3RXVA

Crystal structure of trypsin complexed with benzamide (f05 and f03, cocktail experiment)
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
publication title In-crystal affinity ranking of fragment hit compounds reveals a relationship with their inhibitory activities
doi rcsb
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxvA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxvA02
3DFJA 3FVFB 3OY6U 1BOQA 5FPTA 2WINI 4KGAA 1YGCH 4CRBA 1UVPA 4ISNA 1PJPA 1XVOA 1O5DH 1GI0A 4RKJB 3GY4A 4LK4A 4O3TA 5DGJA 1SGYE 3ATMA 3NCLA 3RXKA 1T8NA 5J4QA 4F49A 3P8OA 1PYTC 4MVNA 3OTJE 3ZVGA 3BTGE 1GCDA 1SOZA 4H6SB 3PO1C 2A0QB 3ZVFA 4ABHA 1KXBA 1Y3XA 3R0FA 1Z8IB 1XUGA 1CT2E 2A45B 1OWEA 2VH6A 3NZIA 2H9EH 1DUAA 2PSYA 1KXEA 4ZXXH 2ZGJA 2GX4A 2BD2A 4DT7B 3KL6A 1DWEH 2A32A 3NPSA 8LPRA 1O35A 5EXMA 2OINA 5FX5A 2R3YA 5IDKA 3VXEH 2OC8A 2BD7A 1Z7KA 1QL8A 4AYVB 3BTDE 3NUMA 1SGFA 2QXJA 4Y76A 5EXLA 3TJVA 4ZH8A 5EW2H 1HIAA 1RFNA 3RXMA 4MPUA 5CHAB 2F83A 1MTNC 1V2JT 3BTKE 1CQQA 3RXJA 1DY9A 1Q3XA 3KCGH 1O2OA 2OC7A 1AWHB 3N7OA 2ALPA 5EPYA 4CBOA 1GBLA 5ETXA 1QURH 5JBAS 2OQ5A 3GDUA 3WY8A 4ABJA 1C4V2 3SNBA 1HJ9A 2C93B 2BZAA 1H9HE 2Y5FA 3GY6A 1C1TA 2PUXB 3SHAH 3U1IB 1JIRA 1C1WH 2XBWA 2ZQ1A 5FBEA 2JKHA 3ZZBA 3A7WA 4NIWA 1ZJDA 4QT8C 2Q6GA 1MZAA 4A1XA 2KAIA 3AW1A 2FTMA 2XBXA 3AVZA 4NFFA 4JZDH 3S9BA 3VB5A 4HZHA 2A4QA 1GJ5H 1QBOA 1GBCA 3D23A 1KTTB 2A4GA 2PTCE 2BY8X 3GY3A 2QAAA 4IC6A 1LVMA 3BEFB 3SV8A 2Y5GA 2A7HA 2FO9A 1VCPA 1QA0A 3SQHE 1C2IA 1CBWC 4FU7A 1ANDA 4Y11E 1G32B 2V3HH 1XXFA 2VWNA 1IQNA 1O3DA 3FP7E 1SLWB 1GMCF 3TJNA 3F9EA 1P09A 2PKAB 1KTSB 2QXIA 1MD8A 3G01A 1T32A 1HAGE 1Z6JH 3LGVA 1HAHH 3D65E 2BOHB 3RXFA 4CRGA 3SU3A 5EXNA 2BQ7B 2P8OC 1GMHG 1TIOA 1CA0C 2PW8H 3QZRA 4LOYH 1DLKB 1V6DA 1MZDA 1K1JA 2C8ZB 1O39A 4GCHF 4TWYA 4CH8B 5F8TA 1O3LA 3RXVA 1EZSC 1YPMH 1DM4B 1GHYH 3E8LA 3M5LA 1W7GH 5C1UA 1X7AC 1OX1A 2AYWA 4VGCB 2BXUH 1UVOA 3P17H 2VIWA 1Y5AT 2BHGA 2P93A 1F0RA 3AASA 5TCAA 3TNTA 1SSXA 3SI4H 1ABJH 2ZEBA 2BYAX 4I8HA 1RIWC 3SU6A 1E38B 1QIXB 5JYIA 2VGCC 3U9AH 1NTPA 4FVDA 1DS2E 4X0WU 1Y8TA 4DOQA 3V12A 2A4OA 2BDHA 1L1GA 3UWIA 1BJUA 2ZGXH 1GGDC 1ARBA 1C1RA 1DXWA 5F8ZA 2O8WA 4UEHH 1ANEA 2LPRA 4OS5A 2K1QA 2BDBA 2ZU1A 4WWYA 5C20A 3FANA 1J17T 3KQCA 1A3EH 3GISB 1F5KU 1NFYA 2FTLE 1FN6A 4IMZA 1GHXH 2XXLA 4JZEH 1O2RA 7KMEH 3BTHE 4FUIA 3RMNH 1C2EA 4Q2KA 2CHAC 3DT0H 1ESBA 2VWLA 1TA6A 3M7QA 1EXFA 1PPZA 5GXPA 2G4TA 2GCHF 5FX6A 3GY8A 4IC5A 4D7GA 1DSTA 4THNH 1FMGA 3ZZ4A 3GCHC 1OP8A 2CXVA 1AU8A 4WMDA 4X8SH 1V2KT 4ZKNU 4HFPB 1TGCA 4DY7B 1FAXA 3Q77A 1S0QA 5DKMA 3ZVCA 2VIOA 4GAWA 3FAOA 1K21H 3RC6A 3TLOA 2Q6FA 1FJSA 3URCA 1SG8B 3HK3B 4X8TH 3U69H 2PFEA 3BEUA 5DO4H 3QO6A 2VIVA 2G81E 4Z0KA 1QRWA 4JYTA 1EPTA 2G00A 4JYVH 1C1QA 2ZPQA 1TA2A 3RXGA 3SUDA 1GBJA 1Y3WA 2A31A 1SGTA 2BX4A 3SNCA 3ENSB 1K1LA 1B0FA 1HPGA 1SPJA 4AG2A 4ESTE 1MD7A 1CHOG 1WQVH 1O2VA 1NU9A 3ZVBA 1GVZA 2YNAA 2PGQB 3TK9A 1ZR0A 1TRMA 1OP2A 1OWKA 4Y7BA 1T8OA 4ZAEA 5L30H 1E34B 3EA7A 1PPFE 1TBQH 1YCPH 1VITH 1CT0E 5E0JA 2CGAA 1TALA 1VR1H 1CGIE 3Q3XA 5GWZA 1D4PB 1FDPA 2ZZUH 1MU8B 2ZDAH 3U8TH 1HAVB 1P02A 2ANMH 3GCTG 3SU2A 2QYIA 3A8AA 2BDAA 2FZZA 3LIWA 2ZCLP 1E37B 4XBDA 2AMDA 2F9BH 1YM0A 3MH4A 3SNDA 5B6OA 1FQ3A 1XMNB 1WAYB 4WF8A 1C1MA 3VGCC 1W7XH 2ZDVH 3LH3A 3ELAH 1TOMH 4MPXA 1V2WT 1O3JA 2VVVA 3ZZ6A 1BMNH 5DP3A 5DK1A 4FU8A 4U30A 4NIYA 3TH3H 1O2GH 1EAUA 2XWAA 2FDAA 1K22H 1C1OA 1V2UT 2FODA 2P16A 2FX4A 2R2WU 1Z8RA 4DURA 2WPJS 3E3TA 2HPQH 1SL3A 1M9UA 3T27A 2WPKS 1GWAA 2QC2A 3PTNA 4Y0YE 1S82A 2F9NA 3FZZA 4KTUA 3T5FH 1TMUH 4ISIH 4X8UH 1EATA 1TGTA 5I46H 3A7TA 1Y3YA 2Z3EA 1O32A 1GMHF 5A8YA 2BQWB 1LTOA 4JZFH 4BAHB 4ZMAH 2ZHWH 1ZSKA 1GI9B 4WXIA 3SI3H 2PKAA 3JZ1B 1INCA 2A1DB 2FOCA 3STJA 1UVSH 2AFQB 2XWBI 3TH2H 1W14U 3KNXA 3BV9B 2BXTH 1VITG 1O5BB 1QBVH 3AAUA 1EUFA 2G4UA 2Z9KA 1AQ7A 1GMDG 2TIOA 2UWPA 3CENA 1FY1A 2D1JA 3UREA 3SJ8A 1VJ9U 2NWNA 5JB8S 3A83A 1D6WA 2G5VA 2ZHDA 7ESTE 3S69A 1HBTH 4X6OA 2VVCA 4Y71A 1FI8A 2ZHFH 3FFGA 1Y5BT 1HUTH 4X2YA 1Y59T 4UD9H 1O3NA 1TPOA 2EI6A 4UFDH 1O3FA 1VGCC 1O2PA 2PSXA 3HK6B 1HAOH 4AB9A 1YLDA 7GCHG 2ZC9H 2QGRA 1C5XB 1K1IA 2H2ZA 2FOEA 1BBRE 2NU4E 1AKSB 4BTIB 5C1XA 1P06A 5JPMH 2ASUB 2PR3A 1IHSH 3VFEA 1QHRB 1TGNA 3LGWA 4Y8XA 2UUKB 2FI4E 1O2MA 4Y8ZA 5HMAA 4TWWA 4A7IB 3RXCA 1BRCE 4WJG2 3RXTA 2BLOA 1A1RA 3PLPA 1LPKB 2ZWLH 1V2MT 4OGXA 2BZ6H 4KP0A 1TMBH 1PPHE 1YPHE 4Y6DA 4LZ4B 3U8RH 4WVPE 3PWCA 1P2QA 2FEQH 1DY8A 2F91A 1O2NA 3ZZ7A 5ESBA 1LQDB 4SGBE 3SU5A 1GCTC 5SGAE 1HDTH 3LH1A 1KSNA 3V0XA 2ZCHP 2YNBA 1EB2A 3UUZA 1XXDA 1ZHRA 3MU0A 3EYDA 3RU4D 1KY9A 1EQ9A 2CJIA 1G36A 3RXSA 3MU8A 3MYWA 2WPIS 1FLEE 5LH8A 2IPHA 3TPIZ 1LKBA 1QFKH 3SZNA 4ZHMU 4JZ1A 3TK6A 1TQ7B 1BTYA 1LKAA 4IMQA 1C2DA 2NU0E 1XUKA 2RDLA 2IN2A 4YOIA 3BG4C 1SB1H 2PWXA 1AFQB 2BVSH 3S7HB 4GCHG 4BOHA 1C1VH 3OSYA 4NA8A 4ZKRU 2B0FA 1B0EA 2Z3DA 1W0YH 4GSOA 3MH6A 2FOHA 4F4OC 4YLUA 2M5TA 2AGGX 2A2QH 1V2PT 1C2HA 4AG1A 2VIQA 3LGTA 4FUEA 2SGFE 1A5HA 1E0FD 4JZIA 3NXPA 1C5VA 3UOPA 1TNHA 3GCTF 1DICA 1BITA 2YOLA 3DFLA 1GJAB 1AIXH 2H5CA 2HOBA 4ABGA 1FIZA 4RN6A 1P11E 5BRRE 2FOMB 2C8YB 2WPMS 5G4BA 2ZU4A 3RXUA 4MNXA 3SO3A 3A84A 4A1TA 1GI6A 4XBBA 1DSUA 1YCPK 1C5QA 1BBRK 1SGRE 5DP5A 1JMOH 2ZNKH 1HYLA 3QWCH 2ZFFH 1FY5A 1GJBB 1MUEB 1HAVA 2R0KA 4E06H 1UK2A 3W94A 2PKSB 1NC6A 2OP9A 2HVXA 4ZROA 2H5DA 5E2OA 3SUFA 3MU1A 2WPHS 1ZGIA 5FAHA 1AE8H 3SU4A 3PMHB 1O37A 1C5NH 2XCNA 1EP6A 2Z3CA 1L0ZA 3E90B 1TABE 7LPRA 2Y7XA 1PPEE 4AFUA 3GCNA 4WY3A 3LC3A 2EEKA 1J16A 1HLTH 1XKAC 1O3KA 3PTBA 3RXOA 2FOBA 1UTJA 1C2GA 2SNWA 2UUFB 2BLVA 2FX6A 5LGOA 4GUXA 2VH0A 2ZU3A 1D3QB 4O3UA 4MPWA 1IQGA 1ABIH 1C1UH 5JBCS 3ZZ3A 1SGNE 3BIUH 4GLYA 4AORA 2P59A 5E0GA 1ELAA 1A2CH 4B1TA 1BTZA 1GBTA 1QCPA 1P9UA 4D8NA 1P2NA 1THPB 2H9TH 3STIA 3DD2H 1KLTA 3LGIA 1MTWA 2UWOA 2XRCA 3QLPH 1H1BA 1NT1A 2VIPA 1O3IA 5DJ7A 4MG3A 3MMGA 1UVTH 1MKWH 1VITF 2JETC 1SQTA 3M36A 2TRMA 2O8TA 1IQKA 1N6YA 2STBE 1GMDF 1GBBA 3F6UH 1NRQH 1C5PA 1AY6H 1C4Y2 4UE7H 1GJ6A 3KQDA 3EA8A 3ZVDA 2WYGA 1TOCB 2PV9B 4DIHH 3SNAA 1HAPH 4X6NA 2TBSA 1T7CA 5E0HA 3VXFH 3E91A 1GBDA 3SQEE 4NA9H 1MAYA 1SQOA 1DITH 4JK6A 4OS2A 3A87A 3A81A 3GY5A 1EZUC 3GDVA 3M7UA 1F7ZA 3GYLB 1AVXA 2VGCB 2ZQ2A 2UUYA 3NWUA 1O5AB 1PFXC 2FPZA 1BZXE 2ZPSA 4NZQA 1UCYE 2RA0A 4MNWA 4UFEH 5DP4A 3O8RA 5A0AE 2BVXH 1C2JA 3K6ZA 1OWIA 5ESTE 1MCVA 4UDWH 3ODDA 3SHCH 1OXGA 2HGTH 1AB9B 1IQJA 4YT7H 6CHAB 4UONA 2F9UA 1TNKA 1D3DB 1FY4A 3VPKA 1AVWA 1A46H 1O2QA 2ZDLA 1NPMA 2HWLB 1GG6B 1LPGB 1KLJH 1AKSA 2GV7A 2VINA 3BTEE 4U2WA 1HGTH 2ZGBH 9ESTA 5AFZH 2UUJB 5GIBA 5A0BA 4ZKOU 1LHFH 3PMBB 2FS9A 2Y7ZA 1LVOA 2QXGA 3M35A 3QTOH 3A85A 1QQ4A 5DP6A 1EP5A 2HLCA 5JDUB 1AUJA 2A5KA 3P95A 1C5OH 2O8LA 1S6HA 1W10U 1QGFA 2QA9E 2HNTC 2ZFRH 2ZO3H 3VB7A 4O9VA 2VU8E 5EGMA 1XVMA 1O2UA 4GHQA 2GV6A 3P6ZB 1P10A 1HNEE 1NFWA 1XUHA 5CE1A 4YOJA 1HAYB 1LCYA 1NO9H 1V2QT 1O3MA 1FXYA 1DWBH 1UVUH 5A2MH 1P8VC 2AERH 1BQYA 1CT4E 3LKWA 1EPTC 2BD5A 1VZQH 5E2PA 3MNBA 3MNSA 5TCCA 4I8LA 6ESTA 1DWCH 1HAXB 5HYOA 1IQMA 2P94A 3EE0B 4E05H 3RC4A 3T25A 3AW0A 2ESTE 4CHAB 2AS9A 1MBMA 5AVDA 4J1YA 3SV7A 3KQBA 2FYRA 5AFYH 4AFSA 1C2FA 1KLIH 1XX9A 3LGYA 4INKA 2ZFSA 3ZVAA 3EAJA 2WYJA 1QRXA 1CU1A 2GMTB 2EI8A 4B71A 5JB9S 1W12U 3M5OA 3MNXA 4FUHA 5JBBS 1EX3A 1ETTH 5L6NH 1T4UH 4B74A 2XYAA 1UTPA 3ZYDA 1WTHD 3ATWA 4TY6A 4KKDA 3D62A 2EI7A 4FUFA 7GCHF 4BTUB 1EASA 1G30B 4K1SA 1DX5M 1RTLA 1NRPH 1BMAA 2FS8A 4MNVA 1UCYK 1H4WA 1ZMNA 1IAUA 2SGAA 1O2TA 1G37A 2ZDMA 3Q76A 1EOJA 1L4DA 2ZI2H 1PQAA 1WUNH 2ZDNA 4BANB 4TYDA 5CHAC 1A7SA 1AN1E 4Y0ZE 2VWMA 4UFFH 4Q7ZA 1P57B 3PYHA 1UTMA 1PQ5A 2ANWA 4D9RA 3V13A 4NIXA 2HNTE 5FBIA 2QY0B 4ZUHA 4D9QA 1Y5UT 4BAMB 1GI1A 4WXVA 5T6GA 3RDZA 4NFEA 3MTYA 2FESH 3OYPA 2G5NA 2ZFPH 1A4WH 4Q7XA 1QTFA 3B8JA 3ESTA 1KIGH 1TGBA 2F9PA 2SFAA 3NKKA 1O5FH 1NM6A 2BY7X 1P2MA 1GJ7B 1HJAB 5T3HA 1AUTC 1JRSA 3LU9B 3QDZB 5A09A 1BMMH 3RLYH 3E16B 1H8DH 2ZU2A 3P92A 4AFZA 5DP9A 1MKXK 2R2MB 2OBQA 3ZZ8A 3E0PB 3RC5A 1A5GH 1AI8H 2H9HA 1G3EA 2F9VA 4K8BA 4DVAU 1P9SA 2VB0A 1AE5A 2ALVA 1OSSA 3HKJB 4KTCA 4CRAA 4CRCA 1BMLA 2C8XB 3PB1E 1EJAA 1HAIH 1SLVB 3RM0H 1C1NA 1GDQA 3UY9A 3DUXH 2ZFTA 4NSVA 1L1JA 4XDEA 2BY9X 2GGVB 1TPPA 1LPZB 1P2OA 2BD3A 2SGQE 4YESB 1BBRH 1GHWH 1BRUP 2W3IA 5IYTA 4GVUA 2Y81A 1S5SA 3I29A 4Y79A 1ARCA 3GDSA 2J95A 1TPAE 1MKWK 4R0IA 2XC5A 4VGCC 2JH6D 2BB4A 4B2BA 1O5GH 4Y10E 4YM9A 1ELTA 1O3GA 2GP9B 1G3CA 1FNIA 2BY5X 2Y80A 2FP7B 3M5MA 2ILNA 1C5TA 1EJMA 1PPCE 1P0SH 1KDQB 1ELCA 4INHA 5I25A 1WOFA 2BD8A 1WSSH 3MNCA 3P8GA 5C67A 1L2EA 1ZPCA 2PGBB 2QF3A 4NGAH 4K3JA 4K69A 2Z9LA 4NA7A 1ZRBA 2FOAA 1EAWA 1SVPA 3QZQA 3SJOA 1UHBB 3UTUH 1SQAA 3RXHA 4WH6A 4X6MA 1O5CB 3GOVB 2ZA5A 1K28D 1JIMA 2IJOB 3HGNA 4CR9A 1SHHB 1DVAH 2JH0D 3TVJB 1A0HB 3SGBE 3TGJE 1C5WB 1OWDA 1W3CA 3C27B 1YPHC 5E8EH 4B2CA 1FAKH 1SLXB 3T29A 3RLWH 1OS8A 1IQIA 1HB0B 4NWLA 1Z71A 1SGCA 5A0CA 3TJOA 3LJJA 3HATH 2GCTC 2QN5T 1D3PB 1O5EH 3SBKA 3RXEA 2FMJA 4RSPA 1SMFE 1UTQA 3QGNB 4SGAE 4CREA 4AN7A 4I8JA 1TONA 2FOGA 5HXFA 2C3SA 2Y82A 1TX6A 1DUEA 4ABBA 3RU4E 1UTLM 3IWMA 1H9IE 2ZPRA 4K5ZA 1YYY1 2G51A 2GZ8A 3KHVA 4ISOA 4NIVA 2GZ7A 2OUAA 1ZMJA 3TK5A 3W95A 1S0RA 1F0UA 3RMMH 2R0LA 1UJ1A 1W2KH 2A2XH 3PV4A 1S85A 6GCHF 1XKBC 1PPGE 3T62A 3BSQA 2Q1JA 3M3VA 1QB6A 1Y3UA 1KXCA 2GD4B 5HM9A 4ISHH 1N8OC 2Z94A 3PLKA 3UNSA 3I77A 2ULLA 2SGPE 3MFJA 3QGJA 1O2YA 5EODA 3K6YA 2FXRA 3LDXH 2J9NA 1LQEA 4K1TA 3A7ZA 3P70B 2OQUA 2J34A 2Y6TA 2O8MA 1ZGVA 4X1NU 1TNIA 1KXAA 3A80A 4K8YA 3O8BA 1G3BA 1GPZA 3QN7A 1YPGH 4WMFA 2BY6X 3PROA 1CO7E 1ZSLA 2Y5HA 4E7NA 1V2ST 2THFB 2P3UB 4CBNA 1RD3B 1BIOA 5EU8A 1L4ZA 1ELVA 3ZZAA 1AGJA 1OKXA 1P2JA 3RXIA 1QNJA 3T26A 1TRNA 2PHBA 3GYMA 2W7UA 3K2UA 4K2YA 4TY7A 3URDA 3TH4H 3VB4A 4IBLH 1YP9A 5FPYA 1DDJA 1THSH 8ESTE 1SC8U 1ZLRA 3EA9A 3H7OA 1UMAH 4JYUH 4BAOB 3L33A 1PPBH 1CE5A 1HRTH 1O2LA 8GCHF 1SBWA 3F9FA 1FPHH 5J4SA 3O8CA 1E36B 1J15A 1OP0A 3MH7A 4AFQA 1P01A 2GT7A 1F0TA 1LMWB 1T31A 5ABWA 1K9OE 3RXRA 1HAZB 4Z6AH 1V2NT 1SI5H 3FP8E 2OXSA 1FUJA 2I6QA 2BTCE 3KF2A 5A8XA 2GDDA 1QQUA 2XBVA 2AMPA 1QJ6B 1IQLA 4KTSA 1AZZA 2QIQA 4X6PA 5LPRA 2SGDE 1P3EA 3IG6B 3MI4A 3A8DA 1SGQE 3OX7U 3PM3A 1BTPA 3PO1B 2OCVB 4FUDA 3SGQE 1AHTH 1C5ZB 1K1MA 3AAVA 2BDGA 4FUJA 1O2ZA 2GT8A 1UCYH 1OWJA 1GI8B 2ANYA 1C5LH 2QF0A 4AZ2B 4BXSA 2SGEE 2LNCA 4NWKA 1ACBE 4CR5A 3SV6A 4ZHAA 3SNEA 9LPRA 2BLWA 2AGEX 1YPLH 3RXQA 4H6TA 3B9FH 3M5NA 1GVLA 1NY22 1MTNB 1Z1JA 1HXEH 1EAXA 4J2YB 3GY7A 2H6MA 5F6MA 4MTBA 1YC0A 1SGEE 1TNJA 2GTBA 2ZU5A 2ZTYA 1GDUA 1KDQA 3A8BA 1F0SA 3GICB 5GJ4B 1QA7A 4ASHA 1D9IA 1AMHA 3MWIU 5CMXH 1TYNA 3SU0A 3BTME 1CVWH 4AB8A 1UHBA 2FIRH 1MKXH 4NZLA 3BTQE 5K7RA 4IN1A 4ZHLU 3S0NA 1QRZA 1Y3VA 2VVUA 4NSYA 1XM1A 1TBZH 2AH4X 3S7KB 3ATIA 5C1YA 1V2TT 2Q6DA 2ZHEH 5FPSA 5FCKA 3SW2B 1CBWB 1C9PA 1NN6A 1BJVA 4BNRA 4E7RG 2NU3E 1LHCH 4U01A 1GJDB 1ZOMA 1EKBB 1FIWA 3TNSA 2IOTA 3FZDA 1ZPBA 2ZGCA 4DGJA 3C1KA 3ZYEA 2PTNA 1SGFG 3VEQB 1S81A 4ZXYH 4ABAA 2ZHQH 2P8OB 1CA0B 2W5EA 1QR3E 3HPTB 1GDNA 1AD8H 2ODPA 1C5SA 2BD9A 4FU9A 4H4FA 3UQVA 1D3TB 4I8GA 1C9TA 1K1NA 3E1XB 3SN8A 1GL0E 1P04A 1A3BH 1F92A 1F2SE 1GBEA 4UFGH 5C5OA 1FN8A 1O2XA 3A88A 4MLFB 2XW9A 5A8ZA 2A4RA 2DE8A 2B5TB 1AFQC 1WV7H 3Q3KA 3ZZDA 2TPIZ 1RJXB 1CA8B 1RIWB 4Q80A 2J94A 2VWOA 3RXPA 1BT7A 1C2LA 2BQ6B 2D26C 1ZMLA 4XFQA 3I78A 1TBRH 3D49H 2P3TB 1G2MA 2G52A 1O0DH 1BTXA 3P8FA 2CV3A 1DOJA 1O3OA 3OY5U 2EA3A 1ESTA 1GGDB 2TGTA 4I8KA 1QY6A 3ZZ5A 1BDAA 5EQQA 1YPEH 3ODFA 2CN0H 1P12E 3V3MA 1GI2A 1TE0A 3VB3A 1ZTJA 2FI5E 1MTUA 1HJ8A 1CGHA 4FXGH 2FWWA 1H8IH 5GDSH 1EAIA 5T6FA 5T6DA 5C5NA 4IW4E 2F9OA 2QXHA 2Z7FE 1THRH 4H42U 5HM2A 2CHAB 1GHBF 5GPIB 4AGJA 2ODYB 4U32A 2WV5A 2PKSC 1LDTT 4WH8A 3SJIA 1A0JA 2ZCKP 2J38A 4DCDA 5C3NA 4YLQH 3BN9A 3GCHB 1BRBE 3U1JB 1O31A 2BDYA 1QJ7B 5EG4A 4Y8YA 1V2LT 1TMTH 1O2SA 1P3CA 1Z8GA 3ZV8A 4AGKA 1QB1A 1T4VH 1TWXB 2TGAA 1JOUB 2J92A 1TX7A 1GBMA 5LPFA 1G3DA 2C8WB 1RS0A 1UTKA 5EPNA 3S9CA 3KN2A 1BRAA 1N1LA 3CS7A 3MOCA 5F03A 2RCEA 1MH0A 1OYTH 1GJ8B 2BDIA 1BB0B 3BTWE 1FZZA 4ABDA 1BA8B 4OS6A 1DANH 1O3PB 2P95A 3EDXB 2W26A 2GKVE 2R3UA 2Z6BD 3LT3A 4GPGA 4MQAA 4D76A 3KEEA 2W3KA 2AMQA 4FUGA 1GJ9B 1BCUH 3UFAA 8KME2 2B9LA 3F68H 4XOJA 4I32A 3LOXA 1JRTA 2AIPA 1SR5C 5C2ZA 3QK1A 1O3HA 6GCHG 1WBGB 1P05A 3CP7A 3E6PH 1GJCB 1CHGA 1NS3A 1V2RT 3SJ9A 2CMYA 1O3EA 2CF9H 2A5AA 3HGPA 3TGKE 2ZP0H 1YLCA 4B76A 4D7FA 4Q7YA 4B2AA 1IQEA 2O8UA 4B75A 3UNQA 1F5RA 3K65B 1EZXC 4XE4A 2ZG0H 1MU6B 1O34A 5JBTA 1O38A 4X2VA 1JBUH 2EC9H 2AGIX 1BHXF 3Q00A 1Z6EA 1XUIA 2RA3A 1ID5H 3MO6A 5EOKA 3BTFE 1HFDA 5L2YH 3V7TA 3SV9A 4LZ1H 3ZZCA 1T8MA 2ZTXA 3R3GB 3RXLA 1PQ8A 3EQ0H 1MBQA 3VGCB 3MO3A 1MTSA 4A1VA 1O2HA 1TQ0B 1O2IA 3UPEA 2OBOA 2VNTA 1MCTA 4FVBA 3PWBA 2GDEH 1WTGH 1AB9C 6CHAC 1EJNA 2STAE 3BTTE 3QUMP 2A5IA 2A7JA 4K60A 4OS7A 3SJKA 1GG6C 3T2NA 1J9CH 1TGSZ 3M37A 5L2ZH 1NRNH 3UIRA 1ESAA 4X1QU 2A7CA 2G55A 1GBKA 1TB6H 1G2LA 1GI4A 1QL7A 1K1PA 2GCTB 8GCHG 1Z1IA 1ORFA 4R8TB 1O36A 4DIIH 1S6FA 1YBWA 1GBIA 1W0ZU 1MTVA 4AOQA 4A6LA 2ZFQH 3PLBA 1LVYA 2TGPZ 1TX8A 1XUJA 1GI3A 1QL9A 4I7YH 1ZSJA 2D8WA 1TPSA 2ZTZA 1C2MA 3UWJH 1TNLA 1QB9A 1PYTD 1SOTA 1O30A 3RMOH 2V3OH 4K1EA 1B7XB 1ZRKA 3A82A 1FV9A 3M7TA 3MHWU 2C4FH 4YTAA 3S9AA 1O2WA 4B73A 4BXWA 1H9LB 2V6NA 1ANBA 1ELGA 4XBCA 1S84A 3ZVEA 1BTUA 4IS5A 2UWLA 2Z9IA 1EZQA 1DWDH 1IHTH 1SLUB 4YO9A 4JCNA 4CHAC 1GBAA 5F8XA 1WQSA 1BUIA 1VCWA 1Q31A 2B8OH 1C5UA 4YT6H 1AFEH 3DHKH 4TPYA 1N8OB 4OS4A 3LPRA 3TGIE 2WUBA 5FXLA 1KXFA 2WUCA 1G9IE 2BM2A 4YOGA 1CSOE 1VGCB 3K9XB 4BAKB 4X1SU 3RMLH 2GMTC 1KYNA 4NCYA 2PLXA 4JK5A 4CH2B 1ELEE 1NRSH 2BD4A 2C90B 2XC4A 3TJUA 3H5CB 4M7GA 2WV4A 3F1SB 1Q2WA 1MAXA 2FI3E 1OWHA 4Y7AA 5EQRA 5DP8A 1A5IA 1HXFH 2OD3B 1ELFA 4WMEA 1NZQH 4KELA 1GHVH 3P8NA 5EW1H 1ZZZA 3RXDA 1VJAU 1MQ5A 3O8DA 1NFUA 3KIDU 1NU7B 2FLRH 4PROA 4CRFA 5LPEA 3QTVH 3RU4T 3MH5A 3TITA 1BTWA 3MO9A 4ABEA 1GHAG 1LHEH 3A7YA 3L6PA 2QCYA 5H4IB 1NROH 1RTKA 3OU0A 1UK3A 1K1OA 6LPRA 1YCPM 2DUCA 3LC5A 1GJ4H 1JXPA 1HV7A 1U6QA 1ELDE 3ATKA 1P2KA 3PMAB 4ZKSU 1GCTB 1O33A 2BX3A 1O3AA 1QBNA 1FONA 3BIVH 1F5LA 1HCGA 3U8OH 4HGCA 1AWFH 1FY3A 1RGQA 5GCHG 2PUQH 1BHXB 1IOEA 1UK4A 1UO6A 3A7XA 1C1PA 3DA9B 3H7TA 1J8AA 4IN2A 2Z9GA 4YZUA 3UR9A 1P03A 3M3SA 3VB6A 3E0NB 1UTOA 1HJAC 2XNIA 3RP2A 1S83A 1PQ7A 1TFXA 2B7DH 2O9QA 1LHDH 1T8LA 1FPCH 2WPLS 4JMYA 3LONA 4X2XA 3GCOA 4X1PU 5TJXA 3BG4B 1GHZA 4X1RU 4MNYA 2BVRH 2CF8H 1YPKH 1DFPA 1C5MD 2TGDA 1A0LA 4FUBA 1RXPA 2G8TA 1WYKA 4BTTB 1SHYA 3M3TA 1GI7B 3RM2H 2FYQA 1L1NA 1RTFB 1B5GH 3ITIA 4HTCH 4GHTA 2HNTF 4A92A 3KQEA 2DE9A 4O97A 1NFXA 1O3BA 1RRKA 3FP6E 2ZGHA 2AIQA 3UNRA 1ETRH 1GI5A 4X2WA 4A5TS 3SV2H 1HIAB 1CGJE 1AVGH 1DXPA 1V2VT 4AX9H 2SNVA 1EOLA 5DPAA 1ZTKA 2J2UA 4XSKU 1NRRH 3NK8A 2XTTB 3A8CA 4NG9H 3KGPA 1ETSH 2D2DA 2GZ9A 1DE7H 3HKIB 4MDSA 2P3FH 1MQ6A 4OGYA 1V2OT 2NU2E 2VJ1A 5DG6A 2HALA 1SGPE 1TLDA 3TIUA 1SFIA 1C4U2 1LVBA 2KAIB 1ZHPA 1YPJH 3T28A 2V35A 1GHBG 3Q3YA 1JWTA 2XBYA 3ATLA 5HGGA 3L3TA 4ISLA 1GBFA 3RUOA 2BOKA 4FUCA 1DPOA 5AHGH 5FCRA 1EB1H 2F3CE 1YKTA 3LGUA 3BG8A 1UTNA 3BEIB 2ZF0H 4IGDA 3SUGA 2OC1A 2HPPH 4ABFA 1QJ1B 3U98H 5K0HA 3UQOA 4I31A 3PMJA 4I33A 1OOKB 3ZV9A 2VIDA 1GBHA 3LJOA 1D6RA 3IITA 3CS0A 1A61H 4BAQB 3F9GA 4INLA 1V3XA 1C5YB 3TU7H 1ZTLA 2ZKSA 1DLEA 2BLQA 2ZIQH 3MU4A 1TAWA 2JETB 1C5RA 1O2JA 3RXAA 4MPVA 2OTVA 3B23B 4AYYB 3EGKH 1GMCG 3A86A 5PTPA 1AO5A 1OYQA 2ZECA 3SGAE 3SUEA 1CHOF 5DP7A 2BMGB 4HI3A 2Z9JA 4RKOB 1WU1A 2RG3A 2QV1A 2OLGA 2BDCA 1MMJN 2FM2A 1C2KA 1W8BH 3ZZ9A 3F9HA 1ZHMA 1TRYA 2ZDKA 1NESE 1GVKB 1O2KA 1SGDE 1XUFA 4OS1A 3MU5A 1DT2A 2H1UA 5BPEA 1SGIB 3BF6H 4ABIA 2NU1E 4TPIZ 1WCZA 1FY8E 2R9PA 5FHTA 1YF4A 1ZYOA 2W7SA 1J14A 1E35B 2AEIH 1TNGA 1O3CA 2J4IA 1ELBA 4LXBH 4CRDA 4DW2U 1SFQB 1GL1A 1GHAF 1LO6A 3SOSA 2HRVA 5EQSA 3JZ2B 4O03A 1ZPZA 1C1SA 3SU1A 1Z8JB 2XCFA 2I6SA 2FLBH 1W11U 2FOFA 3UR6A 2JH5D 3RXBA 1ZJKA 3A7VA 1IQHA 2OC0A 1IQFA 4X8VH 2ODQA 3SORA 1KXDA 3M61U 5GCHF 1OPHB 1VCQA 4DJZB 2ANKH 1K2I1 1N6XA 4DG4A 3A89A 5AF9H 3GY2A 3QX5H 1LHGH 3UOUA 2V0BA 2XC0A 2GCHG 1W13U 2GVFA 1EPTB 1BTHH 1P2IA 1AZ8A 1ANCA
chains in the Genus database with same CATH superfamily
3DFJA 3FVFB 3OY6U 1BOQA 5FPTA 2WINI 4KGAA 1YGCH 4CRBA 1UVPA 4ISNA 1PJPA 1XVOA 1O5DH 1GI0A 4RKJB 3GY4A 4LK4A 4O3TA 5DGJA 4B6EA 1SGYE 3ATMA 3NCLA 3RXKA 1T8NA 5J4QA 3DCLA 4F49A 3P8OA 1PYTC 4MVNA 3OTJE 3ZVGA 3BTGE 1GCDA 1SOZA 4H6SB 3PO1C 2A0QB 3ZVFA 4ABHA 1KXBA 1Y3XA 3R0FA 3FO8D 1Z8IB 1XUGA 1CT2E 2A45B 1OWEA 2VH6A 3NZIA 2H9EH 1DUAA 2PSYA 1KXEA 4ZXXH 2ZGJA 2GX4A 2BD2A 4DT7B 3KL6A 1DWEH 2A32A 3NPSA 8LPRA 1O35A 5EXMA 2HLDD 2OINA 5FX5A 2R3YA 5IDKA 3VXEH 2OC8A 2BD7A 1Z7KA 1QL8A 4AYVB 3BTDE 1E1RD 3WWFA 3NUMA 1SGFA 2QXJA 4Y76A 5EXLA 3TJVA 4ZH8A 5EW2H 1HIAA 1RFNA 3RXMA 4MPUA 5CHAB 2F83A 1MTNC 1V2JT 3BTKE 1CQQA 3RXJA 1DY9A 1Q3XA 3KCGH 1O2OA 2OC7A 1YLNA 5HIZA 1AWHB 3N7OA 2ALPA 5EPYA 4CBOA 1GBLA 5ETXA 1QURH 5JBAS 2OQ5A 3GDUA 3F2FA 3WY8A 4ABJA 1C4V2 3SNBA 1HJ9A 2C93B 2BZAA 1H9HE 2Y5FA 3GY6A 1C1TA 2PUXB 3SHAH 3U1IB 1JIRA 1C1WH 2XBWA 2ZQ1A 5FBEA 2JKHA 3ZZBA 3A7WA 4NIWA 1ZJDA 4QT8C 2Q6GA 1MZAA 4A1XA 2KAIA 3AW1A 2FTMA 2XBXA 3AVZA 2WPDD 4NFFA 2LP6A 4JZDH 3S9BA 3VB5A 4HZHA 2A4QA 1GJ5H 1QBOA 1GBCA 3D23A 1KTTB 2A4GA 2PTCE 2BY8X 3GY3A 2QAAA 4IC6A 1LVMA 3BEFB 3SV8A 2Y5GA 2A7HA 2FO9A 1VCPA 1QA0A 3SQHE 1C2IA 1CBWC 2LELA 4FU7A 1ANDA 4Y11E 1G32B 2V3HH 1XXFA 2VWNA 1EFRD 1IQNA 1O3DA 3FP7E 1SLWB 1GMCF 3TJNA 3F9EA 1P09A 2PKAB 1KTSB 2QXIA 1MD8A 3G01A 1T32A 1HAGE 2JDID 1Z6JH 3LGVA 1HAHH 3D65E 2BOHB 3RXFA 4CRGA 3SU3A 5EXNA 2BQ7B 2P8OC 1GMHG 1TIOA 1CA0C 2PW8H 3QZRA 2K8IA 4LOYH 1DLKB 1V6DA 1MZDA 1K1JA 2C8ZB 1O39A 4GCHF 4TWYA 4CH8B 5F8TA 1O3LA 3RXVA 1EZSC 1YPMH 1DM4B 1GHYH 3E8LA 3M5LA 1H8HD 1W7GH 5C1UA 1X7AC 1OX1A 2AYWA 3DSPA 4VGCB 2BXUH 1UVOA 3P17H 2VIWA 1Y5AT 2BHGA 2P93A 1F0RA 3AASA 5TCAA 3TNTA 1SSXA 3SI4H 1ABJH 2ZEBA 2BYAX 4I8HA 1RIWC 3SU6A 1E38B 1QIXB 5DSFA 5JYIA 2VGCC 3U9AH 1KMHB 1NTPA 4FVDA 1DS2E 4X0WU 1Y8TA 4DOQA 3V12A 2A4OA 2BDHA 1L1GA 3UWIA 1BJUA 2ZGXH 1GGDC 1ARBA 1C1RA 1DXWA 5F8ZA 2O8WA 4UEHH 1ANEA 2LPRA 4OS5A 2K1QA 2BDBA 2ZU1A 4WWYA 5C20A 3FANA 1J17T 3OE7D 3KQCA 1A3EH 3GISB 1F5KU 1NFYA 2FTLE 1FN6A 4IMZA 1GHXH 2XXLA 4JZEH 1O2RA 7KMEH 2RDEA 3BTHE 4FUIA 3RMNH 1C2EA 4Q2KA 2CHAC 3DT0H 1ESBA 2VWLA 1TA6A 3M7QA 1EXFA 1PPZA 5GXPA 2G4TA 2GCHF 5FX6A 3GY8A 4IC5A 4D7GA 1DSTA 4THNH 1FMGA 3ZZ4A 3GCHC 1OP8A 2CXVA 1AU8A 4WMDA 4X8SH 1V2KT 4ZKNU 4HFPB 1TGCA 4DY7B 1FAXA 3Q77A 1S0QA 5DKMA 3ZVCA 2VIOA 4GAWA 3FAOA 1K21H 3RC6A 3TLOA 2Q6FA 1FJSA 3URCA 1SG8B 3HK3B 4X8TH 3U69H 2PFEA 3BEUA 5DO4H 3QO6A 2VIVA 2YMSB 2G81E 4Z0KA 1QRWA 4JYTA 1EPTA 2G00A 2J98B 4JYVH 1C1QA 2ZPQA 1TA2A 3RXGA 3SUDA 1GBJA 1Y3WA 2A31A 1SGTA 2BX4A 3SNCA 3ENSB 1K1LA 1B0FA 1HPGA 1SPJA 3H09A 4AG2A 4ESTE 1MD7A 1CHOG 1WQVH 1O2VA 1NU9A 3ZVBA 1YY3A 1GVZA 2YNAA 2PGQB 3TK9A 1ZR0A 1TRMA 1OP2A 1OWKA 4Y7BA 1T8OA 4ZAEA 5L30H 1E34B 3EA7A 1PPFE 1TBQH 1YCPH 1VITH 1CT0E 5E0JA 2CGAA 1TALA 2RFKC 1VR1H 1CGIE 3Q3XA 5GWZA 1D4PB 1FDPA 2ZZUH 1MU8B 2ZDAH 3U8TH 2KCYA 1HAVB 1P02A 2ANMH 3GCTG 3SU2A 2QYIA 3A8AA 2BDAA 2FZZA 3LIWA 2ZCLP 3OFND 1E37B 4XBDA 2AMDA 3PRBA 2F9BH 1YM0A 3MH4A 3SNDA 5B6OA 1FQ3A 1XMNB 3PV2A 5C94A 1WAYB 2L6OA 4WF8A 1C1MA 1WDIA 3VGCC 1W7XH 2ZDVH 3LH3A 3ELAH 1TOMH 4MPXA 1V2WT 1E79D 1O3JA 2VVVA 5GNDA 3GS9A 3KYFA 3ZZ6A 1BMNH 5DP3A 5DK1A 4FU8A 4U30A 4NIYA 3TH3H 1O2GH 1EAUA 2XWAA 2FDAA 1K22H 1C1OA 1V2UT 2FODA 2P16A 2FX4A 2R2WU 1Z8RA 4DURA 2WPJS 3E3TA 2HPQH 1SL3A 1M9UA 3T27A 2WPKS 1W0JD 1GWAA 2QC2A 3PTNA 4Y0YE 1S82A 2F9NA 3FZZA 4KTUA 3T5FH 1TMUH 4ISIH 4X8UH 1EATA 1TGTA 5I46H 3A7TA 2QF4A 1Y3YA 2Z3EA 1O32A 1GMHF 5A8YA 2EY4C 2BQWB 5EIYA 1LTOA 4JZFH 4BAHB 3W1EA 4ZMAH 2ZHWH 1ZSKA 5HKKD 2W6ID 1GI9B 2QE7D 4WXIA 3SI3H 2PKAA 3JZ1B 1INCA 2A1DB 2FOCA 3STJA 1UVSH 2AFQB 2XWBI 3TH2H 1W14U 3KNXA 3BV9B 2BXTH 1VITG 1O5BB 1QBVH 1NBMD 3AAUA 1EUFA 2G4UA 2Z9KA 1AQ7A 1GMDG 2TIOA 1SKYE 2UWPA 3CENA 1FY1A 2D1JA 3UREA 1MABB 3SJ8A 1VJ9U 2NWNA 5JB8S 3A83A 1D6WA 2G5VA 2ZHDA 7ESTE 3S69A 1HBTH 4X6OA 2VVCA 4Y71A 1FI8A 2ZHFH 3FFGA 1Y5BT 1HUTH 4X2YA 1Y59T 4UD9H 1O3NA 1TPOA 2EI6A 4UFDH 1O3FA 1VGCC 1O2PA 2PSXA 3HK6B 1HAOH 3F3BA 4AB9A 1YLDA 7GCHG 2ZC9H 2QGRA 4F55A 1C5XB 1K1IA 2H2ZA 2FOEA 1BBRE 2NU4E 1AKSB 4BTIB 5C1XA 1P06A 5JPMH 2ASUB 2PR3A 1IHSH 3VFEA 1QHRB 1TGNA 3LGWA 4Y8XA 2UUKB 2FI4E 1O2MA 4Y8ZA 5HMAA 2KR7A 4TWWA 4A7IB 3RXCA 4HG6A 4P00A 1BRCE 4WJG2 3RXTA 2BLOA 1A1RA 3PLPA 1LPKB 2JJ2D 5KEDA 2ZWLH 1V2MT 4OGXA 2BZ6H 3FN8A 1TMBH 4KP0A 1PPHE 1YPHE 4Y6DA 4LZ4B 3U8RH 4WVPE 3PWCA 1P2QA 2FEQH 1DY8A 2F91A 1O2NA 3ZZ7A 5ESBA 2IJD1 1LQDB 4SGBE 3SU5A 1GCTC 5SGAE 1HDTH 3LH1A 1KSNA 3V0XA 2ZCHP 2YNBA 1EB2A 3UUZA 1XXDA 1ZHRA 3MU0A 3EYDA 3RU4D 1KY9A 4ASUD 1EQ9A 2CJIA 1G36A 3RXSA 3MU8A 3MYWA 2WPIS 1FLEE 5LH8A 5FL7D 2IPHA 3TPIZ 1LKBA 1QFKH 3SZNA 4ZHMU 4JZ1A 3TK6A 1TQ7B 1BTYA 1LKAA 4TT3D 5CDFE 4IMQA 1C2DA 2KZ4A 1XUKA 2NU0E 4AC9A 2RDLA 2IN2A 4YOIA 3BG4C 1SB1H 2PWXA 1AFQB 2BVSH 3S7HB 4TSFD 4GCHG 4BOHA 2J98A 1C1VH 5C17A 3OSYA 4NA8A 4ZKRU 2B0FA 4XD7D 1B0EA 2Z3DA 1W0YH 4GSOA 3MH6A 2FOHA 4F4OC 4YLUA 2M5TA 2AGGX 2A2QH 1V2PT 1C2HA 4AG1A 2VIQA 3LGTA 4FUEA 2SGFE 1A5HA 3DSOA 1E0FD 4Z1MD 4JZIA 3NXPA 1C5VA 3UOPA 1TNHA 3GCTF 1DICA 1BITA 2YOLA 3DFLA 1GJAB 1AIXH 2H5CA 2HOBA 4ABGA 1FIZA 4RN6A 1P11E 5BRRE 2FOMB 3PRDA 2C8YB 2WPMS 5G4BA 2ZU4A 3RXUA 4MNXA 3SO3A 3A84A 4A1TA 1GI6A 4XBBA 1DSUA 1YCPK 1C5QA 1BBRK 1SGRE 5DP5A 1JMOH 2ZNKH 1HYLA 3QWCH 2ZFFH 1FY5A 1GJBB 1MUEB 1HAVA 2R0KA 4E06H 1UK2A 3W94A 2PKSB 1NC6A 2OP9A 2HVXA 4ZROA 2H5DA 5E2OA 3SUFA 3MU1A 2WPHS 1ZGIA 5FAHA 1AE8H 3SU4A 3PMHB 1O37A 1C5NH 4FETA 2XCNA 1EP6A 2Z3CA 1L0ZA 4M9FA 3E90B 1TABE 7LPRA 2Y7XA 1PPEE 4AFUA 3GCNA 4WY3A 3LC3A 2EEKA 1J16A 1HLTH 1XKAC 1O3KA 3PTBA 3RXOA 2FOBA 1UTJA 1C2GA 2KFWA 2SNWA 2UUFB 2BLVA 2FX6A 5LGOA 4GUXA 2VH0A 5KGOA 2ZU3A 1D3QB 4O3UA 4MPWA 1IQGA 1ABIH 1C1UH 2WHXA 3ZZ3A 5JBCS 1SGNE 2QF5A 3BIUH 4GLYA 2P59A 5E0GA 4AORA 1ELAA 1A2CH 4B1TA 1BTZA 1GBTA 1QCPA 1P9UA 2XNDD 4D8NA 1P2NA 1THPB 2H9TH 3STIA 3DD2H 1KLTA 3LGIA 1MTWA 2UWOA 2XRCA 3QLPH 1H1BA 1NT1A 2VIPA 1O3IA 5DJ7A 4MG3A 3MMGA 1UVTH 1MKWH 1VITF 2JETC 1SQTA 3M36A 2TRMA 1OHHD 2O8TA 1IQKA 1N6YA 2STBE 1GMDF 1GBBA 3F6UH 1NRQH 1C5PA 1AY6H 1C4Y2 4UE7H 1GJ6A 3KQDA 3EA8A 3ZVDA 2WYGA 1TOCB 2PV9B 4DIHH 3SNAA 2WSSD 1HAPH 4X6NA 2TBSA 1T7CA 5E0HA 3VXFH 3E91A 1GBDA 3SQEE 4NA9H 1MAYA 1SQOA 1DITH 4JK6A 3N7DA 4OS2A 3A87A 3A81A 3GY5A 1EZUC 3GDVA 3M7UA 1F7ZA 3GYLB 1AVXA 2VGCB 2ZQ2A 2UUYA 3NWUA 1O5AB 1PFXC 2FPZA 1BZXE 2ZPSA 4NZQA 3OEHD 1UCYE 2RA0A 3N7EA 4MNWA 4UFEH 5DP4A 3O8RA 5A0AE 2BVXH 1C2JA 3K6ZA 1OWIA 3MQKC 5ESTE 1MCVA 4UDWH 3ODDA 3SHCH 1OXGA 2HGTH 1AB9B 1IQJA 3EE7A 4YT7H 6CHAB 4UONA 2F9UA 1TNKA 1D3DB 1FY4A 3VPKA 1AVWA 1A46H 1O2QA 2ZDLA 5EJLA 1NPMA 2HWLB 2W6JD 1GG6B 1LPGB 1KLJH 1AKSA 2GV7A 2VINA 3BTEE 4U2WA 1HGTH 2ZGBH 9ESTA 5AFZH 2UUJB 5GIBA 5A0BA 4ZKOU 1LHFH 3PMBB 2FS9A 2Y7ZA 1LVOA 2QXGA 3M35A 3QTOH 3A85A 1QQ4A 5DP6A 1EP5A 2HLCA 5JDUB 1AUJA 2A5KA 3P95A 1C5OH 2O8LA 1S6HA 1W10U 1QGFA 2QA9E 2HNTC 2ZFRH 2ZO3H 3VB7A 4O9VA 2VU8E 5EGMA 1XVMA 1O2UA 4GHQA 2GV6A 3P6ZB 1P10A 1HNEE 2KM0A 1NFWA 1XUHA 5CE1A 2HVYB 4YOJA 1HAYB 1LCYA 1NO9H 1V2QT 1O3MA 1W0KD 1FXYA 1DWBH 1UVUH 5A2MH 1P8VC 2AERH 1BQYA 1CT4E 3LKWA 1EPTC 2BD5A 1VZQH 5E2PA 3MNBA 3F0PA 3MNSA 5TCCA 4I8LA 6ESTA 1DWCH 1HAXB 5HYOA 1IQMA 2P94A 3EE0B 4E05H 3RC4A 3T25A 3AW0A 2ESTE 4CHAB 2AS9A 1MBMA 5AVDA 4J1YA 3SV7A 3SYJA 3KQBA 2FYRA 5AFYH 4AFSA 1C2FA 1KLIH 1XX9A 3LGYA 3F2HA 4INKA 2ZFSA 3ZVAA 3EAJA 2WYJA 1QRXA 1CU1A 2GMTB 2EI8A 4B71A 5JB9S 1W12U 3M5OA 3MNXA 4FUHA 5JBBS 3CNRA 1EX3A 1ETTH 5L6NH 1T4UH 4B74A 2XYAA 1UTPA 3ZYDA 1WTHD 3ATWA 4TY6A 4KKDA 3D62A 2EI7A 4FUFA 7GCHF 4BTUB 1EASA 1G30B 4K1SA 1DX5M 1RTLA 1NRPH 4ZCNA 1BMAA 2FS8A 4MNVA 1UCYK 1UW7A 1H4WA 1ZMNA 1IAUA 2SGAA 1O2TA 1G37A 4B6FA 2ZDMA 3Q76A 1EOJA 1L4DA 2ZI2H 1PQAA 1WUNH 4ACBA 2ZDNA 4BANB 4TYDA 5CHAC 1A7SA 1AN1E 4Y0ZE 2VWMA 4UFFH 4Q7ZA 1P57B 3PYHA 1UTMA 1PQ5A 2ANWA 4D9RA 3V13A 4NIXA 2JIZD 4Q4LA 2HNTE 5FBIA 2QY0B 4ZUHA 4D9QA 1Y5UT 4BAMB 1GI1A 4WXVA 5T6GA 3RDZA 4NFEA 2F43B 3MTYA 2FESH 3OYPA 2G5NA 2ZFPH 1A4WH 4Q7XA 1QTFA 3B8JA 3ESTA 3AK5A 1KIGH 1TGBA 2F9PA 2SFAA 3NKKA 1O5FH 1NM6A 2BY7X 1P2MA 1GJ7B 1HJAB 5T3HA 1AUTC 1JRSA 3LU9B 3QDZB 5A09A 1BMMH 3RLYH 3E16B 1H8DH 2ZU2A 3P92A 4AFZA 5DP9A 2WZQA 1MKXK 2R2MB 2OBQA 3ZZ8A 3E0PB 4OM9A 3RC5A 1A5GH 1AI8H 2H9HA 1G3EA 2F9VA 2VBCA 4K8BA 4DVAU 1P9SA 2VB0A 1AE5A 2ALVA 1OSSA 3HKJB 4KTCA 4CRAA 4CRCA 1BMLA 2C8XB 3PB1E 1EJAA 1HAIH 1SLVB 3RM0H 1C1NA 1GDQA 3UY9A 3DUXH 2ZFTA 4NSVA 1L1JA 4XDEA 2BY9X 2GGVB 1TPPA 1LPZB 1P2OA 2BD3A 2SGQE 4YESB 1BBRH 4RI0A 1GHWH 1BRUP 2W3IA 5IYTA 4GVUA 2Y81A 1S5SA 3I29A 4Y79A 1ARCA 3GDSA 2J95A 1TPAE 1NBME 1MKWK 4R0IA 2XC5A 4VGCC 2JH6D 2BB4A 4B2BA 1O5GH 4Y10E 4YM9A 1ELTA 1O3GA 2GP9B 1G3CA 1FNIA 2BY5X 2Y80A 2FP7B 3M5MA 2ILNA 1C5TA 1EJMA 1PPCE 1P0SH 1H8ED 1KDQB 1ELCA 4INHA 5I25A 1WOFA 2BD8A 1WSSH 3MNCA 3P8GA 5C67A 1L2EA 1ZPCA 2PGBB 2QF3A 4NGAH 4K3JA 4K69A 2Z9LA 4NA7A 1ZRBA 2FOAA 1EAWA 1SVPA 3QZQA 3SJOA 1UHBB 2KX4A 3UTUH 1SQAA 3RXHA 2V3MA 4WH6A 4X6MA 1O5CB 3GOVB 2ZA5A 1K28D 1JIMA 2IJOB 3HGNA 4CR9A 1SHHB 1DVAH 2JH0D 3TVJB 1A0HB 3SGBE 3TGJE 1C5WB 1OWDA 2AHME 1W3CA 3C27B 1YPHC 5E8EH 4B2CA 1FAKH 1SLXB 3T29A 3RLWH 1OS8A 1IQIA 1HB0B 4NWLA 1Z71A 1SGCA 5A0CA 3TJOA 3LJJA 3HATH 5EJZA 2GCTC 2QN5T 1D3PB 1O5EH 3SBKA 3RXEA 2FMJA 4RSPA 1SMFE 1UTQA 3QGNB 4SGAE 4CREA 4AN7A 4I8JA 1TONA 2FOGA 5HXFA 2C3SA 2CK3D 2Y82A 1TX6A 1DUEA 4ABBA 3RU4E 1UTLM 3IWMA 2L74A 1H9IE 2ZPRA 4K5ZA 1YYY1 2G51A 2GZ8A 3KHVA 4ISOA 4NIVA 2GZ7A 2OUAA 1ZMJA 3TK5A 3W95A 1S0RA 1F0UA 3RMMH 2R0LA 1UJ1A 1W2KH 2A2XH 3PV4A 1S85A 6GCHF 1XKBC 1PPGE 3T62A 4I86A 3BSQA 2Q1JA 4FOUC 3M3VA 1QB6A 1Y3UA 1KXCA 2GD4B 5HM9A 5EJ1A 4ISHH 1N8OC 2Z94A 3PLKA 3UNSA 3I77A 2ULLA 2SGPE 3MFJA 3QGJA 1O2YA 5EODA 3K6YA 2FXRA 3LDXH 2J9NA 1LQEA 4K1TA 3A7ZA 3P70B 2OQUA 2J34A 2Y6TA 2O8MA 1ZGVA 4X1NU 1TNIA 1KXAA 3A80A 4K8YA 3O8BA 1G3BA 1GPZA 3QN7A 1WXRA 3WWBA 1YPGH 4WMFA 2XOKD 3F0OA 2BY6X 3PROA 1CO7E 1ZSLA 2Y5HA 4E7NA 5T1VA 1V2ST 2THFB 2P3UB 4CBNA 1RD3B 1BIOA 5EU8A 1L4ZA 1ELVA 3ZZAA 1AGJA 1OKXA 1P2JA 3KQ5A 1QNJA 3RXIA 3T26A 1TRNA 2PHBA 3GYMA 2W7UA 3K2UA 4K2YA 4TY7A 3URDA 3TH4H 3VB4A 4IBLH 1YP9A 5FPYA 1DDJA 1THSH 8ESTE 1SC8U 1ZLRA 3EA9A 3H7OA 1UMAH 4JYUH 3NRLA 4BAOB 3L33A 1PPBH 1CE5A 1HRTH 1E1QD 1O2LA 8GCHF 1SBWA 3F9FA 4YXWD 1FPHH 5J4SA 3O8CA 1E36B 1J15A 1OP0A 3MH7A 4AFQA 1P01A 2GT7A 1F0TA 1LMWB 1T31A 5ABWA 1K9OE 3RXRA 1HAZB 4Z6AH 1V2NT 1SI5H 3FP8E 2OXSA 4RT1A 1FUJA 2I6QA 2BTCE 3KF2A 5A8XA 2GDDA 1QQUA 2XBVA 2AMPA 1QJ6B 1IQLA 4KTSA 1AZZA 2QIQA 4X6PA 5LPRA 2SGDE 1P3EA 3IG6B 3MI4A 3A8DA 2F4LA 3FKSD 1SGQE 3OX7U 3PM3A 1BTPA 3PO1B 2KCOA 2OCVB 4FUDA 3SGQE 1AHTH 1C5ZB 1K1MA 3AAVA 2BDGA 4FUJA 1O2ZA 2GT8A 1UCYH 1OWJA 1GI8B 2ANYA 1C5LH 2QF0A 4AZ2B 4BXSA 2SGEE 2LNCA 4NWKA 1ACBE 3UAIC 4CR5A 3SV6A 4ZHAA 1S6LA 3SNEA 9LPRA 2BLWA 2AGEX 1YPLH 3RXQA 4H6TA 3B9FH 3M5NA 1GVLA 1NY22 1MTNB 1Z1JA 1HXEH 1EAXA 4J2YB 3GY7A 2H6MA 5F6MA 3U28C 4MTBA 1YC0A 1SGEE 1TNJA 2GTBA 2ZU5A 2ZTYA 1GDUA 1KDQA 3A8BA 1F0SA 3GICB 5GJ4B 1QA7A 4ASHA 1D9IA 1AMHA 3MWIU 5CMXH 1TYNA 3SU0A 3BTME 1CVWH 4AB8A 1UHBA 2FIRH 1MKXH 4NZLA 3BTQE 4XRNA 5K7RA 4IN1A 4ZHLU 3WW7A 3S0NA 1QRZA 1Y3VA 2VVUA 4NSYA 1XM1A 1TBZH 2AH4X 3S7KB 3ATIA 5C1YA 1V2TT 2Q6DA 2ZHEH 5FPSA 5FCKA 3SW2B 1CBWB 1C9PA 1NN6A 1BJVA 2YMSD 4BNRA 4E7RG 2NU3E 3PV5A 1LHCH 4U01A 1GJDB 1ZOMA 1EKBB 1FIWA 2EQNA 2J97A 3TNSA 2IOTA 3FZDA 1ZPBA 2ZGCA 4DGJA 3C1KA 3ZYEA 2PTNA 1SGFG 3VEQB 1S81A 4ZXYH 4ABAA 2ZHQH 2P8OB 1CA0B 2W5EA 1QR3E 3HPTB 1GDNA 1AD8H 2ODPA 1C5SA 2BD9A 4FU9A 4H4FA 3UQVA 1D3TB 4I8GA 1C9TA 1K1NA 3E1XB 3SN8A 1GL0E 1P04A 1A3BH 1F92A 1F2SE 1GBEA 4UFGH 2M2AA 5C5OA 1FN8A 1O2XA 3A88A 4MLFB 2XW9A 5A8ZA 2A4RA 2PP6A 2DE8A 2B5TB 1AFQC 1WV7H 3Q3KA 3ZZDA 2TPIZ 1RJXB 1CA8B 1RIWB 4Q80A 2J94A 2VWOA 3RXPA 1BT7A 1C2LA 2BQ6B 2D26C 1ZMLA 4XFQA 3I78A 1TBRH 3D49H 2P3TB 1G2MA 2G52A 1O0DH 1BTXA 3P8FA 2CV3A 1DOJA 1O3OA 3OY5U 2EA3A 1ESTA 1GGDB 2TGTA 4I8KA 1QY6A 3ZZ5A 1BDAA 5EQQA 1YPEH 3ODFA 2CN0H 1P12E 3V3MA 1GI2A 1TE0A 3VB3A 1ZTJA 2FI5E 1MTUA 1HJ8A 1CGHA 3SZEA 4FXGH 2FWWA 1H8IH 5GDSH 1EAIA 5T6FA 5T6DA 5C5NA 4IW4E 2F9OA 2QXHA 2Z7FE 1THRH 4H42U 2WV9A 5HM2A 2CHAB 1GHBF 5GPIB 4AGJA 2ODYB 4U32A 2WV5A 3KYGA 2PKSC 1LDTT 4WH8A 3SJIA 4RT0A 1A0JA 2ZCKP 2J38A 4DCDA 5C0UA 5C3NA 4YLQH 3BN9A 3GCHB 1BRBE 4F48B 3U1JB 1O31A 2BDYA 1QJ7B 5EG4A 4Y8YA 1V2LT 1TMTH 1O2SA 1P3CA 1Z8GA 3ZV8A 4AGKA 1QB1A 1T4VH 1TWXB 2TGAA 1JOUB 2J92A 1TX7A 1GBMA 5LPFA 1G3DA 2C8WB 1RS0A 1UTKA 5EPNA 3S9CA 3KN2A 5KECA 1BRAA 1N1LA 3CS7A 3MOCA 5F03A 2RCEA 1MH0A 1OYTH 1GJ8B 2BDIA 4Q63A 1BB0B 3BTWE 1FZZA 4ABDA 1BA8B 4OS6A 1DANH 1O3PB 2P95A 3EDXB 2W26A 2GKVE 2R3UA 2Z6BD 3LT3A 4GPGA 4MQAA 4D76A 3KEEA 2W3KA 2AMQA 4FUGA 1GJ9B 1BCUH 3UFAA 8KME2 3F2GA 2B9LA 3F68H 4XOJA 4I32A 3LOXA 1JRTA 2AIPA 1SR5C 5C2ZA 3OEED 3QK1A 3UB0A 1O3HA 6GCHG 1WBGB 1P05A 3CP7A 3E6PH 1GJCB 1CHGA 1NS3A 1V2RT 3SJ9A 2CMYA 1O3EA 2CF9H 2A5AA 3HGPA 3TGKE 2ZP0H 1YLCA 4B76A 4D7FA 3N99A 4Q7YA 4B2AA 1BMFD 1IQEA 2O8UA 4B75A 3UNQA 1F5RA 3K65B 1EZXC 4XE4A 2ZG0H 1MU6B 1O34A 5JBTA 1O38A 4X2VA 1JBUH 2EC9H 1VKYA 2AGIX 1BHXF 3Q00A 1Z6EA 1XUIA 2RA3A 1ID5H 3MO6A 5EOKA 3BTFE 1HFDA 5L2YH 3V7TA 3SV9A 4LZ1H 3ZZCA 1T8MA 2ZTXA 2KCAA 3R3GB 1PQ8A 3RXLA 3EQ0H 1MBQA 3VGCB 3MO3A 1MTSA 1YWUA 4A1VA 1O2HA 1TQ0B 1O2IA 3UPEA 2OBOA 2VNTA 1MCTA 4FVBA 3PWBA 2GDEH 1WTGH 1AB9C 6CHAC 3FOAA 1EJNA 2STAE 3BTTE 3QUMP 2A5IA 2A7JA 4K60A 4OS7A 3SJKA 1GG6C 3T2NA 1J9CH 2IPQX 1TGSZ 3M37A 5L2ZH 1NRNH 3UIRA 1ESAA 4X1QU 2A7CA 2G55A 1GBKA 3ZIAD 1TB6H 1G2LA 1GI4A 1QL7A 1K1PA 2GCTB 8GCHG 1Z1IA 1ORFA 4R8TB 1O36A 2OK5A 4DIIH 1S6FA 1YBWA 5C0TA 1GBIA 1W0ZU 1MTVA 4AOQA 4A6LA 2ZFQH 2GJGA 3PLBA 1LVYA 2TGPZ 1TX8A 1XUJA 1GI3A 1QL9A 4I7YH 1ZSJA 2D8WA 1TPSA 2ZTZA 1C2MA 3UWJH 1TNLA 1QB9A 1PYTD 1SOTA 1O30A 3RMOH 2V3OH 4K1EA 1B7XB 1ZRKA 3A82A 1FV9A 3M7TA 3MHWU 2C4FH 4YTAA 5F53A 3S9AA 1O2WA 4B73A 4BXWA 1H9LB 2V6NA 1ANBA 1ELGA 4XBCA 1S84A 3ZVEA 1BTUA 4IS5A 2UWLA 2Z9IA 1EZQA 1DWDH 1IHTH 1SLUB 4YO9A 4JCNA 4CHAC 1GBAA 5F8XA 1WQSA 1BUIA 1VCWA 1Q31A 2B8OH 3DSGA 1C5UA 4YT6H 1AFEH 3DHKH 4TPYA 1N8OB 4OS4A 3LPRA 3TGIE 2WUBA 5FXLA 1KXFA 2WUCA 1G9IE 2BM2A 4YOGA 1CSOE 1VGCB 3K9XB 4BAKB 4X1SU 3RMLH 2GMTC 1KYNA 4NCYA 2PLXA 4JK5A 4CH2B 1ELEE 1COWD 1NRSH 2BD4A 2C90B 2XC4A 3TJUA 3H5CB 4M7GA 2WV4A 3F1SB 1Q2WA 1MAXA 2FI3E 1OWHA 4Y7AA 4ACAA 5EQRA 5DP8A 1A5IA 1HXFH 2OD3B 1ELFA 4WMEA 1NZQH 4KELA 1GHVH 3P8NA 5EW1H 1ZZZA 3RXDA 1VJAU 1MQ5A 3O8DA 1NFUA 3KIDU 1NU7B 2FLRH 4PROA 4CRFA 5LPEA 2J5UA 3QTVH 3RU4T 3MH5A 3TITA 1BTWA 3MO9A 4ABEA 1GHAG 1LHEH 3A7YA 3L6PA 2QCYA 5H4IB 1NROH 1RTKA 3OU0A 1UK3A 1K1OA 6LPRA 1YCPM 2DUCA 3LC5A 1GJ4H 1JXPA 1HV7A 1U6QA 1ELDE 3ATKA 1P2KA 3PMAB 4ZKSU 1GCTB 1O33A 2BX3A 1O3AA 1QBNA 1FONA 3BIVH 1F5LA 1HCGA 5HIYA 3U8OH 4HGCA 1AWFH 1FY3A 1RGQA 1SQRA 5GCHG 2PUQH 1BHXB 1IOEA 1UK4A 1UO6A 3A7XA 5DN6D 1C1PA 3DA9B 3H7TA 1J8AA 4IN2A 2Z9GA 4YZUA 3UR9A 1P03A 3M3SA 3VB6A 3E0NB 1UTOA 1HJAC 2XNIA 3RP2A 1S83A 1PQ7A 1TFXA 2B7DH 2O9QA 3OAAD 1LHDH 1T8LA 1FPCH 2WPLS 4JMYA 3LONA 4X2XA 2YMSC 3GCOA 4X1PU 5TJXA 3BG4B 1GHZA 4X1RU 4MNYA 2BVRH 2CF8H 1YPKH 1DFPA 1C5MD 2TGDA 1A0LA 4FUBA 1RXPA 2G8TA 1WYKA 4BTTB 1SHYA 3M3TA 3VG8A 1GI7B 3RM2H 2FYQA 1L1NA 1RTFB 1B5GH 3ITIA 4HTCH 4GHTA 2HNTF 4A92A 3KQEA 2DE9A 4O97A 1NFXA 1O3BA 1RRKA 3OTPA 3FP6E 2ZGHA 2AIQA 3UNRA 1ETRH 1GI5A 4X2WA 4A5TS 3SV2H 1K0HA 1HIAB 2V7QD 1CGJE 1AVGH 1DXPA 1V2VT 4AX9H 2SNVA 1EOLA 5DPAA 1ZTKA 2J2UA 4XSKU 1NRRH 3NK8A 2XTTB 3A8CA 4NG9H 3KGPA 1ETSH 2D2DA 2GZ9A 1DE7H 3HKIB 4MDSA 2P3FH 1MQ6A 4OGYA 1V2OT 2NU2E 2VJ1A 5DG6A 2HALA 1SGPE 1TLDA 3TIUA 1SFIA 1C4U2 1LVBA 2KAIB 1ZHPA 1YPJH 3T28A 2V35A 1GHBG 3Q3YA 1JWTA 2XBYA 3ATLA 5HGGA 3L3TA 4ISLA 1GBFA 3RUOA 2BOKA 4FUCA 1DPOA 5AHGH 5FCRA 1EB1H 2F3CE 1YKTA 3LGUA 3BG8A 1UTNA 3BEIB 2ZF0H 4IGDA 3SUGA 2OC1A 2HPPH 4ABFA 1QJ1B 3U98H 5K0HA 3UQOA 4I31A 3PMJA 4I33A 1OOKB 3ZV9A 2VIDA 1GBHA 3LJOA 1D6RA 3IITA 3CS0A 1A61H 2K0QA 4BAQB 3F9GA 4INLA 1V3XA 1C5YB 2JJ1D 2KCPA 3TU7H 1ZTLA 2ZKSA 1DLEA 2BLQA 2ZIQH 3MU4A 1TAWA 2JETB 1C5RA 1O2JA 3RXAA 4MPVA 2OTVA 3B23B 4AYYB 4DT4A 3EGKH 1GMCG 3A86A 5PTPA 1AO5A 1OYQA 2ZECA 3SGAE 3SUEA 1CHOF 5DP7A 2BMGB 4HI3A 2Z9JA 4RKOB 1WU1A 2RG3A 2QV1A 2OLGA 2BDCA 1MMJN 2FM2A 1C2KA 1W8BH 3ZZ9A 3F9HA 1ZHMA 1TRYA 2ZDKA 1NESE 1GVKB 1O2KA 1SGDE 1XUFA 4OS1A 4P02A 3MU5A 1QZ8A 1DT2A 2H1UA 5BPEA 1SGIB 3BF6H 4ABIA 2NU1E 4TPIZ 1WCZA 1FY8E 2R9PA 5FHTA 1YF4A 1ZYOA 2W7SA 1J14A 1E35B 2AEIH 1TNGA 2J4IA 1O3CA 1ELBA 4LXBH 5CHBA 4CRDA 1SFQB 4DW2U 5B6LA 1GL1A 1GHAF 1LO6A 3SOSA 2HRVA 5EQSA 3JZ2B 4O03A 1ZPZA 1C1SA 3SU1A 1Z8JB 2XCFA 2I6SA 2FLBH 1W11U 2FOFA 3UR6A 2JH5D 3RXBA 1ZJKA 3A7VA 1IQHA 2OC0A 1IQFA 4X8VH 2ODQA 3SORA 1KXDA 3M61U 5GCHF 1OPHB 1VCQA 4DJZB 2ANKH 1K2I1 1N6XA 4DG4A 3A89A 5AF9H 3GY2A 3QX5H 1LHGH 3UOUA 2V0BA 2XC0A 2GCHG 5IK2D 1W13U 2GVFA 1EPTB 1BTHH 1P2IA 1AZ8A 1FX0B 1ANCA
chains in the Genus database with same CATH topology
3DFJA 3FVFB 3OY6U 1BOQA 5FPTA 2WINI 4KGAA 1YGCH 4CRBA 1UVPA 4ISNA 1PJPA 1XVOA 1O5DH 1GI0A 4RKJB 3GY4A 4LK4A 4O3TA 5DGJA 1SGYE 3ATMA 3NCLA 3RXKA 1T8NA 5J4QA 4F49A 3P8OA 1PYTC 4MVNA 3OTJE 3ZVGA 3BTGE 1GCDA 1SOZA 4H6SB 3PO1C 2A0QB 3ZVFA 4ABHA 1KXBA 1Y3XA 3R0FA 1Z8IB 1XUGA 1CT2E 2A45B 1OWEA 2VH6A 3NZIA 2H9EH 1DUAA 2PSYA 1KXEA 4ZXXH 2ZGJA 2GX4A 2BD2A 4DT7B 3KL6A 1DWEH 2A32A 3NPSA 8LPRA 1O35A 5EXMA 2OINA 5FX5A 2R3YA 5IDKA 3VXEH 2OC8A 2BD7A 1Z7KA 1QL8A 4AYVB 3BTDE 3NUMA 1SGFA 2QXJA 4Y76A 5EXLA 3TJVA 4ZH8A 5EW2H 1HIAA 1RFNA 3RXMA 4MPUA 5CHAB 2F83A 1MTNC 1V2JT 3BTKE 1CQQA 3RXJA 1DY9A 1Q3XA 3KCGH 1O2OA 2OC7A 1AWHB 3N7OA 2ALPA 5EPYA 4CBOA 1GBLA 5ETXA 1QURH 5JBAS 2OQ5A 3GDUA 3WY8A 4ABJA 1C4V2 3SNBA 1HJ9A 2C93B 2BZAA 1H9HE 2Y5FA 3GY6A 1C1TA 2PUXB 3SHAH 3U1IB 1JIRA 1C1WH 2XBWA 2ZQ1A 5FBEA 2JKHA 3ZZBA 3A7WA 4NIWA 1ZJDA 4QT8C 2Q6GA 1MZAA 4A1XA 2KAIA 3AW1A 2FTMA 2XBXA 3AVZA 4NFFA 4JZDH 3S9BA 3VB5A 4HZHA 2A4QA 1GJ5H 1QBOA 1GBCA 3D23A 1KTTB 2A4GA 2PTCE 2BY8X 3GY3A 2QAAA 4IC6A 1LVMA 3BEFB 3SV8A 2Y5GA 2A7HA 2FO9A 1VCPA 1QA0A 3SQHE 1C2IA 1CBWC 4FU7A 1ANDA 4Y11E 1G32B 2V3HH 1XXFA 2VWNA 1IQNA 1O3DA 3FP7E 1SLWB 1GMCF 3TJNA 3F9EA 1P09A 2PKAB 1KTSB 2QXIA 1MD8A 3G01A 1T32A 1HAGE 1Z6JH 3LGVA 1HAHH 3D65E 2BOHB 3RXFA 4CRGA 3SU3A 5EXNA 2BQ7B 2P8OC 1GMHG 1TIOA 1CA0C 2PW8H 3QZRA 4LOYH 1DLKB 1V6DA 1MZDA 1K1JA 2C8ZB 1O39A 4GCHF 4TWYA 4CH8B 5F8TA 1O3LA 3RXVA 1EZSC 1YPMH 1DM4B 1GHYH 3E8LA 3M5LA 1W7GH 5C1UA 1X7AC 1OX1A 2AYWA 4VGCB 2BXUH 1UVOA 3P17H 2VIWA 1Y5AT 2BHGA 2P93A 1F0RA 3AASA 5TCAA 3TNTA 1SSXA 3SI4H 1ABJH 2ZEBA 2BYAX 4I8HA 1RIWC 3SU6A 1E38B 1QIXB 5JYIA 2VGCC 3U9AH 1NTPA 4FVDA 1DS2E 4X0WU 1Y8TA 4DOQA 3V12A 2A4OA 2BDHA 1L1GA 3UWIA 1BJUA 2ZGXH 1GGDC 1ARBA 1C1RA 1DXWA 5F8ZA 2O8WA 4UEHH 1ANEA 2LPRA 4OS5A 2K1QA 2BDBA 2ZU1A 4WWYA 5C20A 3FANA 1J17T 3KQCA 1A3EH 3GISB 1F5KU 1NFYA 2FTLE 1FN6A 4IMZA 1GHXH 2XXLA 4JZEH 1O2RA 7KMEH 3BTHE 4FUIA 3RMNH 1C2EA 4Q2KA 2CHAC 3DT0H 1ESBA 2VWLA 1TA6A 3M7QA 1EXFA 1PPZA 5GXPA 2G4TA 2GCHF 5FX6A 3GY8A 4IC5A 4D7GA 1DSTA 4THNH 1FMGA 3ZZ4A 3GCHC 1OP8A 2CXVA 1AU8A 4WMDA 4X8SH 1V2KT 4ZKNU 4HFPB 1TGCA 4DY7B 1FAXA 3Q77A 1S0QA 5DKMA 3ZVCA 2VIOA 4GAWA 3FAOA 1K21H 3RC6A 3TLOA 2Q6FA 1FJSA 3URCA 1SG8B 3HK3B 4X8TH 3U69H 2PFEA 3BEUA 5DO4H 3QO6A 2VIVA 2G81E 4Z0KA 1QRWA 4JYTA 1EPTA 2G00A 4JYVH 1C1QA 2ZPQA 1TA2A 3RXGA 3SUDA 1GBJA 1Y3WA 2A31A 1SGTA 2BX4A 3SNCA 3ENSB 1K1LA 1B0FA 1HPGA 1SPJA 4AG2A 4ESTE 1MD7A 1CHOG 1WQVH 1O2VA 1NU9A 3ZVBA 1GVZA 2YNAA 2PGQB 3TK9A 1ZR0A 1TRMA 1OP2A 1OWKA 4Y7BA 1T8OA 4ZAEA 5L30H 1E34B 3EA7A 1PPFE 1TBQH 1YCPH 1VITH 1CT0E 5E0JA 2CGAA 1TALA 1VR1H 1CGIE 3Q3XA 5GWZA 1D4PB 1FDPA 2ZZUH 1MU8B 2ZDAH 3U8TH 1HAVB 1P02A 2ANMH 3GCTG 3SU2A 2QYIA 3A8AA 2BDAA 2FZZA 3LIWA 2ZCLP 1E37B 4XBDA 2AMDA 2F9BH 1YM0A 3MH4A 3SNDA 5B6OA 1FQ3A 1XMNB 1WAYB 4WF8A 1C1MA 3VGCC 1W7XH 2ZDVH 3LH3A 3ELAH 1TOMH 4MPXA 1V2WT 1O3JA 2VVVA 3ZZ6A 1BMNH 5DP3A 5DK1A 4FU8A 4U30A 4NIYA 3TH3H 1O2GH 1EAUA 2XWAA 2FDAA 1K22H 1C1OA 1V2UT 2FODA 2P16A 2FX4A 2R2WU 1Z8RA 4DURA 2WPJS 3E3TA 2HPQH 1SL3A 1M9UA 3T27A 2WPKS 1GWAA 2QC2A 3PTNA 4Y0YE 1S82A 2F9NA 3FZZA 4KTUA 3T5FH 1TMUH 4ISIH 4X8UH 1EATA 1TGTA 5I46H 3A7TA 1Y3YA 2Z3EA 1O32A 1GMHF 5A8YA 2BQWB 1LTOA 4JZFH 4BAHB 4ZMAH 2ZHWH 1ZSKA 1GI9B 4WXIA 3SI3H 2PKAA 3JZ1B 1INCA 2A1DB 2FOCA 3STJA 1UVSH 2AFQB 2XWBI 3TH2H 1W14U 3KNXA 3BV9B 2BXTH 1VITG 1O5BB 1QBVH 3AAUA 1EUFA 2G4UA 2Z9KA 1AQ7A 1GMDG 2TIOA 2UWPA 3CENA 1FY1A 2D1JA 3UREA 3SJ8A 1VJ9U 2NWNA 5JB8S 3A83A 1D6WA 2G5VA 2ZHDA 7ESTE 3S69A 1HBTH 4X6OA 2VVCA 4Y71A 1FI8A 2ZHFH 3FFGA 1Y5BT 1HUTH 4X2YA 1Y59T 4UD9H 1O3NA 1TPOA 2EI6A 4UFDH 1O3FA 1VGCC 1O2PA 2PSXA 3HK6B 1HAOH 4AB9A 1YLDA 7GCHG 2ZC9H 2QGRA 1C5XB 1K1IA 2H2ZA 2FOEA 1BBRE 2NU4E 1AKSB 4BTIB 5C1XA 1P06A 5JPMH 2ASUB 2PR3A 1IHSH 3VFEA 1QHRB 1TGNA 3LGWA 4Y8XA 2UUKB 2FI4E 1O2MA 4Y8ZA 5HMAA 4TWWA 4A7IB 3RXCA 1BRCE 4WJG2 3RXTA 2BLOA 1A1RA 3PLPA 1LPKB 2ZWLH 1V2MT 4OGXA 2BZ6H 4KP0A 1TMBH 1PPHE 1YPHE 4Y6DA 4LZ4B 3U8RH 4WVPE 3PWCA 1P2QA 2FEQH 1DY8A 2F91A 1O2NA 3ZZ7A 5ESBA 1LQDB 4SGBE 3SU5A 1GCTC 5SGAE 1HDTH 3LH1A 1KSNA 3V0XA 2ZCHP 2YNBA 1EB2A 3UUZA 1XXDA 1ZHRA 3MU0A 3EYDA 3RU4D 1KY9A 1EQ9A 2CJIA 1G36A 3RXSA 3MU8A 3MYWA 2WPIS 1FLEE 5LH8A 2IPHA 3TPIZ 1LKBA 1QFKH 3SZNA 4ZHMU 4JZ1A 3TK6A 1TQ7B 1BTYA 1LKAA 4IMQA 1C2DA 2NU0E 1XUKA 2RDLA 2IN2A 4YOIA 3BG4C 1SB1H 2PWXA 1AFQB 2BVSH 3S7HB 4GCHG 4BOHA 1C1VH 3OSYA 4NA8A 4ZKRU 2B0FA 1B0EA 2Z3DA 1W0YH 4GSOA 3MH6A 2FOHA 4F4OC 4YLUA 2M5TA 2AGGX 2A2QH 1V2PT 1C2HA 4AG1A 2VIQA 3LGTA 4FUEA 2SGFE 1A5HA 1E0FD 4JZIA 3NXPA 1C5VA 3UOPA 1TNHA 3GCTF 1DICA 1BITA 2YOLA 3DFLA 1GJAB 1AIXH 2H5CA 2HOBA 4ABGA 1FIZA 4RN6A 1P11E 5BRRE 2FOMB 2C8YB 2WPMS 5G4BA 2ZU4A 3RXUA 4MNXA 3SO3A 3A84A 4A1TA 1GI6A 4XBBA 1DSUA 1YCPK 1C5QA 1BBRK 1SGRE 5DP5A 1JMOH 2ZNKH 1HYLA 3QWCH 2ZFFH 1FY5A 1GJBB 1MUEB 1HAVA 2R0KA 4E06H 1UK2A 3W94A 2PKSB 1NC6A 2OP9A 2HVXA 4ZROA 2H5DA 5E2OA 3SUFA 3MU1A 2WPHS 1ZGIA 5FAHA 1AE8H 3SU4A 3PMHB 1O37A 1C5NH 2XCNA 1EP6A 2Z3CA 1L0ZA 3E90B 1TABE 7LPRA 2Y7XA 1PPEE 4AFUA 3GCNA 4WY3A 3LC3A 2EEKA 1J16A 1HLTH 1XKAC 1O3KA 3PTBA 3RXOA 2FOBA 1UTJA 1C2GA 2SNWA 2UUFB 2BLVA 2FX6A 5LGOA 4GUXA 2VH0A 2ZU3A 1D3QB 4O3UA 4MPWA 1IQGA 1ABIH 1C1UH 5JBCS 3ZZ3A 1SGNE 3BIUH 4GLYA 4AORA 2P59A 5E0GA 1ELAA 1A2CH 4B1TA 1BTZA 1GBTA 1QCPA 1P9UA 4D8NA 1P2NA 1THPB 2H9TH 3STIA 3DD2H 1KLTA 3LGIA 1MTWA 2UWOA 2XRCA 3QLPH 1H1BA 1NT1A 2VIPA 1O3IA 5DJ7A 4MG3A 3MMGA 1UVTH 1MKWH 1VITF 2JETC 1SQTA 3M36A 2TRMA 2O8TA 1IQKA 1N6YA 2STBE 1GMDF 1GBBA 3F6UH 1NRQH 1C5PA 1AY6H 1C4Y2 4UE7H 1GJ6A 3KQDA 3EA8A 3ZVDA 2WYGA 1TOCB 2PV9B 4DIHH 3SNAA 1HAPH 4X6NA 2TBSA 1T7CA 5E0HA 3VXFH 3E91A 1GBDA 3SQEE 4NA9H 1MAYA 1SQOA 1DITH 4JK6A 4OS2A 3A87A 3A81A 3GY5A 1EZUC 3GDVA 3M7UA 1F7ZA 3GYLB 1AVXA 2VGCB 2ZQ2A 2UUYA 3NWUA 1O5AB 1PFXC 2FPZA 1BZXE 2ZPSA 4NZQA 1UCYE 2RA0A 4MNWA 4UFEH 5DP4A 3O8RA 5A0AE 2BVXH 1C2JA 3K6ZA 1OWIA 5ESTE 1MCVA 4UDWH 3ODDA 3SHCH 1OXGA 2HGTH 1AB9B 1IQJA 4YT7H 6CHAB 4UONA 2F9UA 1TNKA 1D3DB 1FY4A 3VPKA 1AVWA 1A46H 1O2QA 2ZDLA 1NPMA 2HWLB 1GG6B 1LPGB 1KLJH 1AKSA 2GV7A 2VINA 3BTEE 4U2WA 1HGTH 2ZGBH 9ESTA 5AFZH 2UUJB 5GIBA 5A0BA 4ZKOU 1LHFH 3PMBB 2FS9A 2Y7ZA 1LVOA 2QXGA 3M35A 3QTOH 3A85A 1QQ4A 5DP6A 1EP5A 2HLCA 5JDUB 1AUJA 2A5KA 3P95A 1C5OH 2O8LA 1S6HA 1W10U 1QGFA 2QA9E 2HNTC 2ZFRH 2ZO3H 3VB7A 4O9VA 2VU8E 5EGMA 1XVMA 1O2UA 4GHQA 2GV6A 3P6ZB 1P10A 1HNEE 1NFWA 1XUHA 5CE1A 4YOJA 1HAYB 1LCYA 1NO9H 1V2QT 1O3MA 1FXYA 1DWBH 1UVUH 5A2MH 1P8VC 2AERH 1BQYA 1CT4E 3LKWA 1EPTC 2BD5A 1VZQH 5E2PA 3MNBA 3MNSA 5TCCA 4I8LA 6ESTA 1DWCH 1HAXB 5HYOA 1IQMA 2P94A 3EE0B 4E05H 3RC4A 3T25A 3AW0A 2ESTE 4CHAB 2AS9A 1MBMA 5AVDA 4J1YA 3SV7A 3KQBA 2FYRA 5AFYH 4AFSA 1C2FA 1KLIH 1XX9A 3LGYA 4INKA 2ZFSA 3ZVAA 3EAJA 2WYJA 1QRXA 1CU1A 2GMTB 2EI8A 4B71A 5JB9S 1W12U 3M5OA 3MNXA 4FUHA 5JBBS 1EX3A 1ETTH 5L6NH 1T4UH 4B74A 2XYAA 1UTPA 3ZYDA 1WTHD 3ATWA 4TY6A 4KKDA 3D62A 2EI7A 4FUFA 7GCHF 4BTUB 1EASA 1G30B 4K1SA 1DX5M 1RTLA 1NRPH 1BMAA 2FS8A 4MNVA 1UCYK 1H4WA 1ZMNA 1IAUA 2SGAA 1O2TA 1G37A 2ZDMA 3Q76A 1EOJA 1L4DA 2ZI2H 1PQAA 1WUNH 2ZDNA 4BANB 4TYDA 5CHAC 1A7SA 1AN1E 4Y0ZE 2VWMA 4UFFH 4Q7ZA 1P57B 3PYHA 1UTMA 1PQ5A 2ANWA 4D9RA 3V13A 4NIXA 2HNTE 5FBIA 2QY0B 4ZUHA 4D9QA 1Y5UT 4BAMB 1GI1A 4WXVA 5T6GA 3RDZA 4NFEA 3MTYA 2FESH 3OYPA 2G5NA 2ZFPH 1A4WH 4Q7XA 1QTFA 3B8JA 3ESTA 1KIGH 1TGBA 2F9PA 2SFAA 3NKKA 1O5FH 1NM6A 2BY7X 1P2MA 1GJ7B 1HJAB 5T3HA 1AUTC 1JRSA 3LU9B 3QDZB 5A09A 1BMMH 3RLYH 3E16B 1H8DH 2ZU2A 3P92A 4AFZA 5DP9A 1MKXK 2R2MB 2OBQA 3ZZ8A 3E0PB 3RC5A 1A5GH 1AI8H 2H9HA 1G3EA 2F9VA 4K8BA 4DVAU 1P9SA 2VB0A 1AE5A 2ALVA 1OSSA 3HKJB 4KTCA 4CRAA 4CRCA 1BMLA 2C8XB 3PB1E 1EJAA 1HAIH 1SLVB 3RM0H 1C1NA 1GDQA 3UY9A 3DUXH 2ZFTA 4NSVA 1L1JA 4XDEA 2BY9X 2GGVB 1TPPA 1LPZB 1P2OA 2BD3A 2SGQE 4YESB 1BBRH 1GHWH 1BRUP 2W3IA 5IYTA 4GVUA 2Y81A 1S5SA 3I29A 4Y79A 1ARCA 3GDSA 2J95A 1TPAE 1MKWK 4R0IA 2XC5A 4VGCC 2JH6D 2BB4A 4B2BA 1O5GH 4Y10E 4YM9A 1ELTA 1O3GA 2GP9B 1G3CA 1FNIA 2BY5X 2Y80A