2AIPA

Crystal structure of native protein c activator from the venom of copperhead snake agkistrodon contortrix contortrix
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
231
structure length
231
Chain Sequence
VIGGDECNINEHRFLALVYANGSLCGGTLINQEWVLTARHCDRGNMRIYLGMHNLKVLNKDALRRFPKEKYFCLNTRNDTIWDKDIMLIRLNRPVRNSAHIAPLSLPSNPPSVGSVCRIMGWGTITSPNATLPDVPHCANINILDYAVCQAAYKGLAATTLCAGILEGGKDTCKGDSGGPLICNGQFQGILSVGGNPCAQPRKPGIYTKVFDYTDWIQSIISGNTDATCPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Protein C activator
publication title Thrombomodulin-independent Activation of Protein C and Specificity of Hemostatically Active Snake Venom Serine Proteinases: CRYSTAL STRUCTURES OF NATIVE AND INHIBITED AGKISTRODON CONTORTRIX CONTORTRIX PROTEIN C ACTIVATOR.
pubmed doi rcsb
total genus 55
structure length 231
sequence length 231
ec nomenclature ec 3.4.21.74: Venombin A.
pdb deposition date 2005-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2aipA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2aipA02
1DXWA 1V2RT 2H2ZA 2HRVA 4AYYB 1KXEA 3MI4A 1SPJA 4ZKRU 4X2YA 1KTSB 2J94A 1IOEA 1MKWK 1C5NH 1Z8GA 3I78A 2W3KA 4HGCA 1CHOG 1UK3A 3ZYEA 4O03A 4ISHH 1FUJA 2VGCC 1K22H 1ELEE 1E36B 2V3HH 2HNTF 1BMMH 5JBAS 1IQGA 4CBNA 3RXTA 3KQCA 2RDLA 3SI3H 2O8MA 1O2VA 1SLXB 2WV5A 1YLDA 1RXPA 1TFXA 4O9VA 1J14A 4GCHF 3PMAB 1CT4E 4YM9A 1WCZA 3L6PA 1A5GH 3Q77A 1P9SA 2HVXA 5CHAB 1C2FA 3RXAA 1D6RA 3SGBE 6ESTA 1O30A 4PROA 4A7IB 2Z9JA 2HOBA 4INLA 1AWHB 1LQEA 1GBAA 1KLTA 2OTVA 2FOGA 1YCPH 1TX7A 3LGYA 5C20A 2A2XH 1S85A 2AGIX 2V0BA 1EZSC 1Z8IB 1H9IE 3E0PB 5LPRA 3U8OH 1QBVH 2GMTB 2P93A 1P10A 1BOQA 1QL8A 1LHDH 1SGYE 3PO1B 3SORA 5A8XA 1O3EA 1V2JT 1SGCA 4BANB 3U8TH 4Y11E 1EPTC 1GI7B 2QGRA 2ZCKP 4FVBA 3OX7U 3VEQB 1H9HE 1XUJA 5B6OA 3FZZA 2BOKA 1O2SA 1GBKA 3MNBA 2ZDKA 4MNWA 1O37A 4NFFA 1UTJA 5AHGH 1CGJE 1NFXA 5F8ZA 1P8VC 3BTHE 2BXTH 4KTUA 2GCHF 5GDSH 1TGTA 2WPHS 2FS9A 1GJ4H 1DX5M 1LHGH 1VGCC 4UE7H 1PFXC 3VB4A 1ELAA 1BHXF 2XBYA 1W13U 2V35A 2RA0A 2C8YB 1TMBH 4WY3A 1ZRKA 2G55A 5HGGA 2AMDA 4H6TA 4U30A 2ZF0H 1NC6A 2GZ8A 1BBRH 1D6WA 2Y5FA 1AE5A 3RXCA 1QGFA 1FPCH 2GV7A 2OC8A 1SGRE 6GCHG 3OU0A 3TJVA 2FIRH 2EI7A 1DANH 1HAOH 1CGIE 3TITA 1A46H 3LGUA 5L6NH 3UOPA 1DUAA 1TNKA 1PJPA 1TYNA 2FTLE 2V3OH 4Y7AA 5FCKA 3QDZB 1O2RA 1ABIH 1C5PA 1AD8H 1G3DA 1UVTH 5JBBS 4NZQA 3TIUA 3BG4C 1MU6B 1BDAA 1AFQC 4FU7A 1L2EA 4AZ2B 2BQ6B 2GT8A 1FQ3A 2G51A 1KXDA 3PLBA 1Z6EA 4M7GA 4HZHA 1LMWB 1DWEH 1UVUH 4Q7XA 1HAXB 2AMPA 1JIMA 2ZCLP 3LIWA 3UY9A 2XTTB 3A8CA 2SNWA 1G3BA 1SVPA 1GJDB 1Y8TA 4DG4A 4I8LA 1KXFA 2TGPZ 3SJIA 4B73A 1UO6A 2JETB 1V2UT 5EXMA 2OC1A 2ZU3A 1O3KA 1SGDE 3S7HB 3UWJH 1W12U 1JXPA 3Q3YA 1O2OA 1QQ4A 3SGAE 1MTSA 3BEUA 1G37A 1HV7A 4X2WA 1T4VH 2OQUA 1E35B 2ZGJA 2AEIH 1HNEE 4SGAE 2QV1A 3GCTF 1THSH 1L4ZA 2ZGHA 1AB9B 2I6SA 4FVDA 4JCNA 4UD9H 3NPSA 4KELA 1HAZB 3KNXA 4ABGA 1NRRH 5EXNA 1P04A 4Y79A 1TABE 3RXBA 3K9XB 3LPRA 1GJ7B 2FOAA 1YLCA 4X2VA 1QNJA 3NWUA 1YC0A 2RG3A 1XVOA 2G4UA 1L1GA 3H7OA 2FYQA 3ODDA 3SO3A 2FESH 4X8UH 1VR1H 2W26A 1CGHA 3O8CA 2GMTC 1HPGA 2BQ7B 3STJA 3PO1C 1NT1A 2NWNA 1OWJA 1D9IA 1FIZA 2P3UB 3LGIA 2VVVA 1C1PA 5FHTA 3U69H 2ZGBH 4KP0A 3VGCB 3SV7A 1HGTH 1TX6A 1D3QB 3HGPA 4U2WA 2P3FH 1GBIA 2BDAA 4I32A 1AE8H 1ZOMA 4X2XA 2VNTA 1FJSA 1ZR0A 4NA7A 4X1RU 1JWTA 2VIDA 4KTSA 4ZROA 5BRRE 1QBOA 3TH2H 3SU1A 1BT7A 2QY0B 1VCPA 1TPAE 3K2UA 1CO7E 2PFEA 1O2HA 2ULLA 2BY8X 4K3JA 3A7ZA 3MO3A 2BVXH 4X1NU 2K1QA 1S6FA 2XBWA 2ZP0H 1TE0A 1Y5BT 4JYUH 1MAXA 3ATIA 5C67A 2OD3B 2YNAA 4IW4E 1O3PB 1BTUA 1O5DH 2GX4A 3SBKA 1FIWA 1S0RA 2TPIZ 4FUIA 3RXKA 4X6NA 1TBRH 1ZTKA 1K1JA 1O34A 2VIWA 4INKA 1W8BH 1E34B 2VH6A 4XSKU 5L2ZH 1SOZA 5DJ7A 2VINA 4WH6A 3ODFA 4FUGA 2G81E 3A8DA 1MTUA 3NZIA 2FYRA 3PYHA 5ESTE 3RP2A 3QTVH 1DITH 5L2YH 3M7QA 2VIOA 4ABEA 2SNVA 4UONA 1AZZA 2BD7A 2ZCHP 1GJ8B 1S84A 2JETC 2VVCA 2A0QB 2TRMA 2TGTA 1GJAB 3MU8A 1C2KA 5GIBA 5A0CA 1PPFE 3M37A 1W3CA 1MCTA 3Q3XA 1K2I1 5ABWA 1V2VT 1EASA 1P01A 2XW9A 1ZSKA 1MH0A 3M5MA 4WMEA 5E8EH 2CJIA 1C5WB 3M5OA 1IQFA 1TOCB 3A84A 3M3VA 1A5IA 2ZFSA 1SLWB 1CBWB 2PUXB 2ZU4A 3QK1A 1W7GH 2GZ7A 1EP5A 3SZNA 3P8FA 5ETXA 4JK5A 1BQYA 1DT2A 2G4TA 1DLKB 1CHGA 4H6SB 1AWFH 3TK6A 1HRTH 2Y80A 4TY7A 4BAHB 4AB9A 3QLPH 1OWHA 1MQ5A 4LOYH 1V2OT 4FUJA 1C5ZB 3CP7A 1NM6A 1G2LA 1F92A 3D49H 1AY6H 1Z8RA 4K8YA 4AG1A 5A2MH 1LHCH 2D8WA 1BA8B 3PMBB 2BM2A 1T7CA 2BMGB 4I8KA 3RC6A 3VGCC 4XBCA 1O3LA 3D62A 5K7RA 2WPJS 4OGXA 1GI1A 1V2NT 3BN9A 5FX5A 3LGWA 1SGIB 1DWDH 2Y7ZA 1YM0A 1YCPK 2P59A 1ELCA 3PTBA 3GY2A 1C1TA 1P11E 3JZ1B 1DWBH 1W0YH 1UCYE 3SHAH 4F49A 3TJNA 5T6DA 3ZZAA 1C4Y2 1OX1A 3MWIU 3L3TA 2J2UA 1Z71A 2BDYA 1BITA 2GVFA 5FX6A 1HJAB 1GHAF 1O3MA 3T25A 4ISNA 2OQ5A 3UFAA 3VFEA 3SU4A 1OWEA 4ASHA 1RJXB 1V2KT 3IWMA 3SV2H 5EU8A 2HPPH 3CS0A 4ZXYH 4Q7ZA 3RXHA 3LOXA 1WSSH 1FI8A 4NFEA 3M36A 1BTXA 1YKTA 3S9BA 2A4RA 3E90B 2AGEX 1FAKH 3U1JB 4A1VA 4FUEA 2I6QA 1ZPZA 1C1UH 2VWLA 1FNIA 2FXRA 1NZQH 4XBDA 4JYVH 4RSPA 2QCYA 2F9VA 1GI8B 1NRQH 1ZPCA 1MD7A 4GHTA 4NG9H 3SQHE 1MTNC 3GYLB 1QR3E 1AHTH 1CU1A 4DVAU 2W3IA 4WH8A 4YTAA 1G30B 2BD3A 2F3CE 1O2TA 3RXVA 5E2PA 4B1TA 2ZDAH 4NIXA 4B75A 1BB0B 4Y0YE 1ESTA 2PUQH 1Q31A 1EJAA 2ZFPH 1LO6A 2BY7X 1C2MA 3ELAH 1K1LA 1K1MA 1NPMA 2DUCA 3QUMP 1SHHB 1HCGA 1MZAA 1ZZZA 1VCQA 5E0GA 4WXIA 1GL0E 3PLKA 3RXLA 3UOUA 1E37B 4HFPB 3S7KB 5FXLA 3ZZ4A 1AI8H 2BOHB 1EPTB 3BTFE 4WMFA 1BJUA 2FP7B 5DK1A 1CSOE 1SGQE 2C8ZB 2PWXA 3AW1A 2THFB 2ZFQH 1ELFA 3MOCA 1SFIA 3SNBA 4ZXXH 3MU0A 3SNAA 1EPTA 1NFYA 3GY4A 5F6MA 1B7XB 1AUJA 3HGNA 3SV8A 1MCVA 4NA8A 2NU2E 1GHVH 3UQOA 2VVUA 2PKSB 1A61H 5L30H 2VIVA 1O35A 2ZTZA 3STIA 1C4V2 2OINA 2WV4A 4UFEH 5DP4A 1CBWC 1CA8B 2A5KA 4YLUA 1GBBA 4BAOB 1T8MA 5GWZA 5SGAE 5BPEA 5GCHF 2ZA5A 1ORFA 3ZVBA 1SGFG 4FUDA 5EGMA 4LK4A 2ZPQA 1LVMA 1JBUH 1Y3YA 2NU3E 2HGTH 4ISOA 4CRBA 4ABAA 2F9PA 2W7UA 1W2KH 1Y3WA 2XCNA 1EZUC 1GJBB 2H6MA 2O8WA 2UWPA 1JIRA 4WXVA 3ZZ9A 2SFAA 2HWLB 1SFQB 1K28D 2OXSA 4BXSA 3OY5U 1IHSH 3SNEA 4NCYA 3O8BA 1DWCH 1NRPH 2OUAA 2Y81A 1Y3XA 1TPOA 2FS8A 5A0AE 1DM4B 2FO9A 3FP7E 3UR6A 4DT7B 4A5TS 2VWMA 2ZPSA 4MNXA 8GCHG 3UNSA 1C1NA 1XUGA 1NRNH 3RU4T 3GY7A 1TMUH 2GDEH 1NU9A 1PQAA 2A4GA 1O2WA 1HAVB 2BD9A 1PPBH 1W14U 1HYLA 3DT0H 2NU0E 2SGAA 3L33A 1HJAC 1THRH 3E3TA 3T28A 4NA9H 5DP8A 2IPHA 4LZ1H 3RXEA 1DDJA 1HAVA 3TJUA 1EKBB 3VXFH 3U8RH 1L1NA 3PTNA 1O36A 1EAIA 1WAYB 2JKHA 1GBJA 2F9OA 2SGDE 3P8GA 4JYTA 4XFQA 3N7OA 2WUCA 1ETSH 1J9CH 2ZPRA 5ESBA 1VITF 2CN0H 1GCTB 2HPQH 2VJ1A 1IQJA 2TBSA 1GBDA 5FBEA 1DXPA 3P8OA 2ZECA 2PHBA 2AH4X 1LVBA 3V3MA 2XCFA 3TJOA 3MYWA 1AQ7A 1Z1JA 3B9FH 1O5GH 1ZJDA 5CE1A 1GHBG 1QQUA 1O3OA 4O3UA 3SW2B 1T4UH 1C2HA 4X1QU 4IMQA 1A4WH 1CVWH 1C2JA 2PGBB 2ANYA 1AU8A 2GDDA 2Y6TA 5DP5A 5LPFA 4D76A 3JZ2B 3ZV8A 2AS9A 1BTHH 3F1SB 3BTGE 5DKMA 1IQIA 1QRWA 4GSOA 2ODPA 2H9TH 3K6ZA 2Z94A 1GBTA 2G00A 3PWBA 1P12E 3F9FA 1TLDA 1DICA 1YPKH 4NIYA 4NZLA 3M5LA 4OS6A 3BIVH 2FOMB 4CRCA 2Z7FE 3MHWU 1OP0A 2PKSC 2ZDMA 3RXFA 4JMYA 2CF8H 3SU3A 4INHA 4A1TA 1ZMLA 3PWCA 1YPHE 1W11U 3MH7A 3OSYA 2OBOA 5FCRA 1ZTLA 2ZG0H 4DGJA 4ABBA 5JPMH 1S83A 3S9AA 1K1OA 4MDSA 1YPMH 2PV9B 4LZ4B 3RXGA 1QY6A 1X7AC 3CS7A 1C5UA 3FAOA 1P09A 3G01A 9LPRA 3HATH 1O3IA 5J4SA 1BCUH 2FTMA 1PPHE 5AFYH 3RU4D 1UVSH 3ATLA 1L4DA 5AFZH 1J16A 4Y6DA 2ZDVH 1ARBA 3LGVA 4YOGA 4YESB 4D7FA 4X1SU 2ZFFH 1GMDG 1O3CA 1UJ1A 8LPRA 1O5CB 4XDEA 4AORA 2ZNKH 2ZIQH 4VGCB 1MUEB 3UPEA 3AW0A 5DG6A 3BSQA 3ZZ7A 2GCTB 2UWOA 1BUIA 3RXQA 3NUMA 1HDTH 3S0NA 4TPIZ 2Y82A 5HM2A 1FXYA 1F5RA 4JZ1A 4A92A 1D3TB 4ABFA 4CR5A 1W0ZU 1ID5H 1DFPA 3URDA 3E0NB 2ZTXA 5E0HA 1OWKA 2R9PA 1O5FH 1ZYOA 3A8BA 3A7WA 2ODQA 1Y3UA 2BX4A 2C8WB 3RLYH 3LKWA 1GI9B 1GJ5H 4DIIH 4AFUA 4YZUA 1LPGB 1F5LA 1TBQH 2ZZUH 2PKAB 1TNHA 2UUYA 1H8DH 1VCWA 1Y5UT 3A7YA 3LH3A 5E2OA 3RM2H 3GOVB 2P3TB 5GPIB 1BRAA 1DS2E 1V2QT 3SJ8A 1GCTC 2AIQA 3RXRA 3KL6A 4ZKSU 4GAWA 1A0HB 2BD2A 1FMGA 2WPLS 1O3AA 3UQVA 2XNIA 7GCHG 1DSTA 2ASUB 3SV9A 1GJ9B 2B7DH 3RC5A 1SQOA 2H1UA 1SG8B 1O3NA 1V2PT 4ZKNU 4J1YA 3GCNA 4LXBH 1MKXK 2P95A 4IGDA 2BX3A 3M35A 1KDQB 2WYGA 6CHAB 2YNBA 1C5RA 2BD5A 3DHKH 1W7XH 2ZDLA 4MG3A 3VPKA 1KDQA 1GMCG 1O2IA 1IQMA 3DFJA 1N8OC 1MTWA 1O3HA 3LGTA 2Z6BD 1P03A 2B0FA 2GKVE 1C1VH 2ZEBA 5AF9H 1O2YA 1LKBA 2GGVB 1O0DH 2D2DA 3BTQE 3BTEE 1Q2WA 3Q3KA 4IC5A 4MPWA 4D7GA 1TWXB 1SQAA 2GZ9A 1Z8JB 2FOFA 2IN2A 1FAXA 1FN8A 3ESTA 1HIAB 4GLYA 3QGNB 4UFDH 1MKWH 2QXIA 3U1IB 2R0KA 4B2AA 4H4FA 2FOEA 3SGQE 4TY6A 3ZVDA 3NXPA 2QN5T 3LC3A 1HIAA 4AOQA 3DUXH 2ZGXH 1C5OH 1WTGH 2WYJA 4B76A 1RTFB 1TPPA 2ALVA 5HYOA 1DY9A 2ZQ1A 4DCDA 3GCHB 1T8NA 1ZRBA 3GISB 1DUEA 2KAIB 1SLVB 1IQLA 4JZEH 2BDCA 1BMLA 1YPGH 1KIGH 1GHAG 4O97A 3VXEH 2OC7A 5TJXA 1K21H 1DLEA 2KAIA 3AASA 1DOJA 2XWBI 4YT6H 6GCHF 4DIHH 1JOUB 1C1QA 2FEQH 2PLXA 1S6HA 3GY8A 2O8LA 3D65E 4YO9A 1UK2A 1PYTC 1NO9H 2W5EA 4I8HA 2FI4E 3F9EA 4YT7H 4MQAA 1QJ6B 4BAKB 1CT2E 4VGCC 2HNTE 2P8OB 1HXFH 5IYTA 1MTNB 1OKXA 2GCTC 2EEKA 2OC0A 1AFEH 4FU9A 1WYKA 1SB1H 2J95A 3ITIA 1Z1IA 4ZKOU 1J15A 1GBLA 1P05A 2XYAA 1UTNA 3FVFB 1GBHA 4K8BA 1AO5A 3VB3A 4FUFA 4GPGA 1P3EA 2FWWA 1SOTA 1UTQA 1RTKA 4OS2A 2F9NA 1EZQA 5FPYA 2XC5A 1QA7A 1BRUP 1VJ9U 1L1JA 1ELGA 2ZU5A 1LHEH 3HPTB 1A3BH 1FLEE 1ZGIA 4FUBA 1RGQA 1PPZA 1AIXH 1WUNH 1XX9A 2ANWA 2ZHDA 1XKBC 2GP9B 5JB9S 1MD8A 3E1XB 2WPKS 1A3EH 4YOIA 1OOKB 1ETTH 1CE5A 1C4U2 1YPHC 1GJCB 1WU1A 1O2JA 1RS0A 3OTJE 1ZJKA 1FONA 2YOLA 2AYWA 3UTUH 3SU5A 3E91A 1SQTA 3KCGH 1BBRE 1DPOA 1DY8A 1XVMA 4MVNA 5JDUB 2JH6D 1QL7A 1KSNA 3V13A 3A8AA 4F4OC 1NU7B 6CHAC 2RA3A 1INCA 2R3YA 1SLUB 3UWIA 2UWLA 1IAUA 1EAXA 5PTPA 3RXJA 1GHYH 2BYAX 1F0UA 4OS5A 1TALA 1G9IE 3FP6E 4Y7BA 4I33A 2R3UA 1RRKA 1XXFA 4IMZA 1EZXC 2FOHA 4X6MA 1IQHA 5A8ZA 4JZFH 3Q76A 1QA0A 2PTNA 1H9LB 1LKAA 4Q2KA 2VWNA 1GI2A 2HLCA 3A82A 2Q6DA 1GI5A 1FPHH 3O8DA 4K69A 2G5NA 1GBEA 3A85A 4XOJA 1G2MA 3PMJA 1P2KA 2A4QA 3UREA 1NRSH 1LCYA 2F83A 2J4IA 3FZDA 2Z3DA 1UHBB 4HTCH 1GDQA 2ZI2H 2AGGX 3U9AH 5DGJA 1ELDE 1TNLA 3DFLA 5FAHA 1YYY1 1QCPA 1GI3A 1GMHG 3GICB 4U01A 1SSXA 2QA9E 1Z6JH 1TRMA 2XXLA 7LPRA 1UHBA 2FZZA 4UFFH 3LONA 5FPSA 1WTHD 2JH0D 1JRTA 1HAYB 1RTLA 1WBGB 4X6PA 1EB1H 2CV3A 3GCHC 1P2QA 1O2XA 2ZC9H 3RMOH 3KQBA 4ZHLU 5T6GA 2Z3EA 3KQDA 5TCCA 1YPJH 4ABIA 3MH5A 3MU1A 3U98H 4R0IA 1XM1A 1ANBA 3A83A 1YPEH 4THNH 1A0LA 1QFKH 1ZHPA 3MU4A 1FY3A 1HUTH 4BNRA 1TAWA 2BLOA 4DJZB 3BEIB 1GPZA 2J92A 4AFZA 1C2GA 3K6YA 1PQ5A 5G4BA 3SJKA 4FXGH 4AYVB 5HM9A 1JRSA 2P8OC 1GI4A 1QL9A 1XUFA 2AMQA 2ANKH 2G52A 3CENA 3T27A 1F2SE 2WPIS 4GCHG 1WQSA 2WPMS 1BBRK 2WINI 2QXHA 3SUGA 2SGQE 5EQQA 3T5FH 4SGBE 3PMHB 1AVXA 3ATKA 1SGFA 3VB7A 2DE8A 4OGYA 2ZWLH 2C3SA 1Y59T 1GWAA 2Y5HA 1ELBA 2P16A 2PGQB 1E0FD 1TRYA 2H5DA 2GTBA 5DP7A 2PSXA 5F8XA 1Z7KA 1G3EA 3A7TA 1QJ1B 1TA2A 1C5SA 1P06A 1P57B 2BY5X 2VB0A 3I29A 3TH4H 4CREA 4D9QA 1DSUA 3KHVA 3V7TA 4JZIA 2F9BH 1EX3A 2H5CA 4Y8YA 4CR9A 1TONA 2P94A 2ZHFH 3MFJA 3M7UA 4FUCA 2BXUH 3UIRA 1U6QA 1P0SH 3V0XA 1MZDA 1Y3VA 3TU7H 1EJNA 1P2MA 2CHAB 5TCAA 4NIVA 1JMOH 3R0FA 4BTIB 2GCHG 1G32B 4E05H 1D3DB 2EC9H 1TRNA 4B2CA 1O31A 4ZH8A 2DE9A 1A2CH 1THPB 1DVAH 1LVOA 3BTTE 1V2LT 2STBE 3EA7A 2ESTE 2BDHA 3RXSA 4UDWH 1ZMJA 1O3JA 3P17H 4WMDA 1AN1E 3A87A 1D3PB 2BDIA 4X6OA 8ESTE 5HMAA 4U32A 2ZO3H 1TNJA 2D26C 4I8JA 1ESAA 3SU0A 2HNTC 2FM2A 3GY6A 3TLOA 4Y71A 4CRFA 1KY9A 4B74A 3BTDE 2Z9KA 3A80A 1NESE 2FX6A 3DD2H 2A45B 2BLWA 3A7XA 1OSSA 2XBVA 5I46H 3B8JA 5J4QA 1BMAA 1RIWB 3RLWH 2PW8H 2ZHWH 1B0FA 4BTUB 2ZFTA 4B2BA 2FX4A 1ZMNA 3NKKA 2A5AA 2B9LA 1P2IA 1C1MA 3HK3B 1HB0B 2UUJB 1KTTB 1PPEE 1SHYA 4ISIH 1GBFA 1C9PA 4D9RA 1ZGVA 4ABHA 3SNCA 1XKAC 3UUZA 2ANMH 2ZGCA 2ODYB 2ZU1A 1ELVA 2Y5GA 1SGTA 1C2EA 1WOFA 2BTCE 1IQKA 1GVZA 1LTOA 4KTCA 4NWLA 1G36A 5DP3A 3GCTG 1BRBE 2FLBH 2W7SA 3TGKE 1W10U 3HKJB 1NTPA 3BEFB 3NK8A 4WJG2 3P95A 4IN2A 5T6FA 3GDUA 1L0ZA 5T3HA 1GBMA 3GYMA 2O9QA 2IOTA 3OYPA 5DP6A 4ZHMU 3MO6A 1HLTH 1TGSZ 4TWWA 1GGDC 1O5BB 1TQ0B 1VITH 3M7TA 1AVWA 3EQ0H 2ZTYA 4AGJA 1P3CA 2QAAA 4Z6AH 1ANEA 1LPKB 1N8OB 4ABDA 1C5MD 1SL3A 4B71A 1O2PA 3ZVCA 1QJ7B 3R3GB 1ZLRA 2QIQA 1FY8E 1BMNH 1WQVH 2QC2A 2A2QH 2TGDA 3BG8A 4ISLA 5LH8A 1SGNE 4CBOA 1AVGH 3LU9B 3T62A 1NFUA 3MTYA 1S0QA 3GDVA 2Q6FA 4Y76A 4ZMAH 1OS8A 2OCVB 5C5OA 4Y8XA 2PSYA 1AGJA 1C2DA 1GI6A 1GHZA 3KGPA 4WF8A 3PB1E 2R0LA 2BLQA 5LPEA 1GG6B 5EODA 2A1DB 2CHAC 1O2QA 1HFDA 1O39A 2VIQA 1OWIA 2Z3CA 3A81A 3EGKH 1T32A 3ZZ8A 3MU5A 8KME2 1C2LA 1HAIH 4KGAA 1ACBE 5F8TA 3P8NA 1E38B 1V6DA 2Z9IA 3FFGA 5I25A 4AFSA 5C1XA 1IQEA 4Z0KA 5C3NA 4RN6A 2WUBA 1MTVA 3KF2A 1MAYA 4BTTB 3T2NA 4ZAEA 1P02A 2SGPE 4NWKA 3AVZA 1TNIA 1XXDA 1QB1A 2F91A 1XUKA 3SNDA 1QURH 1A7SA 2H9EH 1VZQH 2QXGA 3KN2A 3W94A 3ZVEA 3LT3A 3PM3A 2C93B 4GVUA 1OP8A 1SGEE 2A4OA 2BHGA 1YBWA 2GD4B 2SGFE 1F0TA 4CRAA 1OYQA 4HI3A 5LGOA 2OP9A 1RIWC 1K9OE 1ZPBA 3M61U 1B0EA 8GCHF 1BZXE 1FN6A 3B23B 1BTPA 4R8TB 1ZHRA 1C9TA 1C5LH 1QB9A 3K65B 3RXPA 1QHRB 3AAVA 3H5CB 3Q00A 1A5HA 2AFQB 4IC6A 3ZZ3A 2BY6X 1QRXA 4Q80A 2B5TB 4NIWA 4Y8ZA 3MO9A 3URCA 1HJ8A 2JH5D 3S69A 2XC0A 1A0JA 1UCYH 1O5EH 1CHOF 1V2MT 4UEHH 4CRDA 1C5VA 1TQ7B 1T8OA 1ANDA 2FMJA 1T31A 2QF3A 3KEEA 1FDPA 1GDNA 4WVPE 1QTFA 1UVOA 1NROH 1KLIH 2CF9H 4GHQA 1EB2A 2PKAA 4CRGA 2BVSH 4RKJB 2BD8A 2C4FH 1F0SA 2HALA 2O8UA 3KIDU 3M5NA 2GT7A 4MPVA 1C1WH 4NSYA 3M3SA 3H7TA 4I7YH 4AN7A 3F9HA 3RXUA 1LVYA 1FY4A 3MNSA 1SI5H 2A32A 3P92A 4NSVA 1GHBF 1J17T 2A7CA 1M9UA 2BZAA 1IQNA 2CXVA 3SI4H 2PTCE 3TVJB 5HXFA 2Q6GA 5CHAC 5C1UA 3UR9A 1GCDA 2BD4A 1P2OA 1AMHA 7KMEH 1QIXB 5H4IB 5C5NA 5EOKA 3T29A 1V3XA 1GVLA 4Q7YA 6LPRA 1A1RA 3ENSB 1DE7H 2FLRH 1D4PB 5EPYA 2C90B 4IBLH 3FANA 5JYIA 1VJAU 3QWCH 3SUFA 3W95A 1CA0B 1MBMA 1K1PA 1TPSA 1TA6A 5EG4A 3SV6A 4MNVA 2GV6A 4CH8B 4Y0ZE 3MH4A 1GG6C 2NU1E 3VB5A 2XRCA 1V2WT 3PV4A 4JK6A 3RMNH 1K1IA 1MQ6A 3E6PH 3RXIA 1GBCA 1S5SA 4AB8A 2VH0A 2UUKB 1GI0A 1TOMH 1FY5A 3SU2A 3SUDA 2SGEE 3F68H 1ABJH 1C5QA 3SJOA 1C5XB 1ZSJA 1H8IH 3UNQA 1BTWA 2R2MB 1ETRH 1HBTH 1YCPM 4MTBA 4DW2U 1C1OA 1Y5AT 4E7NA 1SMFE 4X1PU 3M3TA 3SOSA 4MPUA 1KLJH 1YPLH 1O33A 2D1JA 3TK5A 1TBZH 3RXDA 4YLQH 4GUXA 3EA9A 1HAPH 3BIUH 2ZFRH 4ZHAA 5EW1H 3QZRA 1PQ8A 2TGAA 2BLVA 3BV9B 4DOQA 4K5ZA 3IG6B 4CHAB 1EXFA 3MMGA 2ZQ2A 3PLPA 1GMDF 4XE4A 4ABJA 3A89A 3RDZA 5A8YA 1GDUA 1O38A 2AERH 2J34A 1S82A 3QX5H 1LHFH 5F03A 3WY8A 1B5GH 3TNTA 5JB8S 3NCLA 3QZQA 2FODA 4H42U 3SJ9A 3PROA 3LJOA 2Q1JA 1OWDA 4OS1A 2H9HA 2LNCA 4X0WU 3SHCH 4K1SA 1UTLM 1HAGE 2OBQA 4DURA 1LPZB 1QB6A 4J2YB 2VIPA 3C1KA 1N1LA 1O2UA 1KXCA 4MLFB 5C1YA 1Q3XA 4FUHA 3I77A 4X8SH 2QYIA 3T26A 1GHWH 1H4WA 1O2LA 4MPXA 1EP6A 1KXAA 4UFGH 3SUEA 5GJ4B 1C1SA 1EAUA 9ESTA 2O8TA 3LC5A 1EOLA 1UTKA 5A0BA 3C27B 2CGAA 3ATMA 2XBXA 1TMTH 1AB9C 3LDXH 3QTOH 2FOCA 3LH1A 7GCHF 3TPIZ 5FPTA 5AVDA 1EAWA 1UVPA 3FP8E 5GCHG 2FI5E 2PR3A 1AUTC 1O2MA 1PYTD 4JZDH 1NN6A 1SGPE 5CMXH 3HKIB 5C2ZA 1FY1A 1NFWA 4CH2B 4A1XA 3RU4E 1V2ST 3SU6A 1UK4A 1OYTH 4IN1A 5EXLA 4K2YA 3ATWA 3E8LA 5E0JA 1GMCF 2M5TA 1F0RA 3EA8A 3ZZDA 1EATA 4OS7A 3P6ZB 3BF6H 1QBNA 1G3CA 3UNRA 1TGCA 2BY9X 1CT0E 1TNGA 5IDKA 1CA0C 5EQSA 3GDSA 2BDGA 3GY3A 1YGCH 5DP9A 2VU8E 2BZ6H 2J9NA 1C2IA 1P2JA 4IS5A 3RUOA 1C5YB 3MNCA 1FZZA 4AFQA 2FDAA 3BTKE 1PPGE 1O32A 2BDBA 2Z9GA 2ZHEH 4AX9H 4X8TH 1F5KU 1MMJN 1BRCE 1O3BA 2OLGA 4BAQB 3ZVAA 1ZTJA 3RXMA 2A5IA 1EUFA 2EI8A 2QXJA 2VWOA 4I31A 5FBIA 1WV7H 3S9CA 1PQ7A 2AIPA 1UTOA 2ALPA 2QF0A 4D8NA 1O2GH 1H1BA 4TYDA 1GL1A 3A7VA 3TH3H 3V12A 2A31A 1QRZA 3F9GA 1KXBA 2R2WU 1NY22 2A7HA 1MKXH 2B8OH 2RCEA 3QN7A 2NU4E 2VGCB 1VITG 1EJMA 4RKOB 4CHAC 5EQRA 1RD3B 1XUHA 4K1TA 4E7RG 1ZHMA 1BHXB 4TPYA 2EA3A 2STAE 3RC4A 4WWYA 3ZVFA 4YOJA 2Z9LA 1EOJA 1CQQA 3A86A 4OS4A 3SN8A 2ZU2A 1S81A 1F7ZA 4TWYA 1GGDB 1TIOA 1T8LA 3TGJE 2LPRA 1MBQA 2FPZA 1YF4A 1RFNA 4MNYA 1O3GA 3RXOA 2F9UA 1C5TA 3MH6A 4DY7B 1N6XA 5K0HA 1MU8B 2FOBA 2C8XB 1KYNA 1AKSB 1ESBA 3RMLH 3ZV9A 4BOHA 1LDTT 3OY6U 3HK6B 3GY5A 5GXPA 2ILNA 1O3DA 1NS3A 1XMNB 1AKSA 3EE0B 5JBCS 3EDXB 1ANCA 2XWAA 3DA9B 3MNXA 2BB4A 4AGKA 3D23A 1J8AA 3ZZ6A 1BIOA 1EQ9A 1C1RA 1ZSLA 4K1EA 3ZYDA 1OP2A 4E06H 1UTMA 1HJ9A 4I8GA 2G8TA 5DPAA 3AAUA 3EYDA 3SQEE 1BJVA 1P9UA 1O2NA 3E16B 3F6UH 5EW2H 2ZHQH 4K60A 1HAHH 1GJ6A 7ESTE 3KQEA 1LQDB 3VB6A 3P70B 2IJOB 1GVKB 4ZUHA 3QGJA 3GCOA 1K1NA 5JBTA 1TGBA 1VGCB 3QO6A 1UCYK 1SC8U 4X8VH 4AG2A 1O2ZA 2ZKSA 4Y10E 2XC4A 4NGAH 4QT8C 1BTYA 1SR5C 2J38A 3A88A 2G5VA 1HXEH 4A6LA 1TB6H 4ESTE 1O5AB 2Y7XA 3BTWE 3RMMH 1OXGA 1TX8A 3EAJA 2EI6A 2BQWB 1AZ8A 4FU8A 2UUFB 2CMYA 3TNSA 3ZZCA 3O8RA 1N6YA 1V2TT 3TGIE 1XUIA 2TIOA 3LJJA 1FV9A 5EPNA 1O2KA 1SBWA 4BAMB 4BXWA 2A7JA 3TK9A 2FI3E 3BTME 3RM0H 1ARCA 4KKDA 3BG4B 1AFQB 2BVRH 1UMAH 4XBBA 5DO4H 1IHTH 2ZDNA 1ELTA 5A09A 1P2NA 1OPHB 1GMHF 1TGNA 1GHXH 3ZVGA 3ZZ5A 3IITA 1O3FA 3ZZBA 1UTPA 1BTZA 2V6NA 4O3TA 1PPCE 1YP9A
chains in the Genus database with same CATH superfamily
1DXWA 2HLDD 3F2GA 1V2RT 2H2ZA 2HRVA 4AYYB 1KXEA 3MI4A 1SPJA 4ZKRU 4X2YA 5EJ1A 1KTSB 2J94A 1IOEA 1MKWK 1C5NH 1Z8GA 3I78A 2W3KA 4HGCA 1CHOG 1UK3A 3ZYEA 4O03A 4ISHH 1FUJA 2VGCC 1K22H 1ELEE 1E36B 2V3HH 2HNTF 1BMMH 5JBAS 1IQGA 4CBNA 3RXTA 3KQCA 2RDLA 3SI3H 2O8MA 1O2VA 1SLXB 2F4LA 1YLDA 1RXPA 1MABB 2M2AA 2WV5A 1TFXA 4O9VA 1J14A 4GCHF 3PMAB 1CT4E 4YM9A 1WCZA 3L6PA 1A5GH 3Q77A 1P9SA 2HVXA 5CHAB 1C2FA 3RXAA 1D6RA 3SGBE 6ESTA 1O30A 4PROA 4A7IB 2Z9JA 2HOBA 4INLA 1AWHB 1LQEA 1GBAA 1KLTA 2OTVA 2FOGA 1YCPH 1TX7A 3LGYA 5C20A 2A2XH 1S85A 2AGIX 2V0BA 1EZSC 1Z8IB 1H9IE 3E0PB 5DN6D 3U8OH 5LPRA 1QBVH 2GMTB 2P93A 1P10A 2K0QA 1BOQA 4B6FA 3F0OA 1QL8A 1LHDH 1SGYE 3PO1B 3SORA 3DCLA 5A8XA 1O3EA 1V2JT 1SGCA 4BANB 3U8TH 4DT4A 4Y11E 1EPTC 1GI7B 2QGRA 2ZCKP 4Q4LA 4FVBA 3OX7U 3VEQB 1H9HE 1XUJA 5B6OA 3FZZA 2BOKA 1O2SA 1GBKA 3MNBA 2ZDKA 4MNWA 1O37A 4NFFA 1UTJA 5AHGH 1CGJE 2KCOA 1NFXA 5F8ZA 1P8VC 3BTHE 2BXTH 2CK3D 4KTUA 2GCHF 5GDSH 1TGTA 2WPHS 2FS9A 1GJ4H 1DX5M 1LHGH 1VGCC 4UE7H 1PFXC 3VB4A 1ELAA 1BHXF 2XBYA 1W13U 2V35A 2RA0A 2C8YB 1TMBH 4WY3A 1ZRKA 2G55A 5HGGA 2AMDA 4H6TA 4U30A 2ZF0H 3F2FA 1NC6A 2GZ8A 1BBRH 1D6WA 2Y5FA 1AE5A 3RXCA 1QGFA 1FPCH 2GV7A 2OC8A 1SGRE 6GCHG 3OU0A 3TJVA 1BMFD 2FIRH 2EI7A 1DANH 1HAOH 1CGIE 3TITA 1A46H 3LGUA 5L6NH 3UOPA 1DUAA 1TNKA 1PJPA 1TYNA 2FTLE 2V3OH 4Y7AA 5FCKA 3QDZB 1O2RA 1ABIH 1C5PA 1AD8H 1G3DA 1UVTH 5JBBS 4NZQA 3TIUA 3BG4C 1MU6B 1BDAA 1AFQC 4FU7A 1L2EA 4AZ2B 1OHHD 2BQ6B 3OTPA 3OEED 2GT8A 1FQ3A 2G51A 1KXDA 3PLBA 1WDIA 1Z6EA 4M7GA 4HZHA 1LMWB 1DWEH 1UVUH 4Q7XA 1HAXB 1NBME 2AMPA 1JIMA 2ZCLP 3LIWA 3UY9A 2XTTB 3A8CA 2SNWA 1G3BA 1SVPA 1GJDB 1Y8TA 4DG4A 4I8LA 1KXFA 2TGPZ 3SJIA 4B73A 1UO6A 2JETB 1V2UT 3KYFA 5EXMA 2OC1A 2ZU3A 1O3KA 1SGDE 3S7HB 3UWJH 1W12U 1JXPA 3Q3YA 1O2OA 1QQ4A 3SGAE 1MTSA 3BEUA 1G37A 3N7DA 1HV7A 4X2WA 1YWUA 1T4VH 1E35B 2OQUA 2ZGJA 2AEIH 1HNEE 4SGAE 2QV1A 3GCTF 1THSH 1L4ZA 2ZGHA 1AB9B 2I6SA 4FVDA 4JCNA 4UD9H 3NPSA 4KELA 1HAZB 3KNXA 4ABGA 1NRRH 5EXNA 1P04A 4Y79A 1TABE 3RXBA 3K9XB 3LPRA 1GJ7B 2FOAA 1YLCA 4X2VA 1QNJA 3NWUA 1YC0A 2RG3A 1XVOA 2G4UA 1L1GA 3H7OA 2FYQA 3ODDA 3SO3A 2FESH 4X8UH 1VR1H 2W26A 5HKKD 1CGHA 3O8CA 2GMTC 1HPGA 2BQ7B 3STJA 3PO1C 1NT1A 2NWNA 1OWJA 1D9IA 1FIZA 2P3UB 3LGIA 2VVVA 1C1PA 5FHTA 3U69H 2ZGBH 4KP0A 3VGCB 3SV7A 1HGTH 1TX6A 1D3QB 3HGPA 4U2WA 2P3FH 1GBIA 2BDAA 4I32A 1AE8H 5HIZA 1ZOMA 4X2XA 2VNTA 1FJSA 1ZR0A 4NA7A 4X1RU 1JWTA 2VIDA 4KTSA 3FO8D 4ZROA 5BRRE 1QBOA 3TH2H 3SU1A 1BT7A 4B6EA 2QY0B 1VCPA 1TPAE 3K2UA 1CO7E 2PFEA 1O2HA 2ULLA 2BY8X 4K3JA 3F0PA 3A7ZA 3MO3A 2BVXH 4X1NU 2K1QA 1S6FA 2XBWA 2ZP0H 1TE0A 1Y5BT 4JYUH 1MAXA 3ATIA 5C67A 2OD3B 2YNAA 3SZEA 4IW4E 1O3PB 1BTUA 1O5DH 2GX4A 3SBKA 1FIWA 5HIYA 1S0RA 2TPIZ 4FUIA 3RXKA 4X6NA 1TBRH 1ZTKA 1K1JA 1O34A 2VIWA 4INKA 1W8BH 1E34B 2VH6A 4XSKU 5L2ZH 1SOZA 5DJ7A 2VINA 4WH6A 3ODFA 4FUGA 2G81E 3A8DA 1MTUA 3NZIA 2FYRA 3PYHA 4ACAA 5ESTE 3RP2A 3QTVH 3KYGA 3ZIAD 1DITH 5L2YH 3M7QA 2VIOA 4ABEA 2SNVA 4UONA 1E1QD 1AZZA 2BD7A 2ZCHP 3DSOA 1GJ8B 1S84A 2JETC 2VVCA 2A0QB 2TRMA 2TGTA 1GJAB 4FOUC 3MU8A 1C2KA 2J5UA 2WHXA 5GIBA 5A0CA 1PPFE 3M37A 1W3CA 1MCTA 3Q3XA 1K2I1 5ABWA 1V2VT 1EASA 1P01A 1KMHB 2XW9A 1ZSKA 1MH0A 3M5MA 4WMEA 5E8EH 2CJIA 1C5WB 3M5OA 1IQFA 1TOCB 3A84A 3M3VA 1A5IA 2ZFSA 1QZ8A 1SLWB 1CBWB 2LP6A 2PUXB 2ZU4A 3QK1A 1W7GH 2GZ7A 1EP5A 3SZNA 3P8FA 5ETXA 4JK5A 1BQYA 1DT2A 2G4TA 1DLKB 1CHGA 4H6SB 1AWFH 3TK6A 1HRTH 2Y80A 4TY7A 4BAHB 4AB9A 3QLPH 1OWHA 1MQ5A 4LOYH 1WXRA 1V2OT 4FUJA 1C5ZB 3CP7A 1NM6A 1G2LA 1F92A 3D49H 1AY6H 1Z8RA 4K8YA 4AG1A 5A2MH 1LHCH 2D8WA 1BA8B 3PMBB 2BM2A 1T7CA 2BMGB 4I8KA 3RC6A 3VGCC 4XBCA 1O3LA 3D62A 5K7RA 2WPJS 4OGXA 1GI1A 1V2NT 3BN9A 5FX5A 3LGWA 1SGIB 1DWDH 2Y7ZA 1YM0A 1YCPK 2P59A 1ELCA 3PTBA 3GY2A 1C1TA 1P11E 3JZ1B 1DWBH 1W0YH 1UCYE 3SHAH 4F49A 3TJNA 5T6DA 3ZZAA 1C4Y2 1OX1A 3MWIU 3L3TA 2J2UA 1Z71A 2BDYA 1BITA 2GVFA 5FX6A 1HJAB 1GHAF 1O3MA 3T25A 4ISNA 2OQ5A 3UFAA 3VFEA 3SU4A 1UW7A 1OWEA 4ASHA 1RJXB 1V2KT 3IWMA 3SV2H 5EU8A 2HPPH 3CS0A 4ZXYH 4Q7ZA 3RXHA 3LOXA 1WSSH 1FI8A 4NFEA 3M36A 1BTXA 1YKTA 3S9BA 2A4RA 3E90B 2AGEX 1FAKH 3U1JB 4A1VA 4FUEA 2I6QA 1ZPZA 1C1UH 2VWLA 1FNIA 2FXRA 3OE7D 1NZQH 2YMSD 4XBDA 4JYVH 4RSPA 2QCYA 2F9VA 1GI8B 1NRQH 1ZPCA 1MD7A 4GHTA 4NG9H 3SQHE 1MTNC 3GYLB 1QR3E 1AHTH 1CU1A 4DVAU 2W3IA 4WH8A 4YTAA 1G30B 2BD3A 2F3CE 1O2TA 3RXVA 5E2PA 4B1TA 2ZDAH 4NIXA 4B75A 1BB0B 4Y0YE 1ESTA 2PUQH 1Q31A 1EJAA 2ZFPH 1LO6A 2BY7X 1C2MA 3ELAH 1K1LA 1K1MA 1NPMA 2DUCA 3QUMP 1SHHB 1HCGA 1MZAA 1ZZZA 1VCQA 5E0GA 4WXIA 1GL0E 3PLKA 4TSFD 3RXLA 3UOUA 1E37B 4HFPB 3S7KB 5FXLA 2GJGA 3ZZ4A 1AI8H 2BOHB 1EPTB 3BTFE 4WMFA 1BJUA 2FP7B 5DK1A 1CSOE 1SGQE 2C8ZB 2PWXA 3AW1A 2THFB 5CDFE 2ZFQH 1ELFA 3MOCA 1SFIA 3SNBA 4ZXXH 3MU0A 3SNAA 1EPTA 1NFYA 3GY4A 5F6MA 5IK2D 1B7XB 1AUJA 3HGNA 3SV8A 4M9FA 1MCVA 4NA8A 2NU2E 1GHVH 3UQOA 2VVUA 2PKSB 1A61H 5L30H 2VIVA 1O35A 4Q63A 2ZTZA 3STIA 1C4V2 2OINA 2WV4A 4UFEH 5DP4A 1CBWC 1CA8B 2A5KA 4YLUA 1GBBA 4BAOB 1T8MA 5GWZA 5SGAE 5BPEA 5GCHF 2KM0A 2ZA5A 1ORFA 3ZVBA 4ASUD 1SGFG 4FUDA 5EGMA 4LK4A 2ZPQA 1LVMA 1JBUH 1Y3YA 2HGTH 2NU3E 4ISOA 4CRBA 4ABAA 2F9PA 5KEDA 2W7UA 1W2KH 1Y3WA 2XCNA 1EZUC 1GJBB 2H6MA 2O8WA 2UWPA 1JIRA 4WXVA 3ZZ9A 2SFAA 2HWLB 1SFQB 1K28D 2OXSA 4BXSA 3OY5U 1IHSH 3SNEA 4NCYA 3O8BA 1DWCH 1NRPH 2V7QD 2OUAA 2Y81A 1Y3XA 1TPOA 2FS8A 5A0AE 1DM4B 2FO9A 3FP7E 2W6ID 3UR6A 4DT7B 4A5TS 2VWMA 2ZPSA 4MNXA 8GCHG 4RI0A 3UNSA 1C1NA 1XUGA 1NRNH 3RU4T 3GY7A 1TMUH 2GDEH 1NU9A 1PQAA 2A4GA 1O2WA 1HAVB 2BD9A 1PPBH 1W14U 1HYLA 2J98B 3DT0H 2NU0E 2SGAA 3L33A 1HJAC 1THRH 3E3TA 3T28A 4NA9H 5DP8A 2IPHA 4LZ1H 3RXEA 1DDJA 1HAVA 3TJUA 1EKBB 3VXFH 2J98A 3U8RH 1L1NA 3PTNA 1O36A 1EAIA 1WAYB 2JKHA 1GBJA 2F9OA 2SGDE 3P8GA 4JYTA 4XFQA 3N7OA 2WUCA 1ETSH 1J9CH 2ZPRA 5ESBA 1VITF 2CN0H 1GCTB 2HPQH 2VJ1A 1IQJA 2TBSA 1GBDA 5FBEA 1DXPA 2JIZD 3P8OA 2ZECA 2PHBA 2AH4X 1LVBA 3V3MA 2XCFA 3TJOA 3MYWA 1AQ7A 1Z1JA 3B9FH 1O5GH 1ZJDA 5CE1A 2WV9A 3SYJA 1GHBG 1QQUA 1O3OA 4O3UA 3SW2B 1T4UH 1C2HA 4X1QU 4IMQA 1A4WH 1CVWH 1C2JA 2PGBB 2ANYA 1AU8A 3UB0A 2GDDA 2Y6TA 5DP5A 5LPFA 2KX4A 4D76A 3JZ2B 3ZV8A 2AS9A 1BTHH 3F1SB 3BTGE 5DKMA 1IQIA 1QRWA 4GSOA 2ODPA 2H9TH 1H8ED 3K6ZA 2Z94A 1GBTA 2G00A 1SKYE 3PWBA 1P12E 3F9FA 1TLDA 1DICA 1YPKH 4NIYA 4NZLA 3M5LA 4OS6A 3BIVH 3VG8A 2FOMB 4CRCA 2Z7FE 3MHWU 1OP0A 2PKSC 2ZDMA 3RXFA 4JMYA 2CF8H 3SU3A 4INHA 4A1TA 1ZMLA 3PWCA 1YPHE 1W11U 3MH7A 3OSYA 3H09A 2OBOA 5FCRA 1ZTLA 2ZG0H 4DGJA 4ABBA 2EY4C 5JPMH 1S83A 4F48B 3S9AA 1K1OA 4MDSA 1YPMH 3N7EA 2PV9B 4LZ4B 3RXGA 1QY6A 1X7AC 3CS7A 1C5UA 3FAOA 1P09A 3G01A 9LPRA 3HATH 1O3IA 5J4SA 1BCUH 2FTMA 1PPHE 5AFYH 3RU4D 1UVSH 3ATLA 1L4DA 5AFZH 1J16A 4Y6DA 2ZDVH 1ARBA 3LGVA 4YOGA 4YESB 4D7FA 4X1SU 2ZFFH 1GMDG 1O3CA 1UJ1A 8LPRA 1O5CB 4XDEA 4AORA 2ZNKH 2ZIQH 4VGCB 1MUEB 3UPEA 3AW0A 5DG6A 3BSQA 3ZZ7A 2GCTB 2UWOA 1BUIA 3RXQA 3NUMA 4OM9A 1HDTH 5DSFA 3S0NA 4TPIZ 2Y82A 5HM2A 1FXYA 1F5RA 4JZ1A 4A92A 1D3TB 4ABFA 4CR5A 1W0ZU 4P00A 1ID5H 1DFPA 3URDA 3E0NB 2ZTXA 5E0HA 1OWKA 2R9PA 1O5FH 1ZYOA 3A8BA 3A7WA 2ODQA 1Y3UA 2BX4A 2C8WB 3RLYH 3LKWA 1GI9B 3FN8A 1GJ5H 4DIIH 4AFUA 5C0UA 4YZUA 1LPGB 1F5LA 1TBQH 2ZZUH 2PKAB 1TNHA 2UUYA 1H8DH 1VCWA 1Y5UT 3A7YA 3LH3A 5E2OA 3RM2H 3GOVB 2P3TB 5GPIB 1BRAA 1DS2E 1V2QT 3SJ8A 1GCTC 2AIQA 2WSSD 3RXRA 3KL6A 4ZKSU 4GAWA 1A0HB 2BD2A 1FMGA 1YY3A 2WPLS 1O3AA 3UQVA 2XNIA 7GCHG 1DSTA 2ASUB 3SV9A 1GJ9B 2B7DH 3RC5A 1SQOA 2H1UA 5KGOA 1SG8B 1O3NA 1V2PT 4ZKNU 3UAIC 4J1YA 3GCNA 4LXBH 1MKXK 2P95A 4IGDA 2BX3A 3M35A 1KDQB 2WYGA 6CHAB 2XOKD 2YNBA 1C5RA 2BD5A 3DHKH 1W7XH 2ZDLA 4MG3A 3VPKA 1KDQA 1GMCG 1O2IA 1IQMA 3DFJA 1N8OC 1MTWA 1O3HA 3LGTA 2Z6BD 1P03A 2B0FA 2GKVE 1YLNA 1C1VH 2ZEBA 5AF9H 1O2YA 1LKBA 2GGVB 4RT0A 1O0DH 4F55A 2D2DA 3BTQE 3BTEE 1Q2WA 2YMSB 3NRLA 3Q3KA 2L74A 4IC5A 4MPWA 4D7GA 1TWXB 1SQAA 2GZ9A 1Z8JB 2FOFA 5B6LA 2IN2A 1FAXA 1FN8A 1E1RD 3ESTA 1HIAB 4GLYA 3QGNB 4UFDH 1MKWH 2QXIA 3U1IB 2R0KA 4B2AA 4H4FA 2FOEA 3SGQE 4TY6A 3ZVDA 3NXPA 2QN5T 3LC3A 1HIAA 4AOQA 3DUXH 2ZGXH 1C5OH 1WTGH 2WYJA 4B76A 4FETA 1RTFB 1TPPA 2ALVA 5HYOA 1DY9A 2ZQ1A 4DCDA 3GCHB 1T8NA 1ZRBA 3GISB 1DUEA 2KAIB 1SLVB 1IQLA 4JZEH 2BDCA 1BMLA 1YPGH 1KIGH 1GHAG 4O97A 3VXEH 2OC7A 5TJXA 1K21H 1DLEA 2KAIA 3AASA 1DOJA 2XWBI 4YT6H 6GCHF 4DIHH 1JOUB 1C1QA 2FEQH 2PLXA 1S6HA 3GY8A 2O8LA 3D65E 4YO9A 1UK2A 1PYTC 1NO9H 2W5EA 4I8HA 2FI4E 3F9EA 4YT7H 4MQAA 1QJ6B 5CHBA 1CT2E 4VGCC 4BAKB 2HNTE 2P8OB 1HXFH 5IYTA 1MTNB 1OKXA 2GCTC 2EEKA 2OC0A 1AFEH 4FU9A 1WYKA 1SB1H 2J95A 3ITIA 1Z1IA 4ZKOU 1J15A 1GBLA 1P05A 2XYAA 1UTNA 3FVFB 1GBHA 4K8BA 1AO5A 3VB3A 2RDEA 4FUFA 4GPGA 1P3EA 2FWWA 1SOTA 1UTQA 1RTKA 4OS2A 2F9NA 1EZQA 5FPYA 2XC5A 1QA7A 1BRUP 1VJ9U 1L1JA 1ELGA 2ZU5A 1LHEH 3HPTB 1A3BH 1FLEE 1ZGIA 3F2HA 4FUBA 1RGQA 1PPZA 1AIXH 1WUNH 1XX9A 2ANWA 2ZHDA 1XKBC 2GP9B 5JB9S 1MD8A 3E1XB 2WPKS 1A3EH 4YOIA 1OOKB 1ETTH 1CE5A 1C4U2 1YPHC 1GJCB 1WU1A 1O2JA 1RS0A 3OTJE 1ZJKA 1FONA 2YOLA 2AYWA 2IJD1 3UTUH 3SU5A 3E91A 1SQTA 3KCGH 1BBRE 1DPOA 1DY8A 4I86A 1XVMA 4MVNA 5JDUB 2JH6D 1QL7A 2HVYB 1KSNA 3V13A 3A8AA 4F4OC 1NU7B 6CHAC 2RA3A 1INCA 2R3YA 5EJLA 1SLUB 3UWIA 2UWLA 1IAUA 1EAXA 5PTPA 3RXJA 1GHYH 2BYAX 1F0UA 4OS5A 1TALA 1G9IE 3FP6E 3WW7A 4Y7BA 4I33A 3DSPA 2R3UA 1RRKA 1XXFA 4IMZA 1EZXC 2FOHA 4X6MA 1IQHA 5A8ZA 4JZFH 3Q76A 1QA0A 2PTNA 1H9LB 1LKAA 4Q2KA 2YMSC 2VWNA 1GI2A 2HLCA 3A82A 2Q6DA 1GI5A 1FPHH 3O8DA 4K69A 2G5NA 1COWD 2JDID 1GBEA 3A85A 4XOJA 1G2MA 3PMJA 1P2KA 2A4QA 3UREA 1NRSH 1LCYA 2F83A 2J4IA 3FZDA 2Z3DA 1UHBB 4HTCH 1GDQA 2ZI2H 2AGGX 3U9AH 2QF4A 5DGJA 5KECA 1ELDE 1TNLA 3DFLA 5FAHA 1YYY1 1QCPA 1GI3A 1GMHG 3GICB 4U01A 1SSXA 2QA9E 1Z6JH 1TRMA 2F43B 2XXLA 7LPRA 1UHBA 2FZZA 4UFFH 3LONA 5FPSA 1WTHD 2JH0D 1JRTA 1HAYB 1RTLA 1WBGB 4X6PA 1EB1H 2CV3A 3GCHC 1P2QA 1O2XA 2ZC9H 3RMOH 3KQBA 4ZHLU 5T6GA 2Z3EA 3FKSD 3KQDA 5TCCA 1YPJH 4ABIA 3MH5A 3MU1A 3U98H 4R0IA 1XM1A 1ANBA 3A83A 1YPEH 4THNH 2XNDD 1A0LA 1QFKH 1ZHPA 3MU4A 1FY3A 1HUTH 4BNRA 1TAWA 2BLOA 4DJZB 3BEIB 1GPZA 2J92A 4AFZA 1C2GA 3K6YA 1PQ5A 5G4BA 3SJKA 4FXGH 4AYVB 5HM9A 3OAAD 1JRSA 2P8OC 1GI4A 1QL9A 1XUFA 2AMQA 2ANKH 2G52A 3CENA 3T27A 1F2SE 2WPIS 4GCHG 1WQSA 2WPMS 1BBRK 2WINI 3WWFA 1EFRD 2QXHA 3SUGA 2SGQE 5EQQA 3T5FH 4SGBE 3PMHB 2JJ2D 1AVXA 3ATKA 1SGFA 2OK5A 3VB7A 2DE8A 4OGYA 2ZWLH 2C3SA 1Y59T 1GWAA 3AK5A 2Y5HA 1ELBA 2P16A 2PGQB 4Z1MD 1E0FD 3U28C 1TRYA 2H5DA 2GTBA 5DP7A 2PSXA 5F8XA 1Z7KA 1NBMD 5EJZA 1G3EA 3A7TA 1QJ1B 1TA2A 1C5SA 1P06A 1P57B 2BY5X 2VB0A 3I29A 3TH4H 4CREA 4D9QA 1DSUA 3KHVA 3V7TA 2K8IA 4JZIA 1W0KD 2F9BH 1EX3A 2H5CA 4Y8YA 4CR9A 1TONA 2P94A 2ZHFH 3MFJA 3M7UA 4FUCA 2BXUH 3UIRA 1U6QA 1P0SH 3V0XA 1MZDA 1Y3VA 3TU7H 1EJNA 1P2MA 2CHAB 5TCAA 4NIVA 1JMOH 3R0FA 4BTIB 2GCHG 1G32B 4E05H 1D3DB 2EC9H 1TRNA 4B2CA 1O31A 4ZH8A 2DE9A 1A2CH 1THPB 1DVAH 3FOAA 1LVOA 3BTTE 1V2LT 2STBE 3EA7A 2ESTE 2BDHA 3RXSA 4UDWH 5GNDA 1ZMJA 1O3JA 3P17H 4WMDA 1AN1E 3A87A 1D3PB 2BDIA 4X6OA 4AC9A 8ESTE 5HMAA 4U32A 2ZO3H 1TNJA 2D26C 4I8JA 1ESAA 3SU0A 2HNTC 2FM2A 3GY6A 3TLOA 4Y71A 3W1EA 4CRFA 1KY9A 4B74A 3BTDE 2Z9KA 3A80A 1NESE 2FX6A 3DD2H 2A45B 2BLWA 3A7XA 2LELA 1OSSA 2XBVA 5I46H 3B8JA 5J4QA 1BMAA 1RIWB 5F53A 3RLWH 2PW8H 2ZHWH 1B0FA 4BTUB 2ZFTA 4B2BA 2FX4A 1ZMNA 3NKKA 2A5AA 2B9LA 1P2IA 1C1MA 3HK3B 3N99A 4TT3D 1HB0B 2PP6A 2UUJB 1KTTB 1PPEE 1SHYA 4ISIH 1GBFA 2RFKC 1C9PA 4D9RA 1ZGVA 4ABHA 3SNCA 3GS9A 1XKAC 3UUZA 2ANMH 2ZGCA 2ODYB 2ZU1A 1ELVA 3F3BA 2Y5GA 1SGTA 1C2EA 1WOFA 2BTCE 1IQKA 1GVZA 1LTOA 4KTCA 4NWLA 4YXWD 1G36A 5DP3A 3GCTG 1BRBE 2FLBH 2W7SA 3TGKE 1W10U 3HKJB 4XRNA 1NTPA 3BEFB 3NK8A 4WJG2 2AHME 3P95A 4IN2A 5T6FA 3GDUA 1L0ZA 5T3HA 1GBMA 3GYMA 2O9QA 2IOTA 3OYPA 5DP6A 4ZHMU 3MO6A 1HLTH 4XD7D 1TGSZ 4TWWA 1GGDC 1O5BB 1TQ0B 1VITH 3M7TA 1AVWA 3EQ0H 2ZTYA 4AGJA 1P3CA 2QAAA 4Z6AH 1ANEA 1LPKB 1N8OB 4ABDA 1C5MD 1SL3A 3CNRA 4B71A 1O2PA 3ZVCA 1QJ7B 3R3GB 1ZLRA 2QIQA 1FY8E 1BMNH 1WQVH 2QC2A 2A2QH 2TGDA 3BG8A 4ISLA 2W6JD 5LH8A 1SGNE 4CBOA 1AVGH 3LU9B 3T62A 1NFUA 3MTYA 1S0QA 3GDVA 2Q6FA 4Y76A 4ZMAH 1OS8A 2OCVB 5C5OA 4Y8XA 2PSYA 1AGJA 1C2DA 1GI6A 1GHZA 2KR7A 3KGPA 4WF8A 3PB1E 2R0LA 2BLQA 5LPEA 1GG6B 5EODA 2A1DB 2CHAC 1O2QA 1HFDA 1O39A 2VIQA 1OWIA 2Z3CA 5C94A 3A81A 3EGKH 1T32A 3ZZ8A 3MU5A 8KME2 1C2LA 1HAIH 4KGAA 1ACBE 5F8TA 3P8NA 1E38B 1V6DA 2Z9IA 3FFGA 5I25A 4AFSA 5C1XA 1IQEA 4Z0KA 5C3NA 4RN6A 2WUBA 1MTVA 3KF2A 1MAYA 4BTTB 3T2NA 4ZAEA 1P02A 2SGPE 4NWKA 3AVZA 1TNIA 1XXDA 1QB1A 2F91A 1XUKA 3SNDA 1QURH 1A7SA 2H9EH 1VZQH 2QXGA 3KN2A 3W94A 3ZVEA 3LT3A 3PM3A 2C93B 4GVUA 1OP8A 1SGEE 2A4OA 2BHGA 1YBWA 2GD4B 2SGFE 1F0TA 4CRAA 1OYQA 4HI3A 5LGOA 2OP9A 1RIWC 1K9OE 1ZPBA 3M61U 1B0EA 8GCHF 1BZXE 1FN6A 3PV5A 3B23B 1BTPA 4R8TB 1ZHRA 1C9TA 4ACBA 1C5LH 1QB9A 3K65B 3RXPA 1QHRB 3AAVA 3H5CB 3Q00A 1A5HA 2AFQB 4IC6A 3ZZ3A 2BY6X 1QRXA 4Q80A 2B5TB 4NIWA 4Y8ZA 3MO9A 3URCA 1HJ8A 2JH5D 3S69A 2XC0A 1A0JA 1UCYH 1O5EH 1CHOF 1V2MT 4UEHH 4CRDA 1C5VA 1TQ7B 1T8OA 1ANDA 2EQNA 2FMJA 1T31A 2QF3A 3KEEA 1FDPA 3PV2A 1GDNA 4WVPE 1QTFA 1UVOA 1NROH 1KLIH 2CF9H 4GHQA 1EB2A 2PKAA 4CRGA 2BVSH 4RKJB 2BD8A 2C4FH 1F0SA 2HALA 2O8UA 3KIDU 3M5NA 2GT7A 4MPVA 1C1WH 4NSYA 3M3SA 3H7TA 4I7YH 4AN7A 3F9HA 4RT1A 3RXUA 1LVYA 1FY4A 3MNSA 1SI5H 2A32A 3P92A 4NSVA 1GHBF 1J17T 2A7CA 1M9UA 3OEHD 2BZAA 1IQNA 2CXVA 3SI4H 2PTCE 3TVJB 5HXFA 2Q6GA 5CHAC 5C1UA 3UR9A 1GCDA 2BD4A 1P2OA 1AMHA 7KMEH 3PRDA 1QIXB 5H4IB 5C5NA 2JJ1D 5EOKA 1V3XA 3PRBA 3T29A 1GVLA 4Q7YA 6LPRA 1A1RA 3ENSB 1DE7H 2FLRH 1D4PB 5EPYA 2C90B 4IBLH 3FANA 5JYIA 1VJAU 3EE7A 3QWCH 3SUFA 3W95A 1CA0B 1MBMA 1K1PA 2WPDD 5EIYA 1TPSA 1TA6A 5EG4A 3SV6A 4MNVA 2GV6A 4CH8B 4Y0ZE 3MH4A 1GG6C 2NU1E 3VB5A 2XRCA 1V2WT 3PV4A 4JK6A 3RMNH 1K1IA 1MQ6A 3E6PH 3RXIA 1GBCA 1S5SA 4AB8A 2VH0A 2UUKB 2L6OA 1GI0A 1TOMH 1FY5A 2KCPA 3SU2A 3SUDA 2SGEE 3F68H 1ABJH 1C5QA 3SJOA 1C5XB 1ZSJA 1H8IH 3UNQA 1BTWA 2R2MB 1ETRH 1HBTH 1YCPM 4MTBA 4DW2U 4ZCNA 1C1OA 1Y5AT 4E7NA 1SMFE 4X1PU 3M3TA 3SOSA 2VBCA 4MPUA 1KLJH 1YPLH 1O33A 2D1JA 3TK5A 1TBZH 3RXDA 4YLQH 4GUXA 3EA9A 1HAPH 3BIUH 2ZFRH 4ZHAA 5EW1H 3QZRA 1PQ8A 2TGAA 2BLVA 3BV9B 4DOQA 4K5ZA 3IG6B 4CHAB 1EXFA 3MMGA 2ZQ2A 3PLPA 1GMDF 4XE4A 4ABJA 3A89A 3RDZA 5A8YA 1GDUA 1O38A 2WZQA 2AERH 2J34A 1S82A 3QX5H 1LHFH 5F03A 3WY8A 1B5GH 1S6LA 3TNTA 5JB8S 3NCLA 3QZQA 2FODA 4H42U 3SJ9A 3PROA 3LJOA 2Q1JA 1OWDA 4OS1A 2H9HA 2LNCA 4X0WU 3SHCH 4K1SA 1UTLM 1HAGE 2OBQA 4DURA 1LPZB 1QB6A 4J2YB 2VIPA 3C1KA 1N1LA 1O2UA 4HG6A 1KXCA 4MLFB 5C1YA 1Q3XA 4FUHA 3I77A 4X8SH 2QYIA 3T26A 1GHWH 1H4WA 1O2LA 4MPXA 1EP6A 1KXAA 4UFGH 3SUEA 5GJ4B 1C1SA 1EAUA 9ESTA 2O8TA 3LC5A 1EOLA 1UTKA 5A0BA 3C27B 2CGAA 3ATMA 2XBXA 1TMTH 1AB9C 3LDXH 3QTOH 2FOCA 1E79D 3LH1A 7GCHF 3TPIZ 5FPTA 5AVDA 1EAWA 1UVPA 3FP8E 5GCHG 3WWBA 2FI5E 2PR3A 1AUTC 1O2MA 1PYTD 4JZDH 1NN6A 1SGPE 5CMXH 3HKIB 5C2ZA 1FY1A 1NFWA 1SQRA 4A1XA 4CH2B 3RU4E 1V2ST 3SU6A 1UK4A 1OYTH 4IN1A 5EXLA 4K2YA 3ATWA 3E8LA 5E0JA 1GMCF 2M5TA 1F0RA 3EA8A 3ZZDA 1EATA 4OS7A 3P6ZB 3BF6H 1QBNA 1G3CA 3UNRA 1TGCA 2BY9X 1CT0E 1TNGA 5IDKA 1CA0C 5EQSA 3GDSA 2BDGA 3GY3A 1YGCH 5DP9A 2VU8E 2BZ6H 2J9NA 1C2IA 1P2JA 4IS5A 3RUOA 5FL7D 1C5YB 2QF5A 3MNCA 1FZZA 4AFQA 2FDAA 3BTKE 1PPGE 1O32A 2BDBA 2Z9GA 2ZHEH 4AX9H 4X8TH 3DSGA 1F5KU 1MMJN 2KFWA 1BRCE 1O3BA 2OLGA 5C0TA 4BAQB 3ZVAA 1ZTJA 3RXMA 2A5IA 1EUFA 2EI8A 2QXJA 2VWOA 4I31A 5FBIA 1WV7H 3S9CA 1PQ7A 2AIPA 1UTOA 2ALPA 2QF0A 4D8NA 1O2GH 1H1BA 4TYDA 1GL1A 3A7VA 3TH3H 3V12A 2A31A 1QRZA 3F9GA 1KXBA 2R2WU 1NY22 2A7HA 1MKXH 2B8OH 2RCEA 3QN7A 2NU4E 2VGCB 1VITG 1EJMA 4RKOB 4CHAC 5EQRA 1RD3B 1XUHA 4K1TA 4E7RG 1ZHMA 1BHXB 4TPYA 2EA3A 2STAE 3RC4A 4WWYA 3ZVFA 4YOJA 2Z9LA 1EOJA 1CQQA 3A86A 4OS4A 3SN8A 2ZU2A 3KQ5A 1S81A 1F7ZA 4TWYA 1GGDB 1TIOA 1T8LA 3TGJE 2LPRA 1MBQA 2FPZA 3OFND 1YF4A 1RFNA 4MNYA 1O3GA 3RXOA 2F9UA 1K0HA 1FX0B 1C5TA 2V3MA 3MH6A 4DY7B 1N6XA 5K0HA 1MU8B 2FOBA 2C8XB 1KYNA 1AKSB 1ESBA 3RMLH 3ZV9A 4BOHA 1LDTT 2IPQX 3OY6U 3HK6B 3GY5A 5GXPA 2ILNA 1O3DA 1NS3A 1XMNB 1AKSA 2KCYA 3EE0B 5JBCS 3EDXB 1ANCA 2XWAA 3DA9B 3MNXA 2BB4A 4AGKA 3D23A 1J8AA 3ZZ6A 1BIOA 1EQ9A 1C1RA 4P02A 1ZSLA 4K1EA 3ZYDA 1OP2A 4E06H 1UTMA 1HJ9A 4I8GA 2G8TA 5DPAA 3AAUA 3EYDA 3SQEE 1BJVA 1P9UA 1O2NA 3E16B 3F6UH 5EW2H 2ZHQH 4K60A 1HAHH 1GJ6A 7ESTE 3KQEA 1LQDB 3VB6A 3P70B 2IJOB 1GVKB 4ZUHA 3QGJA 3GCOA 1K1NA 5JBTA 5T1VA 1TGBA 1VGCB 3QO6A 3MQKC 1UCYK 1SC8U 4X8VH 4AG2A 1O2ZA 2ZKSA 4Y10E 2XC4A 4NGAH 4QT8C 1BTYA 1SR5C 2J38A 1W0JD 3A88A 2G5VA 1HXEH 4A6LA 1TB6H 4ESTE 1O5AB 2Y7XA 2J97A 3BTWE 3RMMH 1OXGA 1TX8A 3EAJA 2EI6A 2BQWB 2KCAA 1AZ8A 4FU8A 2UUFB 2CMYA 3TNSA 3ZZCA 3O8RA 1N6YA 1V2TT 3TGIE 1XUIA 2TIOA 3LJJA 1FV9A 5EPNA 1O2KA 1SBWA 4BAMB 4BXWA 1H8HD 2A7JA 3TK9A 2FI3E 3BTME 5C17A 3RM0H 1ARCA 4KKDA 2KZ4A 3BG4B 1AFQB 2BVRH 1UMAH 4XBBA 5DO4H 1IHTH 2ZDNA 1ELTA 5A09A 1VKYA 1P2NA 1OPHB 1GMHF 1TGNA 1GHXH 3ZVGA 3ZZ5A 2QE7D 3IITA 1O3FA 3ZZBA 1UTPA 1BTZA 2V6NA 4O3TA 1PPCE 1YP9A
chains in the Genus database with same CATH topology
1DXWA 1V2RT 2H2ZA 2HRVA 4AYYB 1KXEA 3MI4A 1SPJA 4ZKRU 4X2YA 1KTSB 2J94A 1IOEA 1MKWK 1C5NH 1Z8GA 3I78A 2W3KA 4HGCA 1CHOG 1UK3A 3ZYEA 4O03A 4ISHH 1FUJA 2VGCC 1K22H 1ELEE 1E36B 2V3HH 2HNTF 1BMMH 5JBAS 1IQGA 4CBNA 3RXTA 3KQCA 2RDLA 3SI3H 2O8MA 1O2VA 1SLXB 2WV5A 1YLDA 1RXPA 1TFXA 4O9VA 1J14A 4GCHF 3PMAB 1CT4E 4YM9A 1WCZA 3L6PA 1A5GH 3Q77A 1P9SA 2HVXA 5CHAB 1C2FA 3RXAA 1D6RA 3SGBE 6ESTA 1O30A 4PROA 4A7IB 2Z9JA 2HOBA 4INLA 1AWHB 1LQEA 1GBAA 1KLTA 2OTVA 2FOGA 1YCPH 1TX7A 3LGYA 5C20A 2A2XH 1S85A 2AGIX 2V0BA 1EZSC 1Z8IB 1H9IE 3E0PB 5LPRA 3U8OH 1QBVH 2GMTB 2P93A 1P10A 1BOQA 1QL8A 1LHDH 1SGYE 3PO1B 3SORA 5A8XA 1O3EA 1V2JT 1SGCA 4BANB 3U8TH 4Y11E 1EPTC 1GI7B 2QGRA 2ZCKP 4FVBA 3OX7U 3VEQB 1H9HE 1XUJA 5B6OA 3FZZA 2BOKA 1O2SA 1GBKA 3MNBA 2ZDKA 4MNWA 1O37A 4NFFA 1UTJA 5AHGH 1CGJE 1NFXA 5F8ZA 1P8VC 3BTHE 2BXTH 4KTUA 2GCHF 5GDSH 1TGTA 2WPHS 2FS9A 1GJ4H 1DX5M 1LHGH 1VGCC 4UE7H 1PFXC 3VB4A 1ELAA 1BHXF 2XBYA 1W13U 2V35A 2RA0A 2C8YB 1TMBH 4WY3A 1ZRKA 2G55A 5HGGA 2AMDA 4H6TA 4U30A 2ZF0H 1NC6A 2GZ8A 1BBRH 1D6WA 2Y5FA 1AE5A 3RXCA 1QGFA 1FPCH 2GV7A 2OC8A 1SGRE 6GCHG 3OU0A 3TJVA 2FIRH 2EI7A 1DANH 1HAOH 1CGIE 3TITA 1A46H 3LGUA 5L6NH 3UOPA 1DUAA 1TNKA 1PJPA 1TYNA 2FTLE 2V3OH 4Y7AA 5FCKA 3QDZB 1O2RA 1ABIH 1C5PA 1AD8H 1G3DA 1UVTH 5JBBS 4NZQA 3TIUA 3BG4C 1MU6B 1BDAA 1AFQC 4FU7A 1L2EA 4AZ2B 2BQ6B 2GT8A 1FQ3A 2G51A 1KXDA 3PLBA 1Z6EA 4M7GA 4HZHA 1LMWB 1DWEH 1UVUH 4Q7XA 1HAXB 2AMPA 1JIMA 2ZCLP 3LIWA 3UY9A 2XTTB 3A8CA 2SNWA 1G3BA 1SVPA 1GJDB 1Y8TA 4DG4A 4I8LA 1KXFA 2TGPZ 3SJIA 4B73A 1UO6A 2JETB 1V2UT 5EXMA 2OC1A 2ZU3A 1O3KA 1SGDE 3S7HB 3UWJH 1W12U 1JXPA 3Q3YA 1O2OA 1QQ4A 3SGAE 1MTSA 3BEUA 1G37A 1HV7A 4X2WA 1T4VH 2OQUA 1E35B 2ZGJA 2AEIH 1HNEE 4SGAE 2QV1A 3GCTF 1THSH 1L4ZA 2ZGHA 1AB9B 2I6SA 4FVDA 4JCNA 4UD9H 3NPSA 4KELA 1HAZB 3KNXA 4ABGA 1NRRH 5EXNA 1P04A 4Y79A 1TABE 3RXBA 3K9XB 3LPRA 1GJ7B 2FOAA 1YLCA 4X2VA 1QNJA 3NWUA 1YC0A 2RG3A 1XVOA 2G4UA 1L1GA 3H7OA 2FYQA 3ODDA 3SO3A 2FESH 4X8UH 1VR1H 2W26A 1CGHA 3O8CA 2GMTC 1HPGA 2BQ7B 3STJA 3PO1C 1NT1A 2NWNA 1OWJA 1D9IA 1FIZA 2P3UB 3LGIA 2VVVA 1C1PA 5FHTA 3U69H 2ZGBH 4KP0A 3VGCB 3SV7A 1HGTH 1TX6A 1D3QB 3HGPA 4U2WA 2P3FH 1GBIA 2BDAA 4I32A 1AE8H 1ZOMA 4X2XA 2VNTA 1FJSA 1ZR0A 4NA7A 4X1RU 1JWTA 2VIDA 4KTSA 4ZROA 5BRRE 1QBOA 3TH2H 3SU1A 1BT7A 2QY0B 1VCPA 1TPAE 3K2UA 1CO7E 2PFEA 1O2HA 2ULLA 2BY8X 4K3JA 3A7ZA 3MO3A 2BVXH 4X1NU 2K1QA 1S6FA 2XBWA 2ZP0H 1TE0A 1Y5BT 4JYUH 1MAXA 3ATIA 5C67A 2OD3B 2YNAA 4IW4E 1O3PB 1BTUA 1O5DH 2GX4A 3SBKA 1FIWA 1S0RA 2TPIZ 4FUIA 3RXKA 4X6NA 1TBRH 1ZTKA 1K1JA 1O34A 2VIWA 4INKA 1W8BH 1E34B 2VH6A 4XSKU 5L2ZH 1SOZA 5DJ7A 2VINA 4WH6A 3ODFA 4FUGA 2G81E 3A8DA 1MTUA 3NZIA 2FYRA 3PYHA 5ESTE 3RP2A 3QTVH 1DITH 5L2YH 3M7QA 2VIOA 4ABEA 2SNVA 4UONA 1AZZA 2BD7A 2ZCHP 1GJ8B 1S84A 2JETC 2VVCA 2A0QB 2TRMA 2TGTA 1GJAB 3MU8A 1C2KA 5GIBA 5A0CA 1PPFE 3M37A 1W3CA 1MCTA 3Q3XA 1K2I1 5ABWA 1V2VT 1EASA 1P01A 2XW9A 1ZSKA 1MH0A 3M5MA 4WMEA 5E8EH 2CJIA 1C5WB 3M5OA 1IQFA 1TOCB 3A84A 3M3VA 1A5IA 2ZFSA 1SLWB 1CBWB 2PUXB 2ZU4A 3QK1A 1W7GH 2GZ7A 1EP5A 3SZNA 3P8FA 5ETXA 4JK5A 1BQYA 1DT2A 2G4TA 1DLKB 1CHGA 4H6SB 1AWFH 3TK6A 1HRTH 2Y80A 4TY7A 4BAHB 4AB9A 3QLPH 1OWHA 1MQ5A 4LOYH 1V2OT 4FUJA 1C5ZB 3CP7A 1NM6A 1G2LA 1F92A 3D49H 1AY6H 1Z8RA 4K8YA 4AG1A 5A2MH 1LHCH 2D8WA 1BA8B 3PMBB 2BM2A 1T7CA 2BMGB 4I8KA 3RC6A 3VGCC 4XBCA 1O3LA 3D62A 5K7RA 2WPJS 4OGXA 1GI1A 1V2NT 3BN9A 5FX5A 3LGWA 1SGIB 1DWDH 2Y7ZA 1YM0A 1YCPK 2P59A 1ELCA 3PTBA 3GY2A 1C1TA 1P11E 3JZ1B 1DWBH 1W0YH 1UCYE 3SHAH 4F49A 3TJNA 5T6DA 3ZZAA 1C4Y2 1OX1A 3MWIU 3L3TA 2J2UA 1Z71A 2BDYA 1BITA 2GVFA 5FX6A 1HJAB 1GHAF 1O3MA 3T25A 4ISNA 2OQ5A 3UFAA 3VFEA 3SU4A 1OWEA 4ASHA 1RJXB 1V2KT 3IWMA 3SV2H 5EU8A 2HPPH 3CS0A 4ZXYH 4Q7ZA 3RXHA 3LOXA 1WSSH 1FI8A 4NFEA 3M36A 1BTXA 1YKTA 3S9BA 2A4RA 3E90B 2AGEX 1FAKH 3U1JB 4A1VA 4FUEA 2I6QA 1ZPZA 1C1UH 2VWLA 1FNIA 2FXRA 1NZQH 4XBDA 4JYVH 4RSPA 2QCYA 2F9VA 1GI8B 1NRQH 1ZPCA 1MD7A 4GHTA 4NG9H 3SQHE 1MTNC 3GYLB 1QR3E 1AHTH 1CU1A 4DVAU 2W3IA 4WH8A 4YTAA 1G30B 2BD3A 2F3CE 1O2TA 3RXVA 5E2PA 4B1TA 2ZDAH 4NIXA 4B75A 1BB0B 4Y0YE 1ESTA 2PUQH 1Q31A 1EJAA 2ZFPH 1LO6A 2BY7X 1C2MA 3ELAH 1K1LA 1K1MA 1NPMA 2DUCA 3QUMP 1SHHB 1HCGA 1MZAA 1ZZZA 1VCQA 5E0GA 4WXIA 1GL0E 3PLKA 3RXLA 3UOUA 1E37B 4HFPB 3S7KB 5FXLA 3ZZ4A 1AI8H 2BOHB 1EPTB 3BTFE 4WMFA 1BJUA 2FP7B 5DK1A 1CSOE 1SGQE 2C8ZB 2PWXA 3AW1A 2THFB 2ZFQH 1ELFA 3MOCA 1SFIA 3SNBA 4ZXXH 3MU0A 3SNAA 1EPTA 1NFYA 3GY4A 5F6MA 1B7XB 1AUJA 3HGNA 3SV8A 1MCVA 4NA8A 2NU2E 1GHVH 3UQOA 2VVUA 2PKSB 1A61H 5L30H 2VIVA 1O35A 2ZTZA 3STIA 1C4V2 2OINA 2WV4A 4UFEH 5DP4A 1CBWC 1CA8B 2A5KA 4YLUA 1GBBA 4BAOB 1T8MA 5GWZA 5SGAE 5BPEA 5GCHF 2ZA5A 1ORFA 3ZVBA 1SGFG 4FUDA 5EGMA 4LK4A 2ZPQA 1LVMA 1JBUH 1Y3YA 2NU3E 2HGTH 4ISOA 4CRBA 4ABAA 2F9PA 2W7UA 1W2KH 1Y3WA 2XCNA 1EZUC 1GJBB 2H6MA 2O8WA 2UWPA 1JIRA 4WXVA 3ZZ9A 2SFAA 2HWLB 1SFQB 1K28D 2OXSA 4BXSA 3OY5U 1IHSH 3SNEA 4NCYA 3O8BA 1DWCH 1NRPH 2OUAA 2Y81A 1Y3XA 1TPOA 2FS8A 5A0AE 1DM4B 2FO9A 3FP7E 3UR6A 4DT7B 4A5TS 2VWMA 2ZPSA 4MNXA 8GCHG 3UNSA 1C1NA 1XUGA 1NRNH 3RU4T 3GY7A 1TMUH 2GDEH 1NU9A 1PQAA 2A4GA 1O2WA 1HAVB 2BD9A 1PPBH 1W14U 1HYLA 3DT0H 2NU0E 2SGAA 3L33A 1HJAC 1THRH 3E3TA 3T28A 4NA9H 5DP8A 2IPHA 4LZ1H 3RXEA 1DDJA 1HAVA 3TJUA 1EKBB 3VXFH 3U8RH 1L1NA 3PTNA 1O36A 1EAIA 1WAYB 2JKHA 1GBJA 2F9OA 2SGDE 3P8GA 4JYTA 4XFQA 3N7OA 2WUCA 1ETSH 1J9CH 2ZPRA 5ESBA 1VITF 2CN0H 1GCTB 2HPQH 2VJ1A 1IQJA 2TBSA 1GBDA 5FBEA 1DXPA 3P8OA 2ZECA 2PHBA 2AH4X 1LVBA 3V3MA 2XCFA 3TJOA 3MYWA 1AQ7A 1Z1JA 3B9FH 1O5GH 1ZJDA 5CE1A 1GHBG 1QQUA 1O3OA 4O3UA 3SW2B 1T4UH 1C2HA 4X1QU 4IMQA 1A4WH 1CVWH 1C2JA 2PGBB 2ANYA 1AU8A 2GDDA 2Y6TA 5DP5A 5LPFA 4D76A 3JZ2B 3ZV8A 2AS9A 1BTHH 3F1SB 3BTGE 5DKMA 1IQIA 1QRWA 4GSOA 2ODPA 2H9TH 3K6ZA 2Z94A 1GBTA 2G00A 3PWBA 1P12E 3F9FA 1TLDA 1DICA 1YPKH 4NIYA 4NZLA 3M5LA 4OS6A 3BIVH 2FOMB 4CRCA 2Z7FE 3MHWU 1OP0A 2PKSC 2ZDMA 3RXFA 4JMYA 2CF8H 3SU3A 4INHA 4A1TA 1ZMLA 3PWCA 1YPHE 1W11U 3MH7A 3OSYA 2OBOA 5FCRA 1ZTLA 2ZG0H 4DGJA 4ABBA 5JPMH 1S83A 3S9AA 1K1OA 4MDSA 1YPMH 2PV9B 4LZ4B 3RXGA 1QY6A 1X7AC 3CS7A 1C5UA 3FAOA 1P09A 3G01A 9LPRA 3HATH 1O3IA 5J4SA 1BCUH 2FTMA 1PPHE 5AFYH 3RU4D 1UVSH 3ATLA 1L4DA 5AFZH 1J16A 4Y6DA 2ZDVH 1ARBA 3LGVA 4YOGA 4YESB 4D7FA 4X1SU 2ZFFH 1GMDG 1O3CA 1UJ1A 8LPRA 1O5CB 4XDEA 4AORA 2ZNKH 2ZIQH 4VGCB 1MUEB 3UPEA 3AW0A 5DG6A 3BSQA 3ZZ7A 2GCTB 2UWOA 1BUIA 3RXQA 3NUMA 1HDTH 3S0NA 4TPIZ 2Y82A 5HM2A 1FXYA 1F5RA 4JZ1A 4A92A 1D3TB 4ABFA 4CR5A 1W0ZU 1ID5H 1DFPA 3URDA 3E0NB 2ZTXA 5E0HA 1OWKA 2R9PA 1O5FH 1ZYOA 3A8BA 3A7WA 2ODQA 1Y3UA 2BX4A 2C8WB 3RLYH 3LKWA 1GI9B 1GJ5H 4DIIH 4AFUA 4YZUA 1LPGB 1F5LA 1TBQH 2ZZUH 2PKAB 1TNHA 2UUYA 1H8DH 1VCWA 1Y5UT 3A7YA 3LH3A 5E2OA 3RM2H 3GOVB 2P3TB 5GPIB 1BRAA 1DS2E 1V2QT 3SJ8A 1GCTC 2AIQA 3RXRA 3KL6A 4ZKSU 4GAWA 1A0HB 2BD2A 1FMGA 2WPLS 1O3AA 3UQVA 2XNIA 7GCHG 1DSTA 2ASUB 3SV9A 1GJ9B 2B7DH 3RC5A 1SQOA 2H1UA 1SG8B 1O3NA 1V2PT 4ZKNU 4J1YA 3GCNA 4LXBH 1MKXK 2P95A 4IGDA 2BX3A 3M35A 1KDQB 2WYGA 6CHAB 2YNBA 1C5RA 2BD5A 3DHKH 1W7XH 2ZDLA 4MG3A 3VPKA 1KDQA 1GMCG 1O2IA 1IQMA 3DFJA 1N8OC 1MTWA 1O3HA 3LGTA 2Z6BD 1P03A 2B0FA 2GKVE 1C1VH 2ZEBA 5AF9H 1O2YA 1LKBA 2GGVB 1O0DH 2D2DA 3BTQE 3BTEE 1Q2WA 3Q3KA 4IC5A 4MPWA 4D7GA 1TWXB 1SQAA 2GZ9A 1Z8JB 2FOFA 2IN2A 1FAXA 1FN8A 3ESTA 1HIAB 4GLYA 3QGNB 4UFDH 1MKWH 2QXIA 3U1IB 2R0KA 4B2AA 4H4FA 2FOEA 3SGQE 4TY6A 3ZVDA 3NXPA 2QN5T 3LC3A 1HIAA 4AOQA 3DUXH 2ZGXH 1C5OH 1WTGH 2WYJA 4B76A 1RTFB 1TPPA 2ALVA 5HYOA 1DY9A 2ZQ1A 4DCDA 3GCHB 1T8NA 1ZRBA 3GISB 1DUEA 2KAIB 1SLVB 1IQLA 4JZEH 2BDCA 1BMLA 1YPGH 1KIGH 1GHAG 4O97A 3VXEH 2OC7A 5TJXA 1K21H 1DLEA 2KAIA 3AASA 1DOJA 2XWBI 4YT6H 6GCHF 4DIHH 1JOUB 1C1QA 2FEQH 2PLXA 1S6HA 3GY8A 2O8LA 3D65E 4YO9A 1UK2A 1PYTC 1NO9H 2W5EA 4I8HA 2FI4E 3F9EA 4YT7H 4MQAA 1QJ6B 4BAKB 1CT2E 4VGCC 2HNTE 2P8OB 1HXFH 5IYTA 1MTNB 1OKXA 2GCTC 2EEKA 2OC0A 1AFEH 4FU9A 1WYKA 1SB1H 2J95A 3ITIA 1Z1IA 4ZKOU 1J15A 1GBLA 1P05A 2XYAA 1UTNA 3FVFB 1GBHA 4K8BA 1AO5A 3VB3A 4FUFA 4GPGA