2AIPA

Crystal structure of native protein c activator from the venom of copperhead snake agkistrodon contortrix contortrix
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
231
structure length
231
Chain Sequence
VIGGDECNINEHRFLALVYANGSLCGGTLINQEWVLTARHCDRGNMRIYLGMHNLKVLNKDALRRFPKEKYFCLNTRNDTIWDKDIMLIRLNRPVRNSAHIAPLSLPSNPPSVGSVCRIMGWGTITSPNATLPDVPHCANINILDYAVCQAAYKGLAATTLCAGILEGGKDTCKGDSGGPLICNGQFQGILSVGGNPCAQPRKPGIYTKVFDYTDWIQSIISGNTDATCPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein C activator
publication title Thrombomodulin-independent Activation of Protein C and Specificity of Hemostatically Active Snake Venom Serine Proteinases: CRYSTAL STRUCTURES OF NATIVE AND INHIBITED AGKISTRODON CONTORTRIX CONTORTRIX PROTEIN C ACTIVATOR.
pubmed doi rcsb
molecule tags Hydrolase
total genus 55
structure length 231
sequence length 231
ec nomenclature ec 3.4.21.74: Venombin A.
pdb deposition date 2005-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2aipA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2aipA02
2ANMH 2GDDA 4I8JA 1QQUA 3VEQB 1SGIB 1DSTA 1A46H 3ZVFA 1GBDA 2AGEX 2DE9A 2EI7A 2Y82A 1GJDB 1GL1A 1S85A 4B73A 3E3TA 2FOEA 3RXFA 2ZDNA 1KXDA 2PHBA 6ESTA 2YNBA 1DM4B 1O5GH 4BOHA 1H9HE 2C3SA 1GG6B 2SGFE 5GIBA 1NPMA 3P6ZB 2AMDA 2FS9A 2HNTC 3VB5A 1HLTH 2CHAB 1N1LA 3EAJA 2VVVA 4ZROA 1SGEE 1WUNH 2R3YA 1P12E 5LPEA 3I77A 2GZ9A 1JMOH 3RXJA 1OPHB 1CA0B 2P8OB 1CBWB 1O3IA 1V2UT 1ZSKA 1DVAH 3SJKA 3RXLA 3MH5A 2LPRA 1IAUA 1NM6A 3BG8A 2ASUB 5DKMA 2ZDAH 3PLPA 5GCHF 1UHBB 3MO9A 2HLCA 1G2MA 1TGCA 3TITA 3Q00A 4Z6AH 4YO9A 1S0RA 3S0NA 1NFYA 1DT2A 2PSXA 3SU4A 7ESTE 3UFAA 1FN8A 1QB9A 4ISLA 1E0FD 1GJ8B 4GPGA 5BPEA 2ZDVH 3V0XA 4BXWA 1VITH 3P8NA 4K2YA 1OWDA 1EATA 3PB1E 1FPHH 1SHHB 1O3PB 3BG4B 3GCNA 1O2HA 1C4V2 2C93B 4F49A 4K1EA 1W3CA 5EU8A 2HRVA 1A0JA 1D6WA 1BRBE 3AVZA 1V2RT 2UUJB 2P16A 4PROA 2ZU4A 1GCDA 1TA6A 1V2ST 3SHCH 3MU8A 3RXGA 2GV7A 5LPFA 2ODQA 4Q80A 1IOEA 3SV9A 1SQOA 1W12U 4WMDA 1AWFH 2XCNA 1AFQB 4UFEH 1O33A 2G4UA 4MPXA 1ANEA 4INLA 4Q7XA 4CRBA 3NKKA 5L2YH 1ZOMA 1QJ1B 1S6HA 1BIOA 3WY8A 2VIOA 3PO1B 3SU1A 1P2OA 4DURA 1C2MA 1ID5H 1TBRH 4WMEA 1IQNA 1Z8IB 3SU6A 2ZHWH 1Q2WA 5FBEA 2WUBA 1GBIA 1F92A 3B9FH 2W5EA 1WTGH 4JYVH 1AVGH 1ARBA 1GWAA 2BMGB 2ANWA 1L0ZA 1JIRA 4FUDA 2Z6BD 3UOPA 1DANH 1EB1H 2AIPA 3F68H 3LOXA 1QCPA 1ZMLA 2A45B 2QN5T 3LC3A 1W7XH 2GCTC 3IWMA 2XTTB 1WQSA 4NA9H 4Q7YA 2RA0A 3ATKA 1P2MA 2RG3A 2RDLA 1G9IE 4INKA 1QBNA 3NZIA 3LGIA 1ANBA 5AVDA 3TGJE 3K6YA 2HOBA 3RP2A 3RM0H 1UK2A 3HK6B 3KIDU 3RU4D 1V2LT 4VGCB 2HGTH 4IW4E 4WH6A 1ZRBA 2FX6A 1C5LH 3KGPA 1P8VC 3ATWA 4Y0ZE 2G81E 1QJ7B 2J95A 3RXOA 1C1VH 2GD4B 1DLKB 3QZQA 3QLPH 4I8LA 2A7JA 2W7UA 1A0LA 1E37B 1FAXA 2PKSB 4JYUH 4NWKA 5L30H 2PR3A 2OC1A 2VVCA 1AHTH 1GBFA 4KTSA 2BD4A 3RXEA 1ESBA 3A83A 1GI1A 1W8BH 2BVXH 3KQCA 3UIRA 4UONA 3QTVH 5L6NH 1K9OE 4X1SU 1GHBG 2SGQE 4X1RU 1C1MA 3A8AA 2ZGJA 1LCYA 2F83A 3F9GA 1CHGA 3SI3H 1HAXB 1C5YB 1HIAB 2TPIZ 4AOQA 1OYQA 3GDUA 1GMDF 3URCA 1VITG 2SNVA 1TX6A 3GOVB 4A1VA 4R8TB 4B2AA 2Y80A 1O3HA 2FI3E 5EXLA 1O37A 6GCHF 2UUFB 1CE5A 3K2UA 1L2EA 1O2WA 5F8ZA 1S0QA 4D9QA 3SHAH 4AZ2B 3KHVA 1SSXA 3FAOA 3LC5A 2BXTH 4JK6A 5A0AE 1AKSA 1F0SA 3EGKH 4FUEA 3RXIA 1AO5A 1O2NA 4O9VA 2XC0A 2XW9A 4KKDA 3GDVA 4GSOA 2D1JA 1TX7A 1WAYB 7KMEH 2ZO3H 3F6UH 4B1TA 1BT7A 3ZZDA 3K9XB 4XOJA 3KQEA 2PTNA 2A2XH 3Q3XA 2F9OA 4HTCH 1Y3YA 2ZFPH 5EG4A 1A3BH 1IQJA 2ZFRH 1BMMH 4LZ1H 1SGCA 3QGNB 1C5TA 2F3CE 2XBWA 4D7GA 1EX3A 4A1XA 3VB6A 2B7DH 3RXTA 2Y81A 2Z94A 4UD9H 4UFGH 1CU1A 1VCPA 3QWCH 1O2IA 4MNVA 1AZ8A 1KYNA 3RXSA 1C5SA 2I6SA 4WVPE 5A0BA 5C3NA 1ELVA 3UQOA 4KP0A 1YF4A 1O2QA 2QV1A 1HYLA 1ESAA 2ZU5A 2A4QA 4TWYA 1DS2E 4I33A 1V3XA 4B71A 2VGCC 3B23B 5GWZA 1O39A 1MU8B 4JZFH 3TGKE 1C1PA 4LOYH 2W3IA 1HAZB 3M7QA 1TRMA 2A7HA 2G00A 5C5OA 1SGTA 2ZNKH 4GUXA 1XUIA 1VCQA 4CREA 1KLTA 1O3CA 1CA8B 1UCYE 1YPMH 1C1TA 1SGNE 1OP2A 4K1SA 2FOFA 2F9UA 1MZAA 2GX4A 1C5ZB 1XXDA 1NRPH 1RFNA 2BVSH 3MOCA 3E1XB 2Z3DA 1V2QT 3H5CB 3MU1A 3A8CA 2BM2A 4ABDA 4NIXA 1O2JA 1PPZA 1SGPE 1O34A 4GCHF 1GJ7B 1ZGIA 5HM9A 2V6NA 1ACBE 1V2PT 3UR9A 5F6MA 3RC4A 3SU5A 1SBWA 1BRUP 1UVPA 1GHXH 1Y5AT 3SNAA 3K65B 4OS2A 4CH8B 1TFXA 2GCTB 1OSSA 2FPZA 4IMZA 4AGKA 4MDSA 1P2KA 2GKVE 2A4GA 5LH8A 1SL3A 5PTPA 3P70B 2XXLA 3M5MA 4TY7A 1QA7A 1F5LA 1GI8B 2VH0A 3NUMA 1A1RA 3GYLB 1TGNA 3ZZ3A 1ANDA 3MI4A 3MTYA 3RU4E 2R0LA 2BXUH 2ZG0H 2WPKS 1UK4A 2ZPQA 1KXBA 2P94A 3ZZBA 4X6NA 1ZYOA 2AMPA 4X2WA 1SGRE 3PLBA 3MH6A 1MKWK 2VB0A 1GVKB 1UCYK 2GGVB 4DG4A 1HJ8A 1N8OB 1MKXH 1O3GA 1O5AB 3R3GB 1C5XB 2BX4A 1O35A 2BY9X 2C8WB 1O0DH 4HFPB 1GMCG 4DVAU 1O3BA 3V12A 1BRAA 3ZZAA 1T8OA 4WMFA 4ABIA 2ZI2H 4JCNA 3MU0A 1HAHH 2WYGA 3JZ1B 1ZHRA 1QBVH 5DK1A 1GVLA 2THFB 3MNCA 5B6OA 1TONA 3T25A 3SNBA 1W11U 1Z1IA 2ZGBH 3KNXA 1A3EH 2OC7A 1O2RA 1QGFA 2ZU3A 3M35A 1Z71A 4NZQA 2M5TA 1EPTC 6CHAC 1O2UA 2OBQA 1GHVH 1K1LA 2FESH 3TK6A 2GCHF 2FZZA 3A88A 1FY1A 1SMFE 4NIWA 1S6FA 2SGDE 1P2IA 3CENA 3LGWA 4H6SB 1MTVA 1ZPZA 5C5NA 1TNKA 7GCHG 3QGJA 2H1UA 8GCHF 4CRDA 1GBHA 4FUCA 1NFUA 1CGJE 2HWLB 1QHRB 3AAUA 3AASA 3IITA 1C5PA 1HAOH 3V13A 3SU0A 4YLQH 3E16B 1CHOF 4DGJA 2FOBA 3D23A 2H9EH 1LO6A 3S9BA 1IQMA 5C1YA 2AEIH 5DGJA 2FEQH 1ELEE 1HAVA 4BXSA 4KTCA 1KY9A 1GHZA 1EP5A 1BJUA 1GBTA 1G3CA 2RA3A 4NG9H 3RXKA 1EASA 5A8XA 2FYRA 3K6ZA 3V3MA 3GISB 2XC5A 2R2MB 4BTTB 2Y5FA 1GJ4H 2VINA 3A86A 3BTEE 2PWXA 3P92A 2ZHFH 1SR5C 4INHA 3G01A 3UUZA 3Q76A 4WWYA 4CRFA 1EZSC 2ZGXH 1EB2A 3D49H 1ELCA 4Y0YE 3T5FH 4TPIZ 4OS7A 1ZJKA 4ZXXH 2W3KA 5T6GA 1S82A 1O2KA 1C1QA 1MCVA 1UTOA 2GVFA 1WU1A 1RTFB 3ATLA 1IQIA 3T27A 1EZUC 5A09A 1MTSA 3PMAB 4AGJA 1FJSA 2GZ7A 5C2ZA 3A7YA 1C1NA 1H8IH 1MZDA 3RXVA 3P8FA 2FLRH 2VWNA 4Y71A 4BAOB 2GP9B 2BLQA 3UNSA 1H4WA 1YC0A 4YLUA 3URDA 2BB4A 2P3TB 1Q3XA 3FP8E 2VGCB 1LKAA 2VVUA 4E7NA 5DP8A 1EAIA 4AYYB 1DPOA 2WV5A 4DT7B 3GCTG 4OS1A 3SQEE 1O36A 1AWHB 1BBRH 4NGAH 4A6LA 4NZLA 1T4UH 1LDTT 1LVYA 5EPNA 2P3UB 3V7TA 4FXGH 3ZZ7A 3HK3B 3A7ZA 1FPCH 2AMQA 2UWOA 2G5VA 2IOTA 4Q2KA 1F0TA 2XNIA 1BMAA 2QYIA 3U9AH 4Y8XA 5E0GA 1P9UA 3SUEA 1G37A 1FY8E 1EKBB 3MNSA 2FODA 3MFJA 1C4U2 1Y3XA 4I7YH 1PQAA 1O5FH 1TNLA 1TGBA 2NU1E 2QCYA 1KTSB 2OC0A 3O8BA 2H5CA 3S69A 3ZYEA 1UTQA 5FX6A 3EQ0H 1EXFA 3ENSB 1TGSZ 3UWJH 4XSKU 2O8WA 1MBMA 3BV9B 1BMLA 1BJVA 1XMNB 2FOMB 3A7XA 1D9IA 2AFQB 1E34B 2QF3A 2FOAA 1GHAG 3ZV9A 2JETC 3ZZ6A 3RXHA 5J4QA 1SC8U 2ZGCA 1A61H 1K21H 1QRXA 4E05H 1O2YA 4TPYA 2G5NA 1QB1A 4QT8C 1FI8A 4NA7A 4IBLH 1NS3A 2PUXB 2NU2E 3PMJA 1JOUB 2D8WA 4MPWA 1C2LA 1ZGVA 4ZMAH 3SW2B 1J16A 1RIWC 2B8OH 4NA8A 1UTKA 4NWLA 4LXBH 4UFFH 1GDQA 1ZTKA 2G52A 1TB6H 1TNGA 3U8OH 1RJXB 3JZ2B 4CR9A 3LT3A 3PYHA 1GI3A 1Y5UT 8LPRA 5JDUB 1OOKB 2WINI 2CV3A 4ASHA 2CJIA 1EJMA 3UTUH 2PKAA 1O3NA 5GJ4B 2JH5D 3OU0A 1B0FA 3BTGE 1CGIE 2CMYA 1TIOA 1QB6A 2BDGA 1TWXB 3ZZCA 1TE0A 4ABGA 1CT2E 2H6MA 3M61U 1EPTB 3EA8A 4K5ZA 4ZUHA 6CHAB 2A0QB 1JIMA 2BTCE 4K1TA 1LKBA 1LHFH 2GT7A 5FX5A 1C5OH 1NROH 3RXQA 4ISOA 5JBCS 5EW1H 1F0UA 1N6XA 2SNWA 2O8MA 1NFXA 2H2ZA 4SGAE 3U8RH 1JRTA 4Y11E 4AFZA 1C2HA 2ZU2A 4XBCA 3SU3A 5FPSA 2Z9IA 2B9LA 2ZGHA 4Y10E 1K1IA 1GCTC 3P8OA 3NCLA 1B0EA 1O2SA 1P3CA 2ZQ1A 2OINA 2ZFQH 2BZ6H 3PV4A 4DJZB 2VWMA 1SLXB 1C2IA 1S83A 3CS0A 1WBGB 2XWBI 2PLXA 4NIVA 3MHWU 2FLBH 2C8YB 1EZQA 4FVBA 1HB0B 1UJ1A 4ABHA 2PGBB 3SGBE 2A4RA 3ZZ8A 3MNXA 2CN0H 4FUFA 1GJAB 1OWKA 3DFJA 2EA3A 2ZDMA 3F9FA 5DG6A 3SV7A 2BOHB 4D76A 1XKAC 2P93A 4CHAC 2Y7ZA 3F9HA 3TLOA 2CGAA 2PFEA 1L1NA 2BX3A 1C1RA 3F1SB 1SLUB 1H8DH 1ZSJA 2Z7FE 3ATIA 5GXPA 3TVJB 1AZZA 1O2PA 3A81A 1TLDA 5EQRA 1ETTH 3FFGA 3O8CA 3H7OA 3SV8A 1DITH 1SGYE 4X8SH 1XUGA 1GL0E 2Z9GA 3PWBA 2QXIA 1UK3A 1FDPA 4K60A 4XFQA 4AFSA 1LQDB 3RMNH 4B2CA 3NK8A 1IQEA 4DCDA 2VIVA 2DUCA 3PTBA 4MPUA 3BTTE 3VPKA 1TOCB 1N8OC 1ZZZA 3DUXH 4MPVA 1TQ0B 1DWCH 4BAQB 1GBMA 1AB9C 1YPLH 1RRKA 1GI9B 3GY7A 1P06A 1CO7E 3TPIZ 2ULLA 4YOGA 2FOCA 1SLVB 3TNSA 1AI8H 3UPEA 3I78A 2OUAA 3EDXB 3RMMH 2WYJA 1YPEH 1P3EA 3LJOA 4J2YB 1EJAA 3T26A 4RN6A 3KCGH 1ZMNA 1FY3A 1TMUH 1NRSH 2BD9A 4I32A 1AVWA 1O3FA 4O3UA 1UTJA 1V2OT 3QTOH 2C4FH 5HXFA 1K1NA 5DPAA 2NWNA 4MG3A 2PV9B 2J92A 1LPKB 1FQ3A 1F7ZA 5HGGA 1V2JT 5EXNA 1TRNA 4X1PU 5A2MH 1CT0E 1UVOA 3ITIA 3U8TH 1GDUA 1MD8A 1D6RA 3SI4H 3ZVCA 1N6YA 3RDZA 1GI7B 1ZTLA 3SJOA 4WXIA 1VJAU 1A7SA 2GV6A 1HCGA 4A92A 3SJ8A 1KLIH 4RSPA 2STAE 1SI5H 1SOTA 2VIDA 1BCUH 5CE1A 3O8DA 3STIA 3ZVDA 2JETB 1V2NT 5HYOA 1EAXA 1O2ZA 1O5EH 2XWAA 4Y6DA 4BAKB 3BTWE 3ZVGA 2BY5X 4DW2U 4IS5A 1NU9A 4OGYA 3SO3A 4Y79A 1C5NH 1C4Y2 3EA7A 1V2KT 1GHWH 3M36A 3M7TA 1FY4A 2LNCA 1OYTH 1SB1H 2WPMS 1THPB 3UNQA 5EGMA 2ZP0H 1YM0A 1UTNA 1RIWB 1HXEH 5FPTA 1OXGA 1VJ9U 3TJVA 4MNWA 2GMTC 2QF0A 4WH8A 1DY8A 1ORFA 1UTLM 4YTAA 1G32B 3M5NA 1QRWA 2ZDLA 2HPPH 3D65E 2A31A 3GY6A 1OWIA 3OX7U 1ZPBA 1KDQA 1E36B 5AFYH 4E7RG 1BITA 1C5UA 1L1GA 1S84A 2DE8A 3A8BA 2A32A 1VGCC 2VIWA 3PWCA 1DXPA 2CXVA 2ZHQH 2YOLA 2BDCA 1WSSH 3BTQE 1OP8A 4ZHAA 2ZCLP 5JPMH 1MAXA 2UWPA 4HZHA 3LH3A 1YCPM 3AW1A 1SGFG 2FP7B 1YKTA 1EZXC 2OBOA 3LKWA 2ZZUH 3SORA 2BD8A 1Z1JA 2Y5HA 2V3HH 1GI2A 1ELBA 2ZIQH 1QA0A 1P57B 1RD3B 5DP3A 1O2XA 1FY5A 1YCPK 4SGBE 4Y76A 1GHBF 3GCHC 5FHTA 2FI4E 3VB3A 4XBBA 3DHKH 1D3PB 1DFPA 4GLYA 3OTJE 1W7GH 3QK1A 1ZHMA 3EA9A 4BAMB 1C1WH 1THRH 4MQAA 3P8GA 1GCTB 4UE7H 5TJXA 4B76A 2ZC9H 3LPRA 4WY3A 5DO4H 1QL8A 1AKSB 3BEIB 4H6TA 1LPGB 2G51A 3TJOA 3E6PH 1GMHG 3RM2H 1O3OA 1VITF 4FVDA 1CHOG 2ZECA 4ABBA 2ZDKA 1ELDE 2SGAA 4TY6A 5EOKA 1NESE 1SPJA 1MU6B 3A8DA 3HATH 3U98H 1P2NA 2IPHA 4ZAEA 3TIUA 2VU8E 2OD3B 1P2JA 3Q77A 1EP6A 4CH2B 1KIGH 1CVWH 2A2QH 1QY6A 5CHAB 3M5OA 4CHAB 4ZXYH 2ODYB 4YM9A 3PLKA 1MH0A 1MMJN 4LK4A 1XUHA 5L2ZH 1IHSH 4HGCA 1EJNA 4B75A 3GY4A 2O8TA 2Q6GA 3S7HB 1Z8GA 3FP7E 5DP9A 1DDJA 3LGYA 2C8XB 2ZTYA 1C1OA 2JH0D 1PPCE 1A4WH 1CT4E 3S7KB 1AB9B 1RS0A 2Z9JA 1QJ6B 3GYMA 1G36A 3ESTA 1TPSA 2BD7A 2FOGA 4KTUA 2KAIA 2TIOA 1GJBB 4BANB 1NO9H 2TBSA 1O5BB 2ZKSA 5DJ7A 3S9AA 4D9RA 4X8UH 4YT6H 5HMAA 5HM2A 4A5TS 4AYVB 1AGJA 3SUGA 3L6PA 4IC6A 1W13U 1TOMH 1A5IA 3BEUA 2WPIS 2TGAA 3UY9A 3E0NB 3QUMP 1TA2A 1QR3E 5DP5A 3DD2H 1ANCA 1Y3VA 1TNJA 1W2KH 4NSYA 2TGDA 3A7TA 4MTBA 1G30B 1DX5M 5I25A 4U30A 1THSH 1BTZA 3T62A 5TCAA 1V2MT 1HGTH 5FAHA 4D7FA 1S81A 1P03A 7LPRA 5DP6A 4OS5A 1YGCH 4AFUA 1TQ7B 1D3TB 1A0HB 1QL7A 1QBOA 3PM3A 1TABE 4WF8A 1QNJA 3IG6B 1JXPA 1UTMA 4GHQA 4I8KA 1OX1A 1FXYA 1J14A 1ETRH 1FLEE 1Y3UA 1SGQE 1YCPH 4AB8A 1BB0B 1LHEH 4FU8A 3MYWA 2JKHA 2QA9E 1TBZH 1XUKA 2FXRA 5JBTA 1AMHA 1P01A 5EODA 1NFWA 2QY0B 1DE7H 1AE8H 1BQYA 5TCCA 2ANYA 2SGPE 3T2NA 1PPFE 4TWWA 5JB8S 3LGVA 4ABEA 3VGCC 1ZTJA 1LPZB 3AW0A 1PYTD 2BD2A 2OTVA 3SV6A 3ODDA 5E0JA 1S5SA 1MCTA 5DP7A 3KQBA 3QO6A 1W10U 3FVFB 2A5KA 2GMTB 4IGDA 4R0IA 1HXFH 2OCVB 2BOKA 2ALVA 1KXAA 1K1PA 1HAYB 2Y7XA 4NCYA 4MNXA 1P0SH 1F0RA 1LVOA 2PSYA 4ISHH 1O2TA 2ANKH 2AGIX 3M3SA 4UFDH 1RTLA 3M5LA 1XUFA 1BHXB 2A5AA 1CSOE 5ESBA 3UR6A 1KXEA 2FOHA 1VGCB 4IN2A 3BTHE 4FUHA 5GCHG 1LMWB 1YYY1 4H42U 2P3FH 4ESTE 2ZPSA 1PQ5A 4BNRA 5C1XA 3A7WA 2ZTXA 3NPSA 1HJAC 1BTPA 1KTTB 1DICA 1BMNH 2ALPA 1FUJA 1GMCF 1XVOA 4U32A 1MKWH 1UCYH 3DFLA 1GJ9B 2O8LA 3TH4H 1YPGH 4FUIA 3BN9A 1ETSH 2UUKB 4RKJB 3GCHB 1FNIA 1L1JA 2VIQA 3QX5H 1SQTA 1ARCA 5E2PA 1XUJA 4X6MA 4DIIH 1JBUH 4K8BA 2Z9KA 1ZRKA 3STJA 1HAVB 1O3EA 1RXPA 1UHBA 2QIQA 5K7RA 1C2JA 4JZEH 1JWTA 1KXCA 2A5IA 1V2VT 2HALA 5K0HA 1A2CH 1WV7H 1MTUA 5T6DA 1LVBA 1MD7A 1WTHD 7GCHF 3B8JA 1NU7B 5E0HA 1P2QA 4ZHLU 1EOJA 2FTLE 4XBDA 4YZUA 4NSVA 2QXJA 3ATMA 2H9HA 4ZKOU 1E38B 1EAWA 3UWIA 2STBE 2G55A 4X8VH 2BDAA 1V2WT 1CQQA 1GBCA 2TRMA 2V35A 1SFIA 2JH6D 1DXWA 4A7IB 3DT0H 2A1DB 1GHYH 5LPRA 3LIWA 1FZZA 1NT1A 1HAIH 1C5VA 1UVTH 2W7SA 3ODFA 1SGDE 3MU4A 3RC6A 4I8HA 1BTWA 3SN8A 4CR5A 1P10A 3A87A 4JZ1A 5E8EH 4DY7B 1C5MD 1O3LA 1O3DA 1W0ZU 2Z9LA 1T8NA 3VFEA 2FDAA 4BTIB 2BDBA 3GCOA 4K69A 4X6OA 2FX4A 2GDEH 4JYTA 2ZQ2A 4FUJA 3MMGA 3UQVA 4ABJA 2CF9H 1GBEA 2TGPZ 5AFZH 3M3TA 3P17H 1H9IE 2BZAA 1KXFA 2BD5A 1YPHE 1P04A 2ZU1A 4U01A 1WYKA 1ZR0A 1HDTH 1QRZA 2AH4X 1P09A 1K28D 1SQAA 2G4TA 2VH6A 3A85A 3A7VA 1L4ZA 2G8TA 4I31A 1O38A 1HRTH 4FU9A 2I6QA 2EI8A 2BLVA 5A8YA 1MBQA 2ZWLH 3TJUA 1T8MA 1PPEE 1PPBH 1DOJA 4MLFB 1W0YH 1IQFA 4OGXA 1K1MA 3ZVEA 2V3OH 1HPGA 5GPIB 1SOZA 2PUQH 3ELAH 1BTYA 2K1QA 3MU5A 3A80A 1LHGH 5IDKA 2BDIA 3SNEA 1OWJA 3GCTF 2VIPA 1Y5BT 3SGAE 1AY6H 3R0FA 1G3BA 2AGGX 2BVRH 4Y8ZA 3ZZ4A 1T32A 2ZFFH 1BHXF 1O5DH 1GMDG 3SUDA 3HGNA 5C67A 2FYQA 5EW2H 1W14U 2OQUA 1HAGE 1GBJA 2ZHEH 3E90B 4AB9A 1QL9A 2ODPA 5F8TA 3SZNA 4OS4A 2OQ5A 1ZLRA 2ZCKP 3U1JB 6GCHG 2BY6X 1ZJDA 1CGHA 3H7TA 3M37A 1Y8TA 2UWLA 3TNTA 4AN7A 2IN2A 2BDHA 2XRCA 1YPHC 3KL6A 3VGCB 1HIAA 3D62A 3NXPA 5DP4A 2F9VA 3GY2A 2OXSA 1UMAH 4DOQA 3MH4A 1LHDH 5CHAC 5FPYA 2Y5GA 3OY6U 3ZVBA 1AUTC 1OS8A 3C27B 3GDSA 3TK9A 1V2TT 4Y8YA 1OWEA 3MH7A 3CP7A 3KQDA 3LH1A 1DWEH 1GHAF 4AG1A 1A5GH 3PMBB 1JRSA 1ZHPA 1MQ6A 2PKAB 2OP9A 4X1QU 5FBIA 3SV2H 2RCEA 2F9BH 4AG2A 1GJCB 1XX9A 1FIWA 1OWHA 1J17T 1GGDC 3RXRA 1DY9A 2B0FA 3BEFB 1MTWA 3HPTB 1KSNA 1MAYA 1C5WB 2OC8A 2VWOA 3BTDE 2FO9A 3PTNA 4X8TH 1HJAB 1D3DB 1LVMA 1SFQB 4BTUB 1SGFA 1K1JA 3TU7H 4RKOB 3MWIU 3OSYA 4X6PA 1B5GH 1QURH 1Z6EA 3PMHB 3HGPA 4YOJA 4B2BA 1WOFA 1C5QA 1O3AA 3SNDA 1TPOA 1TPAE 4KELA 4XE4A 4TYDA 1G2LA 1HJ9A 1X7AC 2SFAA 4IN1A 1TBQH 2FWWA 2B5TB 1MTNC 1UO6A 2WPHS 3OY5U 4JMYA 4U2WA 2QGRA 3T28A 1NRRH 3PROA 1YPKH 3AAVA 2R9PA 2J38A 2Z3EA 2WPLS 3E8LA 1TX8A 1F2SE 2BYAX 3ZZ9A 3KEEA 1ESTA 1QFKH 4ZHMU 2EC9H 2NU4E 2IJOB 1PYTC 1ABIH 3GICB 1PJPA 3N7OA 1AU8A 1C2KA 3SJIA 3FP6E 8KME2 3LDXH 2QXHA 2ZPRA 4GCHG 1LHCH 1UVUH 1Y59T 4YT7H 1HV7A 3MNBA 1GBBA 1BTHH 1VCWA 1MQ5A 2BDYA 1IQHA 2BD3A 4CBNA 1NZQH 1O32A 2FTMA 2Y6TA 2XC4A 2PW8H 5C1UA 3VXEH 5FCRA 1D4PB 1YLCA 4WXVA 1IQKA 2BY7X 1E35B 3ZZ5A 1AQ7A 2J94A 5ESTE 1ZMJA 2FI5E 1L4DA 2GT8A 1TRYA 1EOLA 2XBVA 1NRQH 2C90B 1P02A 3T29A 2NU0E 1O3MA 3S9CA 1MKXK 3E0PB 3UOUA 1GJ5H 4I8GA 3RXCA 1GBKA 1HNEE 5LGOA 1EQ9A 4AFQA 3RC5A 2BQ7B 5JYIA 2SGEE 1BZXE 5C20A 3GY5A 1KLJH 5F8XA 1H1BA 1BOQA 1NY22 1O2LA 2WPJS 1AVXA 4H4FA 1YBWA 4X2YA 2VWLA 5EPYA 4ZKSU 1GDNA 2OLGA 1WQVH 1Y3WA 1Z8JB 3QZRA 1IQLA 2PTCE 1Z6JH 4AORA 2F9NA 2BQ6B 1C9PA 1ELFA 2V0BA 2ZEBA 2ZFSA 4ABAA 5A0CA 1K2I1 3E91A 1J15A 1BUIA 1YP9A 1LTOA 3M3VA 4F4OC 1UVSH 2D26C 1DUEA 3KN2A 2ZFTA 4Z0KA 3UREA 2O9QA 4A1TA 3L33A 3RUOA 2ZCHP 1PFXC 3O8RA 1C2EA 2Q1JA 1PPHE 5F03A 2GCHG 2QC2A 1HAPH 4O3TA 5ABWA 2FMJA 1Z7KA 2EI6A 3BIUH 4K3JA 4YOIA 3A84A 1MUEB 1XM1A 4NFEA 5T3HA 8GCHG 4X2XA 1NTPA 1FIZA 2F91A 1FV9A 1GJ6A 2CF8H 1FN6A 1TMTH 5I46H 1BTXA 1DWDH 1BBRE 2J4IA 1O2VA 2VNTA 2BLWA 3BTKE 1AN1E 1K22H 1DLEA 3TJNA 2BLOA 5H4IB 5AHGH 2ILNA 1UTPA 3I29A 1HBTH 3C1KA 1P9SA 3L3TA 9LPRA 1GI6A 4FU7A 1C5RA 1AFEH 9ESTA 4J1YA 4NFFA 3VXFH 2HPQH 1XVMA 2XBYA 3BF6H 3BSQA 4ZKNU 4AX9H 3QN7A 3LGTA 1J9CH 4OS6A 1U6QA 4E06H 3BTFE 3W95A 1F5RA 4KGAA 1A5HA 1TALA 3OYPA 3SGQE 5CMXH 3NWUA 1C1UH 1T4VH 5FCKA 1RTKA 3RMOH 1C2FA 1KDQB 1Z8RA 3FZDA 4K8YA 1O3KA 1BDAA 3Q3YA 3ZYDA 1TYNA 1HFDA 2Z3CA 1XXFA 2BHGA 1PQ7A 4IMQA 2P59A 1GGDB 4FUGA 4ZKRU 2UUYA 1K1OA 2H9TH 1G3EA 1GG6C 3LJJA 2GZ8A 4GAWA 8ESTE 1O3JA 1T8LA 3GY8A 3EE0B 5EQSA 2ZTZA 2CHAC 2D2DA 3A89A 4THNH 1GVZA 4X2VA 1V6DA 3U69H 4MVNA 3SU2A 1NN6A 1CA0C 3M7UA 1GI4A 2P8OC 2ZHDA 1CBWC 4M7GA 3RLWH 1PQ8A 2XCFA 2P95A 1BBRK 1TNIA 3SBKA 3VB4A 4DIHH 3SUFA 3RMLH 4CRCA 3ZV8A 2ZA5A 4FUBA 2R0KA 3RXUA 3U1IB 1MTNB 2FIRH 4Q7ZA 2TGTA 2AS9A 1C9TA 1QQ4A 3CS7A 1O30A 2AIQA 3LGUA 1ELGA 2F9PA 2H5DA 2WV4A 2HNTF 5IYTA 1INCA 4ZH8A 4MNYA 5FXLA 3ZVAA 1QTFA 5JB9S 4JZDH 3BTME 1OP0A 5J4SA 3RXDA 4CBOA 4X1NU 1LQEA 1O2MA 2PGQB 5JBAS 3RU4T 1H9LB 3BG4C 4ISIH 1FONA 1AE5A 3HKIB 4D8NA 1ABJH 4UEHH 2VJ1A 2A4OA 3VB7A 2Q6DA 3HKJB 1EAUA 5SGAE 3EYDA 4LZ4B 3TH3H 3UNRA 2J9NA 2NU3E 3A82A 1AFQC 4WJG2 4Y7AA 3FANA 1GMHF 1XKBC 1TGTA 4O97A 1IQGA 2QAAA 2C8ZB 1ELAA 5AF9H 1HUTH 2YNAA 3PO1C 3KF2A 1GBLA 1WCZA 4B74A 4HI3A 2AYWA 1T7CA 3RXBA 1BRCE 1YPJH 2A7CA 2XBXA 1ELTA 1TAWA 3BIVH 2J34A 5T6FA 3RXAA 2O8UA 2FS8A 1C2GA 2EEKA 5E2OA 5GDSH 2KAIB 1AD8H 3W94A 1P05A 1DUAA 2WUCA 5JBBS 5A8ZA 3QDZB 1C1SA 3RXPA 5EXMA 1B7XB 1M9UA 1SG8B 1VZQH 2XYAA 4BAHB 3MO3A 1O5CB 1O2GH 1SLWB 4YESB 2R2WU 5ETXA 2ZF0H 3SQHE 4VGCC 1OKXA 4JZIA 3RXMA 3F9EA 1AUJA 4JK5A 1EUFA 2AERH 1G3DA 1SHYA 2QXGA 4GVUA 3TGIE 4GHTA 1TPPA 1FAKH 1BTUA 5EQQA 4XDEA 3SNCA 1NC6A 1FMGA 1ZPCA 2BY8X 3GY3A 1DWBH 3MO6A 2HNTE 4X0WU 1O2OA 1VR1H 3FZZA 1TNHA 1GBAA 4CRGA 1P11E 1DSUA 3RLYH 2PKSC 3TK5A 1C2DA 2R3UA 1BA8B 2Q6FA 1AIXH 4NIYA 2FM2A 3LONA 1PPGE 3SJ9A 2HVXA 1Q31A 1GI0A 3P95A 4IC5A 3DA9B 5G4BA 1YLDA 1F5KU 1QIXB 1RGQA 3LU9B 4Y7BA 6LPRA 2W26A 2ESTE 1TMBH 3Q3KA 1ZSLA 3TH2H 4ABFA 1T31A 2GTBA 1SVPA 1GI5A 4UDWH 4CRAA 4O03A 1O31A 1EPTA 5BRRE 1GPZA 1J8AA 2BQWB 1D3QB 3SOSA 2J2UA 1NRNH 1IHTH 4ISNA
chains in the Genus database with same CATH superfamily
2ANMH 2GDDA 4I8JA 3DCLA 1QQUA 3VEQB 1SGIB 3OAAD 1DSTA 1A46H 3ZVFA 1GBDA 2AGEX 2DE9A 2EI7A 2Y82A 1GJDB 1GL1A 4FOUC 1S85A 4B73A 3E3TA 2FOEA 2EQNA 3RXFA 2ZDNA 1KXDA 2PHBA 6ESTA 2YNBA 1DM4B 1O5GH 4BOHA 1H9HE 2C3SA 1GG6B 2SGFE 5GIBA 1NPMA 3P6ZB 2AMDA 2FS9A 2HNTC 3VB5A 1HLTH 2CHAB 1N1LA 3KYFA 3EAJA 2VVVA 4ZROA 1SGEE 1WUNH 3MQKC 2R3YA 1P12E 5LPEA 3I77A 2GZ9A 1JMOH 1QZ8A 3RXJA 1OPHB 1CA0B 2P8OB 1CBWB 1O3IA 1V2UT 1ZSKA 1DVAH 4ISNA 5FL7D 3SJKA 3RXLA 3MH5A 2LPRA 2KCYA 1IAUA 1NM6A 3BG8A 2ASUB 5DKMA 2ZDAH 3PLPA 5GCHF 1UHBB 3MO9A 2HLCA 1G2MA 1TGCA 3TITA 3Q00A 4Z6AH 3N7EA 1S0RA 4YO9A 3S0NA 1NFYA 3UB0A 1DT2A 2PSXA 3SU4A 7ESTE 3UFAA 1FN8A 1QB9A 4ISLA 1E0FD 1GJ8B 4GPGA 5BPEA 2ZDVH 3V0XA 4BXWA 1VITH 3P8NA 4K2YA 1OWDA 5HKKD 1EATA 3PB1E 1FPHH 1SHHB 1O3PB 3BG4B 2KR7A 3GCNA 1O2HA 1C4V2 2C93B 4F49A 4K1EA 1W3CA 5EU8A 2HRVA 1A0JA 1D6WA 1BRBE 3AVZA 1V2RT 2UUJB 2P16A 4PROA 2ZU4A 1GCDA 1TA6A 1V2ST 3SHCH 2WSSD 3MU8A 3OEED 3RXGA 2GV7A 5LPFA 1UW7A 2ODQA 4Q80A 1IOEA 3SV9A 1SQOA 1W12U 4WMDA 1AWFH 2XCNA 1AFQB 4UFEH 1O33A 2G4UA 4MPXA 1ANEA 4INLA 4Q7XA 4CRBA 3NKKA 5L2YH 1ZOMA 1QJ1B 1S6HA 1BIOA 3WY8A 2VIOA 3PO1B 1SKYE 3SU1A 1P2OA 4DURA 1C2MA 1ID5H 1TBRH 4WMEA 1IQNA 1Z8IB 3SU6A 2ZHWH 1Q2WA 5FBEA 2WUBA 1GBIA 1F92A 3B9FH 2W5EA 1H8HD 1WTGH 1AVGH 4JYVH 1ARBA 1GWAA 2BMGB 2ANWA 1L0ZA 1JIRA 4FUDA 2Z6BD 3UOPA 1DANH 1EB1H 2AIPA 3F68H 3LOXA 1QCPA 1ZMLA 2A45B 2QN5T 3LC3A 4I86A 1W7XH 2GCTC 3IWMA 2XTTB 1WQSA 4NA9H 4Q7YA 2RA0A 3ATKA 1P2MA 2RG3A 2RDLA 1G9IE 4INKA 1QBNA 3NZIA 3LGIA 1ANBA 5AVDA 3TGJE 3K6YA 1MABB 2HOBA 2WHXA 3RP2A 3RM0H 1UK2A 3HK6B 3KIDU 3RU4D 1V2LT 4VGCB 2HGTH 4IW4E 4WH6A 1ZRBA 2FX6A 1C5LH 3KGPA 1P8VC 3ATWA 4Y0ZE 2G81E 1QJ7B 2J95A 1H8ED 3RXOA 1C1VH 2GD4B 1DLKB 3QZQA 3QLPH 2K8IA 4I8LA 2A7JA 2W7UA 1A0LA 1E37B 1FAXA 2PKSB 4JYUH 4NWKA 5L30H 2PR3A 2OC1A 2VVCA 1AHTH 1GBFA 4KTSA 2BD4A 3RXEA 1ESBA 3A83A 1GI1A 1W8BH 2BVXH 3KQCA 3UIRA 4UONA 3QTVH 5L6NH 1K9OE 4X1SU 1GHBG 2SGQE 4X1RU 1YY3A 1C1MA 3A8AA 2ZGJA 1LCYA 2F83A 3F9GA 1CHGA 3SI3H 1HAXB 1C5YB 1HIAB 2TPIZ 3OE7D 4AOQA 1OYQA 2KM0A 3GDUA 1GMDF 5EJZA 3URCA 1VITG 2J98A 2SNVA 1TX6A 3GOVB 4A1VA 2KZ4A 4R8TB 4B2AA 2Y80A 2RFKC 1O3HA 2FI3E 5EXLA 1O37A 6GCHF 2UUFB 1CE5A 3K2UA 1L2EA 1KMHB 1O2WA 5F8ZA 1S0QA 4D9QA 3SHAH 3NRLA 4AZ2B 3KHVA 1SSXA 3FAOA 3LC5A 2BXTH 4JK6A 5A0AE 1AKSA 1F0SA 3EGKH 4FUEA 3RXIA 1AO5A 1O2NA 4O9VA 2XC0A 2XW9A 4KKDA 3GDVA 4GSOA 2D1JA 1TX7A 1WAYB 7KMEH 2ZO3H 3F6UH 4B1TA 1BT7A 3SYJA 3ZZDA 3K9XB 4XOJA 3KQEA 2PTNA 2A2XH 3Q3XA 2F9OA 4HTCH 1Y3YA 2ZFPH 5EG4A 1A3BH 1IQJA 2ZFRH 1BMMH 4LZ1H 1SGCA 5B6LA 3QGNB 1C5TA 2F3CE 2XBWA 4D7GA 1EX3A 4A1XA 3VB6A 2B7DH 3RXTA 2Y81A 2Z94A 4UD9H 4UFGH 1CU1A 1VCPA 3QWCH 1O2IA 4MNVA 1AZ8A 1KYNA 3RXSA 1C5SA 2I6SA 4WVPE 2IJD1 5A0BA 5C3NA 1ELVA 3UQOA 4KP0A 1YF4A 1O2QA 2QV1A 1HYLA 1ESAA 2ZU5A 2A4QA 4TWYA 1DS2E 4I33A 1V3XA 4B71A 2VGCC 3B23B 5GWZA 1O39A 1MU8B 4JZFH 3TGKE 1C1PA 4LOYH 2W3IA 1HAZB 3M7QA 5C17A 1TRMA 2A7HA 2G00A 5C5OA 1SGTA 2ZNKH 4GUXA 1XUIA 1VCQA 4CREA 1KLTA 1O3CA 1CA8B 1UCYE 1YPMH 1C1TA 1SGNE 1OP2A 4K1SA 2FOFA 2F9UA 1MZAA 2GX4A 1C5ZB 1XXDA 1NRPH 1RFNA 2BVSH 3MOCA 3E1XB 2Z3DA 1V2QT 3F2FA 3H5CB 3MU1A 1OHHD 2WZQA 3A8CA 2BM2A 4ABDA 4NIXA 1WXRA 1O2JA 1PPZA 1SGPE 1O34A 4GCHF 1GJ7B 1ZGIA 5HM9A 2V6NA 1ACBE 1V2PT 2PP6A 4FETA 3UR9A 5F6MA 3RC4A 3SU5A 1SBWA 1BRUP 1UVPA 1GHXH 1Y5AT 3SNAA 3K65B 4OS2A 3OFND 4CH8B 1TFXA 2GCTB 1OSSA 2FPZA 4IMZA 4AGKA 4MDSA 1P2KA 2GKVE 2A4GA 5LH8A 1SL3A 5PTPA 3P70B 2XXLA 3M5MA 4TY7A 1QA7A 1F5LA 1GI8B 2VH0A 3NUMA 1A1RA 3GYLB 1TGNA 3ZZ3A 1ANDA 3MI4A 3MTYA 3RU4E 2R0LA 2BXUH 2ZG0H 2WPKS 1UK4A 2ZPQA 1KXBA 2P94A 3ZZBA 4X6NA 2QF4A 1ZYOA 2AMPA 4X2WA 1SGRE 3PLBA 3MH6A 1MKWK 2VB0A 1GVKB 1UCYK 2GGVB 4DG4A 1HJ8A 1N8OB 1MKXH 1O3GA 1O5AB 3R3GB 1C5XB 2BX4A 1O35A 2BY9X 2C8WB 1O0DH 4HFPB 1GMCG 4DVAU 1O3BA 3V12A 1BRAA 3ZZAA 1T8OA 4WMFA 4ABIA 2ZI2H 4JCNA 3MU0A 1HAHH 2WYGA 3JZ1B 1ZHRA 1QBVH 5DK1A 1GVLA 2THFB 3MNCA 5B6OA 1TONA 3T25A 3SNBA 1W11U 1Z1IA 2ZGBH 3KNXA 1A3EH 2OC7A 1O2RA 1QGFA 2ZU3A 3M35A 1Z71A 4NZQA 2M5TA 1EPTC 6CHAC 1O2UA 2OBQA 1GHVH 1K1LA 2FESH 3TK6A 2GCHF 2FZZA 3A88A 1FY1A 1SMFE 4NIWA 1S6FA 2SGDE 1P2IA 4F55A 3CENA 3LGWA 4H6SB 1MTVA 1ZPZA 5C5NA 1TNKA 7GCHG 3QGJA 2H1UA 8GCHF 4CRDA 1GBHA 4FUCA 1NFUA 1CGJE 3DSOA 5EJ1A 2HWLB 1QHRB 3AAUA 3AASA 3IITA 1C5PA 1HAOH 3V13A 3SU0A 4YLQH 3E16B 1CHOF 4DGJA 2FOBA 3VG8A 3D23A 2H9EH 1LO6A 3S9BA 1IQMA 5C1YA 2AEIH 5DGJA 2FEQH 1E79D 1ELEE 1HAVA 4BXSA 4KTCA 1KY9A 1GHZA 4ACAA 1EP5A 1BJUA 1GBTA 1G3CA 2RA3A 4NG9H 3RXKA 1EASA 5A8XA 2FYRA 3K6ZA 3V3MA 3GS9A 3GISB 2XC5A 2R2MB 2L6OA 4BTTB 2Y5FA 1GJ4H 2VINA 3A86A 3BTEE 2PWXA 3F2GA 3P92A 2ZHFH 1SR5C 4INHA 3G01A 3UUZA 3Q76A 4WWYA 4CRFA 1EZSC 2ZGXH 1EB2A 3D49H 1ELCA 4Y0YE 3T5FH 4TPIZ 4OS7A 1ZJKA 4ZXXH 2W3KA 5T6GA 1S82A 1O2KA 1C1QA 1MCVA 1UTOA 2GVFA 1WU1A 1RTFB 3ATLA 1IQIA 3T27A 2JDID 1EZUC 5A09A 1MTSA 4P02A 3PMAB 4AGJA 1FJSA 2GZ7A 5C2ZA 3A7YA 1C1NA 1H8IH 1MZDA 3RXVA 3P8FA 2FLRH 2VWNA 4Y71A 4BAOB 2GP9B 2BLQA 3UNSA 1H4WA 1YC0A 4YLUA 3URDA 2BB4A 2P3TB 1Q3XA 3FP8E 2VGCB 1LKAA 2VVUA 4E7NA 5DP8A 1EAIA 4AYYB 1DPOA 2WV5A 4DT7B 3GCTG 4OS1A 3SQEE 1O36A 1AWHB 1BBRH 4NGAH 3WW7A 4A6LA 4NZLA 1T4UH 1LDTT 1LVYA 5EPNA 2P3UB 3V7TA 4FXGH 3ZZ7A 3HK3B 3A7ZA 1FPCH 2AMQA 2UWOA 2G5VA 2IOTA 4Q2KA 1F0TA 2XNIA 1BMAA 2QYIA 3U9AH 4Y8XA 5E0GA 1P9UA 3SUEA 1G37A 1FY8E 1EKBB 3MNSA 2FODA 3MFJA 1EFRD 1C4U2 1Y3XA 4I7YH 1PQAA 1O5FH 1TNLA 1TGBA 2NU1E 2QCYA 1S6LA 1KTSB 2OC0A 3O8BA 2L74A 2H5CA 3S69A 3ZYEA 1UTQA 5FX6A 3EQ0H 1EXFA 5GNDA 3ENSB 1TGSZ 3UWJH 4XSKU 1BMFD 2O8WA 1MBMA 3BV9B 1BMLA 1BJVA 1XMNB 2FOMB 3A7XA 1D9IA 2AFQB 1E34B 2QF3A 2FOAA 1GHAG 3ZV9A 2JETC 3ZZ6A 3RXHA 5J4QA 3DSGA 1SC8U 2ZGCA 1A61H 1K21H 1QRXA 4E05H 1O2YA 4TPYA 2G5NA 1QB1A 4QT8C 1FI8A 4NA7A 4B6EA 4IBLH 1NS3A 2PUXB 2NU2E 3PMJA 1JOUB 2D8WA 4MPWA 1C2LA 1ZGVA 4ZMAH 3SW2B 1J16A 1RIWC 2B8OH 4NA8A 1UTKA 4NWLA 4LXBH 4UFFH 1GDQA 1ZTKA 2G52A 1TB6H 1TNGA 3U8OH 1RJXB 3JZ2B 4CR9A 3LT3A 3PYHA 1GI3A 1Y5UT 8LPRA 5JDUB 1OOKB 2WINI 2CV3A 4ASHA 2CJIA 1EJMA 3UTUH 2PKAA 1O3NA 5GJ4B 2JH5D 3OU0A 4Q63A 1B0FA 3BTGE 1CGIE 2CMYA 1TIOA 1QB6A 2BDGA 1TWXB 3ZZCA 1TE0A 4ABGA 1CT2E 2H6MA 3M61U 1EPTB 3EA8A 4K5ZA 4ZUHA 6CHAB 2A0QB 1JIMA 2BTCE 4K1TA 1LKBA 1LHFH 2GT7A 5FX5A 1C5OH 1NROH 3RXQA 4ISOA 5JBCS 5EW1H 1F0UA 1N6XA 2SNWA 2O8MA 1NFXA 2H2ZA 4SGAE 3U8RH 1JRTA 4Y11E 4AFZA 1C2HA 2ZU2A 4XBCA 3SU3A 5FPSA 2Z9IA 2B9LA 2ZGHA 4Y10E 1K1IA 1GCTC 3P8OA 3NCLA 1B0EA 2V3MA 1O2SA 1P3CA 5C0UA 2ZQ1A 2OINA 2ZFQH 2BZ6H 3PV4A 4DJZB 2VWMA 1SLXB 1C2IA 1S83A 3CS0A 1WBGB 2XWBI 2PLXA 4NIVA 3MHWU 2FLBH 2C8YB 1EZQA 4FVBA 2EY4C 1HB0B 1UJ1A 4ABHA 2PGBB 3SGBE 2A4RA 3ZZ8A 3MNXA 2CN0H 4FUFA 1GJAB 1OWKA 3DFJA 2EA3A 4RT0A 2ZDMA 3F9FA 2W6ID 5DG6A 3SV7A 2BOHB 4D76A 1XKAC 2P93A 4CHAC 2Y7ZA 3F9HA 3TLOA 2CGAA 2PFEA 1L1NA 2BX3A 1C1RA 3F1SB 1SLUB 1H8DH 1ZSJA 2Z7FE 3ATIA 5GXPA 3TVJB 1AZZA 1O2PA 3A81A 1TLDA 3WWBA 5EQRA 1ETTH 3FFGA 3O8CA 3H7OA 3SV8A 1DITH 1SGYE 4X8SH 1XUGA 1GL0E 2Z9GA 3PWBA 2QXIA 1UK3A 1FDPA 4K60A 4XFQA 4AFSA 1LQDB 3RMNH 4B2CA 3NK8A 1IQEA 4DCDA 2VIVA 2DUCA 3PTBA 4MPUA 3BTTE 3VPKA 1TOCB 1N8OC 1ZZZA 3DUXH 4MPVA 3FOAA 1TQ0B 1DWCH 4BAQB 1GBMA 1AB9C 1YPLH 1RRKA 1GI9B 3GY7A 1P06A 1CO7E 3TPIZ 2ULLA 4YOGA 2FOCA 1SLVB 3DSPA 4HG6A 3TNSA 1AI8H 3UPEA 3I78A 2OUAA 3EDXB 3RMMH 5KECA 2WYJA 1YPEH 1P3EA 3LJOA 4J2YB 1EJAA 3T26A 4RN6A 3KCGH 1ZMNA 1FY3A 1TMUH 1NRSH 2BD9A 3F0PA 4I32A 1AVWA 1O3FA 4F48B 1K0HA 4O3UA 1UTJA 1V2OT 3QTOH 2C4FH 5HXFA 1K1NA 5DPAA 2NWNA 4MG3A 2PV9B 1YLNA 2J92A 1LPKB 1FQ3A 1F7ZA 5HGGA 1V2JT 5EXNA 1TRNA 4X1PU 5A2MH 1CT0E 1UVOA 3ITIA 3U8TH 1GDUA 1MD8A 2LELA 1D6RA 1COWD 3SI4H 3ZVCA 1N6YA 3RDZA 1GI7B 1ZTLA 3SJOA 4WXIA 1VJAU 1A7SA 2GV6A 1HCGA 4A92A 3SJ8A 1KLIH 4RSPA 2STAE 1SI5H 1SOTA 2VIDA 1BCUH 5CE1A 3O8DA 3STIA 4RT1A 3ZVDA 2JETB 1V2NT 2KCPA 5HYOA 1EAXA 1O2ZA 1O5EH 2XWAA 4Y6DA 4BAKB 3BTWE 3ZVGA 2BY5X 4DW2U 3KYGA 4IS5A 1NU9A 4OGYA 3SO3A 4Y79A 2AHME 1C5NH 1C4Y2 3EA7A 1V2KT 1GHWH 3M36A 3M7TA 1FY4A 2LNCA 1OYTH 1NBMD 1SB1H 2WPMS 1THPB 3UNQA 5EGMA 2ZP0H 1YM0A 1UTNA 1RIWB 1HXEH 5FPTA 1OXGA 1VJ9U 3TJVA 4MNWA 2GMTC 2QF0A 4WH8A 2KCAA 1DY8A 1ORFA 1UTLM 4YTAA 1G32B 2LP6A 1QRWA 3M5NA 2ZDLA 2HPPH 3D65E 2A31A 3GY6A 1OWIA 3OX7U 1ZPBA 1KDQA 1E36B 5AFYH 4E7RG 1BITA 1C5UA 1L1GA 1S84A 2DE8A 4ASUD 2QF5A 3A8BA 2A32A 1VGCC 2VIWA 3PWCA 1DXPA 2CXVA 2ZHQH 2YOLA 2BDCA 1WSSH 3BTQE 1OP8A 4ZHAA 2ZCLP 5JPMH 1MAXA 2UWPA 4HZHA 3LH3A 1YCPM 3AW1A 1SGFG 2FP7B 1YKTA 1EZXC 2J98B 2OBOA 3LKWA 2ZZUH 3SORA 2BD8A 1Z1JA 2Y5HA 2V3HH 1GI2A 1ELBA 2ZIQH 1QA0A 1P57B 1RD3B 5DP3A 1O2XA 1FY5A 1YCPK 4SGBE 4Y76A 1GHBF 3GCHC 5FHTA 2FI4E 3VB3A 4XBBA 3DHKH 1D3PB 1DFPA 4GLYA 3OTJE 1W7GH 3QK1A 1ZHMA 3EA9A 4BAMB 1C1WH 1THRH 4MQAA 3P8GA 1GCTB 4UE7H 5TJXA 5IK2D 4B76A 2ZC9H 3LPRA 4WY3A 5DO4H 1QL8A 2XOKD 1AKSB 3U28C 3BEIB 4H6TA 1LPGB 2G51A 3TJOA 3E6PH 1GMHG 3RM2H 1O3OA 1VITF 4FVDA 3F2HA 1CHOG 2ZECA 4ABBA 2ZDKA 1ELDE 2SGAA 4TY6A 5EOKA 1NESE 1SPJA 1MU6B 3A8DA 3HATH 1SQRA 1W0KD 3U98H 2KCOA 1P2NA 2IPHA 4ZAEA 3TIUA 2VU8E 2OD3B 1P2JA 3Q77A 1EP6A 4CH2B 5DN6D 1KIGH 1CVWH 5T1VA 2A2QH 1QY6A 5CHAB 3M5OA 4CHAB 1E1RD 4ZXYH 2ODYB 4YM9A 3PLKA 3PV5A 1MH0A 1MMJN 4LK4A 1XUHA 5L2ZH 1IHSH 4HGCA 1EJNA 4B75A 3GY4A 2O8TA 2Q6GA 3S7HB 1Z8GA 3FP7E 3PRDA 5DP9A 1DDJA 3LGYA 2C8XB 2ZTYA 1C1OA 2JH0D 1PPCE 1A4WH 1CT4E 3N99A 3S7KB 1AB9B 1RS0A 2Z9JA 1QJ6B 3GYMA 1G36A 3ESTA 1TPSA 2BD7A 2FOGA 4KTUA 4YXWD 2KAIA 2TIOA 1GJBB 2JJ1D 4BANB 1NO9H 2TBSA 1O5BB 2ZKSA 5DJ7A 3S9AA 4D9RA 4X8UH 4YT6H 5HMAA 2M2AA 5HM2A 4A5TS 4AYVB 1AGJA 2QE7D 3L6PA 3SUGA 4IC6A 1W13U 1TOMH 1A5IA 3BEUA 2WPIS 2TGAA 3KQ5A 3UY9A 3E0NB 3QUMP 1TA2A 1QR3E 5DP5A 3DD2H 1ANCA 1Y3VA 1TNJA 1W2KH 4NSYA 2TGDA 3A7TA 4MTBA 1G30B 1DX5M 5I25A 4U30A 1THSH 1BTZA 3T62A 5TCAA 1V2MT 1HGTH 5FAHA 4D7FA 1S81A 1P03A 7LPRA 5DP6A 4OS5A 5C94A 1YGCH 4AFUA 1TQ7B 1D3TB 1A0HB 1QL7A 1QBOA 5KGOA 3PM3A 1TABE 4WF8A 1QNJA 3IG6B 1JXPA 1UTMA 4GHQA 4I8KA 5F53A 1OX1A 1FXYA 1J14A 1ETRH 1FLEE 1Y3UA 1SGQE 1YCPH 5CHBA 4AB8A 1BB0B 1LHEH 4FU8A 3MYWA 2JKHA 2QA9E 1TBZH 1XUKA 2FXRA 5JBTA 1AMHA 1P01A 5EODA 5CDFE 1NFWA 2QY0B 1DE7H 1AE8H 1BQYA 5TCCA 2ANYA 2SGPE 3T2NA 1PPFE 4RI0A 4TWWA 5JB8S 3LGVA 4ABEA 3VGCC 1ZTJA 1LPZB 3AW0A 1PYTD 2BD2A 2OTVA 3SV6A 3ODDA 5E0JA 1S5SA 2F43B 1MCTA 5DP7A 4OM9A 3KQBA 1E1QD 1NBME 3QO6A 1W10U 2J5UA 3FVFB 2A5KA 2GMTB 4IGDA 4R0IA 1HXFH 2OCVB 2BOKA 2ALVA 1W0JD 2WV9A 1KXAA 1K1PA 1HAYB 2Y7XA 4NCYA 4MNXA 1P0SH 4TT3D 1F0RA 1LVOA 2PSYA 4ISHH 1O2TA 2ANKH 2AGIX 3M3SA 4UFDH 1RTLA 3M5LA 1XUFA 1BHXB 2A5AA 1CSOE 5ESBA 3UR6A 1KXEA 2FOHA 1VGCB 4IN2A 3BTHE 4FUHA 5GCHG 1LMWB 1YYY1 4H42U 2P3FH 4ESTE 2ZPSA 1PQ5A 4BNRA 5C1XA 3A7WA 2ZTXA 3NPSA 4Z1MD 1HJAC 1BTPA 1KTTB 1DICA 1BMNH 2ALPA 1FUJA 2V7QD 1GMCF 1XVOA 4U32A 1MKWH 1UCYH 3DFLA 1GJ9B 2O8LA 3TH4H 1YPGH 4FUIA 5EJLA 3BN9A 1ETSH 2UUKB 4RKJB 3GCHB 1FNIA 1L1JA 2VIQA 3QX5H 1SQTA 1ARCA 5E2PA 1XUJA 4X6MA 4DIIH 1JBUH 4K8BA 2Z9KA 1ZRKA 3STJA 1HAVB 1O3EA 1RXPA 1UHBA 2IPQX 2QIQA 5K7RA 1C2JA 4JZEH 1JWTA 1KXCA 2A5IA 1V2VT 2HALA 5K0HA 1A2CH 1WV7H 1MTUA 5T6DA 1LVBA 1MD7A 1WTHD 7GCHF 3B8JA 1NU7B 5E0HA 1P2QA 4ZHLU 1EOJA 2FTLE 4XBDA 4YZUA 4NSVA 2QXJA 3ATMA 2H9HA 4ZKOU 1E38B 1EAWA 3UWIA 2JJ2D 2STBE 2G55A 4X8VH 2BDAA 1V2WT 1CQQA 1GBCA 2TRMA 2V35A 1SFIA 2JH6D 1DXWA 4A7IB 3DT0H 2A1DB 1GHYH 5LPRA 3LIWA 1FZZA 1NT1A 1HAIH 1C5VA 1UVTH 2W7SA 3ODFA 1SGDE 3MU4A 3RC6A 4I8HA 1BTWA 3SN8A 4CR5A 1P10A 3A87A 4JZ1A 5E8EH 4DY7B 1C5MD 1O3LA 1O3DA 1W0ZU 2Z9LA 1T8NA 3VFEA 2FDAA 4BTIB 2BDBA 3GCOA 4K69A 4X6OA 2FX4A 2GDEH 4JYTA 2ZQ2A 4FUJA 3MMGA 3UQVA 4ABJA 2CF9H 1GBEA 2TGPZ 5AFZH 3M3TA 3P17H 1H9IE 2BZAA 1KXFA 2BD5A 1YPHE 1P04A 2ZU1A 4U01A 1WYKA 1ZR0A 3N7DA 1HDTH 1QRZA 2AH4X 1YWUA 1P09A 1K28D 1SQAA 2G4TA 3UAIC 2VH6A 3A85A 3A7VA 1L4ZA 2G8TA 4I31A 1O38A 1HRTH 4FU9A 2I6QA 2EI8A 2BLVA 5A8YA 1MBQA 2ZWLH 3TJUA 1T8MA 1PPEE 1PPBH 1DOJA 4MLFB 1W0YH 1IQFA 4OGXA 1K1MA 3ZVEA 2V3OH 1HPGA 5GPIB 1SOZA 2PUQH 3ELAH 1BTYA 2K1QA 3MU5A 2F4LA 3A80A 1LHGH 5IDKA 2BDIA 3SNEA 1OWJA 3GCTF 2VIPA 1Y5BT 3FKSD 4M9FA 3SGAE 1AY6H 3R0FA 1G3BA 2AGGX 2BVRH 4Y8ZA 3ZZ4A 1FX0B 1T32A 2ZFFH 1BHXF 1O5DH 1GMDG 3SUDA 3HGNA 5C67A 2FYQA 5EW2H 1W14U 2OQUA 1HAGE 1GBJA 2ZHEH 3E90B 3SZEA 4AB9A 1QL9A 2ODPA 5F8TA 3SZNA 4OS4A 2OQ5A 1ZLRA 2ZCKP 3U1JB 6GCHG 2BY6X 1ZJDA 1CGHA 3H7TA 3M37A 1Y8TA 2UWLA 3TNTA 4AN7A 2IN2A 2BDHA 2XRCA 1YPHC 3KL6A 3VGCB 1HIAA 3D62A 3NXPA 5DP4A 2F9VA 3GY2A 2OXSA 1UMAH 4DOQA 3MH4A 1LHDH 5CHAC 5FPYA 2Y5GA 4DT4A 3OY6U 2W6JD 3ZVBA 1AUTC 1OS8A 3C27B 3GDSA 3TK9A 1V2TT 4Y8YA 1OWEA 3MH7A 3CP7A 3KQDA 3LH1A 1DWEH 1GHAF 4AG1A 1A5GH 3EE7A 3PMBB 1JRSA 1ZHPA 1MQ6A 2PKAB 2KFWA 2OP9A 4X1QU 5FBIA 3SV2H 2RCEA 2F9BH 4AG2A 1GJCB 1XX9A 1FIWA 1OWHA 1J17T 1GGDC 3RXRA 1DY9A 2B0FA 3BEFB 1MTWA 3HPTB 1KSNA 1MAYA 1C5WB 2OC8A 2VWOA 3BTDE 2FO9A 3PTNA 4X8TH 1HJAB 1D3DB 1LVMA 1SFQB 4BTUB 1SGFA 1K1JA 3TU7H 4RKOB 3MWIU 3OSYA 4X6PA 1B5GH 5DSFA 1QURH 1Z6EA 3PMHB 3HGPA 4YOJA 4B2BA 1WOFA 1C5QA 1O3AA 3SNDA 1TPOA 1TPAE 4KELA 4XE4A 4TYDA 1G2LA 1HJ9A 1X7AC 2SFAA 4IN1A 1TBQH 2FWWA 2B5TB 1MTNC 1UO6A 2WPHS 3OY5U 4JMYA 4U2WA 2QGRA 3T28A 1NRRH 3PROA 1YPKH 3AAVA 2R9PA 2J38A 2Z3EA 2WPLS 3E8LA 1WDIA 5HIZA 1TX8A 1F2SE 2BYAX 4AC9A 3ZZ9A 3KEEA 1ESTA 1QFKH 4ZHMU 2EC9H 2NU4E 2IJOB 1PYTC 1ABIH 3GICB 1PJPA 3N7OA 1AU8A 1C2KA 3SJIA 3FP6E 8KME2 3LDXH 2QXHA 2ZPRA 4GCHG 1LHCH 3W1EA 1UVUH 1Y59T 4YT7H 1HV7A 3MNBA 1GBBA 3OTPA 1BTHH 1VCWA 1MQ5A 2BDYA 4Q4LA 1IQHA 3H09A 2BD3A 4CBNA 1NZQH 1O32A 2FTMA 2Y6TA 2XC4A 2PW8H 5C1UA 3VXEH 5FCRA 1D4PB 1YLCA 4WXVA 1IQKA 2BY7X 1E35B 3ZZ5A 1AQ7A 2J94A 5ESTE 1ZMJA 2FI5E 1L4DA 2GT8A 1TRYA 2JIZD 1EOLA 2XBVA 1NRQH 2C90B 1P02A 3T29A 2NU0E 1O3MA 3S9CA 1MKXK 3E0PB 3UOUA 1GJ5H 4I8GA 3RXCA 1GBKA 1HNEE 5LGOA 1EQ9A 4AFQA 3RC5A 2BQ7B 5JYIA 2SGEE 1BZXE 5C20A 3GY5A 1KLJH 5F8XA 1H1BA 1BOQA 1NY22 1O2LA 2WPJS 1AVXA 4H4FA 1YBWA 4X2YA 2VWLA 2YMSC 5EPYA 4ZKSU 1GDNA 2OLGA 1WQVH 1Y3WA 1Z8JB 3QZRA 1IQLA 2PTCE 1Z6JH 4AORA 2F9NA 2KX4A 2BQ6B 3CNRA 1C9PA 1ELFA 2V0BA 2ZEBA 2ZFSA 4ABAA 5A0CA 1K2I1 3E91A 1J15A 1BUIA 3F0OA 2HLDD 1YP9A 1LTOA 3M3VA 4F4OC 1UVSH 2D26C 1DUEA 3KN2A 2ZFTA 4Z0KA 5HIYA 2O9QA 3UREA 4A1TA 3L33A 3RUOA 2ZCHP 1PFXC 3O8RA 1C2EA 2Q1JA 1PPHE 4XD7D 5F03A 2GCHG 2QC2A 1HAPH 4O3TA 5ABWA 2FMJA 1Z7KA 2EI6A 3BIUH 4K3JA 4YOIA 3A84A 1MUEB 1XM1A 4NFEA 3AK5A 5T3HA 8GCHG 4X2XA 1NTPA 1FIZA 2F91A 1FV9A 1GJ6A 2CF8H 2RDEA 1FN6A 1TMTH 5I46H 1BTXA 1DWDH 1BBRE 2J4IA 1O2VA 2VNTA 2BLWA 3BTKE 1AN1E 1K22H 1DLEA 3TJNA 2BLOA 5H4IB 5AHGH 2ILNA 1UTPA 3I29A 3OEHD 1HBTH 3C1KA 1P9SA 3L3TA 9LPRA 1GI6A 4FU7A 1C5RA 1AFEH 9ESTA 4J1YA 4NFFA 3VXFH 2HPQH 1XVMA 2XBYA 3BF6H 3BSQA 4ZKNU 4AX9H 3QN7A 3LGTA 1J9CH 4OS6A 1U6QA 4E06H 3BTFE 3W95A 1F5RA 4KGAA 1A5HA 1TALA 3OYPA 3SGQE 5CMXH 3NWUA 1C1UH 1T4VH 5FCKA 1RTKA 3RMOH 1C2FA 1KDQB 1Z8RA 3FZDA 4K8YA 1O3KA 1BDAA 3Q3YA 3ZYDA 1TYNA 1HFDA 2Z3CA 1XXFA 2BHGA 1PQ7A 4IMQA 2P59A 1GGDB 2OK5A 4FUGA 4ZKRU 2UUYA 1K1OA 2H9TH 1G3EA 1GG6C 3LJJA 2GZ8A 4GAWA 8ESTE 1O3JA 1T8LA 3GY8A 3EE0B 5EQSA 2ZTZA 2CHAC 2D2DA 3A89A 3F3BA 4THNH 4TSFD 1GVZA 4X2VA 1V6DA 3U69H 2WPDD 4MVNA 3SU2A 1NN6A 1CA0C 3M7UA 1GI4A 2P8OC 2ZHDA 1CBWC 4M7GA 3RLWH 1PQ8A 4B6FA 2XCFA 2P95A 1BBRK 1TNIA 3SBKA 3VB4A 4DIHH 3SUFA 3RMLH 4CRCA 3ZV8A 3PV2A 2ZA5A 4FUBA 4XRNA 2R0KA 3RXUA 3U1IB 1MTNB 2FIRH 4Q7ZA 2TGTA 2AS9A 1C9TA 1QQ4A 3CS7A 1O30A 2AIQA 3LGUA 2VBCA 1ELGA 2F9PA 2H5DA 2WV4A 2HNTF 3PRBA 5IYTA 1INCA 4ZH8A 4MNYA 5FXLA 3ZVAA 1QTFA 5JB9S 4JZDH 3BTME 1OP0A 3FN8A 5J4SA 3RXDA 4CBOA 4X1NU 1LQEA 1O2MA 2PGQB 5JBAS 3RU4T 1H9LB 3BG4C 4ISIH 1FONA 1AE5A 3HKIB 4D8NA 1ABJH 4UEHH 2VJ1A 2A4OA 3VB7A 2Q6DA 3HKJB 1EAUA 5SGAE 3EYDA 4LZ4B 3TH3H 3UNRA 2J97A 2J9NA 2NU3E 3A82A 1AFQC 4WJG2 4Y7AA 3FANA 1GMHF 1XKBC 1TGTA 4O97A 1IQGA 2QAAA 2C8ZB 1ELAA 5AF9H 1HUTH 2YNAA 3PO1C 3KF2A 2K0QA 1GBLA 1WCZA 4B74A 4HI3A 2AYWA 1T7CA 3RXBA 5EIYA 1BRCE 1YPJH 2A7CA 2XBXA 1ELTA 1TAWA 3FO8D 3BIVH 2J34A 5T6FA 3RXAA 2O8UA 2FS8A 1C2GA 2EEKA 3ZIAD 5E2OA 5GDSH 2KAIB 1AD8H 2XNDD 3W94A 1P05A 1DUAA 2WUCA 1VKYA 5JBBS 5A8ZA 2YMSB 3QDZB 1C1SA 3RXPA 5EXMA 1B7XB 1M9UA 1SG8B 1VZQH 2XYAA 4BAHB 3MO3A 1O5CB 1O2GH 1SLWB 4YESB 2R2WU 5ETXA 5KEDA 2ZF0H 4P00A 3SQHE 4VGCC 1OKXA 4ZCNA 4JZIA 3RXMA 3F9EA 1AUJA 4JK5A 1EUFA 2AERH 1G3DA 1SHYA 2QXGA 4GVUA 3TGIE 4GHTA 1TPPA 1FAKH 1BTUA 5EQQA 4XDEA 3SNCA 1NC6A 1FMGA 1ZPCA 2BY8X 3GY3A 1DWBH 3MO6A 2HNTE 4X0WU 1O2OA 1VR1H 3FZZA 4ACBA 2CK3D 1TNHA 1GBAA 4CRGA 1P11E 1DSUA 3RLYH 2PKSC 3TK5A 2YMSD 1C2DA 2R3UA 1BA8B 2Q6FA 1AIXH 4NIYA 2FM2A 3LONA 1PPGE 3SJ9A 2HVXA 1Q31A 1GI0A 3P95A 4IC5A 3DA9B 5G4BA 1YLDA 3WWFA 1F5KU 1QIXB 1RGQA 3LU9B 4Y7BA 6LPRA 2W26A 2ESTE 1TMBH 3Q3KA 1ZSLA 3TH2H 4ABFA 1T31A 2GTBA 1SVPA 1GI5A 4UDWH 4CRAA 4O03A 1O31A 1EPTA 5BRRE 1GPZA 1J8AA 2BQWB 1D3QB 2HVYB 3SOSA 2J2UA 1NRNH 1IHTH 2GJGA 5C0TA
chains in the Genus database with same CATH topology
2ANMH 2GDDA 4I8JA 1QQUA 3VEQB 1SGIB 1DSTA 1A46H 3ZVFA 1GBDA 2AGEX 2DE9A 2EI7A 2Y82A 1GJDB 1GL1A 1S85A 4B73A 3E3TA 2FOEA 3RXFA 2ZDNA 1KXDA 2PHBA 6ESTA 2YNBA 1DM4B 1O5GH 4BOHA 1H9HE 2C3SA 1GG6B 2SGFE 5GIBA 1NPMA 3P6ZB 2AMDA 2FS9A 2HNTC 3VB5A 1HLTH 2CHAB 1N1LA 3EAJA 2VVVA 4ZROA 1SGEE 1WUNH 2R3YA 1P12E 5LPEA 3I77A 2GZ9A 1JMOH 3RXJA 1OPHB 1CA0B 2P8OB 1CBWB 1O3IA 1V2UT 1ZSKA 1DVAH 3SJKA 3RXLA 3MH5A 2LPRA 1IAUA 1NM6A 3BG8A 2ASUB 5DKMA 2ZDAH 3PLPA 5GCHF 1UHBB 3MO9A 2HLCA 1G2MA 1TGCA 3TITA 3Q00A 4Z6AH 4YO9A 1S0RA 3S0NA 1NFYA 1DT2A 2PSXA 3SU4A 7ESTE 3UFAA 1FN8A 1QB9A 4ISLA 1E0FD 1GJ8B 4GPGA 5BPEA 2ZDVH 3V0XA 4BXWA 1VITH 3P8NA 4K2YA 1OWDA 1EATA 3PB1E 1FPHH 1SHHB 1O3PB 3BG4B 3GCNA 1O2HA 1C4V2 2C93B 4F49A 4K1EA 1W3CA 5EU8A 2HRVA 1A0JA 1D6WA 1BRBE 3AVZA 1V2RT 2UUJB 2P16A 4PROA 2ZU4A 1GCDA 1TA6A 1V2ST 3SHCH 3MU8A 3RXGA 2GV7A 5LPFA 2ODQA 4Q80A 1IOEA 3SV9A 1SQOA 1W12U 4WMDA 1AWFH 2XCNA 1AFQB 4UFEH 1O33A 2G4UA 4MPXA 1ANEA 4INLA 4Q7XA 4CRBA 3NKKA 5L2YH 1ZOMA 1QJ1B 1S6HA 1BIOA 3WY8A 2VIOA 3PO1B 3SU1A 1P2OA 4DURA 1C2MA 1ID5H 1TBRH 4WMEA 1IQNA 1Z8IB 3SU6A 2ZHWH 1Q2WA 5FBEA 2WUBA 1GBIA 1F92A 3B9FH 2W5EA 1WTGH 4JYVH 1AVGH 1ARBA 1GWAA 2BMGB 2ANWA 1L0ZA 1JIRA 4FUDA 2Z6BD 3UOPA 1DANH 1EB1H 2AIPA 3F68H 3LOXA 1QCPA 1ZMLA 2A45B 2QN5T 3LC3A 1W7XH 2GCTC 3IWMA 2XTTB 1WQSA 4NA9H 4Q7YA 2RA0A 3ATKA 1P2MA 2RG3A 2RDLA 1G9IE 4INKA 1QBNA 3NZIA 3LGIA 1ANBA 5AVDA 3TGJE 3K6YA 2HOBA 3RP2A 3RM0H 1UK2A 3HK6B 3KIDU 3RU4D 1V2LT 4VGCB 2HGTH 4IW4E 4WH6A 1ZRBA 2FX6A 1C5LH 3KGPA 1P8VC 3ATWA 4Y0ZE 2G81E 1QJ7B 2J95A 3RXOA 1C1VH 2GD4B 1DLKB 3QZQA 3QLPH 4I8LA 2A7JA 2W7UA 1A0LA 1E37B 1FAXA 2PKSB 4JYUH 4NWKA 5L30H 2PR3A 2OC1A 2VVCA 1AHTH 1GBFA 4KTSA 2BD4A 3RXEA 1ESBA 3A83A 1GI1A 1W8BH 2BVXH 3KQCA 3UIRA 4UONA 3QTVH 5L6NH 1K9OE 4X1SU 1GHBG 2SGQE 4X1RU 1C1MA 3A8AA 2ZGJA 1LCYA 2F83A 3F9GA 1CHGA 3SI3H 1HAXB 1C5YB 1HIAB 2TPIZ 4AOQA 1OYQA 3GDUA 1GMDF 3URCA 1VITG 2SNVA 1TX6A 3GOVB 4A1VA 4R8TB 4B2AA 2Y80A 1O3HA 2FI3E 5EXLA 1O37A 6GCHF 2UUFB 1CE5A 3K2UA 1L2EA 1O2WA 5F8ZA 1S0QA 4D9QA 3SHAH 4AZ2B 3KHVA 1SSXA 3FAOA 3LC5A 2BXTH 4JK6A 5A0AE 1AKSA 1F0SA 3EGKH 4FUEA 3RXIA 1AO5A 1O2NA 4O9VA 2XC0A 2XW9A 4KKDA 3GDVA 4GSOA 2D1JA 1TX7A 1WAYB 7KMEH 2ZO3H 3F6UH 4B1TA 1BT7A 3ZZDA 3K9XB 4XOJA 3KQEA 2PTNA 2A2XH 3Q3XA 2F9OA 4HTCH 1Y3YA 2ZFPH 5EG4A 1A3BH 1IQJA 2ZFRH 1BMMH 4LZ1H 1SGCA 3QGNB 1C5TA 2F3CE 2XBWA 4D7GA 1EX3A 4A1XA 3VB6A 2B7DH 3RXTA 2Y81A 2Z94A 4UD9H 4UFGH 1CU1A 1VCPA 3QWCH 1O2IA 4MNVA 1AZ8A 1KYNA 3RXSA 1C5SA 2I6SA 4WVPE 5A0BA 5C3NA 1ELVA 3UQOA 4KP0A 1YF4A 1O2QA 2QV1A 1HYLA 1ESAA 2ZU5A 2A4QA 4TWYA 1DS2E 4I33A 1V3XA 4B71A 2VGCC 3B23B 5GWZA 1O39A 1MU8B 4JZFH 3TGKE 1C1PA 4LOYH 2W3IA 1HAZB 3M7QA 1TRMA 2A7HA 2G00A 5C5OA 1SGTA 2ZNKH 4GUXA 1XUIA 1VCQA 4CREA 1KLTA 1O3CA 1CA8B 1UCYE 1YPMH 1C1TA 1SGNE 1OP2A 4K1SA 2FOFA 2F9UA 1MZAA 2GX4A 1C5ZB 1XXDA 1NRPH 1RFNA 2BVSH 3MOCA 3E1XB 2Z3DA 1V2QT 3H5CB 3MU1A 3A8CA 2BM2A 4ABDA 4NIXA 1O2JA 1PPZA 1SGPE 1O34A 4GCHF 1GJ7B 1ZGIA 5HM9A 2V6NA 1ACBE 1V2PT 3UR9A 5F6MA 3RC4A 3SU5A 1SBWA 1BRUP 1UVPA 1GHXH 1Y5AT 3SNAA 3K65B 4OS2A 4CH8B 1TFXA 2GCTB 1OSSA 2FPZA 4IMZA 4AGKA 4MDSA 1P2KA 2GKVE 2A4GA 5LH8A 1SL3A 5PTPA 3P70B 2XXLA 3M5MA 4TY7A 1QA7A 1F5LA 1GI8B 2VH0A 3NUMA 1A1RA 3GYLB 1TGNA 3ZZ3A 1ANDA 3MI4A 3MTYA 3RU4E 2R0LA 2BXUH 2ZG0H 2WPKS 1UK4A 2ZPQA 1KXBA 2P94A 3ZZBA 4X6NA 1ZYOA 2AMPA 4X2WA 1SGRE 3PLBA 3MH6A 1MKWK 2VB0A 1GVKB 1UCYK 2GGVB 4DG4A 1HJ8A 1N8OB 1MKXH 1O3GA 1O5AB 3R3GB 1C5XB 2BX4A 1O35A 2BY9X 2C8WB 1O0DH 4HFPB 1GMCG 4DVAU 1O3BA 3V12A 1BRAA 3ZZAA 1T8OA 4WMFA 4ABIA 2ZI2H 4JCNA 3MU0A 1HAHH 2WYGA 3JZ1B 1ZHRA 1QBVH 5DK1A 1GVLA 2THFB 3MNCA 5B6OA 1TONA 3T25A 3SNBA 1W11U 1Z1IA 2ZGBH 3KNXA 1A3EH 2OC7A 1O2RA 1QGFA 2ZU3A 3M35A 1Z71A 4NZQA 2M5TA 1EPTC 6CHAC 1O2UA 2OBQA 1GHVH 1K1LA 2FESH 3TK6A 2GCHF 2FZZA 3A88A 1FY1A 1SMFE 4NIWA 1S6FA 2SGDE 1P2IA 3CENA 3LGWA 4H6SB 1MTVA 1ZPZA 5C5NA 1TNKA 7GCHG 3QGJA 2H1UA 8GCHF 4CRDA 1GBHA 4FUCA 1NFUA 1CGJE 2HWLB 1QHRB 3AAUA 3AASA 3IITA 1C5PA 1HAOH 3V13A 3SU0A 4YLQH 3E16B 1CHOF 4DGJA 2FOBA 3D23A 2H9EH 1LO6A 3S9BA 1IQMA 5C1YA 2AEIH 5DGJA 2FEQH 1ELEE 1HAVA 4BXSA 4KTCA 1KY9A 1GHZA 1EP5A 1BJUA 1GBTA 1G3CA 2RA3A 4NG9H 3RXKA 1EASA 5A8XA 2FYRA 3K6ZA 3V3MA 3GISB 2XC5A 2R2MB 4BTTB 2Y5FA 1GJ4H 2VINA 3A86A 3BTEE 2PWXA 3P92A 2ZHFH 1SR5C 4INHA 3G01A 3UUZA 3Q76A 4WWYA 4CRFA 1EZSC 2ZGXH 1EB2A 3D49H 1ELCA 4Y0YE 3T5FH 4TPIZ 4OS7A 1ZJKA 4ZXXH 2W3KA 5T6GA 1S82A 1O2KA 1C1QA 1MCVA 1UTOA 2GVFA 1WU1A 1RTFB 3ATLA 1IQIA 3T27A 1EZUC 5A09A 1MTSA 3PMAB 4AGJA 1FJSA 2GZ7A 5C2ZA 3A7YA 1C1NA 1H8IH 1MZDA 3RXVA 3P8FA 2FLRH 2VWNA 4Y71A 4BAOB 2GP9B 2BLQA 3UNSA 1H4WA 1YC0A 4YLUA 3URDA 2BB4A 2P3TB 1Q3XA 3FP8E 2VGCB 1LKAA 2VVUA 4E7NA 5DP8A 1EAIA 4AYYB 1DPOA 2WV5A 4DT7B 3GCTG 4OS1A 3SQEE 1O36A 1AWHB 1BBRH 4NGAH 4A6LA 4NZLA 1T4UH 1LDTT 1LVYA 5EPNA 2P3UB 3V7TA 4FXGH 3ZZ7A 3HK3B 3A7ZA 1FPCH 2AMQA 2UWOA 2G5VA 2IOTA 4Q2KA 1F0TA 2XNIA 1BMAA 2QYIA 3U9AH 4Y8XA 5E0GA 1P9UA 3SUEA 1G37A 1FY8E 1EKBB 3MNSA 2FODA 3MFJA 1C4U2 1Y3XA 4I7YH 1PQAA 1O5FH 1TNLA 1TGBA 2NU1E 2QCYA 1KTSB 2OC0A 3O8BA 2H5CA 3S69A 3ZYEA 1UTQA 5FX6A 3EQ0H 1EXFA 3ENSB 1TGSZ 3UWJH 4XSKU 2O8WA 1MBMA 3BV9B 1BMLA 1BJVA 1XMNB 2FOMB 3A7XA 1D9IA 2AFQB 1E34B 2QF3A 2FOAA 1GHAG 3ZV9A 2JETC 3ZZ6A 3RXHA 5J4QA 1SC8U 2ZGCA 1A61H 1K21H 1QRXA 4E05H 1O2YA 4TPYA 2G5NA 1QB1A 4QT8C 1FI8A 4NA7A 4IBLH 1NS3A 2PUXB 2NU2E 3PMJA 1JOUB 2D8WA 4MPWA 1C2LA 1ZGVA 4ZMAH 3SW2B 1J16A 1RIWC 2B8OH 4NA8A 1UTKA 4NWLA 4LXBH 4UFFH 1GDQA 1ZTKA 2G52A 1TB6H 1TNGA 3U8OH 1RJXB 3JZ2B 4CR9A 3LT3A 3PYHA 1GI3A 1Y5UT 8LPRA 5JDUB 1OOKB 2WINI 2CV3A 4ASHA 2CJIA 1EJMA 3UTUH 2PKAA 1O3NA 5GJ4B 2JH5D 3OU0A 1B0FA 3BTGE 1CGIE 2CMYA 1TIOA 1QB6A 2BDGA 1TWXB 3ZZCA 1TE0A 4ABGA 1CT2E 2H6MA 3M61U 1EPTB 3EA8A 4K5ZA 4ZUHA 6CHAB 2A0QB 1JIMA 2BTCE 4K1TA 1LKBA 1LHFH 2GT7A 5FX5A 1C5OH 1NROH 3RXQA 4ISOA 5JBCS 5EW1H 1F0UA 1N6XA 2SNWA 2O8MA 1NFXA 2H2ZA 4SGAE 3U8RH 1JRTA 4Y11E 4AFZA 1C2HA 2ZU2A 4XBCA 3SU3A 5FPSA 2Z9IA 2B9LA 2ZGHA 4Y10E 1K1IA 1GCTC 3P8OA 3NCLA 1B0EA 1O2SA 1P3CA 2ZQ1A 2OINA 2ZFQH 2BZ6H 3PV4A 4DJZB 2VWMA 1SLXB 1C2IA 1S83A 3CS0A 1WBGB 2XWBI 2PLXA 4NIVA 3MHWU 2FLBH 2C8YB 1EZQA 4FVBA 1HB0B 1UJ1A 4ABHA 2PGBB 3SGBE 2A4RA 3ZZ8A 3MNXA 2CN0H 4FUFA 1GJAB 1OWKA 3DFJA 2EA3A 2ZDMA 3F9FA 5DG6A 3SV7A 2BOHB 4D76A 1XKAC 2P93A 4CHAC 2Y7ZA 3F9HA 3TLOA 2CGAA 2PFEA 1L1NA 2BX3A 1C1RA 3F1SB 1SLUB 1H8DH 1ZSJA 2Z7FE 3ATIA 5GXPA 3TVJB 1AZZA 1O2PA 3A81A 1TLDA 5EQRA 1ETTH 3FFGA 3O8CA 3H7OA 3SV8A 1DITH 1SGYE 4X8SH 1XUGA 1GL0E 2Z9GA 3PWBA 2QXIA 1UK3A 1FDPA 4K60A 4XFQA 4AFSA 1LQDB 3RMNH 4B2CA 3NK8A 1IQEA 4DCDA 2VIVA 2DUCA 3PTBA 4MPUA 3BTTE 3VPKA 1TOCB 1N8OC 1ZZZA 3DUXH 4MPVA 1TQ0B 1DWCH 4BAQB 1GBMA 1AB9C 1YPLH 1RRKA 1GI9B 3GY7A 1P06A 1CO7E 3TPIZ 2ULLA 4YOGA 2FOCA 1SLVB 3TNSA 1AI8H 3UPEA 3I78A 2OUAA 3EDXB 3RMMH 2WYJA 1YPEH 1P3EA 3LJOA 4J2YB 1EJAA 3T26A 4RN6A 3KCGH 1ZMNA 1FY3A 1TMUH 1NRSH 2BD9A 4I32A 1AVWA 1O3FA 4O3UA 1UTJA 1V2OT 3QTOH 2C4FH 5HXFA 1K1NA 5DPAA 2NWNA 4MG3A 2PV9B 2J92A 1LPKB 1FQ3A 1F7ZA 5HGGA 1V2JT 5EXNA 1TRNA 4X1PU 5A2MH 1CT0E 1UVOA 3ITIA 3U8TH 1GDUA 1MD8A 1D6RA 3SI4H 3ZVCA 1N6YA 3RDZA 1GI7B 1ZTLA 3SJOA 4WXIA 1VJAU 1A7SA 2GV6A 1HCGA 4A92A 3SJ8A 1KLIH 4RSPA 2STAE 1SI5H 1SOTA 2VIDA 1BCUH 5CE1A 3O8DA 3STIA 3ZVDA 2JETB 1V2NT 5HYOA 1EAXA 1O2ZA 1O5EH 2XWAA 4Y6DA 4BAKB 3BTWE 3ZVGA 2BY5X 4DW2U 4IS5A 1NU9A 4OGYA 3SO3A 4Y79A 1C5NH 1C4Y2 3EA7A 1V2KT 1GHWH 3M36A 3M7TA 1FY4A 2LNCA 1OYTH 1SB1H 2WPMS 1THPB 3UNQA 5EGMA 2ZP0H 1YM0A 1UTNA 1RIWB 1HXEH 5FPTA 1OXGA 1VJ9U 3TJVA 4MNWA 2GMTC 2QF0A 4WH8A 1DY8A 1ORFA 1UTLM 4YTAA 1G32B 3M5NA 1QRWA 2ZDLA 2HPPH 3D65E 2A31A 3GY6A 1OWIA 3OX7U 1ZPBA 1KDQA 1E36B 5AFYH 4E7RG 1BITA 1C5UA 1L1GA 1S84A 2DE8A 3A8BA 2A32A 1VGCC 2VIWA 3PWCA 1DXPA 2CXVA 2ZHQH 2YOLA 2BDCA 1WSSH 3BTQE 1OP8A 4ZHAA 2ZCLP 5JPMH 1MAXA 2UWPA 4HZHA 3LH3A 1YCPM 3AW1A 1SGFG 2FP7B 1YKTA 1EZXC 2OBOA 3LKWA 2ZZUH 3SORA 2BD8A 1Z1JA 2Y5HA 2V3HH 1GI2A 1ELBA 2ZIQH 1QA0A