB 3PO1B 3RXFA 3PV4A 2ZFFH 1O31A 4DGJA 4MPUA 2A5AA 1WCZA 1YCPK 1ZPCA 1HAYB 2PKSC 4FUEA 2ZEBA 1E37B 1MQ6A 1GMHG 2UUKB 4X8VH 5CHAC 1LHFH 1N1LA 1D3PB 3IITA 3F9GA 1OPHB 4MVNA 3RXQA 4FU7A 1GMCF 3TGJE 1TPAE 1SI5H 3M7UA 2WPHS 3MWIU 3RU4T 1EP6A 4ZAEA 1UHBB 1GBKA 2J38A 4BOHA 1TA6A 4X6NA 3GCHC 3FP6E 5TCCA 2FODA 1O3BA 1SGFG 1PPFE 4K1SA 2CXVA 1H9IE 1UVOA 2PTNA 3KHVA 3EAJA 1CQQA 2DE8A 2Z9KA 1XMNB 1MMJN 1IHSH 1B7XB 3GCTF 3GCHB 1QJ6B 2ZP0H 1J15A 1QTFA 3KQEA 5LPEA 3RU4E 3NZIA 1VGCC 1W0YH 1GCDA 1NTPA 1XVOA 1Y5UT 1O34A 1L4DA 2TBSA 1ETRH 3BEFB 2BD5A 5EXNA 4X1RU 9ESTA 5EU8A 2G00A 4Q7XA 3VEQB 4ZXYH 1NRNH 2Y7ZA 3K65B 4LZ1H 2BDAA 2QA9E 1GHXH 2GKVE 1A7SA 4XBDA 1GJ7B 3R0FA 1GGDC 4E05H 3SU6A 4D9QA 1C5TA 2EI6A 1O3NA 1IQIA 2OQUA 4U2WA 2ZPQA 3MI4A 4MPVA 1WQSA 1HRTH 4CR9A 1BMAA 2A5KA 2G55A 3RC6A 3M3VA 1H9HE 3ZVBA 3FZZA 6LPRA 1AFQB 1V2PT 2BZ6H 2P95A 4AYVB 2SFAA 1V2JT 1O2XA 1EAXA 3RP2A 4BNRA 4IMZA 4KTSA 4RKOB 1O3OA 3RXTA 1C5PA 3BSQA 1P2JA 1ZOMA 3P8GA 4K1EA 1A0HB 1C5LH 3LPRA 1Z8GA 3NKKA 1GHYH 3LGYA 1TRNA 4AG2A 4E06H 1C4U2 4Y76A 2OP9A 4TY7A 1SGPE 4TPYA 1GI3A 4I8LA 8KME2 1TMUH 2FOBA 3V12A 3SI3H 4FUDA 1Y5BT 1HXFH 1LPZB 2BXTH 2XWAA 1OP0A 1DE7H 1ZTKA 1BUIA 4DIHH 3SORA 1SMFE 5DP6A 6CHAB 4X8UH 1ZLRA 2TGDA 3RXSA 1P3EA 5A0BA 1UJ1A 2BD4A 1W7GH 3AW0A 1GG6B 2GMTC 2SGPE 3A80A 3MNXA 1ID5H 4GUXA 1TONA 1B0EA 1RFNA 1S85A 3KNXA 2K1QA 1DY9A 3PLKA 3TK5A 3ZZ9A 2ZFRH 1K9OE 4CBOA 1AVGH 2O8LA 2HNTE 2H9HA 2F9OA 2OINA 4OS6A 2BTCE 1P2QA 3BTQE 4B74A 1J9CH 1IQFA 1TX7A 2ZHQH 1WTHD 3VGCC 1O5BB 4LOYH 4CREA 3VB4A 2FOEA 5C3NA 1YM0A 4MLFB 3RXAA 4IS5A 2Z9LA 4NWLA 5L2ZH 4XBCA 4ZHLU 3HK6B 3OU0A 1UK4A 3MO6A 4TY6A 1FPCH 4MNWA 3RUOA 1RIWC 5DP5A 1EJAA 1FN8A 3QUMP 1EZSC 2ZU1A 4NIWA 2Z94A 2J4IA 1JOUB 2HVXA 2ANMH 1ARBA 4WJG2 2BM2A 2UUFB 4GCHG 2PGQB 4X1SU 1G3EA 3M37A 4YT6H 4BAOB 2O8WA 4UDWH 1L1JA 2J94A 1XUIA 3LDXH 3NWUA 4X6OA 4XBBA 1AE8H 1O33A 1YF4A 1FI8A 3VB5A 2R0LA 2FM2A 3OTJE 1ZZZA 3ZZ8A 3T27A 1GGDB 1H4WA 1ETSH 2ZU5A 4XFQA 5FX6A 4DW2U 3BTWE 1AKSA
chains in the Genus database with same CATH superfamily
1AHTH 1QZ8A 3SNAA 2R9PA 4BAMB 1HCGA 1MAXA 1O2PA 1E36B 1UCYH 2IN2A 3LOXA 3NRLA 2W7SA 1QB6A 3ZVAA 3MH7A 5IYTA 4FUCA 2OC0A 2A7JA 3SU1A 5AFYH 4CRBA 2EI7A 4Y0YE 3ZZ3A 1KY9A 2HPQH 2K8IA 3GYMA 3QTOH 1DXWA 3MO3A 1O5FH 3E91A 2XTTB 1O2OA 3RXBA 5F03A 3BTHE 3EA7A 3MMGA 4BAHB 1TX6A 1SGRE 3UOPA 1TGTA 4A7IB 5E0HA 3KQCA 1DSTA 1NN6A 2BY5X 2FEQH 3OEHD 4X1QU 1O3GA 2FDAA 3LC5A 2JH5D 3RXOA 4SGAE 1GJBB 2BMGB 5AHGH 4WMEA 1P03A 1SSXA 2BOHB 5C20A 2NWNA 2ILNA 3G01A 8GCHF 2EY4C 4Q2KA 4DT4A 1T31A 3T2NA 1THRH 1ZTJA 3EE0B 1G3DA 3F6UH 1GHAG 3GDSA 4GLYA 1DM4B 3SUDA 1C1VH 1WUNH 2JETC 3O8BA 3SUEA 4CRFA 1P2IA 4X0WU 3S7HB 3TIUA 4CRDA 1BMFD 4ABGA 1BRBE 1ELTA 4OM9A 1QA0A 3ODDA 1TOCB 1FIWA 1SGEE 4JK6A 1C2JA 4OS5A 3DSGA 1UTPA 5DP7A 1WTGH 4CRCA 4ACAA 1A61H 2K0QA 2QGRA 3GICB 3RXUA 2PP6A 3M36A 4LZ4B 2ZPRA 4PROA 1ESAA 2NU4E 4ISLA 3QZQA 1P2OA 3Q77A 1SHYA 4X1PU 2GMTB 3SZNA 3P8NA 4MG3A 3PYHA 4YLUA 1WYKA 1AUJA 4XRNA 4Z0KA 2IJOB 5HM9A 2Y81A 5C5OA 5C67A 5IK2D 3U8OH 1AI8H 4AFSA 3S0NA 3ZVEA 2HWLB 4ABBA 2GX4A 2A4QA 1Y8TA 1COWD 1SLXB 3SJIA 2SGDE 1ZRKA 2AMPA 1GL0E 2H9EH 3L3TA 3QO6A 1CE5A 1GI4A 3Q76A 2A32A 2H1UA 1L4ZA 1CBWC 3UPEA 4YTAA 2VIQA 2VIDA 1O30A 2WUBA 3P17H 3LH1A 1NT1A 1BZXE 1GCTB 1JBUH 3DSOA 2ZFSA 2GJGA 3VFEA 3RC4A 2ZDMA 4X6MA 5FAHA 1HAVA 4IBLH 3LONA 2FXRA 2XBXA 3WWBA 3U9AH 4ABEA 1D6RA 1SBWA 2CHAC 4NIYA 1V3XA 2F3CE 1GL1A 2P94A 2SGAA 1O2UA 2XRCA 1ZPBA 1YPHE 1NFUA 5FPYA 1SGQE 3RMNH 1HBTH 3UB0A 3U69H 1CT0E 4MPWA 3UIRA 4YOGA 2F9PA 3TPIZ 2D1JA 4IN2A 2ZF0H 1TNKA 5KGOA 1YPKH 3SBKA 3MU4A 4ISIH 2EC9H 3I78A 1GMHF 2ZPSA 1AZZA 1E35B 1BBRK 1PQ7A 2UWPA 3FANA 4X1NU 2C90B 3GY2A 3MYWA 4TWYA 1D4PB 4DT7B 1EPTB 1QRXA 1VCWA 5DGJA 1P12E 1D3TB 1NRPH 3T28A 2ODQA 5DO4H 1TGNA 1TAWA 2A31A 4OGXA 3AAVA 4B2BA 1IQHA 1MH0A 2ZGJA 1C2HA 1WBGB 3A81A 2CN0H 4RSPA 4F49A 2VWLA 5DSFA 1SB1H 3FZDA 1HAOH 5EG4A 1GBHA 1BTXA 2CHAB 3SU5A 3STIA 3PTNA 3BTME 4AFZA 2ZQ1A 1EOJA 1SLVB 3RMLH 4FVDA 1MZDA 1AGJA 1NY22 3RXPA 2QF3A 1MCVA 3F2FA 2NU1E 1UO6A 1F0SA 4P00A 4GHQA 1JXPA 4X2VA 3TVJB 4WH6A 4UEHH 2SNWA 5DKMA 2H5DA 4CBNA 3LGTA 1TBZH 3PMAB 3PTBA 1O3LA 1GHVH 2O8MA 3T62A 2Y6TA 2QE7D 1DXPA 2J92A 1CGIE 1WOFA 4TT3D 1HPGA 4X2YA 1AZ8A 4ZH8A 1TBQH 4AZ2B 4ZCNA 1A5HA 4E7RG 1P2NA 2ZGCA 1DICA 4WXIA 1P9UA 1UVSH 2GP9B 3A7YA 3P70B 5BPEA 5A8XA 5EQQA 3ZVFA 1QIXB 4BXSA 3EE7A 2C8ZB 4ZROA 3UFAA 4LK4A 4K69A 2LELA 2TGAA 3SV9A 3B8JA 2R0KA 1SGTA 2WPKS 3TH2H 3UAIC 1LTOA 3KCGH 4ABAA 2HLCA 3DHKH 4ZHAA 4M9FA 3RXRA 5HXFA 3GOVB 1TMBH 1MU8B 1BIOA 3TLOA 3JZ1B 5LH8A 2WZQA 3K2UA 3Q3KA 1JIMA 4FUFA 2PKAB 1KXCA 2TGTA 4I8JA 1C2FA 3QDZB 1RD3B 2RDEA 1KDQB 1BT7A 1V2VT 3MU8A 2J9NA 1ZJKA 2Y5GA 1HV7A 1GJ6A 3BTGE 1W13U 1Z6JH 2QF5A 3TNTA 1O3KA 4DIIH 2Y5FA 1ZMLA 4K60A 1H8IH 1T8LA 2QF0A 5EPNA 2KCAA 1QQUA 2F43B 1FZZA 1LVYA 1K22H 2ESTE 2GT7A 1MTVA 2OCVB 1JIRA 1BB0B 1ABIH 2AYWA 2Z3DA 1SGYE 1THSH 2ZDLA 4MNXA 3FP7E 2OC1A 2PWXA 2V3MA 2HVYB 4AGJA 1WSSH 3SN8A 1CGHA 3KEEA 5C1UA 2IPHA 1Q2WA 5FCKA 2EEKA 1TB6H 4ABHA 1W7XH 4Y8XA 3E6PH 3TK6A 6CHAC 4D7GA 3OX7U 3FVFB 4ISOA 1F0RA 1LKBA 4I31A 2C8YB 1WU1A 1GVKB 2JH0D 3LU9B 1LHCH 1QGFA 1BTUA 1EKBB 1MZAA 2XBYA 3QGNB 5JBBS 3F2HA 2PUQH 2VWMA 3CP7A 2O8TA 5FXLA 4B1TA 2O9QA 2FOGA 1SGIB 3RLWH 2ZDKA 1O3FA 3N7OA 3RXCA 1SQRA 1EB1H 2AGIX 4KP0A 1VGCB 1UTOA 2FS8A 4OS2A 2ODPA 3LKWA 3V0XA 3QN7A 4K2YA 5SGAE 4BANB 1C9PA 1EAUA 4FUGA 4ASHA 5DP4A 4B2CA 1O2HA 4ESTE 3ZZDA 4CHAC 2SGQE 2QXGA 2OC8A 1Y5AT 2R2MB 1BHXF 3SV6A 3BEIB 1GI9B 2TRMA 1DT2A 5A0CA 1DVAH 1C2MA 1QL9A 1HJAB 3VXFH 1KLTA 1MQ5A 1O2YA 1Z6EA 5T6DA 3VB7A 1A4WH 1P02A 5E2PA 2PTCE 4A1TA 3C27B 2WPJS 2ZHDA 1C5RA 4ZHMU 4DJZB 3GY7A 1EX3A 1ZGIA 2FTMA 1XXDA 1UHBA 1AY6H 2H6MA 1EFRD 2P3UB 4MPXA 3FKSD 4MNYA 3SJOA 1YKTA 1OYQA 3GY8A 2WV4A 1YPLH 3RXJA 1TALA 1JWTA 5CE1A 4BTIB 1HAIH 1KDQA 5JB8S 1EOLA 1S82A 1FLEE 1ELGA 4U30A 4H42U 1LVOA 3GISB 1V2TT 1TE0A 1ZRBA 2GV7A 1W14U 2Z3EA 3S9AA 2R3UA 3F3BA 1OWJA 1TX8A 1OOKB 3W1EA 4B2AA 3BG4C 1XUGA 1YPGH 1YPHC 2L6OA 2ZGBH 1UCYE 2ZCLP 3MNCA 5T3HA 3MH4A 1P11E 4GAWA 1L1NA 2C3SA 1A0JA 3TK9A 3UREA 4Y79A 1C5MD 3SHAH 1Z71A 1S0QA 1DSUA 3ZZ6A 1TA2A 1RS0A 1C1UH 3ATMA 2W3KA 4Z6AH 2Y7XA 2QY0B 4WF8A 3URDA 4BAQB 1S0RA 1GCTC 1C4Y2 5EIYA 1L1GA 2WPMS 3P6ZB 5DP8A 2PV9B 4B73A 5JBTA 3V3MA 1TNIA 3P92A 1OHHD 4ASUD 1SGNE 1CHOG 1BBRE 1VCPA 2JH6D 2VU8E 2PKAA 1BBRH 3NK8A 1CA8B 2PW8H 1FQ3A 1P9SA 4ZXXH 2XBVA 1UK3A 3ZVDA 1NM6A 1O39A 3AW1A 3DT0H 1DWBH 2ZFPH 2OXSA 2FOHA 2VH0A 1O3PB 3PWCA 4YOIA 3TH4H 1QQ4A 2AH4X 4AC9A 1Q31A 2ZTYA 2BY8X 4NSVA 1SGDE 3TJOA 1T8MA 5JBAS 2TIOA 4ZKRU 1SC8U 2CF8H 2PHBA 2VIPA 5KEDA 3TGIE 3N7DA 2ANWA 1AMHA 5F53A 3ZZ7A 1VITH 2BDGA 1GBMA 5J4QA 1GG6C 4BTUB 1E0FD 1BTHH 1WQVH 1V2KT 2BDIA 2FZZA 3SGBE 4QT8C 1D6WA 3GY5A 1AWHB 1NBME 2BOKA 5K7RA 5C2ZA 1VITG 1LPGB 2KR7A 2F91A 3EQ0H 4BTTB 1V2WT 3F0PA 1AIXH 1K2I1 2BQWB 2VH6A 4DVAU 1K1LA 1SOZA 1IQJA 1BOQA 3MHWU 2YNBA 2ZCHP 2D26C 2A4GA 2ZFQH 1VCQA 3A89A 2HNTC 1NRQH 3TH3H 1MTWA 1J17T 1QFKH 3WWFA 3LGVA 1TYNA 3M3SA 1T8OA 4I8HA 1JRTA 1OS8A 3KQDA 5LGOA 1C2GA 1GI8B 5GDSH 3UNQA 2BX3A 1UTKA 1O2SA 1NU7B 3CENA 2DUCA 1H9LB 1UCYK 3A8CA 3W95A 1KTSB 2QXIA 4ABIA 2BQ7B 1O2WA 3VXEH 2QYIA 1LCYA 3HPTB 3F9HA 3M61U 2OK5A 3ITIA 1FUJA 1G2LA 1F92A 2BY9X 2PGBB 3PLBA 4HG6A 1DPOA 3SU0A 1NFWA 1N6YA 1X7AC 3PMBB 4YM9A 1RTKA 5FPSA 2H2ZA 2A7CA 1Z8JB 2NU0E 5DPAA 4YT7H 1F7ZA 2Z9GA 3EA9A 2ZHWH 2XC5A 5GCHG 3L33A 1EB2A 1AB9C 1O2RA 1QBNA 4X8SH 2BDHA 4WY3A 1CGJE 4WXVA 1BRAA 2W26A 1C2EA 1M9UA 3MTYA 4UE7H 1VITF 3D62A 3E0PB 4ISNA 3SUGA 5AF9H 5DJ7A 1ZSLA 1ABJH 2ZWLH 2AMQA 2VGCB 7GCHG 2I6SA 3VB3A 1G3BA 1H8ED 1EASA 2STBE 3A7ZA 1GPZA 3OYPA 1C1RA 3A86A 1HJ8A 4K5ZA 4DOQA 3A7XA 5EJZA 3UWIA 3M35A 2F9BH 5FBEA 4XDEA 2FYRA 4CRGA 3WW7A 1BMLA 3AK5A 1TQ7B 3F9FA 2H9TH 2Z3CA 3KF2A 3UNRA 1GJAB 2WUCA 1IQEA 1GJDB 1GHWH 2HNTF 2VWNA 1BHXB 3PV2A 1SL3A 3N99A 4X6PA 2ODYB 1HNEE 1Z8RA 2LP6A 3LJOA 3MU0A 2LNCA 4TYDA 1XX9A 2C8WB 1OP2A 1N8OB 4B71A 4UFFH 2FI3E 2RG3A 3ZZ5A 1ACBE 1ELAA 1YP9A 1P01A 1S6LA 1KXDA 3ATIA 5C1XA 1YC0A 1LO6A 1RTFB 2ZECA 1F2SE 3U1JB 1CHGA 5A8YA 2O8UA 3D65E 4X2XA 3O8CA 1XUFA 5E0JA 1ANCA 8GCHG 1ZMJA 2AIPA 3OSYA 3U1IB 1GMDF 4TWWA 1OWDA 3QZRA 1Q3XA 2ALVA 1A0LA 2JIZD 4I8KA 3RU4D 4FU8A 4WVPE 1UK2A 3T29A 4JYUH 2J5UA 4TPIZ 2F4LA 4SGBE 1C1PA 5G4BA 1MABB 2VNTA 4B75A 2ZGXH 1DITH 1UTNA 2AGEX 5K0HA 1CVWH 1MTNC 8LPRA 5J4SA 5FPTA 1XKAC 2AEIH 5GIBA 1IAUA 1VJ9U 4YOJA 1NFYA 3GY4A 1ANBA 2HRVA 5LPFA 1K1OA 4NGAH 4O03A 8ESTE 2PSYA 3RM0H 1FNIA 2PLXA 4U32A 4Q4LA 4MDSA 1EP5A 1C1SA 1PFXC 2GT8A 5HM2A 5GPIB 1BMNH 2A2XH 1SGCA 3P8OA 3SGAE 2WYJA 3E90B 2BYAX 4JYVH 1W3CA 1PPBH 1FX0B 1PPGE 3D49H 1C5WB 4VGCB 1OP8A 3S7KB 1H1BA 1TPSA 2EQNA 1GI7B 4KELA 2B9LA 4R8TB 2C93B 1GWAA 1HJ9A 1GBAA 1P04A 2YOLA 4UD9H 1HFDA 1P05A 3KL6A 3URCA 3A85A 1GHBF 3PO1C 3Q3YA 1C1MA 1C4V2 3FFGA 1CA0B 4VGCC 3ATKA 3TGKE 1LQEA 1O36A 3M3TA 3C1KA 1MKXK 1DY8A 1VKYA 2FOMB 2BDBA 4HGCA 3SV7A 1QJ1B 1HAHH 1KXBA 2RDLA 4UFDH 4CH2B 2IJD1 1T32A 1GI6A 3LGWA 4GCHF 2AERH 2FX4A 1O3HA 1HUTH 5A0AE 1OYTH 1P3CA 1T7CA 4I8GA 4FVBA 1TPPA 2JKHA 1MTSA 3BTEE 4YXWD 2BHGA 2KFWA 4AOQA 1BITA 4AG1A 4K1TA 1P06A 2GD4B 3MNBA 4NIXA 5A09A 1ZTLA 2P8OB 2WHXA 3R3GB 3RXHA 1TFXA 3RXLA 1BJUA 3QGJA 3SQHE 3RXKA 3UUZA 1LHGH 1MKWH 2FO9A 3A8DA 1C2KA 2ALPA 3MFJA 3RXEA 3U28C 3RC5A 1LVBA 1IOEA 1SG8B 3HKJB 3D23A 5EQSA 3TJVA 2FMJA 2VVUA 4FUIA 3KYFA 4BAKB 3P95A 2GDDA 1SR5C 1ELEE 1GHZA 1CT2E 2A4RA 5F8TA 1VJAU 2P3TB 1GI5A 1V2NT 2QCYA 3DFLA 1FY4A 5L6NH 1E38B 1XUKA 3K6ZA 4B76A 3RXGA 2UWOA 3FN8A 3GCOA 1K1MA 1RRKA 2ANYA 3BIVH 4D9RA 2UWLA 1TOMH 1SQOA 2BXUH 4INHA 2J98A 1PPCE 1BRCE 1O3EA 6ESTA 1NESE 1GBTA 3QWCH 1FN6A 1K1NA 5EGMA 1CT4E 2BLWA 2A2QH 1O35A 1NFXA 2ZO3H 3RMMH 5L30H 3MU5A 2G4TA 1FJSA 2AFQB 2ZKSA 3BV9B 1TGSZ 3SOSA 4IW4E 1TNHA 4F4OC 1HXEH 3V13A 1ELVA 2UUJB 2C4FH 2XNDD 1TBRH 1GJ4H 2GCHG 3LGIA 3NPSA 4I32A 2ZNKH 4LXBH 7GCHF 4IGDA 4K3JA 1V2OT 1DX5M 1UVTH 5B6OA 3SU3A 1QL8A 4MTBA 5FHTA 2PFEA 1DS2E 1UTLM 3SJ9A 3T25A 4X2WA 1GBLA 2GZ8A 1W8BH 1V2MT 1SQAA 1KIGH 3ZYEA 4DG4A 1FV9A 1FXYA 4CRAA 5C0UA 1OKXA 3SNBA 4AORA 1FDPA 4THNH 2QN5T 1QY6A 2FOAA 1K1PA 1O5EH 1QL7A 1O37A 4TSFD 1IQKA 2KCOA 2B5TB 5A8ZA 4IC6A 1TGCA 5FX5A 3UTUH 1DLKB 5EW1H 2RFKC 1QHRB 1GJCB 1O3IA 1WAYB 2FYQA 4K8YA 2QXJA 5C5NA 1MTNB 1EZUC 4E7NA 2FOFA 4ACBA 3BF6H 1HYLA 1Y3WA 4ZUHA 1NPMA 3T5FH 5HMAA 2M5TA 2ZHFH 3UNSA 3RXMA 1Z1JA 3E8LA 1ESTA 5IDKA 1E79D 3GDVA 1BJVA 1ZSKA 3OY5U 3QTVH 1LPKB 1QJ7B 3T26A 3MH6A 1KSNA 1IHTH 1OX1A 1ELFA 4AFUA 1GBEA 1SLWB 5HKKD 4D76A 4D8NA 1AO5A 2ZFTA 3RXIA 1OWIA 1A3EH 4NWKA 1HB0B 1VZQH 4KTUA 4ZMAH 4Q7YA 4XOJA 1BTYA 1E1RD 3LGUA 4AB8A 4ZKOU 2XBWA 4RI0A 1MD7A 2JJ2D 1GBIA 3RLYH 1ZJDA 1AQ7A 5F6MA 3O8DA 1ELBA 1AVWA 3A88A 2CF9H 4XSKU 2BX4A 4DURA 1A46H 4AN7A 3PLPA 4WH8A 2Q6GA 3QK1A 2P16A 2W7UA 2OQ5A 2AIQA 2QIQA 3UY9A 1QRZA 1B0FA 4Z1MD 1C5YB 4UFGH 4JZFH 2ZDNA 1QBOA 1TNJA 2F9NA 1BDAA 1FAXA 1P8VC 1DWEH 3ODFA 4RT0A 3TITA 1ZSJA 3KIDU 3H5CB 2Z9IA 3PMJA 4HTCH 1A3BH 1LHDH 4HZHA 4KGAA 4KTCA 4O97A 2HGTH 1MAYA 3Q00A 2BQ6B 2FX6A 3M7TA 3F68H 1O32A 2PKSB 3E16B 1GI1A 2J2UA 2WPIS 1BTWA 1EPTC 1V6DA 3BTTE 1O5CB 1TGBA 4B6EA 1FY8E 1EQ9A 5ESTE 5CMXH 1T4UH 3UQVA 1O0DH 3W94A 4AYYB 5JPMH 1YCPH 3LJJA 2W6JD 4JZEH 1O5GH 2BD2A 2GZ7A 4INLA 2V35A 1PQ5A 1GDUA 1PPEE 4MNVA 1ZMNA 1F5RA 1O2MA 2QC2A 1QBVH 1EAIA 1K1JA 1Y3YA 1AWFH 2QAAA 5C17A 1ZYOA 2ZDVH 3SW2B 4HFPB 5GCHF 1C5OH 1W0KD 4OGYA 4KKDA 2BD8A 2ZZUH 3DUXH 3HK3B 4O3TA 1VR1H 1C1TA 1C5ZB 1Z8IB 2SNVA 2OUAA 2XCFA 5EW2H 1O2LA 1BQYA 7ESTE 1C5VA 1KLIH 4ABDA 1SLUB 2EA3A 1GBDA 1MD8A 1O2KA 5JB9S 1XXFA 1W2KH 2ZCKP 3CS7A 1DUAA 2XOKD 3AAUA 4NA9H 5EPYA 5C94A 1YPMH 1MCTA 1SQTA 3A7WA 2A7HA 1MBQA 3AASA 3VPKA 1KXEA 5EXMA 1G9IE 1HIAB 1LVMA 5AVDA 3MOCA 1AKSB 4NG9H 4RN6A 1FIZA 4JZDH 3E0NB 1GVLA 5DG6A 4NA8A 1O3AA 3ZV9A 3H09A 2W5EA 3GCNA 1AFEH 2HALA 2PSXA 1J8AA 3FP8E 3GY6A 5BRRE 3ELAH 1V2LT 2ZHEH 5I25A 2DE9A 3RM2H 1ELDE 2Q1JA 3H7TA 4JMYA 1RTLA 1G37A 4NZLA 3F0OA 2NU3E 3ATLA 1ZHPA 1A5IA 4IC5A 1QB9A 2ZC9H 1TIOA 2IOTA 1O2IA 2ZU3A 1S83A 3UWJH 2ASUB 1EPTA 1RGQA 1BTPA 2OBQA 5EQRA 4H6TA 1N8OC 1TNGA 3KGPA 3OFND 5DK1A 1O2QA 4CH8B 4ABJA 2XC4A 3KN2A 2SGFE 3HKIB 1UTQA 4U01A 1OWEA 1HJAC 1AFQC 2BVXH 1C5NH 4NZQA 2B8OH 2AHME 4Y8ZA 1Y3UA 4NA7A 1S81A 1G32B 1CU1A 1GBJA 3KQ5A 2LPRA 1ZHRA 1AD8H 3DD2H 1CHOF 3ATWA 1FMGA 1LMWB 1YLCA 1ANDA 1P0SH 1MKWK 1WDIA 4GPGA 5JDUB 5JBCS 2WYGA 3EGKH 3UOUA 1NS3A 1TNLA 2FI5E 1IQNA 2BDYA 1RIWB 3RXVA 4Y0ZE 3BTDE 1F0TA 2I6QA 3E1XB 1N6XA 3SUFA 2ZU4A 2ZQ2A 3SJ8A 1E34B 4JCNA 1P2KA 4RT1A 3SI4H 1NRSH 1YBWA 1KXFA 1INCA 1W12U 1LHEH 1QRWA 5E0GA 1HDTH 1ANEA 1NZQH 2Y82A 3A82A 1FPHH 3HGPA 2FLBH 2BLQA 4YZUA 2KM0A 2FPZA 3F9EA 5JYIA 1XM1A 1O2VA 1XUHA 1LQDB 2XWBI 2XNIA 3U8TH 2QF4A 3PB1E 1MTUA 2SGEE 2ANKH 2STAE 1TQ0B 2FWWA 2GCHF 3CNRA 3U8RH 1TLDA 1F0UA 2TGPZ 1NU9A 3TJUA 1HAGE 1YLDA 1HIAA 1O3CA 5C0TA 1BCUH 1NO9H 1QCPA 2VGCC 2Y80A 4A6LA 2RCEA 1AUTC 1QA7A 2J97A 5I46H 1W10U 6GCHG 2ZIQH 3SNDA 2RA0A 1OSSA 4FUBA 5ABWA 3PMHB 1SPJA 4JZ1A 4UONA 4A1XA 1S6FA 1S84A 4WMFA 4OS4A 2BD3A 4X8TH 4BXWA 4DY7B 1XVMA 2PR3A 4FXGH 1WV7H 1EXFA 1G30B 1LDTT 1ZHMA 1C1NA 1ARCA 4ISHH 2FP7B 1XKBC 1H8DH 2BDCA 3IWMA 3SNEA 1XUJA 1C5QA 1GBFA 1PPZA 1F5KU 1C5XB 1K1IA 3EDXB 1ELCA 3UQOA 2H5CA 1GJ8B 5L2YH 5HIZA 1PYTD 1NROH 4NFEA 1EZQA 4NCYA 2P8OC 4OS7A 3BEUA 1YLNA 5FCRA 3TJNA 4AFQA 1AVXA 2FIRH 1C2DA 1MU6B 1BMMH 1RXPA 2CMYA 1ORFA 3A84A 2XW9A 2YMSD 2THFB 3B9FH 1K0HA 2C8XB 1CO7E 3ZVCA 2JDID 3PWBA 1O3MA 2BY6X 2OBOA 4Y7BA 2XC0A 2Z7FE 3HATH 1IQLA 1AU8A 1PQAA 3LC3A 1A5GH 5T6GA 4YO9A 4Q63A 1T4VH 1YGCH 5TJXA 3NCLA 5GXPA 2B0FA 4AX9H 1BA8B 1C2IA 4Q80A 2D2DA 1QR3E 4D7FA 1GMCG 2CV3A 2FOCA 4Q7ZA 3SHCH 4INKA 4R0IA 1O5DH 3B23B 2WV9A 1UTJA 2VBCA 1NC6A 1YY3A 2VVCA 5EJ1A 5KECA 1OWHA 5FBIA 1GHAF 3EA8A 4GSOA 2V3HH 3STJA 1PPHE 4A5TS 2JJ1D 3A8BA 1C2LA 5AFZH 1J16A 1FY1A 2EI8A 2TPIZ 1O3DA 5GJ4B 2G8TA 1O38A 2BD9A 3ZZAA 3AVZA 1DWDH 1EJMA 2VB0A 3N7EA 2RA3A 5E8EH 2B7DH 6GCHF 1QB1A 2A0QB 2VJ1A 3BTFE 2G5VA 2GZ9A 3LH3A 2Z9JA 3BG8A 1G3CA 5EODA 3A83A 4CHAB 2BD7A 3SQEE 1E1QD 4HI3A 3SYJA 3QX5H 1LKAA 1Z1IA 1C5UA 1GDNA 1Y3VA 2R3YA 2J34A 3K9XB 2BB4A 1O2GH 1TRMA 5CHAB 1DOJA 4Y71A 4O3UA 3SNCA 2WPLS 1MBMA 1OWKA 4AGKA 1GMDG 1KLJH 1SVPA 3H7OA 1C9TA 1V2RT 2BLVA 2JETB 4ZKSU 1SHHB 1NBMD 1ETTH 3BG4B 2G81E 1FAKH 1D9IA 1F5LA 1NRRH 2G52A 5DP3A 3DSPA 1S6HA 1P09A 1EJNA 2XXLA 5ESBA 1DWCH 5A2MH 2FS9A 3LT3A 1KTTB 1Y3XA 5T1VA 2OTVA 3A7VA 4JZIA 3UR6A 4M7GA 3GDUA 1SFIA 2M2AA 2OLGA 2ZTXA 3RMOH 3MQKC 1GDQA 2R2WU 1J14A 3HGNA 4I7YH 2G5NA 1H8HD 7KMEH 1MKXH 2PUXB 2KAIB 1U6QA 1P10A 3DCLA 2F9UA 1DDJA 1D3QB 1KYNA 2W3IA 1C5SA 3KQBA 3M7QA 1GJ9B 1FY5A 2OC7A 2A45B 3BIUH 5LPRA 3S9BA 1BTZA 2QV1A 1V2UT 3GCTG 1GVZA 5CDFE 1OXGA 1GBCA 2XCNA 5E2OA 2A1DB 4YLQH 1UTMA 1RJXB 1DANH 1QNJA 4FETA 1ESBA 2HOBA 2ZI2H 1HGTH 1AN1E 3LIWA 2CJIA 3FOAA 1O2TA 2P3FH 2WINI 3GY3A 1EAWA 1C1OA 3SV8A 1UMAH 3OY6U 2UUYA 4F48B 1L2EA 4MQAA 4IMQA 1K21H 5DP9A 3L6PA 2XYAA 3SJKA 3VGCB 1CA0C 1S5SA 3S9CA 1W0ZU 3UR9A 2FESH 2L74A 3FAOA 5DN6D 1BRUP 2FLRH 3A8AA 3BN9A 2QXHA 3MH5A 1GHBG 3F1SB 3WY8A 1P2MA 2FI4E 4JK5A 1DLEA 3Q3XA 1GBBA 1YYY1 1JRSA 2CGAA 2GCTC 3EYDA 1C1QA 1TMTH 2BVSH 4O9VA 4NFFA 3DA9B 3SZEA 4WWYA 1YPJH 1O2JA 2CK3D 2BVRH 4A92A 5TCAA 1KXAA 4AB9A 1TWXB 1UVPA 3NUMA 4DCDA 2VIOA 3P8FA 3SGQE 3BTKE 3S69A 2VIWA 3M5LA 1G2MA 1AE5A 2GTBA 4A1VA 3ZVGA 2GCTB 3OEED 3PV5A 1QURH 2P93A 3E3TA 1HAPH 1TRYA 4XE4A 2NU2E 2V3OH 2BZAA 3ZZCA 1O3JA 1Z7KA 4FOUC 1EUFA 2ZTZA 3A87A 2Q6DA 4GHTA 2F83A 2V6NA 3M5NA 5ETXA 5GWZA 1K28D 1YCPM 3M5OA 1MUEB 1THPB 5EJLA 1IQGA 4FUJA 1GJ5H 1V2ST 4UFEH 1C1WH 3F2GA 3V7TA 1EZXC 1TABE 2VVVA 3CS0A 2GV6A 3RDZA 1ZGVA 2FTLE 1SKYE 3TU7H 3SU2A 3QLPH 3JZ2B 2ULLA 1SFQB 2G51A 2YMSC 3ESTA 1T8NA 2V0BA 3IG6B 4I33A 2GGVB 1TPOA 1W11U 4Y11E 3ZZ4A 2HPPH 3GYLB 2BY7X 4NIVA 2GVFA 1D3DB 3O8RA 5C1YA 5HGGA 2ZG0H 2BLOA 3SU4A 2D8WA 3TNSA 5EXLA 4WMDA 2F9VA 5B6LA 4FU9A 4Y8YA 2KAIA 4JYTA 1PJPA 2AS9A 3M5MA 1IQMA 3MO9A 1O2ZA 1JMOH 1SGFA 2J95A 1CBWB 1GI0A 2P59A 3I77A 4NSYA 5F8XA 1EATA 1L0ZA 4FUHA 4GVUA 3K6YA 2AGGX 2WV5A 2VWOA 3PROA 1W0JD 3ENSB 5FL7D 2ZU2A 4CR5A 3SV2H 1V2QT 3OAAD 3VB6A 1CSOE 9LPRA 4ABFA 2YNAA 1FY3A 3PM3A 4Y10E 3MU1A 3GS9A 5HYOA 1DUEA 2G4UA 2ZDAH 3FO8D 3U98H 2Q6FA 1HAZB 1Y59T 3ZZBA 2ZA5A 5CHBA 7LPRA 1P57B 5F8ZA 1PYTC 1HAVB 1PQ8A 1UVUH 2A5IA 3SO3A 1ZPZA 4RKJB 4H4FA 4K8BA 1A2CH 1HLTH 2OD3B 2GDEH 1HAXB 3MNSA 3RXDA 5EOKA 3ZV8A 5PTPA 3I29A 2VIVA 1WXRA 4J1YA 4YESB 4ZKNU 1FONA 1ZR0A 2VINA 5H4IB 3KYGA 1G36A 3A7TA 1AB9B 3NXPA 1O2NA 2AMDA 4J2YB 1A1RA 1GI2A 1SOTA 5T6FA 1O5AB 2Z6BD 2ZGHA 2Y5HA 4OS1A 1B5GH 4Y6DA 3ZIAD 2A4OA 4F55A 1YPEH 3ZYDA 1DFPA 3DFJA 2KCYA 4IN1A 4Y7AA 4H6SB 3PO1B 3RXFA 3PV4A 2ZFFH 1O31A 4DGJA 4MPUA 2A5AA 1WCZA 1YCPK 1ZPCA 1HAYB 2PKSC 4FUEA 2ZEBA 1E37B 1MQ6A 1GMHG 2UUKB 4X8VH 2KCPA 5CHAC 1LHFH 1N1LA 1D3PB 3IITA 3F9GA 1OPHB 2HLDD 4MVNA 3RXQA 4FU7A 1KMHB 1GMCF 3TGJE 1TPAE 1SI5H 3M7UA 2WPHS 3MWIU 3RU4T 1EP6A 4ZAEA 1UHBB 1GBKA 2J38A 4BOHA 1TA6A 4X6NA 3GCHC 3FP6E 5TCCA 2FODA 1O3BA 1SGFG 1PPFE 3OTPA 4K1SA 2CXVA 1H9IE 1UVOA 2PTNA 3KHVA 3EAJA 1CQQA 2DE8A 2Z9KA 1XMNB 1MMJN 1IHSH 3PRBA 1B7XB 3GCTF 3GCHB 1QJ6B 2ZP0H 1J15A 1QTFA 2KX4A 3KQEA 5LPEA 3RU4E 3NZIA 1VGCC 1W0YH 1GCDA 1NTPA 1XVOA 1Y5UT 1O34A 1L4DA 2TBSA 1ETRH 3BEFB 2W6ID 2BD5A 5EXNA 4X1RU 9ESTA 5EU8A 2G00A 4Q7XA 3VEQB 4ZXYH 1NRNH 2Y7ZA 3K65B 4LZ1H 2WSSD 2BDAA 2QA9E 1GHXH 2GKVE 1A7SA 4XBDA 1GJ7B 3R0FA 1GGDC 4E05H 3SU6A 4D9QA 1C5TA 2EI6A 1O3NA 1IQIA 3PRDA 4B6FA 2OQUA 4U2WA 2ZPQA 5HIYA 3MI4A 4MPVA 1WQSA 1HRTH 4CR9A 1BMAA 2A5KA 2IPQX 2G55A 3RC6A 3M3VA 1H9HE 3ZVBA 3FZZA 6LPRA 1AFQB 1V2PT 1YWUA 2BZ6H 2P95A 4AYVB 2SFAA 1V2JT 1O2XA 1EAXA 3RP2A 4BNRA 4IMZA 4KTSA 4RKOB 1O3OA 3RXTA 1C5PA 3BSQA 1P2JA 1ZOMA 3P8GA 4K1EA 1A0HB 1C5LH 3LPRA 1Z8GA 3NKKA 1GHYH 3LGYA 1TRNA 4AG2A 4E06H 1C4U2 4Y76A 2J98B 2OP9A 4TY7A 1SGPE 5GNDA 4TPYA 1GI3A 4I8LA 8KME2 1TMUH 2FOBA 3V12A 3SI3H 4FUDA 1Y5BT 1HXFH 1LPZB 2BXTH 2V7QD 2XWAA 1OP0A 1DE7H 1ZTKA 1BUIA 4DIHH 3SORA 1SMFE 4XD7D 5DP6A 6CHAB 4X8UH 1ZLRA 2TGDA 3RXSA 1P3EA 5A0BA 1UJ1A 2BD4A 1W7GH 3AW0A 1GG6B 2GMTC 2SGPE 3A80A 3MNXA 1ID5H 4GUXA 1TONA 1B0EA 2WPDD 1RFNA 1S85A 3KNXA 2K1QA 1DY9A 3PLKA 3TK5A 4P02A 3ZZ9A 2ZFRH 1K9OE 4CBOA 1AVGH 2O8LA 2HNTE 2H9HA 2F9OA 2OINA 4OS6A 2BTCE 1P2QA 3BTQE 4B74A 1J9CH 2KZ4A 2YMSB 1IQFA 1TX7A 2ZHQH 3OE7D 1WTHD 3VGCC 1O5BB 4LOYH 4CREA 3VB4A 2FOEA 5C3NA 1YM0A 4MLFB 3RXAA 4IS5A 2Z9LA 4NWLA 5L2ZH 4XBCA 4ZHLU 3HK6B 3OU0A 1UK4A 3MO6A 4TY6A 1FPCH 4MNWA 3RUOA 1RIWC 5DP5A 1EJAA 1FN8A 3QUMP 1EZSC 2ZU1A 4NIWA 2Z94A 2J4IA 1JOUB 2HVXA 2ANMH 1ARBA 4WJG2 2BM2A 2UUFB 4GCHG 2PGQB 4X1SU 1G3EA 3M37A 4YT6H 4BAOB 1UW7A 2O8WA 4UDWH 3VG8A 1L1JA 2J94A 1XUIA 3LDXH 3NWUA 4X6OA 4XBBA 1AE8H 1O33A 1YF4A 1FI8A 3VB5A 2R0LA 2FM2A 3OTJE 1ZZZA 3ZZ8A 3T27A 1GGDB 1H4WA 1ETSH 4I86A 2ZU5A 4XFQA 5FX6A 4DW2U 3BTWE 1AKSA
chains in the Genus database with same CATH topology
1AHTH 3SNAA 2R9PA 4BAMB 1HCGA 1MAXA 1O2PA 1E36B 1UCYH 2IN2A 3LOXA 2W7SA 1QB6A 3ZVAA 3MH7A 5IYTA 4FUCA 2OC0A 2A7JA 3SU1A 5AFYH 4CRBA 2EI7A 4Y0YE 3ZZ3A 1KY9A 2HPQH 3QTOH 3GYMA 1DXWA 3MO3A 1O5FH 3E91A 2XTTB 1O2OA 3RXBA 5F03A 3BTHE 3EA7A 3MMGA 4BAHB 1TX6A 1SGRE 3UOPA 1TGTA 4A7IB 5E0HA 3KQCA 1DSTA 1NN6A 2BY5X 2FEQH 4X1QU 1O3GA 2FDAA 3LC5A 2JH5D 3RXOA 4SGAE 1GJBB 2BMGB 5AHGH 4WMEA 1P03A 1SSXA 2BOHB 5C20A 2NWNA 2ILNA 3G01A 8GCHF 4Q2KA 1T31A 3T2NA 1THRH 1ZTJA 3EE0B 1G3DA 3F6UH 1GHAG 3GDSA 4GLYA 1DM4B 3SUDA 1C1VH 1WUNH 2JETC 3O8BA 3SUEA 4CRFA 1P2IA 4X0WU 3S7HB 3TIUA 4CRDA 4ABGA 1BRBE 1ELTA 1QA0A 3ODDA 1TOCB 1FIWA 1SGEE 4JK6A 1C2JA 4OS5A 1UTPA 5DP7A 1WTGH 4CRCA 1A61H 2QGRA 3RXUA 3GICB 4LZ4B 3M36A 2ZPRA 4PROA 1ESAA 2NU4E 4ISLA 3QZQA 1P2OA 3Q77A 1SHYA 4X1PU 2GMTB 3SZNA 3P8NA 4MG3A 3PYHA 4YLUA 1WYKA 1AUJA 4Z0KA 2IJOB 5HM9A 2Y81A 5C5OA 5C67A 3U8OH 1AI8H 4AFSA 3S0NA 3ZVEA 2HWLB 4ABBA 2GX4A 2A4QA 1Y8TA 1SLXB 3SJIA 2SGDE 1ZRKA 2AMPA 1GL0E 2H9EH 3L3TA 3QO6A 1CE5A 1GI4A 3Q76A 2A32A 2H1UA 1L4ZA 1CBWC 3UPEA 4YTAA 2VIQA 2VIDA 1O30A 2WUBA 3P17H 3LH1A 1NT1A 1BZXE 1GCTB 1JBUH 2ZFSA 3VFEA 3RC4A 2ZDMA 4X6MA 5FAHA 1HAVA 4IBLH 3LONA 2FXRA 2XBXA 3U9AH 4ABEA 1D6RA 1SBWA 2CHAC 4NIYA 1V3XA 2F3CE 1GL1A 2P94A 2SGAA 1O2UA 2XRCA 1ZPBA 1YPHE 1NFUA 5FPYA 1SGQE 3RMNH 1HBTH 3U69H 1CT0E 4MPWA 3UIRA 4YOGA 2F9PA 3TPIZ 2D1JA 4IN2A 2ZF0H 1TNKA 1YPKH 3SBKA 3MU4A 4ISIH 2EC9H 3I78A 1GMHF 2ZPSA 1AZZA 1E35B 1BBRK 1PQ7A 2UWPA 3FANA 4X1NU 2C90B 3GY2A 3MYWA 4TWYA 1D4PB 4DT7B 1EPTB 1QRXA 1VCWA 5DGJA 1P12E 1D3TB 1NRPH 3T28A 2ODQA 5DO4H 1TGNA 1TAWA 2A31A 4OGXA 3AAVA 4B2BA 1IQHA 1MH0A 2ZGJA 1C2HA 1WBGB 3A81A 2CN0H 4RSPA 4F49A 2VWLA 1SB1H 3FZDA 1HAOH 5EG4A 1GBHA 1BTXA 2CHAB 3SU5A 3STIA 3PTNA 3BTME 4AFZA 2ZQ1A 1EOJA 1SLVB 3RMLH 4FVDA 1MZDA 1AGJA 1NY22 3RXPA 2QF3A 1MCVA 2NU1E 1UO6A 1F0SA 4GHQA 1JXPA 4X2VA 3TVJB 4WH6A 4UEHH 2SNWA 5DKMA 2H5DA 4CBNA 3LGTA 1TBZH 3PMAB 3PTBA 1O3LA 1GHVH 2O8MA 3T62A 2Y6TA 1DXPA 2J92A 1CGIE 1WOFA 1HPGA 4X2YA 1AZ8A 4ZH8A 1TBQH 4AZ2B 1A5HA 4E7RG 1P2NA 2ZGCA 1DICA 4WXIA 1P9UA 1UVSH 2GP9B 3A7YA 3P70B 5BPEA 5A8XA 5EQQA 3ZVFA 1QIXB 4BXSA 3UFAA 2C8ZB 4ZROA 4LK4A 4K69A 2TGAA 3SV9A 3B8JA 2R0KA 1SGTA 2WPKS 3TH2H 1LTOA 3KCGH 4ABAA 2HLCA 3DHKH 4ZHAA 3RXRA 5HXFA 3GOVB 1TMBH 1MU8B 1BIOA 3TLOA 3JZ1B 5LH8A 3K2UA 3Q3KA 1JIMA 4FUFA 2PKAB 1KXCA 2TGTA 4I8JA 1C2FA 3QDZB 1RD3B 1KDQB 1BT7A 1V2VT 3MU8A 2J9NA 1ZJKA 2Y5GA 1HV7A 1GJ6A 3BTGE 1W13U 1Z6JH 3TNTA 1O3KA 4DIIH 2Y5FA 1ZMLA 4K60A 1H8IH 1T8LA 2QF0A 5EPNA 1QQUA 1FZZA 1LVYA 1K22H 2ESTE 2GT7A 1MTVA 2OCVB 1JIRA 1BB0B 1ABIH 2AYWA 2Z3DA 1SGYE 1THSH 2ZDLA 4MNXA 3FP7E 2OC1A 2PWXA 4AGJA 1WSSH 3SN8A 1CGHA 3KEEA 5C1UA 1Q2WA 2IPHA 5FCKA 2EEKA 1TB6H 4ABHA 1W7XH 4Y8XA 3E6PH 3TK6A 6CHAC 4D7GA 3OX7U 3FVFB 4ISOA 1F0RA 1LKBA 4I31A 2C8YB 1WU1A 1GVKB 2JH0D 3LU9B 1LHCH 1QGFA 1BTUA 1EKBB 1MZAA 2XBYA 3QGNB 5JBBS 2PUQH 2VWMA 3CP7A 2O8TA 5FXLA 4B1TA 2O9QA 2FOGA 1SGIB 3RLWH 2ZDKA 1O3FA 3N7OA 3RXCA 1EB1H 2AGIX 4KP0A 1VGCB 1UTOA 2FS8A 4OS2A 2ODPA 3LKWA 3V0XA 3QN7A 4K2YA 5SGAE 4BANB 1C9PA 1EAUA 4FUGA 4ASHA 5DP4A 4B2CA 1O2HA 4ESTE 3ZZDA 4CHAC 2SGQE 2QXGA 2OC8A 1Y5AT 2R2MB 1BHXF 3SV6A 3BEIB 1GI9B 2TRMA 1DT2A 5A0CA 1DVAH 1C2MA 1QL9A 1HJAB 3VXFH 1KLTA 1MQ5A 1O2YA 1Z6EA 5T6DA 3VB7A 1A4WH 1P02A 5E2PA 2PTCE 4A1TA 3C27B 2WPJS 2ZHDA 1C5RA 4ZHMU 4DJZB 3GY7A 1EX3A 1ZGIA 2FTMA 1XXDA 1UHBA 1AY6H 2H6MA 2P3UB 4MPXA 4MNYA 3SJOA 1YKTA 1OYQA 3GY8A 2WV4A 1YPLH 3RXJA 1TALA 1JWTA 5CE1A 4BTIB 1HAIH 1KDQA 5JB8S 1EOLA 1S82A 1FLEE 1ELGA 4U30A 4H42U 1LVOA 3GISB 1V2TT 1TE0A 1ZRBA 2GV7A 1W14U 2Z3EA 3S9AA 2R3UA 1OWJA 1TX8A 1OOKB 4B2AA 3BG4C 1XUGA 1YPGH 1YPHC 2ZGBH 1UCYE 2ZCLP 3MNCA 5T3HA 3MH4A 1P11E 4GAWA 1L1NA 2C3SA 1A0JA 3TK9A 3UREA 4Y79A 1C5MD 3SHAH 1Z71A 1S0QA 1DSUA 3ZZ6A 1TA2A 1RS0A 1C1UH 3ATMA 2W3KA 4Z6AH 2Y7XA 2QY0B 4WF8A 3URDA 4BAQB 1S0RA 1GCTC 1C4Y2 1L1GA 2WPMS 3P6ZB 5DP8A 2PV9B 4B73A 5JBTA 3V3MA 1TNIA 3P92A 1SGNE 1CHOG 1BBRE 1VCPA 2JH6D 2VU8E 2PKAA 1BBRH 3NK8A 1CA8B 2PW8H 1FQ3A 1P9SA 4ZXXH 2XBVA 1UK3A 3ZVDA 1NM6A 1O39A 3AW1A 3DT0H 1DWBH 2ZFPH 2OXSA 2FOHA 2VH0A 1O3PB 3PWCA 4YOIA 3TH4H 1QQ4A 2AH4X 1Q31A 2ZTYA 2BY8X 4NSVA 1SGDE 3TJOA 1T8MA 5JBAS 2TIOA 4ZKRU 1SC8U 2CF8H 2PHBA 2VIPA 3TGIE 2ANWA 1AMHA 3ZZ7A 1VITH 2BDGA 1GBMA 5J4QA 1GG6C 4BTUB 1E0FD 1BTHH 1WQVH 1V2KT 2BDIA 2FZZA 3SGBE 4QT8C 1D6WA 3GY5A 1AWHB 5K7RA 2BOKA 5C2ZA 1VITG 1LPGB 2F91A 3EQ0H 4BTTB 1V2WT 1AIXH 1K2I1 2BQWB 2VH6A 4DVAU 1K1LA 1SOZA 1IQJA 1BOQA 3MHWU 2YNBA 2ZCHP 2D26C 2A4GA 2ZFQH 1VCQA 3A89A 2HNTC 1NRQH 3TH3H 1MTWA 1J17T 1QFKH 3LGVA 1TYNA 3M3SA 1T8OA 4I8HA 1JRTA 1OS8A 3KQDA 5LGOA 1C2GA 1GI8B 5GDSH 3UNQA 2BX3A 1UTKA 1O2SA 1NU7B 3CENA 2DUCA 1H9LB 1UCYK 3A8CA 3W95A 1KTSB 2QXIA 4ABIA 2BQ7B 1O2WA 3VXEH 2QYIA 1LCYA 3HPTB 3F9HA 3M61U 3ITIA 1FUJA 1G2LA 1F92A 2BY9X 2PGBB 3PLBA 1DPOA 3SU0A 1NFWA 1N6YA 1X7AC 3PMBB 4YM9A 1RTKA 5FPSA 2H2ZA 2A7CA 1Z8JB 2NU0E 5DPAA 4YT7H 1F7ZA 2Z9GA 3EA9A 2ZHWH 2XC5A 5GCHG 3L33A 1EB2A 1AB9C 1O2RA 1QBNA 4X8SH 2BDHA 4WY3A 1CGJE 4WXVA 1BRAA 2W26A 1C2EA 1M9UA 3MTYA 4UE7H 1VITF 3D62A 3E0PB 4ISNA 3SUGA 5AF9H 5DJ7A 1ZSLA 1ABJH 2ZWLH 2AMQA 2VGCB 7GCHG 2I6SA 3VB3A 1G3BA 1EASA 2STBE 3A7ZA 1GPZA 3OYPA 1C1RA 3A86A 1HJ8A 4K5ZA 4DOQA 3A7XA 3UWIA 3M35A 2F9BH 5FBEA 4XDEA 2FYRA 4CRGA 1BMLA 1TQ7B 3F9FA 2H9TH 2Z3CA 3KF2A 3UNRA 1GJAB 2WUCA 1IQEA 1GJDB 1GHWH 2HNTF 2VWNA 1BHXB 1SL3A 4X6PA 2ODYB 1HNEE 1Z8RA 3LJOA 3MU0A 2LNCA 4TYDA 1XX9A 2C8WB 1OP2A 1N8OB 4B71A 4UFFH 2FI3E 2RG3A 3ZZ5A 1ACBE 1ELAA 1YP9A 1P01A 1KXDA 3ATIA 5C1XA 1YC0A 1LO6A 1RTFB 2ZECA 1F2SE 3U1JB 1CHGA 5A8YA 2O8UA 3D65E 4X2XA 3O8CA 1XUFA 5E0JA 1ANCA 8GCHG 1ZMJA 2AIPA 3OSYA 3U1IB 1GMDF 4TWWA 1OWDA 3QZRA 1Q3XA 2ALVA 1A0LA 4I8KA 3RU4D 4FU8A 4WVPE 1UK2A 3T29A 4JYUH 4TPIZ 4SGBE 1C1PA 5G4BA 2VNTA 4B75A 2ZGXH 1DITH 1UTNA 2AGEX 5K0HA 1CVWH 1MTNC 8LPRA 5J4SA 5FPTA 1XKAC 2AEIH 5GIBA 1IAUA 1VJ9U 4YOJA 1NFYA 3GY4A 1ANBA 2HRVA 5LPFA 1K1OA 4NGAH 4O03A 8ESTE 2PSYA 3RM0H 1FNIA 2PLXA 4U32A 4MDSA 1EP5A 1C1SA 1PFXC 2GT8A 5HM2A 5GPIB 1BMNH 2A2XH 1SGCA 3P8OA 3SGAE 2WYJA 3E90B 2BYAX 4JYVH 1W3CA 1PPBH 1PPGE 3D49H 1C5WB 4VGCB 1OP8A 3S7KB 1H1BA 1TPSA 1GI7B 4KELA 2B9LA 4R8TB 2C93B 1GWAA 1HJ9A 1GBAA 1P04A 2YOLA 4UD9H 1HFDA 1P05A 3KL6A 3URCA 3A85A 1GHBF 3PO1C 3Q3YA 1C1MA 1C4V2 3FFGA 1CA0B 4VGCC 3ATKA 3TGKE 1LQEA 1O36A 3M3TA 3C1KA 1MKXK 1DY8A 2FOMB 2BDBA 4HGCA 3SV7A 1QJ1B 1HAHH 1KXBA 2RDLA 4UFDH 4CH2B 1T32A 1GI6A 3LGWA 4GCHF 2AERH 2FX4A 1O3HA 1HUTH 5A0AE 1OYTH 1P3CA 1T7CA 4I8GA 4FVBA 1TPPA 2JKHA 1MTSA 3BTEE 2BHGA 4AOQA 1BITA 4AG1A 4K1TA 1P06A 2GD4B 3MNBA 4NIXA 5A09A 1ZTLA 2P8OB 3RXHA 3R3GB 1TFXA 3RXLA 1BJUA 3QGJA 3SQHE 3RXKA 3UUZA 1LHGH 1MKWH 2FO9A 3A8DA 1C2KA 2ALPA 3MFJA 3RXEA 3RC5A 1LVBA 1IOEA 1SG8B 3HKJB 3D23A 5EQSA 3TJVA 2FMJA 2VVUA 4FUIA 4BAKB 3P95A 2GDDA 1SR5C 1ELEE 1GHZA 1CT2E 2A4RA 5F8TA 1VJAU 2P3TB 1GI5A 1V2NT 2QCYA 3DFLA 1FY4A 5L6NH 1E38B 1XUKA 3K6ZA 4B76A 3RXGA 2UWOA 3GCOA 1K1MA 1RRKA 2ANYA 3BIVH 4D9RA 2UWLA 1TOMH 1SQOA 2BXUH 4INHA 1PPCE 1BRCE 1O3EA 6ESTA 1NESE 1GBTA 3QWCH 1FN6A 1K1NA 5EGMA 1CT4E 2BLWA 2A2QH 1O35A 1NFXA 2ZO3H 3RMMH 5L30H 3MU5A 2G4TA 1FJSA 2AFQB 2ZKSA 3BV9B 1TGSZ 3SOSA 4IW4E 1TNHA 4F4OC 1HXEH 3V13A 1ELVA 2UUJB 2C4FH 1TBRH 1GJ4H 2GCHG 3LGIA 3NPSA 4I32A 2ZNKH 4LXBH 7GCHF 4IGDA 4K3JA 1V2OT 1DX5M 1UVTH 5B6OA 3SU3A 1QL8A 4MTBA 5FHTA 2PFEA 1DS2E 1UTLM 3SJ9A 3T25A 4X2WA 1GBLA 2GZ8A 1W8BH 1V2MT 1SQAA 1KIGH 3ZYEA 4DG4A 1FV9A 1FXYA 4CRAA 1OKXA 3SNBA 4AORA 1FDPA 4THNH 2QN5T 1QY6A 2FOAA 1K1PA 1O5EH 1QL7A 1O37A 1IQKA 2B5TB 5A8ZA 4IC6A 1TGCA 5FX5A 3UTUH 1DLKB 5EW1H 1QHRB 1GJCB 1O3IA 1WAYB 2FYQA 4K8YA 2QXJA 5C5NA 1MTNB 1EZUC 4E7NA 2FOFA 3BF6H 1HYLA 1Y3WA 4ZUHA 1NPMA 3T5FH 5HMAA 2M5TA 2ZHFH 3UNSA 3RXMA 1Z1JA 3E8LA 1ESTA 5IDKA 3OY5U 3GDVA 1BJVA 1ZSKA 3QTVH 1LPKB 1QJ7B 3T26A 3MH6A 1KSNA 1IHTH 1OX1A 1ELFA 4AFUA 1GBEA 1SLWB 4D76A 4D8NA 1AO5A 2ZFTA 3RXIA 1OWIA 1A3EH 4NWKA 1HB0B 1VZQH 4KTUA 4ZMAH 4Q7YA 4XOJA 1BTYA