2FI4E

Crystal structure of a bpti variant (cys14->ser) in complex with trypsin
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
222
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
publication title Functional and structural roles of the Cys14-Cys38 disulfide of bovine pancreatic trypsin inhibitor.
pubmed doi rcsb
source organism Bos taurus
total genus 59
structure length 222
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2005-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fi4E01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fi4E02
4FUBA 4DIHH 1GHYH 5DP3A 2ZECA 5H4IB 3SU2A 1FDPA 1O5EH 4ZROA 3PMJA 3V12A 2BLWA 1LHFH 4ABAA 4ZKOU 1KLJH 2ZU1A 2WUCA 1NFYA 3ATMA 2C8XB 1HAGE 1HAYB 1BQYA 1A1RA 1BRBE 3JZ2B 2IJOB 2BDYA 4D7FA 1ARBA 1K1LA 3PYHA 2AS9A 4ZKSU 2VH6A 1Q31A 1CO7E 1TB6H 1FJSA 1EXFA 3BTHE 1BA8B 2ZG0H 3BTKE 1O2HA 3OSYA 4R0IA 1H8IH 5L30H 1C1VH 3D65E 5I46H 2AERH 3ZVCA 5HM9A 1GI9B 4NFFA 2ANYA 4JYTA 1GVLA 4Y7AA 1C4U2 1C5RA 2VGCB 1V2PT 4VGCC 1NU9A 1DICA 1FY4A 1VGCC 2B7DH 3Q76A 3SORA 5C3NA 1FY3A 1EAXA 3LGUA 3F9HA 1OSSA 3PROA 1GBCA 1HIAA 4SGAE 3VB5A 2XWBI 1W3CA 2G4TA 1Y5AT 2BZ6H 1V2TT 4B76A 5FPYA 1O5BB 3SU5A 5EOKA 3TLOA 1AHTH 1KDQA 1P3CA 1GJ8B 1SVPA 3LH3A 1FY1A 1AD8H 4H4FA 3T26A 3P95A 1MCTA 5E8EH 2HNTF 2PKAA 2GDDA 2ZTZA 1TGBA 3ODFA 3HATH 1Z6JH 4A1TA 3LJJA 2D1JA 4X6OA 1SGFG 3BTEE 1EP5A 3LH1A 3R3GB 2QN5T 4IGDA 1IQKA 2PUXB 1SGEE 1TNKA 4X2YA 3P8OA 5F8TA 1GBKA 4OGYA 4X2WA 2BVXH 2SNWA 2ZU5A 2PTNA 1SLVB 2ZGCA 4JZEH 1SOZA 3GICB 2VIVA 1JIRA 5EG4A 1TX8A 2HNTC 4X1RU 3BEUA 1O3AA 1OOKB 2CF8H 3PV4A 3BTWE 3M3SA 1ACBE 2A7HA 2FI5E 1UTQA 5T6FA 1P2OA 1YPMH 2A5KA 2GT7A 1OYQA 2Z9JA 4BTUB 4OS2A 5LH8A 2ZTXA 3OU0A 3BG8A 1F2SE 1AMHA 1TABE 1EZUC 1VJ9U 2YNAA 4AZ2B 4Y7BA 1XUIA 5IDKA 4WY3A 2QIQA 5F03A 5E2OA 1FQ3A 4THNH 1ID5H 3LONA 4NZLA 3RXVA 1FY8E 1P2JA 3OY5U 3HGPA 4BTIB 1ZHPA 1F5RA 1D3PB 1ESBA 3VB7A 1EUFA 1ELTA 1Q3XA 1O2XA 1VR1H 1C5YB 2BD4A 1GI1A 4M7GA 4BNRA 1AE8H 2BQ6B 5CE1A 2AIQA 1T8OA 2CF9H 1HJAC 2C3SA 1AFEH 1HAIH 2F9BH 3IWMA 4O9VA 3M36A 5GIBA 1HB0B 5AFYH 3ESTA 4ABGA 1EAIA 1H1BA 3FFGA 3RXDA 5EW1H 3A81A 1LQDB 3D62A 1IHTH 3PO1B 3LGWA 1GBBA 1AUTC 1DXPA 1P03A 2ZDMA 3LGIA 4Q7ZA 5GPIB 1SLWB 4ZHLU 2WPJS 2P8OB 1BBRE 1EB2A 1Y3YA 1O2UA 3E90B 1HAHH 2EI8A 2ULLA 3RXIA 2OCVB 1H9LB 1GBEA 1O3GA 1GJAB 2GGVB 1K1PA 1SFQB 3O8RA 1C5ZB 1WU1A 1HRTH 1XUKA 2QXHA 5EPYA 1AB9C 1MU6B 3BG4C 1DWEH 1S82A 1C2KA 5DGJA 4ZXYH 3QDZB 1LVMA 3Q3XA 4INLA 2LNCA 2BYAX 1T4VH 2O8LA 2LPRA 1H9IE 4NSYA 5GXPA 1P0SH 3M3TA 3TJNA 1IQMA 1MD7A 3K6YA 1YPKH 5ESBA 1P2QA 5FX6A 1G2LA 1DWBH 2J4IA 1TE0A 1SGYE 2W7SA 1G3CA 1HV7A 2BXUH 3PTBA 4WXVA 3MNSA 1JBUH 4TPIZ 4BAMB 1TWXB 2P16A 4MVNA 5HM2A 3SJ8A 5HGGA 1BT7A 3BEFB 1K2I1 5TJXA 1SGDE 2J92A 2Z3EA 3NCLA 4IMZA 4XBDA 4JZDH 4K2YA 1GGDB 2VH0A 2BDIA 1V2UT 2R9PA 5JBCS 5FPSA 3PMAB 1QURH 2PGBB 1DVAH 2UWLA 3U1JB 1J14A 1UVOA 1DLEA 3GY4A 3OYPA 5A2MH 3RC6A 4PROA 1HCGA 2BD5A 4TWWA 5EODA 1O2VA 3QN7A 5L6NH 1EPTA 1TRMA 2P3UB 4K3JA 2A0QB 2A31A 3ATIA 3RXQA 5HMAA 1DS2E 1SGRE 2BY7X 4Y71A 2XCFA 2ODYB 1LVYA 1NRPH 1BTXA 1O2ZA 4CR5A 5J4SA 1LPZB 1TYNA 2XRCA 3EGKH 3RXAA 2JETB 1ELFA 1YP9A 1K1JA 3Q3YA 1TA6A 1EZXC 2BHGA 3NKKA 1BCUH 3TK6A 3PWBA 8GCHG 4J2YB 2HPPH 1C5NH 1K28D 1O2WA 3LC5A 1O3LA 1UTLM 2OC1A 1BJUA 4YO9A 2C8WB 3DD2H 4AFQA 4B2CA 1VCPA 1F7ZA 1Z8RA 3LU9B 4ZAEA 2ALPA 1SQTA 3QTVH 3S7KB 5EU8A 3SJOA 3ZZCA 4Z6AH 3A7ZA 1THSH 4NFEA 3SOSA 2BX3A 1S5SA 1G2MA 3UUZA 1GMCF 2FOMB 4WMDA 1INCA 1V2OT 2A5AA 2GV6A 3AAVA 3E0NB 5AF9H 2QF3A 1RTFB 1C9PA 3MH7A 1PQ7A 5FBIA 3TVJB 1A46H 1BDAA 1SL3A 3LGTA 3SU4A 1SB1H 1ZPZA 2J2UA 3KQCA 3M7QA 4IN2A 4CH8B 2G51A 3TNTA 1C5TA 1BUIA 1BHXB 1DXWA 3ODDA 2BZAA 5SGAE 1QHRB 5E0GA 3S9AA 2Y5GA 2AMQA 1V2QT 2Z3DA 1AKSB 1JMOH 3TH3H 3ZZBA 3U98H 1TNHA 2XWAA 1GJ4H 1WUNH 1WQSA 1W8BH 1L4DA 3GYMA 3MTYA 1L2EA 1TONA 1FZZA 5TCAA 1XXDA 3IG6B 4KTCA 1EQ9A 3ZVGA 5EPNA 1GBTA 3U8OH 1WAYB 4I7YH 3MU8A 3QX5H 3E0PB 1PQ8A 1GHXH 1UCYH 2BM2A 2WYGA 3A89A 4Y8YA 3SU1A 4UFEH 1SGNE 1ETTH 1FNIA 5C5NA 1ZR0A 1GMHG 2WUBA 2OD3B 1MH0A 2CHAC 1EZSC 1AQ7A 4DT7B 1YLDA 2C4FH 1DM4B 2KAIA 4FUEA 1GVKB 1IQLA 2C93B 4IS5A 4AX9H 3MU0A 1AVWA 2G8TA 3SI4H 4D76A 2YOLA 3W94A 4OGXA 3VEQB 4LK4A 3T27A 1CU1A 1DY8A 1RIWB 2ZDNA 3QO6A 4A7IB 1V2LT 4A5TS 9LPRA 1C5LH 1EAWA 4NSVA 1DWDH 1TLDA 2ZDKA 4KELA 1JIMA 2GCTC 5F6MA 1ZOMA 2ANWA 1K22H 2Z9LA 1CGIE 4NA7A 3SQEE 3E3TA 4NIXA 2QY0B 1CBWC 3TNSA 1WQVH 1TOCB 1SOTA 3TU7H 2WV5A 2H9EH 2JH6D 2FX4A 4GVUA 1Z1JA 3RMMH 1KLTA 1O2QA 1Z8IB 3ZZ3A 2AGGX 2OBOA 2AGIX 4XE4A 1NRSH 3KN2A 2FODA 1QJ6B 3GCTG 2FOAA 2J38A 4ZH8A 2TGAA 3UY9A 1Y3WA 2BY8X 2W26A 4ABFA 5HYOA 1GJDB 1TGTA 1SG8B 4CRAA 3SU6A 4E7NA 3FP7E 1W0YH 4B74A 4ISHH 1SQAA 1ZHMA 4F49A 4AN7A 2VINA 1B0EA 1V2MT 1QNJA 3UNRA 2G55A 2O8MA 3MO3A 4I8KA 2BDCA 3MH6A 2HNTE 5E2PA 3R0FA 3RC5A 3SO3A 1RS0A 4OS1A 2H1UA 1Y3UA 1S85A 4JMYA 4BAQB 1O2RA 1V2RT 1EPTB 4B73A 1NPMA 1Z1IA 1B5GH 4FUHA 2VVVA 2Y5FA 5JBAS 3LPRA 1ZJDA 1UHBA 1A3EH 1RTKA 3U69H 1TIOA 3VFEA 1H9HE 3FZZA 1BRUP 3ZV9A 6CHAB 3RMOH 1O35A 2H9HA 4NA8A 2QV1A 4X6NA 4Y0ZE 3TH2H 3P8FA 2NU2E 2FXRA 3UR9A 4YESB 4ABIA 2BQ7B 1OS8A 3HKIB 4X1SU 2FLRH 4CRBA 3SW2B 1HPGA 1C1RA 3W95A 1BB0B 4XOJA 1EOLA 5IYTA 2GD4B 1JRTA 1DDJA 2PHBA 3SU0A 1RD3B 2ZFFH 1KXAA 3GISB 2BD2A 3BTDE 1PPBH 4GCHF 8KME2 4ABEA 1W14U 2Q6GA 1CT2E 2K1QA 5FHTA 4CH2B 3TPIZ 4BAHB 3UQVA 3KQBA 1BTUA 2RA3A 1D3QB 2TRMA 1O37A 2NU0E 5GDSH 3QTOH 3MO6A 1O2KA 1O38A 1Y3XA 2ODPA 2H6MA 3ZZ5A 1GI2A 2AFQB 3SU3A 3P92A 2WPIS 1QCPA 4TPYA 1TQ7B 3FZDA 1QB1A 1D3TB 1O3CA 2NWNA 1TPSA 1HGTH 1B0FA 4XBBA 4YZUA 1ZTKA 4FUIA 1JWTA 1S6FA 1T7CA 1SSXA 2XBVA 3LGVA 4RKOB 4K5ZA 2OBQA 3RM2H 4ISIH 2B0FA 1Y59T 1HFDA 4B2AA 4UONA 1FXYA 1GHZA 2CN0H 3D49H 1YF4A 1ZMLA 4YM9A 5FPTA 1QR3E 1W2KH 3RXKA 1EZQA 1W11U 2P95A 5T6GA 1V2KT 1P2IA 2DUCA 3MMGA 2HALA 1CGHA 5DP7A 2ZNKH 3VGCC 1HYLA 3NUMA 4WMEA 2NU1E 1EAUA 1SHYA 2BY6X 4NWKA 2GVFA 4ABJA 1DX5M 3E6PH 2KAIB 4Y11E 1XUHA 2G4UA 1WCZA 1LKBA 3Q00A 1MTNB 1QL8A 4U30A 5DKMA 2FOHA 5DP9A 4FUFA 1DE7H 4AYVB 3ZVBA 4LXBH 1C1OA 3E1XB 2VIWA 2ILNA 4MPWA 5EXMA 3DA9B 3A84A 3BV9B 1C5UA 3FP6E 4FUDA 3QZQA 4AB8A 4X0WU 4Y8XA 2CXVA 3RMLH 2BDBA 3SNBA 3STIA 3I29A 8ESTE 1DUEA 2V35A 3A8DA 4UD9H 2IPHA 2P93A 1MKWH 2FI4E 4WXIA 1WYKA 1YPLH 3LGYA 1C2LA 1EP6A 1C1UH 1TA2A 4FUGA 1AY6H 1LPGB 4B71A 4RSPA 3EAJA 4X8UH 4RKJB 4U32A 1NFUA 1WTHD 4AOQA 1J8AA 1SGTA 3TJUA 1HNEE 1BTYA 3SZNA 1MQ6A 1S6HA 2FM2A 4H6SB 3AW1A 2FLBH 3ATLA 1UTJA 2ZDAH 1HDTH 1C2HA 1TNIA 2A7JA 1G36A 3TJOA 1UJ1A 3MNBA 1KYNA 4X1NU 1MKXH 2W3IA 1EOJA 2M5TA 3GDVA 3UNSA 2FS9A 2ANMH 2OINA 3K2UA 1HAOH 1ETSH 2TIOA 1D6RA 5DK1A 1XKBC 1NRRH 5ETXA 3VB3A 3D23A 3L6PA 1P01A 3H7TA 4NA9H 1EASA 2QAAA 1EKBB 1TGSZ 2F3CE 2GCHG 1TNGA 4NIVA 1UK3A 1ZLRA 2Y81A 1NN6A 4ABHA 2HWLB 2VGCC 1J15A 4FU7A 4FXGH 4B75A 1HAXB 3ZZ9A 3SUGA 1OPHB 4AYYB 1F0TA 1V2ST 4YOIA 3MYWA 2ZIQH 1HAPH 4Q80A 4E05H 2Y7ZA 1ELCA 3DUXH 3WY8A 1DUAA 1SBWA 2FOEA 4BXSA 2VIDA 4INHA 2XC0A 2A2XH 2FI3E 2HGTH 1NESE 3M7UA 1L1JA 1DOJA 1O31A 1GI8B 3H5CB 4KGAA 4MPVA 3ATWA 4INKA 1SQOA 1GWAA 5A8XA 2PSXA 1OP2A 1PQAA 3RXMA 3HPTB 5JPMH 1QRWA 3RU4D 1A5HA 3LKWA 1ABJH 2QA9E 4ISOA 3UPEA 2WPLS 2ZGJA 7GCHG 1CT0E 1GHVH 4NZQA 3A8BA 2IOTA 2I6SA 2VJ1A 2FOGA 1PPCE 1QGFA 1AFQB 1IOEA 3GYLB 1DFPA 5L2ZH 1FAKH 1O34A 3Q3KA 5DG6A 6LPRA 1C4V2 2RG3A 1V2WT 3ZVAA 4TY6A 1PPHE 1D4PB 1YPGH 2W5EA 1BRCE 1NZQH 1MZAA 1UVPA 3UOPA 1YC0A 1FAXA 1ZJKA 2ZFQH 1BBRK 1NFXA 1O5FH 1BTPA 4DVAU 1FN8A 2UWOA 1QBOA 1P9SA 1IQNA 1LHGH 1EJMA 4X2VA 4OS5A 3PLPA 2A4GA 5ABWA 2BLQA 3RXSA 3BSQA 4NCYA 2DE9A 4HGCA 1IQIA 1LPKB 5LGOA 4ISLA 1MAXA 3SBKA 1GBFA 1YKTA 1SPJA 2PUQH 2I6QA 1YCPK 3AVZA 1W10U 4WJG2 1UVUH 1F0RA 4GAWA 4LZ1H 2QF0A 2QXGA 2CJIA 2FMJA 2RA0A 4JCNA 1IQGA 1A4WH 4AB9A 2VWOA 1AFQC 3KL6A 3RXLA 3A7VA 3E8LA 1ZRBA 2SNVA 5DP6A 1C9TA 4D9RA 4K1SA 2FO9A 1RXPA 3SN8A 5C1YA 4DJZB 1P3EA 3S69A 1SI5H 3DFJA 3V13A 2EA3A 2HVXA 3PTNA 2TGTA 1TMBH 1TMTH 3PO1C 1ZTLA 1KXFA 1OWJA 2EI7A 2O8WA 3GDUA 1O2TA 2XC4A 5K0HA 4IBLH 1F5KU 2ZZUH 2P8OC 5BRRE 3DHKH 4A1XA 4FVBA 2FTLE 3SHCH 4K60A 2Y6TA 8GCHF 4A92A 1K21H 3MO9A 2HPQH 2ZGHA 3SJKA 3TGKE 1HIAB 1O3MA 2ZPQA 2G00A 3RXCA 2PKSB 3RC4A 1C1WH 2SGFE 1TPAE 1Y8TA 2ZHWH 1KDQB 1A0HB 3O8BA 1SGCA 2VIOA 2ZC9H 4LOYH 1DY9A 1TPOA 1AVXA 4DW2U 5AVDA 1SLXB 3GCOA 4A1VA 1TBRH 2PKAB 4ZUHA 3BTME 1ANDA 2O9QA 3CENA 1HXEH 3RLWH 1LTOA 1RRKA 2AGEX 3SV6A 3EQ0H 2WV4A 1C1SA 1LMWB 3B9FH 2OQ5A 1LVBA 1V2JT 3GCHB 3TGJE 2ZU2A 4XFQA 1FIWA 1NO9H 2FEQH 2FDAA 2OUAA 2VB0A 3A87A 2VWMA 2ZGBH 3CS0A 3RM0H 1NS3A 1ZYOA 1YCPM 2UUKB 4Y76A 1GGDC 1O0DH 1UCYE 2J95A 3BF6H 5EQSA 1GHAG 1OWDA 1IHSH 3SNDA 1CSOE 1ZZZA 3F9EA 2FOCA 2FYQA 1GCDA 4D8NA 7LPRA 2GMTB 4NIYA 1KLIH 3LJOA 3A7YA 4MDSA 2HRVA 1GHBG 1C5OH 5DP4A 2SGAA 1LCYA 4HFPB 4BTTB 2R3UA 2TPIZ 1O5CB 1SR5C 1GMHF 2A4QA 1THRH 2JETC 1AUJA 1GBAA 1THPB 4WMFA 1KXBA 5DJ7A 5GCHG 1T8MA 1QTFA 4ZHAA 5C20A 3B23B 1BTWA 4I8JA 3A8CA 1A2CH 2PSYA 1NROH 1D9IA 1BIOA 1UTKA 5B6OA 4CHAB 1DITH 2A4RA 1CA0B 3NZIA 1OKXA 1L1GA 2J94A 5GJ4B 3BTTE 4U01A 3PB1E 3SQHE 3TIUA 2ZF0H 1F92A 3UOUA 1L1NA 2RCEA 3ZYDA 2OXSA 3U1IB 1GMDG 1BHXF 3V7TA 3LOXA 1GI4A 2CMYA 2ZHQH 3HGNA 2A5IA 1C5WB 3EYDA 1PQ5A 1ZPCA 4I32A 1T4UH 2PW8H 3V3MA 1KY9A 1OYTH 1C5SA 3C27B 1ZMNA 2XCNA 4IMQA 3UREA 1BMNH 1NM6A 5CMXH 1O2MA 3MOCA 2B5TB 4KKDA 3RXGA 4CRFA 1O3IA 2G81E 4TYDA 2F9PA 5FX5A 4CREA 3H7OA 5I25A 1UVSH 3KF2A 3GCTF 3GY5A 2VVCA 2BDGA 3TITA 2C8YB 5FXLA 2F9UA 3RXUA 2XW9A 4X1QU 5EW2H 1QRZA 3SNAA 1GI0A 2SGDE 3ZVEA 2UWPA 1KXDA 3CP7A 2JH0D 1GJCB 3TK9A 1F0SA 3ZZDA 1HAVA 3URDA 1S84A 1SGQE 1V2NT 1TPPA 1VCQA 2SGEE 2Y5HA 1TX6A 1K1MA 2GDEH 1P2NA 2HLCA 3HKJB 4CRGA 2BD9A 1MBMA 3M5LA 1O36A 4HTCH 1Z7KA 1JOUB 1C1MA 4LZ4B 1ESAA 1A3BH 2GT8A 3AAUA 1XUJA 1N6YA 1NT1A 4JK5A 2O8UA 4E06H 5T6DA 3M37A 1MTWA 3QLPH 1DLKB 1FN6A 1O2YA 3SGBE 1GL0E 2OQUA 1GPZA 1RIWC 2R2WU 1NTPA 4MG3A 4U2WA 4IN1A 4CBOA 3NXPA 1EATA 2F83A 3RUOA 4BXWA 1ZGIA 4DURA 2BOHB 2C90B 5FCKA 1D6WA 3VB4A 1CHOG 4AORA 4O03A 4GHQA 1O2JA 4R8TB 1Z6EA 4I8GA 3QK1A 2BDHA 3SHAH 3SV8A 1SMFE 4JZ1A 4UFGH 4ABDA 2GZ7A 3T25A 3VPKA 1GI7B 3SGQE 3BIVH 1OWKA 3AW0A 1FIZA 1Z8JB 4CBNA 2ANKH 4MQAA 4O97A 5L2YH 3S7HB 3RXBA 2A1DB 1GJ7B 2XC5A 1GCTB 1WOFA 2Z7FE 1YPHC 3MU5A 1QQUA 4BOHA 1HJ9A 4ZMAH 1QY6A 1W13U 2A4OA 1HAZB 2WPHS 1K1OA 1QB6A 4NWLA 1GG6B 1O3PB 1P9UA 5JB9S 5CHAB 2ZKSA 5C1XA 3SJ9A 2PTCE 1EPTC 3EDXB 2BMGB 3MWIU 3UWIA 1O2PA 1XVMA 2STBE 1J9CH 2H5DA 3U9AH 4IW4E 2PR3A 1CE5A 4GLYA 3ENSB 1N8OB 2G5VA 2A32A 1CA8B 1NY22 2WPKS 3M3VA 1MUEB 1Q2WA 4YLUA 5FCRA 2W7UA 2ZPSA 5DP5A 2PV9B 2UUJB 4Q2KA 6CHAC 1XMNB 1P8VC 1HJ8A 2P94A 2ZDVH 1FPHH 1GCTC 1O3FA 3M5NA 4TY7A 3TK5A 1S0RA 1ZHRA 2FOFA 3A83A 3BTQE 2FYRA 2ZHEH 1RJXB 3SUDA 1YM0A 2Z3CA 1GJ5H 1ZTJA 5G4BA 2Q6FA 1TGNA 2A45B 1AN1E 1QIXB 4TWYA 4D7GA 1IQFA 3L3TA 2VU8E 1FI8A 1G3DA 1WV7H 4Y10E 2BD3A 1KTTB 1GDQA 1KTSB 3SI3H 2ZA5A 2H5CA 2ZHDA 2Q1JA 1AZZA 2O8TA 4UFFH 2ZWLH 3URCA 4VGCB 1AWFH 1PFXC 5F8ZA 4YLQH 2ODQA 7KMEH 4OS6A 1O2NA 1YBWA 4X6MA 4ZHMU 3MNXA 2ESTE 3SUEA 1T32A 1XVOA 4UDWH 1ZMJA 3OTJE 5K7RA 1O2GH 2A2QH 5F8XA 1XX9A 4DGJA 1G3EA 3SNEA 3EA7A 2F9OA 1O2OA 1PYTD 3GY6A 1S0QA 4DOQA 2TGDA 1O32A 2QYIA 2ZEBA 1C1TA 2F91A 1TOMH 2ZP0H 1O3DA 1HAVB 1V2VT 2OLGA 2UUFB 3F9GA 4Y79A 1OP0A 4AFUA 2XBYA 2D8WA 3A82A 1GDUA 1LHCH 3ZV8A 6GCHG 1C2DA 1UK4A 2BB4A 2V0BA 2CV3A 2GCHF 1C5MD 1VITG 5C1UA 2V3HH 2ZDLA 2ZCKP 2GX4A 3ITIA 1O3OA 5E0HA 4XDEA 4AGJA 1TGCA 4FU9A 2XXLA 4Z0KA 2BLOA 3RU4E 3BIUH 3A85A 3STJA 4BAKB 2V3OH 3M35A 4MNVA 2BX4A 1BOQA 1MTNC 5EXLA 4I33A 4BANB 3F9FA 4AFSA 3GY7A 1W7GH 2NU3E 3HK6B 4GHTA 4YTAA 4FU8A 1C5PA 3QGJA 5C67A 2P59A 3S0NA 5EXNA 1QQ4A 2XTTB 3MFJA 1YGCH 4HZHA 1ANEA 2OC0A 2UUYA 1ANCA 3EA8A 3GY3A 3NK8A 8LPRA 2QXJA 1P04A 3RXTA 1BTZA 4ISNA 4MNXA 1TQ0B 4DIIH 1IAUA 3K9XB 2VVUA 5GWZA 3E91A 1TALA 1GI3A 1XM1A 2DE8A 3T29A 1MCVA 3K65B 2ZGXH 2A7CA 5JDUB 3ELAH 3SGAE 1UHBB 1G32B 1UTPA 3SV2H 7GCHF 1P02A 3LC3A 1MTVA 5A09A 1L4ZA 2ZU3A 1UVTH 2FP7B 9ESTA 3A7TA 2ZU4A 1ZRKA 4OS7A 3ZZ7A 4AG1A 2IN2A 3NPSA 1PJPA 1FONA 2BLVA 2SGPE 3LT3A 2Y7XA 1BMLA 1GI5A 1BJVA 1O5GH 3EE0B 2JKHA 3MNCA 3U8RH 1HJAB 2GV7A 1ABIH 4YT7H 1C5XB 2AIPA 1TFXA 5PTPA 4CRDA 4NGAH 2AMPA 1AVGH 3ZVDA 1KSNA 6ESTA 1O5DH 1GBMA 2OC7A 2WPMS 3ATKA 2BY5X 1NC6A 1SLUB 2ZCHP 1A0LA 2BDAA 3ZZ8A 1X7AC 3KCGH 4I31A 4Y6DA 1AKSA 1NU7B 1ELDE 1PYTC 1FLEE 1AB9B 5ESTE 4K69A 3BG4B 3RXPA 2AEIH 3A7WA 5TCCA 1PPFE 1XUFA 1A0JA 1TX7A 2F9VA 2R0LA 2VIQA 2Z9GA 3M5MA 3P70B 1TRNA 2BD7A 3KNXA 4ZKRU 3LIWA 1C5VA 2D26C 3KIDU 1PPZA 4QT8C 1C2EA 1T31A 4XBCA 4ASHA 1YYY1 5EQRA 2ZFPH 2ZO3H 1O3KA 1CHGA 3G01A 1C2GA 1OX1A 4FUJA 3QUMP 1A5IA 1UTMA 5DPAA 3A88A 1QB9A 4Y8ZA 4K8YA 3MI4A 1G3BA 2THFB 1ZGVA 2GP9B 1VJAU 3MH5A 1ZSLA 3SV7A 4X8VH 4JZFH 1MU8B 3Q77A 3T2NA 2QCYA 1C2IA 3V0XA 1T8LA 1NFWA 1O2LA 5EQQA 4B1TA 1AE5A 1AGJA 4MNWA 2EEKA 1GBJA 1H4WA 1BZXE 1O2SA 1N1LA 3BN9A 4O3UA 4DG4A 1QBVH 3GY8A 1J17T 1O2IA 2WINI 4WVPE 3PMHB 1G9IE 1AO5A 3OX7U 4KP0A 3BTGE 1G30B 1OXGA 2C8ZB 1D3DB 1QFKH 5A0CA 1GDNA 1SGPE 1W12U 1HLTH 3O8DA 1E35B 2WYJA 4NG9H 1KXCA 1C5QA 2Y80A 7ESTE 5A8YA 1O3BA 1JXPA 1BRAA 1KIGH 4RN6A 1FY5A 4B2BA 2GKVE 1GJBB 3MU1A 5EGMA 1A61H 1N6XA 2ZFRH 3P6ZB 4UEHH 3BEIB 1Z71A 2J34A 3KHVA 2BD8A 1DPOA 2PWXA 5C5OA 1MD8A 1EJNA 1WBGB 1ZSKA 4IC5A 2ZCLP 4O3TA 1XKAC 1Y3VA 2PFEA 3VB6A 3S9CA 1UTNA 4YOJA 3JZ1B 5BPEA 1C2MA 3VXEH 1GHAF 1SFIA 3DT0H 1BBRH 1PPEE 3F68H 1MZDA 4YOGA 1YPHE 1LHDH 3HK3B 4JK6A 3RXEA 1J16A 1CT4E 1EJAA 2YNBA 2H9TH 3T28A 3RLYH 1GHBF 1P09A 4X1PU 1V6DA 1OWHA 2BVSH 1E34B 1ORFA 4X8TH 3RU4T 1HXFH 1QRXA 1L0ZA 3FP8E 1YCPH 1AIXH 1GVZA 4JYVH 5GCHF 4X8SH 1CVWH 1QBNA 3MU4A 2RDLA 4HI3A 4Q7YA 1UCYK 1NRQH 2JH5D 3A80A 2VWLA 2ZQ2A 1NRNH 1RFNA 3GY2A 1AI8H 4H6TA 1QA7A 2PKSC 1OWIA 3RXOA 2Z6BD 2FTMA 2ALVA 1O3HA 1IQJA 4DCDA 3MHWU 3TGIE 1GMDF 3KEEA 1G37A 1O3NA 2ZFSA 3MH4A 4DY7B 1TNLA 1ELAA 1AU8A 2FESH 4BAOB 2VIPA 3E16B 3P8GA 3RP2A 1BMMH 2PGQB 1GBIA 3LDXH 1TNJA 1C2JA 4WF8A 3ZVFA 4NIWA 3KQDA 1TAWA 2TBSA 1GHWH 2H2ZA 3A86A 1LVOA 1O30A 4AG2A 5HXFA 1MTUA 2G52A 2FIRH 4JYUH 2CHAB 3GCHC 2FPZA 2Z9IA 3I78A 5DP8A 1DSTA 3OY6U 4AFZA 2FZZA 5C2ZA 4SGBE 5E0JA 1MBQA 2EI6A 1UK2A 1ANBA 2BXTH 1W7XH 1O39A 2Y82A 1LHEH 3EA9A 3M61U 4K1EA 2SFAA 2ZHFH 1UTOA 2BY9X 2Z9KA 3SUFA 3UR6A 3SV9A 5DO4H 5FAHA 4WH6A 1ETRH 4ZKNU 1WTGH 2GMTC 1GBDA 2GCTB 3AASA 2ASUB 1ELVA 1KXEA 1P10A 1EB1H 1QL9A 1K9OE 2XYAA 5A8ZA 3ZZ6A 1GMCG 3BTFE 3L33A 1BITA 1CBWB 4Q7XA 2ZQ1A 3UFAA 3C1KA 2QGRA 1DANH 4GPGA 3SJIA 2P3TB 2QXIA 5J4QA 4X6PA 1LDTT 3RDZA 1E37B 4JZIA 2D2DA 2SGQE 1SGIB 2AH4X 2FWWA 4F4OC 2BOKA 5T3HA 2W3KA 1TMUH 3N7OA 4CHAC 1CA0C 1F0UA 1SGFA 4IC6A 1RTLA 1XXFA 1B7XB 1VCWA 2G5NA 3A7XA 1TBZH 1QJ7B 1IQHA 1SC8U 3S9BA 1C4Y2 3U8TH 3UQOA 3CS7A 2STAE 1M9UA 4WH8A 3M5OA 1OWEA 5LPFA 4AGKA 2CGAA 4J1YA 2XNIA 1BTHH 1AWHB 1XUGA 4UFDH 5AFZH 1ZPBA 1CHOF 3T5FH 2XBXA 2AYWA 2BTCE 1FPCH 3P17H 1GI6A 1P11E 4E7RG 4KTSA 4MTBA 3GOVB 5JBTA 1O33A 2GZ9A 3TH4H 1C1NA 4ESTE 1WSSH 1ELGA 3FAOA 4KTUA 1ZSJA 4XSKU 1F5LA 1O5AB 1E0FD 3QGNB 1VITH 1RGQA 1C1QA 1MMJN 1P12E 1MAYA 4FVDA 1CGJE 2BQWB 1P2MA 1Y5UT 3IITA 3RXRA 5AHGH 1H8DH 4K8BA 3VXFH 1BMAA 2Q6DA 1ELEE 1GJ9B 2XBWA 3KGPA 5LPEA 2P3FH 1YLCA 3UNQA 1GBHA 2OTVA 4GSOA 3ZYEA 5JBBS 1U6QA 1LO6A 3B8JA 3PLBA 4ABBA 3NWUA 3K6ZA 2FX6A 1A7SA 3UIRA 4UE7H 3UWJH 2AMDA 1P57B 2BVRH 3I77A 1P2KA 3PMBB 1JRSA 1HBTH 1DSUA 1GBLA 1EX3A 1O3EA 2ZPRA 3PLKA 4YT6H 2VNTA 5LPRA 1MQ5A 3TJVA 1GL1A 3P8NA 1YPJH 2VWNA 5FBEA 1FMGA 1O3JA 2R0KA 3FVFB 3M7TA 1PPGE 1K1NA 1T8NA 2OP9A 1C2FA 1CQQA 3PWCA 1DT2A 3F6UH 4MPXA 3RXJA 4Y0YE 1TBQH 1S81A 4K1TA 5A0AE 1SHHB 2EC9H 2GZ8A 3UTUH 1P06A 1QA0A 1YPEH 3PM3A 2B8OH 1P05A 3RMNH 2GTBA 1QJ1B 5A0BA 1HUTH 4D9QA 1QL7A 1Z8GA 2FOBA 2B9LA 2HOBA 3SNCA 4MNYA 1FUJA 2R2MB 3A8AA 4CRCA 4FUCA 3FANA 1C1PA 4MPUA 4GUXA 3QWCH 3GCNA 1TRYA 1MKWK 3VGCB 2ZI2H 4I8LA 1V3XA 2QC2A 1ELBA 3F1SB 3ZZ4A 1ESTA 1ARCA 1E38B 1K1IA 1AZ8A 3DFLA 3T62A 1S83A 4MLFB 1IQEA 1W0ZU 2J9NA 4WWYA 1GG6C 4OS4A 3RXHA 1FV9A 2TGPZ 1DWCH 1OP8A 5CHAC 4X2XA 1UO6A 1VZQH 2FS8A 1GJ6A 2NU4E 1A5GH 5JYIA 2V6NA 2PLXA 3RXFA 2OC8A 3ZZAA 4H42U 1LQEA 1MKXK 4GCHG 1LKAA 6GCHF 2F9NA 3KQEA 5JB8S 1VITF 1E36B 1MTSA 1Y5BT 1N8OC 3GDSA 4A6LA 1VGCB 4CR9A 2Z94A 1UMAH 4I8HA 2ZFTA 2ZTYA 4ZXXH 2R3YA 3QZRA 3O8CA
chains in the Genus database with same CATH superfamily
4FUBA 4DIHH 1GHYH 5DP3A 2ZECA 5H4IB 3SU2A 1FDPA 1O5EH 4ZROA 3PMJA 3V12A 2BLWA 1LHFH 4ABAA 1SQRA 4ZKOU 1KLJH 2ZU1A 2WUCA 1NFYA 3ATMA 2C8XB 1HAGE 1HAYB 1BQYA 1A1RA 1BRBE 3JZ2B 2IJOB 2BDYA 4D7FA 1ARBA 2YMSC 1K1LA 3PYHA 2AS9A 4ZKSU 2VH6A 1Q31A 1CO7E 1TB6H 1FJSA 1EXFA 3BTHE 1BA8B 2ZG0H 3BTKE 1O2HA 3OSYA 4R0IA 1H8IH 5L30H 1C1VH 3D65E 5I46H 2AERH 3ZVCA 4ASUD 5HM9A 1GI9B 4NFFA 2ANYA 4JYTA 1GVLA 4Y7AA 1C4U2 1C5RA 2VGCB 1V2PT 4VGCC 1NU9A 1DICA 1FY4A 3PV2A 1VGCC 2B7DH 3Q76A 3SORA 5C3NA 1FY3A 1EAXA 3LGUA 3F9HA 1OSSA 3PROA 1GBCA 1HIAA 4SGAE 3VB5A 4RT0A 2XWBI 1W3CA 2G4TA 1Y5AT 2BZ6H 1V2TT 4B76A 5FPYA 3FOAA 1O5BB 3SU5A 5EOKA 3TLOA 1AHTH 1KDQA 1P3CA 1GJ8B 1SVPA 3LH3A 1FY1A 3FO8D 1AD8H 4H4FA 3T26A 3P95A 1MCTA 5E8EH 2KZ4A 2HNTF 2PKAA 2GDDA 2ZTZA 1TGBA 3ODFA 3HATH 1Z6JH 4A1TA 3LJJA 2K8IA 2D1JA 4X6OA 1SGFG 3BTEE 1EP5A 3LH1A 3R3GB 2QN5T 4IGDA 1IQKA 2PUXB 1SGEE 1TNKA 4X2YA 3P8OA 5F8TA 1GBKA 4OGYA 4X2WA 2BVXH 2SNWA 2ZU5A 2KCPA 2PTNA 1SLVB 2ZGCA 4JZEH 5CDFE 1SOZA 3GICB 2VIVA 1JIRA 5EG4A 1NBME 1TX8A 2HNTC 4X1RU 2WPDD 3BEUA 1O3AA 1OOKB 2CF8H 3PV4A 3BTWE 3M3SA 1ACBE 1S6LA 2A7HA 2FI5E 2KR7A 5IK2D 1UTQA 5T6FA 1P2OA 4XRNA 1YPMH 2A5KA 2GT7A 1OYQA 2Z9JA 4BTUB 4OS2A 5LH8A 2ZTXA 2JJ2D 3OU0A 3BG8A 3DCLA 1F2SE 2WZQA 1AMHA 1TABE 1EZUC 1VJ9U 2YNAA 4AZ2B 4Y7BA 1XUIA 5IDKA 4WY3A 2QIQA 5F03A 5E2OA 1FQ3A 4THNH 1ID5H 3LONA 4NZLA 3RXVA 1FY8E 1P2JA 3OY5U 3HGPA 4BTIB 1ZHPA 1F5RA 1D3PB 1ESBA 3VB7A 1EUFA 1ELTA 1Q3XA 1O2XA 1VR1H 1C5YB 2BD4A 1GI1A 4M7GA 4BNRA 1AE8H 2BQ6B 5CE1A 2AIQA 1T8OA 2CF9H 1HJAC 2C3SA 1AFEH 1HAIH 2F9BH 3IWMA 4O9VA 3M36A 5GIBA 1HB0B 1UW7A 5AFYH 3ESTA 4ABGA 1EAIA 1H1BA 3FFGA 3RXDA 5EW1H 3A81A 1LQDB 3D62A 1IHTH 3PO1B 3LGWA 1GBBA 1AUTC 1DXPA 1P03A 2ZDMA 1NBMD 3LGIA 4Q7ZA 5GPIB 1SLWB 4ZHLU 2WPJS 2P8OB 1BBRE 1EB2A 1Y3YA 1O2UA 3E90B 1HAHH 2EI8A 2ULLA 3RXIA 1H9LB 2OCVB 1GBEA 1O3GA 1GJAB 3AK5A 2GGVB 1K1PA 2KX4A 1SFQB 3O8RA 1C5ZB 1WU1A 1HRTH 1XUKA 2QXHA 5EPYA 1AB9C 1MU6B 3BG4C 1DWEH 1S82A 1C2KA 5DGJA 4ZXYH 1COWD 3QDZB 1LVMA 3Q3XA 4INLA 3U28C 2LNCA 2BYAX 1T4VH 2O8LA 2LPRA 2IPQX 1H9IE 4NSYA 5GXPA 1P0SH 3M3TA 3TJNA 1IQMA 1MD7A 3K6YA 1YPKH 5ESBA 1P2QA 5FX6A 1WXRA 1G2LA 1DWBH 2J4IA 1TE0A 1SGYE 2W7SA 1G3CA 1HV7A 2BXUH 3PTBA 4WXVA 3MNSA 1JBUH 4TPIZ 4BAMB 1TWXB 2P16A 4MVNA 5HM2A 3SJ8A 5HGGA 1BT7A 3BEFB 1K2I1 5TJXA 1SGDE 2J92A 2Z3EA 3NCLA 4IMZA 4XBDA 4JZDH 4K2YA 1GGDB 2VH0A 1MABB 2BDIA 1V2UT 2R9PA 5JBCS 5FPSA 3PMAB 1QURH 2PGBB 1DVAH 2UWLA 3U1JB 1J14A 1UVOA 1DLEA 3GY4A 3OYPA 5A2MH 3RC6A 4PROA 1HCGA 2BD5A 4TWWA 5EODA 1O2VA 3QN7A 5L6NH 1EPTA 1TRMA 2P3UB 4K3JA 2A0QB 2A31A 3ATIA 1OHHD 3RXQA 5HMAA 1DS2E 1SGRE 2BY7X 4Y71A 2XCFA 2L74A 1LVYA 2ODYB 1NRPH 1BTXA 1O2ZA 4CR5A 5J4SA 1LPZB 1TYNA 2XRCA 3EGKH 4DT4A 3RXAA 2JETB 1ELFA 1YP9A 1K1JA 3Q3YA 1TA6A 1EZXC 3N99A 2BHGA 3NKKA 1EFRD 1BCUH 3TK6A 3PWBA 8GCHG 4J2YB 2HPPH 1C5NH 1K28D 1O2WA 3LC5A 1O3LA 1UTLM 2OC1A 1BJUA 4YO9A 4RI0A 2C8WB 3DD2H 4AFQA 4B2CA 1VCPA 1F7ZA 1Z8RA 3LU9B 4ZAEA 2ALPA 1SQTA 3QTVH 3S7KB 5EU8A 3SJOA 3ZZCA 4Z6AH 5HIZA 3A7ZA 1THSH 4NFEA 3SOSA 2BX3A 1S5SA 1G2MA 3UUZA 1WDIA 1GMCF 2FOMB 4WMDA 1INCA 1V2OT 2A5AA 2GV6A 3AAVA 3E0NB 5AF9H 5DSFA 2QF3A 1RTFB 1C9PA 3MH7A 1PQ7A 5FBIA 3TVJB 1A46H 5C17A 1BDAA 1SL3A 3LGTA 3SU4A 1SB1H 1ZPZA 2J2UA 2RDEA 3KQCA 3M7QA 4IN2A 4CH8B 2G51A 3TNTA 1C5TA 1BUIA 1BHXB 1DXWA 3ODDA 2BZAA 5SGAE 1QHRB 5E0GA 3S9AA 2Y5GA 2KCOA 2AMQA 1V2QT 2Z3DA 1AKSB 1JMOH 3TH3H 3ZZBA 3U98H 1TNHA 2XWAA 1GJ4H 1WUNH 1WQSA 1W8BH 1L4DA 3GYMA 3MTYA 1L2EA 1TONA 1FZZA 5TCAA 1XXDA 3IG6B 4KTCA 1EQ9A 3ZVGA 5EPNA 1GBTA 3U8OH 1WAYB 4I7YH 3MU8A 3QX5H 3E0PB 1PQ8A 1GHXH 1UCYH 2BM2A 2WYGA 3A89A 4Y8YA 3SU1A 4UFEH 1SGNE 1ETTH 1FNIA 5C5NA 1ZR0A 1GMHG 2WUBA 2OD3B 1MH0A 2CHAC 1EZSC 1AQ7A 4DT7B 3F3BA 1YLDA 2C4FH 1DM4B 2KAIA 4FUEA 1GVKB 1IQLA 2C93B 4IS5A 4AX9H 2HLDD 3MU0A 1AVWA 2G8TA 3SI4H 4D76A 2YOLA 3W94A 4OGXA 3VEQB 4LK4A 3T27A 1CU1A 1DY8A 1RIWB 2ZDNA 3QO6A 4A7IB 1V2LT 4A5TS 9LPRA 1C5LH 1EAWA 2W6ID 3F2HA 4NSVA 1DWDH 1TLDA 2ZDKA 4KELA 1JIMA 1FX0B 2GCTC 5F6MA 1ZOMA 2ANWA 1K22H 2Z9LA 3OE7D 1CGIE 4NA7A 3SQEE 3E3TA 2EQNA 2QY0B 4NIXA 1CBWC 3TNSA 1WQVH 1TOCB 3FKSD 1SOTA 3TU7H 2WV5A 2H9EH 2JH6D 2FX4A 3KYGA 4GVUA 1Z1JA 5CHBA 3RMMH 1KLTA 1O2QA 1Z8IB 3ZZ3A 2AGGX 2OBOA 2AGIX 4XE4A 1NRSH 3KN2A 2FODA 3W1EA 1QJ6B 3GCTG 2FOAA 3UB0A 2J38A 4ZH8A 2TGAA 3PRDA 2WV9A 3UY9A 1Y3WA 2BY8X 2W26A 4ABFA 5HYOA 1GJDB 1TGTA 1SG8B 3OEHD 3SU6A 4CRAA 4E7NA 3FP7E 1W0YH 4B74A 4ISHH 1E1RD 1SQAA 1ZHMA 3F2FA 4F49A 4AN7A 2VINA 1B0EA 1V2MT 1QNJA 3UNRA 2G55A 2O8MA 3MO3A 4I8KA 2BDCA 3MH6A 2HNTE 5E2PA 3R0FA 3RC5A 2JJ1D 3SO3A 1RS0A 4OS1A 2H1UA 1Y3UA 1S85A 4JMYA 4BAQB 1O2RA 1V2RT 1EPTB 4B73A 1NPMA 1Z1IA 1B5GH 4FUHA 2VVVA 2Y5FA 5JBAS 3LPRA 1ZJDA 1UHBA 1A3EH 1RTKA 3U69H 1TIOA 3VFEA 1H9HE 3FZZA 1BRUP 3ZV9A 6CHAB 3RMOH 1O35A 2H9HA 4NA8A 2QV1A 4X6NA 4Y0ZE 3TH2H 1YY3A 3P8FA 2NU2E 2FXRA 3UR9A 4YESB 4ABIA 2BQ7B 1OS8A 3HKIB 4X1SU 3N7EA 2FLRH 3OTPA 3SW2B 4CRBA 1HPGA 1C1RA 3W95A 1BB0B 4XOJA 1EOLA 5IYTA 2GD4B 1JRTA 1DDJA 2PHBA 3SU0A 1RD3B 3KYFA 2ZFFH 1KXAA 3GISB 2BD2A 3BTDE 1PPBH 4GCHF 8KME2 4ABEA 1W14U 2Q6GA 1CT2E 2K1QA 5FHTA 4CH2B 3TPIZ 4BAHB 3UQVA 3KQBA 1BTUA 2RA3A 1D3QB 2TRMA 1O37A 2NU0E 5GDSH 3QTOH 3MO6A 1O2KA 1O38A 1Y3XA 2ODPA 2H6MA 3ZZ5A 1GI2A 2AFQB 4I86A 3SU3A 3P92A 2WPIS 1QCPA 4TPYA 1TQ7B 3FZDA 1QB1A 4TT3D 1D3TB 1O3CA 2NWNA 3GS9A 1TPSA 1HGTH 1B0FA 4XBBA 4YZUA 1ZTKA 4FUIA 1JWTA 1S6FA 2HVYB 1T7CA 1SSXA 2XBVA 3LGVA 4RKOB 4K5ZA 2OBQA 3RM2H 4ISIH 2B0FA 1Y59T 1HFDA 4B2AA 4UONA 2KCAA 1FXYA 1GHZA 2CN0H 3D49H 1YF4A 1ZMLA 4YM9A 5FPTA 1QR3E 1W2KH 3RXKA 1EZQA 1W11U 3DSOA 2P95A 5T6GA 1V2KT 1P2IA 2DUCA 3MMGA 2HALA 1CGHA 5DP7A 2ZNKH 3VGCC 1HYLA 3NUMA 4WMEA 2NU1E 1EAUA 1SHYA 2BY6X 4NWKA 2GVFA 4ABJA 1DX5M 3E6PH 2KAIB 4Y11E 1XUHA 2G4UA 1WCZA 1LKBA 3Q00A 1MTNB 1QL8A 4U30A 5DKMA 2FOHA 5DP9A 3OFND 4FUFA 1DE7H 4AYVB 3ZVBA 1QZ8A 4LXBH 1C1OA 3E1XB 2VIWA 2ILNA 4MPWA 5EXMA 3DA9B 3A84A 2XOKD 3BV9B 1C5UA 3FN8A 3FP6E 3QZQA 4FUDA 4X0WU 4AB8A 4Y8XA 2CXVA 3RMLH 2BDBA 3SNBA 3STIA 3I29A 8ESTE 1DUEA 2V35A 3A8DA 4UD9H 2IPHA 2P93A 1MKWH 4ZCNA 2FI4E 4WXIA 1WYKA 1YPLH 3LGYA 1C2LA 1EP6A 1C1UH 1TA2A 4FUGA 1AY6H 1LPGB 4B71A 4RSPA 3EAJA 4X8UH 4RKJB 2EY4C 4U32A 1NFUA 1WTHD 4AOQA 1J8AA 1SGTA 3TJUA 1HNEE 2J5UA 1BTYA 3SZNA 1MQ6A 1S6HA 2FM2A 4H6SB 3AW1A 2FLBH 3ATLA 1UTJA 2ZDAH 1HDTH 1C2HA 1TNIA 2A7JA 1G36A 3TJOA 1UJ1A 3MNBA 1KYNA 4X1NU 1MKXH 2W3IA 1EOJA 2M5TA 3GDVA 3UNSA 2FS9A 2ANMH 2OINA 3DSGA 3K2UA 1HAOH 1ETSH 2TIOA 1D6RA 5DK1A 1XKBC 2L6OA 1NRRH 5ETXA 3VB3A 3D23A 3L6PA 1P01A 3H7TA 4NA9H 1EASA 2QAAA 1EKBB 1TGSZ 4YXWD 2F3CE 2GCHG 4F55A 1TNGA 4NIVA 1UK3A 1ZLRA 2Y81A 1NN6A 4ABHA 2HWLB 2VGCC 1J15A 4FU7A 4FXGH 4B75A 1HAXB 3ZZ9A 3SUGA 1OPHB 4AYYB 1F0TA 1V2ST 4YOIA 3MYWA 2ZIQH 1HAPH 4Q80A 4E05H 2Y7ZA 1ELCA 3DUXH 3WY8A 1DUAA 2AHME 1SBWA 2FOEA 4BXSA 2VIDA 4INHA 2XC0A 5DN6D 2A2XH 2FI3E 2HGTH 2J98A 1NESE 3M7UA 1L1JA 1DOJA 1O31A 3H09A 1GI8B 5C0TA 3H5CB 3OEED 4KGAA 4MPVA 3VG8A 3ATWA 4INKA 1SQOA 1GWAA 5A8XA 2PSXA 1OP2A 1PQAA 3RXMA 3HPTB 5JPMH 1QRWA 3RU4D 1A5HA 3LKWA 1ABJH 2QA9E 4ISOA 3UPEA 2WPLS 2ZGJA 7GCHG 1CT0E 1GHVH 4NZQA 3A8BA 2IOTA 2I6SA 2VJ1A 5C0UA 2FOGA 1PPCE 1QGFA 1AFQB 1IOEA 3GYLB 1DFPA 5L2ZH 1FAKH 1O34A 3Q3KA 5DG6A 4P02A 6LPRA 1C4V2 2RG3A 1V2WT 3ZVAA 4TY6A 1PPHE 1D4PB 1YPGH 2W5EA 1BRCE 1NZQH 1MZAA 1UVPA 3UOPA 1YC0A 1FAXA 1ZJKA 2ZFQH 1BBRK 1NFXA 1O5FH 3F0OA 1BTPA 4DVAU 1FN8A 2UWOA 1QBOA 1P9SA 1IQNA 1LHGH 1EJMA 4X2VA 4OS5A 3PLPA 2A4GA 5ABWA 2BLQA 3RXSA 3BSQA 4NCYA 2DE9A 4HGCA 1IQIA 1LPKB 5LGOA 4ISLA 2JDID 1MAXA 3SBKA 1GBFA 1YKTA 1SPJA 2PUQH 2I6QA 1YCPK 3AVZA 1K0HA 1W10U 4WJG2 1UVUH 1F0RA 3ZIAD 4GAWA 4Q4LA 2QF0A 4LZ1H 2QXGA 2CJIA 2FMJA 2RA0A 4JCNA 1IQGA 1A4WH 4AB9A 2VWOA 1AFQC 3KL6A 3RXLA 3A7VA 3E8LA 1ZRBA 2SNVA 5DP6A 1C9TA 4D9RA 4K1SA 2FO9A 1RXPA 3SN8A 5C1YA 4DJZB 1P3EA 3S69A 1SI5H 3DFJA 3V13A 2EA3A 2HVXA 3PTNA 2TGTA 1TMBH 1TMTH 3PO1C 1ZTLA 1KXFA 1OWJA 2EI7A 2O8WA 3GDUA 1O2TA 2XC4A 5K0HA 4IBLH 1F5KU 2ZZUH 2P8OC 5BRRE 3DHKH 4A1XA 4FVBA 2FTLE 3SHCH 4K60A 5EJLA 2Y6TA 8GCHF 4A92A 1W0KD 1K21H 2OK5A 3MO9A 4B6EA 2HPQH 2ZGHA 3SJKA 3TGKE 1HIAB 1O3MA 2ZPQA 2G00A 3RXCA 2PKSB 3RC4A 1C1WH 2SGFE 1TPAE 1Y8TA 2ZHWH 1KDQB 1A0HB 3O8BA 1SGCA 2VIOA 2ZC9H 4LOYH 1DY9A 1TPOA 1AVXA 4DW2U 5AVDA 4FETA 1SLXB 3GCOA 4A1VA 1TBRH 4ACAA 2PKAB 4ZUHA 3BTME 1ANDA 2O9QA 3CENA 1HXEH 5EIYA 3RLWH 1LTOA 1RRKA 2AGEX 3SV6A 3EQ0H 2WV4A 1C1SA 1LMWB 3B9FH 2OQ5A 1LVBA 1V2JT 3GCHB 3TGJE 2ZU2A 4XFQA 1FIWA 1NO9H 2FEQH 2FDAA 2OUAA 2VB0A 3A87A 2VWMA 2ZGBH 3CS0A 3RM0H 1NS3A 1ZYOA 3PRBA 1YCPM 2UUKB 4Y76A 1GGDC 1O0DH 4B6FA 1UCYE 2J95A 3BF6H 5EQSA 1GHAG 1OWDA 1IHSH 3SNDA 1CSOE 1ZZZA 3F9EA 2FOCA 2FYQA 1GCDA 4D8NA 7LPRA 2GMTB 3PV5A 4NIYA 1KLIH 3LJOA 2CK3D 3EE7A 3A7YA 4MDSA 2HRVA 1GHBG 1C5OH 5DP4A 2SGAA 1LCYA 4HFPB 4BTTB 2R3UA 2TPIZ 1O5CB 1SR5C 1GMHF 2A4QA 1THRH 2JETC 1AUJA 1GBAA 1THPB 4WMFA 1KXBA 5DJ7A 5GCHG 5KECA 1T8MA 1QTFA 4ZHAA 5C20A 3N7DA 3WW7A 3B23B 1BTWA 4I8JA 3A8CA 1A2CH 2PSYA 1NROH 1D9IA 1BIOA 1UTKA 5B6OA 4CHAB 1DITH 2A4RA 1CA0B 3NZIA 1OKXA 1L1GA 2J94A 5GJ4B 3BTTE 4U01A 3PB1E 3SQHE 3TIUA 2ZF0H 1F92A 3UOUA 1L1NA 2RCEA 3ZYDA 2OXSA 3U1IB 1GMDG 1BHXF 3V7TA 3LOXA 1GI4A 2CMYA 5B6LA 2ZHQH 3HGNA 2A5IA 1C5WB 3EYDA 1PQ5A 1ZPCA 4I32A 1T4UH 2PW8H 3V3MA 1KY9A 1OYTH 1C5SA 3C27B 1ZMNA 2XCNA 5F53A 4RT1A 4IMQA 3OAAD 3UREA 1BMNH 1NM6A 5CMXH 1O2MA 3MOCA 2B5TB 4KKDA 3RXGA 4CRFA 1O3IA 2G81E 4TYDA 2F9PA 5FX5A 4CREA 3H7OA 5I25A 1UVSH 3KF2A 3GCTF 3GY5A 5GNDA 2VVCA 2BDGA 3TITA 2C8YB 5FXLA 1BMFD 2F9UA 3RXUA 2XW9A 4X1QU 2W6JD 5EW2H 1QRZA 3SNAA 1GI0A 2SGDE 3ZVEA 2UWPA 1KXDA 3CP7A 2JH0D 1GJCB 3TK9A 1F0SA 3ZZDA 1HAVA 3URDA 1S84A 1SGQE 1V2NT 1TPPA 1VCQA 2SGEE 2KM0A 2Y5HA 1TX6A 1K1MA 2GDEH 1P2NA 2HLCA 3HKJB 4CRGA 2BD9A 1MBMA 3M5LA 1O36A 4HTCH 1Z7KA 1JOUB 1C1MA 4LZ4B 1ESAA 1A3BH 2GT8A 2LP6A 3AAUA 1XUJA 1N6YA 1NT1A 4JK5A 2O8UA 4E06H 5T6DA 3M37A 1MTWA 3QLPH 1DLKB 1FN6A 1O2YA 3SGBE 1GL0E 2OQUA 1GPZA 1RIWC 2R2WU 1NTPA 4MG3A 4U2WA 4IN1A 4CBOA 3NXPA 1EATA 2F83A 3RUOA 4BXWA 1ZGIA 4DURA 2BOHB 2C90B 5FCKA 1D6WA 3VB4A 1CHOG 4AORA 4O03A 4GHQA 1O2JA 4R8TB 1Z6EA 4I8GA 3QK1A 2BDHA 3SHAH 3SV8A 1SMFE 5T1VA 4JZ1A 4UFGH 4ABDA 2GZ7A 3T25A 3VPKA 1GI7B 3SGQE 3BIVH 1OWKA 3AW0A 1FIZA 1Z8JB 4CBNA 2ANKH 4MQAA 4O97A 5L2YH 3S7HB 2KFWA 3RXBA 2A1DB 1GJ7B 2XC5A 1GCTB 1WOFA 2Z7FE 1YPHC 3MU5A 1QQUA 4BOHA 1HJ9A 4ZMAH 1QY6A 1W13U 2A4OA 1HAZB 2WPHS 1K1OA 1QB6A 4NWLA 1GG6B 1O3PB 1P9UA 4AC9A 5JB9S 5CHAB 5HKKD 2ZKSA 1E1QD 5C1XA 3DSPA 3SJ9A 2PTCE 1EPTC 3EDXB 2BMGB 3MWIU 3UWIA 1O2PA 1XVMA 2STBE 1J9CH 2H5DA 3U9AH 4IW4E 2PR3A 1CE5A 4GLYA 3ENSB 1N8OB 2G5VA 2A32A 1CA8B 1NY22 2WPKS 3M3VA 1MUEB 1Q2WA 4YLUA 5FCRA 2W7UA 2ZPSA 5DP5A 2PV9B 2UUJB 4Q2KA 6CHAC 1XMNB 1P8VC 1HJ8A 2P94A 2ZDVH 3WWFA 1FPHH 1GCTC 1O3FA 3M5NA 4TY7A 3TK5A 1S0RA 2QF4A 1ZHRA 2FOFA 3A83A 3BTQE 2FYRA 2ZHEH 1RJXB 3SUDA 1YM0A 2Z3CA 1GJ5H 1ZTJA 5G4BA 2Q6FA 1TGNA 2A45B 1AN1E 1QIXB 4TWYA 4D7GA 1IQFA 3L3TA 2VU8E 1FI8A 1G3DA 1WV7H 4Y10E 2BD3A 1KTTB 1GDQA 1KTSB 3SI3H 2ZA5A 2H5CA 2ZHDA 2Q1JA 1AZZA 2O8TA 4UFFH 2ZWLH 3URCA 4VGCB 1AWFH 1PFXC 5F8ZA 4YLQH 2ODQA 7KMEH 4OS6A 1O2NA 1YBWA 4X6MA 4ZHMU 3MNXA 2ESTE 3SUEA 1T32A 1XVOA 4UDWH 1ZMJA 3OTJE 1YLNA 1O2GH 5K7RA 2A2QH 5F8XA 1XX9A 4DGJA 1G3EA 3SNEA 3EA7A 2F9OA 1O2OA 1PYTD 3GY6A 1S0QA 4DOQA 2TGDA 1O32A 2QYIA 2ZEBA 1C1TA 2F91A 1TOMH 2ZP0H 1O3DA 1HAVB 1V2VT 2OLGA 2UUFB 3F9GA 4Y79A 1OP0A 4AFUA 2XBYA 2D8WA 3A82A 1GDUA 1LHCH 3ZV8A 6GCHG 1C2DA 1UK4A 2BB4A 2V0BA 2CV3A 2GCHF 1C5MD 1VITG 3F2GA 5C1UA 2V3HH 2ZDLA 2ZCKP 2GX4A 3ITIA 1YWUA 1O3OA 5E0HA 4XDEA 4AGJA 1TGCA 2QE7D 2XXLA 4FU9A 4Z0KA 2BLOA 3RU4E 3BIUH 3A85A 3STJA 4BAKB 2XNDD 2V3OH 3M35A 4MNVA 2BX4A 1BOQA 1MTNC 5EXLA 4I33A 4BANB 3F9FA 4AFSA 3GY7A 1W7GH 2NU3E 3HK6B 4GHTA 4YTAA 4FU8A 1C5PA 3QGJA 5C67A 2P59A 3S0NA 5EXNA 1QQ4A 2XTTB 3MFJA 1YGCH 4HZHA 1ANEA 2OC0A 2UUYA 1ANCA 3EA8A 3GY3A 3NK8A 8LPRA 2QXJA 1P04A 3KQ5A 3RXTA 1BTZA 4ISNA 4MNXA 1TQ0B 4DIIH 1IAUA 3K9XB 2VVUA 5GWZA 3E91A 1TALA 1GI3A 1XM1A 2DE8A 3T29A 1MCVA 3K65B 4Z1MD 2ZGXH 2A7CA 5JDUB 3ELAH 3SGAE 1UHBB 1G32B 1UTPA 3SV2H 7GCHF 1P02A 3LC3A 1MTVA 5A09A 1L4ZA 2IJD1 2ZU3A 1UVTH 3CNRA 2FP7B 9ESTA 3A7TA 4ACBA 2ZU4A 1ZRKA 4OS7A 3ZZ7A 4AG1A 2IN2A 3F0PA 3NPSA 1PJPA 1FONA 2BLVA 2SGPE 3LT3A 2Y7XA 2QF5A 1BMLA 1GI5A 1BJVA 1O5GH 3EE0B 2JKHA 3MNCA 3U8RH 1HJAB 2GV7A 1ABIH 4YT7H 2M2AA 1C5XB 2AIPA 1TFXA 5PTPA 4CRDA 4NGAH 2AMPA 1AVGH 3ZVDA 1KSNA 6ESTA 1O5DH 1GBMA 2OC7A 2WPMS 3ATKA 2BY5X 1NC6A 1SLUB 2ZCHP 2F43B 1A0LA 2BDAA 3ZZ8A 1X7AC 3KCGH 4M9FA 4I31A 4Y6DA 1AKSA 1NU7B 1ELDE 1H8ED 1PYTC 1FLEE 1AB9B 5ESTE 4K69A 3BG4B 3RXPA 2AEIH 3A7WA 5TCCA 1PPFE 1XUFA 1A0JA 1TX7A 2F9VA 2R0LA 2VIQA 2Z9GA 3M5MA 3P70B 1TRNA 2BD7A 3KNXA 4ZKRU 3LIWA 1C5VA 1E79D 2D26C 3KIDU 1PPZA 4QT8C 1C2EA 1T31A 4XBCA 4ASHA 1YYY1 5EQRA 2ZFPH 2ZO3H 1O3KA 1CHGA 3G01A 1C2GA 1OX1A 4FUJA 3QUMP 1A5IA 1UTMA 5DPAA 3A88A 1QB9A 4Y8ZA 4K8YA 3MI4A 1G3BA 2THFB 1ZGVA 2GP9B 1VJAU 3MH5A 1ZSLA 3SV7A 4X8VH 4JZFH 1MU8B 3Q77A 4P00A 3T2NA 2QCYA 1C2IA 3V0XA 1T8LA 1NFWA 1O2LA 5EQQA 4B1TA 1AE5A 1AGJA 4MNWA 2EEKA 1GBJA 1H4WA 1BZXE 1O2SA 1N1LA 3BN9A 4O3UA 4DG4A 3MQKC 1QBVH 3GY8A 1J17T 1O2IA 2WINI 4WVPE 3PMHB 1G9IE 1AO5A 3OX7U 2F4LA 4KP0A 5C94A 3BTGE 1G30B 1OXGA 2C8ZB 2K0QA 1D3DB 1QFKH 5A0CA 1GDNA 1SGPE 1W12U 1HLTH 3O8DA 1E35B 2WYJA 4NG9H 1KXCA 1C5QA 2Y80A 7ESTE 5A8YA 1O3BA 1JXPA 1BRAA 1KIGH 4RN6A 1FY5A 4B2BA 2GKVE 1GJBB 3MU1A 5EGMA 1A61H 1N6XA 2ZFRH 3P6ZB 4UEHH 3BEIB 1Z71A 2J34A 3KHVA 2BD8A 1DPOA 2PWXA 5C5OA 1MD8A 1EJNA 1WBGB 1ZSKA 4IC5A 2ZCLP 5KEDA 4O3TA 1XKAC 1Y3VA 2PFEA 3VB6A 3S9CA 1UTNA 4YOJA 3JZ1B 5BPEA 1C2MA 3VXEH 1GHAF 1SFIA 3DT0H 1BBRH 1PPEE 3F68H 1MZDA 4YOGA 1YPHE 1LHDH 3HK3B 4JK6A 3RXEA 1J16A 2GJGA 1CT4E 1EJAA 2YNBA 2H9TH 3T28A 3RLYH 1GHBF 1P09A 4X1PU 1V6DA 1OWHA 2BVSH 1E34B 1ORFA 4X8TH 3RU4T 1HXFH 1QRXA 1L0ZA 3FP8E 2J97A 1YCPH 1AIXH 1GVZA 3NRLA 4JYVH 5GCHF 3SYJA 4X8SH 1CVWH 1QBNA 3MU4A 2RDLA 4HI3A 4Q7YA 1UCYK 1NRQH 2JH5D 3A80A 2VWLA 2ZQ2A 1NRNH 1RFNA 3GY2A 1AI8H 4H6TA 5EJZA 1QA7A 2PKSC 1OWIA 3RXOA 2Z6BD 2FTMA 2WSSD 2ALVA 5FL7D 1O3HA 1IQJA 4DCDA 3MHWU 3TGIE 1GMDF 3KEEA 1G37A 1O3NA 2ZFSA 2J98B 3MH4A 4DY7B 1TNLA 1ELAA 1AU8A 2FESH 4BAOB 1H8HD 2VIPA 3E16B 3P8GA 3RP2A 1BMMH 2PGQB 1GBIA 3LDXH 1TNJA 4XD7D 1C2JA 4WF8A 3ZVFA 4NIWA 3KQDA 1TAWA 2TBSA 1GHWH 2H2ZA 5KGOA 3A86A 1LVOA 1O30A 4AG2A 5HXFA 1MTUA 2G52A 2FIRH 4JYUH 2CHAB 3GCHC 2FPZA 2Z9IA 3I78A 5DP8A 1DSTA 3OY6U 4AFZA 2FZZA 5C2ZA 4SGBE 2RFKC 5E0JA 1MBQA 2EI6A 1UK2A 2PP6A 2V3MA 1ANBA 2BXTH 1W7XH 1O39A 2Y82A 1LHEH 3EA9A 3M61U 4K1EA 2SFAA 2ZHFH 1UTOA 2BY9X 2Z9KA 3SUFA 3UR6A 3SV9A 5DO4H 4Q63A 5FAHA 4WH6A 1ETRH 4ZKNU 1WTGH 2GMTC 1GBDA 2GCTB 3AASA 2ASUB 1ELVA 1KXEA 1P10A 1EB1H 1QL9A 1K9OE 5HIYA 2XYAA 5A8ZA 3ZZ6A 1GMCG 3BTFE 3L33A 1BITA 1CBWB 4Q7XA 2ZQ1A 3UFAA 3C1KA 2QGRA 1DANH 4GPGA 3SJIA 2P3TB 2QXIA 5J4QA 4X6PA 1LDTT 3RDZA 1E37B 4JZIA 2D2DA 2SGQE 1SGIB 2AH4X 2FWWA 4F4OC 2BOKA 5T3HA 2W3KA 1TMUH 3N7OA 4CHAC 2LELA 1CA0C 1F0UA 1SGFA 4IC6A 1RTLA 1XXFA 1B7XB 1VCWA 2G5NA 3A7XA 1TBZH 1QJ7B 1IQHA 1SC8U 3S9BA 1C4Y2 3U8TH 3UQOA 3CS7A 2STAE 1M9UA 4WH8A 3M5OA 1OWEA 5LPFA 4AGKA 2CGAA 4J1YA 2XNIA 1BTHH 1AWHB 1XUGA 4UFDH 5AFZH 1ZPBA 1CHOF 3T5FH 2XBXA 2AYWA 2BTCE 1FPCH 3P17H 1GI6A 1P11E 4E7RG 4OM9A 4KTSA 4MTBA 3GOVB 5JBTA 1O33A 3SZEA 3UAIC 2GZ9A 3TH4H 1C1NA 4ESTE 1VKYA 1ELGA 1WSSH 3FAOA 4KTUA 1ZSJA 4XSKU 1F5LA 1O5AB 1E0FD 3QGNB 1VITH 1RGQA 1C1QA 1MMJN 1P12E 1MAYA 4FVDA 1CGJE 4F48B 2BQWB 1P2MA 1Y5UT 3IITA 3RXRA 5AHGH 1H8DH 4K8BA 3VXFH 1BMAA 2Q6DA 1W0JD 1ELEE 1GJ9B 2XBWA 3KGPA 5LPEA 2P3FH 1YLCA 2YMSD 3UNQA 1GBHA 2OTVA 4GSOA 3ZYEA 5JBBS 1U6QA 4FOUC 1LO6A 3B8JA 3PLBA 4ABBA 3NWUA 3K6ZA 2FX6A 1A7SA 3UIRA 4UE7H 3UWJH 2AMDA 1P57B 2BVRH 3I77A 1P2KA 3PMBB 1JRSA 1HBTH 1DSUA 1GBLA 1EX3A 1O3EA 2KCYA 2ZPRA 4TSFD 3PLKA 4YT6H 2VNTA 5LPRA 1MQ5A 3TJVA 1GL1A 3P8NA 1YPJH 2VWNA 5FBEA 2WHXA 1FMGA 1O3JA 2R0KA 3FVFB 3M7TA 1PPGE 1K1NA 1T8NA 2OP9A 1C2FA 1CQQA 3PWCA 1DT2A 3F6UH 4MPXA 3RXJA 4Y0YE 1TBQH 1S81A 4K1TA 5A0AE 1SHHB 2EC9H 2GZ8A 1SKYE 3UTUH 1P06A 1QA0A 1YPEH 3PM3A 2B8OH 1P05A 3RMNH 2GTBA 1QJ1B 5A0BA 1HUTH 4D9QA 1QL7A 1Z8GA 2FOBA 2B9LA 2HOBA 3SNCA 1KMHB 4MNYA 1FUJA 2R2MB 3A8AA 2V7QD 4CRCA 4FUCA 3FANA 1C1PA 4MPUA 4GUXA 3WWBA 3QWCH 3GCNA 1TRYA 2JIZD 1MKWK 3VGCB 2ZI2H 4I8LA 1V3XA 2QC2A 1ELBA 3F1SB 3ZZ4A 2YMSB 1ESTA 1ARCA 1E38B 1K1IA 1AZ8A 3DFLA 3T62A 1S83A 4MLFB 1IQEA 1W0ZU 2J9NA 4WWYA 1GG6C 4OS4A 3RXHA 1FV9A 2TGPZ 1DWCH 1OP8A 4HG6A 5CHAC 4X2XA 1UO6A 1VZQH 2FS8A 1GJ6A 2NU4E 1A5GH 5JYIA 2V6NA 2PLXA 3RXFA 2OC8A 3ZZAA 4H42U 1LQEA 1MKXK 4GCHG 1LKAA 2VBCA 6GCHF 2F9NA 3KQEA 5JB8S 1VITF 1E36B 1MTSA 1Y5BT 1N8OC 3GDSA 4A6LA 1VGCB 5EJ1A 4CR9A 2Z94A 1UMAH 4I8HA 2ZFTA 2ZTYA 4ZXXH 2R3YA 3QZRA 3O8CA
chains in the Genus database with same CATH topology
4FUBA 4DIHH 1GHYH 5DP3A 2ZECA 5H4IB 3SU2A 1FDPA 1O5EH 4ZROA 3PMJA 3V12A 2BLWA 1LHFH 4ABAA 4ZKOU 1KLJH 2ZU1A 2WUCA 1NFYA 3ATMA 2C8XB 1HAGE 1HAYB 1BQYA 1A1RA 1BRBE 3JZ2B 2IJOB 2BDYA 4D7FA 1ARBA 1K1LA 3PYHA 2AS9A 4ZKSU 2VH6A 1Q31A 1CO7E 1TB6H 1FJSA 1EXFA 3BTHE 1BA8B 2ZG0H 3BTKE 1O2HA 3OSYA 4R0IA 1H8IH 5L30H 1C1VH 3D65E 5I46H 2AERH 3ZVCA 5HM9A 1GI9B 4NFFA 2ANYA 4JYTA 1GVLA 4Y7AA 1C4U2 1C5RA 2VGCB 1V2PT 4VGCC 1NU9A 1DICA 1FY4A 1VGCC 2B7DH 3Q76A 3SORA 5C3NA 1FY3A 1EAXA 3LGUA 3F9HA 1OSSA 3PROA 1GBCA 1HIAA 4SGAE 3VB5A 2XWBI 1W3CA 2G4TA 1Y5AT 2BZ6H 1V2TT 4B76A 5FPYA 1O5BB 3SU5A 5EOKA 3TLOA 1AHTH 1KDQA 1P3CA 1GJ8B 1SVPA 3LH3A 1FY1A 1AD8H 4H4FA 3T26A 3P95A 1MCTA 5E8EH 2HNTF 2PKAA 2GDDA 2ZTZA 1TGBA 3ODFA 3HATH 1Z6JH 4A1TA 3LJJA 2D1JA 4X6OA 1SGFG 3BTEE 1EP5A 3LH1A 3R3GB 2QN5T 4IGDA 1IQKA 2PUXB 1SGEE 1TNKA 4X2YA 3P8OA 5F8TA 1GBKA 4OGYA 4X2WA 2BVXH 2SNWA 2ZU5A 2PTNA 1SLVB 2ZGCA 4JZEH 1SOZA 3GICB 2VIVA 1JIRA 5EG4A 1TX8A 2HNTC 4X1RU 3BEUA 1O3AA 1OOKB 2CF8H 3PV4A 3BTWE 3M3SA 1ACBE 2A7HA 2FI5E 1UTQA 5T6FA 1P2OA 1YPMH 2A5KA 2GT7A 1OYQA 2Z9JA 4BTUB 4OS2A 5LH8A 2ZTXA 3OU0A 3BG8A 1F2SE 1AMHA 1TABE 1EZUC 1VJ9U 2YNAA 4AZ2B 4Y7BA 1XUIA 5IDKA 4WY3A 2QIQA 5F03A 5E2OA 1FQ3A 4THNH 1ID5H 3LONA 4NZLA 3RXVA 1FY8E 1P2JA 3OY5U 3HGPA 4BTIB 1ZHPA 1F5RA 1D3PB 1ESBA 3VB7A 1EUFA 1ELTA 1Q3XA 1O2XA 1VR1H 1C5YB 2BD4A 1GI1A 4M7GA 4BNRA 1AE8H 2BQ6B 5CE1A 2AIQA 1T8OA 2CF9H 1HJAC 2C3SA 1AFEH 1HAIH 2F9BH 3IWMA 4O9VA 3M36A 5GIBA 1HB0B 5AFYH 3ESTA 4ABGA 1EAIA 1H1BA 3FFGA 3RXDA 5EW1H 3A81A 1LQDB 3D62A 1IHTH 3PO1B 3LGWA 1GBBA 1AUTC 1DXPA 1P03A 2ZDMA 3LGIA 4Q7ZA 5GPIB 1SLWB 4ZHLU 2WPJS 2P8OB 1BBRE 1EB2A 1Y3YA 1O2UA 3E90B 1HAHH 2EI8A 2ULLA 3RXIA 2OCVB 1H9LB 1GBEA 1O3GA 1GJAB 2GGVB 1K1PA 1SFQB 3O8RA 1C5ZB 1WU1A 1HRTH 1XUKA 2QXHA 5EPYA 1AB9C 1MU6B 3BG4C 1DWEH 1S82A 1C2KA 5DGJA 4ZXYH 3QDZB 1LVMA 3Q3XA 4INLA 2LNCA 2BYAX 1T4VH 2O8LA 2LPRA 1H9IE 4NSYA 5GXPA 1P0SH 3M3TA 3TJNA 1IQMA 1MD7A 3K6YA 1YPKH 5ESBA 1P2QA 5FX6A 1G2LA 1DWBH 2J4IA 1TE0A 1SGYE 2W7SA 1G3CA 1HV7A 2BXUH 3PTBA 4WXVA 3MNSA 1JBUH 4TPIZ 4BAMB 1TWXB 2P16A 4MVNA 5HM2A 3SJ8A 5HGGA 1BT7A 3BEFB 1K2I1 5TJXA 1SGDE 2J92A 2Z3EA 3NCLA 4IMZA 4XBDA 4JZDH 4K2YA 1GGDB 2VH0A 2BDIA 1V2UT 2R9PA 5JBCS 5FPSA 3PMAB 1QURH 2PGBB 1DVAH 2UWLA 3U1JB 1J14A 1UVOA 1DLEA 3GY4A 3OYPA 5A2MH 3RC6A 4PROA 1HCGA 2BD5A 4TWWA 5EODA 1O2VA 3QN7A 5L6NH 1EPTA 1TRMA 2P3UB 4K3JA 2A0QB 2A31A 3ATIA 3RXQA 5HMAA 1DS2E 1SGRE 2BY7X 4Y71A 2XCFA 2ODYB 1LVYA 1NRPH 1BTXA 1O2ZA 4CR5A 5J4SA 1LPZB 1TYNA 2XRCA 3EGKH 3RXAA 2JETB 1ELFA 1YP9A 1K1JA 3Q3YA 1TA6A 1EZXC 2BHGA 3NKKA 1BCUH 3TK6A 3PWBA 8GCHG 4J2YB 2HPPH 1C5NH 1K28D 1O2WA 3LC5A 1O3LA 1UTLM 2OC1A 1BJUA 4YO9A 2C8WB 3DD2H 4AFQA 4B2CA 1VCPA 1F7ZA 1Z8RA 3LU9B 4ZAEA 2ALPA 1SQTA 3QTVH 3S7KB 5EU8A 3SJOA 3ZZCA 4Z6AH 3A7ZA 1THSH 4NFEA 3SOSA 2BX3A 1S5SA 1G2MA 3UUZA 1GMCF 2FOMB 4WMDA 1INCA 1V2OT 2A5AA 2GV6A 3AAVA 3E0NB 5AF9H 2QF3A 1RTFB 1C9PA 3MH7A 1PQ7A 5FBIA 3TVJB 1A46H 1BDAA 1SL3A 3LGTA 3SU4A 1SB1H 1ZPZA 2J2UA 3KQCA 3M7QA 4IN2A 4CH8B 2G51A 3TNTA 1C5TA 1BUIA 1BHXB 1DXWA 3ODDA 2BZAA 5SGAE 1QHRB 5E0GA 3S9AA 2Y5GA 2AMQA 1V2QT 2Z3DA 1AKSB 1JMOH 3TH3H 3ZZBA 3U98H 1TNHA 2XWAA 1GJ4H 1WUNH 1WQSA 1W8BH 1L4DA 3GYMA 3MTYA 1L2EA 1TONA 1FZZA 5TCAA 1XXDA 3IG6B 4KTCA 1EQ9A 3ZVGA 5EPNA 1GBTA 3U8OH 1WAYB 4I7YH 3MU8A 3QX5H 3E0PB 1PQ8A 1GHXH 1UCYH 2BM2A 2WYGA 3A89A 4Y8YA 3SU1A 4UFEH 1SGNE 1ETTH 1FNIA 5C5NA 1ZR0A 1GMHG 2WUBA 2OD3B 1MH0A 2CHAC 1EZSC 1AQ7A 4DT7B 1YLDA 2C4FH 1DM4B 2KAIA 4FUEA 1GVKB 1IQLA 2C93B 4IS5A 4AX9H 3MU0A 1AVWA 2G8TA 3SI4H 4D76A 2YOLA 3W94A 4OGXA 3VEQB 4LK4A 3T27A 1CU1A 1DY8A 1RIWB 2ZDNA 3QO6A 4A7IB 1V2LT 4A5TS 9LPRA 1C5LH 1EAWA 4NSVA 1DWDH 1TLDA 2ZDKA 4KELA 1JIMA 2GCTC 5F6MA 1ZOMA 2ANWA 1K22H 2Z9LA 1CGIE 4NA7A 3SQEE 3E3TA 4NIXA 2QY0B 1CBWC 3TNSA 1WQVH 1TOCB 1SOTA 3TU7H 2WV5A 2H9EH 2JH6D 2FX4A 4GVUA 1Z1JA 3RMMH 1KLTA 1O2QA 1Z8IB 3ZZ3A 2AGGX 2OBOA 2AGIX 4XE4A 1NRSH 3KN2A 2FODA 1QJ6B 3GCTG 2FOAA 2J38A 4ZH8A 2TGAA 3UY9A 1Y3WA 2BY8X 2W26A 4ABFA 5HYOA 1GJDB 1TGTA 1SG8B 4CRAA 3SU6A 4E7NA 3FP7E 1W0YH 4B74A 4ISHH 1SQAA 1ZHMA 4F49A 4AN7A 2VINA 1B0EA 1V2MT 1QNJA 3UNRA 2G55A 2O8MA 3MO3A 4I8KA 2BDCA 3MH6A 2HNTE 5E2PA 3R0FA 3RC5A 3SO3A 1RS0A 4OS1A 2H1UA 1Y3UA 1S85A 4JMYA 4BAQB 1O2RA 1V2RT 1EPTB 4B73A 1NPMA 1Z1IA 1B5GH 4FUHA 2VVVA 2Y5FA 5JBAS 3LPRA 1ZJDA 1UHBA 1A3EH 1RTKA 3U69H 1TIOA 3VFEA 1H9HE 3FZZA 1BRUP 3ZV9A 6CHAB 3RMOH 1O35A 2H9HA 4NA8A 2QV1A 4X6NA 4Y0ZE 3TH2H 3P8FA 2NU2E 2FXRA 3UR9A 4YESB 4ABIA 2BQ7B 1OS8A 3HKIB 4X1SU 2FLRH 4CRBA 3SW2B 1HPGA 1C1RA 3W95A 1BB0B 4XOJA 1EOLA 5IYTA 2GD4B 1JRTA 1DDJA 2PHBA 3SU0A 1RD3B 2ZFFH 1KXAA 3GISB 2BD2A 3BTDE 1PPBH 4GCHF 8KME2 4ABEA 1W14U 2Q6GA 1CT2E 2K1QA 5FHTA 4CH2B 3TPIZ 4BAHB 3UQVA 3KQBA 1BTUA 2RA3A 1D3QB 2TRMA 1O37A 2NU0E 5GDSH 3QTOH 3MO6A 1O2KA 1O38A 1Y3XA 2ODPA 2H6MA 3ZZ5A 1GI2A 2AFQB 3SU3A 3P92A 2WPIS 1QCPA 4TPYA 1TQ7B 3FZDA 1QB1A 1D3TB 1O3CA 2NWNA 1TPSA 1HGTH 1B0FA 4XBBA 4YZUA 1ZTKA 4FUIA 1JWTA 1S6FA 1T7CA 1SSXA 2XBVA 3LGVA 4RKOB 4K5ZA 2OBQA 3RM2H 4ISIH 2B0FA 1Y59T 1HFDA 4B2AA 4UONA 1FXYA 1GHZA 2CN0H 3D49H 1YF4A 1ZMLA 4YM9A 5FPTA 1QR3E 1W2KH 3RXKA 1EZQA 1W11U 2P95A 5T6GA 1V2KT 1P2IA 2DUCA 3MMGA 2HALA 1CGHA 5DP7A 2ZNKH 3VGCC 1HYLA 3NUMA 4WMEA 2NU1E 1EAUA 1SHYA 2BY6X 4NWKA 2GVFA 4ABJA 1DX5M 3E6PH 2KAIB 4Y11E 1XUHA 2G4UA 1WCZA 1LKBA 3Q00A 1MTNB 1QL8A 4U30A 5DKMA 2FOHA 5DP9A 4FUFA 1DE7H 4AYVB 3ZVBA 4LXBH 1C1OA 3E1XB 2VIWA 2ILNA 4MPWA 5EXMA 3DA9B 3A84A 3BV9B 1C5UA 3FP6E 4FUDA 3QZQA 4AB8A 4X0WU 4Y8XA 2CXVA 3RMLH 2BDBA 3SNBA 3STIA 3I29A 8ESTE 1DUEA 2V35A 3A8DA 4UD9H 2IPHA 2P93A 1MKWH 2FI4E 4WXIA 1WYKA 1YPLH 3LGYA 1C2LA 1EP6A 1C1UH 1TA2A 4FUGA 1AY6H 1LPGB 4B71A 4RSPA 3EAJA 4X8UH 4RKJB 4U32A 1NFUA 1WTHD 4AOQA 1J8AA 1SGTA 3TJUA 1HNEE 1BTYA 3SZNA 1MQ6A 1S6HA 2FM2A 4H6SB 3AW1A 2FLBH 3ATLA 1UTJA 2ZDAH 1HDTH 1C2HA 1TNIA 2A7JA 1G36A 3TJOA 1UJ1A 3MNBA 1KYNA 4X1NU 1MKXH 2W3IA 1EOJA 2M5TA 3GDVA 3UNSA 2FS9A 2ANMH 2OINA 3K2UA 1HAOH 1ETSH 2TIOA 1D6RA 5DK1A 1XKBC 1NRRH 5ETXA 3VB3A 3D23A 3L6PA 1P01A 3H7TA 4NA9H 1EASA 2QAAA 1EKBB 1TGSZ 2F3CE 2GCHG 1TNGA 4NIVA 1UK3A 1ZLRA 2Y81A 1NN6A 4ABHA 2HWLB 2VGCC 1J15A 4FU7A 4FXGH 4B75A 1HAXB 3ZZ9A 3SUGA 1OPHB 4AYYB 1F0TA 1V2ST 4YOIA 3MYWA 2ZIQH 1HAPH 4Q80A 4E05H 2Y7ZA 1ELCA 3DUXH 3WY8A 1DUAA 1SBWA 2FOEA 4BXSA 2VIDA 4INHA 2XC0A 2A2XH 2FI3E 2HGTH 1NESE 3M7UA 1L1JA 1DOJA 1O31A 1GI8B 3H5CB 4KGAA 4MPVA 3ATWA 4INKA 1SQOA 1GWAA 5A8XA 2PSXA 1OP2A 1PQAA 3RXMA 3HPTB 5JPMH 1QRWA 3RU4D 1A5HA 3LKWA 1ABJH 2QA9E 4ISOA 3UPEA 2WPLS 2ZGJA 7GCHG 1CT0E 1GHVH 4NZQA 3A8BA 2IOTA 2I6SA 2VJ1A 2FOGA 1PPCE 1QGFA 1AFQB 1IOEA 3GYLB 1DFPA 5L2ZH 1FAKH 1O34A 3Q3KA 5DG6A 6LPRA 1C4V2 2RG3A 1V2WT 3ZVAA 4TY6A 1PPHE 1D4PB 1YPGH 2W5EA 1BRCE 1NZQH 1MZAA 1UVPA 3UOPA 1YC0A 1FAXA 1ZJKA 2ZFQH 1BBRK 1NFXA 1O5FH 1BTPA 4DVAU 1FN8A 2UWOA 1QBOA 1P9SA 1IQNA 1LHGH 1EJMA 4X2VA 4OS5A 3PLPA 2A4GA 5ABWA 2BLQA 3RXSA 3BSQA 4NCYA 2DE9A 4HGCA 1IQIA 1LPKB 5LGOA 4ISLA 1MAXA 3SBKA 1GBFA 1YKTA 1SPJA 2PUQH 2I6QA 1YCPK 3AVZA 1W10U 4WJG2 1UVUH 1F0RA 4GAWA 4LZ1H 2QF0A 2QXGA 2CJIA 2FMJA 2RA0A 4JCNA 1IQGA 1A4WH 4AB9A 2VWOA 1AFQC 3KL6A 3RXLA 3A7VA 3E8LA 1ZRBA 2SNVA 5DP6A 1C9TA 4D9RA 4K1SA 2FO9A 1RXPA 3SN8A 5C1YA 4DJZB 1P3EA 3S69A 1SI5H 3DFJA 3V13A 2EA3A 2HVXA 3PTNA 2TGTA 1TMBH 1TMTH 3PO1C 1ZTLA 1KXFA 1OWJA 2EI7A 2O8WA 3GDUA 1O2TA 2XC4A 5K0HA 4IBLH 1F5KU 2ZZUH 2P8OC 5BRRE 3DHKH 4A1XA 4FVBA 2FTLE 3SHCH 4K60A 2Y6TA 8GCHF 4A92A 1K21H 3MO9A 2HPQH 2ZGHA 3SJKA 3TGKE 1HIAB 1O3MA 2ZPQA 2G00A 3RXCA 2PKSB 3RC4A 1C1WH 2SGFE 1TPAE 1Y8TA 2ZHWH 1KDQB 1A0HB 3O8BA 1SGCA 2VIOA 2ZC9H 4LOYH 1DY9A 1TPOA 1AVXA 4DW2U 5AVDA 1SLXB 3GCOA 4A1VA 1TBRH 2PKAB 4ZUHA 3BTME 1ANDA 2O9QA 3CENA 1HXEH 3RLWH 1LTOA 1RRKA 2AGEX 3SV6A 3EQ0H 2WV4A 1C1SA 1LMWB 3B9FH 2OQ5A 1LVBA 1V2JT 3GCHB 3TGJE 2ZU2A 4XFQA 1FIWA 1NO9H 2FEQH 2FDAA 2OUAA 2VB0A 3A87A 2VWMA 2ZGBH 3CS0A 3RM0H 1NS3A 1ZYOA 1YCPM 2UUKB 4Y76A 1GGDC 1O0DH