1O32A

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o32A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o32A02
5J4QA 1RTFB 1J14A 3RXGA 3S7KB 2ZFSA 2RCEA 1O2KA 2BY8X 4F4OC 1A2CH 2J92A 1CSOE 1HUTH 4OS2A 1O2GH 2K1QA 1MZAA 2C8XB 4NZQA 2VINA 4H6TA 1UK4A 2JETB 1V2PT 3DHKH 2F9VA 5T6FA 4A5TS 1NPMA 3ENSB 3KQCA 3T28A 3GY5A 3SV2H 3SBKA 1GDQA 5I25A 3PWBA 3B9FH 3NK8A 5LPEA 1BUIA 4Y6DA 2CXVA 3ELAH 5GPIB 1ZSKA 3P70B 5AVDA 4ABHA 4X6PA 1BT7A 1ELAA 3D49H 3OSYA 2GCHF 1C2JA 1P2JA 4J2YB 3GYMA 1SQAA 4WMEA 1XUKA 5BRRE 5JYIA 5EXNA 3DFJA 3LT3A 3RM2H 3BSQA 3SNDA 2FLBH 1SQTA 3EA9A 1ZSJA 1F92A 1C2KA 1TFXA 3F1SB 4FUHA 2FODA 3M7TA 1GMCF 3D65E 3STJA 4BTIB 3LGTA 5FX5A 1VCQA 1O34A 1S85A 1FY5A 4YTAA 3UNSA 1Z6EA 5L30H 1OP2A 3VGCC 1VCWA 2PGBB 3LONA 2FX4A 4JK5A 4NFEA 1WOFA 3O8RA 1KTSB 3B23B 3BTTE 4ZKSU 3VXFH 1JRTA 1GHYH 4I31A 1O3EA 1THSH 3ZZBA 1O3DA 2STAE 3A80A 1A0HB 5J4SA 1ETTH 4XBCA 1N6YA 3I78A 4RKOB 1Y3YA 1O3HA 2ZEBA 3U8TH 2Z7FE 4XE4A 5EW1H 3E16B 4RSPA 4ABEA 1WQSA 1IQKA 3M5OA 1KSNA 1QGFA 1F2SE 3QGNB 1H9LB 3D62A 1W2KH 2H2ZA 5EQRA 1C5WB 2TGDA 1W7XH 1V2LT 1DPOA 1TNKA 3MH5A 3LU9B 3HKIB 8LPRA 4CBOA 1O3BA 1F7ZA 3BN9A 3ATLA 1QL7A 2ZGCA 3Q3XA 1HIAB 1RXPA 1RGQA 1MTSA 1Y5BT 3QTVH 3EAJA 4OGXA 4ABIA 3SGQE 1L2EA 3PMJA 2FOGA 5L2YH 2F9NA 2B0FA 6CHAB 1YGCH 1GI3A 1SLVB 3SU2A 2A4GA 1GVLA 1O2RA 3KGPA 5DP9A 5SGAE 1ZPBA 3TNTA 1GI1A 2PTNA 1QBVH 5A8ZA 2VGCB 1MBQA 1F0RA 1TGBA 1C5TA 2D1JA 1AHTH 2QCYA 1Z71A 4K8YA 3TNSA 1G3DA 4NG9H 1FY4A 2P94A 3DUXH 4XDEA 1DWEH 1GG6B 4YLUA 2GZ7A 3RXVA 1J9CH 2G81E 2ZPSA 1A1RA 1VITF 2QIQA 1DM4B 5LPFA 5A0AE 2XCFA 3VB5A 1C2MA 4KGAA 4HZHA 1O5EH 3F9EA 5JB9S 1KLIH 1YYY1 2F9UA 1UVTH 3MNSA 4DVAU 1V2TT 1NTPA 2D2DA 1MQ5A 3TIUA 4D7GA 1C5OH 1ZMJA 1G32B 1TONA 2ZGBH 2EA3A 3MO9A 3UTUH 2WPHS 3E0NB 1YPEH 2ZGHA 1O2UA 1C2DA 2SGFE 1QL8A 1AU8A 4LOYH 1HIAA 4Y8ZA 3ZVBA 2Q6FA 2BLOA 3RU4D 2BD4A 5FXLA 5AHGH 1TGSZ 2HNTE 3PMAB 1RS0A 1C2FA 1N8OB 2R2MB 2BD5A 1A61H 1GHBF 2SGQE 5DP3A 4K69A 1OKXA 1KY9A 5F8ZA 1K2I1 4U32A 2D26C 1E34B 1XVMA 1QA7A 4THNH 3UQVA 2A0QB 4U2WA 2UWLA 1LHEH 3HATH 4Q80A 1V2NT 2VIVA 3SN8A 2Y7XA 1UTQA 4TYDA 2G5NA 1BJVA 1YCPK 5GCHG 2M5TA 3A85A 1SGYE 1TNLA 3RM0H 1K1MA 1SHHB 1SBWA 1ZZZA 4D9RA 1L0ZA 3GY8A 1J8AA 5A8XA 5C67A 1P12E 4X8TH 4MNVA 2WPKS 3PLKA 1AE5A 4GHQA 2BVRH 1GI4A 4NCYA 1KXAA 1O5FH 2A5IA 1RTLA 1XUFA 1SQOA 1C2HA 1GCTB 1LHCH 1TX7A 1FLEE 4H42U 5G4BA 2VU8E 3HPTB 3U9AH 4Q7YA 1GBKA 3BTKE 2TRMA 1TX8A 3R0FA 4JCNA 1GGDC 1GMHG 1LVYA 3ATIA 3BTEE 3VXEH 1AFEH 1DOJA 4B1TA 4OS7A 5GCHF 1YPHE 2F3CE 3P17H 3GDSA 3FFGA 4Y7BA 1HAXB 1A5GH 3P8GA 3SGBE 1O3OA 1O2NA 1IHSH 1F0TA 1CBWC 1HYLA 1TNHA 4BXWA 2BYAX 2HNTF 1DY9A 1O3KA 4WMFA 3ZZ9A 4X6OA 1ACBE 2DE8A 2FOCA 1O5BB 2BTCE 5TCAA 1SGNE 2EI8A 4BAHB 3SW2B 3RXUA 3RP2A 1GBJA 1W12U 1RJXB 1ZRBA 1EAIA 3S0NA 1FONA 1MTNC 4DT7B 3TPIZ 1V2QT 3PM3A 3TH2H 4X2XA 1EXFA 4DIIH 2XWBI 4X8SH 1J15A 2BD2A 4FU7A 1XXDA 1T31A 2GT8A 1BTHH 1C5PA 1UJ1A 4BOHA 1G37A 1A4WH 2SNVA 3M36A 3URCA 1FUJA 2TGAA 2VGCC 2BQWB 3TK9A 1FJSA 1UVOA 3CENA 1EAXA 3M3TA 1S0QA 4KTSA 3UNQA 1FAXA 2ODQA 3AW0A 4LZ4B 1SGEE 5ESTE 1UCYH 4JK6A 1WYKA 1GBIA 1P11E 1Y5AT 5IDKA 1GI7B 5CE1A 1XUHA 3QWCH 3QZQA 1BMAA 2NU4E 3ZVGA 2ZU3A 1S6FA 1AVXA 1ETRH 3SU1A 2C93B 2JH6D 4NGAH 4U30A 4XBBA 4Y8XA 1UTPA 2R9PA 6GCHF 1T8OA 3RXEA 4IS5A 2B9LA 1NT1A 1YPJH 1QA0A 3EDXB 1C1OA 3SU5A 2Y81A 2ZDAH 2XXLA 4Y7AA 3SGAE 1D6RA 5FPYA 2QXJA 2AMQA 4HI3A 2Y82A 4ASHA 1ANEA 1F5RA 2GCTB 5A8YA 2V3OH 2Q1JA 5EW2H 5C1XA 4WF8A 2W3IA 4ZKNU 2SGPE 3EA7A 2BY6X 6LPRA 1ORFA 3NCLA 3ZZDA 1F5LA 1GL1A 4I7YH 2GGVB 2RG3A 6CHAC 4MPWA 4YOJA 3MU0A 3EQ0H 1NFXA 1AUTC 5FHTA 1VITH 1O3MA 2UUFB 1TMUH 4NIXA 3M3VA 3VGCB 2THFB 1BTWA 5HYOA 3ZZ5A 1SC8U 3SU0A 3LJJA 4NSVA 3BEUA 1DITH 4MPXA 5HM2A 3P8OA 3SZNA 3KNXA 5ESBA 2D8WA 2ULLA 1UCYK 3BG8A 4CRFA 1AVGH 1QIXB 3ZZ6A 3TJOA 1PPCE 2JH0D 3UWIA 2Y5GA 6GCHG 1C1MA 3RC5A 5I46H 4HFPB 1G36A 3V0XA 4RKJB 2P59A 1NS3A 1Z8RA 1GG6C 1TNJA 1S5SA 4FUCA 3TLOA 4B73A 3GCNA 3RXBA 1A5HA 1K1IA 1BTXA 1SMFE 4O97A 1FIZA 1GI0A 1DWDH 1TPOA 1SGPE 3T62A 5A0BA 4CH2B 4YLQH 1KXEA 1QY6A 1K9OE 4LXBH 1AZZA 1K22H 4TY7A 2GCHG 1BTYA 2WPIS 3QGJA 2F9PA 3KN2A 3QUMP 1WTHD 4ESTE 2BLVA 5HGGA 5GWZA 1AUJA 1ZSLA 1W0YH 1GJ8B 4X2YA 1V2RT 1TE0A 2QYIA 1EP5A 3K2UA 3LJOA 1O30A 5LPRA 3BG4C 2ZO3H 4IMQA 1A3EH 4ABGA 2VJ1A 2OC0A 1G9IE 3KF2A 2ZP0H 2P95A 2GDEH 1UHBB 3QTOH 3CP7A 1N6XA 3S9CA 1V2OT 2XTTB 1LO6A 1QRWA 1ELCA 2OXSA 4BAKB 1YM0A 1QRXA 1P8VC 1BMLA 3ZZ4A 1UK2A 2ZCLP 4B71A 3FZDA 1GBTA 1AQ7A 2VVVA 2AERH 1TX6A 2WYJA 4B76A 1CT2E 2HNTC 4IBLH 4A92A 1SSXA 1DY8A 1UK3A 2PW8H 5DKMA 2BVXH 2G51A 4K1SA 1FAKH 5FAHA 3GCHC 2ZQ1A 1K1OA 1GDUA 1JRSA 1O39A 3MI4A 5A2MH 1VJ9U 3RC4A 1Z1IA 3A8BA 1YP9A 1GBCA 1TMBH 2JKHA 1V3XA 2FM2A 2Z3EA 2BZ6H 1O3JA 2P3FH 1JXPA 4IMZA 2BDIA 4IN2A 3MTYA 1TABE 3OTJE 2ZDNA 1LPKB 2QF3A 4Q7XA 1IQMA 2PWXA 3KCGH 2GTBA 2C3SA 5DK1A 1P9SA 2A45B 4JZDH 1ZMLA 1QJ7B 2RA3A 1HJ9A 1OOKB 1C5XB 4LZ1H 1S6HA 2BDYA 3NPSA 1TBZH 1CU1A 1HAIH 2HWLB 1BBRH 1XXFA 1O3PB 2FOHA 1CHOG 3M35A 1O35A 1TPPA 1SOTA 4JYUH 1M9UA 4TWWA 1O2LA 4M7GA 3TH3H 2PKSB 2V3HH 1UTLM 1Y3VA 3SI4H 1MAXA 4ZROA 1OYTH 1ABJH 3A8AA 3VFEA 5FCRA 1BIOA 3BTWE 1H8DH 1TNIA 2BY9X 1PQ8A 5FX6A 1BTZA 1AFQB 1T32A 1CA0C 1H8IH 3M61U 1H4WA 2KAIA 4I8JA 1MKXH 1SG8B 2AFQB 4UEHH 1EATA 1TBQH 2SGDE 1A3BH 1AIXH 4DCDA 1UTJA 3KQDA 4XFQA 2XBVA 3LC5A 2R3UA 1TGCA 2GMTB 1UVSH 4FVBA 8KME2 2Y80A 2QXIA 3SJOA 1V2VT 1EZQA 5DP7A 1GBBA 1AZ8A 5PTPA 1LTOA 2G00A 3W94A 1NRNH 1DVAH 1CGIE 1O3NA 2XC0A 1S81A 3T26A 3TITA 3SNBA 2PUXB 1V2WT 3EE0B 2VWOA 1QL9A 2NU3E 2XCNA 2A4OA 2PSYA 3OX7U 4AN7A 1ESBA 2A5AA 3ATKA 2O8WA 3A81A 3EYDA 4RN6A 1IQFA 2QA9E 2OBQA 3TJUA 3L33A 2Z6BD 4FXGH 1EJMA 3RXHA 1KLTA 2O8LA 2JH5D 2B5TB 1LHFH 1UMAH 3MNBA 1O3AA 3FVFB 3A7XA 4E06H 2FWWA 3Q76A 1L1JA 4FUDA 1NRQH 1L4DA 1DDJA 4OS4A 1ABIH 2QC2A 2A32A 1CGJE 1ZMNA 4GHTA 3SUEA 2F9OA 1NFUA 2O9QA 1PPBH 5JPMH 1P2KA 2Y5HA 1HAOH 1C5RA 2JETC 1S84A 1D3QB 1HXFH 1TBRH 3ZZAA 1BTUA 1SHYA 2BB4A 3A7ZA 1C1WH 1C9PA 1O2HA 4HGCA 4UDWH 1A7SA 1LVOA 4TY6A 3MFJA 2ZTXA 1YLCA 4Y11E 4K60A 4FU9A 3RXKA 1XUGA 2ZU5A 2A5KA 1FMGA 4NIWA 4FUBA 4LK4A 1F0SA 1EAUA 2FX6A 3RU4E 1WV7H 1QB1A 1QJ1B 1YBWA 1OYQA 3URDA 4NZLA 3T25A 1O2SA 2BQ7B 2J94A 2ANYA 1Q3XA 2BM2A 2G52A 1ANDA 1YKTA 3UOPA 1TNGA 1O2TA 2HLCA 2BDBA 2FI4E 4CRBA 3TGIE 3SI3H 8GCHF 1GCDA 1KXBA 4I8LA 3GCOA 5GJ4B 1MCTA 3A8DA 2I6QA 2SNWA 5TCCA 4NFFA 1ELDE 4ISIH 3ZZ8A 2PLXA 1EZXC 3TGKE 1QCPA 1SGQE 4INKA 2BOHB 1BA8B 4CH8B 1MD7A 4Z6AH 3RLYH 1P3EA 3OY6U 3SJIA 3SU6A 2O8TA 1CBWB 3M5NA 4GCHF 4GAWA 3RXJA 4WJG2 3C1KA 1TOCB 4AGKA 2OLGA 1ESTA 1ZPCA 1GBAA 2WPJS 2GCTC 1PPZA 3BEIB 4JMYA 2ZDVH 3BTHE 2CHAB 4Y79A 2P8OB 3UREA 1OWJA 1RD3B 4K5ZA 2NU0E 2G55A 1C4U2 1Y5UT 3DT0H 1BBRK 4X1PU 1BRUP 3GY7A 2BLQA 1AKSA 5TJXA 1Z7KA 2W3KA 4TWYA 1T4VH 4K8BA 1KIGH 2FMJA 1TRMA 1YPKH 2BDHA 1SI5H 2VVUA 2PFEA 4VGCB 4X2WA 4MNWA 3U8RH 7KMEH 5EQSA 3NWUA 1EOLA 2Z9JA 3SHAH 4D9QA 2ZGJA 4GCHG 3SU3A 5GDSH 3K65B 4NIYA 4X1QU 5A0CA 3ZV8A 4MQAA 2WV4A 1BCUH 1LKBA 3GDUA 3IWMA 4CRCA 2YOLA 3AVZA 4ABJA 3QDZB 1GJDB 2W7SA 1L4ZA 4ZUHA 2A7JA 3PROA 2GVFA 4IC6A 2AGGX 4WXIA 1LKAA 2IN2A 2ODPA 2VWMA 2A4RA 4ABAA 1P2OA 1Z8IB 3PWCA 2ZU2A 2Y5FA 1C1VH 2BLWA 1WTGH 1OWDA 1P3CA 4YZUA 1MMJN 1HAVB 1P03A 1DSTA 1TYNA 2HALA 2FYQA 1TPAE 3F6UH 2FZZA 3UIRA 3BEFB 1PPEE 4IN1A 1GBMA 1EAWA 5H4IB 2ZHFH 4NA7A 2F83A 1KDQB 1T8LA 1Y8TA 3BTDE 1OWEA 1SLWB 2NU2E 1FPHH 3SQHE 2GMTC 5B6OA 1INCA 1P2IA 2BD9A 3FZZA 4A1VA 3M5MA 5DP8A 2J95A 1AWFH 3MOCA 4YO9A 3P8NA 2ZU1A 3TVJB 3FAOA 2Z3DA 1EASA 2H9HA 3MWIU 1DLKB 3FANA 1K28D 1TA2A 3SNAA 1AGJA 2G4TA 3E0PB 1C1PA 1G30B 4ZHLU 1GGDB 3E3TA 1CHGA 1C4V2 1LHGH 3RXCA 4OS5A 1ANCA 5HMAA 2ZHEH 5JBAS 1CA0B 1HPGA 2WUBA 1PPFE 4B74A 4CHAB 1GCTC 2R0LA 1EQ9A 3V7TA 5EPNA 1EJNA 2ANMH 1O2PA 4JZIA 1EZUC 2GT7A 2CN0H 3SV9A 3I29A 1SFQB 2GV6A 1O0DH 2RDLA 1EPTC 1OWHA 3NUMA 1VGCC 3ZVCA 4ISNA 4D8NA 1G3EA 4UFGH 5LGOA 4YOIA 3L3TA 1C5MD 3RC6A 1C1QA 3PO1C 4Y8YA 1O3FA 3E8LA 3QLPH 4NSYA 2UWPA 3PMHB 3P92A 4K2YA 4TPYA 3D23A 4INHA 1PYTD 1BMMH 1QRZA 1NU9A 3RMNH 3GISB 4ISOA 1N8OC 3K9XB 3SV7A 1K21H 2ZDKA 4CR5A 2Z9IA 1FI8A 5T6GA 2EI7A 2UUKB 1HXEH 1P0SH 3PO1B 4FUFA 3S9AA 1ZGIA 1LDTT 3VB6A 2ANWA 2H1UA 2ZC9H 2ZHDA 3NKKA 2BXTH 1VGCB 2YNAA 1QNJA 1GHBG 2XBXA 2EEKA 1NO9H 2VB0A 3BIVH 2C8ZB 3Q77A 3R3GB 3RXQA 4OGYA 1TPSA 4I32A 2BZAA 3UY9A 2TGPZ 1FN8A 4AFQA 7GCHG 2PV9B 1L1GA 5E0HA 1QQ4A 1QURH 1DFPA 1WCZA 1NROH 4UE7H 3NXPA 1D3PB 4BXSA 3A7TA 1X7AC 1NC6A 2VIDA 1NFWA 3A8CA 3ZVFA 2ZNKH 1C1UH 1SB1H 1O2OA 3KQBA 2NWNA 1LPGB 3GCTG 4ZHMU 3WY8A 1BDAA 1J16A 4IC5A 3EA8A 1V6DA 1AN1E 4NA8A 5CHAB 1SL3A 2OBOA 4K3JA 1MTUA 2IJOB 1P9UA 3U98H 1O36A 3UOUA 2ZFRH 3LGWA 1F5KU 1W10U 2FS9A 4ZKRU 5EODA 9ESTA 3F68H 1ZR0A 4DG4A 1GMDF 3BTGE 2AGEX 3MYWA 3AAVA 8GCHG 4AFSA 2FI3E 1EPTB 3KEEA 2QXGA 4UD9H 2QXHA 3UNRA 1GHVH 2VIPA 4J1YA 1QB9A 3SO3A 5F8TA 3PLPA 3SOSA 1IQLA 1GJAB 2AS9A 3JZ1B 4MNYA 1BB0B 2A7CA 2ZHQH 1O2IA 1K1NA 1E38B 2GKVE 3LOXA 2XBYA 1GI8B 3FP8E 1ZHRA 2QN5T 1ZGVA 1JOUB 1O2WA 2A31A 4AG2A 2UUYA 3KIDU 1KLJH 2LNCA 5JBCS 3SV8A 6ESTA 4DIHH 2BHGA 1WU1A 4WXVA 4JZEH 1V2KT 2P3UB 3VB3A 4R8TB 2ZA5A 2ALVA 3DD2H 1K1PA 1SR5C 1ANBA 1Y3WA 1ZRKA 1C5YB 1W11U 2I6SA 1KXCA 1HAYB 3RXLA 4A6LA 1BZXE 5K7RA 4UFFH 1WBGB 1DS2E 4Y10E 1HLTH 2CV3A 1DUAA 5FCKA 7LPRA 3M37A 4WH6A 1GI9B 3T29A 4AX9H 1OP0A 1SPJA 2VH0A 1NRSH 1XVOA 2VNTA 2XC5A 3A87A 4JYTA 1BHXF 2OC8A 3A88A 1W3CA 2HPQH 1QHRB 1VCPA 2EI6A 3RXFA 3SUGA 3L6PA 3M7UA 4A1XA 1W8BH 4X1NU 1C1TA 1T8NA 4ZHAA 3H7TA 1TQ7B 2QAAA 1E0FD 2XRCA 1C2LA 1P09A 5A09A 2Y7ZA 1O3IA 4FUGA 1GHAF 1P05A 2AIQA 4GUXA 4YOGA 1TRNA 2H5CA 2QV1A 1E36B 3C27B 3KQEA 5FPSA 5JBTA 1E35B 3U1JB 1O5GH 2FESH 5F8XA 3RMMH 1TAWA 1IQNA 2STBE 2ESTE 1DXWA 1SGRE 1GJ9B 4X1SU 2FTMA 1B0FA 4FUEA 1VR1H 3SUFA 3QZRA 1P57B 3A7VA 4JYVH 1C5UA 3TU7H 1IQEA 2BVSH 3RLWH 1FNIA 2AYWA 2G5VA 2AIPA 2HGTH 2WPMS 5FPTA 2TGTA 4DGJA 3DFLA 1O38A 2H5DA 1ELGA 3ATMA 4H6SB 5DP4A 5EPYA 4U01A 1W0ZU 1BJUA 4UFDH 2ZDLA 1RRKA 3HGPA 2J34A 2NU1E 4E7NA 2FEQH 3M7QA 1WQVH 4WY3A 2ILNA 1GI5A 2J38A 1OWIA 4A1TA 1O5AB 1AB9C 3RXMA 2IOTA 1MU6B 2F9BH 3MU4A 3GCHB 5JBBS 2RA0A 3ZVDA 4BAQB 1D4PB 5BPEA 1G2MA 1HFDA 4ABFA 4ZH8A 2ZTYA 1AD8H 4XBDA 1THPB 1NY22 4H4FA 1LCYA 1B5GH 3MMGA 1O31A 1YLDA 1OPHB 3F9HA 2ZDMA 2OC1A 3AW1A 2G4UA 3F9GA 1PQAA 1Z1JA 4X1RU 3MH4A 4KP0A 1YC0A 4AFZA 2P8OC 4AYVB 4MPUA 2XYAA 3KL6A 4FVDA 1GWAA 3PB1E 1EKBB 1XMNB 3GYLB 3LGUA 2A1DB 1TA6A 1TRYA 2ZHWH 3ZYDA 4ZMAH 4OS6A 3TH4H 1Z6JH 1Z8GA 2XWAA 4KKDA 4CR9A 2QY0B 1XM1A 3I77A 2HVXA 1C5VA 3V12A 1ELBA 1P2NA 2ZKSA 5ETXA 3CS7A 4D76A 3W95A 1LMWB 1TGNA 3Q3KA 4X2VA 5EOKA 2FPZA 1NFYA 4AOQA 2Y6TA 5DPAA 1SGFA 1RIWC 1RTKA 1DX5M 3QN7A 1P02A 1TALA 1THRH 3SJ9A 1BTPA 2W7UA 3M5LA 4DY7B 4YT7H 1QTFA 2P3TB 5E2OA 1FY8E 1SGFG 4ZAEA 3OYPA 5E2PA 5C1YA 4BAOB 1YCPM 1HDTH 3SHCH 2XC4A 1O2JA 1SGTA 1FDPA 1FIWA 1QJ6B 2ZFFH 3RXPA 4IW4E 3E1XB 3B8JA 1C9TA 1XX9A 3RUOA 7ESTE 1UTOA 2BD7A 1IQJA 1HRTH 2C8WB 1HGTH 1MH0A 2UUJB 1OS8A 2B7DH 2WPLS 5EU8A 5C2ZA 3ZZCA 1O2XA 4AG1A 3MH7A 3BIUH 5EGMA 1SLXB 1GDNA 3BTFE 4ISHH 5C5OA 5EXMA 3LIWA 3PTBA 1AO5A 3MNCA 4MPVA 2ZFQH 2ZFPH 2ZZUH 4SGBE 2Q6DA 4BTTB 1EJAA 1Z8JB 1RIWB 2V6NA 2Z3CA 1GHXH 2J9NA 4I8KA 4X0WU 1O2VA 1YPGH 1CGHA 1O3GA 3UFAA 1K1LA 1BHXB 5EQQA 4YT6H 1ELTA 1GL0E 8ESTE 1KXDA 1T7CA 2ZPQA 3BG4B 2BMGB 3ITIA 2R3YA 3O8CA 4I33A 1O32A 2SGAA 1EX3A 1FY1A 1C1NA 2CJIA 3SJKA 1FXYA 4MDSA 1OP8A 1DUEA 2TBSA 1CT4E 1O2QA 1LQDB 3H7OA 1CT0E 1LVMA 1S82A 4X6NA 3MO3A 1GBHA 3MU1A 5HM9A 5LH8A 1TB6H 1ZTKA 1CHOF 2XW9A 3LGYA 1RFNA 2PGQB 4NIVA 4R0IA 2QF0A 1HCGA 2AMDA 1GMHF 2ZF0H 1BITA 2ZFTA 3VB7A 1YPMH 4O3UA 4X6MA 4CRDA 3GY4A 1GVZA 1A5IA 3RU4T 1HJAB 4GVUA 1JWTA 4MVNA 2SFAA 1IQIA 4K1EA 3SUDA 3MO6A 1YPLH 4MNXA 4ZXYH 2BX4A 4E05H 4K1TA 2FOBA 3S69A 4CBNA 1MKWH 3OU0A 1D6WA 3P95A 1PQ5A 1TGTA 3U69H 3UQOA 1ETSH 2Z9KA 3AAUA 4DW2U 1C2IA 2PHBA 2EC9H 1H9IE 1CO7E 1NM6A 2WINI 2OQ5A 3LPRA 4KTCA 2PKAB 4AZ2B 2PSXA 2GZ9A 4YM9A 2HRVA 1SOZA 1ZOMA 1S0RA 1HAHH 1T4UH 5GXPA 4Q2KA 3PTNA 4NA9H 3GY2A 1K1JA 3G01A 1C5SA 5AFYH 1ELEE 3V3MA 1SFIA 1GJBB 2PR3A 1O33A 5F6MA 2IPHA 3UWJH 1S83A 4IGDA 1Y3XA 3HGNA 1Q2WA 1ZJKA 2ZCHP 2FS8A 1AWHB 1AVWA 1SGDE 1MU8B 1PJPA 1HAGE 1UTKA 1C5NH 1GMDG 1CVWH 4F49A 4GLYA 5DP5A 1SGCA 1ZYOA 4CHAC 3VEQB 1EOJA 1QBNA 3STIA 4CREA 1MAYA 3A7YA 2BY7X 3V13A 1U6QA 1MCVA 3E6PH 2V35A 1NU7B 4FU8A 1HNEE 1A0LA 1A46H 2LPRA 1SGIB 2SGEE 3LH1A 5L2ZH 1FY3A 4ABDA 3TJVA 2TIOA 2BD3A 2GZ8A 3A82A 1C2EA 2BOKA 2WUCA 2FOEA 2PKSC 1ZLRA 3MU8A 4O03A 2VVCA 1B7XB 3A83A 1IHTH 4AORA 3LGVA 1O5CB 4CRGA 2R2WU 1XKAC 1PFXC 1EP6A 5DO4H 2BDCA 2J2UA 3PYHA 1UCYE 1D3DB 3GY3A 2PUQH 3BF6H 1MQ6A 1IOEA 5T3HA 2BX3A 3LGIA 2AGIX 1C1RA 4PROA 1GHZA 1O2YA 2ASUB 2FO9A 2BQ6B 2QGRA 4A7IB 5E0GA 1C1SA 1HB0B 1KYNA 3VB4A 1EZSC 2VWNA 5T6DA 1T8MA 5CMXH 2ANKH 1UHBA 1OWKA 1DLEA 2BD8A 3Q00A 2DUCA 1DE7H 1EB1H 1GHAG 2VIWA 1ELVA 3RXOA 3FP6E 1YPHC 3T5FH 1NZQH 5EXLA 1PYTC 2FOAA 1Q31A 1LQEA 4O3TA 3U1IB 1MD8A 1NRRH 4BNRA 2ZU4A 4UFEH 4NWLA 2Z9LA 1UVPA 1TWXB 1W14U 2Q6GA 2XNIA 2BDGA 3RXRA 4X8VH 3KHVA 3TGJE 4ZXXH 2H9TH 2PKAA 1KDQA 5HXFA 3F9FA 4BANB 2O8UA 2OINA 1L1NA 4DURA 1DWBH 1FQ3A 4CRAA 1Y59T 1AE8H 2FOFA 1LHDH 1QR3E 2ZTZA 1ESAA 3RXSA 1J17T 3A86A 1NN6A 1CE5A 5L6NH 2FDAA 2P93A 3NZIA 3OY5U 3Q3YA 4FUIA 3UR6A 1P04A 5ABWA 1NESE 2A7HA 1XKBC 2OD3B 1O2ZA 3DA9B 4DJZB 1WUNH 1AI8H 2KAIB 5DGJA 1GJ5H 3SNCA 3MU5A 1WAYB 1O5DH 2FXRA 2FYRA 1XUIA 3E91A 3TJNA 2H9EH 2Z9GA 1TIOA 1AY6H 2BXUH 1O37A 1ARCA 3MNXA 1ZHPA 1WSSH 1YCPH 2A2QH 2OCVB 2ZI2H 3EGKH 4AFUA 5E8EH 1MKWK 3T2NA 3A89A 2FP7B 5FBIA 3QO6A 4AGJA 2VIQA 1KXFA 4B2CA 1N1LA 4WWYA 1O3LA 4ISLA 1VZQH 1FN6A 1QB6A 4B2AA 3UUZA 3RDZA 4E7RG 3LH3A 2DE9A 1AMHA 1P01A 1VJAU 1YF4A 3HKJB 1JIMA 1B0EA 1UO6A 4MG3A 2CF8H 3K6ZA 5C5NA 4GSOA 1UTMA 2G8TA 2HOBA 1UTNA 2VIOA 1G3CA 1GMCG 1CA8B 1A0JA 2ZCKP 2AEIH 1GBFA 3FP7E 2TPIZ 2W26A 2W5EA 1AKSB 3RMOH 3QK1A 2AH4X 4INLA 1BOQA 5DJ7A 4Y76A 3LDXH 1TLDA 4X8UH 1FPCH 2O8MA 1V2ST 2C8YB 4WVPE 4B75A 5C20A 1SVPA 4I8HA 4SGAE 2OC7A 1XUJA 3JZ2B 1ID5H 4Y71A 1GPZA 2BDAA 2P16A 4OS1A 4XOJA 1GJ7B 3A84A 2ZECA 4JZFH 4JZ1A 3VPKA 3RXAA 5GIBA 3BV9B 1H1BA 3S7HB 3BTQE 1P2QA 1V2JT 2OUAA 4O9VA 3H5CB 1C5ZB 4Z0KA 1GI2A 1GJ6A 3LC3A 2Z94A 1GBLA 3PLBA 2R0KA 4TPIZ 1QQUA 2GX4A 1DXPA 3A7WA 3IITA 5E0JA 3SNEA 1AFQC 2WV5A 4GPGA 2ZPRA 2FIRH 1HAPH 2A4QA 1ZTLA 1EPTA 1BQYA 1GVKB 1MBMA 3ATWA 4Q7ZA 2FLRH 1FV9A 4MLFB 5FBEA 2VH6A 1P10A 1DWCH 1HAZB 2ZIQH 5F03A 1IQGA 1GBDA 4KTUA 1V2UT 1F0UA 2GV7A 4WMDA 2GD4B 1G3BA 1W7GH 1CQQA 1D3TB 1LVBA 1DSUA 1FZZA 1HAVA 3PV4A 4WH8A 3CS0A 2FTLE 2FOMB 3GY6A 2CF9H 1W13U 1PPGE 1BRCE 5IYTA 2CGAA 3ZYEA 1BRBE 3ZV9A 1VITG 1TQ0B 5EG4A 4BTUB 2ZWLH 3P8FA 1BRAA 5C3NA 1ARBA 4VGCC 3HK3B 1ZJDA 2H6MA 3M3SA 1O3CA 3GDVA 2V0BA 1C2GA 2FI5E 1HBTH 3TK5A 1Y3UA 3GCTF 1E37B 1KTTB 2CMYA 3UPEA 7GCHF 3ESTA 5K0HA 1EUFA 2GP9B 2ODYB 1V2MT 2ZGXH 4DOQA 1MTNB 2ALPA 1TMTH 2CHAC 4ABBA 3N7OA 1DT2A 4AYYB 1LPZB 3BTME 3SQEE 3SORA 1GI6A 1PQ7A 1MZDA 3E90B 3SU4A 1ELFA 2ZQ2A 4B2BA 5AFZH 4BAMB 1JIRA 3T27A 4Y0ZE 3SJ8A 4ZKOU 1MUEB 1ZPZA 1IAUA 2BY5X 1D9IA 3MHWU 4AB8A 1C5QA 3PMBB 3RXTA 4I8GA 5AF9H 3IG6B 2XBWA 3O8DA 3TK6A 3RXDA 3SV6A 2B8OH 2OQUA 1G2LA 5CHAC 3ZZ7A 1TOMH 4KELA 1DICA 1JBUH 1QBOA 4XSKU 1ZHMA 3ZVEA 4YESB 5JDUB 1MTWA 5DP6A 2OP9A 4AB9A 3ODFA 3UR9A 1O2MA 3MH6A 3AASA 2J4IA 2HPPH 2GDDA 2C4FH 3O8BA 3GOVB 3ZZ3A 4D7FA 2ZG0H 3GICB 4NWKA 4MTBA 1SLUB 1P2MA 1BBRE 9LPRA 1OSSA 4FUJA 1BMNH 1GBEA 1PPHE 1P06A 3RMLH 3U8OH 1HJAC 3LKWA 2YNBA 2PTCE 3K6YA 1OXGA 5JB8S 2UWOA 1GHWH 1OX1A 1MKXK 3RXIA 1GJ4H 1EB2A 4Y0YE 3HK6B 3ODDA 1NRPH 1ZTJA 4HTCH 2A2XH 5DG6A 1AB9B 3QX5H 1QFKH 1DANH 2AMPA 4UONA 1C4Y2 1HJ8A 4QT8C 1MTVA 3ZVAA 1JMOH 1H9HE 1HV7A 2C90B 1GJCB 5C1UA 1IQHA 2VWLA 1UVUH 1C5LH 2OTVA 3S9BA 2F91A 2WYGA 3P6ZB
chains in the Genus database with same CATH superfamily
5J4QA 1RTFB 1J14A 3RXGA 3S7KB 2ZFSA 2RCEA 1O2KA 2BY8X 4F4OC 2YMSC 1A2CH 2J92A 1CSOE 1HUTH 4OS2A 1O2GH 2K1QA 1MZAA 2C8XB 4NZQA 2VINA 4H6TA 1UK4A 2JETB 1V2PT 3DHKH 2F9VA 5T6FA 4A5TS 4I86A 1NPMA 3ENSB 3KQCA 3T28A 3GY5A 3SV2H 3SBKA 1GDQA 5I25A 3PWBA 3B9FH 3NK8A 5LPEA 1BUIA 4Y6DA 2CXVA 3ELAH 5GPIB 1ZSKA 3P70B 5AVDA 4ABHA 4X6PA 1BT7A 1ELAA 3D49H 3OSYA 2GCHF 1C2JA 1P2JA 4J2YB 3GYMA 5C0UA 1SQAA 3PRDA 4WMEA 1XUKA 5BRRE 5JYIA 5EXNA 3DFJA 3LT3A 3RM2H 3BSQA 3SNDA 2FLBH 1SQTA 3EA9A 1ZSJA 1F92A 1C2KA 3OFND 1TFXA 3F1SB 4FUHA 2FODA 3M7TA 1GMCF 3D65E 3STJA 4BTIB 3LGTA 5FX5A 1VCQA 1O34A 1S85A 2L74A 1FY5A 3F3BA 4YTAA 3UNSA 1Z6EA 5L30H 1OP2A 3VGCC 1VCWA 2PGBB 3LONA 2FX4A 4JK5A 4NFEA 1WOFA 3O8RA 1KTSB 3B23B 3BTTE 4ZKSU 3VXFH 1JRTA 1GHYH 4I31A 1O3EA 1THSH 3ZZBA 1O3DA 2STAE 3A80A 1A0HB 5J4SA 1ETTH 4XBCA 1N6YA 3I78A 4RKOB 1Y3YA 1O3HA 2ZEBA 3U8TH 2Z7FE 4XE4A 5EW1H 3E16B 4RSPA 4ABEA 1WQSA 1IQKA 3M5OA 1KSNA 1QGFA 1F2SE 3QGNB 1H9LB 3D62A 5KECA 1W2KH 2H2ZA 5EQRA 5EIYA 1C5WB 2TGDA 1W7XH 1V2LT 1DPOA 1TNKA 3MH5A 3LU9B 3HKIB 8LPRA 4CBOA 1O3BA 1F7ZA 3BN9A 3ATLA 1QL7A 2ZGCA 3Q3XA 1HIAB 2V7QD 1RXPA 1RGQA 1MTSA 1Y5BT 3QTVH 3EAJA 4OGXA 4ABIA 3SGQE 1L2EA 3PMJA 2FOGA 5L2YH 2F9NA 2B0FA 6CHAB 1YGCH 1GI3A 1SLVB 3SU2A 2WHXA 2A4GA 1GVLA 1O2RA 3KGPA 5DP9A 5SGAE 1ZPBA 3FOAA 3TNTA 1GI1A 2PTNA 1QBVH 5A8ZA 2VGCB 1MBQA 1F0RA 1TGBA 1C5TA 2D1JA 1AHTH 5HKKD 2QCYA 1Z71A 4K8YA 3TNSA 1G3DA 4NG9H 1FY4A 2P94A 3DUXH 4XDEA 1DWEH 1GG6B 4YLUA 2GZ7A 3RXVA 1J9CH 2G81E 2ZPSA 1A1RA 1VITF 2QIQA 1DM4B 5LPFA 5A0AE 2XCFA 3VB5A 1C2MA 4KGAA 4HZHA 1O5EH 3F9EA 5JB9S 1KLIH 1YYY1 2F9UA 1UVTH 3MNSA 4DVAU 1V2TT 1NTPA 2D2DA 1MQ5A 3TIUA 4D7GA 1C5OH 1ZMJA 1G32B 1TONA 2ZGBH 2EA3A 3MO9A 3UTUH 2WPHS 3E0NB 1YPEH 2ZGHA 3F2GA 1O2UA 3CNRA 1C2DA 2SGFE 1QL8A 1AU8A 4LOYH 3F0PA 1HIAA 4Y8ZA 3ZVBA 2Q6FA 2BLOA 3RU4D 2BD4A 5FXLA 5AHGH 1TGSZ 2HNTE 3PMAB 1RS0A 1C2FA 1N8OB 2R2MB 2BD5A 1A61H 1GHBF 2SGQE 5DP3A 4K69A 1OKXA 1KY9A 5F8ZA 1K2I1 4U32A 2D26C 1E34B 1XVMA 1QA7A 4THNH 3UQVA 2A0QB 4U2WA 2W6ID 2UWLA 1LHEH 3HATH 4Q80A 1V2NT 2VIVA 3SN8A 2Y7XA 1UTQA 2KCOA 4TYDA 2G5NA 1BJVA 1YCPK 5GCHG 2K0QA 2M5TA 3A85A 1SGYE 1TNLA 3RM0H 1K1MA 3FN8A 1SHHB 1SBWA 1ZZZA 4D9RA 1L0ZA 3GY8A 1J8AA 5A8XA 3UAIC 5C67A 1P12E 4X8TH 4MNVA 2WPKS 3PLKA 1AE5A 4GHQA 2BVRH 1GI4A 4NCYA 1KXAA 1O5FH 2A5IA 1RTLA 1XUFA 1SQOA 1C2HA 1GCTB 1LHCH 1TX7A 1FLEE 4H42U 5G4BA 2VU8E 3HPTB 3U9AH 4Q7YA 1GBKA 3BTKE 2TRMA 1TX8A 3R0FA 4JCNA 1GGDC 1GMHG 1LVYA 2WV9A 3ATIA 3BTEE 3VXEH 1AFEH 1DOJA 4B1TA 4OS7A 5GCHF 1YPHE 2WPDD 2F3CE 1WXRA 3P17H 3GDSA 3FFGA 4Y7BA 1HAXB 2QF4A 1A5GH 3P8GA 3SGBE 1O3OA 1O2NA 1IHSH 1F0TA 1CBWC 1HYLA 1TNHA 4BXWA 2BYAX 2HNTF 1DY9A 1O3KA 4WMFA 3ZZ9A 4X6OA 1ACBE 2DE8A 2FOCA 1O5BB 2BTCE 3F2FA 5TCAA 1SGNE 2EI8A 4BAHB 3SW2B 3FO8D 3RXUA 3RP2A 1GBJA 1W12U 1RJXB 1ZRBA 1EAIA 3S0NA 1FONA 1MTNC 4DT7B 3TPIZ 1V2QT 3PM3A 3TH2H 3F0OA 4X2XA 1EXFA 3GS9A 2XWBI 4X8SH 1J15A 2BD2A 4DIIH 4FU7A 1XXDA 1T31A 2GT8A 1BTHH 1C5PA 1UJ1A 4BOHA 3EE7A 1G37A 2SNVA 1A4WH 3M36A 2M2AA 3URCA 1FUJA 2TGAA 2VGCC 2BQWB 3TK9A 1FJSA 1UVOA 3CENA 1EAXA 3M3TA 1S0QA 4KTSA 3DCLA 3UNQA 1FAXA 2ODQA 3AW0A 4LZ4B 1SGEE 5ESTE 1UCYH 4JK6A 1WYKA 1GBIA 1P11E 1Y5AT 5IDKA 1GI7B 5CE1A 1XUHA 3QWCH 3QZQA 1BMAA 2NU4E 3ZVGA 1YWUA 2ZU3A 1S6FA 1AVXA 1ETRH 3SU1A 2C93B 2JH6D 4NGAH 4U30A 4XBBA 4Y8XA 1UTPA 2R9PA 6GCHF 1T8OA 3RXEA 4IS5A 2B9LA 1NT1A 1WDIA 1YPJH 1QA0A 3EDXB 1C1OA 3SU5A 2Y81A 3U28C 2ZDAH 2XXLA 4Y7AA 3SGAE 1D6RA 2KZ4A 5FPYA 2QXJA 2AMQA 4HI3A 2Y82A 4ASHA 2RFKC 1ANEA 1F5RA 2GCTB 5A8YA 2V3OH 2Q1JA 5EW2H 5C1XA 4WF8A 2W3IA 4ZKNU 2SGPE 3EA7A 2BY6X 6LPRA 1ORFA 3NCLA 3ZZDA 1F5LA 1GL1A 4I7YH 2GGVB 2CK3D 2RG3A 6CHAC 4MPWA 4YOJA 3MU0A 3EQ0H 1NFXA 4RI0A 1AUTC 5FHTA 1VITH 1O3MA 2UUFB 1TMUH 4NIXA 3M3VA 3VGCB 2THFB 1BTWA 5HYOA 3ZZ5A 1SC8U 3SU0A 3LJJA 4NSVA 3BEUA 1DITH 4MPXA 5HM2A 3P8OA 3SZNA 3KNXA 5ESBA 2D8WA 2ULLA 1UCYK 3BG8A 4CRFA 1AVGH 1QIXB 3ZZ6A 3TJOA 1PPCE 2JH0D 3UWIA 2Y5GA 6GCHG 1C1MA 3RC5A 5I46H 4HFPB 1G36A 3V0XA 4RKJB 4Q63A 2P59A 1NS3A 1Z8RA 1GG6C 1TNJA 1S5SA 4FUCA 3TLOA 4B73A 3GCNA 3RXBA 3OTPA 1A5HA 1K1IA 1BTXA 1SMFE 4O97A 1FIZA 1GI0A 1DWDH 1TPOA 1SGPE 3T62A 5A0BA 4CH2B 4YLQH 1KXEA 1QY6A 1K9OE 4LXBH 1AZZA 1K22H 4TY7A 2GCHG 1BTYA 2WPIS 3QGJA 2F9PA 3KN2A 1H8ED 3QUMP 1WTHD 4ESTE 5FL7D 2BLVA 5HGGA 5GWZA 1AUJA 1ZSLA 1W0YH 1GJ8B 4X2YA 1V2RT 1TE0A 2QYIA 1EP5A 3FKSD 3K2UA 3LJOA 1O30A 5LPRA 3BG4C 2ZO3H 4IMQA 1A3EH 4ABGA 2KCAA 2VJ1A 2OC0A 1G9IE 3KF2A 2ZP0H 2P95A 2GDEH 1UHBB 3QTOH 3CP7A 1N6XA 3S9CA 1V2OT 2XTTB 3OEHD 1LO6A 1QRWA 1ELCA 2OXSA 4BAKB 1YM0A 4XRNA 1QRXA 1P8VC 1BMLA 3ZZ4A 1UK2A 2YMSB 2ZCLP 4B71A 3FZDA 1GBTA 1VKYA 1AQ7A 3WWBA 2VVVA 2AERH 1TX6A 2WYJA 4B76A 1CT2E 2HNTC 4IBLH 4A92A 1SSXA 1DY8A 1UK3A 2PW8H 5DKMA 2BVXH 2G51A 4K1SA 1FAKH 5FAHA 3GCHC 2ZQ1A 4M9FA 1K1OA 1GDUA 1JRSA 1O39A 3MI4A 5A2MH 1VJ9U 3RC4A 1Z1IA 3A8BA 1YP9A 1GBCA 1TMBH 2JKHA 1V3XA 2FM2A 2Z3EA 2BZ6H 1O3JA 1SKYE 2P3FH 2RDEA 1JXPA 4IMZA 2BDIA 4IN2A 3MTYA 1TABE 3OTJE 2ZDNA 1LPKB 2QF3A 4Q7XA 1IQMA 2PWXA 3KCGH 5DN6D 2GTBA 2C3SA 5DK1A 1P9SA 2A45B 4JZDH 1ZMLA 5CHBA 1QJ7B 2RA3A 1HJ9A 1OOKB 1C5XB 4LZ1H 1S6HA 2BDYA 3NPSA 1TBZH 1CU1A 1HAIH 2HWLB 1BBRH 1XXFA 1O3PB 2FOHA 2J97A 1CHOG 3M35A 1O35A 1TPPA 1SOTA 4JYUH 4XD7D 1M9UA 4TWWA 1O2LA 2HVYB 4M7GA 1EFRD 3TH3H 2PKSB 2V3HH 1UTLM 1Y3VA 3SI4H 1MAXA 4ZROA 1OYTH 1ABJH 3A8AA 3VFEA 5FCRA 1BIOA 3BTWE 1H8DH 1TNIA 2BY9X 1PQ8A 5FX6A 1BTZA 1AFQB 1T32A 2JJ2D 1CA0C 1H8IH 3M61U 1H4WA 2KAIA 4I8JA 1MKXH 1SG8B 2AFQB 4UEHH 1EATA 1UW7A 1TBQH 2SGDE 3ZIAD 1A3BH 1AIXH 4DCDA 1UTJA 3KQDA 4XFQA 2XBVA 3LC5A 2R3UA 1TGCA 2GMTB 1UVSH 4FVBA 8KME2 2Y80A 2QXIA 3SJOA 1V2VT 1EZQA 4OM9A 4TT3D 5DP7A 3OAAD 1GBBA 1AZ8A 5PTPA 1LTOA 2G00A 3W94A 1NRNH 1DVAH 1CGIE 1O3NA 2XC0A 1S81A 3T26A 3TITA 3SNBA 2PUXB 1V2WT 3EE0B 2VWOA 1QL9A 2NU3E 2XCNA 4AC9A 2A4OA 2PSYA 3OX7U 4AN7A 1ESBA 2A5AA 3ATKA 2O8WA 3A81A 3EYDA 4RN6A 1IQFA 2QA9E 2OBQA 1FX0B 3L33A 2Z6BD 3TJUA 4FXGH 1EJMA 3RXHA 1KLTA 2O8LA 2JH5D 2B5TB 1LHFH 1UMAH 3MNBA 1O3AA 3FVFB 3A7XA 4E06H 2FWWA 3Q76A 1L1JA 4FUDA 1NRQH 1L4DA 1DDJA 4OS4A 1ABIH 2QC2A 2A32A 1CGJE 1ZMNA 4GHTA 3SUEA 2F9OA 1NFUA 2O9QA 1PPBH 5JPMH 1P2KA 2Y5HA 1HAOH 1C5RA 2JETC 1S84A 1D3QB 1HXFH 1TBRH 3ZZAA 1BTUA 1SHYA 2BB4A 3A7ZA 1C1WH 1C9PA 1O2HA 4HGCA 4UDWH 1A7SA 1LVOA 4TY6A 3MFJA 5KGOA 2ZTXA 1YLCA 4Y11E 4K60A 4FU9A 3RXKA 1XUGA 2ZU5A 2A5KA 1FMGA 4NIWA 4FUBA 4LK4A 1F0SA 1EAUA 2FX6A 3RU4E 1WV7H 1QB1A 1QJ1B 1YBWA 5EJLA 1OYQA 3URDA 3AK5A 4NZLA 3T25A 1O2SA 2BQ7B 2J94A 2ANYA 1Q3XA 2XNDD 2BM2A 2G52A 1ANDA 1YKTA 3UOPA 1TNGA 1O2TA 2HLCA 2BDBA 2FI4E 4CRBA 3TGIE 3SI3H 8GCHF 1GCDA 1KXBA 4I8LA 3GCOA 1NBMD 1MCTA 3A8DA 5GJ4B 2I6QA 2LELA 2SNWA 5TCCA 4NFFA 1ELDE 4ISIH 3ZZ8A 2PLXA 1EZXC 3TGKE 1QCPA 1SGQE 4INKA 2BOHB 1BA8B 4CH8B 1MD7A 4Z6AH 3RLYH 1P3EA 3OY6U 3SJIA 3SU6A 2O8TA 1CBWB 3M5NA 4GCHF 4GAWA 3RXJA 4WJG2 3C1KA 1TOCB 4AGKA 2OLGA 1ESTA 1ZPCA 1GBAA 2WPJS 2GCTC 1PPZA 3BEIB 4JMYA 2ZDVH 3BTHE 2CHAB 4Y79A 2P8OB 3UREA 1OWJA 1RD3B 4K5ZA 2NU0E 2G55A 1C4U2 1Y5UT 3DT0H 1BBRK 4X1PU 1BRUP 3GY7A 2BLQA 1AKSA 5TJXA 1Z7KA 2W3KA 4TWYA 1T4VH 4K8BA 1KIGH 2FMJA 1TRMA 1YPKH 2BDHA 1SI5H 2VVUA 2PFEA 4VGCB 4X2WA 4MNWA 3U8RH 7KMEH 5EQSA 3NWUA 1EOLA 2Z9JA 3SHAH 4D9QA 2ZGJA 4GCHG 3SU3A 5GDSH 3K65B 4NIYA 4X1QU 5A0CA 3ZV8A 4MQAA 2WV4A 1BCUH 1LKBA 3GDUA 3IWMA 2V3MA 4CRCA 2YOLA 3AVZA 4ABJA 3QDZB 1GJDB 2W7SA 1L4ZA 2AHME 4ZUHA 2A7JA 3PROA 2GVFA 4IC6A 2AGGX 4WXIA 1LKAA 2IN2A 2ODPA 2VWMA 1W0KD 2A4RA 4ABAA 1P2OA 1Z8IB 3PWCA 2ZU2A 5C17A 2Y5FA 1C1VH 2BLWA 1WTGH 1OWDA 1P3CA 4YZUA 1MMJN 1HAVB 1P03A 1DSTA 1TYNA 2HALA 2FYQA 1TPAE 3F6UH 2FZZA 3MQKC 3UIRA 3BEFB 1PPEE 4IN1A 1GBMA 1EAWA 5H4IB 2ZHFH 4NA7A 2F83A 1KDQB 1T8LA 1Y8TA 3BTDE 1OWEA 1SLWB 2NU2E 1FPHH 3SQHE 2GMTC 5B6OA 1INCA 1P2IA 2BD9A 3FZZA 4A1VA 3M5MA 5DP8A 2J95A 1AWFH 3DSPA 3MOCA 4YO9A 3P8NA 2ZU1A 3TVJB 3FAOA 2Z3DA 1EASA 2H9HA 3MWIU 1DLKB 3FANA 5EJ1A 1K28D 1TA2A 3SNAA 1AGJA 2G4TA 3E0PB 1C1PA 1G30B 4ZHLU 1GGDB 1H8HD 3WWFA 2KR7A 1CHGA 1C4V2 1LHGH 3E3TA 3RXCA 1E79D 4OS5A 1ANCA 5HMAA 2ZHEH 5JBAS 1CA0B 1HPGA 2WUBA 1PPFE 4B74A 4CHAB 1GCTC 2R0LA 1EQ9A 3V7TA 5EPNA 1EJNA 2ANMH 1O2PA 4JZIA 1EZUC 2GT7A 2CN0H 3SV9A 3I29A 1SFQB 2GV6A 1O0DH 2RDLA 1EPTC 3KYFA 1OWHA 3NUMA 1VGCC 3ZVCA 4ISNA 4D8NA 1G3EA 4UFGH 5LGOA 4YOIA 3L3TA 1C5MD 3RC6A 1C1QA 3PO1C 4Y8YA 1O3FA 3E8LA 3QLPH 4F48B 4NSYA 2UWPA 3PMHB 3P92A 4K2YA 4TPYA 3D23A 4INHA 1PYTD 1BMMH 1QRZA 1NU9A 3RMNH 3GISB 4ISOA 1N8OC 3K9XB 3SV7A 1K21H 2ZDKA 4CR5A 2Z9IA 1FI8A 5T6GA 2EI7A 2UUKB 1HXEH 1P0SH 3PO1B 4P02A 4FUFA 3S9AA 1ZGIA 1LDTT 3VB6A 2ANWA 2H1UA 2ZC9H 2ZHDA 3NKKA 2BXTH 4F55A 1VGCB 2YNAA 1QNJA 1GHBG 2XBXA 2EEKA 1NO9H 2VB0A 3BIVH 2C8ZB 3Q77A 3R3GB 3RXQA 4OGYA 1TPSA 4I32A 1SQRA 1OHHD 2BZAA 3UY9A 2TGPZ 1FN8A 4AFQA 7GCHG 2PV9B 1L1GA 5E0HA 1QQ4A 1QURH 1DFPA 1WCZA 4ACAA 1NROH 4UE7H 3NXPA 1D3PB 4BXSA 3A7TA 1X7AC 1NC6A 2VIDA 1NFWA 3A8CA 3ZVFA 2ZNKH 2XOKD 1C1UH 1SB1H 1O2OA 3KQBA 2J5UA 2NWNA 1LPGB 3GCTG 4ZHMU 3WY8A 1BDAA 1J16A 4IC5A 3EA8A 1V6DA 1AN1E 4NA8A 5CHAB 1SL3A 2OBOA 4K3JA 1MTUA 2IJOB 1P9UA 3U98H 2L6OA 1O36A 3UOUA 2ZFRH 3LGWA 1F5KU 1W10U 2FS9A 4ZKRU 5EODA 9ESTA 3F68H 1ZR0A 4DG4A 1GMDF 3BTGE 2AGEX 3KYGA 3MYWA 3AAVA 5DSFA 8GCHG 4AFSA 2FI3E 1EPTB 3KEEA 2QXGA 4UD9H 2QXHA 3UNRA 1GHVH 2VIPA 4J1YA 1QB9A 3SO3A 5F8TA 3PLPA 3SOSA 1IQLA 1GJAB 2AS9A 3JZ1B 4MNYA 1BB0B 2A7CA 2ZHQH 1O2IA 1K1NA 1E38B 2GKVE 3LOXA 2XBYA 1GI8B 3FP8E 1ZHRA 2PP6A 2QN5T 1ZGVA 1JOUB 1O2WA 2A31A 4AG2A 2UUYA 3KIDU 1KLJH 2LNCA 5JBCS 3SV8A 6ESTA 4DIHH 2BHGA 1WU1A 4WXVA 4JZEH 1V2KT 2P3UB 3VB3A 4R8TB 2ZA5A 2ALVA 3DD2H 1K1PA 1BMFD 1SR5C 1ANBA 1Y3WA 1ZRKA 1C5YB 1W11U 2I6SA 1KXCA 1HAYB 3RXLA 4A6LA 1BZXE 5K7RA 4UFFH 1WBGB 1DS2E 2KCYA 4Y10E 1HLTH 2CV3A 1DUAA 5FCKA 7LPRA 3M37A 4WH6A 1GI9B 3T29A 3F2HA 4AX9H 1OP0A 1SPJA 4B6EA 2GJGA 2VH0A 1NRSH 1XVOA 2VNTA 2XC5A 3A87A 4JYTA 1BHXF 1QZ8A 2OC8A 3A88A 1W3CA 2HPQH 1QHRB 1VCPA 2EI6A 3RXFA 3SUGA 3L6PA 3M7UA 4A1XA 1W8BH 4X1NU 1C1TA 1T8NA 4ZHAA 3H7TA 1TQ7B 2QAAA 1E0FD 2XRCA 1C2LA 1P09A 5A09A 2Y7ZA 1O3IA 4FUGA 1GHAF 1P05A 2AIQA 4GUXA 4YOGA 5C94A 1TRNA 3N7DA 2H5CA 2QV1A 1E36B 3C27B 2J98B 3KQEA 5FPSA 5JBTA 1E35B 3U1JB 1O5GH 2FESH 5F8XA 3RMMH 1TAWA 3N7EA 1IQNA 2STBE 2ESTE 1DXWA 1SGRE 1GJ9B 4X1SU 2FTMA 1B0FA 4FUEA 1E1QD 1VR1H 3SUFA 3QZRA 1P57B 3A7VA 4JYVH 1C5UA 3TU7H 1IQEA 2BVSH 3RLWH 1FNIA 2AYWA 2G5VA 2AIPA 2HGTH 2WPMS 4Q4LA 2TGTA 5FPTA 4DGJA 3DFLA 1O38A 2H5DA 1ELGA 3ATMA 4RT1A 4H6SB 5DP4A 5EPYA 4U01A 4ZCNA 1W0ZU 1BJUA 4UFDH 2ZDLA 1RRKA 3HGPA 2J34A 2NU1E 4E7NA 2FEQH 3M7QA 1WQVH 4WY3A 2ILNA 1GI5A 2J38A 1OWIA 4A1TA 2WZQA 1O5AB 5KEDA 1AB9C 3RXMA 2IOTA 1MU6B 2F9BH 3MU4A 3GCHB 2HLDD 5JBBS 2RA0A 3ZVDA 4BAQB 1D4PB 2LP6A 5BPEA 1G2MA 1HFDA 4ABFA 4ZH8A 1NBME 2ZTYA 1AD8H 4XBDA 1THPB 1NY22 4H4FA 1LCYA 1B5GH 3MMGA 1O31A 1YLDA 1OPHB 3F9HA 2ZDMA 2OC1A 3AW1A 2G4UA 1MABB 3F9GA 1PQAA 1Z1JA 4X1RU 2KX4A 3MH4A 4KP0A 1YC0A 4AFZA 2P8OC 4AYVB 4MPUA 2XYAA 3KL6A 4FVDA 1GWAA 3PB1E 1EKBB 1XMNB 3GYLB 3LGUA 2A1DB 1TA6A 1TRYA 2ZHWH 3ZYDA 4ZMAH 4OS6A 3TH4H 1Z6JH 1Z8GA 2XWAA 4KKDA 4CR9A 2QY0B 1XM1A 3I77A 2HVXA 1C5VA 3V12A 1ELBA 1P2NA 5HIZA 2ZKSA 5ETXA 3CS7A 4D76A 3W95A 1LMWB 1COWD 1TGNA 3Q3KA 4X2VA 5EOKA 2FPZA 3UB0A 1NFYA 4AOQA 2Y6TA 5DPAA 1SGFA 1RIWC 2JIZD 1RTKA 1DX5M 3QN7A 1P02A 1TALA 1THRH 3SJ9A 1BTPA 2W7UA 3M5LA 4DY7B 4YT7H 1QTFA 2P3TB 5E2OA 1FY8E 1SGFG 4ZAEA 3OYPA 5E2PA 5C1YA 4BAOB 1YCPM 1HDTH 5CDFE 4TSFD 3N99A 3SHCH 2XC4A 1O2JA 1SGTA 1FDPA 1FIWA 1QJ6B 2ZFFH 3RXPA 4IW4E 3E1XB 3B8JA 1C9TA 1XX9A 3RUOA 7ESTE 1UTOA 2BD7A 1IQJA 1HRTH 2C8WB 1HGTH 1MH0A 2UUJB 1OS8A 2B7DH 2WPLS 5EU8A 5C2ZA 3ZZCA 1O2XA 4AG1A 2KCPA 3MH7A 3BIUH 5EGMA 1SLXB 1GDNA 3BTFE 4FOUC 4ISHH 5C5OA 5EXMA 3LIWA 3PTBA 1AO5A 3MNCA 4MPVA 5B6LA 2ZFQH 2ZFPH 2ZZUH 4SGBE 2Q6DA 4BTTB 1EJAA 1Z8JB 1RIWB 2V6NA 2Z3CA 1GHXH 2J9NA 4I8KA 4X0WU 5GNDA 1O2VA 1YPGH 1CGHA 1O3GA 3UFAA 1K1LA 1BHXB 5EQQA 4YT6H 1ELTA 1GL0E 8ESTE 1KXDA 1T7CA 2ZPQA 3BG4B 2BMGB 3ITIA 5T1VA 2R3YA 1K0HA 3O8CA 4I33A 1O32A 2SGAA 1EX3A 1FY1A 1C1NA 2CJIA 3SJKA 1FXYA 4MDSA 1OP8A 1DUEA 2TBSA 1CT4E 1O2QA 1LQDB 3H7OA 1W0JD 1CT0E 1LVMA 1S82A 4X6NA 3MO3A 1GBHA 3MU1A 5HM9A 5LH8A 1TB6H 1ZTKA 1CHOF 2XW9A 3LGYA 1RFNA 2PGQB 4NIVA 4R0IA 2QF0A 1HCGA 2AMDA 1GMHF 2ZF0H 3KQ5A 1BITA 2ZFTA 3VB7A 2KM0A 1YPMH 4O3UA 4X6MA 4CRDA 3GY4A 1GVZA 1A5IA 3RU4T 1HJAB 4GVUA 1JWTA 4MVNA 2SFAA 1IQIA 4K1EA 3SUDA 3MO6A 2IPQX 1YPLH 4MNXA 4ZXYH 2BX4A 4E05H 4K1TA 2FOBA 3S69A 2EQNA 4CBNA 1MKWH 3OU0A 1D6WA 3P95A 1PQ5A 1TGTA 3U69H 3UQOA 1ETSH 2Z9KA 3AAUA 4DW2U 1C2IA 1YLNA 2EC9H 1H9IE 1CO7E 1NM6A 2PHBA 2WINI 3H09A 2OQ5A 3LPRA 4KTCA 2PKAB 4AZ2B 2PSXA 2GZ9A 4YM9A 2HRVA 1SOZA 1ZOMA 1S0RA 1HAHH 1T4UH 2EY4C 4Q2KA 5GXPA 3PTNA 4NA9H 3GY2A 1K1JA 3G01A 1C5SA 5AFYH 1ELEE 3V3MA 1SFIA 1GJBB 2PR3A 1O33A 5F6MA 2IPHA 3UWJH 1S83A 4IGDA 1Y3XA 3HGNA 1Q2WA 1ZJKA 2ZCHP 2FS8A 1AWHB 1AVWA 1SGDE 2YMSD 1MU8B 1PJPA 1KMHB 1HAGE 1UTKA 1C5NH 1GMDG 1CVWH 4F49A 4GLYA 5DP5A 1YY3A 1SGCA 1ZYOA 4CHAC 3VEQB 1EOJA 1QBNA 4P00A 3STIA 4CREA 1MAYA 3A7YA 2BY7X 3V13A 1U6QA 1MCVA 3E6PH 4B6FA 2V35A 1NU7B 4FU8A 1HNEE 1A0LA 2LPRA 1A46H 1S6LA 1SGIB 2WSSD 2SGEE 4ACBA 2QE7D 3LH1A 5L2ZH 1FY3A 4ABDA 3TJVA 2TIOA 2BD3A 2GZ8A 3A82A 1C2EA 2BOKA 2WUCA 2FOEA 2PKSC 1ZLRA 3MU8A 4O03A 2VVCA 1B7XB 3A83A 1IHTH 4AORA 4Z1MD 3LGVA 1O5CB 4CRGA 2R2WU 1XKAC 1PFXC 1EP6A 5DO4H 2BDCA 2J2UA 3PYHA 1UCYE 1D3DB 3GY3A 2PUQH 3BF6H 1MQ6A 1IOEA 5T3HA 2BX3A 3LGIA 2AGIX 1C1RA 4PROA 1GHZA 1O2YA 2ASUB 2FO9A 2BQ6B 2QGRA 4A7IB 5IK2D 5E0GA 1C1SA 1HB0B 3WW7A 1KYNA 3VB4A 1EZSC 3OE7D 2VWNA 5T6DA 1T8MA 5CMXH 2ANKH 1UHBA 1OWKA 1DLEA 2BD8A 3Q00A 2DUCA 1DE7H 1EB1H 1GHAG 2VIWA 1ELVA 3RXOA 3FP6E 1YPHC 3T5FH 1NZQH 5EXLA 1PYTC 2FOAA 1Q31A 5HIYA 1LQEA 4O3TA 3U1IB 1MD8A 1NRRH 4BNRA 2ZU4A 4RT0A 5F53A 4UFEH 4NWLA 2Z9LA 1UVPA 1TWXB 1W14U 2Q6GA 2XNIA 2BDGA 3RXRA 4X8VH 3KHVA 3TGJE 4ZXXH 2H9TH 2VBCA 2W6JD 2PKAA 2OK5A 1KDQA 5HXFA 3F9FA 4BANB 2O8UA 2OINA 1L1NA 4DURA 1DWBH 1FQ3A 4CRAA 1Y59T 1AE8H 2FOFA 1LHDH 1QR3E 2ZTZA 1ESAA 3RXSA 1J17T 3A86A 1NN6A 1CE5A 5L6NH 2FDAA 2P93A 3NZIA 3OY5U 3Q3YA 4FUIA 3UR6A 1P04A 5ABWA 1NESE 2A7HA 1XKBC 2OD3B 1O2ZA 3DA9B 4DJZB 1WUNH 1AI8H 2KAIB 5DGJA 1GJ5H 3SNCA 3W1EA 3MU5A 1WAYB 1O5DH 2FXRA 2FYRA 4HG6A 1XUIA 3E91A 3PV5A 3PV2A 3TJNA 2H9EH 2Z9GA 1TIOA 1AY6H 2BXUH 2J98A 1O37A 1ARCA 3MNXA 1ZHPA 2QF5A 1WSSH 1YCPH 2A2QH 2OCVB 2ZI2H 3EGKH 4AFUA 5E8EH 1MKWK 3T2NA 3A89A 2FP7B 5FBIA 3QO6A 4AGJA 1E1RD 2VIQA 1KXFA 4B2CA 1N1LA 2F43B 4WWYA 1O3LA 4ISLA 1VZQH 1FN6A 1QB6A 4B2AA 3UUZA 3RDZA 4E7RG 4YXWD 3LH3A 2DE9A 1AMHA 1P01A 1VJAU 1YF4A 3HKJB 2F4LA 1JIMA 1B0EA 1UO6A 2CF8H 3K6ZA 4MG3A 5C5NA 4GSOA 1UTMA 2G8TA 2HOBA 1UTNA 2VIOA 1G3CA 1GMCG 1CA8B 1A0JA 2ZCKP 2AEIH 1GBFA 2KFWA 3FP7E 2TPIZ 2W26A 2W5EA 1AKSB 3RMOH 3QK1A 2AH4X 2JDID 4INLA 1BOQA 5DJ7A 4Y76A 3LDXH 1TLDA 4X8UH 1FPCH 2O8MA 1V2ST 2C8YB 4WVPE 4B75A 5C20A 1SVPA 4I8HA 4SGAE 2OC7A 1XUJA 3JZ2B 1ID5H 4Y71A 1GPZA 2BDAA 2P16A 4OS1A 4XOJA 1GJ7B 3A84A 2ZECA 4JZFH 4JZ1A 3VPKA 3RXAA 5GIBA 3BV9B 3DSOA 1H1BA 3S7HB 3BTQE 1P2QA 1V2JT 2OUAA 4O9VA 3H5CB 1C5ZB 4Z0KA 1GI2A 1GJ6A 4DT4A 3LC3A 2Z94A 1GBLA 3PLBA 2R0KA 4TPIZ 1QQUA 2GX4A 1DXPA 3A7WA 3IITA 5E0JA 3SNEA 1AFQC 2WV5A 4GPGA 2ZPRA 2FIRH 1HAPH 2A4QA 1ZTLA 1EPTA 4ASUD 1BQYA 1GVKB 1MBMA 3ATWA 4Q7ZA 2FLRH 1FV9A 4MLFB 5FBEA 2VH6A 1P10A 1DWCH 1HAZB 2ZIQH 5F03A 2K8IA 1IQGA 1GBDA 4KTUA 1V2UT 1F0UA 2GV7A 4WMDA 3OEED 2IJD1 2GD4B 1G3BA 1W7GH 1CQQA 1D3TB 1LVBA 1DSUA 1FZZA 1HAVA 3PV4A 4WH8A 3SZEA 3CS0A 2FTLE 2FOMB 3GY6A 2CF9H 1W13U 1PPGE 1BRCE 5IYTA 2CGAA 3ZYEA 1BRBE 3ZV9A 1VITG 1TQ0B 5EG4A 4BTUB 2ZWLH 3P8FA 1BRAA 5C3NA 1ARBA 4VGCC 3HK3B 1ZJDA 2H6MA 3M3SA 1O3CA 3GDVA 2V0BA 1C2GA 2FI5E 1HBTH 3TK5A 2JJ1D 1Y3UA 3GCTF 1E37B 1KTTB 2CMYA 3UPEA 7GCHF 3ESTA 5K0HA 1EUFA 2GP9B 2ODYB 1V2MT 2ZGXH 4DOQA 1MTNB 2ALPA 1TMTH 2CHAC 4ABBA 3N7OA 1DT2A 4AYYB 5EJZA 1LPZB 3BTME 3SQEE 3SORA 1GI6A 1PQ7A 1MZDA 3E90B 3SU4A 3SYJA 1ELFA 2ZQ2A 4B2BA 5AFZH 4BAMB 1JIRA 3T27A 4Y0ZE 3SJ8A 4ZKOU 1MUEB 1ZPZA 1IAUA 2BY5X 1D9IA 3MHWU 4AB8A 1C5QA 3PMBB 3RXTA 4I8GA 3DSGA 4FETA 5AF9H 3IG6B 2XBWA 3O8DA 3TK6A 3RXDA 3SV6A 2B8OH 5C0TA 2OQUA 1G2LA 5CHAC 3ZZ7A 1TOMH 4KELA 1DICA 1JBUH 1QBOA 4XSKU 1ZHMA 3ZVEA 4YESB 5JDUB 1MTWA 5DP6A 2OP9A 4AB9A 3ODFA 3UR9A 1O2MA 3MH6A 3AASA 2J4IA 2HPPH 2GDDA 2C4FH 3O8BA 3GOVB 3ZZ3A 4D7FA 2ZG0H 3GICB 4NWKA 4MTBA 1SLUB 1P2MA 1BBRE 3PRBA 9LPRA 1OSSA 4FUJA 1BMNH 1GBEA 1PPHE 1P06A 3RMLH 3U8OH 1HJAC 3LKWA 2YNBA 2PTCE 3K6YA 1OXGA 5JB8S 2UWOA 1GHWH 3VG8A 1OX1A 3NRLA 1MKXK 3RXIA 1GJ4H 1EB2A 4Y0YE 3HK6B 3ODDA 1NRPH 1ZTJA 4HTCH 2A2XH 5DG6A 1AB9B 3QX5H 1QFKH 1DANH 2AMPA 4UONA 1C4Y2 1HJ8A 4QT8C 1MTVA 3ZVAA 1JMOH 1H9HE 1HV7A 2C90B 1GJCB 5C1UA 1IQHA 2VWLA 1UVUH 1C5LH 2OTVA 3S9BA 2F91A 2WYGA 3P6ZB
chains in the Genus database with same CATH topology
5J4QA 1RTFB 1J14A 3RXGA 3S7KB 2ZFSA 2RCEA 1O2KA 2BY8X 4F4OC 1A2CH 2J92A 1CSOE 1HUTH 4OS2A 1O2GH 2K1QA 1MZAA 2C8XB 4NZQA 2VINA 4H6TA 1UK4A 2JETB 1V2PT 3DHKH 2F9VA 5T6FA 4A5TS 1NPMA 3ENSB 3KQCA 3T28A 3GY5A 3SV2H 3SBKA 1GDQA 5I25A 3PWBA 3B9FH 3NK8A 5LPEA 1BUIA 4Y6DA 2CXVA 3ELAH 5GPIB 1ZSKA 3P70B 5AVDA 4ABHA 4X6PA 1BT7A 1ELAA 3D49H 3OSYA 2GCHF 1C2JA 1P2JA 4J2YB 3GYMA 1SQAA 4WMEA 1XUKA 5BRRE 5JYIA 5EXNA 3DFJA 3LT3A 3RM2H 3BSQA 3SNDA 2FLBH 1SQTA 3EA9A 1ZSJA 1F92A 1C2KA 1TFXA 3F1SB 4FUHA 2FODA 3M7TA 1GMCF 3D65E 3STJA 4BTIB 3LGTA 5FX5A 1VCQA 1O34A 1S85A 1FY5A 4YTAA 3UNSA 1Z6EA 5L30H 1OP2A 3VGCC 1VCWA 2PGBB 3LONA 2FX4A 4JK5A 4NFEA 1WOFA 3O8RA 1KTSB 3B23B 3BTTE 4ZKSU 3VXFH 1JRTA 1GHYH 4I31A 1O3EA 1THSH 3ZZBA 1O3DA 2STAE 3A80A 1A0HB 5J4SA 1ETTH 4XBCA 1N6YA 3I78A 4RKOB 1Y3YA 1O3HA 2ZEBA 3U8TH 2Z7FE 4XE4A 5EW1H 3E16B 4RSPA 4ABEA 1WQSA 1IQKA 3M5OA 1KSNA 1QGFA 1F2SE 3QGNB 1H9LB 3D62A 1W2KH 2H2ZA 5EQRA 1C5WB 2TGDA 1W7XH 1V2LT 1DPOA 1TNKA 3MH5A 3LU9B 3HKIB 8LPRA 4CBOA 1O3BA 1F7ZA 3BN9A 3ATLA 1QL7A 2ZGCA 3Q3XA 1HIAB 1RXPA 1RGQA 1MTSA 1Y5BT 3QTVH 3EAJA 4OGXA 4ABIA 3SGQE 1L2EA 3PMJA 2FOGA 5L2YH 2F9NA 2B0FA 6CHAB 1YGCH 1GI3A 1SLVB 3SU2A 2A4GA 1GVLA 1O2RA 3KGPA 5DP9A 5SGAE 1ZPBA 3TNTA 1GI1A 2PTNA 1QBVH 5A8ZA 2VGCB 1MBQA 1F0RA 1TGBA 1C5TA 2D1JA 1AHTH 2QCYA 1Z71A 4K8YA 3TNSA 1G3DA 4NG9H 1FY4A 2P94A 3DUXH 4XDEA 1DWEH 1GG6B 4YLUA 2GZ7A 3RXVA 1J9CH 2G81E 2ZPSA 1A1RA 1VITF 2QIQA 1DM4B 5LPFA 5A0AE 2XCFA 3VB5A 1C2MA 4KGAA 4HZHA 1O5EH 3F9EA 5JB9S 1KLIH 1YYY1 2F9UA 1UVTH 3MNSA 4DVAU 1V2TT 1NTPA 2D2DA 1MQ5A 3TIUA 4D7GA 1C5OH 1ZMJA 1G32B 1TONA 2ZGBH 2EA3A 3MO9A 3UTUH 2WPHS 3E0NB 1YPEH 2ZGHA 1O2UA 1C2DA 2SGFE 1QL8A 1AU8A 4LOYH 1HIAA 4Y8ZA 3ZVBA 2Q6FA 2BLOA 3RU4D 2BD4A 5FXLA 5AHGH 1TGSZ 2HNTE 3PMAB 1RS0A 1C2FA 1N8OB 2R2MB 2BD5A 1A61H 1GHBF 2SGQE 5DP3A 4K69A 1OKXA 1KY9A 5F8ZA 1K2I1 4U32A 2D26C 1E34B 1XVMA 1QA7A 4THNH 3UQVA 2A0QB 4U2WA 2UWLA 1LHEH 3HATH 4Q80A 1V2NT 2VIVA 3SN8A 2Y7XA 1UTQA 4TYDA 2G5NA 1BJVA 1YCPK 5GCHG 2M5TA 3A85A 1SGYE 1TNLA 3RM0H 1K1MA 1SHHB 1SBWA 1ZZZA 4D9RA 1L0ZA 3GY8A 1J8AA 5A8XA 5C67A 1P12E 4X8TH 4MNVA 2WPKS 3PLKA 1AE5A 4GHQA 2BVRH 1GI4A 4NCYA 1KXAA 1O5FH 2A5IA 1RTLA 1XUFA 1SQOA 1C2HA 1GCTB 1LHCH 1TX7A 1FLEE 4H42U 5G4BA 2VU8E 3HPTB 3U9AH 4Q7YA 1GBKA 3BTKE 2TRMA 1TX8A 3R0FA 4JCNA 1GGDC 1GMHG 1LVYA 3ATIA 3BTEE 3VXEH 1AFEH 1DOJA 4B1TA 4OS7A 5GCHF 1YPHE 2F3CE 3P17H 3GDSA 3FFGA 4Y7BA 1HAXB 1A5GH 3P8GA 3SGBE 1O3OA 1O2NA 1IHSH 1F0TA 1CBWC 1HYLA 1TNHA 4BXWA 2BYAX 2HNTF 1DY9A 1O3KA 4WMFA 3ZZ9A 4X6OA 1ACBE 2DE8A 2FOCA 1O5BB 2BTCE 5TCAA 1SGNE 2EI8A 4BAHB 3SW2B 3RXUA 3RP2A 1GBJA 1W12U 1RJXB 1ZRBA 1EAIA 3S0NA 1FONA 1MTNC 4DT7B 3TPIZ 1V2QT 3PM3A 3TH2H 4X2XA 1EXFA 4DIIH 2XWBI 4X8SH 1J15A 2BD2A 4FU7A 1XXDA 1T31A 2GT8A 1BTHH 1C5PA 1UJ1A 4BOHA 1G37A 1A4WH 2SNVA 3M36A 3URCA 1FUJA 2TGAA 2VGCC 2BQWB 3TK9A 1FJSA 1UVOA 3CENA 1EAXA 3M3TA 1S0QA 4KTSA 3UNQA 1FAXA 2ODQA 3AW0A 4LZ4B 1SGEE 5ESTE 1UCYH 4JK6A 1WYKA 1GBIA 1P11E 1Y5AT 5IDKA 1GI7B 5CE1A 1XUHA 3QWCH 3QZQA 1BMAA 2NU4E 3ZVGA 2ZU3A 1S6FA 1AVXA 1ETRH 3SU1A 2C93B 2JH6D 4NGAH 4U30A 4XBBA 4Y8XA 1UTPA 2R9PA 6GCHF 1T8OA 3RXEA 4IS5A 2B9LA 1NT1A 1YPJH 1QA0A 3EDXB 1C1OA 3SU5A 2Y81A 2ZDAH 2XXLA 4Y7AA 3SGAE 1D6RA 5FPYA 2QXJA 2AMQA 4HI3A 2Y82A 4ASHA 1ANEA 1F5RA 2GCTB 5A8YA 2V3OH 2Q1JA 5EW2H 5C1XA 4WF8A 2W3IA 4ZKNU 2SGPE 3EA7A 2BY6X 6LPRA 1ORFA 3NCLA 3ZZDA 1F5LA 1GL1A 4I7YH 2GGVB 2RG3A 6CHAC 4MPWA 4YOJA 3MU0A 3EQ0H 1NFXA 1AUTC 5FHTA 1VITH 1O3MA 2UUFB 1TMUH 4NIXA 3M3VA 3VGCB 2THFB 1BTWA 5HYOA 3ZZ5A 1SC8U 3SU0A 3LJJA 4NSVA 3BEUA 1DITH 4MPXA 5HM2A 3P8OA 3SZNA 3KNXA 5ESBA 2D8WA 2ULLA 1UCYK 3BG8A 4CRFA 1AVGH 1QIXB 3ZZ6A 3TJOA 1PPCE 2JH0D 3UWIA 2Y5GA 6GCHG 1C1MA 3RC5A 5I46H 4HFPB 1G36A 3V0XA 4RKJB 2P59A 1NS3A 1Z8RA 1GG6C 1TNJA 1S5SA 4FUCA 3TLOA 4B73A 3GCNA 3RXBA 1A5HA 1K1IA 1BTXA 1SMFE 4O97A 1FIZA 1GI0A 1DWDH 1TPOA 1SGPE 3T62A 5A0BA 4CH2B 4YLQH 1KXEA 1QY6A 1K9OE 4LXBH 1AZZA 1K22H 4TY7A 2GCHG 1BTYA 2WPIS 3QGJA 2F9PA 3KN2A 3QUMP 1WTHD 4ESTE 2BLVA 5HGGA 5GWZA 1AUJA 1ZSLA 1W0YH 1GJ8B 4X2YA 1V2RT 1TE0A 2QYIA 1EP5A 3K2UA 3LJOA 1O30A 5LPRA 3BG4C 2ZO3H 4IMQA 1A3EH 4ABGA 2VJ1A 2OC0A 1G9IE 3KF2A 2ZP0H 2P95A 2GDEH 1UHBB 3QTOH 3CP7A 1N6XA 3S9CA 1V2OT 2XTTB 1LO6A 1QRWA 1ELCA 2OXSA 4BAKB 1YM0A 1QRXA 1P8VC 1BMLA 3ZZ4A 1UK2A 2ZCLP 4B71A 3FZDA 1GBTA 1AQ7A 2VVVA 2AERH 1TX6A 2WYJA 4B76A 1CT2E 2HNTC 4IBLH 4A92A 1SSXA 1DY8A 1UK3A 2PW8H 5DKMA 2BVXH 2G51A 4K1SA 1FAKH 5FAHA 3GCHC 2ZQ1A 1K1OA 1GDUA 1JRSA 1O39A 3MI4A 5A2MH 1VJ9U 3RC4A 1Z1IA 3A8BA 1YP9A 1GBCA 1TMBH 2JKHA 1V3XA 2FM2A 2Z3EA 2BZ6H 1O3JA 2P3FH 1JXPA 4IMZA 2BDIA 4IN2A 3MTYA 1TABE 3OTJE 2ZDNA 1LPKB 2QF3A 4Q7XA 1IQMA 2PWXA 3KCGH 2GTBA 2C3SA 5DK1A 1P9SA 2A45B 4JZDH 1ZMLA 1QJ7B 2RA3A 1HJ9A 1OOKB 1C5XB 4LZ1H 1S6HA 2BDYA 3NPSA 1TBZH 1CU1A 1HAIH 2HWLB 1BBRH 1XXFA 1O3PB 2FOHA 1CHOG 3M35A 1O35A 1TPPA 1SOTA 4JYUH 1M9UA 4TWWA 1O2LA 4M7GA 3TH3H 2PKSB 2V3HH 1UTLM 1Y3VA 3SI4H 1MAXA 4ZROA 1OYTH 1ABJH 3A8AA 3VFEA 5FCRA 1BIOA 3BTWE 1H8DH 1TNIA 2BY9X 1PQ8A 5FX6A 1BTZA 1AFQB 1T32A 1CA0C 1H8IH 3M61U 1H4WA 2KAIA 4I8JA 1MKXH 1SG8B 2AFQB 4UEHH 1EATA 1TBQH 2SGDE 1A3BH 1AIXH 4DCDA 1UTJA 3KQDA 4XFQA 2XBVA 3LC5A 2R3UA 1TGCA 2GMTB 1UVSH 4FVBA 8KME2 2Y80A 2QXIA 3SJOA 1V2VT 1EZQA 5DP7A 1GBBA 1AZ8A 5PTPA 1LTOA 2G00A 3W94A 1NRNH 1DVAH 1CGIE 1O3NA 2XC0A 1S81A 3T26A 3TITA 3SNBA 2PUXB 1V2WT 3EE0B 2VWOA 1QL9A 2NU3E 2XCNA 2A4OA 2PSYA 3OX7U 4AN7A 1ESBA 2A5AA 3ATKA 2O8WA 3A81A 3EYDA 4RN6A 1IQFA 2QA9E 2OBQA 3TJUA 3L33A 2Z6BD 4FXGH 1EJMA 3RXHA 1KLTA 2O8LA 2JH5D 2B5TB 1LHFH 1UMAH 3MNBA 1O3AA 3FVFB 3A7XA 4E06H 2FWWA 3Q76A 1L1JA 4FUDA 1NRQH 1L4DA 1DDJA 4OS4A 1ABIH 2QC2A 2A32A 1CGJE 1ZMNA 4GHTA 3SUEA 2F9OA 1NFUA 2O9QA 1PPBH 5JPMH 1P2KA 2Y5HA 1HAOH 1C5RA 2JETC 1S84A 1D3QB 1HXFH 1TBRH 3ZZAA 1BTUA 1SHYA 2BB4A 3A7ZA 1C1WH 1C9PA 1O2HA 4HGCA 4UDWH 1A7SA 1LVOA 4TY6A 3MFJA 2ZTXA 1YLCA 4Y11E 4K60A 4FU9A 3RXKA 1XUGA 2ZU5A 2A5KA 1FMGA 4NIWA 4FUBA 4LK4A 1F0SA 1EAUA 2FX6A 3RU4E 1WV7H 1QB1A 1QJ1B 1YBWA 1OYQA 3URDA 4NZLA 3T25A 1O2SA 2BQ7B 2J94A 2ANYA 1Q3XA 2BM2A 2G52A 1ANDA 1YKTA 3UOPA 1TNGA 1O2TA 2HLCA 2BDBA 2FI4E 4CRBA 3TGIE 3SI3H 8GCHF 1GCDA 1KXBA 4I8LA 3GCOA 5GJ4B 1MCTA 3A8DA 2I6QA 2SNWA 5TCCA 4NFFA 1ELDE 4ISIH 3ZZ8A 2PLXA 1EZXC 3TGKE 1QCPA 1SGQE 4INKA 2BOHB 1BA8B 4CH8B 1MD7A 4Z6AH 3RLYH 1P3EA 3OY6U 3SJIA 3SU6A 2O8TA 1CBWB 3M5NA 4GCHF 4GAWA 3RXJA 4WJG2 3C1KA 1TOCB 4AGKA 2OLGA 1ESTA 1ZPCA 1GBAA 2WPJS 2GCTC 1PPZA 3BEIB 4JMYA 2ZDVH 3BTHE 2CHAB 4Y79A 2P8OB 3UREA 1OWJA 1RD3B 4K5ZA 2NU0E 2G55A 1C4U2 1Y5UT 3DT0H 1BBRK 4X1PU 1BRUP 3GY7A 2BLQA 1AKSA 5TJXA 1Z7KA 2W3KA 4TWYA 1T4VH 4K8BA 1KIGH 2FMJA 1TRMA 1YPKH 2BDHA 1SI5H 2VVUA 2PFEA 4VGCB 4X2WA 4MNWA 3U8RH 7KMEH 5EQSA 3NWUA 1EOLA 2Z9JA 3SHAH 4D9QA 2ZGJA 4GCHG 3SU3A 5GDSH 3K65B 4NIYA 4X1QU 5A0CA 3ZV8A 4MQAA 2WV4A 1BCUH 1LKBA 3GDUA 3IWMA 4CRCA 2YOLA 3AVZA 4ABJA 3QDZB 1GJDB 2W7SA 1L4ZA 4ZUHA 2A7JA 3PROA 2GVFA 4IC6A 2AGGX 4WXIA 1LKAA 2IN2A 2ODPA 2VWMA 2A4RA 4ABAA 1P2OA 1Z8IB 3PWCA 2ZU2A 2Y5FA 1C1VH 2BLWA 1WTGH 1OWDA 1P3CA 4YZUA 1MMJN 1HAVB 1P03A 1DSTA 1TYNA 2HALA 2FYQA 1TPAE 3F6UH 2FZZA 3UIRA 3BEFB 1PPEE 4IN1A 1GBMA 1EAWA 5H4IB 2ZHFH 4NA7A 2F83A 1KDQB 1T8LA 1Y8TA 3BTDE 1OWEA 1SLWB 2NU2E 1FPHH 3SQHE 2GMTC 5B6OA 1INCA 1P2IA 2BD9A 3FZZA 4A1VA 3M5MA 5DP8A 2J95A 1AWFH 3MOCA 4YO9A 3P8NA 2ZU1A 3TVJB 3FAOA 2Z3DA 1EASA 2H9HA 3MWIU 1DLKB 3FANA 1K28D 1TA2A 3SNAA 1AGJA 2G4TA 3E0PB 1C1PA 1G30B 4ZHLU 1GGDB 3E3TA 1CHGA 1C4V2 1LHGH 3RXCA 4OS5A 1ANCA 5HMAA 2ZHEH 5JBAS 1CA0B 1HPGA 2WUBA 1PPFE 4B74A 4CHAB 1GCTC 2R0LA 1EQ9A 3V7TA 5EPNA 1EJNA 2ANMH 1O2PA 4JZIA 1EZUC 2GT7A 2CN0H 3SV9A 3I29A 1SFQB 2GV6A 1O0DH 2RDLA 1EPTC 1OWHA 3NUMA 1VGCC 3ZVCA 4ISNA 4D8NA 1G3EA 4UFGH 5LGOA 4YOIA 3L3TA 1C5MD 3RC6A 1C1QA 3PO1C 4Y8YA 1O3FA 3E8LA 3QLPH 4NSYA 2UWPA 3PMHB 3P92A 4K2YA 4TPYA 3D23A 4INHA 1PYTD 1BMMH 1QRZA 1NU9A 3RMNH 3GISB 4ISOA 1N8OC 3K9XB 3SV7A 1K21H 2ZDKA 4CR5A 2Z9IA 1FI8A 5T6GA