1SLWB

Rat anionic n143h, e151h trypsin complexed to a86h ecotin; nickel-bound
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
223
structure length
215
Chain Sequence
b'IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKVATIALPSSCAPAGTQCLISGWGHTLNHPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECOTIN
publication title X-ray structures of a designed binding site in trypsin show metal-dependent geometry.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Complex (serine protease/inhibitor)
total genus 51
structure length 215
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1996-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1slwB01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1slwB02
4ASHA 3KGPA 1N8OC 4O03A 2Q1JA 2PKAA 3RXUA 1NT1A 1O3HA 3QX5H 3E90B 4A7IB 3M5OA 1EPTA 3OYPA 3IITA 2R0KA 1L0ZA 3ZZ9A 1CA0B 1C4U2 5EODA 1MAYA 1N6YA 1MH0A 3B9FH 1B7XB 3NZIA 5BRRE 5BPEA 2ZDMA 4FUFA 1K28D 4NG9H 1LMWB 2ZDAH 3GY2A 4UFDH 1SHHB 3ENSB 1O31A 1ZSJA 2Z3DA 2A5IA 1O38A 2BD7A 2DE9A 4ABFA 3TNTA 1XVOA 3RU4E 3RXLA 4KP0A 1ANBA 3MH4A 1DOJA 1SI5H 4HGCA 1NRRH 2J9NA 3STIA 1QB6A 1SVPA 1XXFA 4JZ1A 3RXPA 1RS0A 5TJXA 5F6MA 2TRMA 1DWEH 2HLCA 1ZMLA 4E7NA 3P70B 2VVCA 1SGRE 2WV5A 4NGAH 3SU0A 1CU1A 2ULLA 1ZHMA 1TA2A 3RXFA 3TJNA 1HAYB 5L6NH 4GHTA 1MTSA 2ZHDA 2ZO3H 2EA3A 5JDUB 2Q6DA 5J4QA 1NROH 1MZAA 2GV6A 1HJ8A 1V3XA 1GBMA 2VH6A 2P16A 2ZCLP 3E8LA 5DGJA 2IN2A 3SQHE 3PMBB 1CBWB 3PMAB 1SQAA 3SHAH 3SV7A 4CHAC 2OQ5A 2BD9A 3GISB 2B7DH 3BTKE 2VVUA 1ZOMA 1A2CH 2AMPA 4Q7XA 3NWUA 5K7RA 1O30A 2OTVA 1AY6H 6GCHF 3RXGA 4K8YA 3ZZAA 1C2IA 4A1XA 4AGJA 1T8MA 3M36A 1O5CB 1WSSH 5H4IB 5ABWA 2VGCB 2GZ9A 1HAIH 2WPLS 3F9FA 5AVDA 3T27A 4I8GA 1HAPH 3BTDE 4DW2U 1W12U 1X7AC 2EI7A 1ORFA 3PLBA 4ZKOU 1IQEA 3GCHC 3R3GB 1YCPM 1H9LB 1UTMA 2WYGA 4BANB 2ZC9H 1SFIA 4K69A 1S81A 2O9QA 4TPIZ 1DICA 1UVSH 4Y76A 3LT3A 3I78A 1OYQA 2BXTH 1BRCE 4CBNA 2ZA5A 1O5FH 4XSKU 4ZXYH 1MTVA 5DP3A 1GHBG 2BDYA 4I8KA 5FPYA 1H9HE 1C1WH 3NPSA 3ZZ8A 1P0SH 1WQSA 5GJ4B 1PPZA 1TABE 4X1PU 2H9HA 2ZFSA 2PTNA 2GCHG 4ZKNU 3RXRA 1ZGVA 2FWWA 1O3DA 3TIUA 1UTLM 2AERH 5TCCA 1SGTA 3SNDA 2VINA 1ZMJA 2VIQA 1EUFA 3VB6A 4NA9H 3S0NA 1XMNB 1O2TA 1P2QA 3PLPA 1P12E 3UNQA 1S84A 2FLRH 1O5EH 1YYY1 4JZIA 3V0XA 1O5DH 2G4TA 3BTWE 1LHCH 1BA8B 3A81A 1D3DB 1UCYK 5DP5A 3E91A 1UCYH 1LPKB 2SGPE 3UR6A 4D9QA 2PSXA 3C1KA 2FYQA 1TRNA 3MNSA 1MD8A 1QR3E 1GDQA 2ALVA 1ESAA 2GP9B 2Z9JA 4YO9A 2QAAA 2XCFA 3SU3A 1MQ6A 3E0NB 5L2ZH 1FI8A 1F5RA 1GMDF 1VITG 5DP6A 3RM2H 3P17H 2BOKA 1AZZA 4HZHA 1KDQA 1BBRH 2P8OC 2Z9LA 1O3AA 3GICB 1GWAA 1UK2A 2F9UA 3SV6A 1V2UT 2XC5A 1EZXC 3ZZCA 6LPRA 4NZQA 2BDAA 2LNCA 1BJUA 1FXYA 2ALPA 5I46H 3RC6A 1Z1IA 2AH4X 2QF3A 5C2ZA 3OSYA 2ZU2A 3QWCH 4D76A 1GI5A 4UFGH 3SORA 1YM0A 3UWJH 2ZQ1A 1ELTA 1OOKB 2GCTB 2KAIA 1EP5A 1C4V2 1QRXA 2O8UA 2XBXA 3KHVA 3PMHB 4X6MA 4BTIB 2BY9X 1Q31A 2VIPA 2THFB 1NU9A 5ESBA 1QCPA 3RXSA 1KLIH 2BB4A 1N1LA 1WYKA 2B0FA 5LGOA 1SBWA 2GT7A 3VB4A 1ARCA 1W0ZU 1B5GH 4GHQA 2GGVB 3MU8A 4CRDA 3OTJE 4X8SH 2O8MA 1SGQE 1YP9A 2BDHA 1GMCG 3Q00A 1Y5BT 3GY7A 2A7HA 5AFZH 3KN2A 4FXGH 1DWCH 3Q77A 1TFXA 5EXNA 4X1RU 1KLJH 2A5KA 1RTLA 1YPMH 2QY0B 2ZPQA 3RDZA 2J92A 5GWZA 1C5TA 1FAKH 4D8NA 1GCTB 2FOHA 4INLA 4GUXA 3BTFE 1V6DA 1XUGA 1F0RA 1MQ5A 1WCZA 1PPBH 1MCVA 1DLKB 1O2HA 2P59A 5T6DA 4ABGA 1GDUA 2NU1E 1S85A 4X6OA 4DY7B 1FUJA 5A0CA 4AGKA 2G00A 5T6FA 1SC8U 1PJPA 3ZZ5A 3FP7E 1P8VC 2BD2A 1YF4A 2J34A 2CJIA 2ZECA 1O2LA 1C2KA 2ZU5A 1QJ1B 1SR5C 2PFEA 1A3BH 4E06H 3MNBA 3A8AA 1O0DH 4B2CA 5C3NA 1HIAB 4BNRA 3RXIA 5DK1A 2VVVA 4ABIA 3A88A 4XBDA 1CO7E 4IN1A 3S69A 4B71A 1C5LH 1NESE 1AB9B 3F6UH 3BEUA 1BMAA 4K2YA 3SI3H 4FUGA 4U32A 1AKSB 3BG8A 5HYOA 1TPSA 3GCNA 4WWYA 1AFQB 1ZRBA 1C2FA 1DXPA 4INKA 1TYNA 2ZGHA 1FN8A 1TX8A 2OQUA 2P94A 1DUAA 1C5MD 4K1SA 1DT2A 1Y3WA 4IBLH 3EA7A 2ZGJA 1NZQH 8GCHF 2BD8A 2G5NA 1BTWA 4GLYA 5GCHF 5EPYA 3RMMH 4UONA 1UTJA 2BD5A 1Z8IB 1T4UH 5G4BA 2PGQB 2ZEBA 1AZ8A 2FOMB 5C1UA 1TRMA 3KQCA 3D49H 3T2NA 1C2MA 1P02A 1EZSC 4ABBA 2P3UB 1ZHPA 3AW1A 1T4VH 2GDDA 4Y71A 4NSYA 3T62A 3VXEH 4AFQA 1CHGA 1FZZA 1O2JA 2BX3A 5EPNA 5C5NA 1NPMA 2A45B 3PYHA 1PFXC 1HCGA 4ZHMU 1TMTH 2CHAC 3HKIB 2PWXA 1PPFE 1LVMA 1EOJA 4Q7YA 2Y7XA 3SZNA 1ELGA 1ELAA 5DO4H 1C1SA 4DURA 2G55A 2FX4A 2FI3E 2CF8H 6CHAB 4X2VA 1C2HA 1O2SA 2HVXA 1FY3A 2W7UA 1AUTC 3M3TA 2ODYB 2XC0A 1MBMA 1YPJH 1GBTA 1QJ6B 1P9UA 1QL9A 1BRAA 1O3KA 1LPZB 1A4WH 5GPIB 1LKAA 3QZRA 1F0SA 5CHAC 4SGAE 1IQJA 1DUEA 1FDPA 2A4GA 3LGIA 3RMNH 2XXLA 2UUYA 4IMQA 4RN6A 1TGNA 4U30A 1QL8A 1O2YA 1QQUA 1ELDE 1VGCB 2BY8X 1QBNA 4Y79A 1UTQA 5GDSH 3F1SB 5DPAA 1GBFA 4ISNA 2A5AA 4A92A 1UHBB 1E37B 6ESTA 2FIRH 2VJ1A 2GTBA 3A85A 3QO6A 4OS1A 1F5KU 2ZTYA 3F9EA 2M5TA 1K1IA 3GCTG 1H8DH 2AGGX 2LPRA 1TMBH 4IS5A 1DSUA 5JBBS 2Z9IA 4FVDA 5L30H 1ZLRA 4O9VA 1GBCA 1V2RT 2V0BA 3BTEE 1O3EA 4HFPB 1O3PB 2HNTF 3SU1A 3ZZ7A 3KF2A 3LGWA 1JXPA 2UWOA 1GI7B 2QA9E 4AFSA 3SUDA 1GI3A 3EA8A 1C9PA 3QZQA 2GMTB 3ZV9A 2XTTB 9LPRA 3BEIB 5DP8A 2G4UA 2C8YB 3SOSA 3LGUA 1O2GH 2BMGB 2AYWA 3LONA 4U01A 1ANEA 1O2WA 1BTHH 4TYDA 4FU8A 2R0LA 1C4Y2 5HGGA 2SGDE 1O3IA 1A5IA 1AVGH 1ARBA 1CGIE 3A83A 1P03A 3A7YA 3A8CA 1BT7A 1YGCH 5ESTE 4UD9H 7GCHF 2WUBA 2ZKSA 3MH5A 1L1JA 5SGAE 1L4DA 2C8ZB 3IG6B 1PPEE 2C3SA 5DG6A 3RU4D 1VJAU 2WPIS 1V2QT 2J2UA 1J8AA 2C8WB 1GCDA 1BTYA 2H9EH 3I77A 3OU0A 1CT4E 4QT8C 2G52A 4F49A 1PPCE 1L1GA 2SNWA 4ZHAA 2P95A 5AFYH 1C1PA 1GJCB 4ZAEA 4MVNA 4YLQH 4HTCH 1FIZA 3SV9A 4Z0KA 1GGDB 1GPZA 1V2MT 1W3CA 3KIDU 3LOXA 1GHAF 4BAHB 3UNRA 4NIVA 4A1TA 2I6QA 2R2WU 1G3CA 1QY6A 2F9NA 4IN2A 1HJ9A 2YNBA 1L1NA 1GBJA 3SJIA 1O2KA 1PPGE 2BDGA 2AGEX 3ZVAA 4KELA 3U98H 3TLOA 3TGKE 3KQDA 4AORA 4GCHG 1ESTA 4GVUA 3ZZ6A 1GI9B 1OP0A 4YOGA 1P09A 3SV2H 2F3CE 1OXGA 1WTGH 4X0WU 3TH2H 1IQHA 3N7OA 3VEQB 2TGDA 1YPEH 3KQEA 1O2OA 3TH4H 2OD3B 1CT2E 2F91A 2ZGBH 3HATH 1CHOF 5FXLA 1CGHA 3ZVBA 1K21H 2HPPH 2VWLA 1MKWH 4BTUB 4CRBA 1K1OA 1P2NA 4TWYA 1P2JA 2AEIH 1WUNH 2V3HH 1DY9A 1KY9A 3URDA 3FAOA 4SGBE 1AE5A 1Q2WA 1F2SE 3RXEA 5ETXA 4H6TA 1QA0A 4OGYA 1QGFA 5EW2H 3SNCA 4XBCA 4X6PA 3M5MA 1GHVH 4X1SU 2HNTC 4I8LA 4MPUA 5JYIA 1P3EA 2CV3A 4AN7A 4BTTB 1N8OB 1LPGB 1C1UH 1JBUH 2GZ8A 4UFEH 1MTWA 1XUIA 3RXOA 1O5BB 2O8TA 2XYAA 4Y7AA 2HPQH 2BM2A 1TB6H 1O5GH 1O36A 2OC8A 2NU0E 2A7JA 1OWIA 4JZDH 3ZVDA 3D62A 4THNH 3SU5A 3NKKA 1TQ7B 1TAWA 5JPMH 4OS5A 1A0HB 1CA8B 4UE7H 1Y3XA 1GJ6A 3M3VA 1J9CH 1DSTA 1GBIA 3AVZA 4MQAA 4Y11E 3TK9A 3PB1E 5DP7A 3RM0H 1NRSH 5DJ7A 2ZU4A 3ATLA 4MPWA 3FVFB 5AHGH 1NFWA 3SJOA 3TK5A 1XUKA 2ZPRA 3BF6H 1VCQA 1FJSA 2CMYA 1GJ8B 1P3CA 1S5SA 4FUCA 2YOLA 4KTSA 4WMEA 1GVKB 3RXDA 2QCYA 1QA7A 1G9IE 2F9BH 1EJAA 1MU8B 2BHGA 4B73A 1V2LT 3EE0B 3T25A 4NFEA 1PQ8A 1Y59T 1ZSLA 2FZZA 3ATKA 4NIWA 3UREA 2VIWA 2W26A 4NA7A 3ATIA 2F9VA 3JZ2B 1A5GH 3CS0A 3MYWA 3H5CB 1H4WA 1RTFB 4U2WA 1PQ7A 5HM2A 5IYTA 1SMFE 1SL3A 2PGBB 1GBBA 1GBAA 3PLKA 2BOHB 5HXFA 4CH8B 2UUFB 3P6ZB 3NCLA 1RGQA 4ISHH 2ZFFH 2ZPSA 4BAKB 1O2ZA 1OP8A 1V2NT 3A84A 5FAHA 1UO6A 3DD2H 3QLPH 4CH2B 5FCRA 3AASA 4CHAB 1MKXK 2H9TH 2Y6TA 1GG6C 1IHTH 2ZGXH 3GYMA 2BQWB 1ZHRA 1D3TB 4A1VA 3ATWA 4M7GA 4BXSA 1TX6A 2Z7FE 4RKOB 5F8TA 5K0HA 1IQFA 4JZFH 1G36A 1UK3A 2HALA 3UQOA 3RUOA 2PHBA 2C8XB 2FOAA 3BTME 1Y3YA 2XBYA 3DFLA 1S6FA 3A7WA 1IQLA 4TY7A 1P06A 3H7OA 1XKAC 1LDTT 4CRFA 4YESB 4FUIA 3GCHB 4K60A 1TLDA 1GBLA 4MPVA 3U8RH 4AYVB 3TJUA 3E6PH 4Y0YE 1JRTA 2OCVB 1QBOA 4Q2KA 4X1QU 4NIXA 3P8FA 1Z6EA 1MTNC 1GJAB 1DY8A 1C2EA 1K22H 1NFYA 4NCYA 2XBWA 1EKBB 1HAGE 4IW4E 2JETC 2QN5T 4CR5A 2Q6FA 2YNAA 1GHWH 4ZHLU 3B8JA 1RTKA 1O3JA 3MTYA 1EB2A 4YT7H 1D6WA 3UWIA 4I33A 7KMEH 1LVOA 2BLOA 2BY7X 1T8LA 2Z9GA 3ZVFA 2JH5D 2Z6BD 5C67A 4E05H 3SUFA 4XDEA 3SO3A 5JB9S 2A4RA 1GJ7B 2XNIA 5HMAA 2ZFTA 1SSXA 1HAHH 3MO6A 3ZYEA 3SBKA 2FMJA 3RXAA 4Y8XA 1CSOE 4DJZB 3OY5U 3UOPA 2A32A 1THPB 3MU4A 1ELFA 1MUEB 3TNSA 1S0RA 3BTTE 3T5FH 1KTSB 1E36B 1S0QA 4KTCA 3SU6A 1SGPE 1MCTA 1O37A 2ZZUH 1KTTB 1SLUB 1G3BA 1WTHD 4B2AA 1HAVB 2D1JA 4WMFA 2ESTE 3PTBA 3MO9A 1GHBF 1M9UA 3RC5A 3SQEE 3QDZB 3ZVGA 4FUHA 2K1QA 3LDXH 1ESBA 1SFQB 1Z8JB 2GCHF 1EOLA 2RDLA 2OC0A 3KEEA 3LH1A 2P8OB 1BHXF 1EZQA 1VITH 3VB5A 1SQTA 2VH0A 1QB1A 2BVSH 4ABEA 3A80A 1F0UA 1GJ5H 1O2RA 1ZTKA 3A89A 1PPHE 1Y3UA 4WMDA 4Q80A 3U8TH 1TBRH 1ZR0A 1QQ4A 4J1YA 4JK5A 1P10A 2FO9A 4PROA 3KCGH 1O2PA 1C2DA 3BIVH 1TWXB 3P8OA 1GBDA 1G37A 3PROA 3RXQA 1SLWB 3L6PA 1AMHA 2Y82A 4X8UH 3VB7A 1GBHA 1HV7A 1YPHC 3BV9B 3TGJE 2Y5FA 3H7TA 3LGTA 2VNTA 2BY5X 1VITF 3ZZBA 3ATMA 1S83A 4DCDA 2ZWLH 1TOCB 1S82A 4CREA 4YZUA 3A86A 4Y8YA 3GY6A 1TBZH 3MU1A 3RXCA 1ZMNA 1ZPZA 1C5OH 1NRPH 1ZTJA 1O3LA 3MFJA 3UTUH 1VCWA 2FI4E 1UMAH 5EXMA 2VIDA 3SJ9A 3UPEA 3G01A 1THRH 2A4QA 2BD4A 5FCKA 1NFXA 4UEHH 3SN8A 1HIAA 3Q3XA 3U1JB 4ABDA 4OS4A 1NRQH 5A09A 1O2VA 1C2GA 1K1MA 1GJDB 4DT7B 5A8ZA 4X2WA 1TONA 2V35A 4WF8A 1AKSA 2XWAA 5HM9A 3PV4A 3A7ZA 3EAJA 3O8BA 3MMGA 1SGYE 4ZROA 4Y7BA 2ZDNA 3M61U 2O8LA 1J14A 1O35A 1DX5M 2BLWA 3DT0H 1GMCF 3PWCA 4WXVA 4WXIA 1IQIA 1O3BA 2VB0A 1SQOA 1FN6A 1C5UA 1Z6JH 2XRCA 3HK3B 4X8VH 1QURH 1P57B 1P01A 3QN7A 1UVOA 2C93B 3ODDA 5C1XA 1QRZA 4ABHA 4DOQA 1ACBE 2ZFQH 2VWNA 2AGIX 3BTQE 1KIGH 2R9PA 2UWPA 2Y81A 1O2NA 1UCYE 4LZ1H 1QFKH 2J4IA 1O3NA 1F0TA 2VWMA 2WPHS 4FUJA 1T8NA 1BTPA 2WINI 2SFAA 1KSNA 2ANKH 4B74A 2QXIA 2WPKS 3M7TA 1UJ1A 3U9AH 4ISIH 4CRCA 2WPMS 1YPLH 1B0EA 3URCA 3ZV8A 3A8DA 1GI6A 1HJAC 3ZZ3A 3TJVA 3U1IB 1BQYA 1BBRE 1DFPA 1TQ0B 1YCPK 3K9XB 5JBAS 3RMOH 5A0AE 2W7SA 3LU9B 1YCPH 2B5TB 1LO6A 2BVXH 3AW0A 1EAXA 1XUJA 4B2BA 1O2UA 1HUTH 2DE8A 5T3HA 1HXFH 1C5PA 1EP6A 5EQRA 1HAZB 3PWBA 1BDAA 3DFJA 1V2PT 2SNVA 2NU4E 1AN1E 2F83A 3TH3H 1A0JA 1V2KT 3BG4C 2CHAB 1HGTH 3UQVA 3BEFB 1TE0A 5TCAA 5EXLA 3V3MA 1GMHG 1O32A 1SGFG 4MPXA 4YM9A 1UVPA 1H8IH 1O3CA 9ESTA 2ZIQH 1A1RA 1ZGIA 1TA6A 1NO9H 1ANDA 1EQ9A 1NRNH 4ZH8A 4WJG2 3U69H 1O3MA 1AWHB 3MH6A 2BDIA 2FOEA 2ZFRH 4ESTE 1A0LA 5CHAB 1ETTH 1D4PB 1C5YB 3NUMA 1RXPA 4X8TH 3CP7A 1C1QA 1UHBA 2ZNKH 1W0YH 5A8XA 3RXVA 3E3TA 3SJ8A 1RIWC 3VGCC 4K8BA 1GHYH 3FZDA 1RJXB 1LVBA 2Q6GA 1C9TA 2EEKA 2UUJB 1K1LA 1Z1JA 2ZFPH 4X6NA 4XE4A 5LPFA 3M35A 1PQAA 1C2JA 1XUHA 2HGTH 7ESTE 3UUZA 4ZXXH 4B76A 1GI2A 1ZSKA 5LPEA 4YOJA 3T26A 4LZ4B 2OP9A 3PMJA 2OUAA 2OC7A 1BB0B 3T28A 5EQSA 2PLXA 1V2OT 1IQNA 1AE8H 3LC5A 1LCYA 4K3JA 1OWDA 4H6SB 1G3EA 4B75A 1FAXA 3M3SA 2Y5HA 4ABJA 3FFGA 2A1DB 2GZ7A 2ZTXA 2NWNA 3KQBA 4DGJA 1C5XB 4I8JA 1PQ5A 3TJOA 1OWKA 1C5WB 1LTOA 3LIWA 5EOKA 2P93A 1NY22 1BTXA 1T8OA 2FDAA 2EC9H 1TNLA 3LKWA 1O2MA 3MOCA 1BITA 1SB1H 2OXSA 1NU7B 4VGCC 3D65E 3ITIA 3UOUA 1ZJKA 4MG3A 1QIXB 5F8XA 3GCTF 4UDWH 2WUCA 2CF9H 1MZDA 2H6MA 1MBQA 2PTCE 4WVPE 5DKMA 2C90B 3E16B 2FOCA 1G2LA 3CENA 1B0FA 4AFZA 1OX1A 3MU0A 1IQGA 1UTNA 1WV7H 2ZP0H 5CE1A 4O3UA 2BLVA 2ANYA 2PR3A 2ANWA 3UNSA 2QC2A 8KME2 2C4FH 1A5HA 2ODPA 4H4FA 1EPTC 2ZHFH 1OKXA 1D9IA 4XFQA 3L3TA 3FP6E 3M37A 2FOGA 1C5VA 1FY4A 2OINA 1UTOA 4I31A 2RG3A 3RXBA 1SHYA 2HWLB 4K5ZA 1KXAA 2H5DA 3P8NA 1JRSA 3VPKA 1XVMA 1VCPA 1L2EA 2TGPZ 3RXTA 1NS3A 1TMUH 2R3YA 3I29A 4NZLA 1CA0C 5EGMA 2ZU1A 1GHXH 1IQKA 2ZDLA 2BQ7B 4Y10E 5LPRA 2AIQA 1P04A 3PM3A 5DP4A 1TNGA 2FLBH 1FIWA 4TPYA 2OLGA 2PKAB 3LGVA 1TNJA 1ABJH 2FS8A 2HNTE 3A82A 1BOQA 4TWWA 1H9IE 1O5AB 3SU2A 4OGXA 1XXDA 2RA0A 1O34A 4MDSA 1ELVA 5EQQA 1C1MA 6GCHG 4XOJA 2DUCA 1EAIA 4NSVA 5GXPA 2V6NA 3ZZ4A 3L33A 1DLEA 2STBE 3UIRA 1P2KA 1Y3VA 2I6SA 3ODFA 5CMXH 1DDJA 1N6XA 2Z9KA 2FOFA 1EATA 1QNJA 3B23B 3SGBE 1RD3B 4OS6A 1EJMA 5A2MH 1SLXB 3KL6A 3E0PB 1AI8H 1C1NA 1DITH 1K1NA 4ZUHA 1O3FA 1ZRKA 1HYLA 1BTZA 4KGAA 3D23A 4FUEA 2QYIA 3SGQE 4D7FA 3F9GA 1OS8A 2CN0H 2PSYA 8LPRA 1CBWC 1HRTH 3PTNA 2SGQE 1BCUH 1ZTLA 4GCHF 2QXGA 3DHKH 1JIRA 3A87A 2FOBA 1Z8GA 1MU6B 1RFNA 2G5VA 1C1RA 1TIOA 2TGTA 1GJ9B 2CXVA 3BN9A 2FPZA 3EDXB 5L2YH 3S9BA 1IHSH 2BVRH 1U6QA 4OS7A 2VIVA 1L4ZA 2FTLE 1LHEH 2VGCC 2FS9A 1P2MA 3VB3A 2TBSA 1KLTA 1E35B 2FM2A 1MMJN 3VFEA 5F03A 2ZI2H 4O97A 4F4OC 1FQ3A 3EQ0H 3ZVCA 4IC5A 3E1XB 3MHWU 2WV4A 1GJBB 3RP2A 2AFQB 3M7QA 3FZZA 1Q3XA 1SGFA 3MNCA 1GBKA 2Z3CA 3MWIU 1O2XA 1QHRB 1BMLA 2XBVA 7LPRA 1A7SA 2QF0A 3RXJA 3T29A 4CR9A 3V7TA 4TY6A 2G51A 3ZYDA 1JIMA 2WYJA 1MKXH 2BLQA 2Z3EA 4E7RG 4JCNA 1ID5H 3TPIZ 3QK1A 4MNYA 4OS2A 1P2OA 1GI0A 1GMDG 4ZMAH 1W10U 1FMGA 1VZQH 3M7UA 4FUBA 2NU3E 1VR1H 3LC3A 2A4OA 2RA3A 4Y6DA 4IC6A 5EU8A 2H1UA 1AD8H 2JH0D 2BXUH 4JZEH 2OBQA 5F8ZA 1FNIA 2TPIZ 1K9OE 5C20A 4AB9A 4RSPA 4FU9A 1W14U 2BDBA 3A8BA 1DE7H 1GG6B 1ETSH 1EJNA 1HLTH 2Y80A 5AF9H 2PKSC 4YLUA 1AQ7A 1O3OA 1K2I1 3LH3A 3SNAA 3JZ1B 1DPOA 3RXMA 1W13U 3A7VA 2W5EA 4YTAA 1ELBA 1CT0E 5E0HA 3A7TA 3AAVA 2ZU3A 3VXFH 3O8CA 1GVLA 2GDEH 4RKJB 1KXCA 2B9LA 2PUXB 3ELAH 2XW9A 2ZDKA 3SNEA 2FEQH 1LHDH 5FX5A 2AMDA 1NC6A 2PKSB 1G2MA 1AU8A 1D3QB 1MTNB 4DIHH 4NIYA 2D26C 1V2ST 2J38A 1ZZZA 4Q7ZA 1OP2A 4AG1A 2JETB 1O3GA 2IJOB 1KDQB 5FPSA 5C1YA 1GHZA 2GCTC 1DANH 1GI8B 1HXEH 3STJA 4KTUA 1TNKA 1AHTH 4A6LA 1BRUP 1CQQA 1BBRK 3HPTB 3SI4H 1FY1A 1E34B 1K1JA 1PYTD 2ZTZA 4FU7A 3SW2B 5JBTA 3C27B 4D7GA 1T31A 5IDKA 4LXBH 1TGTA 5J4SA 1HAVA 3SUEA 1CGJE 4A5TS 1TGCA 5DP9A 2KAIB 2BYAX 1AFEH 1GJ4H 5FPTA 1W7XH 2IOTA 3LJOA 1G32B 1KXFA 1SG8B 3NXPA 2VWOA 3M5NA 1Z7KA 3RLWH 1J17T 3QTOH 3UR9A 3FP8E 2JKHA 4AZ2B 5B6OA 2G8TA 2HRVA 1QB9A 1V2VT 2SGEE 1MAXA 2OC1A 1GCTC 1K1PA 4LOYH 4DVAU 2TIOA 1UVTH 1DWDH 1TPOA 1AVWA 1TPPA 1TGSZ 1KXEA 1YPHE 1TBQH 1AVXA 4MNXA 3SU4A 1XUFA 4BOHA 8GCHG 2FX6A 4O3TA 4NA8A 5GCHG 2ZG0H 4DIIH 1MTUA 1TNIA 4HI3A 3GYLB 2AMQA 4IGDA 5E0JA 3GY4A 1JWTA 1BMNH 1E38B 2H5CA 5EG4A 1A46H 1WOFA 3TU7H 1P9SA 4JYTA 1QTFA 4CRAA 1D6RA 1EX3A 2FODA 2BQ6B 5FX6A 3OX7U 4INHA 3EYDA 3AAUA 3P8GA 3BSQA 1YLDA 2RCEA 5E2OA 2HOBA 1AO5A 1FPHH 1AB9C 2BD3A 2QXJA 1SGNE 2Z94A 1OWHA 3MH7A 1EAWA 2A31A 2GV7A 1DS2E 1HAXB 3OY6U 3K2UA 1AFQC 2F9OA 1V2JT 3PO1C 1LHGH 2ZGCA 2GVFA 3GCOA 1BJVA 2O8WA 4YT6H 5C5OA 1WBGB 3EA9A 4NFFA 1TGBA 1O2QA 3SGAE 3GDUA 1SPJA 1W8BH 2AS9A 2FP7B 4CBOA 4AFUA 2BZAA 3MO3A 1LQEA 1P11E 3SJKA 1QJ7B 1BZXE 4DG4A 1NN6A 3S9CA 3S7KB 3Q3YA 2CGAA 1AUJA 2GD4B 2P3FH 2ZCHP 1W7GH 4I32A 3M5LA 2ZF0H 2QV1A 1C5SA 2A7CA 1ELCA 1KXBA 4GPGA 3S9AA 2D8WA 2H2ZA 2EI6A 3PO1B 8ESTE 4WY3A 3GY8A 1P2IA 1JOUB 1HDTH 1C1TA 1PYTC 1G30B 2QXHA 5T6GA 2FESH 4X2XA 1C5QA 4JMYA 4MNWA 2ILNA 3RXHA 1O2IA 1GBEA 3K6ZA 2FTMA 4FUDA 1E0FD 1SGCA 2Y5GA 1ETRH 1C2LA 4BXWA 2BDCA 5I25A 6CHAC 5JB8S 1O39A 1C5NH 1HPGA 1Y8TA 3ESTA 2ZHWH 3HGPA 3FANA 5A0BA 2GT8A 3QTVH 2FI5E 1QRWA 3QUMP 2XC4A 2R2MB 1LVYA 1V2WT 2PW8H 1A3EH 3O8RA 2V3OH 2QIQA 1YBWA 3R0FA 1J15A 3TITA 2EI8A 4MLFB 3K65B 1DXWA 4AOQA 1QBVH 1OPHB 4X1NU 1TPAE 1A61H 5JBCS 2XCNA 4ISLA 1EXFA 5EW1H 3RMLH 1NM6A 1CVWH 5FBEA 5FHTA 1T32A 1VGCC 1TOMH 3K6YA 1AGJA 1SGDE 3DUXH 4NWLA 3EGKH 2GX4A 3TK6A 1GI4A 3IWMA 3QGNB 1FV9A 1UTPA 4UFFH 1WU1A 3SNBA 1SGEE 1INCA 1EAUA 4K1EA 1YC0A 1F92A 2FXRA 2ZQ2A 2BX4A 2W3IA 3W95A 2JH6D 1Z71A 2QGRA 2B8OH 1IOEA 1GL1A 3ZVEA 7GCHG 1OSSA 1Y5UT 1HJAB 3F9HA 1TRYA 3V12A 3ZZDA 1ZPCA 1LHFH 1SLVB 4MTBA 1BHXB 3P92A 4FVBA 1FY5A 1BUIA 3RXKA 1NFUA 1S6HA 4JYUH 1O33A 1IAUA 1ZPBA 1FLEE 2OBOA 3BG4B 3SUGA 1XM1A 1Y5AT 4AB8A 3RLYH 4IMZA 2ZHQH 2GMTC 3GDSA 4J2YB 1VJ9U 4R0IA 1C1VH 4AG2A 3GOVB 4H42U 2D2DA 4ISOA 1CE5A 1GI1A 1YLCA 1GHAG 4BAQB 4I8HA 1AWFH 3LJJA 4JYVH 1HAOH 1WAYB 4R8TB 1V2TT 4AYYB 1TX7A 2ANMH 4ZKRU 1EASA 1P05A 1NTPA 3Q76A 3SHCH 3RU4T 1OWEA 1DM4B 1RRKA 3GY3A 1JMOH 3S7HB 1HFDA 5PTPA 1UVUH 4MNVA 1EB1H 1RIWB 1C5RA 1LKBA 3GY5A 3VGCB 5E8EH 4D9RA 4CRGA 2BZ6H 3LGYA 3U8OH 4BAMB 1GL0E 4Y0ZE 4B1TA 1CHOG 2R3UA 2A2XH 4NWKA 2F9PA 1GMHF 2SGAA 2ASUB 1GGDC 1QL7A 1UTKA 5E0GA 1C5ZB 1AIXH 1ABIH 1SGIB 1Z8RA 1YPKH 1BIOA 3V13A 4ZKSU 1F7ZA 1FPCH 1YPGH 3DA9B 5GIBA 1FONA 4K1TA 2VIOA 3O8DA 1ZJDA 2UWLA 2NU2E 3LPRA 1J16A 3BIUH 3A7XA 1SOTA 2FYRA 2AIPA 2PV9B 3P95A 3F68H 3TGIE 1LQDB 3CS7A 1W11U 3BTGE 3GDVA 3WY8A 4JK6A 2GKVE 1BRBE 1HBTH 3HGNA 1WQVH 2W3KA 2STAE 1OYTH 4YOIA 5LH8A 3HKJB 2BY6X 1XX9A 2G81E 1DWBH 1MD7A 2IPHA 4Y8ZA 2BTCE 1UK4A 2Y7ZA 2TGAA 2XWBI 3HK6B 5E2PA 4AX9H 3SV8A 4KKDA 1DVAH 1T7CA 2ZCKP 4I7YH 1SOZA 1TALA 4LK4A 2ZDVH 1W2KH 1KXDA 1ELEE 4VGCB 1BTUA 1ZYOA 2UUKB 1EZUC 4Z6AH 2J95A 1IQMA 2WPJS 2P3TB 1BMMH 3NK8A 4ABAA 1TNHA 3Q3KA 1D3PB 1YKTA 1G3DA 3TVJB 5FBIA 2A0QB 3UY9A 1H1BA 2ZHEH 2VU8E 2J94A 3RC4A 1THSH 2ODQA 3UFAA 3W94A 1ANCA 2A2QH 4GSOA 2PUQH 3KNXA 3MI4A 1FY8E 4GAWA 3QGJA 5A8YA 1KYNA 1GVZA 3MNXA 2SGFE 1HNEE 1F5LA 1C1OA 4WH6A 1EPTB 1OWJA 3BTHE 4XBBA 1HB0B 1MKWK 4BAOB 4WH8A 1XKBC 1GDNA 4X2YA 3MU5A
chains in the Genus database with same CATH superfamily
4ASHA 3KGPA 1N8OC 4O03A 2Q1JA 2PKAA 2WZQA 3RXUA 1NT1A 1O3HA 3QX5H 3E90B 4A7IB 3M5OA 1EPTA 2KR7A 3OYPA 3IITA 2R0KA 1L0ZA 3ZZ9A 1CA0B 1C4U2 5EODA 1MAYA 1N6YA 1MH0A 3B9FH 1B7XB 1OHHD 3NZIA 5BRRE 5BPEA 2ZDMA 4FUFA 1K28D 4NG9H 1LMWB 2ZDAH 3GY2A 4UFDH 1SHHB 3ENSB 2KCPA 1O31A 1ZSJA 2Z3DA 2A5IA 1O38A 2BD7A 2DE9A 4ABFA 3TNTA 1XVOA 3RU4E 3RXLA 4KP0A 2LP6A 1ANBA 3MH4A 1DOJA 1SI5H 4HGCA 1NRRH 2J9NA 3STIA 1QB6A 1SVPA 1XXFA 4JZ1A 3RXPA 1RS0A 5TJXA 5F6MA 2TRMA 1DWEH 2HLCA 1ZMLA 4E7NA 3P70B 2VVCA 1SGRE 2WV5A 4NGAH 3SU0A 1CU1A 3OE7D 3UAIC 2ULLA 1ZHMA 1TA2A 3RXFA 3TJNA 1HAYB 5L6NH 4GHTA 1MTSA 2ZHDA 2ZO3H 2EA3A 5JDUB 2W6ID 2Q6DA 5J4QA 3OEED 1NROH 1MZAA 2GV6A 1HJ8A 1V3XA 1GBMA 2VH6A 2P16A 2ZCLP 3E8LA 5DGJA 2IN2A 3SQHE 3PMBB 1CBWB 3PMAB 1SQAA 3SHAH 1E1RD 3SV7A 4CHAC 2OQ5A 2BD9A 3GISB 3KQ5A 2B7DH 3BTKE 2VVUA 1ZOMA 1A2CH 2AMPA 4Q7XA 3NWUA 5K7RA 1O30A 2OTVA 1AY6H 6GCHF 3RXGA 4K8YA 3ZZAA 1C2IA 1K0HA 4A1XA 4AGJA 1T8MA 3M36A 1O5CB 1WSSH 5H4IB 3KYGA 3PV5A 5ABWA 2VGCB 2GZ9A 1HAIH 2WPLS 3F9FA 5AVDA 3T27A 4I8GA 1HAPH 3BTDE 4DW2U 1W12U 1X7AC 2EI7A 4RT1A 1ORFA 3PLBA 4ZKOU 1IQEA 3GCHC 3R3GB 1YCPM 1H9LB 1UTMA 2WYGA 4BANB 2ZC9H 1SFIA 4K69A 1S81A 2O9QA 4TPIZ 1DICA 1UVSH 4Y76A 3LT3A 3I78A 1OYQA 2BXTH 1BRCE 4CBNA 2ZA5A 1O5FH 4XSKU 4ZXYH 1MTVA 5DP3A 1GHBG 2BDYA 4I8KA 5FPYA 1H9HE 1C1WH 3NPSA 3ZZ8A 1P0SH 1WQSA 5GJ4B 1PPZA 1TABE 4X1PU 2H9HA 2ZFSA 2WSSD 2HLDD 1W0JD 2PTNA 2GCHG 4ZKNU 3RXRA 1ZGVA 2FWWA 1O3DA 3DSGA 3PRDA 3TIUA 1UTLM 2AERH 5TCCA 1SGTA 3SNDA 2VINA 1ZMJA 2VIQA 1EUFA 3VB6A 4NA9H 3S0NA 2V3MA 1XMNB 1NBME 1O2TA 1P2QA 3PLPA 1P12E 3UNQA 1S84A 2FLRH 1O5EH 1YYY1 4JZIA 3V0XA 1O5DH 2G4TA 3BTWE 1LHCH 1BA8B 3A81A 1D3DB 1UCYK 5DP5A 3E91A 1UCYH 1LPKB 2SGPE 3UR6A 1YY3A 4D9QA 2PSXA 3C1KA 2FYQA 1TRNA 3MNSA 1MD8A 1QR3E 1GDQA 2ALVA 1ESAA 2GP9B 2Z9JA 3H09A 4YO9A 2QAAA 2XCFA 5EIYA 3SU3A 1MQ6A 3E0NB 5L2ZH 1FI8A 1F5RA 1GMDF 1VITG 5DP6A 3RM2H 3P17H 2BOKA 1AZZA 4HZHA 1KDQA 1BBRH 2P8OC 2Z9LA 1O3AA 3GICB 1GWAA 1UK2A 2F9UA 3SV6A 1V2UT 2XC5A 1EZXC 3ZZCA 6LPRA 4NZQA 2BDAA 2LNCA 1BJUA 1FXYA 2ALPA 5I46H 3RC6A 1Z1IA 2AH4X 2QF3A 5C2ZA 3OSYA 2ZU2A 5CDFE 2V7QD 3QWCH 4D76A 1GI5A 4UFGH 3SORA 1YM0A 3UWJH 2ZQ1A 1ELTA 1OOKB 2GCTB 2KAIA 1EP5A 1C4V2 1QRXA 2O8UA 2XBXA 3KHVA 3PMHB 4X6MA 4BTIB 2BY9X 1Q31A 2VIPA 2THFB 1NU9A 5ESBA 1QCPA 3RXSA 1KLIH 2BB4A 1N1LA 1WYKA 2B0FA 5LGOA 1SBWA 2GT7A 3VB4A 1ARCA 1W0ZU 1B5GH 4GHQA 2L6OA 2GGVB 3MU8A 4CRDA 3OTJE 2JJ2D 3PV2A 2XOKD 4X8SH 2O8MA 1SGQE 1YP9A 2BDHA 1GMCG 3Q00A 3N99A 1Y5BT 3GY7A 2A7HA 5AFZH 3KN2A 4FXGH 1DWCH 3Q77A 5KEDA 1TFXA 5EXNA 4X1RU 1KLJH 2A5KA 1RTLA 1YPMH 2QY0B 2ZPQA 3RDZA 2J92A 5GWZA 1C5TA 1FAKH 4D8NA 1GCTB 1S6LA 2FOHA 4INLA 4GUXA 3BTFE 1V6DA 1XUGA 1F0RA 1MQ5A 1WCZA 1PPBH 1MCVA 1DLKB 1O2HA 2P59A 5T6DA 4ABGA 1GDUA 2NU1E 1S85A 4X6OA 4DY7B 1FUJA 5A0CA 4AGKA 3OEHD 2G00A 5T6FA 1SC8U 1PJPA 3ZZ5A 3FP7E 1P8VC 2BD2A 1YF4A 2J34A 2CJIA 2ZECA 1O2LA 1C2KA 2ZU5A 1QJ1B 1SR5C 2PFEA 1A3BH 4E06H 3MNBA 3A8AA 1O0DH 4B2CA 5C3NA 1HIAB 4BNRA 3RXIA 5DK1A 2VVVA 4ABIA 3A88A 4XBDA 1CO7E 4IN1A 3S69A 4B71A 1C5LH 1NESE 1AB9B 3F6UH 3BEUA 1BMAA 4K2YA 3SI3H 4FUGA 4U32A 1AKSB 3BG8A 5HYOA 1TPSA 3GCNA 4WWYA 1AFQB 1ZRBA 1C2FA 1DXPA 2CK3D 4INKA 1TYNA 2ZGHA 1FN8A 1TX8A 2KZ4A 2OQUA 2P94A 1DUAA 1C5MD 4K1SA 1DT2A 1Y3WA 4IBLH 3EA7A 2ZGJA 1NZQH 8GCHF 2BD8A 2G5NA 1BTWA 4GLYA 5GCHF 5EPYA 3RMMH 4UONA 1H8ED 1UTJA 2BD5A 1Z8IB 1T4UH 5G4BA 2PGQB 2ZEBA 1AZ8A 2FOMB 5C1UA 1TRMA 3KQCA 3D49H 3T2NA 1C2MA 1P02A 1EZSC 4ABBA 2P3UB 1ZHPA 3AW1A 1T4VH 2GDDA 4Y71A 4NSYA 3T62A 3VXEH 4AFQA 1CHGA 1FZZA 1O2JA 2BX3A 5EPNA 5C5NA 1NPMA 2A45B 3PYHA 1PFXC 1HCGA 4ZHMU 1TMTH 2CHAC 3HKIB 2PWXA 1PPFE 1LVMA 1EOJA 4Q7YA 2Y7XA 3SZNA 1ELGA 1ELAA 5DO4H 1C1SA 4DURA 2G55A 2FX4A 2FI3E 2CF8H 6CHAB 4X2VA 1C2HA 4I86A 1O2SA 2HVXA 1FY3A 2W7UA 1AUTC 4XRNA 3M3TA 2ODYB 2XC0A 1MBMA 1YPJH 1GBTA 1QJ6B 1P9UA 1QL9A 1BRAA 1O3KA 1LPZB 1A4WH 5HIZA 5GPIB 1LKAA 3QZRA 1F0SA 5CHAC 4SGAE 1IQJA 1VKYA 1DUEA 1FDPA 2A4GA 3LGIA 3RMNH 2XXLA 2UUYA 4IMQA 4RN6A 1TGNA 4U30A 1QL8A 1O2YA 1QQUA 1ELDE 1VGCB 5C0UA 2BY8X 1QBNA 4Y79A 2M2AA 1UTQA 5GDSH 3F1SB 5DPAA 1GBFA 4ISNA 2A5AA 4A92A 1UHBB 1E37B 6ESTA 2FIRH 2VJ1A 2GTBA 3A85A 3QO6A 4OS1A 1F5KU 2ZTYA 3F9EA 2M5TA 1K1IA 3GCTG 1H8DH 3F2GA 2AGGX 2LPRA 1TMBH 4IS5A 1DSUA 5JBBS 2Z9IA 3N7DA 4FVDA 5L30H 1ZLRA 4O9VA 1GBCA 1V2RT 2V0BA 3BTEE 1MABB 1O3EA 4HFPB 1O3PB 2HNTF 3SU1A 4HG6A 3ZZ7A 3KF2A 3LGWA 1JXPA 2UWOA 1GI7B 2QA9E 4AFSA 3SUDA 1GI3A 3EA8A 1C9PA 3QZQA 2GMTB 3ZV9A 2XTTB 9LPRA 3BEIB 5DP8A 5C0TA 2G4UA 1QZ8A 2C8YB 3SOSA 3LGUA 1O2GH 2BMGB 2AYWA 3LONA 4U01A 1ANEA 1O2WA 1BTHH 4TYDA 4FU8A 2R0LA 1C4Y2 5HGGA 2SGDE 1O3IA 1A5IA 1AVGH 1ARBA 1CGIE 3A83A 1P03A 3A7YA 3A8CA 1BT7A 1YGCH 5ESTE 4UD9H 7GCHF 2WUBA 2ZKSA 3MH5A 1L1JA 5SGAE 1L4DA 2C8ZB 3IG6B 1PPEE 2C3SA 5DG6A 3RU4D 1VJAU 2WPIS 1V2QT 2J2UA 1J8AA 2C8WB 1GCDA 1BTYA 2H9EH 3I77A 3OU0A 1CT4E 4QT8C 2G52A 4F49A 1PPCE 1L1GA 2SNWA 4ZHAA 2P95A 5AFYH 1C1PA 5DSFA 1GJCB 4ZAEA 4MVNA 4YLQH 3VG8A 4HTCH 1FIZA 3SV9A 4Z0KA 2KX4A 2L74A 1GGDB 1GPZA 1V2MT 1W3CA 3KIDU 3LOXA 1GHAF 4BAHB 3UNRA 4NIVA 2YMSC 4A1TA 2I6QA 2R2WU 1G3CA 1QY6A 2F9NA 5HKKD 4IN2A 1HJ9A 2YNBA 1L1NA 2QE7D 1GBJA 3SJIA 1O2KA 1PPGE 3F2FA 2BDGA 2AGEX 3ZVAA 3AK5A 4KELA 3U98H 3TLOA 3TGKE 3KQDA 4AORA 4GCHG 1ESTA 4GVUA 3ZZ6A 1GI9B 1OP0A 4YOGA 1P09A 3SV2H 2F3CE 1OXGA 1WTGH 4X0WU 3TH2H 1IQHA 3N7OA 3VEQB 2TGDA 1YPEH 3KQEA 4ASUD 1O2OA 3TH4H 2OD3B 1CT2E 2F91A 2ZGBH 3HATH 1CHOF 1WXRA 5FXLA 1CGHA 3ZVBA 1K21H 2HPPH 2VWLA 1MKWH 4BTUB 4CRBA 1K1OA 1P2NA 4TWYA 1P2JA 2AEIH 1WUNH 2V3HH 1DY9A 1KY9A 3WWFA 3URDA 3FAOA 4SGBE 1AE5A 3N7EA 1Q2WA 1F2SE 3RXEA 5ETXA 4H6TA 1QA0A 4OGYA 1QGFA 5EW2H 3SNCA 4XBCA 4X6PA 3M5MA 1GHVH 4X1SU 2HNTC 4I8LA 4MPUA 5JYIA 1P3EA 2CV3A 4AN7A 4BTTB 1N8OB 1LPGB 1C1UH 1JBUH 2GZ8A 4UFEH 1MTWA 1XUIA 3RXOA 1O5BB 2O8TA 2XYAA 4Y7AA 2HPQH 2BM2A 1TB6H 1O5GH 1O36A 2OC8A 2NU0E 2A7JA 1OWIA 4JZDH 3ZVDA 3D62A 4THNH 3SU5A 3NKKA 1TQ7B 1TAWA 5JPMH 4OS5A 1A0HB 1NBMD 1CA8B 4UE7H 1Y3XA 1GJ6A 3M3VA 1J9CH 1DSTA 1GBIA 3AVZA 4MQAA 4Y11E 3TK9A 3PB1E 4Z1MD 5DP7A 3RM0H 1NRSH 5DJ7A 2ZU4A 3ATLA 4MPWA 3FVFB 5AHGH 5F53A 1NFWA 3SJOA 3TK5A 1XUKA 2ZPRA 3BF6H 1VCQA 1FJSA 2CMYA 1GJ8B 1P3CA 1S5SA 4FUCA 2YOLA 4KTSA 4WMEA 1GVKB 3RXDA 2QCYA 1QA7A 1G9IE 2F9BH 1EJAA 1MU8B 2BHGA 4B73A 1V2LT 3EE0B 3T25A 2IJD1 4NFEA 1PQ8A 1Y59T 1ZSLA 2FZZA 3ATKA 4NIWA 3UREA 2VIWA 2W26A 4NA7A 3ATIA 1BMFD 2F9VA 3JZ2B 1A5GH 3CS0A 3MYWA 3H5CB 3PRBA 1H4WA 1RTFB 4U2WA 1PQ7A 5HM2A 5IYTA 1SMFE 3FKSD 1SL3A 1GBBA 2PGBB 1GBAA 3PLKA 2BOHB 5HXFA 3OFND 2UUFB 4CH8B 3P6ZB 3NCLA 1RGQA 4ISHH 2ZFFH 2ZPSA 4BAKB 1O2ZA 1OP8A 1V2NT 3A84A 5FAHA 1UO6A 3DD2H 3QLPH 4CH2B 5FCRA 3AASA 4CHAB 1MKXK 2IPQX 2H9TH 2Y6TA 1GG6C 1IHTH 2ZGXH 3GYMA 2AHME 2BQWB 1ZHRA 1D3TB 5C17A 4A1VA 3ATWA 4M7GA 4BXSA 1TX6A 2Z7FE 4RKOB 5F8TA 5K0HA 1IQFA 4FOUC 4JZFH 1G36A 1UK3A 1SQRA 2HALA 3UQOA 3RUOA 2PHBA 2C8XB 2FOAA 3BTME 4RI0A 1Y3YA 2F4LA 2XBYA 3DFLA 1S6FA 3A7WA 1IQLA 2KCAA 4TY7A 1P06A 3H7OA 4DT4A 1XKAC 1LDTT 4CRFA 1KMHB 4YESB 5HIYA 4FUIA 3GCHB 4K60A 1TLDA 1GBLA 4MPVA 1YWUA 3U8RH 4AYVB 3TJUA 3E6PH 4Y0YE 1JRTA 2OCVB 1QBOA 4Q2KA 4X1QU 4NIXA 3F0PA 3P8FA 1Z6EA 1MTNC 1GJAB 1DY8A 1C2EA 1K22H 1NFYA 4NCYA 2XBWA 1EKBB 1HAGE 4IW4E 2JETC 2QN5T 4CR5A 3NRLA 2Q6FA 2YNAA 1GHWH 4ZHLU 3B8JA 1RTKA 1O3JA 3MTYA 1EB2A 3F2HA 5C94A 4YT7H 1D6WA 3UWIA 4I33A 7KMEH 1LVOA 2BLOA 2BY7X 1T8LA 2Z9GA 3ZVFA 2JH5D 2Z6BD 5C67A 4E05H 3FN8A 3SUFA 4XDEA 3SO3A 5JB9S 2A4RA 4OM9A 1GJ7B 2XNIA 5HMAA 2ZFTA 1SSXA 1HAHH 3MO6A 4ACBA 3ZYEA 3SBKA 2FMJA 3RXAA 4Y8XA 1CSOE 4DJZB 3OY5U 3UOPA 2A32A 1THPB 3MU4A 1ELFA 1MUEB 3TNSA 1S0RA 3BTTE 3T5FH 1KTSB 1E36B 1S0QA 4KTCA 3SU6A 1SGPE 1MCTA 1O37A 2ZZUH 1KTTB 1SLUB 1G3BA 1WTHD 4B2AA 1HAVB 2D1JA 4WMFA 2ESTE 3PTBA 3MO9A 5EJLA 1GHBF 1M9UA 3RC5A 3SQEE 3QDZB 3ZVGA 4FUHA 2JJ1D 2K1QA 3LDXH 1ESBA 1SFQB 4TT3D 1Z8JB 2GCHF 1EOLA 2RDLA 2OC0A 3KEEA 3LH1A 2P8OB 1BHXF 1EZQA 1VITH 3VB5A 1SQTA 2VH0A 1QB1A 2BVSH 4ABEA 3A80A 1F0UA 1GJ5H 1O2RA 1ZTKA 3A89A 5B6LA 1PPHE 1Y3UA 4WMDA 2J98B 4Q80A 1TBRH 3U8TH 1ZR0A 1QQ4A 4J1YA 4JK5A 1P10A 2FO9A 4PROA 3KCGH 1O2PA 1C2DA 3BIVH 1TWXB 2PP6A 3P8OA 1GBDA 1G37A 3PROA 3RXQA 1SLWB 5DN6D 3L6PA 1AMHA 2Y82A 4X8UH 3VB7A 1GBHA 1HV7A 1YPHC 3BV9B 3TGJE 2Y5FA 3H7TA 3LGTA 2VNTA 2BY5X 2K8IA 5IK2D 1VITF 3ZZBA 3ATMA 1S83A 4DCDA 2ZWLH 1TOCB 1S82A 4CREA 2W6JD 4YZUA 3A86A 4Y8YA 3GY6A 1TBZH 4FETA 3MU1A 3RXCA 1ZMNA 1ZPZA 1C5OH 1NRPH 1ZTJA 1O3LA 3MFJA 3UTUH 1VCWA 2FI4E 1UMAH 5EXMA 2VIDA 3SJ9A 3UPEA 3G01A 1THRH 2A4QA 2BD4A 5FCKA 1NFXA 4UEHH 3SN8A 1HIAA 3Q3XA 3U1JB 4ABDA 4OS4A 1NRQH 5A09A 1O2VA 1C2GA 1K1MA 1GJDB 4DT7B 5KGOA 5A8ZA 4X2WA 1TONA 2V35A 4WF8A 1AKSA 2XWAA 5HM9A 3PV4A 3A7ZA 3EAJA 3O8BA 3MMGA 1SGYE 5EJZA 4ZROA 4Y7BA 2ZDNA 3M61U 2O8LA 1J14A 1O35A 1DX5M 2BLWA 3DT0H 1GMCF 3PWCA 4WXVA 4WXIA 2QF5A 1IQIA 1O3BA 2JDID 2VB0A 1SQOA 1FN6A 1C5UA 1Z6JH 2XRCA 3HK3B 4X8VH 1QURH 1P57B 1P01A 3QN7A 1UVOA 2C93B 3ODDA 5C1XA 1QRZA 4ABHA 4DOQA 1ACBE 2ZFQH 2VWNA 2AGIX 3BTQE 1KIGH 2R9PA 2UWPA 2Y81A 1O2NA 1UCYE 4LZ1H 1QFKH 2J4IA 1O3NA 1F0TA 2VWMA 2WPHS 4FUJA 1T8NA 1BTPA 2WINI 2SFAA 1KSNA 2ANKH 4B74A 2QXIA 3MQKC 2WPKS 3M7TA 1UJ1A 1W0KD 3U9AH 4ISIH 4CRCA 2WPMS 1YPLH 1B0EA 3URCA 1H8HD 3ZV8A 3A8DA 1GI6A 1HJAC 3ZZ3A 3TJVA 3U1IB 1BQYA 1BBRE 1DFPA 1TQ0B 1YCPK 3K9XB 4AC9A 3RMOH 5JBAS 5A0AE 2W7SA 3LU9B 1YCPH 2B5TB 1LO6A 2BVXH 3AW0A 1EAXA 3SZEA 1XUJA 4B2BA 1O2UA 5FL7D 5T1VA 2DE8A 1HUTH 5T3HA 1HXFH 1C5PA 1EP6A 5EQRA 1HAZB 3PWBA 1BDAA 3DFJA 1V2PT 2J5UA 2SNVA 2NU4E 2YMSD 1AN1E 2F83A 3TH3H 1A0JA 1V2KT 3BG4C 2CHAB 1HGTH 3UQVA 1E1QD 3BEFB 1TE0A 5TCAA 5EXLA 3V3MA 1GMHG 1O32A 1SGFG 4MPXA 4YM9A 1UVPA 1H8IH 1O3CA 9ESTA 2ZIQH 1A1RA 1ZGIA 1TA6A 1NO9H 1ANDA 1EQ9A 1NRNH 4ZH8A 4WJG2 3U69H 1O3MA 1UW7A 1AWHB 3MH6A 4RT0A 2BDIA 1EFRD 2FOEA 2ZFRH 4ESTE 1A0LA 5CHAB 1ETTH 1D4PB 1C5YB 3NUMA 1RXPA 4X8TH 3CP7A 1C1QA 1UHBA 2ZNKH 1W0YH 5A8XA 3FOAA 3KYFA 3RXVA 3E3TA 3SJ8A 1RIWC 3VGCC 4K8BA 1GHYH 3FZDA 1RJXB 1LVBA 2Q6GA 1C9TA 2EEKA 2UUJB 1K1LA 1Z1JA 2ZFPH 4X6NA 4XE4A 5LPFA 3M35A 1PQAA 1C2JA 1XUHA 2HGTH 7ESTE 3UB0A 3UUZA 4ZXXH 4B76A 1GI2A 1ZSKA 5LPEA 4YOJA 3T26A 4LZ4B 2OP9A 3PMJA 2OUAA 2OC7A 1BB0B 3T28A 5EQSA 2PLXA 5GNDA 1V2OT 1IQNA 1AE8H 3LC5A 1LCYA 4K3JA 1OWDA 4H6SB 2EQNA 2K0QA 1G3EA 4B75A 1FAXA 3M3SA 2Y5HA 4ABJA 3FFGA 2A1DB 2GZ7A 2ZTXA 2NWNA 3KQBA 4DGJA 1C5XB 4I8JA 1PQ5A 3TJOA 1OWKA 1C5WB 1LTOA 3LIWA 5EOKA 2P93A 1NY22 1BTXA 1T8OA 2FDAA 2EC9H 1TNLA 3LKWA 1O2MA 3MOCA 1BITA 1SB1H 2OXSA 1NU7B 4VGCC 3D65E 3ITIA 3UOUA 1ZJKA 4MG3A 1QIXB 5F8XA 3GCTF 4UDWH 2WUCA 2CF9H 1MZDA 2H6MA 1MBQA 2PTCE 3OAAD 4WVPE 5DKMA 2C90B 2RDEA 3E16B 2FOCA 1G2LA 3CENA 1B0FA 4AFZA 1OX1A 3MU0A 1IQGA 1UTNA 1WV7H 2ZP0H 5CE1A 4O3UA 2BLVA 2ANYA 3FO8D 2PR3A 2ANWA 3UNSA 2QC2A 8KME2 2C4FH 1A5HA 2ODPA 4H4FA 1EPTC 2ZHFH 1OKXA 1D9IA 4XFQA 3L3TA 3FP6E 3M37A 2FOGA 1C5VA 1FY4A 2OINA 1UTOA 4I31A 2RG3A 3RXBA 1SHYA 2HWLB 4K5ZA 1KXAA 2YMSB 2H5DA 3P8NA 1JRSA 3VPKA 1XVMA 1VCPA 4XD7D 1L2EA 2TGPZ 3RXTA 1NS3A 1TMUH 2R3YA 3I29A 4NZLA 1CA0C 5EGMA 2ZU1A 1GHXH 1IQKA 4F48B 2ZDLA 2BQ7B 4Y10E 5LPRA 4ACAA 2AIQA 1P04A 3PM3A 5EJ1A 5DP4A 1TNGA 2FLBH 1FIWA 4TPYA 2OLGA 2PKAB 3LGVA 1TNJA 1ABJH 2FS8A 2HNTE 3A82A 1BOQA 4TWWA 1H9IE 1O5AB 3SU2A 4OGXA 1XXDA 2RA0A 1O34A 4YXWD 4MDSA 1ELVA 5EQQA 1C1MA 6GCHG 4XOJA 2DUCA 1EAIA 4NSVA 5GXPA 2V6NA 3ZZ4A 3L33A 1DLEA 2KCYA 2STBE 3UIRA 1P2KA 1Y3VA 2I6SA 3ODFA 5CMXH 1DDJA 1N6XA 2Z9KA 2FOFA 1EATA 1QNJA 3B23B 3SGBE 1RD3B 4OS6A 2KFWA 1EJMA 5A2MH 1SLXB 3KL6A 3E0PB 1AI8H 1C1NA 3WW7A 1DITH 1K1NA 4ZUHA 1O3FA 1ZRKA 1HYLA 1BTZA 4KGAA 4B6EA 3D23A 4FUEA 2QYIA 3SGQE 4D7FA 3F9GA 1OS8A 2CN0H 2PSYA 8LPRA 1CBWC 1HRTH 3PTNA 2SGQE 1BCUH 1ZTLA 4GCHF 2QXGA 3DHKH 1JIRA 3A87A 2FOBA 1Z8GA 1MU6B 1RFNA 2G5VA 1C1RA 1TIOA 2WPDD 2TGTA 1GJ9B 2CXVA 3BN9A 3CNRA 2FPZA 3EDXB 5L2YH 3S9BA 1IHSH 2BVRH 1U6QA 4OS7A 2VIVA 1L4ZA 2FTLE 1LHEH 2VGCC 2FS9A 1P2MA 3VB3A 2TBSA 1KLTA 1E35B 2FM2A 1MMJN 3VFEA 5F03A 2ZI2H 4O97A 4F4OC 1FQ3A 3EQ0H 3ZVCA 4IC5A 3E1XB 3MHWU 2WV4A 1GJBB 3RP2A 2AFQB 3M7QA 3FZZA 1Q3XA 1SGFA 3MNCA 1GBKA 2Z3CA 3MWIU 1O2XA 1QHRB 1BMLA 2XBVA 7LPRA 1A7SA 2QF0A 3RXJA 2QF4A 3T29A 4CR9A 3V7TA 4TY6A 4TSFD 2G51A 3ZYDA 1JIMA 2WYJA 1MKXH 2BLQA 2Z3EA 4E7RG 4JCNA 1ID5H 3TPIZ 2RFKC 3QK1A 4MNYA 4OS2A 1P2OA 1E79D 1GI0A 1GMDG 4ZMAH 1W10U 1FMGA 2JIZD 1VZQH 1WDIA 3M7UA 4Q63A 4FUBA 2NU3E 1VR1H 3LC3A 2A4OA 2RA3A 4Y6DA 4IC6A 5EU8A 2H1UA 1AD8H 2JH0D 2BXUH 4JZEH 2OBQA 2OK5A 5F8ZA 1FNIA 2TPIZ 1K9OE 5C20A 4AB9A 4RSPA 4FU9A 3F0OA 1W14U 2BDBA 3A8BA 1DE7H 1GG6B 1ETSH 1EJNA 1HLTH 2Y80A 5AF9H 2PKSC 4YLUA 1AQ7A 1O3OA 1K2I1 3LH3A 3GS9A 3JZ1B 3SNAA 1DPOA 3RXMA 4P00A 1W13U 3A7VA 2W5EA 4YTAA 1ELBA 1CT0E 5E0HA 3A7TA 3AAVA 2ZU3A 3VXFH 3O8CA 1GVLA 2GDEH 4RKJB 1KXCA 2B9LA 2PUXB 3ELAH 2EY4C 2XW9A 2ZDKA 3SNEA 4Q4LA 2FEQH 1LHDH 5FX5A 2AMDA 1NC6A 2PKSB 1G2MA 1AU8A 1D3QB 1MTNB 4DIHH 4NIYA 2D26C 1V2ST 2J38A 1ZZZA 4Q7ZA 1OP2A 4AG1A 2JETB 1O3GA 2IJOB 1KDQB 5FPSA 5C1YA 1GHZA 2GCTC 1DANH 1GI8B 1HXEH 3STJA 4KTUA 1TNKA 1AHTH 4A6LA 1BRUP 3DSPA 1CQQA 1BBRK 3HPTB 3SI4H 1FY1A 1E34B 1K1JA 1PYTD 2ZTZA 4FU7A 3SW2B 4F55A 5JBTA 3C27B 4D7GA 1T31A 5IDKA 4LXBH 1TGTA 5J4SA 1HAVA 3SUEA 1CGJE 4A5TS 1TGCA 5DP9A 2KAIB 2BYAX 1AFEH 1GJ4H 5FPTA 1W7XH 2IOTA 3LJOA 1G32B 1KXFA 1SG8B 3NXPA 2LELA 2WHXA 2VWOA 3M5NA 1Z7KA 3RLWH 1J17T 3QTOH 3UR9A 3FP8E 2JKHA 4AZ2B 5B6OA 2G8TA 2HRVA 1QB9A 1V2VT 2SGEE 1MAXA 2OC1A 1GCTC 1K1PA 4LOYH 4DVAU 2TIOA 4M9FA 1UVTH 1DWDH 1TPOA 1AVWA 1TPPA 1TGSZ 1KXEA 1YPHE 1TBQH 1AVXA 4MNXA 3SU4A 1XUFA 4BOHA 8GCHG 2FX6A 4O3TA 4NA8A 2J98A 5GCHG 2ZG0H 4DIIH 1MTUA 1TNIA 4HI3A 2J97A 3GYLB 2AMQA 4IGDA 5E0JA 3GY4A 1JWTA 1BMNH 1E38B 2H5CA 5EG4A 1A46H 1WOFA 3TU7H 1P9SA 2HVYB 4JYTA 1QTFA 4CRAA 1D6RA 1EX3A 2FODA 2BQ6B 2KCOA 5FX6A 3OX7U 4INHA 3DSOA 3EYDA 3AAUA 3P8GA 3BSQA 1YLDA 2RCEA 5E2OA 2HOBA 1AO5A 1FPHH 1AB9C 2BD3A 2QXJA 1SGNE 3F3BA 2Z94A 1OWHA 3MH7A 1EAWA 2A31A 2GV7A 1DS2E 1HAXB 3OY6U 3K2UA 1AFQC 2F9OA 1V2JT 3PO1C 1LHGH 2ZGCA 2GVFA 3GCOA 1BJVA 2O8WA 3W1EA 4YT6H 5C5OA 1WBGB 3EA9A 4NFFA 1TGBA 1O2QA 3SGAE 3GDUA 3EE7A 1SPJA 1W8BH 2AS9A 4ZCNA 2FP7B 4CBOA 4AFUA 2BZAA 3MO3A 1LQEA 1P11E 3SJKA 1QJ7B 1BZXE 4DG4A 1NN6A 3S9CA 3S7KB 3Q3YA 2CGAA 1AUJA 2GD4B 2P3FH 2ZCHP 1W7GH 4I32A 3M5LA 2ZF0H 2QV1A 1C5SA 2A7CA 1ELCA 1KXBA 4GPGA 3S9AA 2D8WA 2H2ZA 2EI6A 1FX0B 3PO1B 8ESTE 4WY3A 3GY8A 1P2IA 1JOUB 1HDTH 1C1TA 1PYTC 1G30B 2QXHA 5T6GA 2FESH 4X2XA 1C5QA 4JMYA 4MNWA 2ILNA 3RXHA 1O2IA 1GBEA 3K6ZA 2FTMA 2F43B 1E0FD 1SGCA 4FUDA 2Y5GA 1ETRH 1C2LA 4BXWA 2BDCA 5I25A 6CHAC 5JB8S 1O39A 1C5NH 1HPGA 1Y8TA 3ESTA 2ZHWH 3HGPA 3FANA 5A0BA 2GT8A 3QTVH 2FI5E 1QRWA 3QUMP 2XC4A 2R2MB 1LVYA 1V2WT 2PW8H 1A3EH 3O8RA 2V3OH 2QIQA 1YBWA 3R0FA 1J15A 3TITA 2EI8A 4MLFB 3K65B 1DXWA 4AOQA 1QBVH 1OPHB 4X1NU 1TPAE 1A61H 5JBCS 2XCNA 4ISLA 1EXFA 5EW1H 3RMLH 1NM6A 1CVWH 5FBEA 5FHTA 1T32A 1VGCC 1TOMH 3K6YA 1AGJA 1SGDE 3DUXH 4NWLA 3EGKH 2GX4A 2VBCA 3TK6A 1GI4A 3IWMA 3QGNB 1FV9A 1UTPA 4UFFH 1WU1A 3SNBA 1SGEE 1INCA 1EAUA 4K1EA 1YC0A 1F92A 2FXRA 2ZQ2A 2BX4A 2W3IA 3W95A 2JH6D 1Z71A 2QGRA 2B8OH 1IOEA 1GL1A 3ZVEA 7GCHG 1OSSA 1Y5UT 1HJAB 3F9HA 1TRYA 3V12A 3DCLA 3ZZDA 1ZPCA 1LHFH 1SLVB 4MTBA 3U28C 1BHXB 3P92A 4FVBA 1FY5A 1BUIA 3RXKA 4P02A 1NFUA 5KECA 1S6HA 4JYUH 1O33A 1IAUA 1ZPBA 1FLEE 2OBOA 3BG4B 3SUGA 1XM1A 1Y5AT 4AB8A 3RLYH 4IMZA 2ZHQH 2GMTC 1COWD 3GDSA 4J2YB 1VJ9U 4R0IA 1C1VH 4AG2A 3GOVB 4H42U 2D2DA 4ISOA 1CE5A 1GI1A 1YLCA 1GHAG 4BAQB 4I8HA 1AWFH 3LJJA 4JYVH 1HAOH 1SKYE 1WAYB 4R8TB 1V2TT 3SYJA 4AYYB 1TX7A 2ANMH 4ZKRU 1EASA 1P05A 1NTPA 3Q76A 3SHCH 3RU4T 1OWEA 1DM4B 1RRKA 3GY3A 1JMOH 3S7HB 1HFDA 5PTPA 1UVUH 2XNDD 4MNVA 1EB1H 1RIWB 1C5RA 1LKBA 3GY5A 3VGCB 5E8EH 4D9RA 1YLNA 4CRGA 2BZ6H 3LGYA 5CHBA 3U8OH 4BAMB 1GL0E 4Y0ZE 4B1TA 2GJGA 1CHOG 2R3UA 2A2XH 4NWKA 2F9PA 1GMHF 2SGAA 2ASUB 1GGDC 1QL7A 2KM0A 1UTKA 5E0GA 1C5ZB 1AIXH 2WV9A 1ABIH 1SGIB 1Z8RA 1YPKH 1BIOA 3V13A 4ZKSU 1F7ZA 1FPCH 1YPGH 3DA9B 5GIBA 1FONA 4K1TA 2VIOA 3O8DA 1ZJDA 2UWLA 2NU2E 3LPRA 1J16A 3BIUH 3A7XA 1SOTA 2FYRA 2AIPA 2PV9B 3P95A 3F68H 3TGIE 1LQDB 3CS7A 4B6FA 1W11U 3BTGE 3GDVA 3WY8A 4JK6A 2GKVE 1BRBE 1HBTH 3HGNA 1WQVH 2W3KA 2STAE 1OYTH 4YOIA 5LH8A 3HKJB 2BY6X 3ZIAD 1XX9A 2G81E 1DWBH 1MD7A 2IPHA 4Y8ZA 2BTCE 1UK4A 2Y7ZA 2TGAA 2XWBI 3HK6B 5E2PA 4AX9H 3SV8A 4KKDA 1DVAH 1T7CA 2ZCKP 4I7YH 1SOZA 1TALA 4LK4A 2ZDVH 1W2KH 1KXDA 1ELEE 4VGCB 1BTUA 1ZYOA 2UUKB 1EZUC 4Z6AH 2J95A 1IQMA 2WPJS 2P3TB 1BMMH 3NK8A 4ABAA 1TNHA 3Q3KA 1D3PB 1YKTA 1G3DA 3TVJB 5FBIA 2A0QB 3UY9A 1H1BA 2ZHEH 2VU8E 2J94A 3RC4A 1THSH 2ODQA 3UFAA 3W94A 1ANCA 2A2QH 4GSOA 2PUQH 3KNXA 3MI4A 1FY8E 3OTPA 4GAWA 3QGJA 5A8YA 1KYNA 1GVZA 3MNXA 2SGFE 1HNEE 3WWBA 1F5LA 1C1OA 4WH6A 1EPTB 1OWJA 3BTHE 4XBBA 1HB0B 1MKWK 4BAOB 4WH8A 1XKBC 1GDNA 4X2YA 3MU5A
chains in the Genus database with same CATH topology
4ASHA 3KGPA 1N8OC 4O03A 2Q1JA 2PKAA 3RXUA 1NT1A 1O3HA 3QX5H 3E90B 4A7IB 3M5OA 1EPTA 3OYPA 3IITA 2R0KA 1L0ZA 3ZZ9A 1CA0B 1C4U2 5EODA 1MAYA 1N6YA 1MH0A 3B9FH 1B7XB 3NZIA 5BRRE 5BPEA 2ZDMA 4FUFA 1K28D 4NG9H 1LMWB 2ZDAH 3GY2A 4UFDH 1SHHB 3ENSB 1O31A 1ZSJA 2Z3DA 2A5IA 1O38A 2BD7A 2DE9A 4ABFA 3TNTA 1XVOA 3RU4E 3RXLA 4KP0A 1ANBA 3MH4A 1DOJA 1SI5H 4HGCA 1NRRH 2J9NA 3STIA 1QB6A 1SVPA 1XXFA 4JZ1A 3RXPA 1RS0A 5TJXA 5F6MA 2TRMA 1DWEH 2HLCA 1ZMLA 4E7NA 3P70B 2VVCA 1SGRE 2WV5A 4NGAH 3SU0A 1CU1A 2ULLA 1ZHMA 1TA2A 3RXFA 3TJNA 1HAYB 5L6NH 4GHTA 1MTSA 2ZHDA 2ZO3H 2EA3A 5JDUB 2Q6DA 5J4QA 1NROH 1MZAA 2GV6A 1HJ8A 1V3XA 1GBMA 2VH6A 2P16A 2ZCLP 3E8LA 5DGJA 2IN2A 3SQHE 3PMBB 1CBWB 3PMAB 1SQAA 3SHAH 3SV7A 4CHAC 2OQ5A 2BD9A 3GISB 2B7DH 3BTKE 2VVUA 1ZOMA 1A2CH 2AMPA 4Q7XA 3NWUA 5K7RA 1O30A 2OTVA 1AY6H 6GCHF 3RXGA 4K8YA 3ZZAA 1C2IA 4A1XA 4AGJA 1T8MA 3M36A 1O5CB 1WSSH 5H4IB 5ABWA 2VGCB 2GZ9A 1HAIH 2WPLS 3F9FA 5AVDA 3T27A 4I8GA 1HAPH 3BTDE 4DW2U 1W12U 1X7AC 2EI7A 1ORFA 3PLBA 4ZKOU 1IQEA 3GCHC 3R3GB 1YCPM 1H9LB 1UTMA 2WYGA 4BANB 2ZC9H 1SFIA 4K69A 1S81A 2O9QA 4TPIZ 1DICA 1UVSH 4Y76A 3LT3A 3I78A 1OYQA 2BXTH 1BRCE 4CBNA 2ZA5A 1O5FH 4XSKU 4ZXYH 1MTVA 5DP3A 1GHBG 2BDYA 4I8KA 5FPYA 1H9HE 1C1WH 3NPSA 3ZZ8A 1P0SH 1WQSA 5GJ4B 1PPZA 1TABE 4X1PU 2H9HA 2ZFSA 2PTNA 2GCHG 4ZKNU 3RXRA 1ZGVA 2FWWA 1O3DA 3TIUA 1UTLM 2AERH 5TCCA 1SGTA 3SNDA 2VINA 1ZMJA 2VIQA 1EUFA 3VB6A 4NA9H 3S0NA 1XMNB 1O2TA 1P2QA 3PLPA 1P12E 3UNQA 1S84A 2FLRH 1O5EH 1YYY1 4JZIA 3V0XA 1O5DH 2G4TA 3BTWE 1LHCH 1BA8B 3A81A 1D3DB 1UCYK 5DP5A 3E91A 1UCYH 1LPKB 2SGPE 3UR6A 4D9QA 2PSXA 3C1KA 2FYQA 1TRNA 3MNSA 1MD8A 1QR3E 1GDQA 2ALVA 1ESAA 2GP9B 2Z9JA 4YO9A 2QAAA 2XCFA 3SU3A 1MQ6A 3E0NB 5L2ZH 1FI8A 1F5RA 1GMDF 1VITG 5DP6A 3RM2H 3P17H 2BOKA 1AZZA 4HZHA 1KDQA 1BBRH 2P8OC 2Z9LA 1O3AA 3GICB 1GWAA 1UK2A 2F9UA 3SV6A 1V2UT 2XC5A 1EZXC 3ZZCA 6LPRA 4NZQA 2BDAA 2LNCA 1BJUA 1FXYA 2ALPA 5I46H 3RC6A 1Z1IA 2AH4X 2QF3A 5C2ZA 3OSYA 2ZU2A 3QWCH 4D76A 1GI5A 4UFGH 3SORA 1YM0A 3UWJH 2ZQ1A 1ELTA 1OOKB 2GCTB 2KAIA 1EP5A 1C4V2 1QRXA 2O8UA 2XBXA 3KHVA 3PMHB 4X6MA 4BTIB 2BY9X 1Q31A 2VIPA 2THFB 1NU9A 5ESBA 1QCPA 3RXSA 1KLIH 2BB4A 1N1LA 1WYKA 2B0FA 5LGOA 1SBWA 2GT7A 3VB4A 1ARCA 1W0ZU 1B5GH 4GHQA 2GGVB 3MU8A 4CRDA 3OTJE 4X8SH 2O8MA 1SGQE 1YP9A 2BDHA 1GMCG 3Q00A 1Y5BT 3GY7A 2A7HA 5AFZH 3KN2A 4FXGH 1DWCH 3Q77A 1TFXA 5EXNA 4X1RU 1KLJH 2A5KA 1RTLA 1YPMH 2QY0B 2ZPQA 3RDZA 2J92A 5GWZA 1C5TA 1FAKH 4D8NA 1GCTB 2FOHA 4INLA 4GUXA 3BTFE 1V6DA 1XUGA 1F0RA 1MQ5A 1WCZA 1PPBH 1MCVA 1DLKB 1O2HA 2P59A 5T6DA 4ABGA 1GDUA 2NU1E 1S85A 4X6OA 4DY7B 1FUJA 5A0CA 4AGKA 2G00A 5T6FA 1SC8U 1PJPA 3ZZ5A 3FP7E 1P8VC 2BD2A 1YF4A 2J34A 2CJIA 2ZECA 1O2LA 1C2KA 2ZU5A 1QJ1B 1SR5C 2PFEA 1A3BH 4E06H 3MNBA 3A8AA 1O0DH 4B2CA 5C3NA 1HIAB 4BNRA 3RXIA 5DK1A 2VVVA 4ABIA 3A88A 4XBDA 1CO7E 4IN1A 3S69A 4B71A 1C5LH 1NESE 1AB9B 3F6UH 3BEUA 1BMAA 4K2YA 3SI3H 4FUGA 4U32A 1AKSB 3BG8A 5HYOA 1TPSA 3GCNA 4WWYA 1AFQB 1ZRBA 1C2FA 1DXPA 4INKA 1TYNA 2ZGHA 1FN8A 1TX8A 2OQUA 2P94A 1DUAA 1C5MD 4K1SA 1DT2A 1Y3WA 4IBLH 3EA7A 2ZGJA 1NZQH 8GCHF 2BD8A 2G5NA 1BTWA 4GLYA 5GCHF 5EPYA 3RMMH 4UONA 1UTJA 2BD5A 1Z8IB 1T4UH 5G4BA 2PGQB 2ZEBA 1AZ8A 2FOMB 5C1UA 1TRMA 3KQCA 3D49H 3T2NA 1C2MA 1P02A 1EZSC 4ABBA 2P3UB 1ZHPA 3AW1A 1T4VH 2GDDA 4Y71A 4NSYA 3T62A 3VXEH 4AFQA 1CHGA 1FZZA 1O2JA 2BX3A 5EPNA 5C5NA 1NPMA 2A45B 3PYHA 1PFXC 1HCGA 4ZHMU 1TMTH 2CHAC 3HKIB 2PWXA 1PPFE 1LVMA 1EOJA 4Q7YA 2Y7XA 3SZNA 1ELGA 1ELAA 5DO4H 1C1SA 4DURA 2G55A 2FX4A 2FI3E 2CF8H 6CHAB 4X2VA 1C2HA 1O2SA 2HVXA 1FY3A 2W7UA 1AUTC 3M3TA 2ODYB 2XC0A 1MBMA 1YPJH 1GBTA 1QJ6B 1P9UA 1QL9A 1BRAA 1O3KA 1LPZB 1A4WH 5GPIB 1LKAA 3QZRA 1F0SA 5CHAC 4SGAE 1IQJA 1DUEA 1FDPA 2A4GA 3LGIA 3RMNH 2XXLA 2UUYA 4IMQA 4RN6A 1TGNA 4U30A 1QL8A 1O2YA 1QQUA 1ELDE 1VGCB 2BY8X 1QBNA 4Y79A 1UTQA 5GDSH 3F1SB 5DPAA 1GBFA 4ISNA 2A5AA 4A92A 1UHBB 1E37B 6ESTA 2FIRH 2VJ1A 2GTBA 3A85A 3QO6A 4OS1A 1F5KU 2ZTYA 3F9EA 2M5TA 1K1IA 3GCTG 1H8DH 2AGGX 2LPRA 1TMBH 4IS5A 1DSUA 5JBBS 2Z9IA 4FVDA 5L30H 1ZLRA 4O9VA 1GBCA 1V2RT 2V0BA 3BTEE 1O3EA 4HFPB 1O3PB 2HNTF 3SU1A 3ZZ7A 3KF2A 3LGWA 1JXPA 2UWOA 1GI7B 2QA9E 4AFSA 3SUDA 1GI3A 3EA8A 1C9PA 3QZQA 2GMTB 3ZV9A 2XTTB 9LPRA 3BEIB 5DP8A 2G4UA 2C8YB 3SOSA 3LGUA 1O2GH 2BMGB 2AYWA 3LONA 4U01A 1ANEA 1O2WA 1BTHH 4TYDA 4FU8A 2R0LA 1C4Y2 5HGGA 2SGDE 1O3IA 1A5IA 1AVGH 1ARBA 1CGIE 3A83A 1P03A 3A7YA 3A8CA 1BT7A 1YGCH 5ESTE 4UD9H 7GCHF 2WUBA 2ZKSA 3MH5A 1L1JA 5SGAE 1L4DA 2C8ZB 3IG6B 1PPEE 2C3SA 5DG6A 3RU4D 1VJAU 2WPIS 1V2QT 2J2UA 1J8AA 2C8WB 1GCDA 1BTYA 2H9EH 3I77A 3OU0A 1CT4E 4QT8C 2G52A 4F49A 1PPCE 1L1GA 2SNWA 4ZHAA 2P95A 5AFYH 1C1PA 1GJCB 4ZAEA 4MVNA 4YLQH 4HTCH 1FIZA 3SV9A 4Z0KA 1GGDB 1GPZA 1V2MT 1W3CA 3KIDU 3LOXA 1GHAF 4BAHB 3UNRA 4NIVA 4A1TA 2I6QA 2R2WU 1G3CA 1QY6A 2F9NA 4IN2A 1HJ9A 2YNBA 1L1NA 1GBJA 3SJIA 1O2KA 1PPGE 2BDGA 2AGEX 3ZVAA 4KELA 3U98H 3TLOA 3TGKE 3KQDA 4AORA 4GCHG 1ESTA 4GVUA 3ZZ6A 1GI9B 1OP0A 4YOGA 1P09A 3SV2H 2F3CE 1OXGA 1WTGH 4X0WU 3TH2H 1IQHA 3N7OA 3VEQB 2TGDA 1YPEH 3KQEA 1O2OA 3TH4H 2OD3B 1CT2E 2F91A 2ZGBH 3HATH 1CHOF 5FXLA 1CGHA 3ZVBA 1K21H 2HPPH 2VWLA 1MKWH 4BTUB 4CRBA 1K1OA 1P2NA 4TWYA 1P2JA 2AEIH 1WUNH 2V3HH 1DY9A 1KY9A 3URDA 3FAOA 4SGBE 1AE5A 1Q2WA 1F2SE 3RXEA 5ETXA 4H6TA 1QA0A 4OGYA 1QGFA 5EW2H 3SNCA 4XBCA 4X6PA 3M5MA 1GHVH 4X1SU 2HNTC 4I8LA 4MPUA 5JYIA 1P3EA 2CV3A 4AN7A 4BTTB 1N8OB 1LPGB 1C1UH 1JBUH 2GZ8A 4UFEH 1MTWA 1XUIA 3RXOA 1O5BB 2O8TA 2XYAA 4Y7AA 2HPQH 2BM2A 1TB6H 1O5GH 1O36A 2OC8A 2NU0E 2A7JA 1OWIA 4JZDH 3ZVDA 3D62A 4THNH 3SU5A 3NKKA 1TQ7B 1TAWA 5JPMH 4OS5A 1A0HB 1CA8B 4UE7H 1Y3XA 1GJ6A 3M3VA 1J9CH 1DSTA 1GBIA 3AVZA 4MQAA 4Y11E 3TK9A 3PB1E 5DP7A 3RM0H 1NRSH 5DJ7A 2ZU4A 3ATLA 4MPWA 3FVFB 5AHGH 1NFWA 3SJOA 3TK5A 1XUKA 2ZPRA 3BF6H 1VCQA 1FJSA 2CMYA 1GJ8B 1P3CA 1S5SA 4FUCA 2YOLA 4KTSA 4WMEA 1GVKB 3RXDA 2QCYA 1QA7A 1G9IE 2F9BH 1EJAA 1MU8B 2BHGA 4B73A 1V2LT 3EE0B 3T25A 4NFEA 1PQ8A 1Y59T 1ZSLA 2FZZA 3ATKA 4NIWA 3UREA 2VIWA 2W26A 4NA7A 3ATIA 2F9VA 3JZ2B 1A5GH 3CS0A 3MYWA 3H5CB 1H4WA 1RTFB 4U2WA 1PQ7A 5HM2A 5IYTA 1SMFE 1SL3A 2PGBB 1GBBA 1GBAA 3PLKA 2BOHB 5HXFA 4CH8B 2UUFB 3P6ZB 3NCLA 1RGQA 4ISHH 2ZFFH 2ZPSA 4BAKB 1O2ZA 1OP8A 1V2NT 3A84A 5FAHA 1UO6A 3DD2H 3QLPH 4CH2B 5FCRA 3AASA 4CHAB 1MKXK 2H9TH 2Y6TA 1GG6C 1IHTH 2ZGXH 3GYMA 2BQWB 1ZHRA 1D3TB 4A1VA 3ATWA 4M7GA 4BXSA 1TX6A 2Z7FE 4RKOB 5F8TA 5K0HA 1IQFA 4JZFH 1G36A 1UK3A 2HALA 3UQOA 3RUOA 2PHBA 2C8XB 2FOAA 3BTME 1Y3YA 2XBYA 3DFLA 1S6FA 3A7WA 1IQLA 4TY7A 1P06A 3H7OA 1XKAC 1LDTT 4CRFA 4YESB 4FUIA 3GCHB 4K60A 1TLDA 1GBLA 4MPVA 3U8RH 4AYVB 3TJUA 3E6PH 4Y0YE 1JRTA 2OCVB 1QBOA 4Q2KA 4X1QU 4NIXA 3P8FA 1Z6EA 1MTNC 1GJAB 1DY8A 1C2EA 1K22H 1NFYA 4NCYA 2XBWA 1EKBB 1HAGE 4IW4E 2JETC 2QN5T 4CR5A 2Q6FA 2YNAA 1GHWH 4ZHLU 3B8JA 1RTKA 1O3JA 3MTYA 1EB2A 4YT7H 1D6WA 3UWIA 4I33A 7KMEH 1LVOA 2BLOA 2BY7X 1T8LA 2Z9GA 3ZVFA 2JH5D 2Z6BD 5C67A 4E05H 3SUFA 4XDEA 3SO3A 5JB9S 2A4RA 1GJ7B 2XNIA 5HMAA 2ZFTA 1SSXA 1HAHH 3MO6A 3ZYEA 3SBKA 2FMJA 3RXAA 4Y8XA 1CSOE 4DJZB 3OY5U 3UOPA 2A32A 1THPB 3MU4A 1ELFA 1MUEB 3TNSA 1S0RA 3BTTE 3T5FH 1KTSB 1E36B 1S0QA 4KTCA 3SU6A 1SGPE 1MCTA 1O37A 2ZZUH 1KTTB 1SLUB 1G3BA 1WTHD 4B2AA 1HAVB 2D1JA 4WMFA 2ESTE 3PTBA 3MO9A 1GHBF 1M9UA 3RC5A 3SQEE 3QDZB 3ZVGA 4FUHA 2K1QA 3LDXH 1ESBA 1SFQB 1Z8JB 2GCHF 1EOLA 2RDLA 2OC0A 3KEEA 3LH1A 2P8OB 1BHXF 1EZQA 1VITH 3VB5A 1SQTA 2VH0A 1QB1A 2BVSH 4ABEA 3A80A 1F0UA 1GJ5H 1O2RA 1ZTKA 3A89A 1PPHE 1Y3UA 4WMDA 4Q80A 3U8TH 1TBRH 1ZR0A 1QQ4A 4J1YA 4JK5A 1P10A 2FO9A 4PROA 3KCGH 1O2PA 1C2DA 3BIVH 1TWXB 3P8OA 1GBDA 1G37A 3PROA 3RXQA 1SLWB 3L6PA 1AMHA 2Y82A 4X8UH 3VB7A 1GBHA 1HV7A 1YPHC 3BV9B 3TGJE 2Y5FA 3H7TA 3LGTA 2VNTA 2BY5X 1VITF 3ZZBA 3ATMA 1S83A 4DCDA 2ZWLH 1TOCB 1S82A 4CREA 4YZUA 3A86A 4Y8YA 3GY6A 1TBZH 3MU1A 3RXCA 1ZMNA 1ZPZA 1C5OH 1NRPH 1ZTJA 1O3LA 3MFJA 3UTUH 1VCWA 2FI4E 1UMAH 5EXMA 2VIDA 3SJ9A 3UPEA 3G01A 1THRH 2A4QA 2BD4A 5FCKA 1NFXA 4UEHH 3SN8A 1HIAA 3Q3XA 3U1JB 4ABDA 4OS4A 1NRQH 5A09