1SLWB

Rat anionic n143h, e151h trypsin complexed to a86h ecotin; nickel-bound
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
223
structure length
215
Chain Sequence
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKVATIALPSSCAPAGTQCLISGWGHTLNHPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (serine protease/inhibitor)
molecule keywords ECOTIN
publication title X-ray structures of a designed binding site in trypsin show metal-dependent geometry.
pubmed doi rcsb
source organism Escherichia coli
total genus 51
structure length 215
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1996-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1slwB01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1slwB02
3F9HA 4ISNA 5CHAC 1Q3XA 1SL3A 3E90B 3VEQB 7KMEH 5A0AE 2B7DH 3AASA 2HWLB 5FBEA 2XWBI 8GCHG 4IMQA 4X1PU 3EQ0H 1YPMH 4NFEA 1C2DA 3RC6A 1SFIA 3MO9A 1TABE 2O9QA 4JZFH 1C1SA 1HJ8A 1ZMJA 1V2RT 3O8RA 1D3TB 2ZF0H 1GL0E 3QO6A 5TJXA 1HPGA 1C2JA 1C9PA 3SN8A 1SSXA 5FHTA 3P95A 2IPHA 2ZHEH 1D6RA 8LPRA 1M9UA 3H7OA 3QN7A 2A4GA 3KQEA 2V35A 1BBRH 3CENA 3VGCB 1HIAB 3QLPH 1DWDH 3EDXB 4WH6A 1D4PB 2G5NA 1QCPA 1CSOE 5GJ4B 2ZGXH 1LHCH 3OY6U 4BAKB 1UCYK 5HM9A 3RDZA 2GP9B 3JZ1B 5JBTA 1UO6A 1GBKA 1LKBA 1YPLH 1GWAA 1GJBB 1O2GH 1UVPA 1QL9A 3A7XA 1W7XH 4YLUA 1OYQA 1QR3E 3TJOA 1O5GH 1QL8A 3D23A 1SQTA 4OS6A 3GY3A 1C4U2 2O8UA 3NXPA 5EPNA 1XXDA 1BRAA 3EA9A 1EASA 1QBNA 1OWIA 4KTUA 5FBIA 3OYPA 7GCHG 1V2UT 1MUEB 2PTNA 2H6MA 2ZFRH 3GCOA 2AMQA 4K2YA 2G4UA 3BTWE 1SGFG 2H9HA 1PPZA 1SOTA 1AE8H 6GCHF 4WJG2 4CBOA 3VB4A 2ZTXA 2AGEX 2UWPA 4YM9A 1Z1IA 3Q00A 2GCTC 1IOEA 2GMTB 1V2NT 4KTSA 2OLGA 1O2MA 1ID5H 2VJ1A 1PPGE 3ZVDA 4ABDA 3MI4A 4ISIH 1XM1A 3UREA 1GI9B 1FNIA 3MU0A 4ZKRU 2WPHS 3A89A 4CBNA 1TOCB 3TNTA 2ZQ1A 3A8DA 3D49H 1O3NA 2FOAA 2GX4A 4RKJB 1BMAA 3DUXH 3L33A 4GAWA 4YO9A 4O9VA 4OS2A 2FP7B 4CHAC 4U2WA 1A0JA 4JK6A 4AZ2B 3ZVCA 1TPSA 2BM2A 1BBRK 3A81A 3KHVA 3KQBA 2FOHA 2B5TB 4MPVA 1V2JT 1TA2A 2FX6A 2IOTA 3K65B 1A4WH 1C1OA 3A7TA 5E8EH 5EPYA 3UTUH 3K6ZA 2J94A 1X7AC 1GHWH 3SJOA 1E34B 1DSUA 2O8LA 1OP2A 4HTCH 2FI4E 3QGNB 1O2KA 3F9GA 4PROA 1FIZA 1LO6A 1UTQA 1FN8A 1DICA 1HAGE 4ESTE 2BVRH 1TX7A 2BQ7B 4KGAA 2JH5D 1IQLA 1F5KU 2RA0A 1D3QB 2F9UA 3E6PH 4K8BA 3V3MA 2AEIH 3EA8A 1TOMH 2ESTE 1YLDA 2RDLA 3A86A 3QGJA 1CGHA 1O3EA 1P01A 2TGTA 2ZU5A 2CF8H 2DE9A 1Q2WA 4Y79A 1NU9A 1P9SA 1UVUH 1DE7H 3P70B 3T29A 2VWMA 4NWKA 1Y8TA 1DOJA 4AX9H 1C5LH 2P16A 5K7RA 5JB8S 1G3DA 1K1IA 1W3CA 5FAHA 1P2OA 2GZ8A 4GLYA 1O2OA 4D76A 3E8LA 3SU1A 3SGBE 1L1JA 2BD5A 1ZJKA 4HZHA 3SJ8A 1CA0B 2OBOA 5EXNA 2NU2E 4GHQA 2XC5A 1O30A 3Q76A 2O8WA 5JB9S 1QHRB 2GZ7A 1O39A 5GIBA 2HRVA 2ZDKA 3RXVA 3BTKE 3W94A 3RXEA 4TWWA 3UNSA 1HFDA 1S85A 4MQAA 2UWOA 3H5CB 4X2XA 4A92A 2TIOA 4KELA 1SR5C 3BTME 2A7CA 1UTOA 3SUDA 2ANMH 1V2ST 4UFGH 4GPGA 4HGCA 3RU4E 1TX6A 2ZKSA 1BMNH 4FUJA 4H6TA 4MLFB 2HNTE 1A2CH 2FTLE 4BNRA 1QY6A 4FUGA 2GV6A 1DUAA 2C3SA 3HGNA 3KF2A 1O3JA 1ANDA 2W7UA 3RP2A 5H4IB 2SGEE 4OS1A 1LCYA 4MNXA 5C67A 2PGQB 1BTPA 3UNRA 1GJDB 3T26A 1OKXA 5AF9H 4YOGA 5DP3A 2QAAA 1ZSLA 3RXCA 1V2MT 1IHSH 1W0ZU 4UEHH 3IWMA 5EW1H 3ATMA 2G81E 3O8BA 1T31A 1NC6A 5DPAA 4I33A 3LOXA 4E7RG 4Q2KA 1O2NA 2G4TA 2O8MA 1EOLA 2XCNA 2QF3A 3LH1A 2P3FH 1Y59T 1F92A 3RXUA 1LMWB 2C8WB 2HALA 3MU1A 1KTSB 4Z0KA 3URDA 3UQVA 3EA7A 4YESB 2BDCA 2OQUA 2W7SA 1FJSA 1O2WA 3HKJB 1GVLA 2WYJA 2C8YB 5C5OA 2V3HH 1EZQA 3L3TA 1ZTLA 1W0YH 3OY5U 1SVPA 2BVSH 2OC0A 1KYNA 1P57B 2UUFB 2ZGCA 1WTHD 1VGCB 1VR1H 2HNTC 2O8TA 4I8GA 1W13U 7LPRA 2B0FA 1J9CH 1P2NA 1GCTB 2PKAA 5DP7A 4AOQA 1ELTA 2ZZUH 4XOJA 1RIWC 4JZDH 2DE8A 4YOIA 4NSYA 1V6DA 1ANBA 1C5VA 1PQ7A 1SLUB 1TRNA 3RXMA 1ELGA 3SHCH 5F8TA 4GUXA 3E1XB 1JMOH 1P3CA 1N6XA 1FY5A 2BX3A 2C8ZB 2QXJA 1HJAB 1QIXB 3M5LA 4DVAU 3T2NA 3HGPA 1ZPBA 3GCHC 1IQIA 1TPOA 1EX3A 4INLA 1A46H 1MCTA 1T7CA 2GD4B 3B23B 1KXFA 1V2QT 2D26C 1S0QA 1WU1A 3C1KA 1GBMA 1TGNA 1C1QA 1GMCF 4ABBA 1MTSA 2OXSA 2C90B 2SGDE 4DT7B 2JETC 1SBWA 3STJA 1AHTH 2FO9A 5C2ZA 3Q3YA 5FXLA 3U9AH 3TIUA 3LGVA 2GDEH 2ZDAH 1O5DH 4UONA 1OWKA 1TMBH 5EOKA 1UTNA 2ZHDA 3UY9A 2BDHA 2R3YA 4O03A 3SU0A 1AFEH 1P9UA 3E0PB 3SU4A 2J38A 5C1XA 2ZPQA 2AMDA 4NIYA 2ZU4A 3NCLA 2ZPSA 6ESTA 1CT0E 3BTQE 3ZVAA 3C27B 3MH6A 2Z9GA 4LZ4B 5FX6A 4X6NA 5EQSA 1ESBA 2F9VA 1KXDA 3SGQE 1A61H 1QQ4A 1Y5UT 3R3GB 4WXVA 1NFXA 2QV1A 4CR5A 3M5OA 2NU4E 1HAIH 2A7HA 2SGAA 3M3SA 3A83A 2J9NA 1FDPA 1TRYA 1AI8H 4B71A 3RXPA 1LPKB 1CBWB 3U1IB 3ZZ9A 2CMYA 2Y81A 4RKOB 3BEFB 3MFJA 2AYWA 1O2JA 2VH0A 1NFWA 2FESH 4DJZB 1GHZA 1OWDA 3MU8A 5AVDA 1D3PB 1RS0A 4X2WA 4X6PA 3VPKA 1P11E 2FLRH 3TK5A 4ABHA 2FOBA 1ARCA 3BIUH 4CRCA 2J4IA 2BDBA 1Z8JB 1P2JA 4FUDA 4ZXYH 1CU1A 3GY8A 1ESTA 2PWXA 1GHAF 2VIWA 4Y0YE 3S9AA 1DY8A 3IITA 1MAXA 5I46H 4ABEA 1TX8A 1ELVA 2SGQE 4FUIA 3A7YA 2HLCA 1T32A 1VCPA 2XBVA 4BTTB 5DKMA 3M5MA 1SGEE 2XTTB 1CGIE 2Y5FA 3HKIB 1NRPH 4CRAA 1ETRH 3SV2H 1ZGIA 5FPTA 1UJ1A 1MTNC 4X2VA 1C5QA 1MKWH 1EOJA 2GV7A 1VITG 2SGFE 2PFEA 1RTFB 2G52A 2B8OH 1C1MA 1C4V2 1W2KH 3PMHB 1EP6A 2JKHA 4UE7H 2FWWA 2G8TA 4I31A 4O3UA 2ZA5A 8KME2 3BTTE 1ZHRA 1C5ZB 4ZXXH 6GCHG 3LPRA 2CXVA 1H9HE 3ODFA 1AIXH 1YM0A 1N6YA 2BXTH 1P2QA 3OU0A 2AH4X 3P8FA 1IQHA 4BAOB 4XDEA 1JWTA 4U01A 3KEEA 1ZR0A 1DY9A 2A5AA 1GG6C 1FONA 2PHBA 3KNXA 2BMGB 1ZPZA 5AHGH 1TGCA 5T6GA 2HNTF 1AWFH 3EE0B 5E2OA 2BY5X 2F9BH 1THRH 3NWUA 1NRRH 1XMNB 4X2YA 5A0CA 1B5GH 5GCHF 1NZQH 2OC1A 9ESTA 2FYQA 3SGAE 4BAMB 1ARBA 1ZGVA 1UK3A 1AB9C 1XUIA 1O3GA 2K1QA 2BY6X 2FDAA 4K8YA 3L6PA 3PMJA 2ZFQH 2FEQH 1MZDA 2Z9KA 1GI7B 1MKWK 1O2UA 3R0FA 1C5OH 1UK4A 1K1MA 3AVZA 2ZDNA 4FVBA 2ZECA 1OWEA 3RXJA 1HUTH 1GJAB 5C1UA 7ESTE 4LXBH 2H9EH 1HXEH 1YKTA 4O3TA 1QB9A 3PROA 1V2VT 3BEIB 4VGCC 3UR9A 1C5PA 1K1JA 2W5EA 1GJ4H 3MNSA 5SGAE 1O2RA 2WUBA 4D9QA 4YT7H 1ZLRA 5DO4H 4KTCA 3RM2H 4K3JA 1UVTH 1Z6JH 1BHXF 4RN6A 1PQ8A 3BF6H 4CRDA 1EZSC 1TIOA 2GTBA 5C20A 1BJUA 1O2LA 2OCVB 5JBBS 1HBTH 2H9TH 1TBQH 4F4OC 1Y5AT 1T4UH 5EXMA 5LPFA 2ZHQH 1SGCA 5FCRA 1GGDC 1JRSA 1W14U 1SGPE 2A0QB 2ULLA 3FZZA 3QZQA 1TBZH 2VIDA 3A8BA 5FX5A 1XUKA 4UFEH 4AFUA 3EYDA 1FLEE 3F6UH 1S84A 5DG6A 1ZHPA 1O35A 3UIRA 1SGTA 1O2YA 1ZRKA 1DXPA 1NM6A 2RG3A 2THFB 1K9OE 1FZZA 1G2MA 3UPEA 5ESBA 3MYWA 2PKSB 1EPTB 4DY7B 3SUGA 3SU3A 3ZZ3A 1ANCA 2WPIS 3VB6A 2SFAA 3I78A 1HAYB 4NIVA 5A8ZA 3M36A 1O5CB 5JDUB 2Y7XA 2H5CA 3F9EA 3MU5A 1G3EA 1QFKH 2H5DA 3QZRA 4OS7A 4UFFH 2AFQB 1O34A 2FIRH 2G00A 3KQCA 1YP9A 1J16A 3SOSA 3SBKA 4CRFA 2A32A 2ILNA 1NRQH 1C2HA 2PGBB 4J1YA 1EJAA 4WH8A 1QBOA 1NY22 4DIHH 3NUMA 1UMAH 1HNEE 1LTOA 2ALVA 4H6SB 2EC9H 3GCTG 3T25A 1K1PA 4K60A 3IG6B 4XBCA 1MTVA 3ATWA 1O3AA 2AERH 1GCDA 2PTCE 1HCGA 1V2OT 3LC3A 3AW0A 4FUBA 1Y3UA 1K2I1 2PR3A 4B75A 2Z9LA 3RXQA 3SNDA 3A80A 1L4DA 6CHAC 1FAKH 2V6NA 2ZNKH 1W12U 1F5RA 4WMDA 1FPCH 3VB3A 1C5WB 1S6FA 3DFJA 3ZYEA 1H9IE 3GY2A 1ABJH 1EAXA 1O33A 3RC5A 2HGTH 1V2WT 4MTBA 4D9RA 1GBJA 3SZNA 1EQ9A 3GDSA 3V13A 4AFZA 3RXRA 1GI8B 1DS2E 4ASHA 2R9PA 4GVUA 1SLWB 3VXFH 1IQKA 2ZTZA 2GT7A 3NZIA 4I8LA 1V2LT 2BY8X 2WYGA 5F6MA 1G36A 4Y7BA 4XSKU 2CJIA 2FODA 4NA8A 3TGJE 2FX4A 1O2SA 1HIAA 2F9OA 3PV4A 2H2ZA 3UWIA 1UTJA 2A4OA 2QIQA 2AGGX 1TRMA 2ZFFH 1BJVA 1DFPA 1C1RA 2IN2A 2R2WU 2QYIA 1PPFE 3AW1A 3GYMA 1O32A 2F9NA 3HATH 2ZI2H 1BRCE 1GMCG 1YPEH 2A2XH 3B9FH 4BAQB 1AUTC 2ZTYA 3SW2B 3MMGA 4XE4A 1J8AA 1VCQA 4JYUH 3P17H 4F49A 4IC5A 1LVBA 3VGCC 1WYKA 1F0RA 5AFYH 3A82A 1FXYA 4E7NA 2OD3B 2C93B 3Q3KA 3A7WA 1MMJN 2C4FH 2QA9E 2GCHF 3A85A 3GY5A 3TITA 3LJJA 4E05H 2RCEA 1SB1H 4K1SA 5L2YH 5EXLA 2VINA 4WF8A 1BTZA 2G55A 1TB6H 1BMMH 1OOKB 3F1SB 1BTWA 2XBXA 1J17T 4SGAE 1CA8B 2J34A 1G9IE 5GPIB 5JPMH 2VIQA 2SGPE 1TPPA 1A7SA 1DDJA 3SNAA 2Z3CA 5DP9A 3BG4B 1Z7KA 1CE5A 1MD7A 1F2SE 2R3UA 3H7TA 3TU7H 2ZP0H 1GL1A 3O8DA 1RIWB 4FUFA 2GMTC 1INCA 2CHAC 2CN0H 2F83A 1SGIB 4INHA 3T5FH 1YPJH 1MTUA 1C2LA 1BOQA 3ELAH 4XFQA 5IDKA 2TGAA 4X1RU 1J14A 1MAYA 1AZZA 1GPZA 1A1RA 1EJNA 3TH2H 4UD9H 2BDIA 4YOJA 1D6WA 3BTEE 1YGCH 1NPMA 2ZCLP 1RTKA 1Z6EA 2PKAB 1QGFA 1FIWA 1Y5BT 4O97A 1NU7B 1ANEA 1L1NA 1TQ0B 3G01A 1G37A 1GHVH 3HPTB 3TJVA 2AIQA 4X8TH 1FAXA 4TWYA 2YOLA 2ANWA 1CVWH 1OX1A 4R8TB 1EB2A 2EI6A 1SGNE 4BTUB 2QY0B 1GI4A 4NCYA 1YPHC 3DT0H 2Z7FE 2GT8A 1QA0A 4MDSA 5F8XA 2P3TB 4ISOA 1T8MA 3ATIA 1BHXB 1Y3YA 5A8XA 1GI1A 3GOVB 3RMMH 1C5UA 2VU8E 1ZSJA 4H4FA 4B2CA 1MBMA 2ANYA 1HYLA 3KN2A 5C5NA 1A5GH 3W95A 1DLEA 1NO9H 1E36B 2FOEA 1CHOG 4OGYA 2ZPRA 1UTKA 1DWBH 2OQ5A 1BUIA 1P10A 1TAWA 1BZXE 2Q1JA 1TYNA 1GI3A 1E37B 2PUQH 4X1QU 1AFQB 1XX9A 1TBRH 3TLOA 1PPCE 2STAE 1DANH 1WQVH 3K2UA 3MH4A 3OSYA 1XUGA 1C2EA 3SQHE 2JH6D 1GBLA 1F7ZA 1QTFA 2CGAA 3K9XB 3UR6A 4AFQA 1Y3WA 4NFFA 1HAHH 1LDTT 1CA0C 3JZ2B 3ZV8A 2WINI 1P2KA 1TMUH 2A4RA 3SV7A 1IQGA 1IQJA 4I32A 3P8GA 2ALPA 4K1EA 1NTPA 3LC5A 1THPB 1QL7A 1HGTH 1P03A 2J2UA 3SI4H 5LGOA 4GHTA 1AGJA 3GDVA 4BOHA 1DT2A 1NROH 4A1VA 3MOCA 2BDGA 1D3DB 1PPBH 1VJAU 1ETSH 1GHBF 5ETXA 2AS9A 2PSXA 4Y7AA 1ZJDA 1NRNH 1C1UH 4ZKOU 3UWJH 3P8OA 1KLIH 3NK8A 2ZGJA 3VB7A 1QRXA 4X6OA 1GMHG 1WAYB 3ITIA 4Q7ZA 3E91A 3E3TA 1L2EA 1A0HB 1O3BA 3LGWA 1KXAA 3U69H 5EQQA 2XWAA 1ZPCA 3F9FA 4X8VH 3FP7E 4K5ZA 1C2MA 4NA9H 1C1PA 4TPIZ 4B73A 4INKA 3LH3A 1WTGH 1JIRA 2BD7A 5IYTA 4NIWA 4Y76A 2VNTA 1P8VC 3F68H 2Y6TA 2ZFPH 1V2TT 1N1LA 2A45B 2G5VA 4X1NU 2XCFA 1Z8IB 1BDAA 1LHEH 3PLBA 1BITA 1HAVB 1C4Y2 3ZYDA 1HAXB 4LZ1H 1ELFA 1YCPM 4WY3A 1C1WH 1G2LA 2VH6A 3RXIA 1S0RA 4NIXA 4E06H 4ABIA 3GYLB 4JZIA 1ELCA 4IW4E 3LT3A 1GBHA 4I8HA 1YF4A 3RXTA 1RGQA 1RXPA 2OINA 3U8RH 3A87A 2GDDA 3PO1B 1LVOA 4JYVH 5EGMA 1D9IA 3MNXA 1GJ9B 3RXKA 2NU0E 1IQEA 4Q80A 1VGCC 2ZFTA 1QJ6B 2ZGBH 1LHFH 2WPLS 4DW2U 1FY8E 1QB1A 3BTHE 3I77A 2Q6FA 1P12E 4WMEA 1GI2A 1SGYE 2ZG0H 2BQ6B 2KAIB 2ZGHA 3RXOA 3TNSA 2FI3E 4YLQH 1PPHE 3GISB 4JZEH 1HJAC 1IAUA 1VITH 9LPRA 1TWXB 4FUEA 2OUAA 2P8OB 4FU8A 5HMAA 1LVMA 3KQDA 1S5SA 1O2IA 4IS5A 1GI5A 2I6QA 5I25A 1RFNA 4IN1A 5B6OA 3SV9A 4Y8XA 2LNCA 3P6ZB 1EAIA 1TNLA 2A5KA 1A5HA 3S9CA 1PPEE 1N8OB 5DP8A 1W11U 5FCKA 3TJNA 6LPRA 3LONA 1UK2A 1FUJA 1G3BA 1YPGH 2VGCB 3KIDU 1KDQA 1O5AB 3VFEA 3FP8E 1P06A 2Z94A 4MNVA 5F03A 2Y7ZA 4ZHMU 1WUNH 3LDXH 5A8YA 4ZKSU 1QRWA 3O8CA 1DXWA 2V3OH 5CHAB 1GI6A 4WWYA 2XC0A 2A5IA 3DA9B 2XBWA 1GDNA 1B0FA 2ZHWH 4DOQA 2BD4A 5DJ7A 3M37A 2XC4A 1TNJA 4GCHF 2FOMB 1Z8RA 2Y82A 1KXEA 1O3HA 1V2KT 1EAWA 3ZZ5A 2BLWA 1ACBE 1O5FH 2EI8A 1HJ9A 2CV3A 1C5RA 1C5XB 5PTPA 2ZEBA 3U1JB 5FPSA 1QNJA 1P2IA 1QB6A 1CBWC 3RXFA 2EA3A 2Z3DA 1VJ9U 3BN9A 2UUYA 1P02A 1UHBB 1C1TA 4FXGH 1W8BH 5L2ZH 1GDQA 4YT6H 3A8CA 3A88A 4TY7A 2BTCE 1AD8H 4ZMAH 1O5EH 2BD9A 1C1NA 4JYTA 4Z6AH 1AVWA 2BLOA 1TMTH 3MO3A 4AG1A 1UVOA 4CREA 3ZZ4A 1ORFA 2VWNA 1DPOA 3UUZA 4IC6A 3WY8A 1OYTH 1A3EH 4NA7A 1GBFA 4KP0A 1TGSZ 3P92A 2GVFA 2BX4A 3MU4A 1H8IH 1O5BB 2FI5E 3MNBA 3DHKH 8ESTE 3PM3A 1C9TA 4K1TA 1SQAA 4DCDA 2XXLA 5E0GA 5E0JA 1C2GA 3MWIU 3RMOH 3V12A 2BD3A 4ZAEA 2GCHG 2NWNA 3SU5A 3CS7A 1T4VH 3SNBA 2PLXA 1BTHH 2W3IA 4DIIH 1V3XA 3ZZDA 4BANB 2EEKA 3ZZ7A 3DD2H 2ZU1A 3BSQA 4BXSA 1W7GH 3LGTA 1TNGA 3PTNA 2GCTB 2FPZA 3M35A 4CR9A 2ZDMA 1E38B 2BZAA 4ABAA 2JH0D 2PSYA 4OS4A 1GHYH 4IMZA 3D65E 3PWBA 4A1XA 2FTMA 1LQEA 3RU4T 3FVFB 2R0KA 1A3BH 3KCGH 4AYVB 1O2ZA 4NGAH 2STBE 1Z1JA 1BTUA 3UQOA 1L0ZA 1YPKH 4CHAB 2Z9IA 3PYHA 3T28A 1TGBA 1YCPH 1FI8A 1O2HA 1UVSH 1WV7H 4RSPA 4ZH8A 2UWLA 2Z3EA 4Y8YA 3LGYA 3PWCA 1HAZB 1VCWA 2ZU2A 3S69A 3PMBB 4WVPE 1P05A 2OC8A 1ZZZA 2ODPA 1MBQA 1XUHA 1KY9A 1O3CA 1GVKB 1ABIH 1O31A 1O3KA 1O0DH 1HV7A 4ISHH 1WCZA 1EATA 1THSH 1SGQE 4H42U 5DP6A 5FPYA 1XUFA 2QGRA 1EUFA 3TPIZ 3ZVGA 1O3FA 2Y5GA 1SGDE 1AKSA 1OP8A 4NZLA 4Y11E 1AVXA 3MTYA 1QQUA 1KIGH 4U30A 1P04A 4A7IB 4U32A 1GBTA 2XYAA 1Y3VA 4AGKA 2W26A 4K69A 1SGFA 1ZYOA 4IN2A 1J15A 2RA3A 2VIVA 2FOGA 2YNAA 5TCCA 3RXAA 1CT4E 1G32B 4ABJA 1SGRE 1ZTJA 2EI7A 3RXDA 1AN1E 4ZKNU 2ZC9H 4D7FA 1FY3A 1QA7A 2Q6DA 5CE1A 2XRCA 3GY6A 1FV9A 1KSNA 1VITF 1NS3A 2GGVB 1GMDF 1YBWA 3U8OH 1YCPK 1ELAA 1OPHB 3ZZ6A 2D8WA 1GHXH 4BXWA 2PUXB 1Z71A 1EB1H 1W10U 3UNQA 2OP9A 1GBEA 5DK1A 1TE0A 1LKAA 1WBGB 3QWCH 1QURH 1RTLA 1EPTA 3SUEA 3DFLA 1KLTA 5C3NA 2ZWLH 2CHAB 1P3EA 1IQMA 2QXIA 1BT7A 2I6SA 3SNEA 3RXLA 1NRSH 2WPMS 5J4SA 4MPUA 2VWLA 1NFYA 4FUCA 4X8SH 1AUJA 3U98H 2D1JA 4BTIB 4LOYH 3ENSB 2BDAA 1DWEH 1E35B 1SQOA 4DURA 2NU3E 1GHBG 1EAUA 3SHAH 4A1TA 4B74A 2PKSC 1EPTC 3SJIA 1O3PB 1BIOA 1Z8GA 1O37A 4B1TA 3RLWH 2FOCA 2D2DA 3ZVBA 2QCYA 3UFAA 4I8JA 1ELEE 2F3CE 2BOKA 1O3MA 4OGXA 1AMHA 2UUKB 1TQ7B 1LQDB 3A8AA 3RXBA 1NN6A 1GBAA 1TLDA 2FS8A 3TH4H 4Q7YA 4Y10E 5J4QA 4WMFA 1QJ7B 1RJXB 5GXPA 3P8NA 4ZROA 1DM4B 1DITH 1TALA 5T6DA 2A4QA 1TONA 1TNKA 1DX5M 1IHTH 1AE5A 2VVUA 2BVXH 2ANKH 3ZVFA 2J92A 1G3CA 2SNWA 4LK4A 2BLVA 1HB0B 1XXFA 1YPHE 2M5TA 3RMNH 3RXHA 1KXBA 1SLVB 2QC2A 4MPXA 1O3DA 3ZZAA 3MH5A 4NZQA 4Y71A 3ZZCA 1CO7E 3LJOA 5ABWA 1EZUC 1F5LA 4B76A 4MNYA 1SI5H 3BTDE 2V0BA 5LPRA 4X0WU 3KGPA 2ZDLA 3PTBA 4I7YH 5DGJA 3KL6A 1KLJH 1MTWA 4Y6DA 3E0NB 5BPEA 3RC4A 4I8KA 1SHYA 4SGBE 1DSTA 4NWLA 1P2MA 3PMAB 3OX7U 4DGJA 1GHAG 2A1DB 2BD8A 4AFSA 1WSSH 1L4ZA 5CMXH 3GCHB 8GCHF 2FYRA 1OS8A 1LVYA 2BYAX 1LHGH 4AORA 1O38A 4AG2A 1OSSA 1SMFE 2XNIA 1FMGA 1TA6A 1BB0B 4DG4A 4Y8ZA 4MG3A 2ZFSA 1P0SH 2JETB 1RRKA 1S82A 4A5TS 1UTLM 5JYIA 3QX5H 5HGGA 4JMYA 2VVVA 2OC7A 1MD8A 2F9PA 1GBCA 2PV9B 5C1YA 2OTVA 4UDWH 4FUHA 3MO6A 1T8LA 2ZCHP 4HFPB 1CT2E 3SI3H 1TGTA 1FY1A 2VVCA 3LKWA 5A09A 5EQRA 3URCA 2VWOA 3LIWA 5JBAS 1GJ6A 1HAPH 1C2KA 1F0TA 4D7GA 3GY4A 5HXFA 1L1GA 1XKAC 2LPRA 5HM2A 3TK6A 2TPIZ 3TK9A 1O3LA 2SNVA 1ZTKA 1PFXC 3AAVA 1O2XA 1F0SA 2A31A 3GCTF 3M3VA 1EZXC 4TY6A 2PW8H 1MZAA 2Y5HA 5EG4A 2A7JA 3OTJE 1MQ5A 4YTAA 1OWHA 3FZDA 2AIPA 4IGDA 1GI0A 7GCHF 4TYDA 1GDUA 2VB0A 3RXGA 2BZ6H 3AAUA 3ATKA 4AB9A 2ZO3H 1O2QA 1K1LA 1JBUH 2C8XB 2ODYB 1AU8A 5L30H 2WPKS 4GCHG 2HOBA 3SJ9A 1AO5A 2BY7X 2FS9A 1PQAA 1SPJA 1H8DH 2BHGA 1P09A 5EU8A 3UOUA 2FZZA 3TH3H 1O3OA 5AFZH 1F0UA 2DUCA 5GCHG 2TGDA 3GY7A 5T3HA 4AB8A 1ETTH 2GZ9A 2FMJA 1ZOMA 3SORA 2H1UA 3BG4C 3D62A 1O2PA 4MNWA 3T62A 3SU2A 2P95A 1SLXB 4B2AA 4Y0ZE 2J95A 1EJMA 3SU6A 3RXSA 3TGIE 1TFXA 1ELBA 3CS0A 2ZU3A 1FQ3A 1GJCB 4FU9A 3RU4D 3S0NA 3BV9B 4YZUA 1XVMA 2AGIX 1C5TA 2WUCA 1MU6B 1MTNB 5GDSH 3SUFA 1CHGA 1MCVA 1C5NH 1K1OA 1MH0A 2OBQA 1SHHB 2BDYA 1ESAA 1EP5A 5TCAA 4CH8B 2Y80A 3QTOH 3S7HB 2F91A 2XW9A 3RLYH 1HAOH 5DP4A 1NESE 1KXCA 1ZRBA 3CP7A 1TNHA 1LPZB 3M61U 4FU7A 1DUEA 3ZV9A 1AWHB 5T6FA 1DWCH 4ABFA 3LGUA 1T8NA 2FXRA 3HK3B 2FOFA 3Q3XA 3NKKA 3BEUA 2BQWB 1T8OA 3BTFE 1PJPA 1S83A 3GICB 3QTVH 4M7GA 1CGJE 4THNH 3K6YA 1GG6B 5E2PA 3QUMP 1C5SA 1DLKB 2QXGA 1CQQA 1AQ7A 2VIPA 2A2QH 1KTTB 4JK5A 1SOZA 1TNIA 1C2IA 1ZMNA 1IQFA 5EW2H 1C1VH 5GWZA 3M7UA 1KDQB 2G51A 1AFQC 2BLQA 5LH8A 1O3IA 2P59A 1GJ5H 1BTXA 1PQ5A 3M3TA 2WPJS 1VZQH 4CRBA 1GCTC 1AZ8A 1AB9B 1C5MD 2CF9H 1GVZA 1MU8B 3SJKA 1ZHMA 2XBYA 4A6LA 2FLBH 3M5NA 2HPPH 1QRZA 3M7QA 1HLTH 4OS5A 2BY9X 3V0XA 2UUJB 2ASUB 4WXIA 3GCNA 1HXFH 1A5IA 2NU1E 2Z6BD 4NSVA 3RMLH 3T27A 2QN5T 1A0LA 3A7ZA 1BTYA 1MKXH 1GBBA 2BXUH 4ZHLU 4J2YB 1JIMA 3FP6E 4VGCB 3PB1E 1G30B 3BG8A 3UOPA 1PYTC 2TRMA 1GBIA 3EGKH 1K21H 3ZZBA 4D8NA 2Z9JA 3BTGE 3SNCA 1JOUB 1HDTH 1K22H 1MQ6A 3LU9B 5A2MH 1NFUA 1TPAE 1SG8B 3MNCA 3B8JA 3S7KB 4MVNA 5L6NH 1EKBB 3TJUA 4Q7XA 1E0FD 4GSOA 1U6QA 3S9BA 1HAVA 2HVXA 3FFGA 4XBBA 1GMDG 1RD3B 1PYTD 3ZVEA 3NPSA 3EAJA 3TGKE 5HYOA 1FPHH 1C5YB 1GGDB 1UTPA 4AYYB 2BD2A 1H9LB 3TVJB 1YLCA 1SC8U 1SFQB 3ESTA 2TGPZ 4ISLA 1K28D 1WOFA 1Q31A 1ZSKA 2W3KA 3A7VA 3MH7A 2HPQH 2ODQA 2ZIQH 1IQNA 3ZZ8A 2TBSA 5K0HA 1CHOF 2AMPA 5BRRE 1H1BA 1AY6H 1XUJA 4CRGA 1BMLA 4CH2B 1QJ1B 1XVOA 4X1SU 1B7XB 2BOHB 2IJOB 4MPWA 1XKBC 5DP5A 2WV5A 5EODA 3STIA 1JRTA 2R2MB 3PLPA 1C2FA 2ZHFH 3PLKA 2VIOA 3Q77A 3VXEH 4ZUHA 2P94A 4HI3A 2GKVE 1O2TA 2KAIA 1MKXK 4XBDA 3FAOA 1Y3XA 2ZCKP 3SO3A 1S81A 1UTMA 1QBVH 3E16B 2FM2A 4B2BA 3PO1C 1NT1A 1K1NA 5F8ZA 1UCYE 4X8UH 3LGIA 4X6MA 3ATLA 4ABGA 1BA8B 1YC0A 1BCUH 5A0BA 3SV6A 2QF0A 1OP0A 3HK6B 1B0EA 4IBLH 4AGJA 1OXGA 1JXPA 4AN7A 1LHDH 3A84A 3VB5A 1O36A 2YNBA 1DVAH 4BAHB 5JBCS 1O2VA 3N7OA 6CHAB 3QK1A 1ZMLA 4QT8C 3ODDA 3SV8A 1GMHF 1HRTH 2P93A 4JCNA 1AKSB 2P8OC 2BB4A 1OWJA 5LPEA 2Q6GA 1BRBE 3QDZB 5G4BA 1GJ8B 5ESTE 1UCYH 2R0LA 3SQEE 1YYY1 3MHWU 3RUOA 1WQSA 4JZ1A 5E0HA 1N8OC 3GDUA 4TPYA 1LPGB 2B9LA 4NG9H 3V7TA 1GJ7B 3FANA 2QXHA 4FVDA 3BIVH 3U8TH 1BQYA 4R0IA 1EXFA 1S6HA 2VGCC 1AVGH 4UFDH 1FN6A 1GBDA 3M7TA 1FY4A 4KKDA 4ZHAA 1V2PT 2WV4A 1BBRE 2P3UB 3I29A 1H4WA 2ZDVH 3RM0H 1ELDE 2ZQ2A 1UHBA 1BRUP
chains in the Genus database with same CATH superfamily
3F9HA 4ISNA 5CHAC 1Q3XA 1SL3A 3E90B 3VEQB 7KMEH 1E1RD 5A0AE 2B7DH 3AASA 2HWLB 5FBEA 2XWBI 8GCHG 4IMQA 4X1PU 3EQ0H 1YPMH 4NFEA 3WWBA 1C2DA 3RC6A 1SFIA 3MO9A 1TABE 2O9QA 4JZFH 1C1SA 1HJ8A 1ZMJA 1V2RT 3O8RA 1D3TB 2ZF0H 1GL0E 3QO6A 5TJXA 1HPGA 1C2JA 1C9PA 3SN8A 1SSXA 5FHTA 5EIYA 3P95A 2IPHA 2ZHEH 1D6RA 8LPRA 1M9UA 3H7OA 3QN7A 2A4GA 3KQEA 2V35A 1BBRH 3CENA 3VGCB 1HIAB 3QLPH 1DWDH 3EDXB 4WH6A 1D4PB 2G5NA 1QCPA 1CSOE 5GJ4B 2ZGXH 1LHCH 3OY6U 4BAKB 1UCYK 5HM9A 3RDZA 2GP9B 3JZ1B 5JBTA 1UO6A 1GBKA 1LKBA 1YPLH 1GWAA 1GJBB 1O2GH 1UVPA 1QL9A 3A7XA 1W7XH 4YLUA 1OYQA 1QR3E 3TJOA 1O5GH 1QL8A 3D23A 1SQTA 4OS6A 3GY3A 1C4U2 2O8UA 3NXPA 5EPNA 1XXDA 1BRAA 3EA9A 1EASA 1QBNA 1OWIA 4KTUA 5FBIA 3OYPA 5T1VA 1V2UT 1MUEB 3OAAD 2PTNA 2H6MA 4Q4LA 2ZFRH 3GCOA 2AMQA 4K2YA 2G4UA 3BTWE 1SGFG 2H9HA 1PPZA 1SOTA 1AE8H 6GCHF 4WJG2 4CBOA 3VB4A 2ZTXA 2AGEX 2UWPA 4YM9A 1Z1IA 3Q00A 2GCTC 1IOEA 2GMTB 1V2NT 3FKSD 4KTSA 2OLGA 1O2MA 1ID5H 2VJ1A 1PPGE 3ZVDA 4ABDA 1YY3A 3MI4A 4ISIH 1XM1A 3UREA 1GI9B 1FNIA 3MU0A 4ZKRU 2WPHS 3A89A 4CBNA 1TOCB 3TNTA 2ZQ1A 3A8DA 3D49H 1O3NA 2FOAA 2GX4A 4RKJB 1BMAA 3DUXH 3L33A 4GAWA 4YO9A 4O9VA 4OS2A 2FP7B 4CHAC 4U2WA 1A0JA 4JK6A 4AZ2B 3ZVCA 1TPSA 2BM2A 1BBRK 3A81A 3KHVA 3KQBA 2FOHA 2B5TB 4MPVA 1V2JT 1TA2A 2FX6A 2IOTA 3K65B 1A4WH 1C1OA 3A7TA 5E8EH 5EPYA 3UTUH 3K6ZA 2J94A 1X7AC 1GHWH 3SJOA 1E34B 1DSUA 2O8LA 1OP2A 2KCPA 4HTCH 2FI4E 3QGNB 1O2KA 3F9GA 3PV2A 1FIZA 4PROA 1LO6A 1UTQA 1FN8A 1DICA 1HAGE 4ESTE 2KCYA 2BVRH 1TX7A 2BQ7B 4KGAA 2JH5D 1IQLA 1F5KU 2RA0A 1D3QB 2F9UA 3E6PH 4K8BA 3V3MA 2AEIH 3EA8A 1TOMH 2ESTE 1YLDA 2RDLA 3A86A 3QGJA 1CGHA 1O3EA 1P01A 2TGTA 2ZU5A 2CF8H 2DE9A 1Q2WA 4Y79A 1NU9A 1P9SA 1UVUH 1DE7H 3P70B 3T29A 2VWMA 4ASUD 4NWKA 1Y8TA 1DOJA 4AX9H 1C5LH 2P16A 5K7RA 5JB8S 1G3DA 1K1IA 1W3CA 5FAHA 1P2OA 5HIZA 2GZ8A 4GLYA 5EJ1A 1O2OA 4D76A 3E8LA 3SU1A 3SGBE 1L1JA 2BD5A 1ZJKA 4HZHA 3SJ8A 1CA0B 2OBOA 5EXNA 2NU2E 4GHQA 3UAIC 2XC5A 1O30A 3Q76A 3OE7D 2O8WA 5JB9S 1QHRB 4TT3D 2GZ7A 1O39A 5GIBA 2HRVA 2ZDKA 3RXVA 3BTKE 3W94A 3RXEA 4TWWA 3UNSA 1HFDA 1S85A 4MQAA 2UWOA 4F55A 3H5CB 4X2XA 4A92A 2TIOA 4KELA 4FOUC 1SR5C 3BTME 2A7CA 1UTOA 3SUDA 2ANMH 1V2ST 4UFGH 3FO8D 4GPGA 4HGCA 3RU4E 1TX6A 2ZKSA 1BMNH 4FUJA 4H6TA 1NBME 4MLFB 2HNTE 1A2CH 2FTLE 4BNRA 1QY6A 4FUGA 2GV6A 1DUAA 2C3SA 3HGNA 3KF2A 1O3JA 1ANDA 2W7UA 3RP2A 5H4IB 2SGEE 4OS1A 1LCYA 4MNXA 5C67A 2PGQB 1BTPA 3UNRA 1GJDB 3T26A 1OKXA 5AF9H 4YOGA 5DP3A 2QAAA 1ZSLA 3RXCA 1V2MT 1IHSH 1W0ZU 4UEHH 3IWMA 5EW1H 3ATMA 2G81E 3O8BA 1T31A 2KCOA 1NC6A 5DPAA 4I33A 3LOXA 4E7RG 4Q2KA 1O2NA 2G4TA 2O8MA 1EOLA 2XCNA 2QF3A 3LH1A 2P3FH 1Y59T 1F92A 3RXUA 1LMWB 2C8WB 2HALA 3F3BA 1KTSB 3MU1A 4Z0KA 3URDA 3UQVA 3EA7A 4YESB 2BDCA 2OQUA 2W7SA 1FJSA 1O2WA 3HKJB 1GVLA 2WYJA 2C8YB 5C5OA 2V3HH 1EZQA 3L3TA 1ZTLA 1W0YH 3OY5U 1SVPA 2BVSH 2OC0A 1KYNA 1P57B 2UUFB 2ZGCA 1WTHD 1VGCB 1VR1H 2HNTC 2O8TA 4I8GA 1W13U 7LPRA 2B0FA 1J9CH 1P2NA 1GCTB 2PKAA 5DP7A 4AOQA 1ELTA 2ZZUH 1BMFD 4XOJA 1RIWC 4JZDH 2DE8A 4YOIA 1YLNA 4NSYA 1V6DA 1ANBA 1C5VA 1PQ7A 1SLUB 1TRNA 3RXMA 1ELGA 3SHCH 5F8TA 4GUXA 3E1XB 1JMOH 1P3CA 1N6XA 1FY5A 2BX3A 2C8ZB 2QXJA 1HJAB 1QIXB 3M5LA 4DVAU 3T2NA 3HGPA 1ZPBA 3GCHC 1IQIA 1TPOA 1EX3A 4INLA 1A46H 1MCTA 1T7CA 2GD4B 3B23B 1KXFA 1V2QT 2D26C 1S0QA 1WU1A 3C1KA 4DT4A 1GBMA 1TGNA 1C1QA 1GMCF 4ABBA 1MTSA 2OXSA 2C90B 2SGDE 4DT7B 2JETC 1SBWA 3STJA 1AHTH 2FO9A 5C2ZA 3Q3YA 5FXLA 2YMSC 3U9AH 3TIUA 3LGVA 2GDEH 2ZDAH 1O5DH 4UONA 1OWKA 1TMBH 5EOKA 1UTNA 2ZHDA 4RT0A 2BDHA 2R3YA 3UB0A 3UY9A 4O03A 3SU0A 1AFEH 1P9UA 3N7DA 3E0PB 3SU4A 2J38A 3WW7A 5C1XA 5IK2D 2ZPQA 2AMDA 4NIYA 2ZU4A 3NCLA 2ZPSA 6ESTA 1CT0E 3BTQE 3ZVAA 3C27B 3MH6A 2LELA 2Z9GA 4LZ4B 2F4LA 5FX6A 4X6NA 5EQSA 1ESBA 2F9VA 1KXDA 3SGQE 1A61H 1QQ4A 1Y5UT 3R3GB 2WPDD 4M9FA 4WXVA 1NFXA 2QV1A 4CR5A 3M5OA 2NU4E 1HAIH 2A7HA 2SGAA 3M3SA 3A83A 2J9NA 1FDPA 1TRYA 1AI8H 4B71A 3RXPA 1LPKB 1CBWB 3U1IB 3ZZ9A 2CMYA 2Y81A 4RKOB 3BEFB 3MFJA 2AYWA 1O2JA 2VH0A 1NFWA 2FESH 4DJZB 1GHZA 1OWDA 3MU8A 5AVDA 1D3PB 1RS0A 4X2WA 4X6PA 2QE7D 3VPKA 1P11E 2FLRH 3TK5A 4ABHA 2FOBA 1ARCA 3BIUH 4CRCA 2J4IA 2BDBA 1Z8JB 1P2JA 4FUDA 4ZXYH 1CU1A 3GY8A 3KQ5A 1ESTA 2PWXA 1GHAF 2VIWA 4Y0YE 3S9AA 1DY8A 3IITA 1MAXA 5I46H 4ABEA 1TX8A 1ELVA 2SGQE 4FUIA 3A7YA 2HLCA 1T32A 1VCPA 2CK3D 2XBVA 4BTTB 5DKMA 3M5MA 1SGEE 2XTTB 1CGIE 2Y5FA 3HKIB 1NRPH 4CRAA 1ETRH 3SV2H 1ZGIA 5FPTA 1UJ1A 1MTNC 2RDEA 4X2VA 1C5QA 1MKWH 1EOJA 2GV7A 1VITG 2SGFE 2PFEA 1RTFB 2G52A 2B8OH 1C1MA 1C4V2 1W2KH 3PMHB 7GCHG 1EP6A 2JKHA 4UE7H 2FWWA 2G8TA 4I31A 4O3UA 2ZA5A 8KME2 3BTTE 1ZHRA 3N7EA 3U28C 1C5ZB 4ZXXH 6GCHG 3LPRA 2CXVA 1H9HE 3ODFA 1AIXH 1YM0A 1N6YA 2BXTH 1P2QA 3OU0A 2AH4X 3P8FA 1IQHA 4BAOB 4XDEA 1JWTA 4U01A 3KEEA 1ZR0A 1DY9A 2A5AA 1GG6C 1FONA 2PHBA 3KNXA 2BMGB 1ZPZA 5AHGH 1TGCA 5T6GA 2HNTF 1AWFH 3EE0B 5E2OA 2BY5X 2F9BH 3DSOA 1THRH 3NWUA 1NRRH 1XMNB 4X2YA 5A0CA 1B5GH 5GCHF 1NZQH 2OC1A 9ESTA 2J98A 2FYQA 3SGAE 4BAMB 1ARBA 1ZGVA 1UK3A 1AB9C 1XUIA 1O3GA 2K1QA 2BY6X 2FDAA 4K8YA 3L6PA 3PMJA 2ZFQH 2FEQH 1MZDA 2Z9KA 1GI7B 1MKWK 1O2UA 3R0FA 1C5OH 1UK4A 1K1MA 3AVZA 2ZDNA 4FVBA 2ZECA 1OWEA 3RXJA 1HUTH 1GJAB 5C1UA 7ESTE 4LXBH 2H9EH 1HXEH 1VKYA 1YKTA 4O3TA 1QB9A 3PROA 1V2VT 3BEIB 2PP6A 4VGCC 3UR9A 1C5PA 1K1JA 2W5EA 1GJ4H 3MNSA 4XD7D 5SGAE 1O2RA 2WUBA 4D9QA 4YT7H 4Z1MD 1ZLRA 5DO4H 1S6LA 4KTCA 3RM2H 4K3JA 1UVTH 1Z6JH 1BHXF 4RN6A 1PQ8A 3BF6H 4CRDA 1EZSC 1TIOA 4P00A 2GTBA 1E1QD 5C20A 1BJUA 1O2LA 2OCVB 5JBBS 1HBTH 2H9TH 3V0XA 1TBQH 4F4OC 1Y5AT 1T4UH 5EXMA 5LPFA 2ZHQH 1SGCA 5FCRA 1GGDC 1JRSA 1W14U 1SGPE 2A0QB 2ULLA 3FZZA 3QZQA 1TBZH 2VIDA 3A8BA 5FX5A 1XUKA 4UFEH 4AFUA 3EYDA 1FLEE 3F6UH 1S84A 5DG6A 1ZHPA 1O35A 3UIRA 1SGTA 1O2YA 1ZRKA 1DXPA 1NM6A 2RG3A 2THFB 1K9OE 1FZZA 1G2MA 3UPEA 5ESBA 3MYWA 2PKSB 1EPTB 4DY7B 3SUGA 3SU3A 3ZZ3A 4Q63A 1ANCA 2WPIS 3VB6A 2SFAA 3I78A 1HAYB 4NIVA 5A8ZA 3F2FA 1O5CB 3M36A 5JDUB 2Y7XA 2H5CA 3F9EA 3MU5A 1G3EA 1QFKH 2H5DA 3QZRA 4OS7A 4UFFH 2AFQB 1O34A 1UW7A 2FIRH 2G00A 3KQCA 1YP9A 1J16A 3SOSA 2LP6A 3SBKA 4CRFA 2A32A 2ILNA 1NRQH 1C2HA 2PGBB 4J1YA 1EJAA 4WH8A 1QBOA 1NY22 4DIHH 3NUMA 1UMAH 1HNEE 3SYJA 1LTOA 2ALVA 4H6SB 2EC9H 3GCTG 3T25A 2J5UA 1K1PA 4K60A 3IG6B 4XBCA 1MTVA 3ATWA 1O3AA 2KFWA 2AERH 4B6EA 1GCDA 2PTCE 1HCGA 1V2OT 3LC3A 3AW0A 4FUBA 1Y3UA 1K2I1 2PR3A 4B75A 2Z9LA 3RXQA 3SNDA 3A80A 1L4DA 6CHAC 1FAKH 2V6NA 2ZNKH 1W12U 1F5RA 4WMDA 1FPCH 3VB3A 1C5WB 1S6FA 3DFJA 4I86A 1H9IE 3GY2A 3ZYEA 1ABJH 1EAXA 1O33A 3RC5A 3PRDA 5C0UA 2HGTH 1V2WT 4MTBA 4D9RA 1GBJA 3SZNA 1EQ9A 3GDSA 3V13A 4AFZA 3RXRA 1GI8B 2RFKC 1DS2E 4ASHA 2R9PA 4GVUA 1SLWB 3VXFH 1IQKA 2ZTZA 2GT7A 3NZIA 4I8LA 1V2LT 2BY8X 2WYGA 5F6MA 1G36A 5F53A 4Y7BA 4XSKU 2CJIA 2FODA 4NA8A 3TGJE 2FX4A 1O2SA 1HIAA 2F9OA 2WV9A 3PV4A 2H2ZA 3UWIA 1UTJA 2A4OA 2QIQA 2AGGX 1TRMA 3SZEA 2ZFFH 3DSGA 1BJVA 1DFPA 1C1RA 2IN2A 2R2WU 2QYIA 1PPFE 3AW1A 3GYMA 1O32A 2F9NA 3HATH 2ZI2H 1BRCE 1GMCG 1YPEH 2A2XH 3B9FH 4BAQB 1AUTC 2ZTYA 3SW2B 3MMGA 4XE4A 1J8AA 1VCQA 4JYUH 3P17H 4F49A 4IC5A 1LVBA 3VGCC 1WYKA 1F0RA 2GJGA 3A82A 1FXYA 5AFYH 2OD3B 4E7NA 1E79D 2C93B 3F2HA 3Q3KA 3A7WA 1MMJN 2C4FH 2QA9E 2GCHF 3A85A 3GY5A 3TITA 2K8IA 3LJJA 4E05H 2RCEA 1SB1H 4K1SA 5L2YH 5EXLA 2VINA 4WF8A 1BTZA 2G55A 1TB6H 1BMMH 1OOKB 3F1SB 1BTWA 2XBXA 1J17T 4SGAE 1CA8B 2J34A 1G9IE 5GPIB 5JPMH 2VIQA 2SGPE 1TPPA 1A7SA 1DDJA 3SNAA 2Z3CA 5DP9A 3BG4B 1Z7KA 1CE5A 1MD7A 1F2SE 2R3UA 3H7TA 3TU7H 2ZP0H 1GL1A 3O8DA 1RIWB 4FUFA 2GMTC 1INCA 2CHAC 2CN0H 2F83A 1SGIB 4INHA 3T5FH 1YPJH 1MTUA 1C2LA 1BOQA 3ELAH 4XFQA 5IDKA 2TGAA 4X1RU 1J14A 1MAYA 1AZZA 1GPZA 1A1RA 1EJNA 3TH2H 1WXRA 4UD9H 2BDIA 4YOJA 1D6WA 3BTEE 1YGCH 1NPMA 2ZCLP 1RTKA 1Z6EA 2PKAB 1QGFA 1FIWA 1Y5BT 4O97A 1NU7B 1ANEA 1L1NA 1TQ0B 3G01A 1G37A 1GHVH 3HPTB 3TJVA 2AIQA 4X8TH 1FAXA 4TWYA 2YOLA 2ANWA 1CVWH 1OX1A 4R8TB 1EB2A 2EI6A 1SGNE 4BTUB 2QY0B 1GI4A 4NCYA 1YPHC 3DT0H 2Z7FE 4ZCNA 2GT8A 1QA0A 4MDSA 5F8XA 2P3TB 4ISOA 1T8MA 3ATIA 1BHXB 1Y3YA 3OEED 5A8XA 1GI1A 3GOVB 3RMMH 1C5UA 2VU8E 1ZSJA 4H4FA 4B2CA 1MBMA 2ANYA 1HYLA 3KN2A 5C5NA 1A5GH 3W95A 1DLEA 1NO9H 1E36B 2FOEA 1CHOG 4OGYA 2ZPRA 1UTKA 1DWBH 2OQ5A 1BUIA 1P10A 1TAWA 1BZXE 2Q1JA 1TYNA 1GI3A 1E37B 4YXWD 3VG8A 2PUQH 4X1QU 1AFQB 1XX9A 1TBRH 3TLOA 1PPCE 2STAE 1DANH 2KM0A 1WQVH 3K2UA 3MH4A 3OSYA 1XUGA 1C2EA 3SQHE 2L74A 2JH6D 1GBLA 1F7ZA 1QTFA 2CGAA 3K9XB 3UR6A 4AFQA 1Y3WA 4NFFA 1HAHH 1LDTT 1CA0C 3JZ2B 2KX4A 3ZV8A 2WINI 1P2KA 1TMUH 2A4RA 3SV7A 1IQGA 1IQJA 4I32A 2QF5A 3P8GA 2ALPA 4K1EA 1NTPA 3LC5A 1THPB 1QL7A 1HGTH 1P03A 2J2UA 3SI4H 5LGOA 4GHTA 1AGJA 3GDVA 4BOHA 1YWUA 1DT2A 1NROH 4A1VA 3MOCA 2BDGA 1D3DB 1PPBH 1VJAU 1ETSH 1GHBF 5ETXA 2AS9A 2PSXA 4Y7AA 1ZJDA 1NRNH 1C1UH 4ZKOU 2WZQA 3UWJH 3P8OA 1KLIH 3NK8A 2ZGJA 3VB7A 3PV5A 1QRXA 4X6OA 1GMHG 1WAYB 3ITIA 4Q7ZA 3E91A 3E3TA 1L2EA 1A0HB 1O3BA 3LGWA 1KXAA 3U69H 5EQQA 2XWAA 1ZPCA 3F9FA 5CHBA 4X8VH 3FP7E 4K5ZA 1C2MA 4NA9H 1C1PA 4TPIZ 4B73A 4INKA 3LH3A 1WTGH 1JIRA 2BD7A 5IYTA 4NIWA 4Y76A 2VNTA 1P8VC 2IJD1 3F68H 2Y6TA 2ZFPH 1V2TT 1N1LA 2A45B 2G5VA 4X1NU 2XCFA 1Z8IB 1BDAA 1LHEH 3PLBA 1BITA 1HAVB 1C4Y2 3ZYDA 1HAXB 4LZ1H 1ELFA 1YCPM 4WY3A 1C1WH 1G2LA 2VH6A 3RXIA 1S0RA 4NIXA 4E06H 4ABIA 3GYLB 4JZIA 1ELCA 4IW4E 3LT3A 1GBHA 4I8HA 1YF4A 3RXTA 1RGQA 1RXPA 2OINA 3U8RH 3A87A 2GDDA 3PO1B 1LVOA 4JYVH 5EGMA 1D9IA 3MNXA 1GJ9B 3RXKA 5HKKD 2NU0E 1IQEA 4Q80A 1VGCC 2ZFTA 1QJ6B 2ZGBH 1LHFH 2WPLS 4DW2U 1FY8E 1QB1A 3BTHE 1MABB 3FN8A 2IPQX 3I77A 2Q6FA 1P12E 4WMEA 1GI2A 1SGYE 2ZG0H 3AK5A 2BQ6B 2KAIB 2ZGHA 3RXOA 3TNSA 5DN6D 2FI3E 4YLQH 1PPHE 3GISB 4JZEH 1HJAC 1IAUA 1VITH 9LPRA 1TWXB 4FUEA 2OUAA 2P8OB 4FU8A 5HMAA 1LVMA 3KQDA 1H8HD 1S5SA 1O2IA 4IS5A 1GI5A 2I6QA 5I25A 1RFNA 4IN1A 3F2GA 5B6OA 3SV9A 4Y8XA 2OK5A 2LNCA 1OHHD 1EAIA 3P6ZB 1TNLA 2A5KA 1A5HA 3F0OA 3S9CA 1PPEE 1N8OB 5DP8A 1W11U 5FCKA 3TJNA 6LPRA 3LONA 1UK2A 1FUJA 1G3BA 1YPGH 2AHME 2VGCB 3KIDU 1KDQA 1O5AB 3VFEA 3FP8E 1P06A 2Z94A 4MNVA 5F03A 2Y7ZA 4ZHMU 1WUNH 3LDXH 5A8YA 4ZKSU 1QRWA 3O8CA 1DXWA 2V3OH 5CHAB 1GI6A 4WWYA 2XC0A 2A5IA 3DA9B 2XBWA 1GDNA 1B0FA 2ZHWH 4DOQA 2BD4A 5DJ7A 3DCLA 3M37A 2XC4A 1TNJA 4GCHF 2FOMB 1Z8RA 2Y82A 1KXEA 1O3HA 1V2KT 1EAWA 3ZZ5A 2BLWA 1ACBE 2JIZD 1O5FH 2EI8A 3CNRA 1HJ9A 2CV3A 1C5RA 1C5XB 5PTPA 2ZEBA 3U1JB 5FPSA 1QNJA 1P2IA 1QB6A 1CBWC 3RXFA 2EA3A 2Z3DA 1VJ9U 3BN9A 3OEHD 5HIYA 2UUYA 1P02A 1UHBB 1C1TA 4FXGH 1W8BH 5L2ZH 1GDQA 4YT6H 3A8CA 3A88A 4TY7A 2BTCE 2EQNA 1AD8H 4ZMAH 1O5EH 4XRNA 2BD9A 1C1NA 1EFRD 4JYTA 4Z6AH 1AVWA 2BLOA 1TMTH 3MO3A 4AG1A 1UVOA 4CREA 3ZZ4A 1ORFA 2VWNA 1DPOA 3UUZA 4IC6A 3WY8A 1OYTH 1A3EH 4NA7A 1GBFA 4KP0A 1TGSZ 3P92A 2GVFA 2BX4A 3MU4A 1H8IH 1O5BB 3WWFA 2FI5E 3MNBA 3DHKH 8ESTE 1W0KD 3PM3A 1C9TA 4K1TA 1SQAA 2KR7A 4DCDA 2XXLA 5E0GA 5E0JA 1C2GA 3MWIU 3RMOH 3V12A 2BD3A 3FOAA 4ZAEA 2GCHG 2NWNA 3SU5A 3CS7A 1T4VH 3KYFA 3SNBA 2PLXA 1BTHH 2W3IA 4DIIH 1V3XA 3ZZDA 4BANB 2EEKA 3ZZ7A 3DD2H 2ZU1A 3BSQA 4BXSA 1W7GH 3LGTA 1TNGA 3PTNA 2GCTB 2FPZA 3M35A 4CR9A 2ZDMA 1E38B 2BZAA 4ABAA 2JH0D 2PSYA 4OS4A 1GHYH 4IMZA 3D65E 3PWBA 4A1XA 2FTMA 1LQEA 3RU4T 2XOKD 3FVFB 2R0KA 1A3BH 3KCGH 4AYVB 1O2ZA 4NGAH 2STBE 1Z1JA 1BTUA 3UQOA 1L0ZA 1YPKH 4CHAB 2Z9IA 3PYHA 4RT1A 3T28A 1TGBA 1YCPH 1FI8A 1O2HA 1UVSH 1WV7H 4RSPA 4ZH8A 2UWLA 2Z3EA 4Y8YA 3LGYA 3PWCA 3MQKC 2L6OA 1HAZB 2HLDD 1VCWA 2ZU2A 3S69A 3PMBB 4WVPE 1P05A 4ACBA 2OC8A 2W6JD 1ZZZA 1MBQA 1XUHA 2ODPA 1KY9A 1O3CA 1GVKB 2V3MA 1ABIH 1O31A 1O3KA 1O0DH 1HV7A 4ISHH 1WCZA 1EATA 1THSH 1SGQE 4H42U 5DP6A 5FPYA 1XUFA 2QGRA 1EUFA 3TPIZ 3ZVGA 1O3FA 2Y5GA 1SGDE 1AKSA 1OP8A 4NZLA 1FX0B 4Y11E 1AVXA 3ZIAD 3MTYA 2HVYB 1QQUA 1KIGH 4U30A 1P04A 4A7IB 4U32A 1GBTA 2XYAA 1Y3VA 4AGKA 2W26A 4OM9A 4K69A 1SGFA 1ZYOA 4IN2A 1J15A 2RA3A 2VIVA 2FOGA 2YNAA 5TCCA 3RXAA 1SKYE 1CT4E 2JDID 3PRBA 1G32B 4ABJA 1SGRE 1ZTJA 2EI7A 3RXDA 1AN1E 4ZKNU 2ZC9H 4D7FA 1FY3A 1QA7A 2Q6DA 5CE1A 2XRCA 3GY6A 1FV9A 1KSNA 1VITF 1NS3A 2GGVB 1GMDF 1YBWA 3U8OH 1YCPK 2VBCA 3DSPA 1ELAA 1OPHB 3ZZ6A 2D8WA 1GHXH 4BXWA 2PUXB 1Z71A 1EB1H 1W10U 3UNQA 2OP9A 1GBEA 4B6FA 4RI0A 5DK1A 1TE0A 1LKAA 1WBGB 3QWCH 1QURH 1RTLA 1EPTA 3SUEA 3DFLA 1KLTA 5C3NA 2ZWLH 2CHAB 1P3EA 5EJLA 2K0QA 1IQMA 2QXIA 1BT7A 2I6SA 3SNEA 3RXLA 1NRSH 2WPMS 2JJ2D 5J4SA 4MPUA 2VWLA 1NFYA 4FUCA 4X8SH 1AUJA 3U98H 2D1JA 4BTIB 4LOYH 3ENSB 2BDAA 1DWEH 1E35B 1SQOA 5DSFA 4DURA 2NU3E 1GHBG 1EAUA 3SHAH 4A1TA 4B74A 2PKSC 1EPTC 3N99A 3SJIA 1O3PB 1BIOA 1Z8GA 1O37A 4B1TA 3RLWH 2FOCA 2D2DA 3ZVBA 2QCYA 3UFAA 4I8JA 1WDIA 1ELEE 2F3CE 2BOKA 1O3MA 4OGXA 1AMHA 2UUKB 1TQ7B 1LQDB 3A8AA 3RXBA 1NN6A 1GBAA 1TLDA 2FS8A 3TH4H 4Q7YA 4Y10E 5J4QA 4WMFA 1QJ7B 1RJXB 5GXPA 3P8NA 3F0PA 4ZROA 1DM4B 1DITH 1TALA 5T6DA 2A4QA 1TONA 1TNKA 1DX5M 1IHTH 1AE5A 2VVUA 2BVXH 2ANKH 1K0HA 3ZVFA 2J92A 1G3CA 2SNWA 4LK4A 2BLVA 1HB0B 1H8ED 1XXFA 1YPHE 2M5TA 3RMNH 3RXHA 3H09A 1KXBA 1SLVB 2QC2A 4MPXA 1O3DA 3ZZAA 3MH5A 4NZQA 4Y71A 3ZZCA 1CO7E 3LJOA 5ABWA 1EZUC 1F5LA 4B76A 2XNDD 4MNYA 1SI5H 3BTDE 2V0BA 5LPRA 2EY4C 4X0WU 3KGPA 4ACAA 2ZDLA 3PTBA 4I7YH 5DGJA 4AC9A 3KL6A 1KLJH 1MTWA 4Y6DA 3E0NB 5FL7D 5BPEA 3RC4A 4I8KA 1SHYA 4SGBE 1DSTA 4NWLA 1P2MA 3PMAB 3OX7U 4DGJA 1GHAG 2A1DB 2BD8A 4AFSA 1WSSH 1L4ZA 5CMXH 3GCHB 8GCHF 2FYRA 1OS8A 1LVYA 2BYAX 1LHGH 4AORA 1O38A 4AG2A 1OSSA 1SMFE 2XNIA 1FMGA 1KMHB 1TA6A 1BB0B 4DG4A 4Y8ZA 4MG3A 2ZFSA 1P0SH 2JETB 1RRKA 1S82A 4A5TS 5KEDA 5EJZA 1UTLM 5JYIA 3QX5H 5HGGA 4JMYA 2VVVA 2YMSB 2OC7A 5C0TA 1MD8A 2F9PA 1GBCA 2PV9B 5C1YA 2OTVA 4UDWH 4FUHA 3MO6A 1T8LA 2ZCHP 4HFPB 1CT2E 3SI3H 1TGTA 1FY1A 2VVCA 3LKWA 5A09A 5EQRA 3URCA 2VWOA 2W6ID 3LIWA 5JBAS 1GJ6A 1HAPH 1C2KA 1F0TA 4D7GA 3GY4A 5HXFA 1L1GA 1XKAC 2LPRA 5HM2A 3TK6A 2TPIZ 3TK9A 2WSSD 4F48B 1O3LA 5KECA 2SNVA 1ZTKA 2M2AA 1PFXC 3AAVA 1O2XA 1F0SA 2A31A 3GCTF 3M3VA 1EZXC 4TY6A 2PW8H 1MZAA 2Y5HA 5EG4A 2A7JA 3OTJE 1MQ5A 4YTAA 1OWHA 3FZDA 2AIPA 4IGDA 1GI0A 7GCHF 2QF4A 4TYDA 1GDUA 2VB0A 3RXGA 2BZ6H 3AAUA 3ATKA 4AB9A 2ZO3H 1O2QA 4P02A 1K1LA 1JBUH 2C8XB 2ODYB 1AU8A 5L30H 2WPKS 4GCHG 2HOBA 3SJ9A 1AO5A 2BY7X 2FS9A 1PQAA 1SPJA 1H8DH 2BHGA 1P09A 5EU8A 3UOUA 2FZZA 3TH3H 1O3OA 5AFZH 1F0UA 2DUCA 5GCHG 2TGDA 3GY7A 5T3HA 4AB8A 1ETTH 2GZ9A 2FMJA 1ZOMA 3SORA 2H1UA 3BG4C 3D62A 1O2PA 4MNWA 3T62A 3SU2A 2P95A 1SLXB 4B2AA 4Y0ZE 2J95A 1EJMA 3SU6A 3RXSA 3TGIE 1TFXA 1ELBA 3CS0A 2ZU3A 1FQ3A 1GJCB 4FU9A 3RU4D 3S0NA 2V7QD 3BV9B 4YZUA 1XVMA 2AGIX 1C5TA 1NBMD 2WUCA 5KGOA 1MU6B 1MTNB 5GDSH 3SUFA 1CHGA 1MCVA 1C5NH 1K1OA 1MH0A 2OBQA 1SHHB 2BDYA 1ESAA 1EP5A 5TCAA 4CH8B 2Y80A 3QTOH 3S7HB 3NRLA 2F91A 2XW9A 3RLYH 1HAOH 5DP4A 1NESE 1KXCA 1ZRBA 3OTPA 3CP7A 1TNHA 1LPZB 3M61U 4FU7A 1DUEA 3ZV9A 1AWHB 5T6FA 1DWCH 4ABFA 3LGUA 1T8NA 2FXRA 3HK3B 2FOFA 3Q3XA 3NKKA 5B6LA 3BEUA 2BQWB 1T8OA 3BTFE 1PJPA 1S83A 3GICB 3QTVH 4M7GA 1CGJE 4THNH 3K6YA 1GG6B 5E2PA 3QUMP 1C5SA 1DLKB 2YMSD 2QXGA 1CQQA 1AQ7A 2VIPA 2A2QH 1KTTB 4JK5A 1SOZA 1TNIA 1C2IA 1ZMNA 1IQFA 5EW2H 1C1VH 5GWZA 3M7UA 1KDQB 2G51A 1AFQC 2BLQA 5LH8A 1O3IA 2P59A 1GJ5H 1BTXA 1PQ5A 3M3TA 2WPJS 1VZQH 4CRBA 1GCTC 1AZ8A 1AB9B 3EE7A 1C5MD 2CF9H 4FETA 1GVZA 1MU8B 3SJKA 1ZHMA 2XBYA 4A6LA 2FLBH 3M5NA 2HPPH 1QRZA 3M7QA 1HLTH 4OS5A 2BY9X 2JJ1D 2UUJB 2ASUB 4WXIA 3GCNA 1HXFH 1A5IA 2NU1E 2Z6BD 4NSVA 3RMLH 3T27A 2QN5T 1A0LA 5C17A 3A7ZA 1BTYA 1MKXH 1GBBA 2BXUH 4ZHLU 4J2YB 1JIMA 3FP6E 4VGCB 3PB1E 1G30B 3BG8A 1SQRA 3UOPA 1COWD 1PYTC 2TRMA 2J98B 1GBIA 3EGKH 1K21H 3ZZBA 4D8NA 2Z9JA 4HG6A 3BTGE 3SNCA 1JOUB 1HDTH 1K22H 4TSFD 1MQ6A 3LU9B 5A2MH 1NFUA 1TPAE 1SG8B 3MNCA 3B8JA 3S7KB 4MVNA 5L6NH 1EKBB 3TJUA 4Q7XA 1E0FD 4GSOA 1U6QA 3S9BA 1HAVA 2HVXA 3FFGA 4XBBA 1GMDG 1RD3B 1PYTD 3ZVEA 3NPSA 3EAJA 3TGKE 5HYOA 1FPHH 1C5YB 1GGDB 1UTPA 3W1EA 4AYYB 2BD2A 1H9LB 3TVJB 1YLCA 1SC8U 1SFQB 3ESTA 2TGPZ 4ISLA 1K28D 1WOFA 1Q31A 5GNDA 1ZSKA 2W3KA 3A7VA 3MH7A 1W0JD 2HPQH 2ODQA 2ZIQH 1IQNA 3ZZ8A 2TBSA 5K0HA 1CHOF 2AMPA 5BRRE 1H1BA 1AY6H 1XUJA 4CRGA 1BMLA 4CH2B 1QJ1B 3KYGA 1XVOA 4X1SU 1B7XB 5CDFE 2BOHB 2IJOB 4MPWA 1XKBC 5DP5A 2WV5A 5EODA 3STIA 1JRTA 2R2MB 3PLPA 1C2FA 2ZHFH 3PLKA 2VIOA 3Q77A 3VXEH 4ZUHA 2P94A 4HI3A 2GKVE 1O2TA 2KAIA 1MKXK 4XBDA 3FAOA 1Y3XA 2ZCKP 2F43B 1S81A 3SO3A 1UTMA 1QBVH 3E16B 2FM2A 4B2BA 3PO1C 1NT1A 1K1NA 5F8ZA 1UCYE 4X8UH 3LGIA 4X6MA 3ATLA 4ABGA 1BA8B 1YC0A 1BCUH 5A0BA 3SV6A 2QF0A 1OP0A 3HK6B 1B0EA 2WHXA 2KZ4A 4IBLH 4AGJA 1OXGA 1JXPA 4AN7A 1LHDH 3A84A 3VB5A 1O36A 2YNBA 1DVAH 4BAHB 2KCAA 5JBCS 1O2VA 2J97A 3N7OA 6CHAB 3QK1A 1ZMLA 3GS9A 3ODDA 4QT8C 3SV8A 1GMHF 1HRTH 2P93A 4JCNA 1AKSB 2P8OC 1QZ8A 2BB4A 1OWJA 5LPEA 2Q6GA 1BRBE 3QDZB 5G4BA 1GJ8B 5ESTE 1UCYH 2R0LA 3SQEE 1YYY1 3MHWU 3RUOA 1WQSA 4JZ1A 5E0HA 1N8OC 3GDUA 4TPYA 1LPGB 2B9LA 4NG9H 3V7TA 1GJ7B 3FANA 2QXHA 4FVDA 3BIVH 3U8TH 1BQYA 4R0IA 1EXFA 1S6HA 2VGCC 1AVGH 4UFDH 1FN6A 1GBDA 3M7TA 1FY4A 4KKDA 4ZHAA 1V2PT 2WV4A 5C94A 1BBRE 2P3UB 3I29A 1H4WA 2ZDVH 3RM0H 3OFND 1ELDE 2ZQ2A 1UHBA 1BRUP
chains in the Genus database with same CATH topology
3F9HA 4ISNA 5CHAC 1Q3XA 1SL3A 3E90B 3VEQB 7KMEH 5A0AE 2B7DH 3AASA 2HWLB 5FBEA 2XWBI 8GCHG 4IMQA 4X1PU 3EQ0H 1YPMH 4NFEA 1C2DA 3RC6A 1SFIA 3MO9A 1TABE 2O9QA 4JZFH 1C1SA 1HJ8A 1ZMJA 1V2RT 3O8RA 1D3TB 2ZF0H 1GL0E 3QO6A 5TJXA 1HPGA 1C2JA 1C9PA 3SN8A 1SSXA 5FHTA 3P95A 2IPHA 2ZHEH 1D6RA 8LPRA 1M9UA 3H7OA 3QN7A 2A4GA 3KQEA 2V35A 1BBRH 3CENA 3VGCB 1HIAB 3QLPH 1DWDH 3EDXB 4WH6A 1D4PB 2G5NA 1QCPA 1CSOE 5GJ4B 2ZGXH 1LHCH 3OY6U 4BAKB 1UCYK 5HM9A 3RDZA 2GP9B 3JZ1B 5JBTA 1UO6A 1GBKA 1LKBA 1YPLH 1GWAA 1GJBB 1O2GH 1UVPA 1QL9A 3A7XA 1W7XH 4YLUA 1OYQA 1QR3E 3TJOA 1O5GH 1QL8A 3D23A 1SQTA 4OS6A 3GY3A 1C4U2 2O8UA 3NXPA 5EPNA 1XXDA 1BRAA 3EA9A 1EASA 1QBNA 1OWIA 4KTUA 5FBIA 3OYPA 7GCHG 1V2UT 1MUEB 2PTNA 2H6MA 2ZFRH 3GCOA 2AMQA 4K2YA 2G4UA 3BTWE 1SGFG 2H9HA 1PPZA 1SOTA 1AE8H 6GCHF 4WJG2 4CBOA 3VB4A 2ZTXA 2AGEX 2UWPA 4YM9A 1Z1IA 3Q00A 2GCTC 1IOEA 2GMTB 1V2NT 4KTSA 2OLGA 1O2MA 1ID5H 2VJ1A 1PPGE 3ZVDA 4ABDA 3MI4A 4ISIH 1XM1A 3UREA 1GI9B 1FNIA 3MU0A 4ZKRU 2WPHS 3A89A 4CBNA 1TOCB 3TNTA 2ZQ1A 3A8DA 3D49H 1O3NA 2FOAA 2GX4A 4RKJB 1BMAA 3DUXH 3L33A 4GAWA 4YO9A 4O9VA 4OS2A 2FP7B 4CHAC 4U2WA 1A0JA 4JK6A 4AZ2B 3ZVCA 1TPSA 2BM2A 1BBRK 3A81A 3KHVA 3KQBA 2FOHA 2B5TB 4MPVA 1V2JT 1TA2A 2FX6A 2IOTA 3K65B 1A4WH 1C1OA 3A7TA 5E8EH 5EPYA 3UTUH 3K6ZA 2J94A 1X7AC 1GHWH 3SJOA 1E34B 1DSUA 2O8LA 1OP2A 4HTCH 2FI4E 3QGNB 1O2KA 3F9GA 4PROA 1FIZA 1LO6A 1UTQA 1FN8A 1DICA 1HAGE 4ESTE 2BVRH 1TX7A 2BQ7B 4KGAA 2JH5D 1IQLA 1F5KU 2RA0A 1D3QB 2F9UA 3E6PH 4K8BA 3V3MA 2AEIH 3EA8A 1TOMH 2ESTE 1YLDA 2RDLA 3A86A 3QGJA 1CGHA 1O3EA 1P01A 2TGTA 2ZU5A 2CF8H 2DE9A 1Q2WA 4Y79A 1NU9A 1P9SA 1UVUH 1DE7H 3P70B 3T29A 2VWMA 4NWKA 1Y8TA 1DOJA 4AX9H 1C5LH 2P16A 5K7RA 5JB8S 1G3DA 1K1IA 1W3CA 5FAHA 1P2OA 2GZ8A 4GLYA 1O2OA 4D76A 3E8LA 3SU1A 3SGBE 1L1JA 2BD5A 1ZJKA 4HZHA 3SJ8A 1CA0B 2OBOA 5EXNA 2NU2E 4GHQA 2XC5A 1O30A 3Q76A 2O8WA 5JB9S 1QHRB 2GZ7A 1O39A 5GIBA 2HRVA 2ZDKA 3RXVA 3BTKE 3W94A 3RXEA 4TWWA 3UNSA 1HFDA 1S85A 4MQAA 2UWOA 3H5CB 4X2XA 4A92A 2TIOA 4KELA 1SR5C 3BTME 2A7CA 1UTOA 3SUDA 2ANMH 1V2ST 4UFGH 4GPGA 4HGCA 3RU4E 1TX6A 2ZKSA 1BMNH 4FUJA 4H6TA 4MLFB 2HNTE 1A2CH 2FTLE 4BNRA 1QY6A 4FUGA 2GV6A 1DUAA 2C3SA 3HGNA 3KF2A 1O3JA 1ANDA 2W7UA 3RP2A 5H4IB 2SGEE 4OS1A 1LCYA 4MNXA 5C67A 2PGQB 1BTPA 3UNRA 1GJDB 3T26A 1OKXA 5AF9H 4YOGA 5DP3A 2QAAA 1ZSLA 3RXCA 1V2MT 1IHSH 1W0ZU 4UEHH 3IWMA 5EW1H 3ATMA 2G81E 3O8BA 1T31A 1NC6A 5DPAA 4I33A 3LOXA 4E7RG 4Q2KA 1O2NA 2G4TA 2O8MA 1EOLA 2XCNA 2QF3A 3LH1A 2P3FH 1Y59T 1F92A 3RXUA 1LMWB 2C8WB 2HALA 3MU1A 1KTSB 4Z0KA 3URDA 3UQVA 3EA7A 4YESB 2BDCA 2OQUA 2W7SA 1FJSA 1O2WA 3HKJB 1GVLA 2WYJA 2C8YB 5C5OA 2V3HH 1EZQA 3L3TA 1ZTLA 1W0YH 3OY5U 1SVPA 2BVSH 2OC0A 1KYNA 1P57B 2UUFB 2ZGCA 1WTHD 1VGCB 1VR1H 2HNTC 2O8TA 4I8GA 1W13U 7LPRA 2B0FA 1J9CH 1P2NA 1GCTB 2PKAA 5DP7A 4AOQA 1ELTA 2ZZUH 4XOJA 1RIWC 4JZDH 2DE8A 4YOIA 4NSYA 1V6DA 1ANBA 1C5VA 1PQ7A 1SLUB 1TRNA 3RXMA 1ELGA 3SHCH 5F8TA 4GUXA 3E1XB 1JMOH 1P3CA 1N6XA 1FY5A 2BX3A 2C8ZB 2QXJA 1HJAB 1QIXB 3M5LA 4DVAU 3T2NA 3HGPA 1ZPBA 3GCHC 1IQIA 1TPOA 1EX3A 4INLA 1A46H 1MCTA 1T7CA 2GD4B 3B23B 1KXFA 1V2QT 2D26C 1S0QA 1WU1A 3C1KA 1GBMA 1TGNA 1C1QA 1GMCF 4ABBA 1MTSA 2OXSA 2C90B 2SGDE 4DT7B 2JETC 1SBWA 3STJA 1AHTH 2FO9A 5C2ZA 3Q3YA 5FXLA 3U9AH 3TIUA 3LGVA 2GDEH 2ZDAH 1O5DH 4UONA 1OWKA 1TMBH 5EOKA 1UTNA 2ZHDA 3UY9A 2BDHA 2R3YA 4O03A 3SU0A 1AFEH 1P9UA 3E0PB 3SU4A 2J38A 5C1XA 2ZPQA 2AMDA 4NIYA 2ZU4A 3NCLA 2ZPSA 6ESTA 1CT0E 3BTQE 3ZVAA 3C27B 3MH6A 2Z9GA 4LZ4B 5FX6A 4X6NA 5EQSA 1ESBA 2F9VA 1KXDA 3SGQE 1A61H 1QQ4A 1Y5UT 3R3GB 4WXVA 1NFXA 2QV1A 4CR5A 3M5OA 2NU4E 1HAIH 2A7HA 2SGAA 3M3SA 3A83A 2J9NA 1FDPA 1TRYA 1AI8H 4B71A 3RXPA 1LPKB 1CBWB 3U1IB 3ZZ9A 2CMYA 2Y81A 4RKOB 3BEFB 3MFJA 2AYWA 1O2JA 2VH0A 1NFWA 2FESH 4DJZB 1GHZA 1OWDA 3MU8A 5AVDA 1D3PB 1RS0A 4X2WA 4X6PA 3VPKA 1P11E 2FLRH 3TK5A 4ABHA 2FOBA 1ARCA 3BIUH 4CRCA 2J4IA 2BDBA 1Z8JB 1P2JA 4FUDA 4ZXYH 1CU1A 3GY8A 1ESTA 2PWXA 1GHAF 2VIWA 4Y0YE 3S9AA 1DY8A 3IITA 1MAXA 5I46H 4ABEA 1TX8A 1ELVA 2SGQE 4FUIA 3A7YA 2HLCA 1T32A 1VCPA 2XBVA 4BTTB 5DKMA 3M5MA 1SGEE 2XTTB 1CGIE 2Y5FA 3HKIB 1NRPH 4CRAA 1ETRH 3SV2H 1ZGIA 5FPTA 1UJ1A 1MTNC 4X2VA 1C5QA 1MKWH 1EOJA 2GV7A 1VITG 2SGFE 2PFEA 1RTFB 2G52A 2B8OH 1C1MA 1C4V2 1W2KH 3PMHB 1EP6A 2JKHA 4UE7H 2FWWA 2G8TA 4I31A 4O3UA 2ZA5A 8KME2 3BTTE 1ZHRA 1C5ZB 4ZXXH 6GCHG 3LPRA 2CXVA 1H9HE 3ODFA 1AIXH 1YM0A 1N6YA 2BXTH 1P2QA 3OU0A 2AH4X 3P8FA 1IQHA 4BAOB 4XDEA 1JWTA 4U01A 3KEEA 1ZR0A 1DY9A 2A5AA 1GG6C 1FONA 2PHBA 3KNXA 2BMGB 1ZPZA 5AHGH 1TGCA 5T6GA 2HNTF 1AWFH 3EE0B 5E2OA 2BY5X 2F9BH 1THRH 3NWUA 1NRRH 1XMNB 4X2YA 5A0CA 1B5GH 5GCHF 1NZQH 2OC1A 9ESTA 2FYQA 3SGAE 4BAMB 1ARBA 1ZGVA 1UK3A 1AB9C 1XUIA 1O3GA 2K1QA 2BY6X 2FDAA 4K8YA 3L6PA 3PMJA 2ZFQH 2FEQH 1MZDA 2Z9KA 1GI7B 1MKWK 1O2UA 3R0FA 1C5OH 1UK4A 1K1MA 3AVZA 2ZDNA 4FVBA 2ZECA 1OWEA 3RXJA 1HUTH 1GJAB 5C1UA 7ESTE 4LXBH 2H9EH 1HXEH 1YKTA 4O3TA 1QB9A 3PROA 1V2VT 3BEIB 4VGCC 3UR9A 1C5PA 1K1JA 2W5EA 1GJ4H 3MNSA 5SGAE 1O2RA 2WUBA 4D9QA 4YT7H 1ZLRA 5DO4H 4KTCA 3RM2H 4K3JA 1UVTH 1Z6JH 1BHXF 4RN6A 1PQ8A 3BF6H 4CRDA 1EZSC 1TIOA 2GTBA 5C20A 1BJUA 1O2LA 2OCVB 5JBBS 1HBTH 2H9TH 1TBQH 4F4OC 1Y5AT 1T4UH 5EXMA 5LPFA 2ZHQH 1SGCA 5FCRA 1GGDC 1JRSA 1W14U 1SGPE 2A0QB 2ULLA 3FZZA 3QZQA 1TBZH 2VIDA 3A8BA 5FX5A 1XUKA 4UFEH 4AFUA 3EYDA 1FLEE 3F6UH 1S84A 5DG6A 1ZHPA 1O35A 3UIRA 1SGTA 1O2YA 1ZRKA 1DXPA 1NM6A 2RG3A 2THFB 1K9OE 1FZZA 1G2MA 3UPEA 5ESBA 3MYWA 2PKSB 1EPTB 4DY7B 3SUGA 3SU3A 3ZZ3A 1ANCA 2WPIS 3VB6A 2SFAA 3I78A 1HAYB 4NIVA 5A8ZA 3M36A 1O5CB 5JDUB 2Y7XA 2H5CA 3F9EA 3MU5A 1G3EA 1QFKH 2H5DA 3QZRA 4OS7A 4UFFH 2AFQB 1O34A 2FIRH 2G00A 3KQCA 1YP9A 1J16A 3SOSA 3SBKA 4CRFA 2A32A 2ILNA 1NRQH 1C2HA 2PGBB 4J1YA 1EJAA 4WH8A 1QBOA 1NY22 4DIHH 3NUMA 1UMAH 1HNEE 1LTOA 2ALVA 4H6SB 2EC9H 3GCTG 3T25A 1K1PA 4K60A 3IG6B 4XBCA 1MTVA 3ATWA 1O3AA 2AERH 1GCDA 2PTCE 1HCGA 1V2OT 3LC3A 3AW0A 4FUBA 1Y3UA 1K2I1 2PR3A 4B75A 2Z9LA 3RXQA 3SNDA 3A80A 1L4DA 6CHAC 1FAKH 2V6NA 2ZNKH 1W12U 1F5RA 4WMDA 1FPCH 3VB3A 1C5WB 1S6FA 3DFJA 3ZYEA 1H9IE 3GY2A 1ABJH 1EAXA 1O33A 3RC5A 2HGTH 1V2WT 4MTBA 4D9RA 1GBJA 3SZNA 1EQ9A 3GDSA 3V13A 4AFZA 3RXRA 1GI8B 1DS2E 4ASHA 2R9PA 4GVUA 1SLWB 3VXFH 1IQKA 2ZTZA 2GT7A 3NZIA 4I8LA 1V2LT 2BY8X 2WYGA 5F6MA 1G36A 4Y7BA 4XSKU 2CJIA 2FODA 4NA8A 3TGJE 2FX4A 1O2SA 1HIAA 2F9OA 3PV4A 2H2ZA 3UWIA 1UTJA 2A4OA 2QIQA 2AGGX 1TRMA 2ZFFH 1BJVA 1DFPA 1C1RA 2IN2A 2R2WU 2QYIA 1PPFE 3AW1A 3GYMA 1O32A 2F9NA 3HATH 2ZI2H 1BRCE 1GMCG 1YPEH 2A2XH 3B9FH 4BAQB 1AUTC 2ZTYA 3SW2B 3MMGA 4XE4A 1J8AA 1VCQA 4JYUH 3P17H 4F49A 4IC5A 1LVBA 3VGCC 1WYKA 1F0RA 5AFYH 3A82A 1FXYA 4E7NA 2OD3B 2C93B 3Q3KA 3A7WA 1MMJN 2C4FH 2QA9E 2GCHF 3A85A 3GY5A 3TITA 3LJJA 4E05H 2RCEA 1SB1H 4K1SA 5L2YH 5EXLA 2VINA 4WF8A 1BTZA 2G55A 1TB6H 1BMMH 1OOKB 3F1SB 1BTWA 2XBXA 1J17T 4SGAE 1CA8B 2J34A 1G9IE 5GPIB 5JPMH 2VIQA 2SGPE 1TPPA 1A7SA 1DDJA 3SNAA 2Z3CA 5DP9A 3BG4B 1Z7KA 1CE5A 1MD7A 1F2SE 2R3UA 3H7TA 3TU7H 2ZP0H 1GL1A 3O8DA 1RIWB 4FUFA 2GMTC 1INCA 2CHAC 2CN0H 2F83A 1SGIB 4INHA 3T5FH 1YPJH 1MTUA 1C2LA 1BOQA 3ELAH 4XFQA 5IDKA 2TGAA 4X1RU 1J14A 1MAYA 1AZZA 1GPZA 1A1RA 1EJNA 3TH2H 4UD9H 2BDIA 4YOJA 1D6WA 3BTEE 1YGCH 1NPMA 2ZCLP 1RTKA 1Z6EA 2PKAB 1QGFA 1FIWA 1Y5BT 4O97A 1NU7B 1ANEA 1L1NA 1TQ0B 3G01A 1G37A 1GHVH 3HPTB 3TJVA 2AIQA 4X8TH 1FAXA 4TWYA 2YOLA 2ANWA 1CVWH 1OX1A 4R8TB 1EB2A 2EI6A 1SGNE 4BTUB 2QY0B 1GI4A 4NCYA 1YPHC 3DT0H 2Z7FE 2GT8A 1QA0A 4MDSA 5F8XA 2P3TB 4ISOA 1T8MA 3ATIA 1BHXB 1Y3YA 5A8XA 1GI1A 3GOVB 3RMMH 1C5UA 2VU8E 1ZSJA 4H4FA 4B2CA 1MBMA 2ANYA 1HYLA 3KN2A 5C5NA 1A5GH 3W95A 1DLEA 1NO9H 1E36B 2FOEA 1CHOG 4OGYA 2ZPRA 1UTKA 1DWBH 2OQ5A 1BUIA 1P10A 1TAWA 1BZXE 2Q1JA 1TYNA 1GI3A 1E37B 2PUQH 4X1QU 1AFQB 1XX9A 1TBRH 3TLOA 1PPCE 2STAE 1DANH 1WQVH 3K2UA 3MH4A 3OSYA 1XUGA 1C2EA 3SQHE 2JH6D 1GBLA 1F7ZA 1QTFA 2CGAA 3K9XB 3UR6A 4AFQA 1Y3WA 4NFFA 1HAHH 1LDTT 1CA0C 3JZ2B 3ZV8A 2WINI 1P2KA 1TMUH 2A4RA 3SV7A 1IQGA 1IQJA 4I32A 3P8GA 2ALPA 4K1EA 1NTPA 3LC5A 1TH