1SLWB

Rat anionic n143h, e151h trypsin complexed to a86h ecotin; nickel-bound
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
223
structure length
215
Chain Sequence
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKVATIALPSSCAPAGTQCLISGWGHTLNHPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECOTIN
publication title X-ray structures of a designed binding site in trypsin show metal-dependent geometry.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Complex (serine protease/inhibitor)
total genus 51
structure length 215
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1996-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1slwB01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1slwB02
3FZZA 1ORFA 5GXPA 3P8FA 3SGBE 1ARCA 2Z9JA 1HCGA 1O3IA 1W13U 3RMLH 1M9UA 1V2NT 2VIPA 4LZ1H 4DIHH 2GT8A 1A1RA 1TBQH 4Y10E 1WTHD 1P06A 1TNJA 1WU1A 1MH0A 1GVLA 4Q7ZA 1D3DB 1CA0C 3M3SA 1SBWA 4BANB 2PKSC 2ILNA 2BD5A 5AFYH 4OGYA 3LJJA 1DWEH 3BG8A 3A7VA 1F0UA 2AMPA 2AS9A 1GBMA 3M5OA 3RXVA 1HUTH 3ATLA 5T6DA 1S82A 3GCTG 1GBLA 1PJPA 1DS2E 3DHKH 1QQUA 2PUQH 1CE5A 3KIDU 4UD9H 3IWMA 1FY1A 2Z6BD 1RGQA 4YESB 4WWYA 4MTBA 1P2KA 3SU1A 1J16A 2P59A 1IQGA 2ZTZA 3SNEA 3RXBA 1GI2A 1DWDH 4B1TA 3NUMA 1BMAA 3BG4B 1YYY1 2GV6A 2J95A 4B71A 1C4U2 3ZVAA 2XBXA 2NU0E 5T6FA 1TPPA 1O5CB 2V6NA 3KQDA 3SNCA 1EB1H 1K21H 1ELEE 3P8OA 4OS1A 1HPGA 1THRH 5GJ4B 2QXJA 2EEKA 1IQNA 1HNEE 1P02A 4XDEA 3BSQA 1KXBA 2VVCA 1GMDF 1IHTH 1W11U 4CRGA 2IOTA 5EXMA 3SO3A 4UDWH 2BLOA 5DPAA 1Y59T 2GX4A 3BEIB 3K9XB 1IQFA 2VVUA 3L3TA 2J92A 1EASA 5JBCS 2PGQB 1WOFA 3ATMA 3E3TA 2EI7A 4CR9A 2FOAA 3GYLB 4F4OC 2ASUB 1QQ4A 5JPMH 2CGAA 1QA7A 3M36A 4DGJA 1DICA 2ZDKA 1KXCA 3UNSA 1BTYA 1QJ1B 1ZPBA 2FMJA 1GJ9B 1J17T 1LPZB 4MLFB 3SNBA 2JH5D 1P8VC 4X8UH 3M61U 3UOUA 3MNSA 1UK4A 1DLKB 1WQSA 1E0FD 1OP2A 2ZDVH 3SQHE 1F92A 1CVWH 3TNSA 1HAHH 1MTUA 1YLDA 8GCHF 1SGCA 2BB4A 4YOJA 2V3OH 1W8BH 1RTLA 4X1SU 3MNXA 1AUTC 3ZVDA 2Q6FA 1CA0B 4GSOA 1V2VT 2Z9LA 1ZR0A 2ZDNA 1DSTA 2OINA 2RDLA 1GBBA 2FWWA 2D1JA 4SGAE 3EA8A 2HPQH 1P2JA 1BHXF 1TQ0B 4X1NU 1ANDA 1V2ST 3RXSA 6CHAC 5J4QA 2CMYA 1H8IH 1C9PA 2Y5GA 4ABHA 1IOEA 5FPSA 5FX5A 5FCKA 3QX5H 1JRSA 2VNTA 1A0LA 1L1GA 4A1TA 1F5RA 4YZUA 3NCLA 1GBCA 4UE7H 3PYHA 3VB7A 3ZZ7A 1MAXA 3UREA 1UTLM 1O2NA 3RMNH 1OWJA 4Y6DA 1NY22 1DWBH 1MMJN 1ZSKA 1QBVH 1THSH 3P70B 3VGCC 3UUZA 5CMXH 4CREA 1MTVA 1EJNA 1KDQB 1AE8H 1WTGH 2TBSA 1FIZA 3KN2A 3OYPA 2V0BA 4ZHMU 3ITIA 3MMGA 4ABFA 1KTTB 1PQ8A 2YNAA 1GI8B 3ZZAA 1TOCB 1TBZH 4X6MA 3NKKA 2C8XB 2ZGCA 4BAKB 2QA9E 3SV8A 3UR6A 2THFB 3Q3YA 2P16A 1YPHC 1PPFE 4WMDA 4DURA 1V2UT 3C1KA 2W5EA 4WXIA 2UUJB 1O5DH 1LMWB 1LPKB 1BRCE 3PLBA 3SGQE 3OSYA 1SGTA 1AZ8A 2PKAB 1P2OA 1UVUH 2GMTC 3E8LA 1JWTA 1UTMA 2ZGJA 4FU8A 5DP9A 4XE4A 3QZQA 1O2SA 5B6OA 1P04A 1C2LA 1W7GH 4AGKA 3A88A 3M37A 1AZZA 5HYOA 2G5VA 1O3PB 3SORA 3A85A 3SJ9A 4E05H 1L0ZA 1MCTA 2BDBA 2HVXA 4AZ2B 4ABEA 3ENSB 3DT0H 2XCFA 1Y5BT 1P0SH 3SJ8A 2BDCA 3GCTF 3BTTE 2PW8H 3GY3A 4NSVA 3S0NA 1DY8A 2ALPA 3F9EA 3UY9A 2F9VA 2ZQ1A 3RXLA 1YP9A 1UVTH 2DE9A 1AY6H 1FN6A 2XC0A 3URDA 1MKWK 3PTNA 1Z71A 1BTHH 1IHSH 1SLXB 2RG3A 3AASA 3E90B 5DGJA 5SGAE 3ZYEA 3GY4A 2BHGA 5EOKA 1GCDA 5HMAA 1GWAA 3ODDA 1IQKA 3PLPA 3BTKE 2FYRA 1B0EA 3ZZ8A 1SGFG 3VGCB 1HAYB 1G2LA 1CGHA 1CA8B 1LPGB 1HAVB 4MPXA 3QUMP 3TK5A 2OXSA 3STJA 1UJ1A 1TWXB 5TCAA 1C4V2 1QR3E 1ZHPA 2ZCLP 4CH8B 1G3EA 2HNTE 1XVOA 1RTKA 4AYYB 4A1XA 5L2YH 1O2GH 2WPIS 1K2I1 2ZWLH 5A0CA 1O30A 1H9LB 1NTPA 3O8BA 4I32A 1PYTC 3GISB 3BTDE 2GD4B 1SGEE 1KDQA 3RC4A 3U8RH 4I31A 1EZSC 2Y5FA 4BXSA 1XUKA 2ZC9H 1CQQA 2ALVA 3KF2A 1DY9A 4RKJB 8KME2 2Q1JA 4GAWA 1N8OC 1YLCA 2G51A 1O2TA 2IJOB 1JMOH 1GBFA 3A8DA 5A0BA 5A09A 3QO6A 2FTMA 1C5OH 2C93B 2XWBI 1AMHA 4WH6A 1RIWC 3SV2H 5L30H 1TX7A 4AB9A 1UHBB 3UTUH 4Y71A 1KLJH 2R2WU 5DKMA 2ZCHP 3HATH 2BQ6B 1HJ8A 1Y5UT 4XBBA 1KLTA 3U8OH 3MU1A 1MTNC 1KIGH 3SU4A 2PKAA 1JXPA 1LO6A 2CJIA 1BQYA 1LHCH 3MYWA 3TGJE 1V2KT 1Z7KA 1S83A 5AVDA 1NC6A 1SC8U 1T7CA 2PR3A 1YPGH 2VGCB 4ZH8A 1MBQA 1C5VA 1XX9A 3FP7E 3STIA 2FS9A 1D6RA 2TGPZ 2NWNA 2XTTB 4I8JA 3M5NA 2UWLA 4TY6A 2P3TB 1O3LA 1O32A 4X8SH 2QXHA 1QGFA 1ID5H 1O38A 1LVOA 5GDSH 2BZ6H 4E7RG 2BXUH 2ZPRA 1GI6A 4D76A 3EQ0H 3RUOA 1PPBH 2GKVE 4BXWA 1KYNA 2M5TA 3S7KB 2A7JA 1TNLA 1WQVH 2OD3B 2CV3A 1EOJA 1J14A 2GZ7A 1P57B 2FOHA 3SJOA 1CU1A 3G01A 3IG6B 3SUFA 4X0WU 1H8DH 4INKA 4TYDA 1F2SE 1XM1A 4GHQA 4I8HA 3M35A 4ZXXH 4ZUHA 3GY2A 1PPHE 2Z94A 3KHVA 3OU0A 3GCNA 3BTHE 1OWDA 2A45B 1O3BA 2HALA 2OBOA 2D2DA 4UFEH 7ESTE 2FI5E 2XRCA 3SUEA 3RU4E 3SOSA 5JBAS 1FZZA 3BTQE 5J4SA 4X2VA 1C5UA 4RKOB 1HAVA 1Z8JB 4U01A 1DDJA 1BTXA 2ZG0H 1LVBA 1K1IA 2Y7XA 1C5SA 1MD7A 3A80A 4INLA 4ISHH 4H4FA 4JYTA 1C1UH 5DP8A 2ANWA 4GLYA 1YPLH 2ZTYA 2ZHQH 1UK3A 3V13A 2W3IA 1RRKA 5ETXA 1HRTH 2ZTXA 1N8OB 1IQMA 2P94A 1TPAE 1A7SA 3FP8E 1YC0A 1GJ4H 1JBUH 4UEHH 1IQHA 4JZ1A 4E7NA 3F68H 5I25A 5FHTA 3BV9B 1C5XB 3ZZCA 1RIWB 2A2XH 2CN0H 3E16B 4B2CA 4A92A 2ANMH 2PUXB 1DWCH 1MBMA 1O2OA 3ZVGA 1O3DA 3UPEA 3PV4A 2ZO3H 1EJAA 1XMNB 2OTVA 2FOBA 1OSSA 2FOCA 1K22H 1RD3B 4ASHA 2OQ5A 1GCTC 1HBTH 1MZDA 3MO6A 1UHBA 2GGVB 1RTFB 4NA8A 1SFIA 1TAWA 4JYVH 1OX1A 3LOXA 3VB6A 4KP0A 4Y0ZE 3MO9A 3O8CA 1XUGA 1W0YH 1ZRKA 2ZFSA 2QXIA 1ZJKA 2OUAA 2WPHS 1C5LH 3JZ2B 1UTNA 2FI3E 1AHTH 5AHGH 1BDAA 1GG6C 2OC7A 3C27B 2C3SA 3VB5A 3SUGA 2G5NA 1V2WT 2A7CA 2ZDAH 1C2HA 2FXRA 1F5LA 3LKWA 3RU4D 3HK3B 1QHRB 4FUBA 4K1EA 3LGYA 1MQ5A 4FVDA 4UFGH 3F6UH 2ZZUH 2ZFTA 3ODFA 1ELFA 1KLIH 3SNAA 2XBYA 1CGJE 1N1LA 2V3HH 2BX4A 1IQIA 1NU7B 7GCHG 2GDEH 3V3MA 1TGBA 2SGDE 1Y8TA 1SG8B 2F3CE 2VIOA 1OWIA 2XW9A 2PTNA 1LVMA 1O2KA 1NRRH 1FUJA 1EUFA 1QJ6B 1EJMA 1VGCC 4JZIA 1INCA 3U69H 3E0PB 1FIWA 2VIVA 1EZUC 1Y3UA 4NIXA 3H5CB 1T8LA 1P03A 1O3GA 2Q6DA 3ZZ3A 2WINI 3P8GA 4CRBA 1LKBA 2SGEE 1G36A 2W26A 4NG9H 1MKWH 3RMOH 1SLVB 1A2CH 2DE8A 1NFYA 1DXWA 4Z0KA 2P8OB 1HAPH 4X6PA 3F1SB 3NPSA 1OXGA 4X2XA 1C2KA 1ANCA 4X2YA 4LK4A 1H9HE 2FLBH 2A1DB 3A82A 4DVAU 2ZKSA 4BTUB 1FJSA 3OY6U 2ZECA 4IS5A 2VJ1A 4FUDA 4ABJA 3FZDA 1PQAA 2BY9X 2ZU2A 1GCTB 1TFXA 9ESTA 1S5SA 1FMGA 1EAXA 1VCQA 1HJ9A 3A7XA 3FVFB 1P3EA 1TA6A 2QCYA 1TMTH 1O3CA 1QRWA 1TB6H 2SGQE 1C5PA 1NFXA 3GCHC 5JB9S 1Z8IB 1BBRK 3RLWH 1AB9C 2BY7X 3WY8A 3NXPA 1NU9A 5TJXA 1ZHMA 1ETRH 1A3EH 1BRUP 3SHAH 3GY8A 1J8AA 1GG6B 1P2QA 2B0FA 1BZXE 1C2FA 3A7YA 3A7TA 3ZZ5A 4ISIH 1AVGH 3GICB 3H7OA 1H1BA 3VB3A 4OS6A 1QNJA 5EXLA 1VITG 3EGKH 3K6YA 5FPTA 3SU5A 3BTWE 1HJAB 2PHBA 4KTUA 1S6FA 2NU1E 2PLXA 4VGCC 5DP5A 3TH4H 3BTME 2BDAA 3KEEA 4ABGA 1NO9H 8ESTE 2AIQA 3ZYDA 1VJAU 1DPOA 4A5TS 4X6NA 1ESTA 3RLYH 3TPIZ 3ZZ9A 1SLUB 1Q31A 1O37A 3HKJB 3E0NB 4MPVA 1HXEH 2FS8A 5JB8S 4YTAA 5EU8A 3GY6A 1VGCB 2P3UB 4K2YA 2UUYA 1TBRH 1OP0A 3PB1E 1GL1A 5T6GA 1QBOA 4OS4A 4GUXA 1O5BB 4KELA 3MH6A 3P92A 1B5GH 2WUBA 5EGMA 2P95A 1G9IE 3S9AA 1AFQC 1C9TA 1TPOA 4BTTB 5EG4A 4JZFH 1TALA 1MCVA 1C1WH 3A83A 1C1OA 1P3CA 1KXFA 1LQEA 1SHHB 2GV7A 3KL6A 2DUCA 4R8TB 1ETSH 1TGNA 1UVOA 2OP9A 1FPCH 3LGWA 4AX9H 2J38A 1ACBE 3GY5A 3GDUA 2ZI2H 1FY4A 1TE0A 1DOJA 3DD2H 2A5IA 2VWNA 1BJUA 1QBNA 2PFEA 4IMZA 1BBRE 1T4UH 2C8YB 5EQRA 4ZMAH 3TGIE 3TK6A 4X1QU 4XSKU 2WPMS 3U8TH 1YPJH 3RXGA 3FAOA 3RXIA 1OYTH 2Y7ZA 3SBKA 1Y3WA 1EATA 3S9CA 5EQSA 4MNYA 1SMFE 4K60A 2WPLS 1IQEA 1A5IA 5C5OA 3LU9B 1AGJA 2PKSB 2FOMB 4BNRA 5FBEA 1J9CH 4XFQA 2CHAC 3UNRA 4O9VA 4HGCA 2ZHDA 3RM2H 4TPYA 4ZXYH 1AB9B 2QV1A 1WUNH 3CS7A 5A8ZA 2A32A 1V2PT 1F0TA 3K65B 3SW2B 3RXHA 1BCUH 1MTSA 2FX4A 4X1PU 3B8JA 1O35A 1QFKH 1UO6A 5E0GA 1BMMH 5FXLA 2Z3DA 1TX6A 1SPJA 2AMQA 4X6OA 1ELAA 1ABJH 3SQEE 2CF9H 4AG2A 1ESAA 5HGGA 2VU8E 1LHDH 4VGCB 3UQVA 6GCHF 4GHTA 1C1RA 4FUCA 1VCWA 1QB1A 1GJ6A 4CH2B 3KCGH 2FZZA 3A89A 1C2EA 2PTCE 5E0JA 3M3VA 1FXYA 4O3UA 2XC4A 2B5TB 4M7GA 3TU7H 4D9QA 4NIYA 2YOLA 1BTZA 3MH4A 1V3XA 4BOHA 4AGJA 1XUFA 2BMGB 3AAVA 1Y3YA 1G2MA 5GPIB 5BPEA 1O2WA 1WV7H 2EC9H 2H5DA 3PMHB 1LTOA 1SGQE 3ZZDA 1AFQB 3RXJA 5JYIA 1V2QT 4NFFA 4MPUA 3T27A 1FLEE 1NESE 1V2MT 2GCHG 1T31A 1FN8A 2NU2E 4I33A 5E8EH 5FAHA 2B9LA 3RC6A 4AORA 1THPB 3RP2A 3BIUH 2R2MB 2P3FH 3SU3A 3EDXB 2O8WA 4Y8XA 4B2AA 1TGSZ 1GPZA 4ABIA 3LH1A 4X2WA 1ZTJA 2FYQA 2G4UA 1E37B 5K7RA 4ZHAA 2BDGA 2WYJA 3TITA 1ANBA 1MU8B 1EAUA 4Y8YA 4Y7BA 1P9SA 3BTFE 4JMYA 2G55A 4IW4E 1TABE 5JDUB 1PPZA 1G37A 1PPEE 2QYIA 1XKAC 3A7WA 3MOCA 2WV4A 1DUEA 1SGDE 1GJDB 3MH7A 4IGDA 3RXRA 2XCNA 1CT4E 1C5WB 3LC3A 1TYNA 1Y3VA 1UTJA 1UK2A 1Q3XA 4CBOA 3EE0B 6CHAB 2B7DH 1U6QA 2GZ8A 4A7IB 1YPMH 2BY5X 1DVAH 5C2ZA 3FFGA 1AI8H 1W7XH 3MTYA 1FY8E 2A5KA 5FPYA 1QB9A 2HLCA 5L6NH 3U1JB 3HKIB 1EPTC 3ZVFA 2RA3A 4YOIA 1K28D 2Y81A 5ESTE 2UWOA 1NFWA 1AWFH 5A8YA 4K5ZA 2Y80A 5DP7A 4CRDA 5C5NA 1P09A 2BD8A 4K1TA 1SFQB 2OC1A 2HGTH 3F9HA 3N7OA 3PO1C 1O3KA 3LGTA 4WF8A 5EW2H 3Q3KA 1DSUA 3LDXH 1GJ5H 5CE1A 1X7AC 1WYKA 4UFFH 4MVNA 2R0LA 3EAJA 3T62A 2V35A 3R0FA 2KAIB 2VH6A 1MUEB 1BMNH 2C8WB 4ZAEA 3MI4A 5EW1H 1GMCG 3U98H 1ZMLA 1TOMH 1Z8RA 1OP8A 1W14U 5EPNA 5C3NA 1RXPA 3P17H 4OS7A 1UTPA 4J2YB 2BQ7B 1XKBC 1PPGE 1BBRH 3MNBA 5H4IB 1J15A 1TGCA 1C5NH 1TRMA 2ZA5A 3QK1A 1T8OA 1O36A 1TGTA 1GJ7B 2O8MA 4JK6A 3LGUA 2BLVA 3L33A 1V2RT 1YPHE 3QGNB 2GMTB 2F9UA 1CT2E 3P95A 1LQDB 3AVZA 3HK6B 1SHYA 1GMHG 2ZPQA 3RXAA 2UUFB 4U30A 2GZ9A 5C1UA 3SHCH 2UWPA 2IN2A 1ZRBA 1SGFA 3MU0A 1OWHA 3M5MA 1CSOE 4YT6H 1D6WA 1UMAH 2BOHB 2ZFFH 1EAIA 1O2MA 4WXVA 1NPMA 1BRAA 1VJ9U 4FUFA 1L4ZA 2GCTC 1O2YA 2H1UA 1AVWA 1PQ7A 4LOYH 4I7YH 5GCHG 2BYAX 1TA2A 2H5CA 3A86A 1TQ7B 1DM4B 4IN1A 1Z1JA 2ZHWH 4H6SB 4ISNA 4LXBH 2ANKH 4PROA 4B2BA 4WJG2 1D3PB 3SU2A 2GT7A 2ZP0H 1MKXK 2J2UA 1SLWB 1EPTB 1T8NA 2B8OH 3TH3H 2Y6TA 4NWLA 2ZNKH 1PQ5A 2Z9KA 1IAUA 3RXFA 2SGPE 4Q80A 1O2IA 3MHWU 4MQAA 4X8VH 1QRXA 1O2LA 3O8DA 1F0RA 5C67A 2O9QA 5E2PA 4A1VA 1QURH 1HGTH 1O2QA 2SGFE 2EI6A 3GDVA 1DUAA 4NSYA 2PWXA 1L4DA 2BD7A 2ZHFH 3PMAB 4NIWA 2STBE 1T4VH 1TPSA 2BQWB 4OS2A 3U1IB 1TNGA 4B74A 4K8YA 2F9NA 1UVSH 1DLEA 2STAE 5DP4A 4AFSA 1MU6B 2HOBA 2A4OA 2WV5A 1LVYA 4NGAH 1O39A 1O3AA 4FU9A 3SU0A 1GBAA 2GCHF 1C1NA 2JH6D 1QA0A 4U32A 3QZRA 7LPRA 2KAIA 1O3HA 2WYGA 4H42U 2ZU5A 2LNCA 4U2WA 2BD3A 3BF6H 1BITA 1Y5AT 2TGAA 1FPHH 2FI4E 4RSPA 1H9IE 1K1NA 1LKAA 2BM2A 1JIMA 1W12U 3D49H 9LPRA 2FODA 1PFXC 2HRVA 3RXDA 1LHEH 1YCPK 3TJNA 1K1MA 1L1JA 1P2MA 4Y76A 2PSYA 2BX3A 1UTQA 1GBKA 1ZOMA 4O97A 1MTNB 3LH3A 2FP7B 1KTSB 4AB8A 3GYMA 4NFEA 3I29A 1AKSB 3Q77A 1P2NA 1HAGE 3GY7A 1ELDE 4Q7YA 3VB4A 4ZKNU 3W95A 3UWJH 3DUXH 1GHYH 3RXQA 2GCTB 3CS0A 5TCCA 5ABWA 1LDTT 3MWIU 1K1JA 1QL9A 4Y79A 5F8TA 1KY9A 4GVUA 1GVZA 2BD2A 5I46H 1S84A 1SQOA 4ISOA 2XBWA 2ZU4A 3T26A 3SUDA 1T32A 3EA9A 1OWEA 1XUJA 4HFPB 1ZJDA 1SR5C 3SGAE 3GDSA 3P8NA 4D7GA 1GHXH 1A0JA 1BA8B 1BB0B 1EX3A 3SNDA 1S85A 1EZXC 2I6QA 2Z9GA 3RXCA 1QIXB 3S9BA 3SV6A 1LCYA 1G32B 4ABAA 5A8XA 1HXFH 4JYUH 1ZSJA 1NT1A 4F49A 1O0DH 1OKXA 1NROH 2FOGA 1ZHRA 1EPTA 2TRMA 3SU6A 2BDIA 3NK8A 2D8WA 2AGGX 3S69A 2G81E 1PYTD 3Q00A 2F91A 2SNVA 1NN6A 2ZU3A 4YM9A 4XBDA 1GI7B 1UTKA 3ATKA 4NA9H 3ZV9A 2ODQA 3B9FH 4UONA 1Z6EA 1XXFA 1AD8H 1TNIA 2BXTH 3TJUA 3RXKA 1T8MA 2BTCE 2OLGA 1SVPA 3MU4A 1GI4A 1OS8A 1ABIH 3BEUA 1SSXA 2SNWA 3SN8A 4O03A 3VFEA 1A61H 2WUCA 3PM3A 5BRRE 3QWCH 4ZHLU 4FUEA 1O2PA 1YBWA 4IN2A 1A4WH 1VZQH 3PWCA 3SI4H 1SGYE 2VIDA 1BTUA 1GBIA 2XYAA 3D65E 2VVVA 2H2ZA 1BT7A 1QCPA 3ZZ4A 1ZZZA 2HPPH 1O3OA 2ZEBA 3QLPH 2XWAA 2Z9IA 3KQEA 1GBTA 1H4WA 2H9HA 4YOGA 1WAYB 1UCYH 1GL0E 1VR1H 3OX7U 5AF9H 4X8TH 3TVJB 5HXFA 1KXEA 2TGTA 3BEFB 3HPTB 1F0SA 4WMEA 3EA7A 1HDTH 1Z8GA 2FOEA 3OTJE 1AKSA 2CF8H 2J9NA 5AFZH 3MH5A 3I78A 2SFAA 5JBBS 2FO9A 4K69A 1HYLA 3ZVBA 1ESBA 1IQJA 4AN7A 3LONA 4BAQB 3ZVEA 1O31A 1YGCH 2G8TA 1CHGA 3PTBA 3P6ZB 4ZKOU 2ZGXH 1E35B 3PLKA 1QJ7B 1SL3A 5LH8A 2D26C 3SZNA 3ZZ6A 3QGJA 2VH0A 2BD9A 3TIUA 4Q2KA 1OPHB 4JZEH 1GHAG 1V2LT 2J4IA 3V12A 2QAAA 3LGIA 4KTSA 6LPRA 1GJCB 1ZPZA 5EQQA 1S0QA 3RXMA 2RA0A 3T28A 4IBLH 3S7HB 2AFQB 7KMEH 1D3TB 1NRSH 3A87A 1YPEH 5F03A 1GBJA 2ZGBH 3RXUA 2ZCKP 2XNIA 2AMDA 1QY6A 1HAZB 2BLQA 1QTFA 4WMFA 1O5FH 1TONA 1HV7A 1SGNE 1BMLA 1XVMA 1WBGB 3LJOA 3MFJA 3T2NA 1FDPA 1HB0B 1GHBG 1MKXH 3GOVB 1GHWH 1AO5A 3UWIA 3M3TA 1GBEA 4Y0YE 3RC5A 2W7SA 2NU3E 1P9UA 1Q2WA 2W3KA 4I8LA 1FAKH 2XBVA 1ELTA 1OWKA 1GJBB 1HLTH 2C4FH 3TJVA 4AYVB 1C5QA 1TX8A 4UFDH 5IYTA 2R3YA 1AIXH 4OGXA 2J34A 4KKDA 1MTWA 4ZKSU 4I8KA 1QRZA 3CP7A 4TY7A 2JETC 2QGRA 2AERH 1MQ6A 2H9TH 3GCHB 3R3GB 5F6MA 2ZIQH 1FV9A 4FUGA 4DOQA 5EODA 3AAUA 2BZAA 4K8BA 1NRQH 1O34A 3A8BA 3TK9A 2A5AA 1S81A 2F83A 1GI9B 2AGEX 4ABBA 7GCHF 2SGAA 3KQBA 1GGDC 3EYDA 1CO7E 1FQ3A 1C5MD 2G52A 1FY5A 2R9PA 1L2EA 2ZFPH 4GCHG 3MU8A 5GIBA 2VWMA 1YCPH 1NRNH 1P05A 2K1QA 2FESH 1YF4A 4WVPE 4DW2U 2LPRA 1C5ZB 4D7FA 2HNTC 1GJ8B 3SI3H 4D9RA 1S0RA 4J1YA 1BTWA 4WY3A 1ELBA 2VINA 2IPHA 1TRYA 3DFLA 1GDUA 3PMBB 1JOUB 4TPIZ 4GPGA 4O3TA 2BVSH 1HAOH 4THNH 1P10A 1OOKB 1VITH 3UR9A 2NU4E 3TH2H 3TNTA 2G00A 4DCDA 3RDZA 2FPZA 2GVFA 1NM6A 1O5EH 3NWUA 1K1OA 4Q7XA 4WH8A 1S6HA 2R3UA 4DY7B 1BTPA 4CRAA 2H9EH 4MNXA 3RU4T 1N6XA 1EOLA 2C8ZB 1GI3A 1W2KH 4BAMB 3L6PA 1JIRA 1CHOG 3A7ZA 2G4TA 2O8UA 1NS3A 3O8RA 3TJOA 2FDAA 3PMJA 3UFAA 2EA3A 2QN5T 1ZYOA 1K9OE 1MAYA 4QT8C 1AN1E 2GP9B 1ARBA 1TMBH 2BLWA 1TRNA 3ZVCA 5K0HA 2CXVA 2Z7FE 3KNXA 1Z1IA 1ZTLA 4D8NA 1A5GH 4MNWA 1AU8A 1CBWC 2QC2A 1O2HA 2TGDA 3E91A 5T3HA 1QL8A 1CT0E 1ETTH 1SI5H 1WCZA 1SGPE 2BY8X 4AFZA 1B7XB 1ZLRA 2YNBA 3RXTA 2JETB 1GHVH 2ZPSA 2QIQA 5E0HA 3RMMH 2CHAB 2F9BH 3B23B 2ZQ2A 1HIAB 5CHAC 4HI3A 2Z3CA 1VITF 3A8CA 2FLRH 1ZSLA 2WPKS 2ODPA 4INHA 2PSXA 1AVXA 3UQOA 2ZFRH 4KGAA 4BAHB 1GBHA 1AUJA 2BOKA 1FAXA 1KSNA 3MO3A 2VGCC 2Z3EA 1SOTA 5A2MH 4DIIH 1EP5A 3MU5A 3DFJA 1QL7A 3E6PH 1YPKH 3TLOA 1W10U 1GHAF 1GGDB 2ODYB 3LIWA 1K1LA 3M7TA 2BVRH 1O2XA 2Y5HA 2A7HA 3BIVH 4XOJA 2JH0D 3UIRA 4K3JA 2R0KA 4OS5A 1DFPA 3A84A 2GTBA 2ANYA 5FX6A 1FNIA 5FCRA 1UCYK 3GCOA 1P12E 3M5LA 8LPRA 5F8XA 1O33A 4Y11E 3SJKA 4E06H 1GDQA 1C2DA 2P93A 1O2JA 5ESBA 2OBQA 4MPWA 1AE5A 5DJ7A 3ATIA 1NZQH 4YT7H 1TLDA 1ELCA 4DT7B 1F7ZA 1GHBF 1DITH 4IC6A 1AQ7A 1HAXB 2OC8A 1ZPCA 1HFDA 1A3BH 1O3NA 1FY3A 2F9PA 3QTOH 3TGKE 4ISLA 1DE7H 1EP6A 1XXDA 1V2TT 3QTVH 6ESTA 3LPRA 3VPKA 2VWLA 1DXPA 1ZMNA 4IC5A 3HGNA 4RN6A 5HM9A 3AW1A 3D23A 1O3JA 1TIOA 4Y8ZA 4AFQA 1D3QB 5EPYA 3M7UA 3LGVA 2ESTE 2WPJS 2AH4X 1C1TA 1CBWB 2ULLA 3BN9A 1EB2A 2QY0B 3ESTA 3QN7A 3KQCA 4AOQA 2TPIZ 2J94A 2RCEA 2VIQA 1EKBB 2BY6X 1G3DA 3UNQA 1KXAA 4HTCH 3T5FH 3ZZBA 4NWKA 2O8TA 5JBTA 1ZMJA 5DG6A 2A4GA 1GI0A 2W7UA 1TMUH 1C5RA 5CHAB 1GDNA 3A8AA 4CRFA 1GI1A 2TIOA 1LHFH 1NFUA 1E38B 1A0HB 3SV7A 1BIOA 2BDHA 1V2JT 4DJZB 4GCHF 2BDYA 1GVKB 1B0FA 1UCYE 3E1XB 4LZ4B 5DP3A 3W94A 3SJIA 1RS0A 1ZTKA 1HIAA 4MDSA 2JKHA 5F8ZA 3RXOA 1EXFA 1G30B 1F5KU 1E34B 4MNVA 4ESTE 5GWZA 5E2OA 2FIRH 3NZIA 3PWBA 4Y7AA 3T29A 2PGBB 3D62A 3H7TA 3PO1B 3ATWA 4BAOB 3MNCA 4ZROA 3RXEA 4IMQA 1O3FA 2BVXH 4JCNA 4CHAC 2Q6GA 1O3MA 2A0QB 1ZGVA 1JRTA 2GDDA 1WSSH 1YCPM 2PV9B 1RFNA 1GHZA 3OY5U 5FBIA 4B75A 1HAIH 2O8LA 2OC0A 2ZDMA 1BJVA 3Q3XA 4B73A 1L1NA 3U9AH 4AG1A 2AYWA 1O2VA 5C20A 2ZFQH 3JZ1B 5LPFA 1Z6JH 4NZQA 4CRCA 1C2JA 4A6LA 3FP6E 3I77A 1BOQA 1CHOF 2FM2A 3DA9B 4FU7A 4AFUA 4BTIB 3SV9A 4SGBE 1O2UA 1BUIA 2A31A 3VXEH 1NRPH 4NZLA 1SQAA 3FANA 5IDKA 1YKTA 3ZV8A 1D9IA 4I8GA 2XXLA 4Z6AH 2AEIH 2HWLB 1KXDA 1DX5M 1DANH 3PROA 1BHXB 2VB0A 4ABDA 1DT2A 3AW0A 2UUKB 3T25A 2P8OC 4JK5A 2ZHEH 1ANEA 1GMDG 1LHGH 4FUHA 1SGRE 1W3CA 2VWOA 4B76A 4FVBA 3CENA 1FI8A 1SGIB 2ZDLA 5A0AE 5DK1A 1C4Y2 2AIPA 2ZF0H 1IQLA 3QDZB 4KTCA 4HZHA 5L2ZH 2FX6A 1EZQA 1C1QA 3URCA 2AGIX 4TWWA 5DO4H 4FUIA 2XC5A 1C5YB 1SB1H 2Y82A 1GI5A 2FTLE 1VCPA 4ZKRU 1V6DA 4FXGH 4XBCA 1EAWA 2VIWA 1E36B 1P11E 1GBDA 4H6TA 2QF3A 1O5AB 2BD4A 2OQUA 1C1MA 5LPEA 2F9OA 1BRBE 3F9FA 1O2ZA 1Y3XA 2FEQH 5HM2A 3V0XA 8GCHG 5C1YA 1A5HA 3K2UA 1A46H 1C2IA 3HGPA 1C5TA 3LT3A 1MZAA 1O3EA 4K1SA 1QB6A 3LC5A 2A2QH 1GMCF 1O2RA 1SOZA 4CHAB 5LPRA 1PPCE 1AFEH 1O5GH 1C1SA 2ZGHA 3A81A 1UTOA 5G4BA 1V2OT 3V7TA 2A4QA 1OYQA 1RJXB 5DP6A 1C2GA 4NIVA 4YLQH 4YLUA 1HJAC 2A4RA 2I6SA 3RXPA 3BG4C 1AWHB 1ELGA 4X1RU 4DG4A 1FONA 3K6ZA 3VXFH 1K1PA 2C90B 1GMHF 2FOFA 5PTPA 3M7QA 2ZU1A 1EQ9A 6GCHG 4NA7A 3Q76A 4R0IA 1UVPA 1SQTA 4YO9A 3VEQB 1MD8A 5C1XA 1P01A 3RM0H 1N6YA 2H6MA 2QXGA 3IITA 4NCYA 5LGOA 5EXNA 3BTEE 2QF0A 1XUIA 1TNHA 1ELVA 1TNKA 2HNTF 3F9GA 4JZDH 3KGPA 1CGIE 1XUHA 1C1VH 3UOPA 1GJAB 2OCVB 4TWYA 4CR5A 1P2IA 4FUJA 5GCHF 3ELAH 1D4PB 1G3CA 4CBNA 2EI8A 1C2MA 3BTGE 4MG3A 1G3BA 1C1PA 1YM0A 1W0ZU 1ZGIA
chains in the Genus database with same CATH superfamily
3FZZA 1ORFA 5GXPA 2J98A 3P8FA 3SGBE 1ARCA 2Z9JA 1HCGA 1O3IA 1W13U 3RMLH 1M9UA 1V2NT 2VIPA 4LZ1H 4DIHH 2GT8A 1A1RA 1TBQH 4Y10E 1WTHD 1P06A 1TNJA 1WU1A 1MH0A 1GVLA 4Q7ZA 1D3DB 1CA0C 3M3SA 1SBWA 3PRDA 4BANB 2PKSC 2ILNA 2BD5A 5AFYH 4OGYA 3LJJA 1DWEH 3BG8A 3A7VA 1F0UA 2AMPA 2AS9A 1GBMA 3M5OA 3RXVA 1HUTH 3ATLA 5T6DA 1S82A 3GCTG 1GBLA 1E1QD 1DS2E 1PJPA 3DHKH 1QQUA 2PUQH 1CE5A 3KIDU 4UD9H 3IWMA 1FY1A 2Z6BD 1RGQA 3H09A 4YESB 4WWYA 4MTBA 1P2KA 3SU1A 1J16A 1WXRA 2P59A 1IQGA 2ZTZA 3SNEA 3RXBA 1GI2A 1DWDH 4B1TA 3NUMA 1BMAA 3BG4B 1YYY1 2GV6A 2J95A 4B71A 1C4U2 3ZVAA 2XBXA 2NU0E 5T6FA 1TPPA 1O5CB 2V6NA 3KQDA 3SNCA 1EB1H 1K21H 1ELEE 3P8OA 4OS1A 1HPGA 3OTPA 1THRH 5GJ4B 2QXJA 2EEKA 1IQNA 1HNEE 1P02A 4XDEA 3BSQA 1KXBA 2VVCA 1GMDF 1IHTH 1W11U 4CRGA 2IOTA 4ASUD 1W0JD 5EXMA 3SO3A 4UDWH 4P00A 2BLOA 5DPAA 1Y59T 2GX4A 3BEIB 3K9XB 1IQFA 2VVUA 3L3TA 2J92A 1EASA 5JBCS 2KM0A 2PGQB 1WOFA 3ATMA 3E3TA 2EI7A 4CR9A 2FOAA 3GYLB 4F4OC 2ASUB 1QQ4A 5JPMH 2CGAA 1QA7A 3M36A 4DGJA 1DICA 2ZDKA 1KXCA 3UNSA 1BTYA 1QJ1B 1ZPBA 2FMJA 1GJ9B 1J17T 1LPZB 4MLFB 3SNBA 2JH5D 1P8VC 4X8UH 3M61U 3UOUA 3MNSA 1UK4A 1DLKB 1WQSA 1E0FD 1OP2A 2ZDVH 3SQHE 1F92A 1CVWH 3TNSA 1HAHH 1MTUA 1YLDA 8GCHF 1SGCA 2BB4A 4YOJA 2V3OH 1W8BH 1RTLA 4X1SU 3MNXA 1AUTC 3ZVDA 2Q6FA 2KCPA 1CA0B 4GSOA 4F48B 1V2VT 2Z9LA 1ZR0A 2ZDNA 1DSTA 2OINA 2RDLA 1GBBA 2FWWA 2LELA 2D1JA 3KYGA 4SGAE 3EA8A 2HPQH 1P2JA 1BHXF 1TQ0B 4X1NU 1ANDA 1V2ST 3RXSA 6CHAC 5J4QA 2CMYA 1H8IH 1C9PA 2Y5GA 4ABHA 1IOEA 5FPSA 5FX5A 5FCKA 3QX5H 1JRSA 2VNTA 1A0LA 1L1GA 4A1TA 1F5RA 4YZUA 3NCLA 1GBCA 4UE7H 3PYHA 3VB7A 3ZZ7A 1MAXA 3UREA 1UTLM 1O2NA 3RMNH 1OWJA 2HVYB 4Y6DA 5HIYA 1NY22 1DWBH 1MMJN 1ZSKA 1QBVH 1THSH 3P70B 3VGCC 3UUZA 5CMXH 4CREA 1MTVA 1EJNA 1KDQB 1AE8H 1WTGH 2TBSA 1FIZA 3KN2A 3OYPA 2V0BA 4ZHMU 3ITIA 5F53A 3MMGA 4ABFA 1KTTB 1PQ8A 2YNAA 1GI8B 3ZZAA 1TOCB 1TBZH 4X6MA 3NKKA 2C8XB 2ZGCA 4BAKB 2CK3D 2QA9E 3WWFA 3SV8A 3UR6A 2THFB 3FO8D 3Q3YA 2KFWA 2P16A 1YPHC 1PPFE 4WMDA 4DURA 1V2UT 3N7EA 2IJD1 3C1KA 2W5EA 4WXIA 3DSGA 2UUJB 2GJGA 1O5DH 1LMWB 1LPKB 1BRCE 3PLBA 3SGQE 3OSYA 1SGTA 1AZ8A 2K8IA 2PKAB 1P2OA 1UVUH 2GMTC 3E8LA 1JWTA 1UTMA 2ZGJA 4FU8A 5DP9A 4XE4A 3QZQA 1O2SA 5B6OA 1P04A 1C2LA 1W7GH 4AGKA 3A88A 3M37A 1AZZA 5HYOA 2G5VA 1O3PB 3SORA 3A85A 3SJ9A 4E05H 1L0ZA 1MCTA 2BDBA 2HVXA 4AZ2B 4ABEA 4FETA 3ENSB 3DT0H 2XCFA 1Y5BT 1P0SH 3SJ8A 2BDCA 3GCTF 3BTTE 5T1VA 2PW8H 3GY3A 4NSVA 3S0NA 1DY8A 2ALPA 3F9EA 2J97A 3UY9A 2F9VA 3SYJA 2ZQ1A 3RXLA 1YP9A 1UVTH 2DE9A 1AY6H 1FN6A 2XC0A 3URDA 1MKWK 3PTNA 1Z71A 1BTHH 1IHSH 1SLXB 2RG3A 3AASA 3E90B 5DGJA 5SGAE 3ZYEA 3GY4A 2BHGA 5EOKA 1GCDA 5HMAA 1GWAA 3ODDA 1IQKA 3PLPA 3BTKE 2FYRA 1B0EA 3ZZ8A 1SGFG 3DSOA 3VGCB 1HAYB 1G2LA 1CGHA 1CA8B 1LPGB 1HAVB 4MPXA 3QUMP 3TK5A 4RT0A 2OXSA 3STJA 1UJ1A 1TWXB 5TCAA 1C4V2 1QR3E 1ZHPA 2ZCLP 4CH8B 1G3EA 2HNTE 1XVOA 1RTKA 4AYYB 4A1XA 4HG6A 1O2GH 2WPIS 1K2I1 2ZWLH 5A0CA 5L2YH 1O30A 1H9LB 1NTPA 3O8BA 4I32A 1PYTC 3GISB 3BTDE 2GD4B 1SGEE 1KDQA 3RC4A 3U8RH 4I31A 1EZSC 2Y5FA 4BXSA 1XUKA 2ZC9H 1CQQA 2ALVA 3KF2A 1DY9A 4RKJB 8KME2 2Q1JA 3GS9A 4GAWA 1N8OC 1YLCA 2G51A 1O2TA 2IJOB 1JMOH 1GBFA 3A8DA 5A0BA 5A09A 2JIZD 3QO6A 2FTMA 1C5OH 2C93B 1QZ8A 1AMHA 2XWBI 1RIWC 4WH6A 3SV2H 1TX7A 5L30H 4AB9A 1UHBB 3UTUH 4Y71A 1KLJH 2R2WU 5DKMA 2ZCHP 3HATH 2BQ6B 1HJ8A 1Y5UT 4XBBA 1KLTA 3U8OH 3MU1A 1MTNC 1KIGH 3SU4A 2PKAA 1JXPA 1LO6A 2CJIA 1BQYA 1LHCH 3MYWA 3TGJE 1V2KT 1Z7KA 1S83A 5AVDA 1NC6A 1SC8U 1T7CA 2PR3A 1YPGH 2VGCB 4ZH8A 1MBQA 1C5VA 1XX9A 3FP7E 3STIA 2FS9A 1D6RA 2TGPZ 2NWNA 2XTTB 4I8JA 3M5NA 2UWLA 3FOAA 2P3TB 4TY6A 1O3LA 1O32A 4X8SH 2QXHA 1QGFA 1ID5H 1O38A 1LVOA 5GDSH 2BZ6H 4E7RG 2BXUH 2ZPRA 1GI6A 4D76A 3EQ0H 3RUOA 1PPBH 2GKVE 4BXWA 1KYNA 2M5TA 3S7KB 2A7JA 1TNLA 1WQVH 2OD3B 2CV3A 1EOJA 1J14A 2GZ7A 1P57B 2FOHA 3SJOA 1CU1A 3G01A 3IG6B 3SUFA 4X0WU 1H8DH 4INKA 4TYDA 1F2SE 1XM1A 4GHQA 4I8HA 3M35A 4ZXXH 4ZUHA 3GY2A 1PPHE 2Z94A 3KHVA 3OU0A 3GCNA 3BTHE 1OWDA 2A45B 1O3BA 2HALA 2OBOA 2D2DA 4UFEH 7ESTE 2FI5E 4P02A 5EJLA 2XRCA 1YWUA 3SUEA 3RU4E 3SOSA 5JBAS 1FZZA 3BTQE 5J4SA 4X2VA 1C5UA 4RKOB 1HAVA 1Z8JB 3DCLA 4U01A 1DDJA 1BTXA 2ZG0H 1LVBA 1K1IA 2AHME 1C5SA 1MD7A 2Y7XA 3A80A 4INLA 4B6FA 4ISHH 4H4FA 3PV2A 4JYTA 1C1UH 5DP8A 5EJ1A 2ANWA 4GLYA 1YPLH 2ZTYA 2ZHQH 1UK3A 3V13A 2W3IA 1RRKA 5ETXA 1HRTH 2ZTXA 1N8OB 4B6EA 1IQMA 2P94A 1TPAE 1A7SA 3FP8E 1YC0A 1GJ4H 1JBUH 4UEHH 1IQHA 4JZ1A 4E7NA 3F68H 5I25A 5FHTA 3BV9B 1C5XB 3ZZCA 1RIWB 2A2XH 2CN0H 3E16B 4B2CA 4A92A 2ANMH 2PUXB 1DWCH 1MBMA 3F0OA 1O2OA 3ZVGA 1O3DA 3UPEA 3PV4A 2ZO3H 1EJAA 1XMNB 2OTVA 2FOBA 1OSSA 2FOCA 1K22H 1RD3B 4ASHA 2OQ5A 1GCTC 1HBTH 1MZDA 3MO6A 1UHBA 2GGVB 1RTFB 2KCAA 4NA8A 1SFIA 1TAWA 4JYVH 1OX1A 3LOXA 3VB6A 4KP0A 4Y0ZE 3MO9A 3O8CA 1XUGA 1W0YH 1ZRKA 2W6JD 2ZFSA 2QXIA 1ZJKA 2OUAA 2WPHS 1C5LH 3JZ2B 1UTNA 2FI3E 1AHTH 5AHGH 1BDAA 1GG6C 2OC7A 3C27B 2C3SA 3VB5A 3SUGA 4AC9A 2G5NA 1V2WT 2A7CA 2ZDAH 2KCYA 1C2HA 2FXRA 1F5LA 3LKWA 3RU4D 3HK3B 1QHRB 4FUBA 2WHXA 4K1EA 3LGYA 1MQ5A 4FVDA 4UFGH 3F6UH 5EIYA 2ZZUH 2ZFTA 3ODFA 1WDIA 3UAIC 1ELFA 1KLIH 3SNAA 2XBYA 1CGJE 1N1LA 2V3HH 2BX4A 1IQIA 1NU7B 7GCHG 2GDEH 3V3MA 1TGBA 2SGDE 1Y8TA 1SG8B 2F3CE 2VIOA 1OWIA 2XW9A 2PTNA 1LVMA 1O2KA 1NRRH 1YY3A 1FUJA 1EUFA 1QJ6B 1EJMA 1VGCC 3UB0A 4JZIA 1INCA 3U69H 3E0PB 1FIWA 2VIVA 1EZUC 1Y3UA 3NRLA 4NIXA 3H5CB 5KEDA 1T8LA 1P03A 1O3GA 2Q6DA 3ZZ3A 2WINI 3P8GA 4CRBA 2L6OA 1LKBA 2SGEE 1G36A 2W26A 4NG9H 1MKWH 3RMOH 1SLVB 1A2CH 2DE8A 1NFYA 1DXWA 4Z0KA 2P8OB 1HAPH 4X6PA 3F1SB 3NPSA 1OXGA 4X2XA 1C2KA 1ANCA 2KX4A 4X2YA 4LK4A 1H9HE 2FLBH 2A1DB 3A82A 4DVAU 2ZKSA 4BTUB 1FJSA 3OY6U 2ZECA 4IS5A 2VJ1A 4FUDA 4ABJA 3F2HA 3FZDA 1PQAA 2BY9X 2ZU2A 4YXWD 1GCTB 1TFXA 9ESTA 1S5SA 1FMGA 1EAXA 1VCQA 1HJ9A 3A7XA 3FVFB 1P3EA 1TA6A 2QCYA 1TMTH 1O3CA 1QRWA 1TB6H 2SGQE 1C5PA 1NFXA 3GCHC 5JB9S 3EE7A 1Z8IB 1BBRK 3RLWH 1AB9C 2BY7X 3WY8A 3NXPA 1NU9A 5TJXA 1ZHMA 1ETRH 1A3EH 1BRUP 3SHAH 3GY8A 1J8AA 1GG6B 1P2QA 1H8HD 3U28C 2B0FA 1BZXE 1C2FA 3A7YA 1OHHD 3A7TA 4ACBA 5IK2D 3ZZ5A 4ISIH 1AVGH 3GICB 2EQNA 1H1BA 3H7OA 3VB3A 4OS6A 1QNJA 5EXLA 1VITG 3EGKH 2QF5A 3K6YA 5FPTA 3SU5A 3BTWE 1HJAB 2PHBA 4KTUA 1S6FA 2NU1E 2PLXA 4VGCC 5DP5A 3TH4H 3BTME 2BDAA 2QF4A 3KEEA 4ABGA 1NO9H 8ESTE 2AIQA 3ZYDA 1VJAU 1DPOA 4A5TS 4X6NA 1ESTA 3RLYH 3TPIZ 3ZZ9A 1SLUB 1Q31A 1O37A 3HKJB 3E0NB 4MPVA 1HXEH 2F43B 2FS8A 5JB8S 4YTAA 5EU8A 3GY6A 1VGCB 2P3UB 4K2YA 2UUYA 1TBRH 1OP0A 3PB1E 1GL1A 5T6GA 1QBOA 4OS4A 4GUXA 1O5BB 4KELA 3MH6A 3P92A 1SKYE 1B5GH 2WUBA 5EGMA 2P95A 1G9IE 3FN8A 3S9AA 1AFQC 1C9TA 4TT3D 1TPOA 4BTTB 5EG4A 4JZFH 1TALA 1E79D 1MCVA 1C1WH 2M2AA 3A83A 1C1OA 1P3CA 1KXFA 1LQEA 1SHHB 2GV7A 3KL6A 2DUCA 4R8TB 1ETSH 1TGNA 1UVOA 2OP9A 1FPCH 3LGWA 4AX9H 2J38A 2YMSD 1ACBE 3GY5A 3GDUA 2ZI2H 1FY4A 1TE0A 1DOJA 3DD2H 2A5IA 2VWNA 1BJUA 1QBNA 2PFEA 4IMZA 1BBRE 1T4UH 2C8YB 5EQRA 4ZMAH 3TGIE 3TK6A 4X1QU 4XSKU 2WPMS 3U8TH 1YPJH 3RXGA 3FAOA 3RXIA 1OYTH 2Y7ZA 3SBKA 1Y3WA 1EATA 3S9CA 5EQSA 4MNYA 1SMFE 4K60A 2WPLS 1IQEA 1A5IA 5C5OA 3LU9B 1AGJA 2PKSB 2FOMB 4BNRA 5FBEA 1J9CH 4XFQA 2CHAC 3UNRA 4O9VA 4HGCA 2ZHDA 3RM2H 4TPYA 2RFKC 4ZXYH 1AB9B 2QV1A 1WUNH 3CS7A 5A8ZA 2A32A 3AK5A 1V2PT 1F0TA 3K65B 3SW2B 3RXHA 1BCUH 1MTSA 2FX4A 4X1PU 3B8JA 1O35A 1QFKH 1UO6A 5E0GA 1BMMH 5FXLA 2Z3DA 1TX6A 1SPJA 2AMQA 4X6OA 1ELAA 1ABJH 3SQEE 2CF9H 4AG2A 1ESAA 5HGGA 2VU8E 1LHDH 4VGCB 3UQVA 6GCHF 4GHTA 1C1RA 4FUCA 1VCWA 1QB1A 1GJ6A 4CH2B 3KCGH 2FZZA 3A89A 1C2EA 2PTCE 5E0JA 3M3VA 1FXYA 4O3UA 2XC4A 2B5TB 4M7GA 3TU7H 4D9QA 4NIYA 2YOLA 1BTZA 3MH4A 1V3XA 4BOHA 4AGJA 1XUFA 2BMGB 3AAVA 1Y3YA 1G2MA 5GPIB 5BPEA 1O2WA 1WV7H 2EC9H 2H5DA 3KYFA 1LTOA 3PMHB 1SGQE 3ZZDA 1AFQB 3RXJA 5JYIA 1V2QT 4NFFA 4MPUA 3T27A 1FLEE 1NESE 3WWBA 1V2MT 2GCHG 1T31A 1FN8A 2NU2E 4I33A 5E8EH 5FAHA 2B9LA 3RC6A 4AORA 1THPB 3RP2A 3BIUH 2R2MB 2P3FH 3SU3A 3EDXB 2O8WA 4Y8XA 4B2AA 1TGSZ 1GPZA 4ABIA 3LH1A 4X2WA 1ZTJA 2FYQA 2WSSD 2G4UA 1E37B 5K7RA 4ZHAA 2BDGA 2WYJA 3TITA 1ANBA 1MU8B 1EAUA 4Y8YA 4Y7BA 1P9SA 3BTFE 4JMYA 2G55A 4IW4E 1TABE 5JDUB 1PPZA 1G37A 1PPEE 2RDEA 2QYIA 1XKAC 3A7WA 3MOCA 2WV4A 2KZ4A 1DUEA 1SGDE 1GJDB 3MH7A 4IGDA 3RXRA 4RT1A 2XCNA 1CT4E 1C5WB 3LC3A 1TYNA 1Y3VA 1UTJA 1UK2A 1Q3XA 4CBOA 3EE0B 6CHAB 2B7DH 1U6QA 2GZ8A 4A7IB 1YPMH 4FOUC 2BY5X 1DVAH 5C2ZA 3FFGA 1AI8H 1W7XH 3MTYA 1FY8E 2A5KA 5FPYA 1QB9A 2HLCA 5L6NH 3U1JB 3HKIB 1EPTC 3ZVFA 2RA3A 4YOIA 1K28D 2Y81A 5ESTE 2UWOA 1NFWA 1AWFH 5A8YA 4K5ZA 2Y80A 5DP7A 4CRDA 5C5NA 1P09A 3DSPA 2BD8A 4K1TA 1SFQB 2OC1A 2HGTH 3F9HA 3N7OA 3PO1C 1O3KA 3LGTA 4WF8A 5EW2H 3Q3KA 2LP6A 1DSUA 3LDXH 1GJ5H 5CE1A 1X7AC 1WYKA 4UFFH 4MVNA 2R0LA 3EAJA 3T62A 2V35A 3R0FA 2KAIB 2W6ID 2VH6A 1MUEB 1BMNH 2C8WB 4ZAEA 3MI4A 5EW1H 1GMCG 3U98H 1ZMLA 1TOMH 1Z8RA 1OP8A 1W14U 5EPNA 5C3NA 1RXPA 3P17H 4OS7A 1UTPA 4J2YB 2BQ7B 1XKBC 1PPGE 1BBRH 3MNBA 5H4IB 1J15A 1TGCA 1C5NH 1TRMA 2ZA5A 3QK1A 1T8OA 1O36A 1TGTA 1GJ7B 1BMFD 2O8MA 4F55A 4JK6A 3LGUA 2BLVA 3L33A 1V2RT 1YPHE 3QGNB 2GMTB 2F9UA 1CT2E 3P95A 1LQDB 3AVZA 3HK6B 1SHYA 1GMHG 2ZPQA 3RXAA 2UUFB 4U30A 2GZ9A 5C1UA 3SHCH 2UWPA 2IN2A 1ZRBA 1SGFA 3MU0A 1OWHA 3M5MA 1CSOE 4YT6H 1D6WA 1UMAH 2BOHB 2ZFFH 1EAIA 1O2MA 4WXVA 1NPMA 1BRAA 1VJ9U 4Z1MD 4FUFA 1L4ZA 2GCTC 1O2YA 2H1UA 1AVWA 1NBME 1PQ7A 4LOYH 4I7YH 5GCHG 2BYAX 1TA2A 2H5CA 3A86A 1TQ7B 1DM4B 4IN1A 1Z1JA 2ZHWH 4H6SB 4ISNA 4LXBH 2ANKH 4PROA 4B2BA 4WJG2 1D3PB 3SU2A 2GT7A 2ZP0H 1MKXK 2J2UA 1SLWB 3F3BA 1EPTB 1T8NA 2B8OH 3TH3H 2Y6TA 4NWLA 2ZNKH 1PQ5A 2EY4C 2Z9KA 1IAUA 3RXFA 2SGPE 4Q80A 1O2IA 3MHWU 4MQAA 4X8VH 5DSFA 1QRXA 2OK5A 3OEHD 1O2LA 3O8DA 1F0RA 5C67A 2O9QA 5KECA 5E2PA 4A1VA 1QURH 1HGTH 1O2QA 2SGFE 3WW7A 2EI6A 3GDVA 1DUAA 4NSYA 2PWXA 1L4DA 2BD7A 2ZHFH 2KCOA 3PMAB 4NIWA 2STBE 1T4VH 1TPSA 2BQWB 4OS2A 2K0QA 3U1IB 1TNGA 4B74A 4K8YA 2F9NA 1UVSH 1DLEA 2STAE 5DP4A 4AFSA 1MU6B 2HOBA 2A4OA 2WV5A 1LVYA 4NGAH 1O39A 1O3AA 4FU9A 3SU0A 1GBAA 2GCHF 1C1NA 2JH6D 1QA0A 4U32A 3QZRA 7LPRA 3OFND 2KAIA 1O3HA 2WYGA 4H42U 2ZU5A 2LNCA 4U2WA 2BD3A 3BF6H 1BITA 1Y5AT 2TGAA 2J5UA 1FPHH 2FI4E 4RSPA 1H9IE 1K1NA 1LKAA 2BM2A 1JIMA 1W12U 3D49H 9LPRA 2FODA 1PFXC 2HRVA 3RXDA 1LHEH 1YCPK 3TJNA 1NBMD 1K1MA 1L1JA 1P2MA 3PRBA 4Y76A 2PSYA 2BX3A 2J98B 1UTQA 1GBKA 1ZOMA 4O97A 1MTNB 3LH3A 2FP7B 1KTSB 4AB8A 3GYMA 4NFEA 3I29A 1AKSB 3Q77A 3ZIAD 1P2NA 1HAGE 3GY7A 1ELDE 4Q7YA 3VB4A 4ZKNU 3W95A 3UWJH 3DUXH 1GHYH 3RXQA 2GCTB 3CS0A 5TCCA 5ABWA 1LDTT 3MWIU 1K1JA 1QL9A 4Y79A 5F8TA 1KY9A 4GVUA 1GVZA 2BD2A 5I46H 1S84A 1SQOA 4ISOA 2XBWA 2ZU4A 3T26A 3SUDA 1T32A 3EA9A 1OWEA 1XUJA 4HFPB 2XOKD 1ZJDA 1SR5C 3SGAE 3GDSA 3P8NA 4D7GA 1GHXH 1A0JA 1BA8B 1BB0B 2F4LA 5CHBA 1EX3A 3SNDA 1S85A 1EZXC 2I6QA 2Z9GA 3RXCA 1QIXB 3S9BA 3SV6A 1LCYA 1G32B 4ABAA 5A8XA 1HXFH 4JYUH 1ZSJA 1NT1A 4F49A 1O0DH 1OKXA 1NROH 2FOGA 1ZHRA 1EPTA 2TRMA 3SU6A 2BDIA 3NK8A 2D8WA 2AGGX 3S69A 2G81E 1PYTD 2L74A 2F91A 2WV9A 3Q00A 2SNVA 1NN6A 2ZU3A 4YM9A 4XBDA 1GI7B 1UTKA 3ATKA 4NA9H 3ZV9A 2ODQA 3B9FH 4UONA 1Z6EA 1XXFA 3CNRA 3W1EA 1AD8H 1TNIA 2BXTH 3TJUA 3RXKA 1T8MA 2IPQX 2BTCE 2OLGA 1SVPA 3MU4A 1GI4A 1OS8A 1ABIH 4I86A 3BEUA 1SSXA 2SNWA 3SN8A 4O03A 3VFEA 1A61H 2WUCA 3PM3A 5BRRE 3QWCH 4ZHLU 4FUEA 1O2PA 1YBWA 4IN2A 1A4WH 1VZQH 3PWCA 3SI4H 1SGYE 2VIDA 1BTUA 1GBIA 2XYAA 3D65E 2VVVA 2H2ZA 1BT7A 1QCPA 3ZZ4A 1ZZZA 2HPPH 1O3OA 2ZEBA 4OM9A 3QLPH 5C17A 2XWAA 2Z9IA 3KQEA 1GBTA 1H4WA 5C0UA 2H9HA 4M9FA 4YOGA 1WAYB 1UCYH 1GL0E 1VR1H 3OX7U 5AF9H 3KQ5A 4X8TH 3TVJB 5HXFA 1KXEA 2TGTA 3BEFB 3HPTB 1F0SA 4WMEA 3EA7A 1HDTH 1Z8GA 2FOEA 3OTJE 1AKSA 2CF8H 2J9NA 5AFZH 3MH5A 3I78A 2SFAA 1E1RD 5JBBS 2FO9A 4K69A 1HYLA 3ZVBA 1ESBA 1IQJA 4AN7A 3LONA 4BAQB 3ZVEA 1O31A 1K0HA 1YGCH 2G8TA 1CHGA 3PTBA 3P6ZB 4ZKOU 2ZGXH 1E35B 4Q63A 3PLKA 1QJ7B 4TSFD 1SL3A 5LH8A 2D26C 3SZNA 3ZZ6A 1SQRA 5C94A 2V3MA 3QGJA 2VH0A 2BD9A 3TIUA 4Q2KA 1OPHB 4JZEH 1GHAG 1V2LT 2J4IA 3N7DA 3V12A 2QAAA 3LGIA 4KTSA 6LPRA 1GJCB 1ZPZA 5EQQA 1S0QA 3RXMA 2RA0A 3T28A 4IBLH 3S7HB 2AFQB 7KMEH 1D3TB 1NRSH 3A87A 1YPEH 5F03A 4DT4A 1GBJA 5FL7D 2ZGBH 3RXUA 2ZCKP 2XNIA 2AMDA 1QY6A 1HAZB 2BLQA 1QTFA 4WMFA 1O5FH 1TONA 1HV7A 1SGNE 1BMLA 1XVMA 3VG8A 1WBGB 3LJOA 3MFJA 3T2NA 1FDPA 1HB0B 4XD7D 1GHBG 1MKXH 3GOVB 1GHWH 1AO5A 3UWIA 3M3TA 1GBEA 4Y0YE 5HIZA 3MQKC 3RC5A 2W7SA 3PV5A 2NU3E 1P9UA 1Q2WA 2W3KA 3F0PA 4I8LA 1FAKH 2XBVA 1ELTA 1MABB 1OWKA 1GJBB 1HLTH 2C4FH 3TJVA 4AYVB 1C5QA 1TX8A 4UFDH 5IYTA 2R3YA 1AIXH 4OGXA 2J34A 4KKDA 1MTWA 2VBCA 4ZKSU 4I8KA 1QRZA 3CP7A 4TY7A 2JETC 2QGRA 2AERH 1MQ6A 2H9TH 3GCHB 3R3GB 5F6MA 2ZIQH 1FV9A 4FUGA 4DOQA 5EODA 3AAUA 2BZAA 4K8BA 1NRQH 1O34A 3A8BA 3TK9A 2A5AA 1S81A 2F83A 1GI9B 2AGEX 4ABBA 7GCHF 3F2GA 2SGAA 3KQBA 1GGDC 3EYDA 3F2FA 1CO7E 1FQ3A 1C5MD 2G52A 1FY5A 2R9PA 1L2EA 2ZFPH 4GCHG 3MU8A 5GIBA 2VWMA 1YCPH 1NRNH 1P05A 2K1QA 2FESH 1YF4A 4WVPE 4DW2U 3SZEA 2LPRA 1C5ZB 4D7FA 2HNTC 1GJ8B 3SI3H 4D9RA 1S0RA 4J1YA 1BTWA 4WY3A 1ELBA 2VINA 5CDFE 2IPHA 1TRYA 3DFLA 1GDUA 3PMBB 1JOUB 4TPIZ 4GPGA 3OEED 4O3TA 5GNDA 2BVSH 1HAOH 4THNH 1P10A 1OOKB 1VITH 3UR9A 2NU4E 3TH2H 3TNTA 2G00A 4DCDA 3RDZA 2FPZA 2GVFA 1NM6A 1O5EH 3NWUA 1K1OA 4Q7XA 4WH8A 1S6HA 2R3UA 4DY7B 1BTPA 4CRAA 2H9EH 4MNXA 3RU4T 1N6XA 1EOLA 2C8ZB 1GI3A 1W2KH 4BAMB 3L6PA 1JIRA 1CHOG 3A7ZA 2G4TA 2O8UA 1NS3A 3O8RA 3TJOA 2FDAA 3PMJA 3UFAA 2EA3A 2QN5T 1ZYOA 1K9OE 1MAYA 4QT8C 1AN1E 2GP9B 1ARBA 1TMBH 2BLWA 1TRNA 3ZVCA 5K0HA 2CXVA 2Z7FE 3KNXA 1Z1IA 1ZTLA 4D8NA 1A5GH 4MNWA 1AU8A 1CBWC 2QC2A 1O2HA 2TGDA 3E91A 5T3HA 4ACAA 1QL8A 1CT0E 1ETTH 1SI5H 1WCZA 1SGPE 2BY8X 4AFZA 1B7XB 1ZLRA 2YNBA 3RXTA 2JETB 1GHVH 2ZPSA 2QIQA 5E0HA 3RMMH 2CHAB 2F9BH 3B23B 2ZQ2A 1HIAB 5CHAC 5DN6D 4HI3A 2Z3CA 1VITF 3A8CA 2FLRH 1ZSLA 4ZCNA 2WPKS 2ODPA 4INHA 2PSXA 1AVXA 3UQOA 2ZFRH 4KGAA 4BAHB 2WZQA 1GBHA 1AUJA 2BOKA 1FAXA 1KSNA 3MO3A 2VGCC 2Z3EA 1SOTA 3OE7D 5A2MH 4DIIH 1EP5A 3MU5A 3DFJA 1QL7A 1YLNA 1EFRD 3E6PH 1YPKH 3TLOA 1W10U 1GHAF 1GGDB 2ODYB 3LIWA 1K1LA 3M7TA 2BVRH 1O2XA 2Y5HA 1S6LA 2A7HA 3BIVH 4XOJA 2JH0D 3UIRA 4K3JA 2R0KA 4OS5A 1DFPA 3A84A 2GTBA 2ANYA 5FX6A 1FNIA 5FCRA 1UCYK 3GCOA 1P12E 3M5LA 8LPRA 5F8XA 1O33A 4Y11E 3SJKA 4E06H 1GDQA 1C2DA 2P93A 1O2JA 2QE7D 5ESBA 2OBQA 4MPWA 5KGOA 1AE5A 5DJ7A 3ATIA 1NZQH 4YT7H 1VKYA 1TLDA 1ELCA 4DT7B 1F7ZA 1GHBF 1DITH 4IC6A 1AQ7A 1HAXB 2OC8A 1ZPCA 1HFDA 1A3BH 1O3NA 4RI0A 1FY3A 2F9PA 3QTOH 3TGKE 4ISLA 2JDID 1DE7H 1EP6A 1XXDA 1KMHB 1V2TT 3QTVH 6ESTA 3LPRA 3VPKA 2VWLA 1DXPA 1ZMNA 4IC5A 3HGNA 4RN6A 5HM9A 3AW1A 3D23A 1O3JA 1TIOA 4Y8ZA 4AFQA 1D3QB 5EPYA 3M7UA 3LGVA 2ESTE 2WPJS 2AH4X 1C1TA 3FKSD 1CBWB 2ULLA 3BN9A 1EB2A 2KR7A 2QY0B 3ESTA 3QN7A 3KQCA 4AOQA 2TPIZ 2J94A 2RCEA 2VIQA 1EKBB 2BY6X 1G3DA 3UNQA 1KXAA 4HTCH 3T5FH 3ZZBA 4NWKA 2O8TA 5JBTA 2PP6A 1ZMJA 5DG6A 2A4GA 1GI0A 2W7UA 1TMUH 1C5RA 5CHAB 1GDNA 3A8AA 2V7QD 4CRFA 1GI1A 2TIOA 1LHFH 1NFUA 1E38B 1A0HB 3SV7A 1BIOA 2BDHA 1V2JT 4DJZB 4GCHF 2BDYA 1GVKB 1B0FA 1UCYE 3E1XB 4LZ4B 5DP3A 3W94A 3SJIA 1RS0A 1ZTKA 1HIAA 4MDSA 2JKHA 5F8ZA 3RXOA 1EXFA 1G30B 1F5KU 1E34B 4MNVA 4ESTE 5GWZA 5E2OA 2FIRH 3NZIA 3PWBA 4Y7AA 3T29A 2PGBB 3D62A 3H7TA 3PO1B 3ATWA 4BAOB 3MNCA 4ZROA 3RXEA 4IMQA 1O3FA 2BVXH 4JCNA 4CHAC 2Q6GA 1O3MA 2WPDD 2A0QB 1ZGVA 1JRTA 2GDDA 1WSSH 1YCPM 2PV9B 1COWD 1RFNA 1GHZA 3OY5U 5FBIA 4B75A 1HAIH 2O8LA 2OC0A 2ZDMA 1BJVA 3Q3XA 1W0KD 4B73A 1L1NA 3U9AH 4AG1A 2AYWA 1O2VA 5C20A 2ZFQH 3JZ1B 1H8ED 5LPFA 1Z6JH 4NZQA 4CRCA 1C2JA 4A6LA 3FP6E 3I77A 1BOQA 1CHOF 2FM2A 3DA9B 4FU7A 4AFUA 4BTIB 3SV9A 4SGBE 1O2UA 1BUIA 2A31A 3VXEH 1NRPH 4NZLA 1SQAA 3FANA 5IDKA 1YKTA 3ZV8A 1D9IA 4I8GA 2XXLA 4Z6AH 2AEIH 2HWLB 1KXDA 1DX5M 1DANH 3PROA 1BHXB 2VB0A 4ABDA 1DT2A 3AW0A 2UUKB 3T25A 2P8OC 4JK5A 2ZHEH 1ANEA 1GMDG 1LHGH 4FUHA 1SGRE 1W3CA 2VWOA 5EJZA 4FVBA 3CENA 1FI8A 1SGIB 2ZDLA 4B76A 5A0AE 2HLDD 5DK1A 1C4Y2 2AIPA 2ZF0H 1IQLA 3QDZB 2YMSC 4KTCA 4HZHA 5L2ZH 2FX6A 1EZQA 1C1QA 3URCA 1FX0B 2AGIX 4TWWA 5DO4H 4FUIA 2XC5A 1C5YB 1SB1H 2Y82A 1GI5A 2FTLE 1VCPA 4ZKRU 1V6DA 4FXGH 4XBCA 1EAWA 2VIWA 1E36B 1P11E 1GBDA 4H6TA 2QF3A 1O5AB 2BD4A 2OQUA 1C1MA 5LPEA 2F9OA 1BRBE 3F9FA 1O2ZA 1Y3XA 2FEQH 5HM2A 3V0XA 8GCHG 5C1YA 1A5HA 3K2UA 5HKKD 1A46H 1C2IA 3HGPA 1C5TA 3LT3A 1MZAA 1O3EA 4K1SA 1QB6A 3LC5A 2A2QH 1GMCF 1O2RA 1SOZA 4CHAB 5LPRA 1PPCE 1AFEH 1O5GH 1C1SA 2ZGHA 3A81A 1UTOA 2JJ1D 5G4BA 1V2OT 3V7TA 2A4QA 1OYQA 1RJXB 5DP6A 1C2GA 4NIVA 1UW7A 4YLQH 1HJAC 2A4RA 4YLUA 2I6SA 3RXPA 3BG4C 2XNDD 1AWHB 1ELGA 4X1RU 4DG4A 1FONA 3K6ZA 3VXFH 1K1PA 2C90B 5B6LA 2JJ2D 1GMHF 2FOFA 5PTPA 3M7QA 3OAAD 2ZU1A 1EQ9A 6GCHG 4NA7A 3Q76A 4Q4LA 4R0IA 1UVPA 1SQTA 3N99A 4YO9A 3VEQB 1MD8A 5C1XA 1P01A 3RM0H 1N6YA 2H6MA 2QXGA 3IITA 4NCYA 5LGOA 5EXNA 4XRNA 3BTEE 2QF0A 1XUIA 1TNHA 1ELVA 1TNKA 2HNTF 3F9GA 4JZDH 3KGPA 1CGIE 1XUHA 1C1VH 3UOPA 1GJAB 2OCVB 4TWYA 4CR5A 1P2IA 4FUJA 5GCHF 5C0TA 3ELAH 1D4PB 1G3CA 4CBNA 2EI8A 1C2MA 3BTGE 4MG3A 1G3BA 1C1PA 1YM0A 1W0ZU 1ZGIA 2YMSB
chains in the Genus database with same CATH topology
3FZZA 1ORFA 5GXPA 3P8FA 3SGBE 1ARCA 2Z9JA 1HCGA 1O3IA 1W13U 3RMLH 1M9UA 1V2NT 2VIPA 4LZ1H 4DIHH 2GT8A 1A1RA 1TBQH 4Y10E 1WTHD 1P06A 1TNJA 1WU1A 1MH0A 1GVLA 4Q7ZA 1D3DB 1CA0C 3M3SA 1SBWA 4BANB 2PKSC 2ILNA 2BD5A 5AFYH 4OGYA 3LJJA 1DWEH 3BG8A 3A7VA 1F0UA 2AMPA 2AS9A 1GBMA 3M5OA 3RXVA 1HUTH 3ATLA 5T6DA 1S82A 3GCTG 1GBLA 1PJPA 1DS2E 3DHKH 1QQUA 2PUQH 1CE5A 3KIDU 4UD9H 3IWMA 1FY1A 2Z6BD 1RGQA 4YESB 4WWYA 4MTBA 1P2KA 3SU1A 1J16A 2P59A 1IQGA 2ZTZA 3SNEA 3RXBA 1GI2A 1DWDH 4B1TA 3NUMA 1BMAA 3BG4B 1YYY1 2GV6A 2J95A 4B71A 1C4U2 3ZVAA 2XBXA 2NU0E 5T6FA 1TPPA 1O5CB 2V6NA 3KQDA 3SNCA 1EB1H 1K21H 1ELEE 3P8OA 4OS1A 1HPGA 1THRH 5GJ4B 2QXJA 2EEKA 1IQNA 1HNEE 1P02A 4XDEA 3BSQA 1KXBA 2VVCA 1GMDF 1IHTH 1W11U 4CRGA 2IOTA 5EXMA 3SO3A 4UDWH 2BLOA 5DPAA 1Y59T 2GX4A 3BEIB 3K9XB 1IQFA 2VVUA 3L3TA 2J92A 1EASA 5JBCS 2PGQB 1WOFA 3ATMA 3E3TA 2EI7A 4CR9A 2FOAA 3GYLB 4F4OC 2ASUB 1QQ4A 5JPMH 2CGAA 1QA7A 3M36A 4DGJA 1DICA 2ZDKA 1KXCA 3UNSA 1BTYA 1QJ1B 1ZPBA 2FMJA 1GJ9B 1J17T 1LPZB 4MLFB 3SNBA 2JH5D 1P8VC 4X8UH 3M61U 3UOUA 3MNSA 1UK4A 1DLKB 1WQSA 1E0FD 1OP2A 2ZDVH 3SQHE 1F92A 1CVWH 3TNSA 1HAHH 1MTUA 1YLDA 8GCHF 1SGCA 2BB4A 4YOJA 2V3OH 1W8BH 1RTLA 4X1SU 3MNXA 1AUTC 3ZVDA 2Q6FA 1CA0B 4GSOA 1V2VT 2Z9LA 1ZR0A 2ZDNA 1DSTA 2OINA 2RDLA 1GBBA 2FWWA 2D1JA 4SGAE 3EA8A 2HPQH 1P2JA 1BHXF 1TQ0B 4X1NU 1ANDA 1V2ST 3RXSA 6CHAC 5J4QA 2CMYA 1H8IH 1C9PA 2Y5GA 4ABHA 1IOEA 5FPSA 5FX5A 5FCKA 3QX5H 1JRSA 2VNTA 1A0LA 1L1GA 4A1TA 1F5RA 4YZUA 3NCLA 1GBCA 4UE7H 3PYHA 3VB7A 3ZZ7A 1MAXA 3UREA 1UTLM 1O2NA 3RMNH 1OWJA 4Y6DA 1NY22 1DWBH 1MMJN 1ZSKA 1QBVH 1THSH 3P70B 3VGCC 3UUZA 5CMXH 4CREA 1MTVA 1EJNA 1KDQB 1AE8H 1WTGH 2TBSA 1FIZA 3KN2A 3OYPA 2V0BA 4ZHMU 3ITIA 3MMGA 4ABFA 1KTTB 1PQ8A 2YNAA 1GI8B 3ZZAA 1TOCB 1TBZH 4X6MA 3NKKA 2C8XB 2ZGCA 4BAKB 2QA9E 3SV8A 3UR6A 2THFB 3Q3YA 2P16A 1YPHC 1PPFE 4WMDA 4DURA 1V2UT 3C1KA 2W5EA 4WXIA 2UUJB 1O5DH 1LMWB 1LPKB 1BRCE 3PLBA 3SGQE 3OSYA 1SGTA 1AZ8A 2PKAB 1P2OA 1UVUH 2GMTC 3E8LA 1JWTA 1UTMA 2ZGJA 4FU8A 5DP9A 4XE4A 3QZQA 1O2SA 5B6OA 1P04A 1C2LA 1W7GH 4AGKA 3A88A 3M37A 1AZZA 5HYOA 2G5VA 1O3PB 3SORA 3A85A 3SJ9A 4E05H 1L0ZA 1MCTA 2BDBA 2HVXA 4AZ2B 4ABEA 3ENSB 3DT0H 2XCFA 1Y5BT 1P0SH 3SJ8A 2BDCA 3GCTF 3BTTE 2PW8H 3GY3A 4NSVA 3S0NA 1DY8A 2ALPA 3F9EA 3UY9A 2F9VA 2ZQ1A 3RXLA 1YP9A 1UVTH 2DE9A 1AY6H 1FN6A 2XC0A 3URDA 1MKWK 3PTNA 1Z71A 1BTHH 1IHSH 1SLXB 2RG3A 3AASA 3E90B 5DGJA 5SGAE 3ZYEA 3GY4A 2BHGA 5EOKA 1GCDA 5HMAA 1GWAA 3ODDA 1IQKA 3PLPA 3BTKE 2FYRA 1B0EA 3ZZ8A 1SGFG 3VGCB 1HAYB 1G2LA 1CGHA 1CA8B 1LPGB 1HAVB 4MPXA 3QUMP 3TK5A 2OXSA 3STJA 1UJ1A 1TWXB 5TCAA 1C4V2 1QR3E 1ZHPA 2ZCLP 4CH8B 1G3EA 2HNTE 1XVOA 1RTKA 4AYYB 4A1XA 5L2YH 1O2GH 2WPIS 1K2I1 2ZWLH 5A0CA 1O30A 1H9LB 1NTPA 3O8BA 4I32A 1PYTC 3GISB 3BTDE 2GD4B 1SGEE 1KDQA 3RC4A 3U8RH 4I31A 1EZSC 2Y5FA 4BXSA 1XUKA 2ZC9H 1CQQA 2ALVA 3KF2A 1DY9A 4RKJB 8KME2 2Q1JA 4GAWA 1N8OC 1YLCA 2G51A 1O2TA 2IJOB 1JMOH 1GBFA 3A8DA 5A0BA 5A09A 3QO6A 2FTMA 1C5OH 2C93B 2XWBI 1AMHA 4WH6A 1RIWC 3SV2H 5L30H 1TX7A 4AB9A 1UHBB 3UTUH 4Y71A 1KLJH 2R2WU 5DKMA 2ZCHP 3HATH 2BQ6B 1HJ8A 1Y5UT 4XBBA 1KLTA 3U8OH 3MU1A 1MTNC 1KIGH 3SU4A 2PKAA 1JXPA 1LO6A 2CJIA 1BQYA 1LHCH 3MYWA 3TGJE 1V2KT 1Z7KA 1S83A 5AVDA 1NC6A 1SC8U 1T7CA 2PR3A 1YPGH 2VGCB 4ZH8A 1MBQA 1C5VA 1XX9A 3FP7E 3STIA 2FS9A 1D6RA 2TGPZ 2NWNA 2XTTB 4I8JA 3M5NA 2UWLA 4TY6A 2P3TB 1O3LA 1O32A 4X8SH 2QXHA 1QGFA 1ID5H 1O38A 1LVOA 5GDSH 2BZ6H 4E7RG 2BXUH 2ZPRA 1GI6A 4D76A 3EQ0H 3RUOA 1PPBH 2GKVE 4BXWA 1KYNA 2M5TA 3S7KB 2A7JA 1TNLA 1WQVH 2OD3B 2CV3A 1EOJA 1J14A 2GZ7A 1P57B 2FOHA 3SJOA 1CU1A 3G01A 3IG6B 3SUFA 4X0WU 1H8DH 4INKA 4TYDA 1F2SE 1XM1A 4GHQA 4I8HA 3M35A 4ZXXH 4ZUHA 3GY2A 1PPHE 2Z94A 3KHVA 3OU0A 3GCNA 3BTHE 1OWDA 2A45B 1O3BA 2HALA 2OBOA 2D2DA 4UFEH 7ESTE 2FI5E 2XRCA 3SUEA 3RU4E 3SOSA 5JBAS 1FZZA 3BTQE 5J4SA 4X2VA 1C5UA 4RKOB 1HAVA 1Z8JB 4U01A 1DDJA 1BTXA 2ZG0H 1LVBA 1K1IA 2Y7XA 1C5SA 1MD7A 3A80A 4INLA 4ISHH 4H4FA 4JYTA 1C1UH 5DP8A 2ANWA 4GLYA 1YPLH 2ZTYA 2ZHQH 1UK3A 3V13A 2W3IA 1RRKA 5ETXA 1HRTH 2ZTXA 1N8OB 1IQMA 2P94A 1TPAE 1A7SA 3FP8E 1YC0A 1GJ4H 1JBUH 4UEHH 1IQHA 4JZ1A 4E7NA 3F68H 5I25A 5FHTA 3BV9B 1C5XB 3ZZCA 1RIWB 2A2XH 2CN0H 3E16B 4B2CA 4A92A 2ANMH 2PUXB 1DWCH 1MBMA 1O2OA 3ZVGA 1O3DA 3UPEA 3PV4A 2ZO3H 1EJAA 1XMNB 2OTVA 2FOBA 1OSSA 2FOCA 1K22H 1RD3B 4ASHA 2OQ5A 1GCTC 1HBTH 1MZDA 3MO6A 1UHBA 2GGVB 1RTFB 4NA8A 1SFIA 1TAWA 4JYVH 1OX1A 3LOXA 3VB6A 4KP0A 4Y0ZE 3MO9A 3O8CA 1XUGA 1W0YH 1ZRKA 2ZFSA 2QXIA 1ZJKA 2OUAA 2WPHS 1C5LH 3JZ2B 1UTNA 2FI3E 1AHTH 5AHGH 1BDAA 1GG6C 2OC7A 3C27B 2C3SA 3VB5A 3SUGA 2G5NA 1V2WT 2A7CA 2ZDAH 1C2HA 2FXRA 1F5LA 3LKWA 3RU4D 3HK3B 1QHRB 4FUBA 4K1EA 3LGYA 1MQ5A 4FVDA 4UFGH 3F6UH 2ZZUH 2ZFTA 3ODFA 1ELFA 1KLIH 3SNAA 2XBYA 1CGJE 1N1LA 2V3HH 2BX4A 1IQIA 1NU7B 7GCHG 2GDEH 3V3MA 1TGBA 2SGDE 1Y8TA 1SG8B 2F3CE 2VIOA 1OWIA 2XW9A 2PTNA 1LVMA 1O2KA 1NRRH 1FUJA 1EUFA 1QJ6B 1EJMA 1VGCC 4JZIA 1INCA 3U69H 3E0PB 1FIWA 2VIVA 1EZUC 1Y3UA 4NIXA 3H5CB 1T8LA 1P03A 1O3GA 2Q6DA 3ZZ3A 2WINI 3P8GA 4CRBA 1LKBA 2SGEE 1G36A 2W26A 4NG9H 1MKWH 3RMOH 1SLVB 1A2CH 2DE8A 1NFYA 1DXWA 4Z0KA 2P8OB 1HAPH 4X6PA 3F1SB 3NPSA 1OXGA 4X2XA 1C2KA 1ANCA 4X2YA 4LK4A 1H9HE 2FLBH 2A1DB 3A82A 4DVAU 2ZKSA 4BTUB 1FJSA 3OY6U 2ZECA 4IS5A 2VJ1A 4FUDA 4ABJA 3FZDA 1PQAA 2BY9X 2ZU2A 1GCTB 1TFXA 9ESTA 1S5SA 1FMGA 1EAXA 1VCQA 1HJ9A 3A7XA 3FVFB 1P3EA 1TA6A 2QCYA 1TMTH 1O3CA 1QRWA 1TB6H 2SGQE 1C5PA 1NFXA 3GCHC 5JB9S 1Z8IB 1BBRK 3RLWH 1AB9C 2BY7X 3WY8A 3NXPA 1NU9A 5TJXA 1ZHMA 1ETRH 1A3EH 1BRUP 3SHAH 3GY8A 1J8AA 1GG6B 1P2QA 2B0FA 1BZXE 1C2FA 3A7YA 3A7TA 3ZZ5A 4ISIH 1AVGH 3GICB 3H7OA 1H1BA 3VB3A 4OS6A 1QNJA 5EXLA 1VITG 3EGKH 3K6YA 5FPTA 3SU5A 3BTWE 1HJAB 2PHBA 4KTUA 1S6FA 2NU1E 2PLXA 4VGCC 5DP5A 3TH4H 3BTME 2BDAA 3KEEA 4ABGA 1NO9H 8ESTE 2AIQA 3ZYDA 1VJAU 1DPOA 4A5TS 4X6NA 1ESTA 3RLYH 3TPIZ 3ZZ9A 1SLUB 1Q31A 1O37A 3HKJB 3E0NB 4MPVA 1HXEH 2FS8A 5JB8S 4YTAA 5EU8A 3GY6A 1VGCB 2P3UB 4K2YA 2UUYA 1TBRH 1OP0A 3PB1E 1GL1A 5T6GA 1QBOA 4OS4A 4GUXA 1O5BB 4KELA 3MH6A 3P92A 1B5GH 2WUBA 5EGMA 2P95A 1G9IE 3S9AA 1AFQC 1C9TA 1TPOA 4BTTB 5EG4A 4JZFH 1TALA 1MCVA 1C1WH 3A83A 1C1OA 1P3CA 1KXFA 1LQEA 1SHHB 2GV7A 3KL6A 2DUCA 4R8TB 1ETSH 1TGNA 1UVOA 2OP9A 1FPCH 3LGWA 4AX9H 2J38A 1ACBE 3GY5A 3GDUA 2ZI2H 1FY4A 1TE0A 1DOJA 3DD2H 2A5IA 2VWNA 1BJUA 1QBNA 2PFEA 4IMZA 1BBRE 1T4UH 2C8YB 5EQRA 4ZMAH 3TGIE 3TK6A 4X1QU 4XSKU 2WPMS 3U8TH 1YPJH 3RXGA 3FAOA 3RXIA 1OYTH 2Y7ZA 3SBKA 1Y3WA 1EATA 3S9CA 5EQSA 4MNYA 1SMFE 4K60A 2WPLS 1IQEA 1A5IA 5C5OA 3LU9B 1AGJA 2PKSB 2FOMB 4BNRA 5FBEA 1J9CH 4XFQA 2CHAC 3UNRA 4O9VA 4HGCA 2ZHDA 3RM2H 4TPYA 4ZXYH 1AB9B 2QV1A 1WUNH 3CS7A 5A8ZA 2A32A 1V2PT 1F0TA 3K65B 3SW2B 3RXHA 1BCUH 1MTSA 2FX4A 4X1PU 3B8JA 1O35A 1QFKH 1UO6A 5E0GA 1BMMH 5FXLA 2Z3DA 1TX6A 1SPJA 2AMQA 4X6OA 1ELAA 1ABJH 3SQEE 2CF9H 4AG2A 1ESAA 5HGGA 2VU8E 1LHDH 4VGCB 3UQVA 6GCHF 4GHTA 1C1RA 4FUCA 1VCWA 1QB1A 1GJ6A 4CH2B 3KCGH 2FZZA 3A89A 1C2EA 2PTCE 5E0JA 3M3VA 1FXYA 4O3UA 2XC4A 2B5TB 4M7GA 3TU7H 4D9QA 4NIYA 2YOLA 1BTZA 3MH4A 1V3XA 4BOHA 4AGJA 1XUFA 2BMGB 3AAVA 1Y3YA 1G2MA 5GPIB 5BPEA 1O2WA 1WV7H 2EC9H 2H5DA 3PMHB 1LTOA 1SGQE 3ZZDA 1AFQB 3RXJA 5JYIA 1V2QT 4NFFA 4MPUA 3T27A 1FLEE 1NESE 1V2MT 2GCHG 1T31A 1FN8A 2NU2E 4I33A 5E8EH 5FAHA 2B9LA 3RC6A 4AORA 1THPB 3RP2A 3BIUH 2R2MB 2P3FH 3SU3A 3EDXB 2O8WA 4Y8XA 4B2AA 1TGSZ 1GPZA 4ABIA 3LH1A 4X2WA 1ZTJA 2FYQA 2G4UA 1E37B 5K7RA 4ZHAA 2BDGA 2WYJA 3TITA 1ANBA 1MU8B 1EAUA 4Y8YA 4Y7BA 1P9SA 3BTFE 4JMYA 2G55A 4IW4E 1TABE 5JDUB 1PPZA 1G37A 1PPEE 2QYIA 1XKAC 3A7WA 3MOCA 2WV4A 1DUEA 1SGDE 1GJDB 3MH7A 4IGDA 3RXRA 2XCNA 1CT4E 1C5WB 3LC3A 1TYNA 1Y3VA 1UTJA 1UK2A 1Q3XA 4CBOA 3EE0B 6CHAB 2B7DH 1U6QA 2GZ8A 4A7IB 1YPMH 2BY5X 1DVAH 5C2ZA 3FFGA 1AI8H 1W7XH 3MTYA 1FY8E 2A5KA 5FPYA 1QB9A 2HLCA 5L6NH 3U1JB 3HKIB 1EPTC 3ZVFA 2RA3A 4YOIA 1K28D 2Y81A 5ESTE 2UWOA 1NFWA 1AWFH 5A8YA 4K5ZA 2Y80A 5DP7A 4CRDA 5C5NA 1P09A 2BD8A 4K1TA 1SFQB 2OC1A 2HGTH 3F9HA 3N7OA 3PO1C 1O3KA 3LGTA 4WF8A 5EW2H 3Q3KA<