2FI4E

Crystal structure of a bpti variant (cys14->ser) in complex with trypsin
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
222
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Functional and structural roles of the Cys14-Cys38 disulfide of bovine pancreatic trypsin inhibitor.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 59
structure length 222
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2005-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fi4E01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fi4E02
2CHAC 2V0BA 1D3DB 2ZGHA 4A1TA 4K8BA 2SFAA 1HJAB 5GWZA 5K0HA 4WVPE 5DP5A 1ANEA 2FOCA 1DWDH 1TPOA 2VIWA 3O8BA 1QB1A 3PM3A 1B5GH 2D8WA 1TALA 1ZSLA 3ZZ4A 3EA9A 3BTWE 4QT8C 2XTTB 3BIUH 3NUMA 1ZJDA 3ZVFA 2VVCA 1D3QB 1ELEE 2O8UA 4Z0KA 1GJ8B 2Z3CA 3E0NB 1NFYA 3EGKH 2WPIS 3Q3YA 2OCVB 1C5TA 1NRSH 5E8EH 1ZGIA 4AG2A 1BUIA 1L0ZA 3L33A 1E0FD 5IYTA 3A7WA 4AGKA 1ZZZA 3ATMA 2ZHDA 4AG1A 3GYLB 2I6SA 1GI1A 3DFJA 5JBAS 2PLXA 1C5SA 1LHFH 3HKJB 5GCHG 2ODQA 3SNDA 4B1TA 1NU9A 2AGIX 5A8ZA 1NU7B 4IMZA 2FYRA 2PUQH 2XBYA 2BD4A 1F0TA 3IWMA 2W3KA 2FI3E 1THSH 2HWLB 1LMWB 1LPZB 1GDNA 3STIA 1TX8A 1THRH 1MAXA 3K6ZA 2QA9E 3RXAA 3S9CA 2QCYA 3H7TA 4FVBA 4B71A 2VWMA 5F6MA 3M61U 5T3HA 3PO1B 4BAOB 2SGAA 3I29A 3PMJA 4OGYA 1D3PB 1F92A 3AW0A 1JRSA 1GHBF 3MO9A 1FY8E 4GCHG 3BTHE 3RU4D 5JB8S 3A82A 1RJXB 1YLDA 2IJOB 4FUFA 1SGIB 1SQTA 2F9UA 3P17H 3MU5A 1C5PA 1C2EA 5GXPA 3RM0H 3SJOA 2OLGA 2TGTA 4AFSA 1WOFA 1GI5A 3EA7A 4FUDA 4Y7AA 4JZ1A 2VB0A 1BOQA 1ZPZA 1EAIA 2VIVA 1TRNA 1AQ7A 1NC6A 2HPPH 1YBWA 4YOGA 3S9AA 4NIYA 1K28D 1C5YB 1NRQH 1C1MA 5FPYA 1XKAC 2B0FA 5C20A 1GG6B 5JBBS 1DWEH 3M3TA 3TH4H 1O3EA 1J16A 5LPFA 1W10U 1O3FA 4GCHF 2WUBA 1HAYB 2A2XH 5A8YA 3UIRA 2Z9KA 1AFQC 2A45B 3EE0B 4GVUA 1PQ8A 1H8DH 2VWOA 1FIZA 3D23A 1K2I1 4X8TH 2WV4A 1UTNA 2DE8A 2ZHQH 3GY2A 1BJVA 4A6LA 2H9EH 2NU4E 1PFXC 1VGCB 2H5CA 3UREA 1Y3UA 4IN2A 4AN7A 2PUXB 1T8NA 4IS5A 1C2DA 2F83A 2C8YB 2J9NA 3A7TA 1GBFA 1GMCG 5EXNA 2BZAA 1GBMA 1NS3A 1C1QA 5HM9A 2R2WU 1XUGA 5DP4A 1GI7B 1XUKA 3TK6A 2BOKA 3RXGA 3E90B 3B23B 1P10A 1O5FH 2ZEBA 1SGYE 2EI7A 1HCGA 2C4FH 5LGOA 3RXLA 3RC4A 5BRRE 1V6DA 1ARBA 3KGPA 1ELAA 5LPRA 1C1UH 5ESTE 3RMLH 2M5TA 1YCPK 3DA9B 6GCHG 2FEQH 4H4FA 2IPHA 2ANWA 1JIMA 1GJCB 2GCHG 5JYIA 2ZGBH 3VB3A 1A1RA 1VJAU 1TOCB 2FI4E 5FHTA 3SU4A 3ZZ9A 5L2ZH 1C1WH 1GBBA 1SSXA 3ATWA 5EW2H 2VVVA 4CBNA 2HGTH 4FUIA 1IQNA 3SI4H 1TX7A 1O3LA 1A2CH 4CR9A 1ZMNA 3STJA 1AVWA 3LGTA 2XCNA 4X2VA 1C1OA 3ZZ6A 1O3AA 2A4QA 2ZFQH 1SGPE 1GJDB 2Z94A 3BG4B 6GCHF 2B8OH 1ZR0A 3SNAA 2GKVE 2GCHF 2BD9A 2FODA 5I25A 1BBRK 1TRYA 2BLOA 3CS0A 2PWXA 4TWWA 2P8OC 1WQVH 1V2OT 1FIWA 3RDZA 3IG6B 1AB9B 3SGAE 3VFEA 1TGBA 1K1IA 2AS9A 2GDDA 3LH3A 4YO9A 2BXUH 3RXEA 1HJAC 4ISNA 1EP5A 1ETRH 1ESBA 2FXRA 4AB8A 1W7XH 4NSYA 1OP2A 1G30B 1GWAA 1YPLH 2F9NA 2FOGA 3M5NA 4FU8A 3PMHB 4MNYA 2VIDA 1F5RA 2VH6A 4NFEA 1LHDH 3MU0A 2ZDAH 2NU1E 4BAHB 1RFNA 3KL6A 4X1RU 3NZIA 3F9HA 1TGSZ 1P8VC 5EQRA 1TIOA 1DLKB 2VJ1A 3ZZCA 1K1PA 3GDUA 1N1LA 2ASUB 1F0UA 2G00A 1AWHB 1HGTH 1IQFA 3U1IB 4D76A 5FCKA 1Z1JA 2FOAA 3EQ0H 1V2NT 1ZHRA 4RSPA 1YC0A 3SNEA 2P3TB 1WV7H 1PQ5A 1MBMA 2B9LA 3AAVA 3GYMA 2A5KA 3TJVA 4ASHA 1T4UH 1DDJA 2GV7A 1EATA 1O3GA 4DG4A 2F9PA 4IC5A 3SV2H 1L4DA 1EPTB 1DICA 4R0IA 3SHAH 1DM4B 4F4OC 3S7HB 1GI9B 4WMFA 2R2MB 1BRBE 5EW1H 3KQCA 8LPRA 3ATLA 4ABBA 2OP9A 1A4WH 3VEQB 4H6TA 1BCUH 4NA8A 1K1NA 1O3OA 1PPEE 1MMJN 1YCPH 1ZMLA 3UTUH 6CHAB 1UVTH 1LCYA 1GHWH 3HPTB 1S83A 3VGCB 1QIXB 1YPGH 3A8BA 3M37A 1C5ZB 3RLWH 3T28A 2ZO3H 2CGAA 2ZTYA 3LC3A 1UTMA 3GCTG 4X0WU 5AFZH 3MH5A 1CVWH 1K9OE 2GCTB 3BTQE 1RTKA 4YOJA 5L2YH 1Y5UT 4NCYA 1FXYA 1Z8RA 2R0KA 1GG6C 1XX9A 2EI8A 4DJZB 2ZU2A 4TY7A 1Y8TA 1Y3VA 3UWJH 1TA2A 1RIWC 1BBRH 2FS9A 4Z6AH 1HXFH 4XFQA 1O2LA 2TGDA 4Q7YA 1MTUA 3MU8A 1AMHA 1RRKA 2ULLA 3KQEA 1W11U 1KTSB 2Y5HA 2CHAB 3GCTF 2QIQA 1YGCH 5I46H 1V2QT 1O3CA 2BDIA 1VGCC 1GI4A 4AZ2B 1S0QA 1C5RA 3D62A 1O37A 1HV7A 4O97A 4BAKB 1YPHC 2P3UB 2O8WA 1LDTT 2UUYA 1UTQA 1K1OA 2A4OA 1DSTA 1T8MA 2ZDLA 3HGNA 1QL7A 3ZVCA 2EI6A 3RUOA 1ZLRA 5SGAE 1EZSC 4NIWA 3HKIB 1TYNA 1ANDA 3GISB 1BQYA 4GPGA 3TNTA 3VXEH 3PLBA 1KXAA 1DY8A 3RXRA 3ZVGA 1GL0E 4K1SA 4XBDA 4I8LA 3RXJA 1EJNA 1QJ6B 3QO6A 1GVLA 1KDQA 3W94A 2W7UA 4YOIA 3O8DA 1TB6H 1GJ9B 2RDLA 4K1TA 1C2MA 1AUTC 4JZFH 3LJOA 4HTCH 1IQJA 2CV3A 1UVSH 2OQ5A 4MDSA 1L4ZA 1ZGVA 1W14U 2ZQ2A 1FAKH 5IDKA 3V0XA 2SGFE 4LXBH 4DURA 1CGHA 3RXMA 4R8TB 4JYVH 1GBEA 1O35A 1MCVA 1O2RA 2XWAA 5C5NA 1FY1A 1P2OA 4I31A 4TPYA 3BG4C 1FN6A 1XKBC 5TCCA 5FXLA 2XBXA 4I7YH 1TPPA 3O8RA 1C4U2 4FU7A 4XSKU 1C5VA 4ZHAA 2C93B 1MTVA 3A83A 4YT6H 1AB9C 1ZSJA 1J15A 2HRVA 2ZU3A 3RXBA 1DFPA 1F7ZA 3MNCA 4UEHH 3QK1A 5DP3A 1VITH 3RXDA 2OC0A 5T6DA 4UFDH 5JPMH 1GHXH 5DG6A 5C1YA 1PPHE 1V2PT 4K1EA 5A2MH 2ZCLP 1GI2A 3ODFA 3UNSA 1S81A 1TGCA 3A88A 1YM0A 3M7QA 1O5DH 4NA7A 3SN8A 5ESBA 1CT2E 1F5KU 2BDHA 1PYTD 3P8NA 4F49A 1ZTJA 4LOYH 2PFEA 2OQUA 1GJ7B 1HAZB 2STBE 4ZH8A 2CJIA 2FI5E 3PMAB 1P04A 2ILNA 1K22H 2A5AA 1C5LH 3SUGA 3DD2H 5ABWA 4A1VA 2WYGA 1CHOG 3RLYH 4NWLA 1Y3XA 5HM2A 2Z9LA 1NO9H 3LPRA 4K5ZA 2FP7B 1HB0B 3AW1A 4U2WA 3SZNA 1FN8A 1AGJA 1V2WT 1BZXE 3QTVH 3UR9A 5E0JA 3A8DA 4ZUHA 5EXMA 3ZVBA 1NT1A 3P92A 1AY6H 1TX6A 3LC5A 2G51A 5HGGA 5C1UA 1EPTC 3V12A 3SUDA 3BV9B 1WTGH 1M9UA 6LPRA 3GY5A 3RMOH 1OOKB 1LKAA 1V2RT 2P95A 4INLA 1IQEA 2Y6TA 1DUEA 1UTOA 3ZZ3A 3LH1A 1TONA 4Q7XA 1O2HA 4U01A 4B2AA 3KEEA 1TBQH 4I8GA 5J4QA 1ZTLA 1NM6A 3FP6E 4X8VH 4KKDA 1AUJA 1J14A 4K8YA 4Y79A 5EPNA 3SJIA 6CHAC 4BOHA 1A5IA 2ZFPH 4JMYA 2H2ZA 4MPXA 1EAUA 1PPGE 4BANB 2GTBA 4Q2KA 3VGCC 4MPWA 1MD7A 1S0RA 2OD3B 4NG9H 1ZHPA 4RN6A 1BMNH 2Z3EA 2FOHA 3P8FA 2BX3A 1EZUC 3ZVEA 2OBOA 1BITA 3SU6A 2GCTC 1H1BA 1GVZA 1ZSKA 4MLFB 4AFUA 1QA7A 1ZPBA 3BTFE 3CENA 1E38B 5A0AE 3KQBA 3TNSA 1MH0A 1VZQH 2UWOA 3GCHB 1A5HA 4Y0YE 4Y8ZA 3RC6A 1C5QA 5GIBA 5JBTA 1O32A 3GY3A 3HK3B 3R3GB 1O38A 1CU1A 1BTZA 2XCFA 3UOPA 1QURH 3DHKH 1TWXB 1XXDA 2XBWA 2RCEA 3RC5A 1MKXK 4O03A 3M3VA 1RXPA 1P9SA 3F6UH 2F91A 1GMDF 4IC6A 1GHAG 4YESB 1UTKA 1SG8B 1A7SA 1H9HE 1ZYOA 2OBQA 1WTHD 3BEIB 2NU3E 2D1JA 1O2TA 1MD8A 1QTFA 2W7SA 2QXHA 3MH7A 2P3FH 5C67A 1TNLA 2BHGA 4ZHLU 4GLYA 2QXIA 1SLUB 5JB9S 2H6MA 2Y5GA 4FVDA 2ZPQA 3VB6A 1G3EA 3FFGA 4HGCA 1SC8U 1SGFA 3TU7H 1AZZA 1HUTH 2A5IA 4FUJA 2VWLA 1GHAF 3TJUA 1WQSA 6ESTA 5TJXA 1TMUH 1GHBG 4NWKA 1UCYE 3UNQA 4BAQB 2QXJA 1FPHH 3ESTA 2V3OH 3SU1A 3Q77A 1KLJH 1YPHE 4MVNA 1O2QA 1QJ7B 1DSUA 4U32A 4DVAU 2Q6GA 1A3BH 2XYAA 2FYQA 2ZC9H 2BDAA 3KNXA 2P59A 3A85A 4K3JA 1PPCE 3HGPA 1KIGH 1CGIE 1ELGA 3PV4A 3TH3H 4DCDA 2YNBA 2ZIQH 4X1PU 2WPJS 4M7GA 1O2OA 1THPB 3E1XB 2C90B 2ZF0H 4YT7H 1HAHH 4D7GA 3BTTE 3BTKE 3PWCA 1P2MA 4IGDA 3F9EA 1FY4A 1PPBH 1GBLA 5GJ4B 1HYLA 2AIPA 5EGMA 1BMAA 1OWEA 3U69H 3VB7A 2J2UA 4I8KA 1L1GA 3ATIA 5F03A 1O2KA 5J4SA 1ELTA 3S7KB 1DPOA 2HVXA 1ANCA 4FU9A 2LPRA 3URCA 1DE7H 1C2IA 3SU0A 2FMJA 1FUJA 1RTLA 3LDXH 3SQEE 3EYDA 3QN7A 1LQDB 1MU6B 1O2PA 2IOTA 2ZFRH 4JZDH 4KTCA 1C5OH 3LGWA 2Z7FE 1G32B 1HNEE 1S84A 1E37B 1IQKA 4BTUB 2TGAA 1OWJA 1P01A 1ELCA 1RIWB 1UVPA 4Y8YA 3Q3KA 2BD7A 5C5OA 3TGIE 1F2SE 1OYQA 3EDXB 1L1NA 1FPCH 2PHBA 1AE8H 1ZMJA 4OS2A 1HAIH 1AWFH 3NK8A 3A8AA 1C2GA 5CHAB 3UNRA 3F9FA 1ETSH 2AYWA 2GX4A 1GDUA 3K65B 1MKXH 3PMBB 1T8OA 4A5TS 2BY9X 2XC4A 1EB1H 1O36A 1VCWA 2FESH 2G81E 2BOHB 4A92A 4YLQH 1GJ6A 4WJG2 3RXFA 1EUFA 3AASA 1Q2WA 4ZXXH 1UTLM 2W5EA 4WXVA 2O8TA 3TK9A 3KQDA 1IHTH 3RMNH 5FAHA 1EAXA 9LPRA 4TWYA 3GOVB 5FX5A 1GPZA 1DLEA 4UFEH 1O3IA 3MU1A 3B8JA 3E0PB 2FPZA 2RA0A 3HATH 3U8RH 3UFAA 1UK4A 2TGPZ 2FDAA 1P05A 5DP9A 5DJ7A 1LQEA 4X1QU 4ABIA 3M5LA 2ZTZA 1OPHB 4HZHA 4B76A 4CRCA 1LVBA 1YPMH 3T27A 2IN2A 4ZHMU 1FAXA 2OTVA 3HK6B 5FCRA 1C1SA 4H6SB 4MG3A 4BAMB 2QV1A 3MH4A 1ZPCA 1NROH 1QGFA 2H5DA 2ZQ1A 3SV9A 1KXFA 2C3SA 2PGBB 3H7OA 4CRFA 4MNVA 1GBDA 1DITH 1FONA 1BRUP 1EASA 1C2HA 3GCHC 2ZU1A 2GT7A 1RGQA 2ZGCA 2K1QA 5K7RA 2VVUA 4YM9A 1FNIA 1P57B 1TNGA 1CE5A 1FI8A 2P93A 2UUJB 1CO7E 2F9BH 3BF6H 1UTPA 1EZQA 4FUEA 4ISLA 1EZXC 1BT7A 1A5GH 3FP7E 3H5CB 1LVMA 1T7CA 4DIIH 2ZFSA 5GDSH 4INKA 5HXFA 3ZZ7A 3D49H 5C3NA 2B7DH 1YLCA 2P94A 2Z9GA 1K1MA 4E06H 4KTSA 4UFFH 1BJUA 5FPTA 2UWLA 1GBIA 1PQAA 2Q6DA 1SOZA 1SOTA 1P2KA 2BLQA 1C2LA 1S6HA 2BTCE 4FUCA 3OYPA 3NPSA 1MZAA 3RXIA 3TJOA 1IQGA 3BTDE 1VCQA 3TITA 1SGTA 4DOQA 1EOLA 2WPKS 3MO3A 5AFYH 4CRAA 5FBEA 4IMQA 4E7NA 2UWPA 2ZDKA 1QRZA 2WPLS 1GCTB 1F5LA 1WYKA 2THFB 3ZYEA 1KTTB 2VGCB 1C5XB 1NFUA 5FPSA 3R0FA 4ESTE 4Y71A 2FOFA 3PTNA 1A0JA 1G3BA 2GDEH 1KYNA 3ZVDA 3UY9A 2ALPA 3IITA 1ZOMA 4ZKNU 3F68H 5B6OA 2QC2A 3K2UA 2DUCA 2ZWLH 4RKOB 3SU3A 3RXOA 3RU4E 2J34A 1GHZA 5F8TA 1V3XA 2FIRH 1HIAA 1SBWA 1XUHA 1TGNA 3SNCA 1GGDB 3A89A 1LO6A 4YTAA 1HIAB 2ZTXA 4JZEH 1SQOA 1LTOA 3OY6U 1SQAA 2ZHFH 4CRDA 4AYYB 2G4TA 1C5MD 4MNXA 5E2OA 4B2BA 1DS2E 2WYJA 3QTOH 4A7IB 2AERH 3C27B 1KSNA 1FY3A 1MCTA 3GY7A 1NRRH 4LZ1H 3SJ9A 5E2PA 1Y59T 1QB9A 2Z9IA 4XE4A 4O3TA 1UVUH 1ESAA 1DANH 1CBWB 4I32A 1EAWA 4WY3A 1P12E 2A31A 3KIDU 1B0FA 3QWCH 2Y7XA 3A7VA 1O3JA 3SGBE 5CE1A 2FO9A 3SNBA 4UD9H 2A32A 4D8NA 2CN0H 2FX4A 1ABJH 5CHAC 1HJ9A 3QDZB 1MTSA 2C8ZB 1C9TA 1AFEH 4E7RG 2BLWA 2VNTA 3SHCH 2G8TA 4ZKOU 2BB4A 2PSXA 1K1LA 1IQMA 3K6YA 1P11E 1AI8H 5CMXH 5DGJA 4INHA 1TBZH 2VIQA 1AKSA 1BRAA 2D2DA 1WU1A 3ATKA 2PGQB 4Y11E 3M3SA 4DY7B 2Z9JA 5DP8A 2B5TB 4VGCB 2XNIA 4NZQA 1O2UA 2BY6X 1C5NH 5EPYA 3T5FH 4AX9H 2CMYA 3LGYA 1ORFA 1SPJA 3A7YA 5BPEA 3RXQA 2ALVA 1HJ8A 4JCNA 3Q76A 4E05H 1PPFE 2ZFTA 3JZ2B 4BXWA 4BXSA 1CSOE 3BEFB 1CQQA 1UK3A 1XVOA 2NU0E 2HALA 3RXCA 1BBRE 1KY9A 1YKTA 1ELFA 1KDQB 4LK4A 1DWBH 1TMTH 1A46H 1PPZA 1UVOA 1GI6A 1BB0B 1AVXA 3S9BA 4WMEA 3VB5A 1YYY1 1DXWA 2TPIZ 2AIQA 2JETB 4JK5A 1NFWA 1TBRH 4X6OA 5HYOA 1SGCA 3MHWU 2XRCA 1A0LA 5DO4H 2ZECA 3LGVA 1JMOH 1IAUA 2PKSC 3NWUA 2XC0A 2GP9B 3Q00A 5H4IB 1YPEH 1UO6A 4X6PA 1C4Y2 1NFXA 1V2MT 4X6MA 5EG4A 4ISIH 3E16B 4DIHH 1SGFG 1YP9A 3BTGE 1VCPA 2F9OA 1RTFB 1H9LB 1HDTH 3PTBA 2JH6D 3PLKA 3OU0A 3S0NA 4XBCA 3KHVA 4GHQA 1BTPA 4TYDA 4WWYA 3SV8A 3SU2A 1Q3XA 1JWTA 3ODDA 1JBUH 3KCGH 5AHGH 1O3PB 2ZFFH 2O8MA 3BN9A 8KME2 1C4V2 1GDQA 4B2CA 3TH2H 1NPMA 5AVDA 3BTEE 4PROA 3MTYA 4NFFA 1Z71A 1D9IA 1W0ZU 1OP8A 1TFXA 3E8LA 3A80A 2A1DB 4X2YA 1QL9A 2VWNA 4KTUA 1GL1A 3PYHA 3LGIA 3URDA 1AVGH 3F1SB 4OS1A 2PTCE 1SLXB 5FX6A 4ZROA 1GCTC 1OKXA 1QA0A 4UE7H 2VGCC 1IOEA 2AGGX 2BVXH 4FUHA 1VJ9U 3P70B 1Y5AT 3QZQA 1C1VH 2XXLA 2A7JA 5C1XA 1OWIA 1TABE 2ZHEH 3BTME 5HMAA 3A86A 1B0EA 3PB1E 3ITIA 2XBVA 1P2NA 2ODYB 1BTUA 3RMMH 1TRMA 1O5EH 3PWBA 2PV9B 2FLBH 2BMGB 4GAWA 9ESTA 1G36A 1H8IH 2QN5T 2XC5A 1B7XB 1S6FA 4CHAB 8ESTE 1GGDC 1O2VA 1GCDA 2OC8A 1LKBA 1TQ0B 1CA8B 2KAIA 1BTYA 3DFLA 2G52A 3M36A 4X2XA 2H9TH 4NSVA 3P95A 2QYIA 1DX5M 4HFPB 2PKAA 3RXKA 7GCHG 2FTMA 1O2WA 1MTWA 1NRNH 1EX3A 2XWBI 3G01A 3UPEA 2FS8A 4Y7BA 1XUJA 3ZZ8A 1KXCA 2ODPA 1GMDG 3U98H 5EQSA 1JXPA 2TIOA 1HAVA 3OTJE 4NGAH 4XBBA 2HNTF 2PR3A 5EU8A 2ZU4A 1AN1E 2RG3A 3TIUA 1CBWC 2ZNKH 1FLEE 1SGEE 4AB9A 2V35A 2Y82A 1BMLA 3A87A 1DWCH 3MOCA 4X1NU 1LHGH 4UDWH 1EOJA 2V3HH 2ZDNA 1OWKA 1C5UA 2ESTE 4ZKSU 4IN1A 7GCHF 1E34B 2VH0A 3VXFH 3GDSA 3QGNB 1P3CA 1MKWH 3SUEA 2ZA5A 1QY6A 3M5MA 1GBKA 4SGBE 3LU9B 3RXTA 1AHTH 4A1XA 4AGJA 4X2WA 3CS7A 4B73A 2J94A 3I78A 3LKWA 4X1SU 2QY0B 4O9VA 1UCYH 8GCHF 2SGEE 1IQIA 2G55A 3EA8A 2ZKSA 4Y8XA 3QZRA 1ANBA 1RD3B 1QR3E 4VGCC 2HNTE 1C2JA 2QF3A 1D6RA 1G2MA 2ZPSA 3QGJA 1HPGA 1OS8A 3VPKA 1H9IE 1SFIA 2PSYA 4J2YB 3GICB 4NZLA 3QUMP 3SBKA 1OWHA 4ZAEA 3BEUA 2BY5X 3U8TH 3ELAH 1IQLA 2GGVB 3RU4T 1D4PB 3MNSA 1C1NA 2JH5D 3MNXA 1L2EA 7KMEH 1J8AA 1O2XA 3GDVA 4KP0A 1GI0A 1O2IA 4TY6A 5PTPA 1O2ZA 2BD2A 4HI3A 2WV5A 1P9UA 2BDGA 2HLCA 2BY7X 2VIOA 3ZZBA 5A0BA 1UHBA 1ABIH 1V2KT 2JETC 5DK1A 2FOEA 3M7TA 3UQOA 1KXEA 1UHBB 3O8CA 2ZDVH 4CR5A 2YOLA 2ZCKP 1O34A 3JZ1B 2JKHA 1TPSA 1FZZA 1SHHB 3DUXH 5JDUB 1OSSA 1ESTA 3PLPA 1V2JT 1LVYA 1Z8GA 1O5AB 2H1UA 3E91A 1O33A 1FY5A 1P2JA 3OX7U 2VU8E 5GCHF 1MTNB 2BQWB 4OGXA 4X8SH 3A81A 1CA0B 2RA3A 1QFKH 3LJJA 2O9QA 1INCA 2GMTB 3V7TA 3E6PH 3RXHA 1G2LA 2ZHWH 3U9AH 1SMFE 3GY8A 4CRGA 3F9GA 4K2YA 3ZVAA 2FZZA 1F0RA 4H42U 1LHEH 1O2NA 4WF8A 2VINA 4J1YA 3FANA 2BVRH 4NIVA 1W3CA 1P02A 4D7FA 1GJ4H 2ZDMA 2AGEX 1HAGE 1HFDA 4MPVA 2Q6FA 1T31A 4JZIA 5EQQA 1P2IA 3UUZA 1EKBB 2UUFB 1EQ9A 1A0HB 3SOSA 1GBCA 1QL8A 1SR5C 4U30A 1MU8B 1O2YA 3M35A 2FX6A 4Y6DA 3QLPH 7ESTE 4TPIZ 5AF9H 5EOKA 1O39A 2DE9A 1GHVH 2NU2E 5F8ZA 2LNCA 3E3TA 1XUFA 5F8XA 4OS4A 4RKJB 5DPAA 3FVFB 1NN6A 1TAWA 2FTLE 1HAPH 1G3DA 1MUEB 3SW2B 2ZP0H 3T25A 1W0YH 2Q1JA 2R3UA 1FDPA 1O31A 1TGTA 2I6QA 1BTWA 1KXDA 1O2MA 3P6ZB 4Q80A 2SGPE 4ABDA 1QJ1B 4CHAC 2ZPRA 2PW8H 4WH6A 3U8OH 1YF4A 2GZ8A 2Y5FA 1F0SA 1EP6A 1O3NA 5LH8A 1CGJE 2XW9A 3A7ZA 1NESE 5ETXA 1BTHH 7LPRA 4K69A 1E35B 5L30H 3RXUA 1SI5H 2GV6A 5JBCS 1C2FA 4ISHH 4XOJA 5FBIA 1T4VH 4NA9H 4GSOA 1FQ3A 1G9IE 1NY22 1QB6A 2EA3A 2A0QB 4JYTA 2EC9H 3MYWA 1XXFA 4KGAA 1HAOH 4GHTA 2GZ7A 1BTXA 2A4GA 1GMCF 2PKSB 3P8GA 1O5GH 4BTIB 1X7AC 2BZ6H 3SO3A 3PROA 1OXGA 2R3YA 1SVPA 1FMGA 2J38A 3LGUA 1ZRKA 4ABFA 3NCLA 4ISOA 5TCAA 3MH6A 1FV9A 4AOQA 1A61H 4OS6A 1MBQA 1GI8B 1XUIA 1EB2A 1WBGB 5T6FA 1O3HA 1DXPA 1NZQH 3WY8A 1IHSH 4IW4E 2GT8A 3ZZAA 1NRPH 1QNJA 1GHYH 2BQ7B 3FZZA 1V2TT 2O8LA 3CP7A 2BD5A 1O2SA 1TA6A 4I8JA 1Z6JH 2Y80A 4WXIA 4Y0ZE 1JIRA 1BDAA 1PQ7A 1ZJKA 3SJ8A 4UFGH 1Q31A 3ZZDA 3TVJB 2ZCHP 2ZZUH 1TOMH 1WUNH 1P03A 1SGQE 1BHXF 3OY5U 2P16A 1SFQB 3MMGA 2AMDA 4WH8A 4X6NA 1GVKB 4ZXYH 4KELA 3K9XB 1J9CH 2HPQH 3N7OA 3FAOA 1KLTA 1T8LA 2J92A 2R0LA 2AMQA 1TPAE 1CT0E 1G3CA 1V2LT 4JK6A 1GI3A 1XVMA 2BDBA 2Y81A 3I77A 1JRTA 1ZTKA 1QQUA 1SHYA 2SGDE 1SLVB 3D65E 1TLDA 3TJNA 2R9PA 4OS7A 4O3UA 5C2ZA 1GBTA 2OC7A 1EPTA 3AVZA 1WCZA 1HLTH 1TNHA 1K1JA 5L6NH 1N6YA 3A7XA 1O2JA 1C5WB 4BNRA 1UJ1A 3ENSB 3BIVH 1TNIA 5A0CA 2W26A 4X8UH 3PO1C 5GPIB 3UR6A 1P09A 3T62A 3UOUA 5A09A 1MTNC 4JYUH 1CA0C 5T6GA 1LHCH 1XM1A 1G37A 3MFJA 2CXVA 3C1KA 2GMTC 1N8OB 3L3TA 1O3KA 1N6XA 2BDCA 1W7GH 1SB1H 1TQ7B 4CH8B 2C8XB 2AH4X 3UWIA 3T29A 3SJKA 1L1JA 2Z3DA 1O3MA 3L6PA 1UTJA 1O5CB 2QF0A 3NXPA 2HNTC 4Y10E 3AAUA 2BDYA 1ELVA 1EJAA 1HRTH 1AD8H 2NWNA 2ZI2H 4AFZA 1QHRB 1P2QA 1Z8IB 2TRMA 2BVSH 2JH0D 3UQVA 2A7CA 1ELDE 4YLUA 2ZG0H 1QQ4A 1E36B 3T2NA 4CBOA 1GJAB 1TE0A 4AORA 3ZV8A 5E0GA 1KLIH 2BLVA 2CF8H 1AKSB 4CREA 2J4IA 4ABAA 3RXVA 2HOBA 3A84A 1RS0A 3EAJA 5LPEA 2BD8A 3DT0H 4UONA 1C2KA 1ARCA 2ANMH 3TLOA 1HAXB 1VR1H 5DP7A 3V3MA 3SU5A 4LZ4B 1C1TA 4NIXA 1OWDA 1D3TB 1ID5H 3MWIU 1SGNE 2OINA 4BTTB 3W95A 2SNWA 2G5NA 1Z6EA 1MQ6A 1P3EA 3KN2A 3SUFA 4MQAA 3FP8E 3QX5H 3GY6A 1QBNA 1BHXB 2YNAA 1GBAA 4IBLH 4CH2B 1QCPA 1PYTC 1CT4E 1EXFA 4K60A 1LPGB 3BG8A 1DVAH 4SGAE 1EJMA 2GD4B 1YCPM 4MNWA 2TBSA 3NKKA 2ANYA 1VITG 4FXGH 2ZGXH 1YPKH 3MO6A 4Q7ZA 1AO5A 1AZ8A 2CF9H 3GCOA 1HBTH 1O3DA 3ZYDA 1ACBE 1DT2A 1GBHA 1AU8A 2BYAX 1ZHMA 4WMDA 3A8CA 1IQHA 1TNKA 1TMBH 1Y5BT 2OXSA 1WSSH 1SLWB 1O0DH 3LOXA 3RM2H 1O30A 3MNBA 1MKWK 4MTBA 1U6QA 3TK5A 1CHGA 1C1PA 1VITF 1SGDE 1UMAH 1FJSA 4MPUA 3RXPA 4ABJA 4XDEA 1BRCE 4DT7B 2G4UA 2OC1A 2FOMB 5E0HA 4ABGA 1ZRBA 1HXEH 2J95A 2WPMS 4THNH 1LPKB 1MZDA 1OP0A 2FOBA 1UCYK 3P8OA 2ZU5A 1SL3A 1H4WA 2V6NA 3SI3H 1D6WA 1QRWA 1V2UT 3T26A 3TPIZ 3RXSA 1WAYB 1V2VT 4AFQA 1S82A 4AYVB 3LT3A 3ZZ5A 2G5VA 1BIOA 2QXGA 4Y76A 1K21H 1QBVH 3FZDA 3SQHE 2ANKH 1YPJH 4OS5A 1PJPA 1KXBA 1S85A 1S5SA 2PTNA 5DKMA 1A3EH 5EXLA 4YZUA 5A8XA 1ETTH 4B75A 1C9PA 1OYTH 2SGQE 3LIWA 1P0SH 1XMNB 2F3CE 1GJ5H 1NTPA 4DW2U 2W3IA 1MAYA 1BA8B 1O3BA 4ABEA 1C1RA 1W13U 1AIXH 4ZKRU 3RP2A 4DGJA 1W8BH 4B74A 1AFQB 2SNVA 2WPHS 2BQ6B 4FUBA 1W2KH 3OSYA 1Z8JB 2QGRA 4I8HA 2BY8X 4FUGA 3VB4A 2WUCA 1Y3YA 2BX4A 2D26C 3SV6A 2QAAA 2BXTH 1DY9A 2A7HA 1GMHG 2GVFA 1GJBB 3SGQE 1JOUB 1ELBA 1LVOA 2A4RA 3V13A 3LONA 1P06A 2Z6BD 3MI4A 1W12U 3M5OA 2STAE 1CHOF 1V2ST 2KAIB 1SGRE 5EODA 2GZ9A 2H9HA 3ZV9A 2VIPA 1J17T 3M7UA 4ABHA 2WINI 1GBJA 4I33A 2PKAB 2AEIH 2UUKB 1MQ5A 4GUXA 1Z1IA 2C8WB 3U1JB 2EEKA 5DP6A 1GMHF 1N8OC 1DUAA 4D9RA 3GY4A 1HAVB 1Z7KA 2AFQB 2OUAA 8GCHG 1Y3WA 2Y7ZA 3TGKE 1QRXA 3TGJE 2F9VA 1AE5A 3BSQA 2FWWA 2A2QH 4CRBA 5G4BA 3SV7A 3GCNA 2FM2A 1BMMH 1OX1A 3Q3XA 1O2GH 2FLRH 3KF2A 4ZMAH 4D9QA 3B9FH 3SORA 1DOJA 3MU4A 1T32A 2BD3A 2ZGJA 2AMPA 1UK2A 1TNJA 2P8OB 1O5BB 2BM2A 3S69A 1QBOA
chains in the Genus database with same CATH superfamily
2CHAC 2V0BA 1D3DB 2ZGHA 4A1TA 4K8BA 2SFAA 1HJAB 5GWZA 5K0HA 4WVPE 5DP5A 1ANEA 2FOCA 1DWDH 1TPOA 2VIWA 3O8BA 1QB1A 3PM3A 1B5GH 5F53A 2D8WA 1TALA 1ZSLA 3ZZ4A 3EA9A 3BTWE 4QT8C 2XTTB 3BIUH 3NUMA 1ZJDA 3ZVFA 2VVCA 1D3QB 1ELEE 2JDID 2O8UA 1GJ8B 4Z0KA 2Z3CA 3E0NB 1NFYA 3EGKH 2WPIS 3Q3YA 2OCVB 1C5TA 1NRSH 5E8EH 1ZGIA 4AG2A 1BUIA 1L0ZA 3L33A 1E0FD 5IYTA 3A7WA 4AGKA 1ZZZA 3ATMA 2ZHDA 4AG1A 3GYLB 2I6SA 1GI1A 3DFJA 5JBAS 2PLXA 1C5SA 1LHFH 3HKJB 5GCHG 2ODQA 3SNDA 4B1TA 1NU9A 2AGIX 5A8ZA 1NU7B 4IMZA 2FYRA 2PUQH 2XBYA 2BD4A 1F0TA 3IWMA 2W3KA 2FI3E 1THSH 2HWLB 1LMWB 1LPZB 1GDNA 3STIA 1TX8A 1THRH 3U28C 1MAXA 3K6ZA 2QA9E 3RXAA 3S9CA 2QCYA 3H7TA 4FVBA 4B71A 2VWMA 5F6MA 3M61U 5T3HA 3PO1B 4BAOB 4Q63A 2SGAA 3I29A 3PMJA 4OGYA 1D3PB 1F92A 3AW0A 1JRSA 1GHBF 3MO9A 1FY8E 4GCHG 3BTHE 3RU4D 5JB8S 3A82A 1RJXB 1YLDA 2IJOB 4FUFA 1SGIB 1SQTA 2F9UA 3P17H 3MU5A 1C5PA 1C2EA 5GXPA 1SQRA 3RM0H 3SJOA 2OLGA 2TGTA 4AFSA 1WOFA 1GI5A 3EA7A 4FUDA 4Y7AA 4JZ1A 2VB0A 1BOQA 2JJ1D 1ZPZA 5KECA 1EAIA 2VIVA 1TRNA 1AQ7A 1NC6A 2HPPH 1YBWA 4YOGA 3S9AA 4NIYA 1K28D 1C5YB 1NRQH 1C1MA 5FPYA 1XKAC 2B0FA 5C20A 1GG6B 5JBBS 1DWEH 3M3TA 3TH4H 1O3EA 1J16A 5LPFA 1W10U 1O3FA 4GCHF 2WUBA 5C17A 1HAYB 2A2XH 5A8YA 3UIRA 2Z9KA 1AFQC 2A45B 3EE0B 4GVUA 1PQ8A 1H8DH 2VWOA 1FIZA 3D23A 1K2I1 4X8TH 2WV4A 1UTNA 2DE8A 2ZHQH 3GY2A 1BJVA 4A6LA 2H9EH 2NU4E 1PFXC 1VGCB 2H5CA 3UREA 1Y3UA 4IN2A 4AN7A 2PUXB 1T8NA 4IS5A 1C2DA 2F83A 2C8YB 2J9NA 3A7TA 1GBFA 1GMCG 5EXNA 2BZAA 1GBMA 1NS3A 1C1QA 5HM9A 2R2WU 1XUGA 5DP4A 1GI7B 1XUKA 3TK6A 2BOKA 3RXGA 3E90B 2J98A 3B23B 1P10A 1O5FH 2ZEBA 1SGYE 2EI7A 1HCGA 2J98B 2C4FH 5DSFA 5LGOA 3RXLA 3RC4A 5BRRE 1V6DA 1ARBA 3KGPA 1ELAA 5LPRA 1C1UH 5ESTE 3RMLH 2M5TA 1YCPK 3DA9B 6GCHG 2FEQH 4H4FA 2IPHA 2ANWA 1JIMA 1GJCB 2GCHG 5JYIA 2ZGBH 3VB3A 1A1RA 1VJAU 1TOCB 2FI4E 5FHTA 3SU4A 3ZZ9A 5L2ZH 1C1WH 1GBBA 1SSXA 2RDEA 3ATWA 5EW2H 2VVVA 4CBNA 2HGTH 4FUIA 1IQNA 3SI4H 1TX7A 4B6EA 1O3LA 1A2CH 4CR9A 1ZMNA 3STJA 1AVWA 4RT1A 3LGTA 2XCNA 4X2VA 1C1OA 3ZZ6A 1O3AA 2A4QA 2ZFQH 1SGPE 1GJDB 2Z94A 3BG4B 6GCHF 2B8OH 1ZR0A 3SNAA 2GKVE 2GCHF 3F2HA 2BD9A 2FODA 5I25A 1BBRK 1TRYA 2BLOA 3CS0A 2PWXA 4TWWA 2P8OC 1WQVH 1V2OT 2KX4A 1FIWA 3RDZA 3IG6B 1AB9B 3SGAE 3VFEA 1TGBA 1K1IA 2AS9A 2GDDA 3LH3A 4YO9A 2BXUH 3RXEA 1HJAC 4ISNA 1EP5A 1ETRH 1ESBA 2FXRA 4AB8A 1W7XH 4NSYA 1OP2A 1G30B 1GWAA 1YPLH 2F9NA 2FOGA 3M5NA 5T1VA 4FU8A 3PMHB 4MNYA 2VIDA 1F5RA 2VH6A 4NFEA 1LHDH 3MU0A 2ZDAH 2NU1E 4BAHB 1RFNA 3KL6A 4X1RU 3NZIA 3F9HA 1TGSZ 3AK5A 1P8VC 5EQRA 1TIOA 1DLKB 2VJ1A 3ZZCA 1K1PA 3GDUA 1N1LA 2ASUB 1E79D 1F0UA 2G00A 1AWHB 1HGTH 1IQFA 3U1IB 4D76A 5FCKA 1Z1JA 2FOAA 3EQ0H 1V2NT 1ZHRA 4RSPA 1YC0A 3SNEA 2P3TB 1WV7H 1PQ5A 1MBMA 2B9LA 3AAVA 3GYMA 2A5KA 3TJVA 4ASHA 1T4UH 1DDJA 2GV7A 1EATA 1O3GA 4DG4A 2F9PA 4IC5A 3SV2H 1L4DA 1EPTB 1DICA 4R0IA 3N7EA 3SHAH 1DM4B 4F4OC 3S7HB 1GI9B 4WMFA 2R2MB 1BRBE 5EW1H 3KQCA 8LPRA 3ATLA 4ABBA 2OP9A 1A4WH 3VEQB 4H6TA 1BCUH 4NA8A 1K1NA 1O3OA 1PPEE 1MMJN 1YCPH 1ZMLA 3UTUH 6CHAB 1UVTH 1LCYA 1GHWH 3HPTB 1S83A 3VGCB 1KMHB 1QIXB 1YPGH 3A8BA 3M37A 1C5ZB 3RLWH 3T28A 2ZO3H 2CGAA 2ZTYA 3LC3A 1UTMA 3GCTG 4X0WU 5AFZH 3MH5A 1CVWH 1K9OE 2GCTB 3BTQE 1RTKA 4YOJA 5L2YH 5C0TA 1Y5UT 4NCYA 1FXYA 1Z8RA 2R0KA 1GG6C 1XX9A 2EI8A 4OM9A 2XOKD 4DJZB 2ZU2A 4TY7A 1Y8TA 1Y3VA 3UWJH 1TA2A 1RIWC 2GJGA 1BBRH 2FS9A 3DCLA 1HXFH 4XFQA 4Z6AH 1O2LA 2TGDA 4Q7YA 1MTUA 3MU8A 1AMHA 1RRKA 2ULLA 3KQEA 2J5UA 1W11U 1KTSB 2Y5HA 2CHAB 3GCTF 2QIQA 1YGCH 5I46H 1V2QT 1O3CA 2BDIA 1VGCC 1GI4A 4AZ2B 1S0QA 1C5RA 3D62A 1O37A 1HV7A 4O97A 4BAKB 1YPHC 2P3UB 2O8WA 1LDTT 2UUYA 1UTQA 1K1OA 2A4OA 1DSTA 1T8MA 3SYJA 2ZDLA 3HGNA 1QL7A 3ZVCA 2EI6A 3RUOA 1ZLRA 5SGAE 1EZSC 4NIWA 3HKIB 1TYNA 1ANDA 3GISB 1BQYA 4GPGA 3TNTA 3VXEH 3PLBA 1KXAA 1DY8A 3RXRA 3ZVGA 1GL0E 4K1SA 4XBDA 1SKYE 4I8LA 3RXJA 1EJNA 1QJ6B 2HVYB 3QO6A 1GVLA 1KDQA 3W94A 2W7UA 4YOIA 2WV9A 3O8DA 1TB6H 1GJ9B 2RDLA 4K1TA 5KEDA 1C2MA 1AUTC 3VG8A 4JZFH 3LJOA 4HTCH 1IQJA 2CV3A 1UVSH 2OQ5A 4MDSA 2WSSD 5EJZA 1L4ZA 1ZGVA 1W14U 2ZQ2A 1FAKH 5IDKA 3V0XA 2SGFE 4LXBH 4DURA 1CGHA 3RXMA 4R8TB 4JYVH 1GBEA 3DSGA 1O35A 1MCVA 1O2RA 2XWAA 3PV5A 5C5NA 1FY1A 1P2OA 4I31A 4TPYA 3BG4C 2WPDD 1FN6A 1XKBC 5TCCA 5FXLA 2XBXA 4I7YH 1TPPA 3O8RA 1C4U2 4FU7A 4XSKU 1C5VA 4ZHAA 2C93B 1MTVA 3A83A 4YT6H 1AB9C 3KQ5A 1ZSJA 1J15A 2HRVA 2ZU3A 3RXBA 1DFPA 1F7ZA 3MNCA 4UEHH 3QK1A 5DP3A 1VITH 3RXDA 2OC0A 5T6DA 4UFDH 5JPMH 1GHXH 2EQNA 5DG6A 5C1YA 1PPHE 1V2PT 4K1EA 5A2MH 2RFKC 2ZCLP 1GI2A 3ODFA 3UNSA 1S81A 1TGCA 3A88A 1YM0A 3M7QA 1O5DH 4NA7A 3SN8A 5ESBA 1CT2E 1F5KU 2BDHA 1PYTD 3P8NA 4F49A 1ZTJA 4LOYH 2PFEA 2OQUA 1GJ7B 3W1EA 1HAZB 2STBE 4ZH8A 2CJIA 2FI5E 3PMAB 1P04A 2ILNA 1K22H 1MABB 1C5LH 2A5AA 3SUGA 3DD2H 5ABWA 4A1VA 2WYGA 2CK3D 1CHOG 3RLYH 4NWLA 1Y3XA 5HM2A 2Z9LA 3F0PA 1NO9H 4YXWD 3LPRA 4K5ZA 2FP7B 1HB0B 3AW1A 4U2WA 3SZNA 1FN8A 1AGJA 1V2WT 1BZXE 3QTVH 3UR9A 5E0JA 3A8DA 4RI0A 4ZUHA 5EXMA 4HG6A 3WW7A 3ZVBA 2PP6A 1NT1A 3H09A 3P92A 1AY6H 1TX6A 3LC5A 2G51A 5HGGA 5C1UA 1EPTC 3V12A 3SUDA 3BV9B 1WTGH 1M9UA 6LPRA 4XD7D 3GY5A 3RMOH 1OOKB 1LKAA 2LELA 1V2RT 4AC9A 2P95A 4INLA 1IQEA 2Y6TA 1DUEA 1UTOA 3ZZ3A 3LH1A 1TONA 4Q7XA 1O2HA 4U01A 4B2AA 3KEEA 1TBQH 4I8GA 5J4QA 1ZTLA 1NM6A 3FP6E 4X8VH 4KKDA 1AUJA 1J14A 4K8YA 4Y79A 5EPNA 2L74A 3F0OA 3SJIA 6CHAC 4BOHA 1A5IA 2ZFPH 4JMYA 2H2ZA 4MPXA 1EAUA 1PPGE 4BANB 2GTBA 4Q2KA 3VGCC 4MPWA 1MD7A 1S0RA 2OD3B 4NG9H 1ZHPA 4RN6A 1BMNH 2Z3EA 2IPQX 2FOHA 4ACAA 3P8FA 2BX3A 1EZUC 3ZVEA 1BITA 2OBOA 3SU6A 2GCTC 1H1BA 1GVZA 1ZSKA 4MLFB 4AFUA 1QA7A 1ZPBA 2KCYA 3BTFE 1E38B 3CENA 5A0AE 3KQBA 3TNSA 1MH0A 1VZQH 2UWOA 3GCHB 1A5HA 4Y0YE 4Y8ZA 3RC6A 1C5QA 5GIBA 5JBTA 1O32A 3GY3A 3HK3B 3R3GB 1O38A 1CU1A 1BTZA 2XCFA 3UOPA 1QURH 2QF5A 3DHKH 1TWXB 1XXDA 2XBWA 2RCEA 3RC5A 1MKXK 4O03A 3M3VA 1RXPA 1P9SA 3F6UH 2F91A 1GMDF 4IC6A 1GHAG 2OK5A 2JJ2D 2LP6A 2M2AA 4P00A 4P02A 4YESB 1UTKA 1SG8B 1A7SA 1H9HE 1ZYOA 2OBQA 1WTHD 3BEIB 2NU3E 2D1JA 1O2TA 1MD8A 1QTFA 2W7SA 2QXHA 3MH7A 3KYFA 2P3FH 5C67A 1TNLA 2BHGA 4ZHLU 4GLYA 2QXIA 1SLUB 5JB9S 2H6MA 2Y5GA 4FVDA 2ZPQA 3VB6A 1G3EA 3FFGA 4HGCA 5EJLA 1SC8U 1SGFA 3TU7H 1AZZA 1HUTH 2A5IA 4FUJA 2VWLA 1GHAF 3TJUA 1WQSA 6ESTA 5TJXA 1TMUH 1GHBG 4NWKA 3GS9A 1UCYE 3UNQA 4BAQB 2QXJA 1FPHH 3ESTA 2V3OH 3SU1A 3Q77A 1KLJH 1YPHE 4MVNA 1O2QA 1QJ7B 1DSUA 4U32A 4DVAU 2Q6GA 1A3BH 2XYAA 2FYQA 4TSFD 4DT7B 2ZC9H 2BDAA 3KNXA 2P59A 3A85A 4K3JA 1PPCE 2K8IA 3HGPA 1KIGH 1CGIE 1ELGA 3PV4A 3TH3H 4DCDA 2YNBA 2ZIQH 4X1PU 2WPJS 4M7GA 1O2OA 1THPB 3E1XB 2C90B 2ZF0H 4YT7H 1HAHH 4D7GA 3BTTE 3BTKE 3PWCA 1P2MA 4IGDA 3F9EA 1FY4A 1PPBH 1GBLA 5GJ4B 1HYLA 2AIPA 5EGMA 1BMAA 1OWEA 3U69H 3VB7A 2J2UA 4I8KA 1L1GA 3ATIA 5F03A 1O2KA 5J4SA 1ELTA 1W0KD 3S7KB 1DPOA 2HVXA 1ANCA 4FU9A 2LPRA 3URCA 1DE7H 2KZ4A 1C2IA 3SU0A 3CNRA 2FMJA 1FUJA 1RTLA 3LDXH 3SQEE 3EYDA 3QN7A 1LQDB 1MU6B 2IOTA 1O2PA 2ZFRH 4JZDH 4KTCA 1C5OH 3UB0A 3LGWA 2Z7FE 1G32B 1HNEE 1S84A 1E37B 1IQKA 4BTUB 2TGAA 1OWJA 1P01A 1ELCA 1RIWB 1UVPA 4Y8YA 3Q3KA 2BD7A 5C5OA 3TGIE 1F2SE 1OYQA 3EDXB 3OE7D 1L1NA 1FPCH 2PHBA 1AE8H 1ZMJA 4OS2A 1HAIH 1AWFH 3NK8A 3A8AA 1C2GA 3OTPA 5CHAB 3UNRA 3F9FA 1ETSH 2AYWA 2GX4A 1GDUA 3K65B 1MKXH 3PMBB 1T8OA 4A5TS 2BY9X 2XC4A 1EB1H 1O36A 1VCWA 1H8ED 4Z1MD 2FESH 2G81E 2BOHB 4A92A 4YLQH 1GJ6A 4WJG2 3RXFA 1EUFA 3AASA 1Q2WA 4ZXXH 1UTLM 2W5EA 4WXVA 2O8TA 3TK9A 3KQDA 1IHTH 3RMNH 5FAHA 1EAXA 9LPRA 4TWYA 3GOVB 5FX5A 1GPZA 4TT3D 1DLEA 4UFEH 1OHHD 4FETA 1O3IA 3MU1A 3B8JA 3E0PB 3FO8D 2FPZA 2RA0A 3HATH 3U8RH 3UFAA 1UK4A 2HLDD 2TGPZ 2FDAA 1P05A 5DP9A 5DJ7A 1LQEA 4X1QU 4ABIA 3M5LA 2ZTZA 1OPHB 4HZHA 4B76A 4CRCA 2W6JD 1LVBA 1YPMH 3T27A 2IN2A 4ZHMU 1FAXA 2OTVA 3HK6B 5FCRA 1C1SA 4H6SB 4MG3A 4BAMB 2QV1A 3MH4A 1ZPCA 1NROH 1QGFA 2H5DA 2ZQ1A 3SV9A 1KXFA 2C3SA 2PGBB 3H7OA 4CRFA 4MNVA 1GBDA 1DITH 1FONA 1BRUP 1EASA 1C2HA 3GCHC 2ZU1A 2GT7A 1RGQA 2ZGCA 2K1QA 5K7RA 2VVUA 4YM9A 1FNIA 1P57B 1TNGA 1CE5A 1FI8A 2P93A 2UUJB 1CO7E 2F9BH 3BF6H 1UTPA 1EZQA 4FUEA 4ISLA 1EZXC 1BT7A 1A5GH 3FP7E 3H5CB 1LVMA 1T7CA 3F3BA 5HIZA 4DIIH 2ZFSA 5GDSH 4INKA 5KGOA 5HXFA 3ZZ7A 3D49H 5C3NA 2B7DH 1YLCA 2P94A 2Z9GA 1K1MA 4E06H 4KTSA 4UFFH 1BJUA 5FPTA 2UWLA 1GBIA 1PQAA 2Q6DA 1SOZA 1SOTA 1P2KA 3FOAA 2BLQA 1C2LA 1S6HA 2BTCE 4FUCA 3OYPA 3NPSA 1MZAA 3RXIA 3TJOA 1IQGA 3BTDE 1VCQA 3TITA 1SGTA 4DOQA 1EOLA 2WPKS 3MO3A 5AFYH 4CRAA 5FBEA 2WZQA 4IMQA 4E7NA 2UWPA 2ZDKA 1QRZA 2WPLS 1GCTB 1F5LA 1WYKA 2THFB 3ZYEA 1KTTB 2VGCB 1C5XB 2EY4C 3OEHD 1NFUA 5FPSA 3R0FA 5EJ1A 4ESTE 3NRLA 4Y71A 2FOFA 3FKSD 3PTNA 1A0JA 1G3BA 2GDEH 1KYNA 3ZVDA 3UY9A 2ALPA 3IITA 1ZOMA 4ZKNU 3F68H 5B6OA 2QC2A 3K2UA 4F55A 2DUCA 2ZWLH 4RKOB 3SU3A 3RXOA 4FOUC 3RU4E 2J34A 1GHZA 5F8TA 1V3XA 2FIRH 1HIAA 1SBWA 1XUHA 1TGNA 3SNCA 1GGDB 3A89A 1LO6A 4YTAA 1HIAB 2ZTXA 4JZEH 1SQOA 1LTOA 3OY6U 1SQAA 2ZHFH 4CRDA 4AYYB 2G4TA 1C5MD 4ZCNA 4MNXA 5E2OA 4B2BA 1DS2E 2WYJA 3QTOH 1E1QD 4A7IB 2AERH 3PRDA 3C27B 1KSNA 1FY3A 1MCTA 3GY7A 1NRRH 4LZ1H 3SJ9A 5E2PA 1Y59T 1QB9A 2Z9IA 4XE4A 4O3TA 1UVUH 1ESAA 1DANH 1CBWB 4I32A 1EAWA 4WY3A 1P12E 2A31A 3KIDU 3MQKC 1B0FA 3QWCH 2Y7XA 3A7VA 5DN6D 1O3JA 3SGBE 5CE1A 2FO9A 3SNBA 4UD9H 2A32A 4D8NA 2CN0H 2FX4A 1ABJH 5CHAC 1HJ9A 3QDZB 1MTSA 2C8ZB 1C9TA 1AFEH 4E7RG 2BLWA 2VNTA 3SHCH 1NBME 2G8TA 4ZKOU 2BB4A 2PSXA 1K1LA 1IQMA 3K6YA 1P11E 1AI8H 5CMXH 5DGJA 4INHA 1TBZH 2VIQA 1AKSA 1BRAA 2D2DA 1WU1A 3ATKA 2PGQB 4Y11E 3M3SA 2V3MA 4DY7B 2Z9JA 5DP8A 2B5TB 4VGCB 2XNIA 4NZQA 1O2UA 2BY6X 1C5NH 5EPYA 3T5FH 4AX9H 2CMYA 3LGYA 1ORFA 1SPJA 3A7YA 5BPEA 3RXQA 2ALVA 1HJ8A 4JCNA 1K0HA 3Q76A 4E05H 1PPFE 2ZFTA 3JZ2B 4BXWA 4BXSA 1CSOE 3BEFB 3N7DA 1CQQA 1UK3A 1XVOA 2NU0E 2HALA 3RXCA 1BBRE 1KY9A 1YKTA 1ELFA 1KDQB 4LK4A 3KYGA 1DWBH 1TMTH 1A46H 1PPZA 1UVOA 1GI6A 1BB0B 1AVXA 1WXRA 3S9BA 4WMEA 3VB5A 1YYY1 1DXWA 2TPIZ 2AIQA 2V7QD 2JETB 4JK5A 1NFWA 1TBRH 4X6OA 5HYOA 1SGCA 3OFND 3MHWU 2XRCA 1A0LA 5DO4H 2ZECA 3LGVA 1JMOH 1IAUA 2PKSC 3NWUA 2KR7A 5C94A 2XC0A 2GP9B 3Q00A 5H4IB 1YPEH 1UO6A 4X6PA 2L6OA 1C4Y2 1NFXA 1V2MT 4X6MA 5EG4A 4ISIH 3E16B 2AHME 4DIHH 1SGFG 1YP9A 3BTGE 1VCPA 2F9OA 1RTFB 1H9LB 1HDTH 2VBCA 3PTBA 2JH6D 3PLKA 3OU0A 3S0NA 4XBCA 3KHVA 4GHQA 1BTPA 4TYDA 4WWYA 3SV8A 3SU2A 1Q3XA 1JWTA 3ODDA 1JBUH 2F4LA 3KCGH 5AHGH 1O3PB 2ZFFH 3UAIC 2O8MA 3BN9A 8KME2 1C4V2 1GDQA 4B2CA 3TH2H 1NPMA 5AVDA 3BTEE 4PROA 3MTYA 4NFFA 1Z71A 1D9IA 1W0ZU 1OP8A 1TFXA 3E8LA 3A80A 2A1DB 4X2YA 1QL9A 2VWNA 4KTUA 1GL1A 2KCAA 3LGIA 3PYHA 3URDA 1AVGH 3F1SB 4OS1A 2PTCE 1SLXB 5FX6A 4ZROA 1GCTC 1OKXA 1QA0A 4UE7H 2IJD1 2VGCC 1IOEA 2AGGX 2BVXH 4FUHA 1VJ9U 5C0UA 3P70B 1Y5AT 2J97A 3QZQA 1C1VH 2XXLA 2A7JA 5C1XA 1OWIA 1TABE 2ZHEH 3BTME 5HMAA 3A86A 1B0EA 3PB1E 3ITIA 2XBVA 1P2NA 2ODYB 1BTUA 3RMMH 1TRMA 1O5EH 3PWBA 2PV9B 2FLBH 2BMGB 3OAAD 4ASUD 4GAWA 9ESTA 1G36A 1H8IH 2QN5T 3DSOA 2XC5A 3N99A 5EIYA 1B7XB 1S6FA 4CHAB 8ESTE 1GGDC 1O2VA 1GCDA 2OC8A 1LKBA 1TQ0B 1CA8B 2KAIA 1BTYA 3DFLA 2G52A 3M36A 4X2XA 4DT4A 2H9TH 4NSVA 3P95A 4XRNA 2QYIA 1DX5M 4HFPB 2PKAA 3RXKA 7GCHG 2FTMA 1O2WA 1MTWA 1NRNH 1EX3A 2XWBI 3G01A 3UPEA 2FS8A 4Y7BA 1XUJA 3ZZ8A 1KXCA 2ODPA 1GMDG 3U98H 5EQSA 1JXPA 2TIOA 1HAVA 3OTJE 4NGAH 4XBBA 2HNTF 2PR3A 5EU8A 2ZU4A 1AN1E 2RG3A 3TIUA 1CBWC 2ZNKH 1FLEE 1SGEE 4AB9A 2V35A 2Y82A 1BMLA 3A87A 1DWCH 3MOCA 4X1NU 1LHGH 4UDWH 1EOJA 2V3HH 2ZDNA 1OWKA 1C5UA 2ESTE 4ZKSU 4IN1A 7GCHF 1E34B 2VH0A 3VXFH 3GDSA 3QGNB 1P3CA 1MKWH 3SUEA 2ZA5A 1QY6A 3M5MA 1GBKA 4SGBE 3LU9B 3RXTA 1AHTH 4A1XA 4AGJA 4X2WA 3CS7A 4B73A 2J94A 3I78A 3LKWA 4X1SU 1H8HD 1VKYA 4F48B 2QY0B 4O9VA 1UCYH 8GCHF 2SGEE 1IQIA 2G55A 3EA8A 2ZKSA 4Y8XA 3QZRA 1ANBA 1RD3B 1QR3E 4VGCC 2HNTE 1C2JA 2QF3A 1D6RA 1G2MA 2ZPSA 3QGJA 1HPGA 1OS8A 3VPKA 1H9IE 1SFIA 2PSYA 4J2YB 3GICB 4NZLA 3QUMP 3SBKA 3PV2A 1OWHA 4ZAEA 3BEUA 2BY5X 3U8TH 3ELAH 1IQLA 2GGVB 3RU4T 1D4PB 3MNSA 1C1NA 2JH5D 3MNXA 1L2EA 7KMEH 1J8AA 1O2XA 3GDVA 4KP0A 1GI0A 1O2IA 4TY6A 5PTPA 1O2ZA 2BD2A 4HI3A 2WV5A 1P9UA 2BDGA 2HLCA 2BY7X 2VIOA 3ZZBA 5A0BA 1UHBA 3PRBA 1ABIH 1V2KT 2JETC 5DK1A 2FOEA 3M7TA 3UQOA 1KXEA 1UHBB 3O8CA 2ZDVH 4CR5A 2YOLA 2ZCKP 1O34A 3JZ1B 2JKHA 1UW7A 1TPSA 1FZZA 1SHHB 3DUXH 5JDUB 1OSSA 2F43B 1ESTA 3PLPA 1V2JT 1LVYA 1Z8GA 1O5AB 2H1UA 3E91A 1O33A 1FY5A 1P2JA 2KCOA 3SZEA 3OX7U 2VU8E 5GCHF 1MTNB 2BQWB 4OGXA 4X8SH 3A81A 3WWFA 1CA0B 2RA3A 1QFKH 3LJJA 2O9QA 1INCA 1WDIA 2GMTB 3V7TA 3E6PH 3RXHA 1G2LA 2ZHWH 3U9AH 1SMFE 3GY8A 4CRGA 3F9GA 4K2YA 3ZVAA 2FZZA 1F0RA 4H42U 1LHEH 1O2NA 4WF8A 2VINA 4J1YA 3FANA 2BVRH 4NIVA 5CHBA 1W3CA 1P02A 4D7FA 1GJ4H 2ZDMA 2AGEX 1HAGE 1HFDA 4MPVA 2Q6FA 1T31A 4JZIA 5EQQA 1P2IA 3UUZA 1EKBB 2UUFB 1EQ9A 1A0HB 3SOSA 1FX0B 1GBCA 1QL8A 1SR5C 4U30A 1MU8B 1O2YA 3M35A 2FX6A 4Y6DA 3QLPH 7ESTE 4TPIZ 5AF9H 5EOKA 1O39A 2DE9A 1GHVH 2NU2E 5F8ZA 2LNCA 3E3TA 1XUFA 5F8XA 4OS4A 4RKJB 5DPAA 3FVFB 1NN6A 1TAWA 2FTLE 1HAPH 1G3DA 1MUEB 3SW2B 2ZP0H 3T25A 1W0YH 2Q1JA 2R3UA 4ACBA 1FDPA 1O31A 1TGTA 2I6QA 1BTWA 1KXDA 1O2MA 3P6ZB 4Q80A 2SGPE 4ABDA 1QJ1B 4CHAC 1NBMD 2ZPRA 2PW8H 4WH6A 5GNDA 3U8OH 1YF4A 2GZ8A 2Y5FA 1F0SA 1EP6A 1O3NA 5LH8A 1CGJE 2XW9A 3A7ZA 1NESE 5ETXA 1BTHH 7LPRA 4K69A 1E35B 5L30H 3RXUA 1SI5H 2GV6A 5JBCS 4Q4LA 1C2FA 4ISHH 4XOJA 5FBIA 1T4VH 4NA9H 4GSOA 1FQ3A 5HKKD 1G9IE 1NY22 1QB6A 2EA3A 2A0QB 4JYTA 2EC9H 3MYWA 1XXFA 4KGAA 1HAOH 2JIZD 4GHTA 2GZ7A 1BTXA 2A4GA 1GMCF 2PKSB 3P8GA 1O5GH 4BTIB 1X7AC 2BZ6H 2KFWA 3SO3A 3PROA 1OXGA 2R3YA 1SVPA 1FMGA 2J38A 3LGUA 1ZRKA 4ABFA 3NCLA 4ISOA 5TCAA 3MH6A 1E1RD 1FV9A 4AOQA 1A61H 4OS6A 1MBQA 1GI8B 1XUIA 1EB2A 1WBGB 5T6FA 1O3HA 1DXPA 1NZQH 4M9FA 3WY8A 1IHSH 2YMSB 4IW4E 2GT8A 3ZZAA 1NRPH 1QNJA 1GHYH 2BQ7B 3FZZA 1V2TT 2O8LA 3CP7A 2BD5A 1O2SA 1TA6A 4I8JA 1Z6JH 2Y80A 4WXIA 4Y0ZE 1JIRA 1BDAA 1PQ7A 1ZJKA 3SJ8A 4UFGH 1Q31A 3ZZDA 3TVJB 2ZCHP 2ZZUH 1TOMH 1WUNH 1P03A 1SGQE 5CDFE 1BHXF 3OY5U 3FN8A 2P16A 1SFQB 3MMGA 2AMDA 4WH8A 4X6NA 1GVKB 4ZXYH 4KELA 3K9XB 1J9CH 2HPQH 3N7OA 3FAOA 1KLTA 1T8LA 2J92A 2R0LA 2AMQA 1TPAE 1CT0E 1G3CA 1V2LT 3DSPA 4JK6A 1GI3A 1XVMA 2BDBA 2Y81A 3I77A 1JRTA 1ZTKA 1QQUA 1SHYA 2SGDE 1SLVB 3D65E 1TLDA 3TJNA 2W6ID 2R9PA 4OS7A 4O3UA 5C2ZA 1GBTA 2OC7A 1EPTA 3AVZA 1WCZA 1HLTH 2QF4A 1TNHA 2WHXA 1K1JA 5L6NH 1N6YA 3A7XA 1O2JA 1C5WB 4BNRA 1UJ1A 3ENSB 3BIVH 1TNIA 5A0CA 2W26A 4X8UH 1QZ8A 3PO1C 5GPIB 3UR6A 1P09A 3T62A 3UOUA 5A09A 1MTNC 4JYUH 1CA0C 5T6GA 1LHCH 1XM1A 1G37A 3MFJA 2CXVA 3C1KA 2GMTC 1N8OB 5HIYA 3L3TA 1O3KA 1N6XA 2BDCA 1W7GH 1SB1H 1TQ7B 4CH8B 2C8XB 2AH4X 3UWIA 3T29A 3SJKA 1L1JA 2Z3DA 1O3MA 3L6PA 1UTJA 1O5CB 2QF0A 3NXPA 2HNTC 1BMFD 3OEED 4Y10E 3AAUA 2BDYA 1ELVA 1EJAA 1HRTH 1AD8H 2NWNA 2ZI2H 4AFZA 1QHRB 1P2QA 1Z8IB 2TRMA 2BVSH 2JH0D 3UQVA 2A7CA 1ELDE 4YLUA 2ZG0H 1QQ4A 1E36B 3T2NA 4CBOA 1YLNA 1GJAB 1TE0A 4AORA 1YY3A 3ZV8A 5E0GA 1KLIH 2BLVA 2CF8H 1AKSB 4CREA 2J4IA 4ABAA 3RXVA 2HOBA 3A84A 1RS0A 3EAJA 5LPEA 2BD8A 3DT0H 4UONA 1C2KA 1ARCA 2ANMH 3TLOA 1HAXB 1VR1H 5DP7A 3V3MA 3SU5A 4LZ4B 1C1TA 4NIXA 1OWDA 1D3TB 1ID5H 3MWIU 1SGNE 2OINA 4BTTB 3W95A 2SNWA 2G5NA 1Z6EA 3F2GA 1MQ6A 1P3EA 3KN2A 3SUFA 4MQAA 3FP8E 3QX5H 3GY6A 1QBNA 1BHXB 2YNAA 1GBAA 4IBLH 4CH2B 5B6LA 1QCPA 1PYTC 1CT4E 1EXFA 5IK2D 4K60A 1LPGB 3BG8A 1DVAH 4SGAE 1EJMA 2GD4B 1YCPM 4MNWA 2TBSA 3NKKA 2ANYA 1VITG 4FXGH 2ZGXH 1YPKH 3MO6A 4Q7ZA 1AO5A 1AZ8A 2CF9H 3GCOA 1HBTH 1O3DA 3ZYDA 1ACBE 1DT2A 1GBHA 1AU8A 2QE7D 2BYAX 1ZHMA 4WMDA 3A8CA 1IQHA 1TNKA 1TMBH 1Y5BT 2OXSA 1WSSH 1SLWB 1O0DH 3LOXA 3RM2H 1O30A 3MNBA 1MKWK 4MTBA 1U6QA 1YWUA 2XNDD 3TK5A 1CHGA 1C1PA 1VITF 1SGDE 1UMAH 2K0QA 1FJSA 2KCPA 4MPUA 3RXPA 4XDEA 1BRCE 4ABJA 2G4UA 2OC1A 2FOMB 5E0HA 2YMSC 4ABGA 1ZRBA 1HXEH 2J95A 2WPMS 4THNH 1LPKB 4B6FA 1MZDA 1OP0A 2FOBA 1UCYK 3P8OA 2ZU5A 1SL3A 1H4WA 2V6NA 3SI3H 1D6WA 1QRWA 1V2UT 3T26A 3TPIZ 3RXSA 1WAYB 1V2VT 4AFQA 1S82A 4AYVB 3LT3A 3ZZ5A 2G5VA 1BIOA 2QXGA 4Y76A 1K21H 1QBVH 3FZDA 3SQHE 2ANKH 1YPJH 4OS5A 1PJPA 1KXBA 1W0JD 1S85A 1COWD 1S5SA 2PTNA 5DKMA 1A3EH 5EXLA 4YZUA 5A8XA 1ETTH 4B75A 1C9PA 1OYTH 2SGQE 3LIWA 1P0SH 3WWBA 1XMNB 2F3CE 1GJ5H 1NTPA 4DW2U 2W3IA 1MAYA 1BA8B 1O3BA 4ABEA 1C1RA 1W13U 1AIXH 4ZKRU 3RP2A 4DGJA 1W8BH 4B74A 1AFQB 2SNVA 2WPHS 2BQ6B 4FUBA 1W2KH 3OSYA 1Z8JB 2QGRA 4I8HA 2BY8X 1EFRD 4FUGA 3VB4A 2WUCA 1Y3YA 2BX4A 3EE7A 2D26C 3SV6A 2QAAA 2BXTH 1DY9A 2A7HA 1GMHG 2GVFA 1GJBB 3SGQE 1JOUB 1ELBA 1LVOA 2A4RA 3F2FA 3V13A 3LONA 1P06A 2Z6BD 3MI4A 4I86A 1W12U 3M5OA 2YMSD 2STAE 1CHOF 1V2ST 2KAIB 1SGRE 5EODA 2GZ9A 2H9HA 3ZV9A 2VIPA 1J17T 3M7UA 4RT0A 4ABHA 2WINI 1GBJA 4I33A 2PKAB 2AEIH 2UUKB 1MQ5A 4GUXA 1Z1IA 2C8WB 1S6LA 3U1JB 2EEKA 5DP6A 1GMHF 1N8OC 1DUAA 3ZIAD 4D9RA 3GY4A 1HAVB 1Z7KA 2AFQB 2OUAA 8GCHG 1Y3WA 2Y7ZA 3TGKE 1QRXA 3TGJE 2F9VA 1AE5A 3BSQA 2FWWA 2A2QH 4CRBA 5G4BA 2KM0A 3GCNA 3SV7A 2FM2A 1BMMH 5FL7D 1OX1A 3Q3XA 1O2GH 2FLRH 3KF2A 4ZMAH 4D9QA 3B9FH 3SORA 1DOJA 3MU4A 1T32A 2BD3A 2ZGJA 2AMPA 1UK2A 1TNJA 2P8OB 1O5BB 2BM2A 3S69A 1QBOA
chains in the Genus database with same CATH topology
2CHAC 2V0BA 1D3DB 2ZGHA 4A1TA 4K8BA 2SFAA 1HJAB 5GWZA 5K0HA 4WVPE 5DP5A 1ANEA 2FOCA 1DWDH 1TPOA 2VIWA 3O8BA 1QB1A 3PM3A 1B5GH 2D8WA 1TALA 1ZSLA 3ZZ4A 3EA9A 3BTWE 4QT8C 2XTTB 3BIUH 3NUMA 1ZJDA 3ZVFA 2VVCA 1D3QB 1ELEE 2O8UA 4Z0KA 1GJ8B 2Z3CA 3E0NB 1NFYA 3EGKH 2WPIS 3Q3YA 2OCVB 1C5TA 1NRSH 5E8EH 1ZGIA 4AG2A 1BUIA 1L0ZA 3L33A 1E0FD 5IYTA 3A7WA 4AGKA 1ZZZA 3ATMA 2ZHDA 4AG1A 3GYLB 2I6SA 1GI1A 3DFJA 5JBAS 2PLXA 1C5SA 1LHFH 3HKJB 5GCHG 2ODQA 3SNDA 4B1TA 1NU9A 2AGIX 5A8ZA 1NU7B 4IMZA 2FYRA 2PUQH 2XBYA 2BD4A 1F0TA 3IWMA 2W3KA 2FI3E 1THSH 2HWLB 1LMWB 1LPZB 1GDNA 3STIA 1TX8A 1THRH 1MAXA 3K6ZA 2QA9E 3RXAA 3S9CA 2QCYA 3H7TA 4FVBA 4B71A 2VWMA 5F6MA 3M61U 5T3HA 3PO1B 4BAOB 2SGAA 3I29A 3PMJA 4OGYA 1D3PB 1F92A 3AW0A 1JRSA 1GHBF 3MO9A 1FY8E 4GCHG 3BTHE 3RU4D 5JB8S 3A82A 1RJXB 1YLDA 2IJOB 4FUFA 1SGIB 1SQTA 2F9UA 3P17H 3MU5A 1C5PA 1C2EA 5GXPA 3RM0H 3SJOA 2OLGA 2TGTA 4AFSA 1WOFA 1GI5A 3EA7A 4FUDA 4Y7AA 4JZ1A 2VB0A 1BOQA 1ZPZA 1EAIA 2VIVA 1TRNA 1AQ7A 1NC6A 2HPPH 1YBWA 4YOGA 3S9AA 4NIYA 1K28D 1C5YB 1NRQH 1C1MA 5FPYA 1XKAC 2B0FA 5C20A 1GG6B 5JBBS 1DWEH 3M3TA 3TH4H 1O3EA 1J16A 5LPFA 1W10U 1O3FA 4GCHF 2WUBA 1HAYB 2A2XH 5A8YA 3UIRA 2Z9KA 1AFQC 2A45B 3EE0B 4GVUA 1PQ8A 1H8DH 2VWOA 1FIZA 3D23A 1K2I1 4X8TH 2WV4A 1UTNA 2DE8A 2ZHQH 3GY2A 1BJVA 4A6LA 2H9EH 2NU4E 1PFXC 1VGCB 2H5CA 3UREA 1Y3UA 4IN2A 4AN7A 2PUXB 1T8NA 4IS5A 1C2DA 2F83A 2C8YB 2J9NA 3A7TA 1GBFA 1GMCG 5EXNA 2BZAA 1GBMA 1NS3A 1C1QA 5HM9A 2R2WU 1XUGA 5DP4A 1GI7B 1XUKA 3TK6A 2BOKA 3RXGA 3E90B 3B23B 1P10A 1O5FH 2ZEBA 1SGYE 2EI7A 1HCGA 2C4FH 5LGOA 3RXLA 3RC4A 5BRRE 1V6DA 1ARBA 3KGPA 1ELAA 5LPRA 1C1UH 5ESTE 3RMLH 2M5TA 1YCPK 3DA9B 6GCHG 2FEQH 4H4FA 2IPHA 2ANWA 1JIMA 1GJCB 2GCHG 5JYIA 2ZGBH 3VB3A 1A1RA 1VJAU 1TOCB 2FI4E 5FHTA 3SU4A 3ZZ9A 5L2ZH 1C1WH 1GBBA 1SSXA 3ATWA 5EW2H 2VVVA 4CBNA 2HGTH 4FUIA 1IQNA 3SI4H 1TX7A 1O3LA 1A2CH 4CR9A 1ZMNA 3STJA 1AVWA 3LGTA 2XCNA 4X2VA 1C1OA 3ZZ6A 1O3AA 2A4QA 2ZFQH 1SGPE 1GJDB 2Z94A 3BG4B 6GCHF 2B8OH 1ZR0A 3SNAA 2GKVE 2GCHF 2BD9A 2FODA 5I25A 1BBRK 1TRYA 2BLOA 3CS0A 2PWXA 4TWWA 2P8OC 1WQVH 1V2OT 1FIWA 3RDZA 3IG6B 1AB9B 3SGAE 3VFEA 1TGBA 1K1IA 2AS9A 2GDDA 3LH3A 4YO9A 2BXUH 3RXEA 1HJAC 4ISNA 1EP5A 1ETRH 1ESBA 2FXRA 4AB8A 1W7XH 4NSYA 1OP2A 1G30B 1GWAA 1YPLH 2F9NA 2FOGA 3M5NA 4FU8A 3PMHB 4MNYA 2VIDA 1F5RA 2VH6A 4NFEA 1LHDH 3MU0A 2ZDAH 2NU1E 4BAHB 1RFNA 3KL6A 4X1RU 3NZIA 3F9HA 1TGSZ 1P8VC 5EQRA 1TIOA 1DLKB 2VJ1A 3ZZCA 1K1PA 3GDUA 1N1LA 2ASUB 1F0UA 2G00A 1AWHB 1HGTH 1IQFA 3U1IB 4D76A 5FCKA 1Z1JA 2FOAA 3EQ0H 1V2NT 1ZHRA 4RSPA 1YC0A 3SNEA 2P3TB 1WV7H 1PQ5A 1MBMA 2B9LA 3AAVA 3GYMA 2A5KA 3TJVA 4ASHA 1T4UH 1DDJA 2GV7A 1EATA 1O3GA 4DG4A 2F9PA 4IC5A 3SV2H 1L4DA 1EPTB 1DICA 4R0IA 3SHAH 1DM4B 4F4OC 3S7HB 1GI9B 4WMFA 2R2MB 1BRBE 5EW1H 3KQCA 8LPRA 3ATLA 4ABBA 2OP9A 1A4WH 3VEQB 4H6TA 1BCUH 4NA8A 1K1NA 1O3OA 1PPEE 1MMJN 1YCPH 1ZMLA 3UTUH 6CHAB 1UVTH 1LCYA 1GHWH 3HPTB 1S83A 3VGCB 1QIXB 1YPGH 3A8BA 3M37A 1C5ZB 3RLWH 3T28A 2ZO3H 2CGAA 2ZTYA 3LC3A 1UTMA 3GCTG 4X0WU 5AFZH 3MH5A 1CVWH 1K9OE 2GCTB 3BTQE 1RTKA 4YOJA 5L2YH 1Y5UT 4NCYA 1FXYA 1Z8RA 2R0KA 1GG6C 1XX9A 2EI8A 4DJZB 2ZU2A 4TY7A 1Y8TA 1Y3VA 3UWJH 1TA2A 1RIWC 1BBRH 2FS9A 4Z6AH 1HXFH 4XFQA 1O2LA 2TGDA 4Q7YA 1MTUA 3MU8A 1AMHA 1RRKA 2ULLA 3KQEA 1W11U 1KTSB 2Y5HA 2CHAB 3GCTF 2QIQA 1YGCH 5I46H 1V2QT 1O3CA 2BDIA 1VGCC 1GI4A 4AZ2B 1S0QA 1C5RA 3D62A 1O37A 1HV7A 4O97A 4BAKB 1YPHC 2P3UB 2O8WA 1LDTT 2UUYA 1UTQA 1K1OA 2A4OA 1DSTA 1T8MA 2ZDLA 3HGNA 1QL7A 3ZVCA 2EI6A 3RUOA 1ZLRA 5SGAE 1EZSC 4NIWA 3HKIB 1TYNA 1ANDA 3GISB 1BQYA 4GPGA 3TNTA 3VXEH 3PLBA 1KXAA 1DY8A 3RXRA 3ZVGA 1GL0E 4K1SA 4XBDA 4I8LA 3RXJA 1EJNA 1QJ6B 3QO6A 1GVLA 1KDQA 3W94A 2W7UA 4YOIA 3O8DA 1TB6H 1GJ9B 2RDLA 4K1TA 1C2MA 1AUTC 4JZFH 3LJOA 4HTCH 1IQJA 2CV3A 1UVSH 2OQ5A 4MDSA 1L4ZA 1ZGVA 1W14U 2ZQ2A 1FAKH 5IDKA 3V0XA 2SGFE 4LXBH 4DURA 1CGHA 3RXMA 4R8TB 4JYVH 1GBEA 1O35A 1MCVA 1O2RA 2XWAA 5C5NA 1FY1A 1P2OA 4I31A 4TPYA 3BG4C 1FN6A 1XKBC 5TCCA 5FXLA 2XBXA 4I7YH 1TPPA 3O8RA 1C4U2 4FU7A 4XSKU 1C5VA 4ZHAA 2C93B 1MTVA 3A83A 4YT6H 1AB9C 1ZSJA 1J15A 2HRVA 2ZU3A 3RXBA 1DFPA 1F7ZA 3MNCA 4UEHH 3QK1A 5DP3A 1VITH 3RXDA 2OC0A 5T6DA 4UFDH 5JPMH 1GHXH 5DG6A 5C1YA 1PPHE 1V2PT 4K1EA 5A2MH 2ZCLP 1GI2A 3ODFA 3UNSA 1S81A 1TGCA 3A88A 1YM0A 3M7QA 1O5DH 4NA7A 3SN8A 5ESBA 1CT2E 1F5KU 2BDHA 1PYTD 3P8NA 4F49A 1ZTJA 4LOYH 2PFEA 2OQUA 1GJ7B 1HAZB 2STBE 4ZH8A 2CJIA 2FI5E 3PMAB 1P04A 2ILNA 1K22H 2A5AA 1C5LH 3SUGA 3DD2H 5ABWA 4A1VA 2WYGA 1CHOG 3RLYH 4NWLA 1Y3XA 5HM2A 2Z9LA 1NO9H 3LPRA 4K5ZA 2FP7B 1HB0B 3AW1A 4U2WA 3SZNA 1FN8A 1AGJA 1V2WT 1BZXE 3QTVH 3UR9A 5E0JA 3A8DA 4ZUHA 5EXMA 3ZVBA 1NT1A 3P92A 1AY6H 1TX6A 3LC5A 2G51A 5HGGA 5C1UA 1EPTC 3V12A 3SUDA 3BV9B 1WTGH 1M9UA 6LPRA 3GY5A 3RMOH 1OOKB 1LKAA 1V2RT 2P95A 4INLA 1IQEA 2Y6TA 1DUEA 1UTOA 3ZZ3A 3LH1A 1TONA 4Q7XA 1O2HA 4U01A 4B2AA 3KEEA 1TBQH 4I8GA 5J4QA 1ZTLA 1NM6A 3FP6E 4X8VH 4KKDA 1AUJA 1J14A 4K8YA 4Y79A 5EPNA 3SJIA 6CHAC 4BOHA 1A5IA 2ZFPH 4JMYA 2H2ZA 4MPXA 1EAUA 1PPGE 4BANB 2GTBA 4Q2KA 3VGCC 4MPWA 1MD7A 1S0RA 2OD3B 4NG9H 1ZHPA 4RN6A 1BMNH 2Z3EA 2FOHA 3P8FA 2BX3A 1EZUC 3ZVEA 2OBOA 1BITA 3SU6A 2GCTC 1H1BA 1GVZA 1ZSKA 4MLFB 4AFUA 1QA7A 1ZPBA 3BTFE 3CENA 1E38B 5A0AE 3KQBA 3TNSA 1MH0A 1VZQH 2UWOA 3GCHB 1A5HA 4Y0YE 4Y8ZA 3RC6A 1C5QA 5GIBA 5JBTA 1O32A 3GY3A 3HK3B 3R3GB 1O38A 1CU1A 1BTZA 2XCFA 3UOPA 1QURH 3DHKH 1TWXB 1XXDA 2XBWA 2RCEA 3RC5A 1MKXK 4O03A 3M3VA 1RXPA 1P9SA 3F6UH 2F91A 1GMDF 4IC6A 1GHAG 4YESB 1UTKA 1SG8B 1A7SA 1H9HE 1ZYOA 2OBQA 1WTHD 3BEIB 2NU3E 2D1JA 1O2TA 1MD8A 1QTFA 2W7SA 2QXHA 3MH7A 2P3FH 5C67A 1TNLA 2BHGA 4ZHLU 4GLYA 2QXIA 1SLUB 5JB9S 2H6MA 2Y5GA 4FVDA 2ZPQA 3VB6A 1G3EA 3FFGA 4HGCA 1SC8U 1SGFA 3TU7H 1AZZA 1HUTH 2A5IA 4FUJA 2VWLA 1GHAF 3TJUA 1WQSA 6ESTA 5TJXA 1TMUH 1GHBG 4NWKA 1UCYE 3UNQA 4BAQB 2QXJA 1FPHH 3ESTA 2V3OH 3SU1A 3Q77A 1KLJH 1YPHE 4MVNA 1O2QA 1QJ7B 1DSUA 4U32A 4DVAU 2Q6GA 1A3BH 2XYAA 2FYQA 2ZC9H 2BDAA 3KNXA 2P59A 3A85A 4K3JA 1PPCE 3HGPA 1KIGH 1CGIE 1ELGA 3PV4A 3TH3H 4DCDA 2YNBA 2ZIQH 4X1PU 2WPJS 4M7GA 1O2OA 1THPB 3E1XB 2C90B 2ZF0H 4YT7H 1HAHH 4D7GA 3BTTE 3BTKE 3PWCA 1P2MA 4IGDA 3F9EA 1FY4A 1PPBH 1GBLA 5GJ4B 1HYLA 2AIPA 5EGMA 1BMAA 1OWEA 3U69H 3VB7A 2J2UA 4I8KA 1L1GA 3ATIA 5F03A 1O2KA 5J4SA 1ELTA 3S7KB 1DPOA 2HVXA 1ANCA 4FU9A 2LPRA 3URCA 1DE7H 1C2IA 3SU0A 2FMJA 1FUJA 1RTLA 3LDXH 3SQEE 3EYDA 3QN7A 1LQDB 1MU6B 1O2PA 2IOTA 2ZFRH 4JZDH 4KTCA 1C5OH 3LGWA 2Z7FE 1G32B 1HNEE 1S84A 1E37B 1IQKA 4BTUB 2TGAA 1OWJA 1P01A 1ELCA 1RIWB 1UVPA 4Y8YA 3Q3KA 2BD7A 5C5OA 3TGIE 1F2SE 1OYQA 3EDXB 1L1NA 1FPCH 2PHBA 1AE8H 1ZMJA 4OS2A 1HAIH 1AWFH 3NK8A 3A8AA 1C2GA 5CHAB 3UNRA 3F9FA 1ETSH 2AYWA 2GX4A 1GDUA 3K65B 1MKXH 3PMBB 1T8OA 4A5TS 2BY9X 2XC4A 1EB1H 1O36A 1VCWA 2FESH 2G81E 2BOHB 4A92A 4YLQH 1GJ6A 4WJG2 3RXFA 1EUFA 3AASA 1Q2WA 4ZXXH 1UTLM 2W5EA 4WXVA 2O8TA 3TK9A 3KQDA 1IHTH 3RMNH 5FAHA 1EAXA 9LPRA 4TWYA 3GOVB 5FX5A 1GPZA 1DLEA 4UFEH 1O3IA 3MU1A 3B8JA 3E0PB 2FPZA 2RA0A 3HATH 3U8RH 3UFAA 1UK4A 2TGPZ 2FDAA 1P05A 5DP9A 5DJ7A 1LQEA 4X1QU 4ABIA 3M5LA 2ZTZA 1OPHB 4HZHA 4B76A 4CRCA 1LVBA 1YPMH 3T27A 2IN2A 4ZHMU 1FAXA 2OTVA 3HK6B 5FCRA 1C1SA 4H6SB 4MG3A 4BAMB 2QV1A 3MH4A 1ZPCA 1NROH 1QGFA 2H5DA 2ZQ1A 3SV9A 1KXFA 2C3SA 2PGBB 3H7OA 4CRFA 4MNVA 1GBDA 1DITH 1FONA 1BRUP 1EASA 1C2HA 3GCHC 2ZU1A 2GT7A 1RGQA 2ZGCA 2K1QA 5K7RA 2VVUA 4YM9A 1FNIA 1P57B 1TNGA 1CE5A 1FI8A 2P93A 2UUJB 1CO7E 2F9BH 3BF6H 1UTPA 1EZQA 4FUEA 4ISLA 1EZXC 1BT7A 1A5GH 3FP7E 3H5CB 1LVMA 1T7CA 4DIIH 2ZFSA 5GDSH 4INKA 5HXFA 3ZZ7A 3D49H 5C3NA 2B7DH 1YLCA 2P94A 2Z9GA 1K1MA 4E06H 4KTSA 4UFFH 1BJUA 5FPTA 2UWLA 1GBIA 1PQAA 2Q6DA 1SOZA 1SOTA 1P2KA 2BLQA 1C2LA 1S6HA 2BTCE 4FUCA 3OYPA 3NPSA 1MZAA 3RXIA 3TJOA 1IQGA 3BTDE 1VCQA 3TITA 1SGTA 4DOQA 1EOLA 2WPKS 3MO3A 5AFYH 4CRAA 5FBEA 4IMQA 4E7NA 2UWPA 2ZDKA 1QRZA 2WPLS 1GCTB 1F5LA 1WYKA 2THFB 3ZYEA 1KTTB 2VGCB 1C5XB 1NFUA 5FPSA 3R0FA 4ESTE 4Y71A 2FOFA 3PTNA 1A0JA 1G3BA 2GDEH 1KYNA 3ZVDA 3UY9A 2ALPA 3IITA 1ZOMA 4ZKNU