3S9AA

Russell's viper venom serine proteinase, rvv-v (closed-form)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
234
structure length
234
Chain Sequence
VVGGDECNINEHPFLVALYTSASSTIHCAGALINREWVLTAAHCDRRNIRIKLGMHSKNIRNEDEQIRVPRGKYFCLNTKFPNGLDKDIMLIRLRRPVTYSTHIAPVSLPSRSRGVGSRCRIMGWGKISTTTYPDVPHCTNIFIVKHKWCEPLYPWVPADSRTLCAGILKGGRDTCHGDSGGPLICNGEMHGIVAGGSEPCGQHLKPAVYTKVFDYNNWIQSIIAGNRTVTCPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of coagulation factor V recognition for cleavage by RVV-V
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Vipera russelli proteinase RVV-V gamma
total genus 56
structure length 234
sequence length 234
ec nomenclature ec 3.4.21.95: Snake venom factor V activator.
pdb deposition date 2011-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3s9aA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3s9aA02
2H2ZA 3RC6A 2QGRA 3SZNA 1B7XB 4WH6A 4X1NU 1KXBA 3SUEA 2Y80A 1PFXC 2Z9JA 1IOEA 3F1SB 1HFDA 1EJAA 2VIPA 3HKJB 1Z1JA 3U8TH 4UDWH 3VB5A 1EAWA 1TPOA 1UCYK 2ANKH 1V3XA 4JK5A 3WY8A 3QX5H 2ALPA 1TPSA 1U6QA 1O5GH 3RXMA 5FX5A 1MZDA 4Z0KA 4FUHA 1C2MA 1C5ZB 3VB6A 1BMNH 2ZDLA 4OS7A 1CT0E 2P95A 3PROA 4A5TS 1ELVA 3BF6H 1LQEA 1A5HA 3LKWA 3SUFA 5EODA 1NY22 5CMXH 1KSNA 2G4UA 1FIZA 1GJ5H 1HAVA 2CGAA 3RXVA 1T8NA 3MO9A 4IC5A 2VGCC 4AYYB 3MO6A 4E7NA 1LTOA 4NZLA 3I77A 2Z3CA 2WV4A 2YNBA 4ABAA 4R0IA 4K5ZA 4GPGA 2FODA 1OSSA 4YOJA 1GBHA 2WPMS 1TNGA 4DIIH 5C3NA 2FS8A 4U01A 7LPRA 1INCA 1PPEE 1WV7H 3UQOA 2XWAA 1OWHA 2OQUA 1NT1A 1CA0B 2ZHFH 1RIWC 1GG6B 2C93B 2EEKA 4FU8A 4X2WA 1P06A 1SGEE 3UOPA 1WBGB 3SV2H 4MPUA 3GDUA 4O97A 2ZC9H 2M5TA 3KEEA 4FUBA 2ZFFH 3MU1A 1P10A 3QDZB 3CS0A 4NWKA 1WUNH 5E0HA 2B8OH 4BAMB 1ZMNA 4I33A 1J17T 3GCTG 1TGNA 5GPIB 4OGXA 1IQMA 5EGMA 3T28A 1ELEE 1J14A 1Z6JH 1O2RA 2VWMA 3UQVA 2ZECA 1THRH 5BRRE 1TRYA 2BVXH 4XBCA 1KTSB 1PQ5A 3DFJA 5SGAE 1DM4B 1GBJA 2P8OB 5H4IB 1F0UA 4ZROA 7ESTE 2FMJA 1G2LA 1LVBA 2BQ7B 1JRSA 3BG8A 2IOTA 1G32B 1C5XB 2TBSA 3RXDA 2NU1E 4HZHA 1MUEB 3RXKA 1O2SA 3BTWE 1C5YB 3QO6A 4X1PU 3RXHA 2RDLA 5EXLA 2HPPH 4A6LA 3RXTA 2XBWA 3LONA 1CBWC 1UTKA 2HALA 1MD7A 2J34A 3BTME 1UVSH 4MNWA 3LC3A 4Q7XA 1D6WA 1BBRH 4JZDH 4DURA 2PSYA 3GCOA 4ISOA 4IBLH 2AMDA 2GVFA 4ZHMU 1P9UA 2J38A 1VJ9U 2P94A 2GTBA 1BTWA 1DSUA 3EAJA 2SGEE 4THNH 1C1WH 2Z9LA 3KN2A 1HGTH 1P05A 1V2UT 1BHXF 5B6OA 2NU3E 4DIHH 2H9HA 2YOLA 1BMAA 1GVZA 1YGCH 4X1RU 1BOQA 2VJ1A 3UR6A 2JH6D 4WY3A 2ZFPH 3RXUA 3S7KB 1C1UH 3PMBB 1ZHMA 1T8MA 4UEHH 1FY8E 1CGJE 1MCTA 3SQEE 4D7GA 1AUJA 1THSH 4CHAB 4BTTB 2P16A 1QB9A 3SI3H 1IAUA 4XSKU 1FQ3A 4KTUA 2PW8H 4UFGH 1ANDA 1GBDA 1SR5C 1A0HB 4IC6A 3ODFA 1UK2A 4M7GA 3E1XB 1O2HA 1SGTA 1YPHC 3T2NA 1N8OB 3RXGA 3GYLB 1QHRB 2OBOA 2ZGBH 1C2JA 2C90B 1AE5A 2FI5E 1B0EA 1GCDA 3RXIA 3VB3A 3KQBA 2ALVA 1Z7KA 1MZAA 3SV9A 5A0CA 1DWBH 2AH4X 1RGQA 4YTAA 2QY0B 1P0SH 2VWNA 3LH1A 5JPMH 1XUKA 1QBVH 1MAYA 3ZVBA 1Q2WA 1ELTA 1WOFA 2JH0D 3FVFB 1H8DH 3BEFB 4DGJA 3A80A 4ZAEA 4OS6A 3PWCA 1H9LB 4TPYA 4FUFA 2HOBA 4K2YA 1UTOA 1C4V2 1UVTH 2ANYA 3L3TA 2G81E 1LMWB 5BPEA 4X2YA 3JZ1B 5PTPA 2AYWA 2FM2A 2VIDA 1V2OT 1Z8RA 1DWEH 1EAXA 2GCTC 1ZZZA 5E8EH 3ITIA 3PO1B 2PKAB 3HPTB 2BDAA 1CT4E 4UFFH 4Q7ZA 1Y5BT 2Q6DA 3O8DA 1O3BA 2FPZA 3O8BA 2VH0A 1ZPCA 1C5WB 1OP2A 4ZKSU 1LCYA 2CN0H 3M35A 1A61H 2BZ6H 1GJ6A 1HAYB 2A4OA 2J92A 4OS4A 1ARBA 3A86A 4KELA 4X0WU 1YPGH 2BHGA 1AN1E 4MPXA 1C1MA 1SSXA 2TGPZ 3U1IB 2SGAA 2FDAA 3L6PA 5CHAC 3MWIU 2GKVE 1OKXA 1DLEA 3LIWA 1O2VA 1J9CH 3M5OA 2BD3A 2G00A 5ETXA 1DUEA 1A0JA 1G30B 2G51A 1QL7A 2BD5A 3CS7A 3BG4B 5FPSA 1DICA 5HM2A 1C1NA 1RJXB 1F0RA 4ZKOU 1AQ7A 1D6RA 1C2LA 3TH4H 2ZTYA 2R3YA 4I8JA 3W94A 2ANWA 1ETSH 3SW2B 4X8SH 1PPGE 3NZIA 1C2IA 1EZXC 1HJAC 4A1XA 2WPJS 5FPTA 4I7YH 1SGFG 2ZKSA 2H1UA 1P02A 1UK3A 2A5AA 1XVMA 3E90B 2GCHG 2CJIA 2THFB 3SGQE 2AS9A 5ABWA 1SI5H 1GBMA 1TBQH 1SQAA 2QIQA 4LK4A 1NN6A 1C9TA 5LPRA 1JXPA 2ZU5A 3SNDA 5C67A 2C8ZB 2BTCE 1IQHA 1O36A 2PUXB 3W95A 1AY6H 1K9OE 1EAUA 1LVYA 2I6QA 1GMDF 3PTNA 4I8GA 2FX4A 5A2MH 2BDCA 2QXIA 2BLVA 2P93A 3TJOA 4CH8B 1AKSB 4J2YB 1WAYB 1QNJA 1EKBB 3RMMH 2NU2E 4YZUA 3PM3A 3AAVA 3UWJH 4Y8XA 1TNLA 2J9NA 4BAHB 4FVDA 7GCHG 4GAWA 3OU0A 2BY7X 1XX9A 3VPKA 3GY8A 5JBBS 1NRSH 1GI6A 1DWDH 1AFQB 4FVBA 1P11E 2ZA5A 2ZGJA 2GT7A 4ZHLU 1C1RA 2OLGA 3MI4A 1YC0A 1NO9H 1Y8TA 2IPHA 1KTTB 4K8BA 2SNWA 2XBXA 1UTMA 3K2UA 1HUTH 1V2TT 3E91A 2PGBB 3BEUA 4WJG2 1QIXB 5T6GA 3BTGE 2FI3E 3CP7A 4NIXA 3T5FH 4IN1A 3RM0H 1MTUA 1WQSA 1QGFA 2A2QH 4IW4E 1O3IA 1Y3XA 1KXFA 1O39A 3S9CA 1GI2A 2BDHA 4K60A 1P2QA 4X6MA 4Q80A 5GJ4B 3T62A 3VGCB 4BAKB 5FAHA 1ZPBA 4E05H 3P70B 4NIWA 1O5DH 4B2AA 1AHTH 1VITF 1VITH 4ABJA 2ZHEH 3RXCA 3QK1A 1TGCA 2UUKB 3ZZBA 5T3HA 1QQUA 1V2RT 1W13U 2BDBA 2BD7A 4WMEA 1YPLH 1D3PB 2BOKA 2ZF0H 3TGIE 3E8LA 1Q3XA 1IQKA 5FXLA 1AB9B 4AFQA 5DP3A 2H5CA 2AEIH 2Y5FA 1P2IA 3NPSA 1F5RA 1ARCA 1T32A 3ZZ6A 1TNJA 1CSOE 1ZJKA 1GVKB 2FP7B 1BQYA 3ZVFA 3D23A 3DFLA 1G36A 3A87A 1S82A 1SGFA 3MYWA 2OBQA 1ANEA 1OS8A 1EZSC 2A7JA 1HAHH 1LPZB 4D9QA 3TJNA 4IMZA 1AD8H 4JYVH 4GCHF 2BZAA 1SGRE 1ANCA 1BCUH 2UUYA 1TA6A 3FZDA 3EGKH 5G4BA 1HAGE 2P59A 1AVXA 3GY4A 1GL0E 1CQQA 1SFQB 4CHAC 1QL9A 1C5PA 1GJ4H 2K1QA 4VGCB 1FZZA 4DW2U 5J4SA 1F0SA 1F5KU 5F8TA 2R0LA 4CRFA 1P2KA 1HIAB 3ZYDA 4X8VH 1V2VT 1EQ9A 5EU8A 2HNTC 1C5SA 4YT7H 2ASUB 3F9FA 1BTZA 1E35B 1UTQA 3V13A 4IGDA 3GY6A 2QF3A 3EE0B 4B73A 1OXGA 1GI1A 1GDUA 2QAAA 3SU3A 2FOBA 3RMOH 2FOMB 3RC5A 2EI6A 1EZQA 2ZCHP 1F0TA 1O32A 4FU9A 2TGDA 1H9HE 1GMDG 3K65B 4Y8YA 1B0FA 1P2JA 2OQ5A 3AVZA 1QRZA 4SGBE 1GBCA 2C8YB 2OP9A 3C27B 4SGAE 1S0RA 1NU9A 3AASA 5J4QA 3ZVDA 4RSPA 1T4UH 1CVWH 1XUGA 2R2WU 3SU0A 5GIBA 1OWKA 3A8DA 1MKWK 1Z1IA 1LQDB 2QN5T 4YM9A 3BG4C 3M7QA 1ZRBA 3VXEH 4NG9H 1HXFH 1NFUA 1P12E 3AAUA 1QBNA 3UNRA 1A3EH 1O34A 4K1EA 3PMJA 2FLRH 1SGYE 3KQCA 1CGIE 1GI5A 1W12U 3ESTA 3MFJA 1D3TB 1Q31A 1NU7B 2A5IA 2GDDA 3ZVGA 1TMUH 3RXJA 5C20A 5LGOA 2W3IA 1J16A 2PGQB 2ZFRH 4BANB 2EC9H 1ESBA 1O3FA 4I32A 1P3CA 2BY5X 2ZHDA 1UO6A 3FAOA 2R9PA 4NCYA 3RLYH 4LZ4B 4Y7BA 1JMOH 4UFEH 1EOJA 5IDKA 1LPGB 2GX4A 4MNVA 4TWWA 3SGAE 1O37A 3SV7A 4BTUB 5JB8S 2GV7A 1C1VH 1O0DH 1SGPE 2FYQA 2ZU4A 1SLWB 1P03A 3DT0H 5AHGH 2A45B 3A7TA 1P01A 3ELAH 1CA0C 1SQOA 1C4U2 1YPHE 2FO9A 4BXWA 4IN2A 4Y7AA 2BX3A 1FY4A 2G8TA 1S5SA 7GCHF 4AZ2B 1J15A 2LNCA 1BUIA 2AFQB 1P9SA 1RTKA 1HAPH 1IQFA 4ZMAH 4X8UH 1TX6A 4MLFB 1CO7E 1XKAC 2RCEA 2P3FH 4D9RA 2G4TA 5TJXA 1O2PA 3TPIZ 4B76A 3LJJA 1C2KA 4Y0ZE 1P57B 1VCPA 2W7UA 1PYTD 4MTBA 1O2KA 1GBAA 1KXEA 1W0YH 1LHGH 1GBTA 1A4WH 1PQAA 1JIMA 1BHXB 3MH5A 4AFUA 1CHGA 1AFQC 4NFFA 1HAIH 3ZZ3A 3ATLA 4H42U 1GI8B 1Y5AT 2VWOA 2BY9X 1MMJN 3VGCC 4X2XA 5HM9A 1S0QA 3UPEA 4CR5A 3M3TA 1K1MA 2SGQE 2FOGA 1IQNA 2XCNA 1KDQB 1O2NA 3PYHA 3SU1A 1GBEA 3GDSA 3KQDA 1TMTH 2ZCLP 1DFPA 2ZPRA 4TYDA 3RU4E 1SMFE 1NFWA 1UTJA 4AB8A 1EAIA 3UIRA 4Y79A 5JBAS 2JETC 3LJOA 2XNIA 2BDGA 1GCTB 2A4RA 3EA7A 3FZZA 3FP6E 4F49A 2SNVA 5C5OA 1YYY1 3P8OA 4YLUA 2GMTB 3UREA 4JYTA 2G55A 2WPHS 2V3OH 3TNSA 2ODYB 3LGWA 3RXFA 2ZHQH 1O3HA 2PTNA 1O2IA 1W7XH 3QGNB 3SBKA 4Y0YE 5EQRA 2ULLA 4DT7B 1NM6A 6LPRA 1LO6A 1G9IE 4Y6DA 2HRVA 2A1DB 4NA7A 2G5VA 2H9EH 2ODPA 1NS3A 2ZU1A 3D62A 4FUDA 1KXDA 1O5FH 3A7VA 4JZEH 3A8AA 3MH7A 4O9VA 3P8GA 3GCNA 2ZGCA 4O3TA 5C2ZA 1MAXA 3MTYA 4KTSA 1O35A 1L0ZA 2Q6GA 3KCGH 2A4QA 1YCPK 1P04A 2R0KA 4CRDA 4E06H 4FUIA 3N7OA 1A0LA 2F9NA 4H4FA 4VGCC 3U9AH 4X6PA 1GBLA 1FAXA 1ABIH 1CHOF 2A5KA 3F9EA 1SVPA 4U2WA 1GI9B 5EG4A 3TJVA 2RG3A 3V12A 1FY3A 6CHAB 2FESH 1V2KT 4I8LA 2Y7XA 5DGJA 1O2YA 2PKAA 4NIYA 1FI8A 4AFZA 1GDNA 2QXJA 5JDUB 4FUCA 1ZYOA 3Q3KA 1BIOA 1BJVA 1GMHF 2WUCA 1F5LA 2AMPA 3O8CA 1GBIA 1O3EA 1BRBE 1KXAA 3JZ2B 3BTEE 3SHCH 3QTOH 3S69A 3HK6B 3RMLH 1GG6C 1BTPA 2ZTZA 3HGNA 1SPJA 1C1PA 5E2PA 2NWNA 1KLJH 1O3JA 1HYLA 1EP6A 4RN6A 1QCPA 4MVNA 3H7OA 1XVOA 1QB1A 2GP9B 2V35A 2CXVA 1MTSA 1MTWA 2PUQH 1AVGH 1IQJA 1HV7A 1QRWA 5GCHF 4CBNA 1ZOMA 3GDVA 4HI3A 3ENSB 4A1TA 2QF0A 3LGUA 1Y3UA 3A88A 4TWYA 4NWLA 1VGCC 1TONA 3M7UA 2GCTB 4B2BA 1K28D 2I6SA 3PB1E 2ILNA 1HAXB 1BTUA 1K1NA 1NROH 2EA3A 3ZZ5A 3UUZA 5FBIA 1UVUH 3M36A 3PV4A 1XUHA 1MKWH 3R0FA 4JK6A 1C2FA 3SN8A 1GHAG 2OC7A 4B74A 1SGIB 1O2MA 2BYAX 3URCA 6CHAC 3UOUA 2BXTH 1O5BB 3H7TA 1F7ZA 2Q6FA 3OX7U 1L4ZA 2HLCA 1AI8H 1TOMH 1ZJDA 2VIVA 3K6ZA 1GMCF 2Y5HA 1TGTA 1QQ4A 1BMMH 2BQWB 3UTUH 1QR3E 4D8NA 1C1TA 3E6PH 3MOCA 1FUJA 3E3TA 4FXGH 1JBUH 2D1JA 1CU1A 8GCHF 1FAKH 2OC8A 3B8JA 4WXIA 1ESTA 3EQ0H 4XBDA 1KLTA 1A5IA 2BD8A 5FBEA 3ZZ4A 2PKSB 3BTQE 3S9AA 3QGJA 1BMLA 1LHEH 1SGCA 5K7RA 1AVWA 3NXPA 3RU4D 1P8VC 1SGDE 3BN9A 1DDJA 3LGVA 1HAZB 1DPOA 4X2VA 4E7RG 1BJUA 4CRAA 3SUGA 1NRNH 4Y71A 1XM1A 1BRAA 1YPJH 3R3GB 1W2KH 1C4Y2 5ESBA 4K1SA 1VITG 5K0HA 4PROA 3LU9B 1ZHPA 2QXGA 1QY6A 2Z9KA 3IITA 2AIQA 2V0BA 4AG1A 2VINA 1ZR0A 5DKMA 1A46H 1ACBE 1DWCH 1NTPA 4WXVA 1GBBA 2JETB 1C1QA 2G5NA 2FI4E 1O2UA 1GJDB 1O3KA 3Q77A 2H6MA 3SU4A 2STBE 3RXOA 1NZQH 1OP8A 1HXEH 4ABIA 2XBYA 4AFSA 4INKA 3IG6B 1TQ7B 3BTKE 2XC0A 4ZHAA 4Y76A 1OYQA 1C2HA 1TA2A 1G3DA 1BDAA 2ZWLH 3LC5A 1O2XA 1XMNB 1O3AA 3SNBA 1MKXK 1K1IA 1DXWA 2BM2A 5C1YA 2ZU2A 1GHBG 1KY9A 2DE9A 5A0AE 3UWIA 1VGCB 1GJ8B 3SJOA 4FUJA 3VFEA 1UHBA 3QN7A 1AB9C 1JOUB 1ZGIA 4K69A 4WMDA 3M37A 2AGIX 1TGBA 3IWMA 4CBOA 2P8OC 3PLPA 5A8XA 1TAWA 1O3LA 1RFNA 1DS2E 2ZDNA 1IQLA 1VCWA 2GT8A 1A2CH 1AE8H 4YESB 4NGAH 1KLIH 2GZ8A 2XBVA 3TK9A 1K1LA 2ZU3A 1SQTA 2WPLS 3OSYA 2PFEA 1PPHE 1TX8A 2Z6BD 2ZG0H 2BDYA 1ELBA 1K22H 1HBTH 4GHTA 4ZKNU 1KXCA 8ESTE 4KP0A 1SHYA 2XWBI 3FANA 1RTFB 1L1GA 1QJ1B 4INHA 1NFYA 1RS0A 2PHBA 3EA8A 1DUAA 3RP2A 2AIPA 2NU0E 3SU2A 1K1OA 5DP8A 1QURH 3SNEA 2GZ9A 3GISB 1A5GH 1EB2A 3OY6U 5TCCA 2C8WB 1GWAA 3DD2H 1SLXB 1C2GA 1FPHH 3M5LA 1TNKA 5C5NA 1O2JA 4R8TB 2OUAA 5AFZH 1DOJA 1TMBH 2ZQ1A 2O9QA 1CHOG 4B1TA 1S6HA 1CT2E 3HGPA 5I25A 2WPIS 1O5AB 2ZHWH 4ABDA 1PJPA 2XCFA 2BQ6B 1C2EA 1V2NT 3PLKA 3MU5A 1TBRH 1HAVB 2ESTE 2BMGB 5FHTA 2EI7A 1A7SA 4ESTE 5DP6A 4JZ1A 3TGKE 1OP0A 3SO3A 1WQVH 5CE1A 1RXPA 1GL1A 4OS1A 2ZI2H 2HNTF 4I31A 1D9IA 3ZVAA 2STAE 1Z8IB 4DOQA 5DO4H 1W10U 2OC0A 3BTTE 2FOAA 2F9VA 4HFPB 4BXSA 2BLWA 4ISLA 1BRCE 3FP7E 1W14U 1VCQA 1MU8B 4AB9A 2ZFSA 4WH8A 5AFYH 2A0QB 1TOCB 1OWDA 4K1TA 1O3CA 3QTVH 2EI8A 3E0NB 2ZDAH 3S9BA 2A31A 2FOCA 1PYTC 3A7YA 2VB0A 2GDEH 1GGDC 3MNSA 1OOKB 1V2ST 4ISIH 3A7ZA 3SI4H 3KIDU 1C5UA 1HJAB 4MNXA 5AVDA 1E34B 1FPCH 1TNIA 3MNCA 5E0JA 5JYIA 3PLBA 4ABFA 1DT2A 4UONA 4AGJA 5T6FA 1V6DA 1BITA 2W26A 3SNAA 3RXPA 1G2MA 2VVCA 8GCHG 3MMGA 3OYPA 2BY8X 3A7WA 4ABGA 2ZDMA 3U8OH 3UNSA 1SB1H 2NU4E 1GJBB 5HYOA 5EW1H 2O8TA 1XXDA 5L6NH 4I8KA 1EOLA 2F91A 1UTLM 4Y10E 1NRRH 2XTTB 3Q3YA 3RC4A 1SGNE 3SOSA 1YCPM 3SV6A 5EW2H 3GYMA 4UD9H 3PWBA 1EJMA 1FLEE 1RIWB 3ATIA 3P95A 1VZQH 4NA8A 1OX1A 3VEQB 1ESAA 1EPTB 1H8IH 2CHAC 2GZ7A 2ZP0H 4CRCA 1AFEH 3MU8A 3Q76A 4MQAA 1O5EH 3ATMA 1TFXA 4J1YA 1W11U 3GY3A 1GI3A 3RU4T 4AN7A 2CMYA 3NCLA 3FP8E 2QCYA 3GCHC 4I8HA 5GCHG 3SJ8A 2Z9IA 4JZFH 1V2JT 5DP9A 3UFAA 3PO1C 1AUTC 2AMQA 1O5CB 1ID5H 1SBWA 6ESTA 1BT7A 1BA8B 1WU1A 2IJOB 4K8YA 1YCPH 1UVOA 1E38B 2BLOA 4GHQA 3LH3A 1N6YA 1FIWA 2SGPE 5AF9H 2OTVA 3RXLA 1GPZA 3QLPH 2F3CE 1Y3WA 1PQ8A 1QA0A 2HVXA 3SUDA 3A8CA 4X8TH 4A7IB 3P17H 4X1SU 2WYJA 4LXBH 5EXNA 1ZSKA 1UTNA 1C5VA 1FMGA 4NIVA 2H9TH 4KKDA 1F2SE 1DXPA 3P92A 1P2NA 1NC6A 2LPRA 4Q7YA 2PWXA 3NUMA 1QJ7B 2VGCB 4Z6AH 3F6UH 1UJ1A 1TX7A 1P09A 2VWLA 1LKBA 4YO9A 2RA0A 1ZSLA 3DUXH 2BD2A 3RM2H 2OCVB 5FX6A 2TPIZ 1EXFA 1XXFA 1C2DA 2SGFE 4AGKA 1NESE 1QBOA 2UWLA 1ELDE 1EPTC 1N8OC 2CHAB 1IQEA 2FWWA 1YP9A 1O2LA 3SORA 1H4WA 2R3UA 4H6SB 1MTVA 4HGCA 4RKOB 5EOKA 5DG6A 4FU7A 3A89A 4JZIA 1C5OH 1S85A 1P2MA 4XE4A 5DJ7A 3QWCH 5C1UA 2FX6A 3U98H 1IHTH 3CENA 4CRGA 2HPQH 1ZTJA 4Y8ZA 1YF4A 4UE7H 4XOJA 4F4OC 5FPYA 1OYTH 2ZIQH 1IHSH 1D3DB 2A7HA 1E0FD 1HIAA 2Z3EA 5ESTE 3V3MA 1ZSJA 1UMAH 1C5LH 4XDEA 2VVVA 1LVMA 3TLOA 1WTHD 2D26C 2OXSA 1LPKB 4A92A 4ZH8A 4U30A 3M3SA 2A4GA 1GI4A 1GJCB 2FOEA 3TGJE 1UHBB 3LDXH 3ZZDA 1O3OA 3BSQA 3SHAH 2FEQH 2HWLB 3A81A 4B71A 4GSOA 1BB0B 1GHXH 2YNAA 1DX5M 1SLVB 2GGVB 2Y7ZA 2XRCA 8LPRA 1S84A 2FYRA 1CBWB 1SLUB 1EZUC 2FTLE 2W3KA 2XW9A 3I29A 5JBTA 1HRTH 3LOXA 1CE5A 1MTNB 3F9HA 1GHBF 4CH2B 5C1XA 1M9UA 3A8BA 2O8WA 2XC5A 3SQHE 1HJ9A 2OINA 2ZGXH 3M7TA 3F68H 1Y3VA 3RUOA 1QA7A 5DP5A 1TIOA 1AIXH 2VU8E 1KYNA 2UUFB 1S81A 4BNRA 3URDA 4AORA 1EPTA 5DK1A 3A85A 5FCRA 2Z7FE 1FY5A 1UCYE 1L1JA 2OC1A 9ESTA 1AWHB 1PPFE 3TH3H 1O2TA 3ZVCA 4DG4A 4LZ1H 1D4PB 2ZZUH 1TNHA 1EASA 4ZUHA 2HGTH 4MPWA 3HKIB 1ZMLA 1C5RA 1TLDA 2Z94A 3S7HB 5A8ZA 4K3JA 1HLTH 1IQGA 2UWOA 3GY5A 4H6TA 4CRBA 1C1OA 1NFXA 1XUFA 3TK5A 5DP7A 3C1KA 4BAQB 2VVUA 4YOIA 2PR3A 2BD9A 4INLA 1TE0A 3UNQA 2ANMH 3TK6A 1SFIA 1FN6A 1VJAU 4D7FA 3NKKA 2BOHB 3VB4A 4AYVB 3TJUA 1TBZH 1GMCG 2JH5D 4NSYA 2ZTXA 1K21H 4YT6H 2C3SA 1RRKA 3HATH 3OTJE 2UWPA 1OWIA 2FOHA 2GCHF 2ZDVH 1G37A 2H5DA 4B2CA 1W0ZU 3VB7A 5A0BA 1FONA 1RD3B 2C4FH 1YLDA 1T7CA 3A7XA 1O2ZA 5GWZA 3T26A 1L1NA 4WVPE 1OPHB 4GVUA 3RXAA 5L2ZH 5L30H 1XKBC 1VR1H 1GBKA 4UFDH 2BDIA 2Z3DA 2KAIA 3I78A 1FV9A 2J4IA 4OGYA 2RA3A 2B0FA 1DITH 6GCHF 4WMFA 1Y59T 3H5CB 4ZKRU 3ZYEA 4GLYA 3P8NA 2ZGHA 1C5TA 2ZFQH 2VIQA 3MNBA 1MKXH 1O3DA 3AW1A 1LHCH 4MDSA 3QUMP 3PMHB 1LVOA 2FXRA 1V2PT 2A2XH 3ZV9A 1Z6EA 3MNXA 1Y3YA 2ZNKH 4MG3A 1THPB 5HXFA 1JRTA 1ANBA 3MU4A 2Y5GA 3SJKA 3K9XB 3SGBE 1H1BA 1N6XA 3P6ZB 5HGGA 2FTMA 5GDSH 3TU7H 3U8RH 2XC4A 3D49H 3KF2A 1BTYA 1DE7H 3GCTF 1H9IE 2XYAA 1HAOH 1GHVH 4ISHH 1AMHA 4O3UA 1GI7B 1WSSH 1S6FA 1W3CA 1GMHG 2GD4B 2WINI 4XBBA 1YPKH 2Y82A 2WYGA 2TRMA 1TYNA 4DVAU 2P3TB 1FNIA 5E2OA 3SV8A 2GMTC 3ZZCA 1O38A 2A32A 2PV9B 1MQ6A 5F6MA 1MQ5A 2BD4A 3A84A 1ZLRA 1GJ9B 1HJ8A 2J95A 4KTCA 1X7AC 1ELAA 4IS5A 3NK8A 1SOTA 1T8OA 4AX9H 1YLCA 1JIRA 1ABJH 1GDQA 5LH8A 1O3GA 2CF9H 2DE8A 3KNXA 3B9FH 1A3BH 4B75A 4DJZB 3V7TA 1FJSA 1O3MA 4X6NA 1BZXE 1O2WA 2BVSH 2ZQ2A 4AG2A 1NRQH 1AKSA 1ZTKA 3MO3A 3T25A 2VIOA 1ETTH 4O03A 5DPAA 2QV1A 2B9LA 1NPMA 1TPPA 1O2OA 1TRNA 2TGTA 3QZQA 1KIGH 2PTCE 2SGDE 2UUJB 1V2WT 1ELGA 1DANH 1EUFA 4GUXA 1F92A 3DA9B 4YOGA 4BAOB 2BXUH 2BY6X 4RKJB 1Z8JB 1P3EA 1TALA 4TY7A 3SNCA 1PPZA 3O8RA 4Q2KA 3GCHB 3ZZ8A 1GI0A 1O31A 4AOQA 1S83A 1OWJA 1G3CA 1LDTT 2WPKS 7KMEH 1AU8A 1SOZA 2VH6A 1BBRK 3BIVH 1YPMH 4OS2A 1UVPA 1ZGVA 2AGGX 1KDQA 2ZO3H 1C5MD 3T29A 4JCNA 3OY5U 2Y6TA 2ZFTA 1PPCE 1MD8A 1Z71A 1YKTA 2FZZA 5F03A 1AZ8A 1B5GH 5LPFA 1EB1H 1P2OA 1UTPA 1SHHB 1ZRKA 2QA9E 2ZDKA 5DP4A 1CA8B 2GV6A 2R2MB 2AERH 3S0NA 1AGJA 2W5EA 2O8LA 1T4VH 3RXSA 1E37B 3NWUA 1FY1A 2BB4A 3UY9A 4ABBA 2O8MA 1BTXA 3KQEA 5EPNA 2F9OA 1J8AA 5I46H 5JB9S 3TIUA 1W8BH 1T8LA 3M5NA 1CGHA 3U69H 1SG8B 3BIUH 3TVJB 1MH0A 2O8UA 3TITA 1DSTA 1N1LA 1D3QB 1MTNC 3RLWH 3Q00A 2SFAA 1ETRH 4WF8A 4FUEA 1HCGA 3P8FA 4JYUH 4X6OA 4FUGA 2A7CA 4NA9H 5F8XA 1C5NH 5FCKA 3GY7A 1L4DA 1V2QT 5T6DA 1O30A 1FXYA 1GVLA 4WWYA 5IYTA 1G3BA 1A1RA 1K2I1 3ATKA 2Q1JA 1XUJA 3PTBA 1K1JA 2V3HH 2AGEX 1QTFA 1TQ0B 3L33A 4NZQA 2VIWA 4TPIZ 4NSVA 1EJNA 3M5MA 2QYIA 1RTLA 5CHAB 1TB6H 2J94A 1GGDB 1K1PA 1MCVA 1WYKA 2F83A 3BV9B 1DLKB 2F9PA 3LGTA 4ABEA 8KME2 1EX3A 1G3EA 3KGPA 2PKSC 1GJ7B 1HDTH 2HNTE 9LPRA 1DY8A 2OD3B 2W7SA 3EDXB 1EATA 3GY2A 1SGQE 2XXLA 2FOFA 4BTIB 1IQIA 1QRXA 3T27A 1TWXB 1WCZA 3LGIA 3LT3A 5E0GA 1GCTC 2D2DA 1FN8A 1GHYH 2ZPSA 3ODDA 4A1VA 3AW0A 3Q3XA 4BOHA 2G52A 4IMQA 1QB6A 1O2GH 4Y11E 3E16B 4ZXXH 1ZPZA 2BX4A 1TABE 4JMYA 4YLQH 3B23B 1HPGA 1ELCA 2BLQA 3VXFH 1L2EA 4X1QU 3KHVA 1ORFA 1QFKH 3M61U 3LPRA 4QT8C 4KGAA 5EQSA 1AZZA 2B7DH 3A82A 1ZMJA 2JKHA 1YM0A 1AWFH 2IN2A 6GCHG 3ZVEA 1YPEH 3STIA 1GHZA 1JWTA 1BRUP 2VNTA 5F8ZA 3SJIA 1C1SA 1PPBH 4ZXYH 4DCDA 2J2UA 3GICB 2DUCA 3RXQA 4D76A 1AO5A 1PQ7A 2KAIB 2ZEBA 3ZZAA 3RXEA 2F9UA 2FIRH 1TGSZ 3ZZ7A 1O2QA 4CR9A 4DY7B 4GCHG 1LKAA 4NFEA 2ZPQA 1ZHRA 3ZZ9A 1GHWH 2QXHA 3BEIB 3BTFE 3RMNH 1UCYH 1Y5UT 2PLXA 5EPYA 3STJA 3RXBA 2CV3A 3RXRA 3F9GA 2WUBA 2CF8H 1GJAB 4ASHA 3UR9A 1ZTLA 5HMAA 1WTGH 1HNEE 1O3PB 3FFGA 1LHFH 2ZCKP 4HTCH 1MBQA 1SL3A 5JBCS 1MBMA 3RDZA 1EP5A 2FLBH 3EA9A 5GXPA 3A83A 3MH6A 1ELFA 2Y81A 3G01A 4LOYH 5L2YH 1QJ6B 1Z8GA 3E0PB 2P3UB 1HB0B 2QC2A 1DVAH 4TY6A 3V0XA 1FDPA 3MHWU 3LGYA 1O3NA 3QZRA 4CREA 1TRMA 5TCAA 1SC8U 3HK3B 1V2LT 1DY9A 4MPVA 1GBFA 1V2MT 2F9BH 3U1JB 1BTHH 4OS5A 4U32A 1LHDH 1O33A 1GHAF 1T31A 3TNTA 2V6NA 3DHKH 4ISNA 5A09A 1XUIA 3EYDA 1MU6B 3MU0A 4ABHA 3SJ9A 2PSXA 1OWEA 2TIOA 3SU6A 1TPAE 4MNYA 3ZV8A 1BBRE 3PMAB 1W7GH 2WV5A 3ATWA 1QL8A 1NRPH 2TGAA 1C5QA 1UK4A 3BTDE 2D8WA 3M3VA 2Z9GA 3TH2H 3BTHE 3MH4A 1YBWA 5EXMA 2ODQA 1E36B 5LPEA 2B5TB 5EQQA 2C8XB 4XFQA 2FS9A 2BVRH 3D65E 3GOVB 3SU5A 1C9PA 3K6YA 5A8YA 3KL6A
chains in the Genus database with same CATH superfamily
2H2ZA 3RC6A 2QGRA 3SZNA 1B7XB 4WH6A 4X1NU 1KXBA 3SUEA 2Y80A 1PFXC 2Z9JA 1IOEA 3F1SB 1HFDA 1EJAA 2VIPA 3HKJB 1Z1JA 3U8TH 4UDWH 3VB5A 1EAWA 1TPOA 1UCYK 2ANKH 1V3XA 3F0PA 3KYFA 4JK5A 3WY8A 3QX5H 2ALPA 1TPSA 1U6QA 1O5GH 3RXMA 5FX5A 1MZDA 4Z0KA 4FUHA 1C2MA 1C5ZB 3VB6A 1BMNH 2ZDLA 4OS7A 1CT0E 2P95A 3PROA 4A5TS 1ELVA 3BF6H 1LQEA 1A5HA 3LKWA 3SUFA 5EODA 1NY22 5CMXH 1KSNA 2G4UA 1FIZA 1GJ5H 1HAVA 2CGAA 3RXVA 1T8NA 3MO9A 4IC5A 2VGCC 4AYYB 3MO6A 4E7NA 1LTOA 4NZLA 3I77A 2Z3CA 2WV4A 2YNBA 4ABAA 4R0IA 4K5ZA 4GPGA 2FODA 1OSSA 4YOJA 3FKSD 1GBHA 2WPMS 4B6EA 1TNGA 4DIIH 5C17A 5C3NA 2FS8A 4U01A 7LPRA 1INCA 1PPEE 1WV7H 3UQOA 1E79D 2XWAA 1OWHA 2OQUA 1NT1A 1CA0B 2ZHFH 1RIWC 2VBCA 1GG6B 2C93B 2EEKA 4FU8A 4X2WA 1P06A 1SGEE 3UOPA 1WBGB 3SV2H 4MPUA 3GDUA 4O97A 2ZC9H 2M5TA 3KEEA 4FUBA 2ZFFH 3MU1A 1P10A 3QDZB 3CS0A 4NWKA 1WUNH 5E0HA 2B8OH 5DSFA 4BAMB 5EJZA 1ZMNA 3KQ5A 1J17T 3GCTG 4I33A 5EJ1A 1TGNA 5GPIB 4OGXA 3NRLA 1IQMA 5EGMA 3T28A 1ELEE 1J14A 1Z6JH 1O2RA 2VWMA 3UQVA 2ZECA 1THRH 5BRRE 1TRYA 2BVXH 4XBCA 1KTSB 1PQ5A 3DFJA 5SGAE 1DM4B 1GBJA 2P8OB 5H4IB 1F0UA 4RT0A 4ZROA 7ESTE 2FMJA 1G2LA 1LVBA 2BQ7B 1JRSA 3BG8A 2IOTA 1G32B 1C5XB 2TBSA 3RXDA 2NU1E 4HZHA 1MUEB 3RXKA 1O2SA 3BTWE 1C5YB 1SKYE 3QO6A 4X1PU 3RXHA 2RDLA 5EXLA 2HPPH 4A6LA 3EE7A 3RXTA 2XBWA 3LONA 1CBWC 1UTKA 2HALA 1MD7A 2J34A 3BTME 1UVSH 4MNWA 3LC3A 4Q7XA 1D6WA 1BBRH 4JZDH 4DURA 2PSYA 3GCOA 4ISOA 4IBLH 2AMDA 2GVFA 4ZHMU 3N7EA 1P9UA 2HLDD 2J38A 1VJ9U 2P94A 2GTBA 1BTWA 1WDIA 1DSUA 3EAJA 2SGEE 3W1EA 4THNH 1C1WH 2Z9LA 5KEDA 3KN2A 1HGTH 1P05A 1V2UT 1BHXF 5B6OA 2NU3E 4DIHH 2H9HA 2YOLA 1BMAA 1GVZA 1YGCH 4X1RU 1BOQA 2VJ1A 3UR6A 2JH6D 4WY3A 2ZFPH 3RXUA 3S7KB 1C1UH 3PMBB 1ZHMA 1T8MA 4UEHH 1FY8E 1CGJE 1MCTA 3SQEE 4OM9A 4D7GA 1AUJA 1THSH 4CHAB 4BTTB 5KGOA 2P16A 1QB9A 3SI3H 1IAUA 4XSKU 3PV2A 1FQ3A 3PRDA 4KTUA 2PW8H 4UFGH 1ANDA 1GBDA 1SR5C 1A0HB 4IC6A 3ODFA 1UK2A 4M7GA 3E1XB 1O2HA 1SGTA 1YPHC 2AHME 3T2NA 1N8OB 3RXGA 3GYLB 1QHRB 3H09A 2OBOA 2ZGBH 1C2JA 2C90B 1AE5A 2FI5E 1B0EA 1GCDA 3RXIA 3VB3A 3KQBA 1VKYA 2ALVA 1Z7KA 1MZAA 3SV9A 5A0CA 1DWBH 2AH4X 3PV5A 1RGQA 4YTAA 2QY0B 1P0SH 2VWNA 3LH1A 5JPMH 1XUKA 1QBVH 1MAYA 3ZVBA 1Q2WA 1ELTA 1WOFA 2JH0D 3FVFB 1H8DH 3BEFB 4DGJA 3A80A 4ZAEA 4OS6A 3PWCA 1H9LB 4TPYA 4FUFA 2HOBA 4K2YA 1UTOA 1C4V2 1UVTH 2ANYA 3L3TA 2G81E 1LMWB 5BPEA 4X2YA 3JZ1B 5PTPA 2AYWA 2FM2A 2VIDA 1V2OT 1Z8RA 1DWEH 1EAXA 2GCTC 1ZZZA 5E8EH 3ITIA 3PO1B 2PKAB 3HPTB 2BDAA 1CT4E 4UFFH 4Q7ZA 1Y5BT 2Q6DA 3O8DA 1O3BA 2FPZA 3O8BA 2VH0A 1ZPCA 1C5WB 1OP2A 4ZKSU 1LCYA 2CN0H 4F55A 3M35A 1A61H 2BZ6H 1GJ6A 1HAYB 2A4OA 2J92A 4OS4A 1ARBA 3A86A 4KELA 4X0WU 1YPGH 2BHGA 1AN1E 4MPXA 1C1MA 1SSXA 2TGPZ 3U1IB 2SGAA 2FDAA 3L6PA 5CHAC 3MWIU 2GKVE 1OKXA 1DLEA 3OEHD 3LIWA 1O2VA 1J9CH 3M5OA 2BD3A 2G00A 5ETXA 1DUEA 1A0JA 1G30B 2G51A 1QL7A 5C0UA 2BD5A 3CS7A 3BG4B 5FPSA 1DICA 5HM2A 1C1NA 1RJXB 1F0RA 4ZKOU 2W6ID 1AQ7A 3DSPA 1D6RA 1C2LA 3TH4H 2ZTYA 2R3YA 4I8JA 3W94A 2ANWA 1ETSH 3SW2B 4X8SH 4HG6A 1PPGE 3NZIA 1C2IA 1EZXC 1HJAC 2K8IA 4A1XA 2WPJS 5FPTA 4I7YH 3FO8D 1SGFG 2ZKSA 2H1UA 1P02A 1UK3A 2A5AA 1XVMA 3E90B 2GCHG 2CJIA 2THFB 3SGQE 2AS9A 5ABWA 1SI5H 1GBMA 1TBQH 1SQAA 2J5UA 2QIQA 4LK4A 1NN6A 1C9TA 5LPRA 1JXPA 2ZU5A 3SNDA 5C67A 2C8ZB 2BTCE 1IQHA 1O36A 2PUXB 3W95A 1AY6H 1K9OE 1EAUA 1LVYA 2I6QA 1GMDF 3PTNA 4I8GA 2FX4A 5A2MH 2BDCA 2QXIA 2BLVA 2P93A 3TJOA 4CH8B 1AKSB 4J2YB 1WAYB 1QNJA 1EKBB 3RMMH 2NU2E 4YZUA 3PM3A 1MABB 3AAVA 3UWJH 1OHHD 4Y8XA 1YY3A 1TNLA 2J9NA 4BAHB 4FVDA 7GCHG 4GAWA 3OU0A 2BY7X 1XX9A 3VPKA 3GY8A 5JBBS 1NRSH 1GI6A 1DWDH 1AFQB 4FVBA 1P11E 2ZA5A 2ZGJA 2GT7A 3WWBA 4ZHLU 1C1RA 2OLGA 3MI4A 1YC0A 1NO9H 1Y8TA 2IPHA 1KTTB 4K8BA 2SNWA 2XBXA 2XNDD 1UTMA 3K2UA 1HUTH 1V2TT 3E91A 2PGBB 3BEUA 4WJG2 1QIXB 5T6GA 3BTGE 2FI3E 3CP7A 4NIXA 3T5FH 4IN1A 3RM0H 1MTUA 1WQSA 1QGFA 2A2QH 4IW4E 1O3IA 1Y3XA 1KXFA 1O39A 1E1QD 3S9CA 1GI2A 2BDHA 4K60A 1P2QA 4X6MA 4Q80A 5GJ4B 3T62A 3VGCB 4BAKB 5FAHA 1ZPBA 4E05H 3P70B 4NIWA 1O5DH 4B2AA 1AHTH 1VITF 1VITH 4ABJA 2ZHEH 3RXCA 3QK1A 1TGCA 2UUKB 3ZZBA 5T3HA 1QQUA 1V2RT 1W13U 2BDBA 3VG8A 2BD7A 2WV9A 4WMEA 1YPLH 1D3PB 2BOKA 2ZF0H 3TGIE 3E8LA 1Q3XA 1IQKA 5FXLA 1AB9B 4AFQA 5DP3A 2H5CA 2AEIH 2Y5FA 1P2IA 3NPSA 1F5RA 1ARCA 1T32A 3ZZ6A 1TNJA 1CSOE 1ZJKA 1GVKB 2FP7B 1BQYA 3ZVFA 3D23A 3DFLA 1G36A 3A87A 1S82A 1SGFA 3MYWA 2OBQA 1ANEA 1OS8A 1EZSC 2A7JA 1HAHH 1LPZB 1H8HD 4D9QA 3TJNA 4IMZA 1AD8H 4JYVH 3SZEA 4GCHF 2BZAA 1SGRE 1ANCA 1BCUH 2UUYA 1TA6A 3GS9A 3FZDA 3EGKH 5G4BA 1HAGE 2EQNA 2P59A 1AVXA 3GY4A 1GL0E 1CQQA 1SFQB 4CHAC 1QL9A 1C5PA 1GJ4H 2K1QA 4VGCB 1FZZA 4DW2U 5J4SA 1F0SA 1F5KU 5F8TA 3OEED 2R0LA 4CRFA 1P2KA 1HIAB 3ZYDA 4X8VH 1V2VT 1EQ9A 5EU8A 2HNTC 1C5SA 4YT7H 2ASUB 3F9FA 1BTZA 1E35B 1UTQA 3V13A 4IGDA 3GY6A 2QF3A 3EE0B 4B73A 1OXGA 1GI1A 1GDUA 2QAAA 3SU3A 2FOBA 3RMOH 2FOMB 3RC5A 2EI6A 1EZQA 2ZCHP 1F0TA 1O32A 4FU9A 2TGDA 1H9HE 1GMDG 1WXRA 3K65B 3ZIAD 1YWUA 4Y8YA 1B0FA 1P2JA 2OQ5A 2YMSD 3AVZA 1QRZA 4SGBE 1GBCA 2C8YB 2OP9A 3C27B 4SGAE 5FL7D 1S0RA 1NU9A 3AASA 5J4QA 3ZVDA 4RSPA 1T4UH 1CVWH 1XUGA 2R2WU 3SU0A 5GIBA 1OWKA 3A8DA 1MKWK 1Z1IA 1LQDB 2QN5T 4YM9A 2LELA 3BG4C 3M7QA 1ZRBA 3VXEH 4NG9H 1HXFH 1NFUA 1P12E 3AAUA 1QBNA 2LP6A 3UNRA 1A3EH 1O34A 1S6LA 3PMJA 4K1EA 2FLRH 1SGYE 3KQCA 1CGIE 1GI5A 1W12U 3ESTA 3MFJA 1D3TB 1Q31A 1NU7B 2A5IA 1SQRA 2GDDA 1TMUH 3RXJA 3ZVGA 5C20A 5LGOA 2W3IA 2K0QA 1J16A 2PGQB 2ZFRH 4BANB 2EC9H 1ESBA 1W0KD 2CK3D 1O3FA 4I32A 1P3CA 2BY5X 2ZHDA 1UO6A 3FAOA 2R9PA 4NCYA 3RLYH 4LZ4B 4Y7BA 1JMOH 4UFEH 1EOJA 5IDKA 1LPGB 2GX4A 4MNVA 4TWWA 3SGAE 3N99A 1O37A 3SV7A 4BTUB 5JB8S 2GV7A 1C1VH 1O0DH 1SGPE 2FYQA 2ZU4A 1SLWB 1P03A 3DT0H 5AHGH 2A45B 5B6LA 3A7TA 1P01A 3ELAH 1CA0C 1SQOA 3F2FA 1C4U2 1YPHE 2FO9A 4BXWA 4IN2A 4Y7AA 2BX3A 1FY4A 2G8TA 1S5SA 7GCHF 4AZ2B 1J15A 2LNCA 1BUIA 2AFQB 1P9SA 1RTKA 1HAPH 1IQFA 4ZMAH 4X8UH 1TX6A 4MLFB 1CO7E 1XKAC 2RCEA 2P3FH 4D9RA 2G4TA 5TJXA 1O2PA 3TPIZ 4B76A 3LJJA 1C2KA 4Y0ZE 1P57B 1VCPA 4P02A 1PYTD 2W7UA 4MTBA 1O2KA 1GBAA 1KXEA 1W0YH 1LHGH 1GBTA 1A4WH 1PQAA 1JIMA 1BHXB 3MH5A 4AFUA 1CHGA 1AFQC 4NFFA 1HAIH 3ZZ3A 3ATLA 4H42U 1GI8B 1Y5AT 2VWOA 2BY9X 1MMJN 3VGCC 4X2XA 5HM9A 1S0QA 3UPEA 4CR5A 3M3TA 1K1MA 2SGQE 2FOGA 1IQNA 2XCNA 1KDQB 1O2NA 3PYHA 3SU1A 1GBEA 3GDSA 3KQDA 1TMTH 2ZCLP 1DFPA 2ZPRA 4TYDA 3RU4E 1SMFE 1NFWA 1UTJA 4AB8A 1EAIA 3UIRA 4Y79A 5JBAS 2KCYA 2JETC 2M2AA 3LJOA 2XNIA 2BDGA 1GCTB 2A4RA 3EA7A 3FZZA 3FP6E 3OAAD 2SNVA 4F49A 1YYY1 3P8OA 5C5OA 4YLUA 2GMTB 4F48B 3UREA 4JYTA 2G55A 2WPHS 2V3OH 3TNSA 2ODYB 3LGWA 3RXFA 2ZHQH 1O3HA 2PTNA 1O2IA 1W7XH 3QGNB 3SBKA 4Y0YE 5EQRA 2JJ2D 2ULLA 1K0HA 5F53A 4DT7B 1NM6A 6LPRA 1LO6A 1G9IE 4Y6DA 2HRVA 2A1DB 1QZ8A 2KCPA 4NA7A 2G5VA 2H9EH 2ODPA 1NS3A 2ZU1A 3D62A 4FUDA 2QF4A 1KXDA 1O5FH 3A7VA 4JZEH 3A8AA 3MH7A 4O9VA 3P8GA 3GCNA 2ZGCA 4O3TA 5C2ZA 1MAXA 3MTYA 4KTSA 1O35A 1L0ZA 2Q6GA 3KCGH 2A4QA 1YCPK 1P04A 2R0KA 4CRDA 4E06H 4FUIA 3N7OA 1A0LA 2F9NA 2J97A 4H4FA 4VGCC 3U9AH 4RT1A 4X6PA 3FOAA 1GBLA 1FAXA 1ABIH 1CHOF 2A5KA 3F9EA 1SVPA 4U2WA 1GI9B 5EG4A 3TJVA 2RG3A 3V12A 1FY3A 6CHAB 2FESH 2L6OA 1V2KT 4I8LA 2Y7XA 5DGJA 1O2YA 2PKAA 4NIYA 4I86A 4AC9A 1FI8A 4AFZA 1GDNA 2QXJA 5JDUB 4FUCA 1ZYOA 3Q3KA 1BIOA 1BJVA 1GMHF 2WUCA 1F5LA 2AMPA 3O8CA 1GBIA 1O3EA 1BRBE 1KXAA 3JZ2B 3BTEE 3SHCH 3QTOH 3S69A 3HK6B 3RMLH 1GG6C 1BTPA 2ZTZA 3HGNA 1SPJA 1C1PA 5E2PA 2NWNA 1KLJH 1O3JA 1HYLA 1EP6A 4RN6A 1QCPA 4MVNA 3H7OA 1XVOA 1QB1A 2GP9B 2V35A 2CXVA 1MTSA 1MTWA 2PUQH 1AVGH 1IQJA 1HV7A 1QRWA 5GCHF 4CBNA 1ZOMA 3GDVA 4HI3A 3ENSB 4A1TA 2QF0A 3F2GA 3LGUA 1Y3UA 3A88A 4TWYA 4NWLA 1VGCC 1TONA 3M7UA 2GCTB 4B2BA 1K28D 2I6SA 3PB1E 2J98B 2ILNA 1HAXB 1BTUA 1K1NA 2KZ4A 1NROH 2EA3A 3ZZ5A 3UUZA 5FBIA 1UVUH 3M36A 3PV4A 5C94A 1XUHA 1MKWH 3R0FA 4JK6A 1C2FA 3SN8A 1GHAG 2KCOA 2OC7A 4B74A 1SGIB 2RDEA 1O2MA 2BYAX 3URCA 6CHAC 3UOUA 2BXTH 1O5BB 3H7TA 1F7ZA 2Q6FA 3OX7U 1L4ZA 2F43B 2HLCA 1AI8H 1TOMH 1ZJDA 2VIVA 3K6ZA 3F2HA 1GMCF 2Y5HA 1TGTA 3FN8A 1QQ4A 1BMMH 2BQWB 3UTUH 1QR3E 4D8NA 1C1TA 3E6PH 3MOCA 1FUJA 3E3TA 4FXGH 1JBUH 2D1JA 1CU1A 8GCHF 1FAKH 2OC8A 3B8JA 4WXIA 1ESTA 3EQ0H 4XBDA 1KLTA 1A5IA 2BD8A 5FBEA 3ZZ4A 2PKSB 3BTQE 3S9AA 3QGJA 1BMLA 1LHEH 4P00A 2V7QD 1SGCA 5K7RA 1AVWA 3NXPA 1COWD 3RU4D 1P8VC 1SGDE 3BN9A 1DDJA 3LGVA 1HAZB 1DPOA 4X2VA 4E7RG 1BJUA 4CRAA 3SUGA 1NRNH 4Y71A 1XM1A 1BRAA 1YPJH 3R3GB 1W2KH 1C4Y2 5ESBA 2XOKD 4K1SA 1VITG 4Q63A 5K0HA 4PROA 3LU9B 1ZHPA 2QXGA 1QY6A 2Z9KA 3IITA 3F0OA 2AIQA 4Z1MD 2V0BA 3U28C 4AG1A 2VINA 1ZR0A 5DKMA 1A46H 1ACBE 1DWCH 1NTPA 4WXVA 1GBBA 2JETB 1C1QA 2G5NA 2FI4E 1O2UA 1GJDB 1O3KA 3Q77A 2H6MA 3SU4A 2STBE 3RXOA 1NZQH 1OP8A 1HXEH 4ABIA 2EY4C 2XBYA 4AFSA 2KFWA 4INKA 3IG6B 1TQ7B 3BTKE 2XC0A 4ZHAA 4Y76A 1OYQA 1C2HA 1TA2A 1G3DA 1BDAA 2ZWLH 3LC5A 1O2XA 1XMNB 1O3AA 3SNBA 1MKXK 1K1IA 1DXWA 2BM2A 5C1YA 2ZU2A 1GHBG 1KY9A 2DE9A 5A0AE 3OTPA 3UWIA 1VGCB 1GJ8B 3SJOA 4FUJA 3VFEA 1UHBA 3QN7A 1AB9C 1JOUB 1ZGIA 4K69A 4WMDA 3M37A 2AGIX 1TGBA 3IWMA 4CBOA 2P8OC 3PLPA 5A8XA 1TAWA 1O3LA 1RFNA 1DS2E 2ZDNA 1IQLA 1VCWA 2GT8A 1A2CH 1AE8H 4YESB 4NGAH 3MQKC 1KLIH 2GZ8A 2XBVA 3TK9A 1K1LA 2ZU3A 1SQTA 2WPLS 3OSYA 2PFEA 1PPHE 1TX8A 2Z6BD 2ZG0H 2BDYA 1ELBA 1K22H 1HBTH 4GHTA 4ZKNU 1KXCA 8ESTE 4KP0A 1SHYA 2XWBI 3FANA 1RTFB 1L1GA 1QJ1B 4DT4A 4INHA 1NFYA 1RS0A 2PHBA 3EA8A 1DUAA 3RP2A 2AIPA 2WSSD 2NU0E 3SU2A 1K1OA 5DP8A 1QURH 3SNEA 2GZ9A 5HIYA 3GISB 1A5GH 1EB2A 3OY6U 5TCCA 2C8WB 2J98A 2JDID 1GWAA 3DD2H 3N7DA 1SLXB 1C2GA 1FPHH 3M5LA 1TNKA 5C5NA 1O2JA 2KX4A 4R8TB 2OUAA 5AFZH 1DOJA 1TMBH 2ZQ1A 2O9QA 1CHOG 4B1TA 1S6HA 1CT2E 3HGPA 5I25A 2WPIS 1O5AB 2ZHWH 4ABDA 1PJPA 2XCFA 2BQ6B 1C2EA 1V2NT 3PLKA 3MU5A 1TBRH 1HAVB 2ESTE 2BMGB 5FHTA 2EI7A 1A7SA 4ESTE 5DP6A 4JZ1A 3TGKE 1OP0A 3SO3A 3AK5A 1WQVH 5CE1A 1RXPA 1GL1A 4OS1A 2ZI2H 2HNTF 4I31A 1D9IA 3ZVAA 2STAE 1Z8IB 4DOQA 1UW7A 1W10U 2OC0A 5DN6D 5DO4H 3BTTE 2FOAA 4ACBA 2F9VA 2WZQA 4HFPB 4BXSA 2BLWA 4ISLA 1BRCE 3FP7E 1W14U 1VCQA 1MU8B 4AB9A 2ZFSA 4WH8A 5AFYH 2A0QB 1TOCB 1OWDA 4K1TA 1O3CA 2YMSB 3QTVH 2EI8A 3E0NB 2ZDAH 3S9BA 2A31A 2IJD1 2FOCA 1PYTC 3A7YA 2VB0A 2GDEH 1GGDC 3MNSA 1OOKB 1V2ST 4ISIH 3A7ZA 3SI4H 3KIDU 1KMHB 1C5UA 1HJAB 4MNXA 5AVDA 1E34B 2GJGA 1FPCH 1TNIA 3MNCA 5E0JA 5JYIA 3PLBA 4ABFA 1DT2A 4UONA 4AGJA 5T6FA 1V6DA 1BITA 2W26A 3SNAA 3RXPA 1G2MA 2VVCA 8GCHG 3MMGA 3OYPA 2BY8X 3A7WA 4ABGA 2ZDMA 3U8OH 3UNSA 1SB1H 2NU4E 1GJBB 5HYOA 5EW1H 2O8TA 1XXDA 5L6NH 4I8KA 1EOLA 2F91A 1UTLM 4Y10E 1NRRH 2XTTB 3Q3YA 3RC4A 1H8ED 1SGNE 3SOSA 1YCPM 3SV6A 5EW2H 3GYMA 4UD9H 3PWBA 1EJMA 1FLEE 1RIWB 3ATIA 3P95A 1VZQH 4NA8A 1OX1A 3VEQB 1ESAA 1EPTB 1H8IH 2CHAC 2GZ7A 2ZP0H 4CRCA 1AFEH 3MU8A 3Q76A 4MQAA 1O5EH 3ATMA 1E1RD 1TFXA 4J1YA 1W11U 3GY3A 1GI3A 3RU4T 4AN7A 2CMYA 3NCLA 3FP8E 2QCYA 3GCHC 4I8HA 5GCHG 3SJ8A 2Z9IA 4JZFH 1V2JT 5DP9A 3UFAA 3PO1C 1AUTC 2AMQA 1O5CB 1ID5H 1SBWA 6ESTA 1BT7A 1BA8B 1WU1A 2IJOB 4K8YA 1YCPH 1UVOA 1E38B 2BLOA 4GHQA 3LH3A 1N6YA 1FIWA 2SGPE 5AF9H 2OTVA 3RXLA 1GPZA 3QLPH 2F3CE 1Y3WA 1PQ8A 1QA0A 2HVXA 3SUDA 4RI0A 3A8CA 4X8TH 5C0TA 4A7IB 3P17H 4X1SU 2WYJA 4LXBH 5EXNA 1ZSKA 1UTNA 1C5VA 1FMGA 4NIVA 2H9TH 4KKDA 1F2SE 1DXPA 3P92A 1P2NA 1NC6A 2LPRA 4Q7YA 2PWXA 1NBMD 3NUMA 2WPDD 1QJ7B 2VGCB 4Z6AH 3F6UH 1UJ1A 1TX7A 1P09A 2VWLA 1LKBA 4YO9A 2RA0A 1ZSLA 3DUXH 2BD2A 3RM2H 2OCVB 5FX6A 2TPIZ 1EXFA 1XXFA 1C2DA 2SGFE 4AGKA 1NESE 1QBOA 2UWLA 1ELDE 1EPTC 1N8OC 2CHAB 1IQEA 2FWWA 1YP9A 1O2LA 3SORA 1H4WA 2R3UA 4H6SB 1MTVA 4HGCA 4RKOB 5EOKA 5DG6A 4FU7A 3A89A 4JZIA 1C5OH 1S85A 1P2MA 4XE4A 5DJ7A 3QWCH 5C1UA 2FX6A 2HVYB 3U98H 1IHTH 3CENA 4CRGA 2HPQH 1ZTJA 4Y8ZA 1YF4A 4UE7H 4XOJA 4F4OC 5FPYA 1OYTH 2ZIQH 1IHSH 1D3DB 2A7HA 1E0FD 2W6JD 1HIAA 2Z3EA 5ESTE 3V3MA 1ZSJA 1UMAH 1C5LH 4XDEA 2VVVA 1LVMA 3TLOA 1WTHD 2D26C 2OXSA 1LPKB 4A92A 4ZH8A 4U30A 4M9FA 3M3SA 2A4GA 1GI4A 1GJCB 2FOEA 3TGJE 1UHBB 3LDXH 2L74A 3ZZDA 1O3OA 3BSQA 3SHAH 4B6FA 2FEQH 2HWLB 3A81A 4B71A 4GSOA 1BB0B 1GHXH 2YNAA 1DX5M 1SLVB 2GGVB 2Y7ZA 2XRCA 8LPRA 1S84A 2FYRA 1CBWB 1SLUB 1EZUC 2FTLE 2W3KA 2XW9A 3I29A 5JBTA 1HRTH 3LOXA 1CE5A 1MTNB 3F9HA 1GHBF 4CH2B 5C1XA 1M9UA 3A8BA 2O8WA 2XC5A 3SQHE 1HJ9A 2OINA 2ZGXH 3M7TA 3F68H 1Y3VA 3RUOA 1QA7A 5DP5A 1TIOA 1AIXH 2VU8E 3CNRA 1KYNA 2UUFB 1S81A 4BNRA 3URDA 4AORA 1EPTA 5DK1A 3A85A 5FCRA 2Z7FE 1FY5A 1UCYE 1L1JA 2OC1A 9ESTA 1AWHB 1PPFE 3TH3H 1O2TA 3ZVCA 4DG4A 4LZ1H 1D4PB 2ZZUH 1TNHA 1EASA 4ZUHA 2HGTH 4MPWA 3HKIB 1ZMLA 1C5RA 1TLDA 2Z94A 4TT3D 5A8ZA 3S7HB 4K3JA 1HLTH 1IQGA 2UWOA 3GY5A 4H6TA 4CRBA 1C1OA 1NFXA 1XUFA 4XD7D 3TK5A 5DP7A 3C1KA 5EJLA 4BAQB 2VVUA 4YOIA 2PR3A 2BD9A 4INLA 1TE0A 3UNQA 3OFND 2ANMH 3TK6A 1SFIA 1FN6A 1VJAU 4D7FA 3NKKA 2BOHB 3VB4A 4AYVB 3TJUA 1TBZH 1GMCG 2JH5D 4NSYA 2ZTXA 1K21H 4YT6H 2C3SA 1RRKA 3HATH 3OTJE 2UWPA 1OWIA 2FOHA 3DSGA 2GCHF 2ZDVH 1G37A 2H5DA 4B2CA 1W0ZU 3VB7A 5A0BA 1FONA 1RD3B 2C4FH 1YLDA 1T7CA 3A7XA 1O2ZA 4YXWD 5GWZA 3T26A 1L1NA 4WVPE 1OPHB 4GVUA 3RXAA 5L2ZH 5L30H 1XKBC 1VR1H 1GBKA 4UFDH 2BDIA 2Z3DA 2KAIA 3I78A 1FV9A 2J4IA 4OGYA 2RA3A 2B0FA 1DITH 6GCHF 4WMFA 1Y59T 3H5CB 4ZKRU 3ZYEA 4GLYA 3P8NA 2ZGHA 1C5TA 2ZFQH 2VIQA 3MNBA 2PP6A 1MKXH 1O3DA 3AW1A 1LHCH 2YMSC 4MDSA 3QUMP 3PMHB 1LVOA 2IPQX 2FXRA 1V2PT 2A2XH 3ZV9A 1Z6EA 3MNXA 1Y3YA 2ZNKH 4MG3A 1THPB 5HXFA 1JRTA 1ANBA 3MU4A 2Y5GA 3SJKA 3K9XB 3SGBE 1H1BA 1N6XA 3P6ZB 5HGGA 2FTMA 5GDSH 3TU7H 3U8RH 2XC4A 3D49H 3KF2A 1BTYA 3WW7A 1DE7H 3GCTF 1H9IE 4TSFD 2XYAA 1HAOH 1GHVH 4ISHH 1AMHA 4O3UA 1GI7B 1WSSH 1S6FA 1W3CA 1GMHG 2GD4B 2WINI 4XBBA 1YPKH 2Y82A 2WYGA 2TRMA 1TYNA 4DVAU 2P3TB 1FNIA 5E2OA 3SV8A 2GMTC 3ZZCA 1O38A 2A32A 2PV9B 1MQ6A 5F6MA 1MQ5A 2BD4A 3A84A 1ZLRA 1GJ9B 1HJ8A 2J95A 4KTCA 1X7AC 1ELAA 4IS5A 3NK8A 1SOTA 1T8OA 4AX9H 1YLCA 1JIRA 1ABJH 1GDQA 5LH8A 1O3GA 2CF9H 2DE8A 3KNXA 3B9FH 1A3BH 4B75A 4DJZB 3V7TA 1FJSA 1O3MA 4X6NA 1BZXE 1O2WA 2BVSH 3DCLA 2ZQ2A 4AG2A 1NRQH 1AKSA 1ZTKA 3MO3A 3T25A 2VIOA 1ETTH 4O03A 5DPAA 3SYJA 2QV1A 2B9LA 1NPMA 1TPPA 1O2OA 1TRNA 2TGTA 3QZQA 1KIGH 2PTCE 2SGDE 2UUJB 1V2WT 1ELGA 1DANH 1EUFA 4GUXA 1F92A 3DA9B 4YOGA 4BAOB 2BXUH 2BY6X 4RKJB 1Z8JB 4ACAA 1P3EA 1TALA 4TY7A 3SNCA 1PPZA 3O8RA 4Q2KA 2KR7A 3GCHB 3ZZ8A 1GI0A 1O31A 5CDFE 4AOQA 1FX0B 1S83A 1OWJA 3KYGA 1G3CA 1LDTT 2WPKS 7KMEH 1AU8A 1SOZA 2VH6A 1BBRK 3BIVH 1YPMH 4OS2A 1UVPA 1ZGVA 2AGGX 1KDQA 2ZO3H 1C5MD 3T29A 4JCNA 3OY5U 2Y6TA 2V3MA 3OE7D 2ZFTA 1PPCE 1MD8A 1Z71A 1YKTA 2FZZA 5F03A 2KM0A 1AZ8A 1B5GH 5LPFA 1EB1H 1P2OA 3WWFA 1UTPA 1SHHB 2QA9E 1ZRKA 2ZDKA 5DP4A 1CA8B 1NBME 2GV6A 2R2MB 2AERH 3S0NA 1AGJA 2W5EA 2O8LA 1T4VH 5HKKD 3RXSA 1E37B 3NWUA 1FY1A 5HIZA 2BB4A 3UY9A 4ABBA 2O8MA 1BTXA 3KQEA 5EPNA 2F9OA 1J8AA 5I46H 5JB9S 3TIUA 1W8BH 1T8LA 3M5NA 1CGHA 5T1VA 3U69H 1SG8B 3BIUH 3TVJB 1MH0A 2O8UA 3TITA 1DSTA 1N1LA 1D3QB 1MTNC 3RLWH 3Q00A 2SFAA 1ETRH 4WF8A 4FUEA 1HCGA 3P8FA 4JYUH 4X6OA 4FUGA 2A7CA 4NA9H 5F8XA 1C5NH 5FCKA 3GY7A 1L4DA 1V2QT 5T6DA 1O30A 1FXYA 1GVLA 4WWYA 5IYTA 1G3BA 1A1RA 1K2I1 3ATKA 2Q1JA 1XUJA 3PTBA 1K1JA 2V3HH 2AGEX 1QTFA 1TQ0B 3L33A 4NZQA 2VIWA 4TPIZ 4NSVA 1EJNA 3M5MA 2QYIA 1RTLA 5CHAB 2QF5A 1TB6H 2J94A 1GGDB 1K1PA 1MCVA 1WYKA 2F83A 3BV9B 1DLKB 2F9PA 3LGTA 4ABEA 8KME2 1EX3A 1G3EA 3KGPA 2PKSC 1GJ7B 1HDTH 2HNTE 9LPRA 1DY8A 2OD3B 2W7SA 5CHBA 3EDXB 5IK2D 1EFRD 1EATA 3UAIC 3GY2A 1SGQE 3DSOA 4FOUC 2XXLA 2FOFA 4BTIB 1IQIA 1QRXA 3T27A 1TWXB 1WCZA 3F3BA 3LGIA 2OK5A 3LT3A 5E0GA 1GCTC 2D2DA 1FN8A 1GHYH 2ZPSA 3ODDA 4A1VA 3AW0A 3Q3XA 4BOHA 2G52A 4IMQA 1QB6A 4ZCNA 1O2GH 4Y11E 3E16B 4ZXXH 1ZPZA 4ASUD 2BX4A 1TABE 3PRBA 4JMYA 4YLQH 3B23B 1HPGA 2JIZD 1ELCA 2BLQA 3VXFH 1L2EA 4X1QU 3KHVA 1ORFA 1QFKH 3M61U 3LPRA 4QT8C 4KGAA 5EQSA 1AZZA 2B7DH 3A82A 1ZMJA 5GNDA 2JKHA 1YM0A 1AWFH 2IN2A 6GCHG 2JJ1D 3ZVEA 1YPEH 3STIA 1JWTA 1GHZA 1BRUP 2VNTA 5F8ZA 2KCAA 3SJIA 1C1SA 1PPBH 4ZXYH 4DCDA 2WHXA 2J2UA 3GICB 2DUCA 1BMFD 3RXQA 4D76A 1AO5A 1PQ7A 2KAIB 2ZEBA 3ZZAA 3RXEA 2F9UA 2FIRH 1TGSZ 3ZZ7A 1O2QA 4CR9A 4DY7B 4GCHG 1LKAA 4Q4LA 4NFEA 2ZPQA 1ZHRA 3ZZ9A 1GHWH 2QXHA 3BEIB 3BTFE 3RMNH 1UCYH 1Y5UT 2PLXA 5EPYA 3STJA 3RXBA 2CV3A 3RXRA 3F9GA 2WUBA 2CF8H 1GJAB 4ASHA 3UR9A 1ZTLA 5HMAA 1WTGH 1HNEE 1O3PB 3FFGA 5EIYA 1LHFH 2ZCKP 4HTCH 1MBQA 1SL3A 5JBCS 1MBMA 3RDZA 1EP5A 2FLBH 3EA9A 5GXPA 3A83A 3MH6A 1ELFA 1YLNA 4XRNA 2RFKC 2Y81A 3G01A 4LOYH 5L2YH 1QJ6B 1Z8GA 3E0PB 2P3UB 1HB0B 2QC2A 2F4LA 1W0JD 1DVAH 4TY6A 3V0XA 1FDPA 3MHWU 3LGYA 1O3NA 4FETA 3QZRA 4CREA 1TRMA 5TCAA 1SC8U 3HK3B 1V2LT 1DY9A 4MPVA 1GBFA 1V2MT 2F9BH 3U1JB 1BTHH 4OS5A 4U32A 1LHDH 1O33A 1GHAF 1T31A 3TNTA 2V6NA 3DHKH 4ISNA 5A09A 1XUIA 3EYDA 1MU6B 3MU0A 4ABHA 3SJ9A 2PSXA 1OWEA 2TIOA 3SU6A 1TPAE 4MNYA 3ZV8A 1BBRE 3PMAB 1W7GH 2WV5A 3ATWA 1QL8A 1NRPH 2TGAA 1C5QA 1UK4A 3BTDE 2D8WA 3UB0A 3M3VA 2Z9GA 3TH2H 3BTHE 3MH4A 1YBWA 5EXMA 2ODQA 1E36B 5LPEA 2B5TB 5EQQA 2C8XB 4XFQA 2FS9A 2BVRH 5KECA 3D65E 3GOVB 3SU5A 1C9PA 2QE7D 3K6YA 5A8YA 3KL6A
chains in the Genus database with same CATH topology
2H2ZA 3RC6A 2QGRA 3SZNA 1B7XB 4WH6A 4X1NU 1KXBA 3SUEA 2Y80A 1PFXC 2Z9JA 1IOEA 3F1SB 1HFDA 1EJAA 2VIPA 3HKJB 1Z1JA 3U8TH 4UDWH 3VB5A 1EAWA 1TPOA 1UCYK 2ANKH 1V3XA 4JK5A 3WY8A 3QX5H 2ALPA 1TPSA 1U6QA 1O5GH 3RXMA 5FX5A 1MZDA 4Z0KA 4FUHA 1C2MA 1C5ZB 3VB6A 1BMNH 2ZDLA 4OS7A 1CT0E 2P95A 3PROA 4A5TS 1ELVA 3BF6H 1LQEA 1A5HA 3LKWA 3SUFA 5EODA 1NY22 5CMXH 1KSNA 2G4UA 1FIZA 1GJ5H 1HAVA 2CGAA 3RXVA 1T8NA 3MO9A 4IC5A 2VGCC 4AYYB 3MO6A 4E7NA 1LTOA 4NZLA 3I77A 2Z3CA 2WV4A 2YNBA 4ABAA 4R0IA 4K5ZA 4GPGA 2FODA 1OSSA 4YOJA 1GBHA 2WPMS 1TNGA 4DIIH 5C3NA 2FS8A 4U01A 7LPRA 1INCA 1PPEE 1WV7H 3UQOA 2XWAA 1OWHA 2OQUA 1NT1A 1CA0B 2ZHFH 1RIWC 1GG6B 2C93B 2EEKA 4FU8A 4X2WA 1P06A 1SGEE 3UOPA 1WBGB 3SV2H 4MPUA 3GDUA 4O97A 2ZC9H 2M5TA 3KEEA 4FUBA 2ZFFH 3MU1A 1P10A 3QDZB 3CS0A 4NWKA 1WUNH 5E0HA 2B8OH 4BAMB 1ZMNA 4I33A 1J17T 3GCTG 1TGNA 5GPIB 4OGXA 1IQMA 5EGMA 3T28A 1ELEE 1J14A 1Z6JH 1O2RA 2VWMA 3UQVA 2ZECA 1THRH 5BRRE 1TRYA 2BVXH 4XBCA 1KTSB 1PQ5A 3DFJA 5SGAE 1DM4B 1GBJA 2P8OB 5H4IB 1F0UA 4ZROA 7ESTE 2FMJA 1G2LA 1LVBA 2BQ7B 1JRSA 3BG8A 2IOTA 1G32B 1C5XB 2TBSA 3RXDA 2NU1E 4HZHA 1MUEB 3RXKA 1O2SA 3BTWE 1C5YB 3QO6A 4X1PU 3RXHA 2RDLA 5EXLA 2HPPH 4A6LA 3RXTA 2XBWA 3LONA 1CBWC 1UTKA 2HALA 1MD7A 2J34A 3BTME 1UVSH 4MNWA 3LC3A 4Q7XA 1D6WA 1BBRH 4JZDH 4DURA 2PSYA 3GCOA 4ISOA 4IBLH 2AMDA 2GVFA 4ZHMU 1P9UA 2J38A 1VJ9U 2P94A 2GTBA 1BTWA 1DSUA 3EAJA 2SGEE 4THNH 1C1WH 2Z9LA 3KN2A 1HGTH 1P05A 1V2UT 1BHXF 5B6OA 2NU3E 4DIHH 2H9HA 2YOLA 1BMAA 1GVZA 1YGCH 4X1RU 1BOQA 2VJ1A 3UR6A 2JH6D 4WY3A 2ZFPH 3RXUA 3S7KB 1C1UH 3PMBB 1ZHMA 1T8MA 4UEHH 1FY8E 1CGJE 1MCTA 3SQEE 4D7GA 1AUJA 1THSH 4CHAB 4BTTB 2P16A 1QB9A 3SI3H 1IAUA 4XSKU 1FQ3A 4KTUA 2PW8H 4UFGH 1ANDA 1GBDA 1SR5C 1A0HB 4IC6A 3ODFA 1UK2A 4M7GA 3E1XB 1O2HA 1SGTA 1YPHC 3T2NA 1N8OB 3RXGA 3GYLB 1QHRB 2OBOA 2ZGBH 1C2JA 2C90B 1AE5A 2FI5E 1B0EA 1GCDA 3RXIA 3VB3A 3KQBA 2ALVA 1Z7KA 1MZAA 3SV9A 5A0CA 1DWBH 2AH4X 1RGQA 4YTAA 2QY0B 1P0SH 2VWNA 3LH1A 5JPMH 1XUKA 1QBVH 1MAYA 3ZVBA 1Q2WA 1ELTA 1WOFA 2JH0D 3FVFB 1H8DH 3BEFB 4DGJA 3A80A 4ZAEA 4OS6A 3PWCA 1H9LB 4TPYA 4FUFA 2HOBA 4K2YA 1UTOA 1C4V2 1UVTH 2ANYA 3L3TA 2G81E 1LMWB 5BPEA 4X2YA 3JZ1B 5PTPA 2AYWA 2FM2A 2VIDA 1V2OT 1Z8RA 1DWEH 1EAXA 2GCTC 1ZZZA 5E8EH 3ITIA 3PO1B 2PKAB 3HPTB 2BDAA 1CT4E 4UFFH 4Q7ZA 1Y5BT 2Q6DA 3O8DA 1O3BA 2FPZA 3O8BA 2VH0A 1ZPCA 1C5WB 1OP2A 4ZKSU 1LCYA 2CN0H 3M35A 1A61H 2BZ6H 1GJ6A 1HAYB 2A4OA 2J92A 4OS4A 1ARBA 3A86A 4KELA 4X0WU 1YPGH 2BHGA 1AN1E 4MPXA 1C1MA 1SSXA 2TGPZ 3U1IB 2SGAA 2FDAA 3L6PA 5CHAC 3MWIU 2GKVE 1OKXA 1DLEA 3LIWA 1O2VA 1J9CH 3M5OA 2BD3A 2G00A 5ETXA 1DUEA 1A0JA 1G30B 2G51A 1QL7A 2BD5A 3CS7A 3BG4B 5FPSA 1DICA 5HM2A 1C1NA 1RJXB 1F0RA 4ZKOU 1AQ7A 1D6RA 1C2LA 3TH4H 2ZTYA 2R3YA 4I8JA 3W94A 2ANWA 1ETSH 3SW2B 4X8SH 1PPGE 3NZIA 1C2IA 1EZXC 1HJAC 4A1XA 2WPJS 5FPTA 4I7YH 1SGFG 2ZKSA 2H1UA 1P02A 1UK3A 2A5AA 1XVMA 3E90B 2GCHG 2CJIA 2THFB 3SGQE 2AS9A 5ABWA 1SI5H 1GBMA 1TBQH 1SQAA 2QIQA 4LK4A 1NN6A 1C9TA 5LPRA 1JXPA 2ZU5A 3SNDA 5C67A 2C8ZB 2BTCE 1IQHA 1O36A 2PUXB 3W95A 1AY6H 1K9OE 1EAUA 1LVYA 2I6QA 1GMDF 3PTNA 4I8GA 2FX4A 5A2MH 2BDCA 2QXIA 2BLVA 2P93A 3TJOA 4CH8B 1AKSB 4J2YB 1WAYB 1QNJA 1EKBB 3RMMH 2NU2E 4YZUA 3PM3A 3AAVA 3UWJH 4Y8XA 1TNLA 2J9NA 4BAHB 4FVDA 7GCHG 4GAWA 3OU0A 2BY7X 1XX9A 3VPKA 3GY8A 5JBBS 1NRSH 1GI6A 1DWDH 1AFQB 4FVBA 1P11E 2ZA5A 2ZGJA 2GT7A 4ZHLU 1C1RA 2OLGA 3MI4A 1YC0A 1NO9H 1Y8TA 2IPHA 1KTTB 4K8BA 2SNWA 2XBXA 1UTMA 3K2UA 1HUTH 1V2TT 3E91A 2PGBB 3BEUA 4WJG2 1QIXB 5T6GA 3BTGE 2FI3E 3CP7A 4NIXA 3T5FH 4IN1A 3RM0H 1MTUA 1WQSA 1QGFA 2A2QH 4IW4E 1O3IA 1Y3XA 1KXFA 1O39A 3S9CA 1GI2A 2BDHA 4K60A 1P2QA 4X6MA 4Q80A 5GJ4B 3T62A 3VGCB 4BAKB 5FAHA 1ZPBA 4E05H 3P70B 4NIWA 1O5DH 4B2AA 1AHTH 1VITF 1VITH 4ABJA 2ZHEH 3RXCA 3QK1A 1TGCA 2UUKB 3ZZBA 5T3HA 1QQUA 1V2RT 1W13U 2BDBA 2BD7A 4WMEA 1YPLH 1D3PB 2BOKA 2ZF0H 3TGIE 3E8LA 1Q3XA 1IQKA 5FXLA 1AB9B 4AFQA 5DP3A 2H5CA 2AEIH 2Y5FA 1P2IA 3NPSA 1F5RA 1ARCA 1T32A 3ZZ6A 1TNJA 1CSOE 1ZJKA 1GVKB 2FP7B 1BQYA 3ZVFA 3D23A 3DFLA 1G36A 3A87A 1S82A 1SGFA 3MYWA 2OBQA 1ANEA 1OS8A 1EZSC 2A7JA 1HAHH 1LPZB 4D9QA 3TJNA 4IMZA 1AD8H 4JYVH 4GCHF 2BZAA 1SGRE 1ANCA 1BCUH 2UUYA 1TA6A 3FZDA 3EGKH 5G4BA 1HAGE 2P59A 1AVXA 3GY4A 1GL0E 1CQQA 1SFQB 4CHAC 1QL9A 1C5PA 1GJ4H 2K1QA 4VGCB 1FZZA 4DW2U 5J4SA 1F0SA 1F5KU 5F8TA 2R0LA 4CRFA 1P2KA 1HIAB 3ZYDA 4X8VH 1V2VT 1EQ9A 5EU8A 2HNTC 1C5SA 4YT7H 2ASUB 3F9FA 1BTZA 1E35B 1UTQA 3V13A 4IGDA 3GY6A 2QF3A 3EE0B 4B73A 1OXGA 1GI1A 1GDUA 2QAAA 3SU3A 2FOBA 3RMOH 2FOMB 3RC5A 2EI6A 1EZQA 2ZCHP 1F0TA 1O32A 4FU9A 2TGDA 1H9HE 1GMDG 3K65B 4Y8YA 1B0FA 1P2JA 2OQ5A 3AVZA 1QRZA 4SGBE 1GBCA 2C8YB 2OP9A 3C27B 4SGAE 1S0RA 1NU9A 3AASA 5J4QA 3ZVDA 4RSPA 1T4UH 1CVWH 1XUGA 2R2WU 3SU0A 5GIBA 1OWKA 3A8DA 1MKWK 1Z1IA 1LQDB 2QN5T 4YM9A 3BG4C 3M7QA 1ZRBA 3VXEH 4NG9H 1HXFH 1NFUA 1P12E 3AAUA 1QBNA 3UNRA 1A3EH 1O34A 4K1EA 3PMJA 2FLRH 1SGYE 3KQCA 1CGIE 1GI5A 1W12U 3ESTA 3MFJA 1D3TB 1Q31A 1NU7B 2A5IA 2GDDA 3ZVGA 1TMUH 3RXJA 5C20A 5LGOA 2W3IA 1J16A 2PGQB 2ZFRH 4BANB 2EC9H 1ESBA 1O3FA 4I32A 1P3CA 2BY5X 2ZHDA 1UO6A 3FAOA 2R9PA 4NCYA 3RLYH 4LZ4B 4Y7BA 1JMOH 4UFEH 1EOJA 5IDKA 1LPGB 2GX4A 4MNVA 4TWWA 3SGAE 1O37A 3SV7A 4BTUB 5JB8S 2GV7A 1C1VH 1O0DH 1SGPE 2FYQA 2ZU4A 1SLWB 1P03A 3DT0H 5AHGH 2A45B 3A7TA 1P01A 3ELAH 1CA0C 1SQOA 1C4U2 1YPHE 2FO9A 4BXWA 4IN2A 4Y7AA 2BX3A 1FY4A 2G8TA 1S5SA 7GCHF 4AZ2B 1J15A 2LNCA 1BUIA 2AFQB 1P9SA 1RTKA 1HAPH 1IQFA 4ZMAH 4X8UH 1TX6A 4MLFB 1CO7E 1XKAC 2RCEA 2P3FH 4D9RA 2G4TA 5TJXA 1O2PA 3TPIZ 4B76A 3LJJA 1C2KA 4Y0ZE 1P57B 1VCPA 2W7UA 1PYTD 4MTBA 1O2KA 1GBAA 1KXEA 1W0YH 1LHGH 1GBTA 1A4WH 1PQAA 1JIMA 1BHXB 3MH5A 4AFUA 1CHGA 1AFQC 4NFFA 1HAIH 3ZZ3A 3ATLA 4H42U 1GI8B 1Y5AT 2VWOA 2BY9X 1MMJN 3VGCC 4X2XA 5HM9A 1S0QA 3UPEA 4CR5A 3M3TA 1K1MA 2SGQE 2FOGA 1IQNA 2XCNA 1KDQB 1O2NA 3PYHA 3SU1A 1GBEA 3GDSA 3KQDA 1TMTH 2ZCLP 1DFPA 2ZPRA 4TYDA 3RU4E 1SMFE 1NFWA 1UTJA 4AB8A 1EAIA 3UIRA 4Y79A 5JBAS 2JETC 3LJOA 2XNIA 2BDGA 1GCTB 2A4RA 3EA7A 3FZZA 3FP6E 4F49A 2SNVA 5C5OA 1YYY1 3P8OA 4YLUA 2GMTB 3UREA 4JYTA 2G55A 2WPHS 2V3OH 3TNSA 2ODYB 3LGWA 3RXFA 2ZHQH 1O3HA 2PTNA 1O2IA 1W7XH 3QGNB 3SBKA 4Y0YE 5EQRA 2ULLA 4DT7B 1NM6A 6LPRA 1LO6A 1G9IE 4Y6DA 2HRVA 2A1DB 4NA7A 2G5VA 2H9EH 2ODPA 1NS3A 2ZU1A 3D62A 4FUDA 1KXDA 1O5FH 3A7VA 4JZEH 3A8AA 3MH7A 4O9VA 3P8GA 3GCNA 2ZGCA 4O3TA 5C2ZA 1MAXA 3MTYA 4KTSA 1O35A 1L0ZA 2Q6GA 3KCGH 2A4QA 1YCPK 1P04A 2R0KA 4CRDA 4E06H 4FUIA 3N7OA 1A0LA 2F9NA 4H4FA 4VGCC 3U9AH 4X6PA 1GBLA 1FAXA 1ABIH 1CHOF 2A5KA 3F9EA 1SVPA 4U2WA 1GI9B 5EG4A 3TJVA 2RG3A 3V12A 1FY3A 6CHAB 2FESH 1V2KT 4I8LA 2Y7XA 5DGJA 1O2YA 2PKAA 4NIYA 1FI8A 4AFZA 1GDNA 2QXJA 5JDUB 4FUCA 1ZYOA 3Q3KA 1BIOA 1BJVA 1GMHF 2WUCA 1F5LA 2AMPA 3O8CA 1GBIA 1O3EA 1BRBE 1KXAA 3JZ2B 3BTEE 3SHCH 3QTOH 3S69A 3HK6B 3RMLH 1GG6C 1BTPA 2ZTZA 3HGNA 1SPJA 1C1PA 5E2PA 2NWNA 1KLJH 1O3JA 1HYLA 1EP6A 4RN6A 1QCPA 4MVNA 3H7OA 1XVOA 1QB1A 2GP9B 2V35A 2CXVA 1MTSA 1MTWA 2PUQH 1AVGH 1IQJA 1HV7A 1QRWA 5GCHF 4CBNA 1ZOMA 3GDVA 4HI3A 3ENSB 4A1TA 2QF0A 3LGUA 1Y3UA 3A88A 4TWYA 4NWLA 1VGCC 1TONA 3M7UA 2GCTB 4B2BA 1K28D 2I6SA 3PB1E 2ILNA 1HAXB 1BTUA 1K1NA 1NROH 2EA3A 3ZZ5A 3UUZA 5FBIA 1UVUH 3M36A 3PV4A 1XUHA 1MKWH 3R0FA 4JK6A 1C2FA 3SN8A 1GHAG 2OC7A 4B74A 1SGIB 1O2MA 2BYAX 3URCA 6CHAC 3UOUA 2BXTH 1O5BB 3H7TA 1F7ZA 2Q6FA 3OX7U 1L4ZA 2HLCA 1AI8H 1TOMH 1ZJDA 2VIVA 3K6ZA 1GMCF 2Y5HA 1TGTA 1QQ4A 1BMMH 2BQWB 3UTUH 1QR3E 4D8NA 1C1TA 3E6PH 3MOCA 1FUJA 3E3TA 4FXGH 1JBUH 2D1JA 1CU1A 8GCHF 1FAKH 2OC8A 3B8JA 4WXIA 1ESTA 3EQ0H 4XBDA 1KLTA 1A5IA 2BD8A 5FBEA 3ZZ4A 2PKSB 3BTQE 3S9AA 3QGJA 1BMLA 1LHEH 1SGCA 5K7RA 1AVWA 3NXPA 3RU4D 1P8VC 1SGDE 3BN9A 1DDJA 3LGVA 1HAZB 1DPOA 4X2VA 4E7RG 1BJUA 4CRAA 3SUGA 1NRNH 4Y71A 1XM1A 1BRAA 1YPJH 3R3GB 1W2KH 1C4Y2 5ESBA 4K1SA 1VITG 5K0HA 4PROA 3LU9B 1ZHPA 2QXGA 1QY6A 2Z9KA 3IITA 2AIQA 2V0BA 4AG1A 2VINA 1ZR0A 5DKMA 1A46H 1ACBE 1DWCH 1NTPA 4WXVA 1GBBA 2JETB 1C1QA 2G5NA 2FI4E 1O2UA 1GJDB 1O3KA 3Q77A 2H6MA 3SU4A 2STBE 3RXOA 1NZQH 1OP8A