1O32A

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o32A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o32A02
2F9BH 4ISNA 2Y7ZA 4MLFB 1FAKH 4Y79A 3SHAH 2G5VA 3OU0A 4JCNA 4BXSA 3E91A 4LXBH 5T6DA 2OLGA 1DT2A 3ATMA 3HGPA 4R8TB 4D7FA 3URDA 2QN5T 4Y8ZA 1NTPA 2AMDA 2SGEE 3MO9A 1DXWA 2TIOA 3TK6A 2AMPA 1XUGA 1J14A 2ULLA 3V7TA 1O3KA 2WPJS 2F91A 2HPQH 1AB9C 4OS6A 4WMFA 2VGCC 1EATA 3PLPA 4ZHAA 1BBRK 3VGCC 1SLWB 2RA3A 2V35A 2ODQA 2CF8H 1N8OC 4CH8B 2ZCLP 5FPTA 1L1JA 4CREA 4WMDA 1BTUA 3M61U 2PR3A 2Q1JA 3LJJA 4UFDH 4B76A 4CRCA 1ZOMA 3FANA 3SNBA 2M5TA 5FBIA 5EOKA 3P8OA 1EZXC 5EU8A 2KAIA 3RM2H 3O8BA 1IHSH 1EZSC 7GCHF 1O2JA 2OUAA 3AW0A 1GCTB 3LC5A 4MNVA 1UTKA 3SO3A 3C27B 1K2I1 3GCOA 3ZV8A 1DUEA 1MKXK 4BAMB 4ABEA 5TCCA 2C4FH 2VB0A 2R0KA 3A86A 2XC4A 1BTXA 1ZGVA 1LVYA 1E38B 3SV9A 3KCGH 2GCHF 2A7CA 3VB7A 1TPPA 1Y59T 4OS4A 4OS5A 3PWBA 2ZO3H 4AORA 1QA0A 1S0RA 1ELEE 1GHYH 1YCPM 3P8NA 2H2ZA 4K8YA 4E05H 2Z6BD 1C9TA 2J38A 4GLYA 4B2BA 1E34B 2H9TH 2QIQA 3GCTG 4IN2A 3SNDA 3RDZA 1JRSA 4ZUHA 2AS9A 2CF9H 1UHBA 2ZHFH 2ZZUH 1MCTA 1T4UH 1VZQH 2ZTYA 3PYHA 1J16A 3VB5A 3KF2A 3LONA 1V2MT 5HXFA 2FXRA 3LOXA 1O34A 4MPXA 4JZ1A 2CGAA 4K1EA 3AAUA 4YT6H 1WBGB 1FPHH 1A3BH 4ZXXH 3F6UH 3A87A 3MYWA 1ZSKA 4X2YA 3MH6A 2B0FA 3SU2A 3RU4E 3DFJA 4A5TS 1O5CB 1QTFA 4ABIA 2BXTH 3MNBA 1D4PB 2Z3DA 4E7RG 2TPIZ 3M5MA 2OQ5A 2VINA 5AF9H 1SGQE 1NC6A 2FI3E 3UY9A 3S7KB 1K21H 1C5NH 2G8TA 1U6QA 2ZA5A 2ZNKH 3F9HA 3FP6E 4HFPB 4ABDA 2A0QB 5C5NA 4FUHA 1C5XB 3E3TA 1BMLA 2KAIB 4CR9A 1CT2E 1Y3XA 2BVSH 9ESTA 2O8UA 3HATH 2F83A 3ATWA 1MU6B 1GMDG 1TFXA 2UUYA 3KL6A 3U8TH 5AHGH 3BSQA 1GJBB 1AHTH 1GBEA 4B71A 1L1NA 1L4ZA 4Z6AH 3TVJB 1TBRH 3MU8A 4BAHB 1O3DA 5EPYA 2P3FH 1CU1A 1SGYE 1O5GH 4A1VA 4NIYA 4XOJA 1O3EA 1GJCB 2Y5HA 2XC5A 1YPMH 2D26C 1AVXA 7ESTE 4TPIZ 1O2MA 4X6OA 1AO5A 1QB6A 3ZVGA 1KXCA 1ZZZA 4MVNA 5E0GA 1GJDB 3SJIA 1C4V2 3F9EA 1ZRKA 5DJ7A 5AVDA 2FMJA 1CA8B 2P59A 3KN2A 4TY7A 3GISB 2F9UA 1A0JA 1T8NA 3A7YA 1AFQB 3U8OH 4IMZA 2TGTA 4FUIA 1HRTH 2FX6A 3S69A 1B0FA 1MTNC 1MKWH 3M5LA 4D8NA 4CR5A 1V2LT 4OGYA 1A1RA 2PSXA 2AYWA 1BRAA 1KLIH 4AB8A 4X8UH 3BTGE 1BTYA 3ZYEA 2OBQA 2YNBA 1TX8A 2ANYA 3L33A 3UQVA 4E06H 2BD3A 1LHDH 2P8OB 2BB4A 1V2VT 3ELAH 1Z8RA 1ZMJA 2OTVA 1TIOA 3UOPA 4NZLA 1ESTA 2F9NA 2G00A 5FX6A 1K1NA 2VVUA 1HCGA 1H9IE 3FP7E 4X2VA 3DFLA 2VWLA 2PUQH 1P06A 1ZPZA 4NG9H 1DWEH 1E35B 2Y81A 2XCFA 3MNCA 1S85A 3I78A 4U32A 4HZHA 3EA8A 1Z6EA 3Q3KA 3A88A 3GCHC 1PPCE 2ANWA 2UUKB 5L6NH 3RXPA 8GCHG 1PYTD 3ZZ5A 1J15A 1KXEA 3TITA 1V2RT 4Q80A 1K22H 1O2KA 2GMTB 4UFEH 1C5ZB 5C5OA 2ESTE 3VB6A 2ZU1A 5T3HA 2BDYA 3HPTB 3WY8A 1MBMA 1P09A 4KKDA 4K8BA 3PV4A 4SGBE 1EOLA 1O5FH 3E8LA 3EDXB 4NWLA 2A5KA 4KTSA 2PHBA 3LIWA 3M3SA 1P2MA 5JB9S 2Z9KA 3RXRA 5DG6A 4AGJA 1BMAA 3NKKA 5JYIA 2GVFA 1GMCG 2P93A 4AOQA 4GAWA 5A8XA 1MQ6A 1CBWB 3TLOA 1WQSA 1LDTT 4O3UA 1SL3A 2BZAA 5EG4A 1A4WH 5FAHA 3GYMA 4UFFH 2Y80A 1TRNA 1NZQH 4F4OC 1Z8GA 1JWTA 2ZFRH 2QAAA 3S7HB 1DXPA 3A7VA 4YOJA 2A5IA 2HWLB 1HAVA 5C3NA 4Y10E 2CN0H 3BN9A 5HGGA 2GV6A 1FJSA 3OYPA 4WJG2 2BZ6H 1HJ8A 1NRRH 2OC1A 2J95A 1VITH 1LHFH 1P11E 2BLVA 4RKJB 2EI6A 2BM2A 2GCTB 6GCHG 1ZYOA 4NFFA 3BTDE 3CENA 1TALA 3KGPA 4LOYH 4CRBA 2A5AA 3EA9A 4B2AA 1MTVA 5K0HA 1GCDA 1ELVA 1A0LA 5DP5A 2FOCA 2OINA 5F6MA 5ESTE 4BTIB 1QBVH 1GI0A 3DD2H 4Q7ZA 1CA0B 1QBOA 2CV3A 3A84A 4ZKNU 3VPKA 2FOFA 1GBCA 1LPGB 4YLQH 2DE8A 3ZZDA 1W8BH 2WPMS 3QUMP 3ZZ4A 1QRXA 4K5ZA 1P01A 3SU1A 1D6WA 2GGVB 2RA0A 3BTKE 1A0HB 5AFZH 1TGBA 3RXLA 2C90B 1FMGA 1IQLA 5LPFA 3LGIA 1E36B 1MKXH 3M7UA 3KQBA 2XCNA 4IBLH 1O3JA 1SQTA 4ZROA 2BDHA 3UOUA 1EJMA 5BRRE 3ODDA 1G3DA 1S0QA 1C2GA 3ENSB 3H5CB 2FX4A 4X8TH 1THRH 4JYVH 4H4FA 2A4RA 2BY5X 3MTYA 1EZQA 3ITIA 4H42U 1D3PB 1WTHD 2DE9A 3PTBA 1JIRA 1W10U 4A1TA 2Z3CA 5LH8A 3VB3A 4ABHA 1RIWC 2BY8X 7KMEH 4XE4A 1VCQA 1FPCH 4XBCA 2HPPH 3T2NA 2UUFB 3TJOA 2HRVA 3UREA 1V2KT 1QB9A 1VGCC 5DP6A 1AE5A 2GDDA 4AFSA 1FDPA 1GBAA 3RLWH 2Z9IA 1DICA 2H1UA 2Q6FA 1HB0B 3TK5A 2A45B 3LH3A 1VJ9U 3TIUA 1GJ7B 1GDNA 3SNEA 1ELCA 1YP9A 2BDCA 4UDWH 2AERH 4H6SB 2P94A 4WF8A 2FZZA 1D3TB 5A0CA 1ETSH 1EAWA 3A8DA 1LVMA 1ZJDA 3ZZ9A 1WUNH 3UWJH 3A8AA 1ETRH 1G3EA 1N1LA 4XBBA 2BVXH 2UWPA 1TX6A 3A7WA 3BTHE 1HUTH 1PQ8A 5E0JA 2A7HA 3RMMH 4JZIA 1ZPBA 2GTBA 4YESB 2SGPE 2Y7XA 1OX1A 1CT0E 3LGYA 4BTTB 1FIWA 1DSTA 1DSUA 3TJVA 3UWIA 1O2QA 1PPZA 1ANBA 6CHAC 1C2LA 4K69A 2I6SA 1V2JT 2BHGA 3RXKA 3LGVA 3P8FA 1NN6A 1WCZA 1C1NA 1P0SH 1HIAA 3TPIZ 1G37A 3RXTA 1D3DB 1ZTKA 2ILNA 2NU3E 1MTSA 4X1RU 2PV9B 3KEEA 3TH2H 1QL9A 4U2WA 1AUJA 1TOMH 5FPSA 1AIXH 1UTMA 2WINI 3S9BA 4X6MA 1MH0A 4NA8A 3R3GB 4NWKA 1L0ZA 3MWIU 1PQAA 2IOTA 1TQ7B 4E7NA 3FVFB 3TH4H 1IQEA 2VIVA 2HOBA 1ANDA 1EKBB 1Y5UT 4RN6A 2R3UA 2XWAA 4DURA 2PW8H 1P04A 4OS7A 3TNSA 1QCPA 4WMEA 1YCPK 2QY0B 2J4IA 1RTLA 5GPIB 5IYTA 3SU0A 4BTUB 3NZIA 1P2IA 3HK6B 1DY8A 4H6TA 1C1UH 4DCDA 2G4TA 5A0BA 1AWFH 1QGFA 4AFUA 1F2SE 1GMHG 4IC6A 2VU8E 3SGAE 1Z1IA 3EGKH 4FUGA 2J94A 1SLUB 2F9VA 3SOSA 1YKTA 3ZVCA 4X1SU 1CVWH 1ZPCA 1IQFA 2ZU3A 2NU2E 1O31A 1SI5H 2SGDE 4FXGH 3T27A 4FUDA 1K1JA 3BIVH 2QXHA 1WSSH 3PROA 4JYUH 2ZP0H 1OSSA 2AGEX 4AB9A 2JETB 1C5WB 1OWJA 3SW2B 4CHAB 3QLPH 3ATKA 1BBRE 4GVUA 2OC8A 5JBCS 3SNAA 1DFPA 2AEIH 5T6GA 3UFAA 2QA9E 3SORA 3ZZ6A 1PPBH 3Q3XA 3L3TA 2VH6A 1O3GA 1H8DH 4D9RA 1IQMA 1AKSB 1AFEH 3GY3A 1C5YB 1OS8A 2HALA 1BA8B 1FXYA 1K1MA 4Y8XA 1C5VA 4ZKRU 3S9CA 1QRZA 3GY5A 1T4VH 4YM9A 1HIAB 1FY3A 1LKBA 3M3TA 3TK9A 3GY7A 1AZ8A 4HTCH 1C5PA 4KTUA 2QYIA 5FBEA 3GY6A 1O5BB 3RXJA 1O37A 1ANEA 1P9SA 2Y5FA 2WV5A 1XUJA 4D7GA 1MZAA 3GCNA 1Z8JB 2P16A 1S84A 1O35A 3ZVFA 1NS3A 3SV6A 3VFEA 1GHBG 1DDJA 3PMHB 1QA7A 4NGAH 4CBNA 4Y6DA 2PTCE 2ZKSA 1BMNH 4TYDA 1EB1H 1TABE 1GBKA 3A7TA 4TY6A 2G51A 3PMJA 2PKSB 2ANKH 2OQUA 2V3HH 2XXLA 1DOJA 2BX4A 3K2UA 5EODA 1G2LA 1WV7H 1THPB 1C2MA 2ZF0H 2ZCHP 3SZNA 2FESH 3EYDA 2ZDVH 1H1BA 5GCHF 3BEIB 4NIWA 1OP8A 1W7XH 1O2RA 3STIA 1FN6A 4CRFA 1C4Y2 1O2TA 1F0RA 2BQWB 3ESTA 1C2EA 2XNIA 6LPRA 1GI6A 4INKA 1GGDC 4U01A 1PQ7A 1KY9A 3QDZB 3GY2A 3TJNA 5DPAA 4AGKA 4IMQA 1DUAA 1Y8TA 3NUMA 4O9VA 3PO1C 3ZZAA 3G01A 2THFB 1YGCH 1QBNA 2EI7A 4DGJA 4YT7H 1TBZH 1GG6C 4MNXA 1SGFA 2FWWA 4ABGA 3RM0H 1GHAF 2J2UA 4X0WU 3LKWA 3RXQA 4FUBA 5DO4H 4PROA 3RXSA 5J4QA 5E8EH 3PMBB 3ZVEA 3TGJE 1FY4A 2VWNA 2BY6X 1Q3XA 1TNKA 1RTFB 4AYYB 1PPGE 1BTZA 1XKAC 3RMOH 1KTSB 2LNCA 2STBE 2BDGA 3SN8A 1P12E 1TPSA 3M7QA 4BNRA 1TYNA 1HJAC 4MPUA 3FP8E 4JZFH 3V3MA 1K9OE 3NK8A 3F9GA 1VITF 4J2YB 2QC2A 1C5QA 5CHAB 2BTCE 4AX9H 1NFYA 4OS1A 4JMYA 5EXLA 3SU5A 3F68H 1A5GH 1GJ8B 2H5DA 1EAUA 2BQ7B 1SOTA 4CRDA 1PJPA 4BOHA 5I46H 2VWMA 2ZTZA 4VGCC 1O3IA 4ZXYH 1GI1A 1SQOA 2BOHB 4SGAE 2QGRA 4I8LA 4CRGA 4X2WA 5LPRA 1IQHA 3SI4H 1UVUH 3RXMA 1K1PA 2NU4E 4X1QU 1SQAA 5C1UA 3H7OA 1GVZA 2CXVA 7GCHG 2O9QA 1P10A 1RFNA 1TNLA 2B7DH 2EA3A 2Z9GA 3DUXH 3PB1E 4UFGH 2J9NA 4ZHMU 1C5TA 1HAHH 1UTNA 1O3BA 4INHA 3ZZ3A 1EZUC 1GDQA 1FI8A 3STJA 1YPGH 1Y3UA 1EPTB 3BTFE 4FVBA 1C2KA 1LPKB 1ELAA 3K9XB 2FS9A 2GCHG 1C1OA 3M5NA 1XUHA 1WYKA 4THNH 5EPNA 1QJ6B 3SUFA 1QNJA 1O2VA 5EXNA 1HV7A 3E0NB 4MPVA 2Q6DA 1JOUB 1O3MA 1ELFA 4CH2B 3V12A 2TRMA 5EGMA 2ZDNA 3LT3A 1RRKA 3FAOA 1QR3E 1C1RA 4F49A 3MNXA 3RU4T 4ESTE 2FM2A 1P9UA 1PQ5A 2ZGCA 4TWWA 2AGGX 1FY5A 1C1QA 1YPLH 2Y6TA 1HGTH 1Q31A 1FLEE 1ZSJA 4Y7AA 5C67A 1ORFA 2H9EH 2VIQA 1E0FD 2QF0A 1UTJA 1KIGH 4IW4E 3DHKH 1OOKB 1ZMLA 1K28D 1O2IA 1W3CA 1O5AB 5JBBS 4JK5A 2AIPA 3UNQA 4A7IB 2BVRH 1D3QB 1O5EH 1GBTA 5PTPA 3UNRA 2A31A 4DW2U 1SLVB 1YLCA 4TWYA 3T26A 1HAIH 3KIDU 1T7CA 2BY7X 4FU7A 3BG4C 3MH7A 3M35A 1KXBA 4JYTA 1KTTB 1P2JA 1ARBA 1QHRB 2BOKA 1ESBA 3I77A 4MG3A 5C2ZA 3W95A 4FUCA 3MI4A 1ABJH 3RXVA 1JMOH 1C5MD 1TQ0B 4XDEA 2ZFTA 5F8XA 1KLTA 4K3JA 4WH6A 5B6OA 1PYTC 2PKAA 4INLA 3S9AA 1A2CH 3PLKA 4FUJA 3T25A 3ZZBA 2ZGHA 1FY8E 4MNYA 4X6NA 1LVBA 1BDAA 2CHAB 1T8LA 2QXJA 2QCYA 3VXFH 1UMAH 2XBVA 1YCPH 1O3PB 1O2SA 5GDSH 9LPRA 1S83A 2SNWA 1GJAB 2FOMB 2ZTXA 2VVVA 3BTEE 3CS0A 1Y5BT 4CBOA 1FAXA 1CGJE 4AFZA 1T8MA 2W3IA 4TPYA 1O2PA 2FO9A 2XBYA 2Z3EA 3BTQE 3FFGA 3SJ9A 1PPHE 1HAYB 2QXGA 3NPSA 3RXEA 2C93B 2BYAX 1UK3A 2BDIA 1YBWA 1GBBA 3AASA 1SGDE 1M9UA 5E0HA 1TRYA 2VIDA 1ZTLA 1TA6A 4WH8A 3U69H 3K6YA 3OX7U 1XUFA 2VIPA 1AB9B 1O3NA 2OC7A 2VGCB 1QFKH 1GI7B 1B5GH 2RDLA 2ZHDA 3VGCB 3RXGA 3A7ZA 1GJ9B 1VJAU 3AW1A 1WU1A 1N8OB 3IWMA 4NIVA 1GCTC 1O2OA 1W13U 1F5RA 4Q2KA 3M5OA 5E2OA 5EW2H 1GBDA 1CT4E 5LPEA 2Y82A 1DITH 1THSH 1O2NA 2ZC9H 1FV9A 1K1IA 4AG2A 1BBRH 2Z7FE 5FCKA 1V6DA 1FONA 4DT7B 4RKOB 3HKJB 1DX5M 3BIUH 1CHOF 1V2WT 5F8TA 3T5FH 3ZZCA 1LQDB 1BUIA 4ZAEA 4DVAU 3NXPA 1G36A 3ATLA 1V3XA 1BJVA 1RTKA 2IJOB 2PKAB 3K6ZA 2ASUB 3T29A 2F9PA 1DVAH 1NT1A 1G3CA 1TNJA 1EUFA 1A3EH 1C2JA 2ODPA 3UR9A 3GY8A 4XSKU 1BRCE 2PTNA 3RXOA 1YM0A 1QL7A 4GHTA 1GHZA 1HAPH 1HXEH 1MTWA 2BMGB 3BEUA 2XYAA 2D1JA 1TPOA 2SFAA 4NA9H 4WY3A 2ANMH 2WPHS 1MQ5A 1NU9A 4JZDH 3QTVH 5A2MH 1XVOA 1C1SA 5DP4A 1XXDA 2HNTE 2ZGBH 1H8IH 1ZHMA 5ESBA 1NRSH 4YOGA 1J9CH 1AZZA 3SU3A 1YYY1 3SI3H 1QL8A 2UWLA 1BT7A 1IQKA 4NFEA 7LPRA 3TJUA 2FDAA 3A80A 1DLKB 4ISIH 4I8GA 1P3EA 2GP9B 2ZHEH 1WAYB 4BAOB 1S82A 5H4IB 1MD7A 4DJZB 1SGEE 3P70B 2B5TB 3M37A 3HKIB 4NA7A 3BV9B 3R0FA 1JBUH 5L30H 1UCYK 4O97A 1ZMNA 2GZ8A 1OKXA 1Z6JH 1B7XB 3RXDA 1F0TA 2H9HA 3A8BA 5HYOA 1ZR0A 1BQYA 2I6QA 3O8CA 1O30A 1GDUA 2P3UB 2ZU4A 1LMWB 1SB1H 4BXWA 3LDXH 2C8XB 1SFIA 2C8YB 2XBXA 4Y11E 4KELA 3MU4A 1F5KU 1AGJA 1C5LH 2ZDKA 2EI8A 2V3OH 1QJ7B 2FLBH 3EAJA 1GBIA 4X2XA 4GCHF 1SPJA 2FEQH 2VIOA 1AKSA 2DUCA 3QZQA 4WXIA 1DWDH 3OY6U 1HAOH 1AQ7A 2BLQA 8ESTE 3ZVBA 2G5NA 2V0BA 3ZZ7A 2AGIX 5HM2A 1GBLA 5FCRA 2GX4A 2ALVA 1AFQC 2BQ6B 1VCPA 2UWOA 3DT0H 2CMYA 4X8SH 3TGIE 2A4GA 4I8HA 1NROH 4LZ1H 4BAKB 3HK3B 4I31A 1G2MA 1P02A 4MQAA 3FZDA 1SGRE 3BTWE 1AN1E 1O0DH 1ARCA 1EJAA 1O33A 2BLOA 1MTNB 2HNTC 2RCEA 1ZTJA 1YPJH 5EQSA 3H7TA 5HM9A 1C2IA 2P8OC 1F92A 3EA7A 1NFUA 3BEFB 3GOVB 5L2YH 1P03A 3D65E 1JXPA 2ZFQH 1AU8A 4ABAA 2W7UA 2SGAA 1GI3A 1SFQB 4KGAA 3OY5U 3U98H 1GI2A 2ZPSA 3LH1A 1P2OA 1H4WA 1AVGH 3BTME 1YPHE 2EC9H 2XRCA 4R0IA 1XKBC 1V2TT 4GSOA 2FODA 2W7SA 1OYQA 2BXUH 2W3KA 1TAWA 3PM3A 1GJ6A 1GBMA 2BX3A 1DM4B 4QT8C 2GMTC 1MMJN 3D49H 3CP7A 3GCTF 3SUGA 2NU0E 1BIOA 1SOZA 2C8ZB 3A7XA 3GCHB 4IC5A 3RMLH 3KQDA 3BF6H 1FQ3A 2O8LA 3MHWU 4WWYA 3P95A 2WV4A 3MH5A 2ZGXH 5DKMA 3EQ0H 1MUEB 3MH4A 1ELDE 4FU9A 2PSYA 5TCAA 1V2OT 1SR5C 1DWCH 3GYLB 1VCWA 2TBSA 2R0LA 1ETTH 5C20A 1GL1A 3C1KA 2FOHA 5CE1A 3HGNA 3A89A 2OBOA 3SJKA 1GI5A 1TNIA 2R2MB 1TMUH 4NSVA 4ISLA 2GKVE 1TMBH 4I7YH 1WQVH 1HFDA 1SHHB 3N7OA 3KNXA 4IN1A 1C4U2 4ZH8A 1SBWA 2PLXA 1ZJKA 2ZFPH 4JZEH 1A5HA 3RXIA 2OCVB 1O2LA 1Y3VA 4K1SA 2R9PA 3E6PH 5DGJA 2GCTC 3CS7A 4ABFA 3SGQE 3SQHE 4AYVB 1OYTH 1V2QT 5L2ZH 1BHXF 1ELTA 1GMDF 1HPGA 3AAVA 1SGFG 3OTJE 2EEKA 4ZHLU 5EQRA 4WXVA 3D23A 2JH5D 2V6NA 1PPEE 1S5SA 2OP9A 4X6PA 1AVWA 3U1JB 1O2XA 2ZDMA 2A2XH 2IN2A 3T28A 1CA0C 1EPTA 1F0UA 1O2HA 3A85A 1C1TA 2WUCA 4DIHH 2GZ9A 1EP6A 1AUTC 4B75A 1YPHC 1ZGIA 2BD7A 3OSYA 3LPRA 3P17H 3O8RA 1EASA 2O8MA 3UNSA 1J8AA 3O8DA 3P92A 3T62A 4DG4A 3ODFA 2OD3B 4Z0KA 1QURH 4GPGA 5I25A 2Z9LA 3RXHA 4XBDA 2ZPQA 2FTLE 5TJXA 3AVZA 1MAXA 2AMQA 5HMAA 2XC0A 5F8ZA 1HJ9A 3UIRA 1BRBE 1O3CA 3LC3A 1KXFA 3LGTA 1C2DA 1P05A 1SVPA 4A1XA 2H5CA 2ODYB 1W7GH 4B73A 2JH0D 1EAXA 1W2KH 4ASHA 3PMAB 2Z9JA 1IQJA 1KLJH 1BZXE 1UVOA 3ATIA 1GBHA 1UVTH 5DP3A 1HAGE 2XTTB 3SUEA 1BOQA 2GDEH 5GIBA 1T31A 1AI8H 2FI4E 4FUEA 4Y8YA 1DLEA 2FIRH 1E37B 1DPOA 1EB2A 3RMNH 2FYRA 1XM1A 1EOJA 1SGIB 4MDSA 3ZYDA 1Z8IB 4UEHH 1BTWA 1F7ZA 1D6RA 3UUZA 3VB4A 3JZ1B 3A83A 2TGAA 4Y0ZE 1GJ5H 4Y7BA 4B2CA 1L2EA 4Q7YA 1V2UT 1ZLRA 4U30A 4UONA 3MU1A 1LKAA 3MU0A 3SNCA 1RIWB 2FI5E 4AG1A 1OXGA 2R2WU 2QXIA 5CMXH 1W11U 1EJNA 3SHCH 1QQ4A 3RUOA 3BTTE 1UVPA 1VGCB 3NCLA 1MBQA 3VEQB 3RLYH 5A09A 1ABIH 4XFQA 3DA9B 2GD4B 1JIMA 1UJ1A 2A4OA 2R3YA 1GL0E 1Z1JA 1OWHA 4ABBA 1NESE 2ZQ2A 2ZWLH 1C1MA 1HXFH 8GCHF 2TGPZ 1FIZA 1O3FA 2YNAA 5JPMH 1P2QA 1NU7B 1G9IE 1TGTA 3SUDA 5GCHG 1MZDA 3LGWA 1TNGA 3RP2A 4MNWA 1Y3YA 4DOQA 3IITA 1P2KA 2G55A 1CO7E 3FZZA 1DS2E 1TBQH 1BRUP 3TGKE 4D9QA 1HNEE 3U8RH 2G52A 2PGQB 1QB1A 2D2DA 3F1SB 1SGNE 1TWXB 1LHGH 2BLWA 3SV8A 2GZ7A 3Q3YA 1UCYH 1C5UA 4Y76A 3QWCH 2B9LA 2HLCA 2ZIQH 2FOAA 1SHYA 3UTUH 1DANH 3E16B 1GMCF 5J4SA 5FX5A 2J34A 2HVXA 1SGTA 1UVSH 1GWAA 3QN7A 4A92A 6CHAB 2H6MA 1FUJA 1LVOA 3LJOA 3GICB 1OP0A 1GHAG 1KYNA 1DY9A 2PUXB 1C1PA 1UTQA 2WPLS 1K1LA 1UHBB 2XW9A 1AY6H 4MTBA 5E2PA 1HBTH 3SV2H 4YLUA 2PGBB 1IQNA 1ACBE 1ZSLA 1RS0A 2F9OA 1AMHA 3RXUA 1MU8B 1C5RA 4ISHH 1GBJA 2A1DB 1A7SA 3TNTA 1MCVA 6GCHF 2W5EA 1A61H 1P57B 4ZMAH 3E1XB 2ZQ1A 2BDAA 1DE7H 5A0AE 1GJ4H 1P3CA 1VITG 3SV7A 1SGPE 1T8OA 1TLDA 4NZQA 5LGOA 1OP2A 4YOIA 1UTLM 1EXFA 2VIWA 4K2YA 3RU4D 1EP5A 1ZRBA 3A8CA 4YO9A 1V2PT 1F0SA 3JZ2B 2AH4X 1BTPA 4BANB 3RC5A 5A8YA 2FOEA 1XUKA 3M36A 1CGIE 1QJ1B 5IDKA 1YLDA 1HLTH 3I29A 3Q00A 5C1XA 1UK2A 3QZRA 3SJ8A 1UO6A 5DK1A 4CRAA 1TRMA 4NSYA 1MTUA 4J1YA 2Y5GA 4GUXA 2JETC 1GVLA 3GDSA 3D62A 4HI3A 4K1TA 1O2WA 4X1NU 4YZUA 1C2HA 4CHAC 1EAIA 4ABJA 2JKHA 2RG3A 1AWHB 2FLRH 2ZI2H 1XX9A 1O3OA 2ZHWH 1SSXA 4Y0YE 1PPFE 1ESAA 2A4QA 3KQEA 5ETXA 1TE0A 4LZ4B 1HYLA 1NO9H 2VH0A 1TGSZ 2GT7A 1TOCB 4UE7H 2VJ1A 2SGQE 2BDBA 4ZKOU 1LHEH 5GWZA 1CQQA 2A7JA 1BHXB 3SGBE 3P8GA 3M7TA 4AN7A 4FUFA 4D76A 1LQEA 3E90B 2ALPA 4DIIH 1ELBA 4HGCA 1F5LA 1TX7A 3GY4A 4O3TA 2FS8A 2WPIS 3F9FA 4LK4A 2WYJA 1Z71A 3V13A 2QF3A 4A6LA 2JH6D 2ZECA 5JDUB 1V2ST 2CJIA 2PKSC 3B9FH 4K60A 4B1TA 2K1QA 3MFJA 1WTGH 2BD4A 3KQCA 1PFXC 2ZHQH 1ZHRA 2C8WB 1GHWH 4JK6A 1XXFA 3NWUA 2WYGA 4IS5A 2VWOA 2WUBA 1NFWA 3V0XA 5EQQA 1OWDA 1V2NT 1YPKH 3RXCA 1SLXB 2G4UA 3ZVAA 1NPMA 1BTHH 2FP7B 4I8JA 2BD9A 3MNSA 1GPZA 1AE8H 1GHXH 1GVKB 4BAQB 1O38A 1LPZB 1TONA 1T32A 1C1VH 3PTNA 1D9IA 2A32A 2BD2A 1GGDB 3KHVA 5GXPA 5BPEA 1O2UA 1LO6A 8LPRA 1W0YH 2G81E 5DP8A 1SG8B 1O3LA 1C5SA 2A2QH 3LU9B 3PLBA 3S0NA 1X7AC 1ELGA 2NWNA 1OWEA 1NM6A 1N6XA 1GI4A 5EW1H 1S81A 3PO1B 1TGNA 1MD8A 1OWIA 3RC6A 2GV7A 2P3TB 5C1YA 2ZU5A 1GG6B 2FYQA 3L6PA 3QX5H 2STAE 4Q7XA 3QGJA 1O36A 1L1GA 1NRNH 1QY6A 2P95A 1N6YA 1UCYE 1O2GH 1TMTH 1DWBH 4YTAA 2PFEA 4AFQA 1A5IA 3BG8A 1NRQH 2ZG0H 3M3VA 2IPHA 2BD5A 2NU1E 4I8KA 1IOEA 2FPZA 2Q6GA 3GDVA 1ANCA 3QGNB 2XWBI 1NFXA 5CHAC 4OS2A 1SGCA 1S6FA 3SU4A 1QRWA 2UUJB 5F03A 4KP0A 1HJAB 2YOLA 1BITA 3RXAA 3SJOA 4IGDA 2AIQA 1CGHA 1W0ZU 1O5DH 1NRPH 1TGCA 2PWXA 5AFYH 1S6HA 1QIXB 3QK1A 1GMHF 1Q2WA 2SNVA 2WPKS 1G32B 1HDTH 1UTOA 1LTOA 3MOCA 3ZVDA 1KDQA 1FNIA 1G30B 5JB8S 5DP9A 2ZDAH 1QQUA 2D8WA 3SQEE 1O32A 3A81A 3W94A 1HAVB 4VGCB 1GHVH 4B74A 1GBFA 3QTOH 1FZZA 1H9HE 1BMMH 3K65B 1FY1A 3RXBA 3GDUA 1INCA 3UQOA 4ISOA 1JRTA 1RGQA 1WOFA 3U1IB 1OWKA 4FU8A 1EPTC 5DP7A 5GJ4B 1A46H 1NY22 4KTCA 1MKWK 4NIXA 1CHOG 3UPEA 1P2NA 1EQ9A 1ZHPA 2ZU2A 1TA2A 4I32A 2J92A 3RC4A 2HGTH 3B23B 3VXEH 1EX3A 4O03A 5A8ZA 1KSNA 1Y5AT 4AZ2B 3E0PB 4M7GA 3QO6A 4WVPE 2GT8A 4OGXA 1FN8A 5JBAS 5FHTA 2ZDLA 2XBWA 1GI8B 4X8VH 1HAZB 5ABWA 2BD8A 2BY9X 3MMGA 3TH3H 3A82A 2FTMA 3P6ZB 1W14U 3TU7H 1AD8H 3EE0B 3RXFA 1C5OH 2W26A 1CE5A 1OPHB 3URCA 4ZKSU 3Q77A 5JBTA 2ZEBA 1CSOE 1KXDA 3MO6A 5G4BA 5FPYA 1C1WH 1GHBF 1Y3WA 2ZFFH 5T6FA 2ZCKP 1UK4A 2C3SA 1B0EA 3PWCA 1IAUA 3ZZ8A 2VVCA 3MU5A 1RJXB 1W12U 2TGDA 1HAXB 2B8OH 1LCYA 5K7RA 1SMFE 8KME2 2SGFE 2ZFSA 3SBKA 4RSPA 2O8WA 2LPRA 1O3AA 2O8TA 1SC8U 4FVDA 1IQGA 1O39A 1UTPA 4MPWA 1BCUH 3BG4B 2Z94A 1J17T 1KDQB 2FOBA 1YF4A 2VNTA 1MAYA 1O3HA 5FXLA 1P8VC 1XMNB 3SU6A 4X1PU 1C9PA 6ESTA 1XVMA 1XUIA 1K1OA 2CHAC 2ZGJA 1L4DA 1TNHA 2HNTF 3Q76A 4Y71A 1LHCH 3MO3A 2F3CE 2OC0A 3U9AH 4UD9H 3B8JA 4DY7B 4NCYA 1YPEH 4GHQA 4I33A 5SGAE 1O2ZA 1BJUA 1YC0A 1Z7KA 1BB0B 1IQIA 2ZPRA 1ID5H 1TPAE 2AFQB 3LGUA 1CHGA 5EXMA 1IHTH 1RXPA 3ZV9A 2OXSA 1RD3B 1GI9B 3UR6A 1C2FA 1KXAA 4GCHG 1VR1H 1TB6H 2FOGA 2QV1A 1O2YA 1CBWC 1H9LB 3IG6B 1G3BA
chains in the Genus database with same CATH superfamily
2F9BH 4ISNA 2Y7ZA 4Q63A 4MLFB 1FAKH 4Y79A 3SHAH 2G5VA 3OU0A 4JCNA 4BXSA 2WHXA 3E91A 4LXBH 4RT1A 5T6DA 2OLGA 1DT2A 3ATMA 3HGPA 4R8TB 4D7FA 3URDA 2QN5T 4Y8ZA 1NTPA 2AMDA 2SGEE 3MO9A 1DXWA 2TIOA 3TK6A 2AMPA 1XUGA 1J14A 2ULLA 3V7TA 1O3KA 2WPJS 2F91A 2HPQH 3FOAA 1AB9C 4OS6A 4WMFA 2VGCC 1EATA 3PLPA 4ZHAA 1BBRK 3VGCC 1SLWB 2RA3A 2V35A 2ODQA 2CF8H 1N8OC 4CH8B 2ZCLP 5FPTA 1L1JA 4CREA 4WMDA 1BTUA 3M61U 2PR3A 2Q1JA 3LJJA 4UFDH 4B76A 4CRCA 1ZOMA 3FANA 3SNBA 2M5TA 5FBIA 5EOKA 3P8OA 1EZXC 5EU8A 2KAIA 3RM2H 3O8BA 1IHSH 1EZSC 7GCHF 1O2JA 2OUAA 3AW0A 1GCTB 3LC5A 4MNVA 1UTKA 3SO3A 3C27B 4AC9A 1K2I1 3GCOA 3ZV8A 1DUEA 1MKXK 4BAMB 4ABEA 5TCCA 2C4FH 2VB0A 2R0KA 3A86A 2XC4A 1BTXA 1ZGVA 1LVYA 1E38B 3SV9A 3KCGH 2GCHF 2A7CA 3VB7A 1TPPA 1Y59T 4OS4A 4OS5A 3PWBA 2ZO3H 4AORA 1QA0A 1S0RA 1ELEE 1GHYH 1YCPM 3P8NA 2H2ZA 4K8YA 3U28C 4E05H 2LELA 2Z6BD 1C9TA 2J38A 4GLYA 4B2BA 1E34B 2H9TH 2QIQA 3GCTG 4IN2A 3SNDA 3N7DA 3RDZA 1JRSA 4I86A 4ZUHA 2AS9A 2CF9H 1UHBA 1K0HA 2ZHFH 2ZZUH 1MCTA 1T4UH 1VZQH 2ZTYA 3PYHA 1J16A 3KQ5A 3VB5A 3KF2A 3LONA 1V2MT 5HXFA 2FXRA 3LOXA 1O34A 4MPXA 4JZ1A 2CGAA 4K1EA 3AAUA 4YT6H 1WBGB 1FPHH 1A3BH 4ZXXH 3F6UH 3A87A 3MYWA 1ZSKA 4X2YA 3MH6A 2B0FA 3SU2A 3RU4E 3DFJA 4A5TS 1O5CB 1QTFA 4ABIA 2BXTH 3MNBA 1D4PB 2Z3DA 4E7RG 2TPIZ 3M5MA 2OQ5A 2VINA 3PV5A 5AF9H 1SGQE 1NC6A 2FI3E 3UY9A 3S7KB 1K21H 1C5NH 2G8TA 1U6QA 2ZA5A 2ZNKH 3F9HA 3FP6E 4HFPB 4ABDA 2A0QB 2KCYA 5C5NA 4FUHA 1C5XB 3E3TA 3F2GA 1BMLA 2KAIB 4CR9A 1CT2E 1Y3XA 1E1QD 2BVSH 9ESTA 2O8UA 3HATH 2F83A 3ATWA 4XRNA 1MU6B 1GMDG 1TFXA 2UUYA 3KL6A 3U8TH 5AHGH 3BSQA 1GJBB 1AHTH 1GBEA 4B71A 1L1NA 1L4ZA 4Z6AH 3TVJB 1TBRH 3MU8A 4BAHB 1O3DA 5EPYA 4YXWD 2P3FH 1CU1A 1SGYE 1O5GH 4A1VA 4NIYA 1WDIA 1O3EA 2W6JD 1GJCB 4XOJA 2Y5HA 2XC5A 1YPMH 2D26C 1AVXA 4P02A 7ESTE 4TPIZ 1O2MA 4X6OA 1AO5A 3KYFA 1QB6A 3ZVGA 1KXCA 1ZZZA 4MVNA 5E0GA 2KFWA 1GJDB 3SJIA 1C4V2 2J98B 3F9EA 1ZRKA 5DJ7A 2L74A 5AVDA 2FMJA 1CA8B 2P59A 3KN2A 4TY7A 2EQNA 3GISB 2F9UA 1A0JA 1T8NA 3A7YA 1AFQB 3U8OH 4IMZA 2TGTA 4FUIA 1HRTH 2FX6A 3S69A 1B0FA 1MTNC 1MKWH 3M5LA 4D8NA 2K0QA 4CR5A 1V2LT 4OGYA 1A1RA 2PSXA 2AYWA 1BRAA 1KLIH 4AB8A 4X8UH 3BTGE 1BTYA 2CK3D 3ZYEA 2OBQA 2YNBA 1TX8A 2ANYA 3L33A 3UQVA 4E06H 2BD3A 1LHDH 2P8OB 2BB4A 1V2VT 3ELAH 1Z8RA 2YMSD 1ZMJA 2OTVA 1TIOA 3UOPA 4NZLA 1ESTA 2F9NA 2G00A 5FX6A 1K1NA 2VVUA 1HCGA 1H9IE 3FP7E 4X2VA 3DFLA 2VWLA 2PUQH 1P06A 1ZPZA 4NG9H 1DWEH 1E35B 2Y81A 4FETA 2XCFA 3MNCA 1S85A 3I78A 4U32A 4HZHA 3EA8A 1Z6EA 3Q3KA 3A88A 5FL7D 3GCHC 1PPCE 2ANWA 2UUKB 2KM0A 5L6NH 3RXPA 8GCHG 1PYTD 3ZZ5A 1J15A 1KXEA 3TITA 1V2RT 4Q80A 1K22H 1O2KA 2GMTB 4UFEH 1C5ZB 5C5OA 2ESTE 3VB6A 2ZU1A 5T3HA 2BDYA 3UAIC 3HPTB 3WY8A 1MBMA 1P09A 4KKDA 4K8BA 3PV4A 4SGBE 1EOLA 1O5FH 1SKYE 3E8LA 3EDXB 4NWLA 2A5KA 4KTSA 2PHBA 3LIWA 3M3SA 1P2MA 5JB9S 2Z9KA 3RXRA 5DG6A 4AGJA 1BMAA 3NKKA 1E79D 2GVFA 5JYIA 1YY3A 1GMCG 1YLNA 2P93A 4AOQA 4GAWA 5A8XA 1MQ6A 1CBWB 3TLOA 1WQSA 1LDTT 4O3UA 1SL3A 2BZAA 5EG4A 1A4WH 5FAHA 3GYMA 4UFFH 4Z1MD 2Y80A 1TRNA 2J97A 1NZQH 4F4OC 1Z8GA 1JWTA 2ZFRH 2QAAA 3S7HB 1DXPA 3A7VA 4YOJA 3MQKC 2A5IA 2HWLB 1HAVA 5C3NA 4Y10E 2CN0H 3BN9A 5HGGA 2GV6A 1FJSA 3OYPA 4WJG2 2BZ6H 1HJ8A 1NRRH 2OC1A 2J95A 1VITH 1LHFH 1P11E 2BLVA 4RKJB 2EI6A 2BM2A 2GCTB 6GCHG 1ZYOA 4NFFA 3BTDE 3CENA 1TALA 3KGPA 3F0OA 4LOYH 4CRBA 2A5AA 3EA9A 4B2AA 1MTVA 5K0HA 1GCDA 1ELVA 1A0LA 5DP5A 2FOCA 2OINA 5F6MA 5ESTE 4BTIB 1QBVH 1GI0A 3DD2H 4Q7ZA 1CA0B 1QBOA 2CV3A 5F53A 3A84A 4ZKNU 3VPKA 2FOFA 1GBCA 1LPGB 2HLDD 4YLQH 2DE8A 3ZZDA 1W8BH 2WPMS 3QUMP 3ZZ4A 1QRXA 4K5ZA 1P01A 3SU1A 1D6WA 2GGVB 2RA0A 3BTKE 2WPDD 1A0HB 5AFZH 1TGBA 3RXLA 2C90B 1FMGA 1IQLA 5LPFA 4DT4A 3LGIA 1E36B 1MKXH 4P00A 3M7UA 3KQBA 2XCNA 4IBLH 1O3JA 1SQTA 4ZROA 2BDHA 3UOUA 1EJMA 5BRRE 3ODDA 1G3DA 1S0QA 1C2GA 3ENSB 3H5CB 2FX4A 3OEHD 4X8TH 1THRH 4JYVH 4H4FA 5EJLA 2A4RA 2BY5X 3MTYA 1EZQA 3ITIA 4H42U 1D3PB 1WTHD 2DE9A 3PTBA 1JIRA 1W10U 4A1TA 2Z3CA 5LH8A 3VB3A 4ABHA 1RIWC 2BY8X 7KMEH 4XE4A 1VCQA 1FPCH 4XBCA 2HPPH 3FKSD 3T2NA 2UUFB 3TJOA 2HRVA 3UREA 1V2KT 1QB9A 1VGCC 5DP6A 3WWBA 1AE5A 2GDDA 4AFSA 1FDPA 1GBAA 3RLWH 2Z9IA 1DICA 2H1UA 2Q6FA 1HB0B 3TK5A 2A45B 3LH3A 1VJ9U 3TIUA 1GJ7B 1GDNA 3SNEA 1ELCA 1YP9A 2BDCA 4UDWH 2AERH 4H6SB 2P94A 5GNDA 4WF8A 2FZZA 1D3TB 3ZIAD 5A0CA 1ETSH 1EAWA 3A8DA 1LVMA 1ZJDA 3ZZ9A 1WUNH 3UWJH 3A8AA 1ETRH 1G3EA 1N1LA 4XBBA 2BVXH 2UWPA 1TX6A 3A7WA 3BTHE 1HUTH 1PQ8A 5E0JA 2A7HA 3RMMH 4JZIA 4XD7D 1ZPBA 2GTBA 4YESB 2SGPE 5DSFA 2Y7XA 1OX1A 1CT0E 3LGYA 4BTTB 1FIWA 1DSTA 1DSUA 3TJVA 3UWIA 1O2QA 1PPZA 1ANBA 6CHAC 1C2LA 4K69A 2I6SA 1V2JT 2BHGA 3RXKA 3LGVA 3P8FA 1NN6A 1WCZA 1C1NA 1P0SH 1HIAA 3TPIZ 1G37A 3RXTA 3AK5A 1D3DB 1ZTKA 2ILNA 2NU3E 1MTSA 4X1RU 2PV9B 3KEEA 3TH2H 1QL9A 4U2WA 1AUJA 1TOMH 5FPSA 1AIXH 1UTMA 2WINI 3S9BA 4X6MA 1MH0A 4NA8A 3R3GB 4NWKA 1COWD 1L0ZA 3MWIU 1PQAA 2IOTA 1TQ7B 4E7NA 5C0UA 3FVFB 3TH4H 1IQEA 2VIVA 2HOBA 1ANDA 1EKBB 3VG8A 1Y5UT 4RN6A 2R3UA 2XWAA 4DURA 2PW8H 5HIZA 1P04A 4OS7A 3TNSA 1QCPA 4WMEA 1YCPK 2QY0B 2J4IA 1RTLA 5GPIB 5IYTA 3SU0A 4BTUB 3NZIA 1P2IA 3HK6B 1DY8A 4H6TA 1C1UH 4DCDA 2G4TA 5A0BA 1AWFH 1QGFA 4AFUA 2QF4A 1F2SE 1GMHG 4IC6A 2VU8E 3SGAE 1Z1IA 3EGKH 4FUGA 2J94A 1SLUB 2F9VA 3SOSA 1YKTA 3ZVCA 4X1SU 1CVWH 1ZPCA 1IQFA 2ZU3A 2NU2E 1O31A 1SI5H 5B6LA 2SGDE 4FXGH 3T27A 4FUDA 1K1JA 3BIVH 2QXHA 1WSSH 3PROA 4JYUH 2ZP0H 3PRDA 1OSSA 2AGEX 4AB9A 2JETB 1C5WB 1OWJA 3SW2B 4CHAB 3QLPH 3ATKA 1BBRE 4GVUA 2OC8A 5JBCS 3SNAA 1DFPA 2AEIH 5T6GA 3UFAA 2QA9E 3SORA 3ZZ6A 1PPBH 4B6EA 3Q3XA 3L3TA 2VH6A 1O3GA 1H8DH 4D9RA 1IQMA 1AKSB 1AFEH 3GY3A 1C5YB 1OS8A 2HALA 1BA8B 1FXYA 1K1MA 4Y8XA 1C5VA 4ZKRU 3S9CA 1QRZA 3GY5A 1T4VH 4YM9A 1HIAB 1FY3A 1LKBA 3M3TA 3TK9A 3GY7A 1AZ8A 4HTCH 1C5PA 4KTUA 2QYIA 5FBEA 3GY6A 1O5BB 3RXJA 1O37A 1ANEA 1P9SA 2Y5FA 2WV5A 1XUJA 4D7GA 1MZAA 3GCNA 1Z8JB 2P16A 1S84A 1O35A 3ZVFA 1NS3A 3SV6A 3VFEA 1GHBG 1DDJA 3PMHB 1QA7A 1NBME 4HG6A 4NGAH 4CBNA 4Y6DA 2PTCE 2ZKSA 1BMNH 4TYDA 1EB1H 1TABE 1GBKA 3A7TA 5KEDA 4TY6A 2G51A 3PMJA 2PKSB 2ANKH 4TSFD 2OQUA 2V3HH 2XXLA 1DOJA 2BX4A 3K2UA 5EODA 1G2LA 1WV7H 1THPB 1C2MA 2ZF0H 2ZCHP 3SZNA 2FESH 3EYDA 2ZDVH 1H1BA 5GCHF 3BEIB 4NIWA 1OP8A 1W7XH 1O2RA 3STIA 3GS9A 1FN6A 4CRFA 1C4Y2 1O2TA 1F0RA 1S6LA 2BQWB 3ESTA 1C2EA 2XNIA 6LPRA 1GI6A 4INKA 1GGDC 4U01A 1PQ7A 1KY9A 3QDZB 3GY2A 3TJNA 5DPAA 4AGKA 4IMQA 1DUAA 1Y8TA 3NUMA 4O9VA 2J98A 3PO1C 4RI0A 3ZZAA 3G01A 2THFB 1YGCH 1QBNA 2EI7A 4DGJA 4YT7H 1TBZH 1GG6C 4MNXA 1SGFA 2FWWA 4ABGA 3RM0H 1W0JD 1GHAF 2J2UA 4X0WU 3LKWA 3RXQA 4FUBA 5EJ1A 5DO4H 2EY4C 4PROA 3RXSA 5J4QA 5E8EH 3PMBB 3ZVEA 3TGJE 1FY4A 5C0TA 2VWNA 2BY6X 1Q3XA 1TNKA 1RTFB 4AYYB 1PPGE 1BTZA 1XKAC 3RMOH 4F48B 1KTSB 2LNCA 2STBE 2BDGA 3SN8A 1E1RD 1P12E 1TPSA 3DSGA 3M7QA 4BNRA 1TYNA 1HJAC 4MPUA 5C17A 3FP8E 4JZFH 3V3MA 1K9OE 3NK8A 3F9GA 1VITF 4J2YB 2QC2A 2OK5A 1C5QA 5CHAB 2BTCE 2KZ4A 4AX9H 1NFYA 4OS1A 4JMYA 5EXLA 3SU5A 1H8HD 3F68H 1A5GH 1GJ8B 2H5DA 1EAUA 2BQ7B 1SOTA 4CRDA 1PJPA 4BOHA 5I46H 2VWMA 2ZTZA 4VGCC 1O3IA 4ZXYH 1GI1A 1SQOA 2BOHB 2W6ID 3F2FA 4SGAE 2QGRA 4I8LA 4CRGA 4X2WA 5LPRA 1IQHA 3SI4H 1UVUH 3RXMA 1K1PA 2NU4E 4X1QU 1SQAA 5C1UA 3H7OA 1GVZA 2CXVA 7GCHG 2O9QA 1P10A 1RFNA 1TNLA 2B7DH 2EA3A 2Z9GA 3DUXH 3PB1E 4UFGH 2J9NA 4ZHMU 1C5TA 1HAHH 1UTNA 1O3BA 4INHA 3ZZ3A 1EZUC 1GDQA 1FI8A 3STJA 1YPGH 1Y3UA 5IK2D 1EPTB 3BTFE 4FVBA 1C2KA 1LPKB 1ELAA 3K9XB 2FS9A 2GCHG 1C1OA 3M5NA 1XUHA 2IPQX 1WYKA 4THNH 5EPNA 1QJ6B 3SUFA 1QNJA 1O2VA 5EXNA 1HV7A 3E0NB 4MPVA 2Q6DA 1JOUB 1O3MA 1ELFA 4CH2B 3V12A 2TRMA 5EGMA 2ZDNA 5KECA 3LT3A 1RRKA 3FAOA 1QR3E 1C1RA 4F49A 3MNXA 3RU4T 4ESTE 4F55A 2FM2A 1P9UA 1PQ5A 2ZGCA 4TWWA 2AGGX 1FY5A 1C1QA 1YPLH 2Y6TA 1HGTH 1Q31A 1FLEE 1ZSJA 4Y7AA 1EFRD 5C67A 1ORFA 2H9EH 2VIQA 4RT0A 1E0FD 2QF0A 1UTJA 1KIGH 4IW4E 3DHKH 1OOKB 1ZMLA 1K28D 1O2IA 2YMSC 1W3CA 1O5AB 5JBBS 4JK5A 2AIPA 3UNQA 4A7IB 2BVRH 1D3QB 1O5EH 1GBTA 5PTPA 3UNRA 2A31A 3WWFA 4DW2U 1SLVB 1YLCA 2KCPA 4TWYA 3T26A 1HAIH 3KIDU 1T7CA 2BY7X 4FU7A 3BG4C 3MH7A 4B6FA 3M35A 1KXBA 4JYTA 1KTTB 1P2JA 2WSSD 1ARBA 1QHRB 2BOKA 1ESBA 3I77A 4MG3A 5C2ZA 3W95A 4FUCA 2HVYB 3MI4A 1ABJH 3RXVA 1JMOH 1C5MD 1TQ0B 2VBCA 4XDEA 2ZFTA 5F8XA 1KLTA 1OHHD 4K3JA 4WH6A 5B6OA 1PYTC 2PKAA 4INLA 3S9AA 1A2CH 1UW7A 3PLKA 4FUJA 3T25A 3ZZBA 2GJGA 2ZGHA 1FY8E 4MNYA 4X6NA 1LVBA 1BDAA 2CHAB 5CHBA 1T8LA 5KGOA 2QXJA 2QCYA 3VXFH 1UMAH 2XBVA 1YCPH 1O3PB 2KX4A 1O2SA 5GDSH 9LPRA 2WZQA 2XOKD 5EJZA 1S83A 2SNWA 2F4LA 1FX0B 1GJAB 2FOMB 2ZTXA 2VVVA 3BTEE 3CS0A 1Y5BT 4CBOA 1FAXA 2QE7D 1CGJE 4AFZA 1T8MA 2W3IA 4TPYA 1O2PA 2FO9A 2XBYA 2Z3EA 3BTQE 3FFGA 3SJ9A 1PPHE 1BMFD 1HAYB 2QXGA 3NPSA 3RXEA 2C93B 2BYAX 1UK3A 2BDIA 1YBWA 1GBBA 3AASA 1SGDE 1M9UA 5E0HA 1TRYA 2VIDA 1ZTLA 1TA6A 4WH8A 3U69H 3K6YA 3OX7U 1XUFA 2VIPA 1AB9B 1O3NA 2OC7A 2VGCB 1QFKH 1GI7B 1B5GH 2RDLA 2ZHDA 3VGCB 3RXGA 3A7ZA 1GJ9B 1VJAU 3AW1A 1WU1A 1N8OB 3IWMA 4NIVA 1GCTC 1O2OA 1W13U 1F5RA 4Q2KA 3M5OA 5E2OA 5EW2H 1GBDA 1CT4E 5LPEA 2Y82A 1DITH 1THSH 1O2NA 2ZC9H 1FV9A 1K1IA 3H09A 1BBRH 4AG2A 2Z7FE 2IJD1 5FCKA 1V6DA 1FONA 4DT7B 4RKOB 3HKJB 1DX5M 3BIUH 1CHOF 1V2WT 5F8TA 3T5FH 3ZZCA 1LQDB 1BUIA 4ZAEA 4DVAU 3NXPA 1G36A 3ATLA 1V3XA 1BJVA 1RTKA 2IJOB 2PKAB 3K6ZA 2ASUB 3T29A 2F9PA 1DVAH 3PRBA 1NT1A 1G3CA 1TNJA 1EUFA 1A3EH 1C2JA 2ODPA 3UR9A 3GY8A 4XSKU 1BRCE 2PTNA 3UB0A 3RXOA 1YM0A 1QL7A 4GHTA 1GHZA 1HAPH 2JDID 2RFKC 1HXEH 1MTWA 2BMGB 3BEUA 2XYAA 2D1JA 1TPOA 2SFAA 4NA9H 5DN6D 4WY3A 2ANMH 2WPHS 5HKKD 1MQ5A 1NU9A 2JJ1D 4JZDH 3QTVH 5A2MH 1XVOA 1C1SA 5DP4A 1XXDA 1WXRA 2HNTE 2ZGBH 1H8IH 3SYJA 1ZHMA 5ESBA 1NRSH 4YOGA 1J9CH 1AZZA 3SU3A 1YYY1 3SI3H 1QL8A 2UWLA 1BT7A 1IQKA 4NFEA 7LPRA 3TJUA 2FDAA 3A80A 1DLKB 4ISIH 4I8GA 1P3EA 2GP9B 2ZHEH 1WAYB 4BAOB 1S82A 5H4IB 1MD7A 4DJZB 1SGEE 2V3MA 3P70B 2B5TB 3M37A 2K8IA 3HKIB 4NA7A 3BV9B 3R0FA 1JBUH 5L30H 1UCYK 4O97A 1ZMNA 2GZ8A 1OKXA 1Z6JH 1B7XB 3RXDA 1F0TA 2H9HA 3A8BA 5HYOA 1ZR0A 1BQYA 2I6QA 3O8CA 1O30A 1GDUA 2P3UB 2ZU4A 1LMWB 1SB1H 2L6OA 4BXWA 3LDXH 2C8XB 1SFIA 2C8YB 2XBXA 4Y11E 4KELA 3MU4A 1F5KU 1AGJA 1C5LH 2ZDKA 3OE7D 2EI8A 2V3OH 1QJ7B 2FLBH 3EAJA 1GBIA 4X2XA 4GCHF 1SPJA 2FEQH 2VIOA 1AKSA 2DUCA 3QZQA 4WXIA 1DWDH 3CNRA 3OY6U 1AQ7A 1HAOH 2BLQA 8ESTE 3ZVBA 2G5NA 2V0BA 3ZZ7A 2AGIX 5HM2A 1GBLA 5FCRA 2GX4A 2ALVA 1AFQC 2BQ6B 1VCPA 2UWOA 3DT0H 2CMYA 4X8SH 3TGIE 2A4GA 4I8HA 1NROH 4LZ1H 4BAKB 3HK3B 4I31A 1G2MA 1P02A 4MQAA 3FZDA 1SGRE 3BTWE 1AN1E 1O0DH 1ARCA 1EJAA 1O33A 2BLOA 1MTNB 2HNTC 2RCEA 1ZTJA 1YPJH 5EQSA 3H7TA 5HM9A 1C2IA 2P8OC 1F92A 3EA7A 1NFUA 3BEFB 3GOVB 5L2YH 1P03A 3D65E 1JXPA 2ZFQH 1AU8A 3DSOA 4ABAA 2W7UA 2SGAA 1GI3A 1SFQB 4KGAA 3OY5U 3U98H 1GI2A 2ZPSA 3LH1A 5C94A 1P2OA 1H4WA 1AVGH 3BTME 1YPHE 2EC9H 2XRCA 4R0IA 3OFND 1XKBC 1V2TT 4GSOA 2FODA 2W7SA 1OYQA 2BXUH 2W3KA 1TAWA 3PM3A 1GJ6A 1GBMA 2BX3A 1DM4B 4QT8C 2GMTC 1MMJN 3D49H 3CP7A 3GCTF 3SUGA 2NU0E 1BIOA 1SOZA 2C8ZB 3A7XA 3GCHB 4IC5A 3RMLH 3KQDA 3BF6H 1FQ3A 2O8LA 3OAAD 3MHWU 4WWYA 3P95A 2WV4A 3MH5A 2ZGXH 5DKMA 3EQ0H 1MUEB 3MH4A 1ELDE 4FU9A 2PSYA 5TCAA 1V2OT 1SR5C 1DWCH 3GYLB 1VCWA 2TBSA 2R0LA 1ETTH 5C20A 1GL1A 3WW7A 3C1KA 2FOHA 5CE1A 3HGNA 3A89A 2OBOA 3SJKA 1GI5A 1TNIA 3F3BA 2R2MB 1TMUH 4NSVA 4ISLA 2GKVE 1TMBH 4I7YH 1WQVH 1HFDA 3N7EA 1SHHB 3N7OA 3KNXA 4IN1A 1C4U2 4ZH8A 1SBWA 2PLXA 1ZJKA 2ZFPH 4JZEH 1A5HA 3RXIA 2OCVB 1O2LA 1Y3VA 4K1SA 2R9PA 3E6PH 5DGJA 2GCTC 3CS7A 4ABFA 3SGQE 3SQHE 4AYVB 1OYTH 1V2QT 5L2ZH 1BHXF 1ELTA 1GMDF 1HPGA 3AAVA 1SGFG 3OTJE 2EEKA 4ZHLU 5EQRA 4WXVA 3D23A 2JH5D 2V6NA 1PPEE 1S5SA 2OP9A 4X6PA 1AVWA 3U1JB 1O2XA 3EE7A 2ZDMA 2A2XH 2IN2A 3T28A 1CA0C 1EPTA 1F0UA 1O2HA 3A85A 1C1TA 2WUCA 4DIHH 2GZ9A 1EP6A 1AUTC 4B75A 1YPHC 1ZGIA 2BD7A 3OSYA 3LPRA 3P17H 3O8RA 1EASA 2O8MA 3UNSA 1J8AA 3O8DA 3P92A 3T62A 4DG4A 3ODFA 2OD3B 4Z0KA 1QURH 4GPGA 5I25A 2Z9LA 3RXHA 4XBDA 2ZPQA 2FTLE 5TJXA 3AVZA 1MAXA 2AMQA 3DCLA 3SZEA 5HMAA 2XC0A 5F8ZA 1HJ9A 4ACAA 3UIRA 1BRBE 1O3CA 3LC3A 1KXFA 3LGTA 1C2DA 1P05A 1SVPA 4A1XA 2KR7A 2H5CA 2ODYB 1W7GH 4B73A 2JH0D 1EAXA 1W2KH 4ASHA 3PMAB 2Z9JA 1IQJA 1KLJH 1BZXE 1UVOA 3ATIA 1GBHA 1UVTH 5DP3A 1HAGE 2XTTB 3SUEA 2GDEH 1BOQA 5GIBA 1T31A 1AI8H 2FI4E 4FUEA 4Y8YA 1DLEA 2FIRH 1E37B 1DPOA 1EB2A 3RMNH 2FYRA 4M9FA 1XM1A 1EOJA 1SGIB 4MDSA 3ZYDA 1Z8IB 4UEHH 1BTWA 1F7ZA 1D6RA 3UUZA 3VB4A 3JZ1B 3A83A 2TGAA 4Y0ZE 1GJ5H 4Y7BA 4B2CA 1L2EA 4Q7YA 1V2UT 1ZLRA 4U30A 4FOUC 4UONA 3MU1A 1LKAA 3MU0A 3SNCA 1RIWB 2FI5E 2JJ2D 4AG1A 1OXGA 2R2WU 2QXIA 5CMXH 1W11U 1EJNA 3SHCH 1QQ4A 3RUOA 3BTTE 1UVPA 1VGCB 3NCLA 5T1VA 1MBQA 3VEQB 3RLYH 5A09A 1ABIH 4XFQA 3DA9B 2GD4B 1JIMA 1UJ1A 2A4OA 2R3YA 1GL0E 1Z1JA 1OWHA 4ABBA 1NESE 2ZQ2A 2ZWLH 1C1MA 1HXFH 8GCHF 2TGPZ 1FIZA 2WV9A 1O3FA 2YNAA 5JPMH 1P2QA 1NU7B 2J5UA 1G9IE 1TGTA 3SUDA 1NBMD 5GCHG 1MZDA 3LGWA 1TNGA 3RP2A 4ZCNA 4MNWA 1Y3YA 4DOQA 3IITA 1P2KA 2G55A 1CO7E 3FZZA 1DS2E 1TBQH 1BRUP 3TGKE 4D9QA 1HNEE 3U8RH 2G52A 2PGQB 1QB1A 2D2DA 3F1SB 1SGNE 1TWXB 4TT3D 1LHGH 2BLWA 3SV8A 2GZ7A 3Q3YA 1UCYH 1C5UA 5CDFE 4Y76A 3QWCH 2B9LA 2JIZD 2HLCA 1MABB 2ZIQH 2FOAA 1SHYA 3UTUH 1DANH 3E16B 1GMCF 5J4SA 5FX5A 2J34A 2HVXA 1SGTA 1UVSH 1GWAA 3QN7A 4A92A 6CHAB 2H6MA 1FUJA 1LVOA 3LJOA 3GICB 1OP0A 1GHAG 1KYNA 1DY9A 2PUXB 1C1PA 1UTQA 2WPLS 1K1LA 1UHBB 2XW9A 1AY6H 4MTBA 5E2PA 1HBTH 3SV2H 4YLUA 2PGBB 1IQNA 3OEED 1ACBE 1ZSLA 1RS0A 2F9OA 1AMHA 3RXUA 1MU8B 1C5RA 4ISHH 1GBJA 2A1DB 1A7SA 3TNTA 1MCVA 6GCHF 2W5EA 1A61H 1P57B 4ZMAH 3E1XB 2ZQ1A 2BDAA 1DE7H 5A0AE 1GJ4H 1P3CA 1VITG 3SV7A 1QZ8A 1SGPE 1T8OA 1TLDA 4NZQA 5LGOA 1OP2A 4YOIA 1UTLM 3F2HA 1EXFA 2VIWA 4K2YA 3RU4D 1EP5A 1ZRBA 3A8CA 4YO9A 1V2PT 1F0SA 3JZ2B 2AH4X 1BTPA 4BANB 3RC5A 5A8YA 2FOEA 1XUKA 3M36A 1CGIE 1QJ1B 5IDKA 1YLDA 1HLTH 3I29A 3Q00A 5C1XA 1UK2A 3QZRA 3SJ8A 1UO6A 5DK1A 4CRAA 1TRMA 4NSYA 1MTUA 4J1YA 2Y5GA 4GUXA 2JETC 1GVLA 3GDSA 3D62A 4HI3A 4K1TA 1O2WA 4X1NU 4YZUA 1C2HA 4CHAC 3OTPA 1EAIA 4ABJA 2JKHA 2RG3A 1AWHB 2FLRH 2ZI2H 1XX9A 3FO8D 1O3OA 2ZHWH 1SSXA 4Y0YE 1PPFE 1ESAA 2A4QA 3KQEA 5ETXA 1TE0A 4LZ4B 1HYLA 1NO9H 2VH0A 1TGSZ 2GT7A 1TOCB 4UE7H 2VJ1A 2SGQE 2BDBA 3PV2A 4ZKOU 1LHEH 5GWZA 3FN8A 1CQQA 2A7JA 1BHXB 3SGBE 3P8GA 3M7TA 4AN7A 2RDEA 3W1EA 4FUFA 4D76A 1LQEA 3E90B 2ALPA 4DIIH 1ELBA 4HGCA 2QF5A 1F5LA 1TX7A 3GY4A 4O3TA 2FS8A 2WPIS 3F9FA 4LK4A 2WYJA 1Z71A 3V13A 2QF3A 2LP6A 4A6LA 2JH6D 2ZECA 5JDUB 1V2ST 2CJIA 2PKSC 3B9FH 4K60A 4B1TA 2K1QA 3MFJA 1WTGH 2BD4A 3KQCA 1PFXC 2ZHQH 1ZHRA 2C8WB 1GHWH 4JK6A 1XXFA 3NWUA 2WYGA 4IS5A 2VWOA 2WUBA 1NFWA 3V0XA 5EQQA 1OWDA 1V2NT 1YPKH 4Q4LA 1SLXB 3RXCA 2G4UA 3ZVAA 4ACBA 1NPMA 1BTHH 2FP7B 4I8JA 2BD9A 3MNSA 1GPZA 1AE8H 1GHXH 1GVKB 4BAQB 1O38A 1LPZB 3NRLA 1TONA 1T32A 1C1VH 3PTNA 1D9IA 2A32A 2BD2A 1GGDB 3KHVA 5GXPA 5BPEA 1O2UA 1LO6A 2PP6A 8LPRA 1W0YH 4ASUD 2G81E 5DP8A 1SG8B 1O3LA 1C5SA 1H8ED 2A2QH 3LU9B 3PLBA 3S0NA 1X7AC 1ELGA 2NWNA 1OWEA 3F0PA 1NM6A 1N6XA 1GI4A 5EW1H 1S81A 3PO1B 1TGNA 1MD8A 1OWIA 3RC6A 2GV7A 2P3TB 5C1YA 2KCOA 2ZU5A 1GG6B 2AHME 2FYQA 3L6PA 3QX5H 1VKYA 2STAE 4Q7XA 3QGJA 1O36A 1L1GA 1NRNH 1QY6A 2P95A 1N6YA 1UCYE 1O2GH 1TMTH 1DWBH 4YTAA 2PFEA 2KCAA 4AFQA 1A5IA 3BG8A 1NRQH 2ZG0H 3M3VA 2IPHA 2BD5A 2NU1E 4I8KA 1IOEA 2FPZA 2Q6GA 3GDVA 1ANCA 3QGNB 2XWBI 1NFXA 5CHAC 4OS2A 1SGCA 1S6FA 3SU4A 1QRWA 2UUJB 5F03A 4KP0A 1HJAB 2YOLA 3N99A 1YWUA 1BITA 3RXAA 3SJOA 4IGDA 2AIQA 1CGHA 1W0ZU 5HIYA 1O5DH 1NRPH 1TGCA 2PWXA 5AFYH 1S6HA 1QIXB 3QK1A 1GMHF 1Q2WA 2SNVA 2WPKS 1G32B 1HDTH 1UTOA 1LTOA 3MOCA 3ZVDA 1KDQA 1FNIA 1G30B 5JB8S 5DP9A 2ZDAH 2XNDD 1QQUA 2D8WA 3SQEE 1O32A 3A81A 3W94A 1HAVB 4VGCB 1GHVH 4B74A 1GBFA 3QTOH 1FZZA 1H9HE 1BMMH 3K65B 4OM9A 1FY1A 3RXBA 3GDUA 1INCA 3UQOA 4ISOA 1JRTA 1RGQA 1WOFA 3U1IB 1OWKA 4FU8A 1EPTC 5DP7A 5GJ4B 1A46H 1NY22 4KTCA 1MKWK 4NIXA 1CHOG 3UPEA 2M2AA 1P2NA 1EQ9A 1ZHPA 2ZU2A 1TA2A 4I32A 2J92A 3RC4A 2HGTH 3B23B 3VXEH 1EX3A 4O03A 5A8ZA 1KSNA 1Y5AT 4AZ2B 3E0PB 4M7GA 3QO6A 4WVPE 2GT8A 4OGXA 1FN8A 5JBAS 5FHTA 2ZDLA 2XBWA 1GI8B 4X8VH 1HAZB 5ABWA 2BD8A 2BY9X 3MMGA 3TH3H 3A82A 2FTMA 3P6ZB 1W14U 3TU7H 1AD8H 3EE0B 3DSPA 1C5OH 2W26A 3RXFA 1CE5A 1OPHB 3URCA 4ZKSU 3Q77A 5JBTA 2ZEBA 1CSOE 1KXDA 3MO6A 5G4BA 5FPYA 1C1WH 1GHBF 1Y3WA 2ZFFH 5T6FA 2ZCKP 1UK4A 2C3SA 1B0EA 3PWCA 1IAUA 3ZZ8A 2VVCA 3MU5A 1RJXB 1W12U 2TGDA 1HAXB 2B8OH 1LCYA 5K7RA 1SMFE 8KME2 2SGFE 2ZFSA 2YMSB 3SBKA 4RSPA 2O8WA 2LPRA 1O3AA 2O8TA 1SC8U 1KMHB 4FVDA 1IQGA 1O39A 1UTPA 3KYGA 1W0KD 4MPWA 1BCUH 3BG4B 2Z94A 1J17T 1KDQB 2FOBA 1YF4A 2VNTA 1MAYA 1O3HA 5FXLA 1P8VC 1XMNB 3SU6A 4X1PU 1SQRA 1C9PA 6ESTA 1XVMA 1XUIA 1K1OA 2CHAC 2ZGJA 1L4DA 5EIYA 1TNHA 2HNTF 3Q76A 4Y71A 1LHCH 3MO3A 2F3CE 2OC0A 3U9AH 4UD9H 3B8JA 4DY7B 2V7QD 4NCYA 1YPEH 4GHQA 4I33A 5SGAE 1O2ZA 1BJUA 1YC0A 1Z7KA 1BB0B 1IQIA 2ZPRA 1ID5H 1TPAE 2F43B 2AFQB 3LGUA 1CHGA 5EXMA 1IHTH 1RXPA 3ZV9A 2OXSA 1RD3B 1GI9B 3UR6A 1C2FA 1KXAA 4GCHG 1VR1H 1TB6H 2FOGA 2QV1A 1O2YA 1CBWC 1H9LB 3IG6B 1G3BA
chains in the Genus database with same CATH topology
2F9BH 4ISNA 2Y7ZA 4MLFB 1FAKH 4Y79A 3SHAH 2G5VA 3OU0A 4JCNA 4BXSA 3E91A 4LXBH 5T6DA 2OLGA 1DT2A 3ATMA 3HGPA 4R8TB 4D7FA 3URDA 2QN5T 4Y8ZA 1NTPA 2AMDA 2SGEE 3MO9A 1DXWA 2TIOA 3TK6A 2AMPA 1XUGA 1J14A 2ULLA 3V7TA 1O3KA 2WPJS 2F91A 2HPQH 1AB9C 4OS6A 4WMFA 2VGCC 1EATA 3PLPA 4ZHAA 1BBRK 3VGCC 1SLWB 2RA3A 2V35A 2ODQA 2CF8H 1N8OC 4CH8B 2ZCLP 5FPTA 1L1JA 4CREA 4WMDA 1BTUA 3M61U 2PR3A 2Q1JA 3LJJA 4UFDH 4B76A 4CRCA 1ZOMA 3FANA 3SNBA 2M5TA 5FBIA 5EOKA 3P8OA 1EZXC 5EU8A 2KAIA 3RM2H 3O8BA 1IHSH 1EZSC 7GCHF 1O2JA 2OUAA 3AW0A 1GCTB 3LC5A 4MNVA 1UTKA 3SO3A 3C27B 1K2I1 3GCOA 3ZV8A 1DUEA 1MKXK 4BAMB 4ABEA 5TCCA 2C4FH 2VB0A 2R0KA 3A86A 2XC4A 1BTXA 1ZGVA 1LVYA 1E38B 3SV9A 3KCGH 2GCHF 2A7CA 3VB7A 1TPPA 1Y59T 4OS4A 4OS5A 3PWBA 2ZO3H 4AORA 1QA0A 1S0RA 1ELEE 1GHYH 1YCPM 3P8NA 2H2ZA 4K8YA 4E05H 2Z6BD 1C9TA 2J38A 4GLYA 4B2BA 1E34B 2H9TH 2QIQA 3GCTG 4IN2A 3SNDA 3RDZA 1JRSA 4ZUHA 2AS9A 2CF9H 1UHBA 2ZHFH 2ZZUH 1MCTA 1T4UH 1VZQH 2ZTYA 3PYHA 1J16A 3VB5A 3KF2A 3LONA 1V2MT 5HXFA 2FXRA 3LOXA 1O34A 4MPXA 4JZ1A 2CGAA 4K1EA 3AAUA 4YT6H 1WBGB 1FPHH 1A3BH 4ZXXH 3F6UH 3A87A 3MYWA 1ZSKA 4X2YA 3MH6A 2B0FA 3SU2A 3RU4E 3DFJA 4A5TS 1O5CB 1QTFA 4ABIA 2BXTH 3MNBA 1D4PB 2Z3DA 4E7RG 2TPIZ 3M5MA 2OQ5A 2VINA 5AF9H 1SGQE 1NC6A 2FI3E 3UY9A 3S7KB 1K21H 1C5NH 2G8TA 1U6QA 2ZA5A 2ZNKH 3F9HA 3FP6E 4HFPB 4ABDA 2A0QB 5C5NA 4FUHA 1C5XB 3E3TA 1BMLA 2KAIB 4CR9A 1CT2E 1Y3XA 2BVSH 9ESTA 2O8UA 3HATH 2F83A 3ATWA 1MU6B 1GMDG 1TFXA 2UUYA 3KL6A 3U8TH 5AHGH 3BSQA 1GJBB 1AHTH 1GBEA 4B71A 1L1NA 1L4ZA 4Z6AH 3TVJB 1TBRH 3MU8A 4BAHB 1O3DA 5EPYA 2P3FH 1CU1A 1SGYE 1O5GH 4A1VA 4NIYA 4XOJA 1O3EA 1GJCB 2Y5HA 2XC5A 1YPMH 2D26C 1AVXA 7ESTE 4TPIZ 1O2MA 4X6OA 1AO5A 1QB6A 3ZVGA 1KXCA 1ZZZA 4MVNA 5E0GA 1GJDB 3SJIA 1C4V2 3F9EA 1ZRKA 5DJ7A 5AVDA 2FMJA 1CA8B 2P59A 3KN2A 4TY7A 3GISB 2F9UA 1A0JA 1T8NA 3A7YA 1AFQB 3U8OH 4IMZA 2TGTA 4FUIA 1HRTH 2FX6A 3S69A 1B0FA 1MTNC 1MKWH 3M5LA 4D8NA 4CR5A 1V2LT 4OGYA 1A1RA 2PSXA 2AYWA 1BRAA 1KLIH 4AB8A 4X8UH 3BTGE 1BTYA 3ZYEA 2OBQA 2YNBA 1TX8A 2ANYA 3L33A 3UQVA 4E06H 2BD3A 1LHDH 2P8OB 2BB4A 1V2VT 3ELAH 1Z8RA 1ZMJA 2OTVA 1TIOA 3UOPA 4NZLA 1ESTA 2F9NA 2G00A 5FX6A 1K1NA 2VVUA 1HCGA 1H9IE 3FP7E 4X2VA 3DFLA 2VWLA 2PUQH 1P06A 1ZPZA 4NG9H 1DWEH 1E35B 2Y81A 2XCFA 3MNCA 1S85A 3I78A 4U32A 4HZHA 3EA8A 1Z6EA 3Q3KA 3A88A 3GCHC 1PPCE 2ANWA 2UUKB 5L6NH 3RXPA 8GCHG 1PYTD 3ZZ5A 1J15A 1KXEA 3TITA 1V2RT 4Q80A 1K22H 1O2KA 2GMTB 4UFEH 1C5ZB 5C5OA 2ESTE 3VB6A 2ZU1A 5T3HA 2BDYA 3HPTB 3WY8A 1MBMA 1P09A 4KKDA 4K8BA 3PV4A 4SGBE 1EOLA 1O5FH 3E8LA 3EDXB 4NWLA 2A5KA 4KTSA 2PHBA 3LIWA 3M3SA 1P2MA 5JB9S 2Z9KA 3RXRA 5DG6A 4AGJA 1BMAA 3NKKA 5JYIA 2GVFA 1GMCG 2P93A 4AOQA 4GAWA 5A8XA 1MQ6A 1CBWB 3TLOA 1WQSA 1LDTT 4O3UA 1SL3A 2BZAA 5EG4A 1A4WH 5FAHA 3GYMA 4UFFH 2Y80A 1TRNA 1NZQH 4F4OC 1Z8GA 1JWTA 2ZFRH 2QAAA 3S7HB 1DXPA 3A7VA 4YOJA 2A5IA 2HWLB 1HAVA 5C3NA 4Y10E 2CN0H 3BN9A 5HGGA 2GV6A 1FJSA 3OYPA 4WJG2 2BZ6H 1HJ8A 1NRRH 2OC1A 2J95A 1VITH 1LHFH 1P11E 2BLVA 4RKJB 2EI6A 2BM2A 2GCTB 6GCHG 1ZYOA 4NFFA 3BTDE 3CENA 1TALA 3KGPA 4LOYH 4CRBA 2A5AA 3EA9A 4B2AA 1MTVA 5K0HA 1GCDA 1ELVA 1A0LA 5DP5A 2FOCA 2OINA 5F6MA 5ESTE 4BTIB 1QBVH 1GI0A 3DD2H 4Q7ZA 1CA0B 1QBOA 2CV3A 3A84A 4ZKNU 3VPKA 2FOFA 1GBCA 1LPGB 4YLQH 2DE8A 3ZZDA 1W8BH 2WPMS 3QUMP 3ZZ4A 1QRXA 4K5ZA 1P01A 3SU1A 1D6WA 2GGVB 2RA0A 3BTKE 1A0HB 5AFZH 1TGBA 3RXLA 2C90B 1FMGA 1IQLA 5LPFA 3LGIA 1E36B 1MKXH 3M7UA 3KQBA 2XCNA 4IBLH 1O3JA 1SQTA 4ZROA 2BDHA 3UOUA 1EJMA 5BRRE 3ODDA 1G3DA 1S0QA 1C2GA 3ENSB 3H5CB 2FX4A 4X8TH 1THRH 4JYVH 4H4FA 2A4RA 2BY5X 3MTYA 1EZQA 3ITIA 4H42U 1D3PB 1WTHD 2DE9A 3PTBA 1JIRA 1W10U 4A1TA 2Z3CA 5LH8A 3VB3A 4ABHA 1RIWC 2BY8X 7KMEH 4XE4A 1VCQA 1FPCH 4XBCA 2HPPH 3T2NA 2UUFB 3TJOA 2HRVA 3UREA 1V2KT 1QB9A 1VGCC 5DP6A 1AE5A 2GDDA 4AFSA 1FDPA 1GBAA 3RLWH 2Z9IA 1DICA 2H1UA 2Q6FA 1HB0B 3TK5A 2A45B 3LH3A 1VJ9U 3TIUA 1GJ7B 1GDNA 3SNEA 1ELCA 1YP9A 2BDCA 4UDWH 2AERH 4H6SB 2P94A 4WF8A 2FZZA 1D3TB 5A0CA 1ETSH 1EAWA 3A8DA 1LVMA 1ZJDA 3ZZ9A 1WUNH 3UWJH 3A8AA 1ETRH 1G3EA 1N1LA 4XBBA 2BVXH 2UWPA 1TX6A 3A7WA 3BTHE 1HUTH 1PQ8A 5E0JA 2A7HA 3RMMH 4JZIA 1ZPBA 2GTBA 4YESB 2SGPE 2Y7XA 1OX1A 1CT0E 3LGYA 4BTTB 1FIWA 1DSTA 1DSUA 3TJVA 3UWIA 1O2QA 1PPZA 1ANBA 6CHAC 1C2LA 4K69A 2I6SA 1V2JT 2BHGA 3RXKA 3LGVA 3P8FA 1NN6A 1WCZA 1C1NA 1P0SH 1HIAA 3TPIZ 1G37A 3RXTA 1D3DB 1ZTKA 2ILNA 2NU3E 1MTSA 4X1RU 2PV9B 3KEEA 3TH2H 1QL9A 4U2WA 1AUJA 1TOMH 5FPSA 1AIXH 1UTMA 2WINI 3S9BA 4X6MA 1MH0A 4NA8A 3R3GB 4NWKA 1L0ZA 3MWIU 1PQAA 2IOTA 1TQ7B 4E7NA 3FVFB 3TH4H 1IQEA 2VIVA 2HOBA 1ANDA 1EKBB 1Y5UT 4RN6A 2R3UA 2XWAA 4DURA 2PW8H 1P04A 4OS7A 3TNSA 1QCPA 4WMEA 1YCPK 2QY0B 2J4IA 1RTLA 5GPIB 5IYTA 3SU0A 4BTUB 3NZIA 1P2IA 3HK6B 1DY8A 4H6TA 1C1UH 4DCDA 2G4TA 5A0BA 1AWFH 1QGFA 4AFUA 1F2SE 1GMHG 4IC6A 2VU8E 3SGAE 1Z1IA 3EGKH 4FUGA 2J94A 1SLUB 2F9VA 3SOSA 1YKTA 3ZVCA 4X1SU 1CVWH 1ZPCA 1IQFA 2ZU3A 2NU2E 1O31A 1SI5H 2SGDE 4FXGH 3T27A 4FUDA 1K1JA 3BIVH 2QXHA 1WSSH 3PROA 4JYUH 2ZP0H 1OSSA 2AGEX 4AB9A 2JETB 1C5WB 1OWJA 3SW2B 4CHAB 3QLPH 3ATKA 1BBRE 4GVUA 2OC8A 5JBCS 3SNAA 1DFPA 2AEIH 5T6GA 3UFAA 2QA9E 3SORA 3ZZ6A 1PPBH 3Q3XA 3L3TA 2VH6A 1O3GA 1H8DH 4D9RA 1IQMA 1AKSB 1AFEH 3GY3A 1C5YB 1OS8A 2HALA 1BA8B 1FXYA 1K1MA 4Y8XA 1C5VA 4ZKRU 3S9CA 1QRZA 3GY5A 1T4VH 4YM9A 1HIAB 1FY3A 1LKBA 3M3TA 3TK9A 3GY7A 1AZ8A 4HTCH 1C5PA 4KTUA 2QYIA 5FBEA 3GY6A 1O5BB 3RXJA 1O37A 1ANEA 1P9SA 2Y5FA 2WV5A 1XUJA 4D7GA 1MZAA 3GCNA 1Z8JB 2P16A 1S84A 1O35A 3ZVFA 1NS3A 3SV6A 3VFEA 1GHBG 1DDJA 3PMHB 1QA7A 4NGAH 4CBNA 4Y6DA 2PTCE 2ZKSA 1BMNH 4TYDA 1EB1H 1TABE 1GBKA 3A7TA 4TY6A 2G51A 3PMJA 2PKSB 2ANKH 2OQUA 2V3HH 2XXLA 1DOJA 2BX4A 3K2UA 5EODA 1G2LA 1WV7H 1THPB 1C2MA 2ZF0H 2ZCHP 3SZNA 2FESH 3EYDA 2ZDVH 1H1BA 5GCHF 3BEIB 4NIWA 1OP8A 1W7XH 1O2RA 3STIA 1FN6A 4CRFA 1C4Y2 1O2TA 1F0RA 2BQWB 3ESTA 1C2EA 2XNIA 6LPRA 1GI6A 4INKA 1GGDC 4U01A 1PQ7A 1KY9A 3QDZB 3GY2A 3TJNA 5DPAA 4AGKA 4IMQA 1DUAA 1Y8TA 3NUMA 4O9VA 3PO1C 3ZZAA 3G01A 2THFB 1YGCH 1QBNA 2EI7A 4DGJA 4YT7H 1TBZH 1GG6C 4MNXA 1SGFA 2FWWA 4ABGA 3RM0H 1GHAF 2J2UA 4X0WU 3LKWA 3RXQA 4FUBA 5DO4H 4PROA 3RXSA 5J4QA 5E8EH 3PMBB 3ZVEA 3TGJE 1FY4A 2VWNA 2BY6X 1Q3XA 1TNKA 1RTFB 4AYYB 1PPGE 1BTZA 1XKAC 3RMOH 1KTSB 2LNCA 2STBE 2BDGA 3SN8A 1P12E 1TPSA 3M7QA 4BNRA 1TYNA 1HJAC 4MPUA 3FP8E 4JZFH 3V3MA 1K9OE 3NK8A 3F9GA 1VITF 4J2YB 2QC2A 1C5QA 5CHAB 2BTCE 4AX9H 1NFYA 4OS1A 4JMYA 5EXLA 3SU5A 3F68H 1A5GH 1GJ8B 2H5DA 1EAUA 2BQ7B 1SOTA 4CRDA 1PJPA 4BOHA 5I46H 2VWMA 2ZTZA 4VGCC 1O3IA 4ZXYH 1GI1A 1SQOA 2BOHB 4SGAE 2QGRA 4I8LA 4CRGA 4X2WA 5LPRA 1IQHA 3SI4H 1UVUH 3RXMA 1K1PA 2NU4E 4X1QU 1SQAA 5C1UA 3H7OA 1GVZA 2CXVA 7GCHG 2O9QA 1P10A 1RFNA 1TNLA 2B7DH 2EA3A 2Z9GA 3DUXH 3PB1E 4UFGH 2J9NA 4ZHMU 1C5TA 1HAHH 1UTNA 1O3BA 4INHA 3ZZ3A 1EZUC 1GDQA 1FI8A 3STJA 1YPGH 1Y3UA 1EPTB 3BTFE 4FVBA 1C2KA 1LPKB 1ELAA 3K9XB 2FS9A 2GCHG 1C1OA 3M5NA 1XUHA 1WYKA 4THNH 5EPNA 1QJ6B 3SUFA 1QNJA 1O2VA 5EXNA 1HV7A 3E0NB 4MPVA 2Q6DA 1JOUB 1O3MA 1ELFA 4CH2B 3V12A 2TRMA 5EGMA 2ZDNA 3LT3A 1RRKA 3FAOA 1QR3E 1C1RA 4F49A 3MNXA 3RU4T 4ESTE 2FM2A 1P9UA 1PQ5A 2ZGCA 4TWWA 2AGGX 1FY5A 1C1QA 1YPLH 2Y6TA 1HGTH 1Q31A 1FLEE 1ZSJA 4Y7AA 5C67A 1ORFA 2H9EH 2VIQA 1E0FD 2QF0A 1UTJA 1KIGH 4IW4E 3DHKH 1OOKB 1ZMLA 1K28D 1O2IA 1W3CA 1O5AB 5JBBS 4JK5A 2AIPA 3UNQA 4A7IB 2BVRH 1D3QB 1O5EH 1GBTA 5PTPA 3UNRA 2A31A 4DW2U 1SLVB 1YLCA 4TWYA 3T26A 1HAIH 3KIDU 1T7CA 2BY7X 4FU7A 3BG4C 3MH7A 3M35A 1KXBA 4JYTA 1KTTB 1P2JA 1ARBA 1QHRB 2BOKA 1ESBA 3I77A 4MG3A 5C2ZA 3W95A 4FUCA 3MI4A 1ABJH 3RXVA 1JMOH 1C5MD 1TQ0B 4XDEA 2ZFTA 5F8XA 1KLTA 4K3JA 4WH6A 5B6OA 1PYTC 2PKAA 4INLA 3S9AA 1A2CH 3PLKA 4FUJA 3T25A 3ZZBA 2ZGHA 1FY8E 4MNYA 4X6NA 1LVBA 1BDAA 2CHAB 1T8LA 2QXJA 2QCYA 3VXFH 1UMAH 2XBVA 1YCPH 1O3PB 1O2SA 5GDSH 9LPRA 1S83A 2SNWA 1GJAB 2FOMB 2ZTXA 2VVVA 3BTEE 3CS0A 1Y5BT 4CBOA 1FAXA 1CGJE 4AFZA 1T8MA 2W3IA 4TPYA 1O2PA 2FO9A 2XBYA 2Z3EA 3BTQE 3FFGA 3SJ9A 1PPHE 1HAYB 2QXGA 3NPSA 3RXEA 2C93B 2BYAX 1UK3A 2BDIA 1YBWA 1GBBA 3AASA 1SGDE 1M9UA 5E0HA 1TRYA