1O32A

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o32A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o32A02
1F0TA 1WSSH 1WOFA 2HVXA 3KN2A 4ZHAA 3SQHE 3FANA 4WXIA 1ANEA 1S81A 1GBIA 1GJ5H 3VEQB 2BDHA 1QR3E 3BTWE 5EXMA 1KY9A 2B9LA 4NSYA 5AF9H 1F5LA 1PQ7A 5EU8A 1PQ8A 3O8RA 1XUGA 1AN1E 1EZQA 3VFEA 1FIZA 5L6NH 2QY0B 1BTWA 4IC6A 1ESBA 3STJA 2J9NA 1AVWA 4ASHA 1ETRH 5AFZH 5EW1H 1YPLH 3PB1E 4K60A 1NT1A 1GJ9B 1O39A 3FP8E 3M5MA 2NU4E 1ZOMA 1O37A 4Y8YA 1MUEB 5EQQA 3BTDE 3ELAH 1GI7B 1ARBA 1S83A 1F5RA 2O8WA 3RLYH 2ZFSA 2ZCLP 4X8TH 4KGAA 3QUMP 1G2LA 2UWPA 4ABDA 5K0HA 1TGSZ 4D76A 2ZFFH 1NFUA 1P2MA 2EC9H 1YPHC 1OSSA 1DLEA 1OS8A 2NU2E 3RXOA 4INLA 2GMTB 3TH4H 1AO5A 2NWNA 1S5SA 1CO7E 1PPZA 2HLCA 5DO4H 1P04A 2VWLA 5LPFA 3DA9B 3ATKA 2BD8A 1LHDH 4QT8C 1G32B 6CHAC 3E0PB 4NWKA 1ZZZA 3PWCA 3GCTF 1MCTA 1FY1A 1ARCA 1O5GH 2D2DA 3TPIZ 1AY6H 1NS3A 1HUTH 2VIQA 2A2QH 4ZAEA 1XVMA 4B73A 2BXUH 3SU1A 1UHBA 2BOKA 3T27A 1RJXB 1V2OT 3RXLA 3RC5A 4CRGA 3TJUA 1TIOA 3LC3A 2NU1E 2C4FH 1C1NA 2FLBH 1TGBA 4Z0KA 2IJOB 4A5TS 1SSXA 2AEIH 4ABAA 4IC5A 1GBTA 1GHYH 1GBAA 3I77A 1RRKA 1LDTT 1BDAA 3EGKH 1SLWB 1T8MA 3RXKA 1IQKA 4E06H 2BY6X 2JH5D 5EXNA 4K8BA 1TX6A 3ATMA 1SGCA 1XX9A 3SNAA 1NO9H 2Y7ZA 4HTCH 1Z71A 1O33A 7ESTE 3MMGA 3T26A 1QGFA 1O34A 3NWUA 3GOVB 1L0ZA 1HIAB 1T31A 4JMYA 5EG4A 1UCYH 4Q2KA 1TB6H 4IN1A 1CGIE 2ZF0H 1BTHH 4NA9H 4CHAB 3OX7U 5F6MA 2C3SA 4AYYB 4NFFA 2GCTB 1XUIA 5J4SA 4AFZA 1BMLA 1GHVH 2BD9A 5EPNA 1LMWB 1W0ZU 1EX3A 3TK5A 5DPAA 1C5UA 4ZMAH 1UHBB 1ELAA 1K1PA 1K21H 4IMQA 2FI4E 2TRMA 1Y5UT 1BHXB 2EI8A 5T6GA 2SFAA 3PTNA 2ZNKH 3QZQA 1SGQE 3ZZAA 1O3LA 4UONA 2ZGHA 1QA0A 3A7ZA 4X0WU 4H4FA 2BQ7B 4WWYA 2ZFQH 4HFPB 1AUJA 1O5CB 1SLVB 3QN7A 5EOKA 3ZZ7A 1T4VH 2QV1A 3SHAH 2V35A 3SNBA 1O3FA 4XOJA 2ANMH 1UTOA 3GCHB 3PLKA 1P2IA 1EB2A 1GWAA 2Q1JA 1C5TA 1ZYOA 1SQTA 3EYDA 2PKAB 1ZHRA 1IQIA 3ODFA 4OS5A 1GJAB 4X2VA 1HJAC 3BG4C 1O5EH 1TRNA 4Y10E 4DCDA 4I32A 5DP4A 1DSUA 1P2OA 1DUAA 1AE8H 3A89A 3HK3B 2F83A 3RXBA 4ESTE 2A0QB 2Y80A 5DG6A 4OGYA 5LPRA 1F0SA 2ZPRA 5CHAC 2A4RA 3SJ9A 3LT3A 2BY7X 4ABHA 8KME2 3IITA 1MD8A 1DWBH 3IWMA 1XVOA 3GDSA 1F7ZA 4SGAE 2KAIA 1HAPH 4WVPE 1PPBH 3ZVDA 1O2JA 4XBBA 3RM2H 1ZSKA 2J92A 1SGFG 2VINA 3NZIA 2P16A 2A32A 1NPMA 2R3UA 2W7SA 4R0IA 3BEFB 2PUXB 3M7UA 1RS0A 2WPMS 5HM2A 1SHHB 5HM9A 1K1MA 1FONA 4Y79A 4ZXXH 3TVJB 1NU9A 2QXGA 5IYTA 5EW2H 2VVCA 4JZIA 3EA7A 5JB8S 2AMDA 1W0YH 2F3CE 3E3TA 1PYTC 2Y5HA 3RXIA 4CRCA 2ZO3H 2Q6DA 4D8NA 1C1PA 1BRBE 1SFQB 1EOJA 1RXPA 3A7YA 3ATIA 2AIPA 3UWJH 1H8IH 4XBCA 2H5CA 3HPTB 2PTNA 2BX4A 1BTPA 4AORA 3CENA 3F9GA 3MWIU 1PPFE 5T3HA 1XXFA 4J2YB 2J34A 4RSPA 3RUOA 1HB0B 1AD8H 1GHAF 1GI8B 1ELBA 1ZTKA 1INCA 2AFQB 2XC4A 2FDAA 1UTLM 1P01A 4AFUA 1CT0E 1MAXA 3FVFB 2FOBA 4AB8A 1A5IA 1AWFH 1MAYA 5C67A 1C1WH 5AHGH 2ZDVH 2TGDA 1QY6A 1GDUA 2Q6GA 2G4UA 1U6QA 4FU9A 5TJXA 1FXYA 4HI3A 1A0LA 3T2NA 1EPTC 1ZTJA 5GIBA 3K9XB 5DP8A 1HAXB 2ZDNA 4TYDA 1GBDA 4DVAU 2QXHA 4IBLH 2RDLA 2CF9H 1MTUA 2C93B 3KQBA 2BQ6B 4A92A 2BMGB 1O3CA 3PMBB 1A0JA 7KMEH 3BTEE 3C1KA 1GDNA 1MBQA 2GDDA 1ORFA 3PLPA 5F8XA 2OUAA 2ZGXH 3RXGA 3W95A 3DD2H 2Z94A 3PO1C 3MO6A 1SG8B 1YPMH 2WV5A 1P3CA 1O2NA 3UQOA 2ZTYA 4WF8A 1DS2E 2ZU2A 1YC0A 1P05A 3CP7A 3T5FH 1O3AA 1OP8A 1TQ0B 3KQEA 1C2IA 5FPSA 3RMNH 2FOGA 1IQFA 1G3DA 3M36A 4FUDA 7GCHF 1EAWA 5F03A 4CRBA 4TWYA 3I78A 1AI8H 3TK9A 1THSH 2GVFA 1TALA 1K2I1 2FIRH 4O9VA 5FBEA 5H4IB 3ZYEA 1Z8IB 1ZPCA 4NZQA 1E0FD 1LQDB 2Z9JA 1N8OB 3KEEA 3ZZ9A 3RXRA 3AASA 3ZZCA 3LH1A 1QL7A 4A1XA 3LPRA 4Q7XA 1BMMH 1NY22 1VITG 2VJ1A 1ZHPA 1TAWA 2ZZUH 1UVOA 3F1SB 3PLBA 1ELFA 1TBZH 1O2YA 3GY6A 4B74A 3BG4B 2BY5X 4CBNA 5FHTA 1ANCA 1O3MA 5ESTE 1TBQH 1C2JA 1HYLA 1B7XB 2ZECA 1MH0A 2ZTXA 2HWLB 8GCHF 4JZ1A 2STBE 4X1QU 1V2WT 1F0RA 1H9IE 4KELA 1XUJA 3A81A 1D9IA 2PTCE 1V2NT 4UFFH 1TNHA 1ELDE 3E1XB 2BY9X 5L2ZH 4LXBH 1TX7A 3P6ZB 2VH0A 1TNJA 1L1GA 1V2PT 5GWZA 2A45B 3BIUH 2A7JA 1P8VC 1TPOA 2PKSC 4KTSA 1Q3XA 3ZV8A 2GDEH 4UFDH 2H9TH 4BAQB 1N6YA 4GSOA 5E0GA 3SUEA 5JBCS 3GICB 4NIWA 2H9HA 3FZDA 3S7KB 1MU8B 2FTMA 4GHQA 2CN0H 3K65B 3VGCC 4WMDA 3Q3YA 3M35A 3F9EA 5A8XA 1C5PA 1YP9A 1PJPA 3MH7A 2A4GA 3JZ1B 1P03A 1BBRE 2G4TA 2FMJA 1QBOA 3A85A 2PSXA 2ALPA 1GI3A 1OWJA 2KAIB 3KQDA 1B5GH 4MPXA 2OC7A 1G3EA 1VJAU 3ENSB 2FPZA 2NU3E 3M37A 1DY9A 1SVPA 4AYVB 3R3GB 2AH4X 1IHTH 4X8VH 1T8OA 1GMCF 2ZFTA 1QQ4A 3O8BA 1A3EH 1W12U 4I8JA 1PPGE 1QTFA 2ZGJA 3FP7E 2F9VA 4X6NA 3T25A 3MO9A 2QCYA 3KCGH 2W3KA 1LCYA 2UWOA 1RFNA 1GDQA 4BTUB 3RXCA 3TNTA 1BTXA 4GVUA 3SOSA 1TONA 4NFEA 5E8EH 5C2ZA 5JPMH 3SU2A 1BJVA 4Q80A 1FI8A 1GI2A 2F9NA 3OSYA 3S69A 4BTIB 1JMOH 2ZU5A 3S0NA 2ZDKA 2XXLA 3M5NA 4KTCA 1E35B 1BRUP 2ZHDA 1MTWA 1TRYA 2XNIA 2ZC9H 1CVWH 2BZ6H 1C2GA 1BUIA 3RXQA 1YCPK 1FPHH 1THRH 1YPKH 2XCNA 3KHVA 4OS1A 3LGIA 2HPPH 4NCYA 1JXPA 3TITA 3SGAE 1QBNA 2OQ5A 1DANH 4YOGA 1P2JA 2PSYA 1O36A 5IDKA 1O2KA 4IMZA 1NZQH 1CGJE 2ZDLA 2Y5FA 1LKAA 3LU9B 3UY9A 1WV7H 3RXEA 2BLVA 1MKXH 1O30A 3P70B 4JZEH 1IHSH 1GJ8B 2GZ7A 1OYTH 1AMHA 2BLOA 3K2UA 1D6WA 1GMDG 1FY5A 1ETTH 1AGJA 2PV9B 1PQ5A 2OCVB 4DT7B 1MZDA 2Z9GA 2FXRA 2C8YB 4IN2A 1DVAH 1C5NH 1MBMA 1WUNH 3A87A 4CBOA 4BOHA 5C5NA 2AIQA 3SW2B 1EZUC 3VPKA 1LVOA 2J2UA 1FNIA 3OY5U 3SZNA 1YLCA 5FCRA 4ISHH 3NUMA 4X2YA 1C9TA 1QL9A 4Y8XA 1AKSA 2F9BH 1KTSB 3NXPA 2WINI 1SQAA 4Y7AA 1Z8RA 3PYHA 1OWDA 1ZSLA 6GCHF 1SLUB 1JRSA 3SN8A 3SO3A 4A6LA 4X1PU 2GCTC 4AB9A 1GBLA 3VB7A 1DDJA 4K2YA 2BOHB 3SUDA 2BDIA 1T4UH 4UDWH 1ELCA 2AYWA 1O2QA 3SU5A 3SV9A 1EPTA 2HNTC 4Y0ZE 3SU3A 1MU6B 2Y7XA 5SGAE 1DM4B 3SGQE 1KXEA 3SHCH 2LPRA 1TOCB 3RC4A 4IGDA 3TJOA 4VGCC 4WH8A 3SU6A 3HK6B 1S85A 4OS6A 5DK1A 1OX1A 1AFQB 4ZKNU 1V2LT 1TQ7B 2QYIA 6LPRA 1MKWH 3SI3H 1EZXC 1TLDA 3ZVFA 5CE1A 5L30H 4WMEA 3T28A 1A5GH 1SB1H 2B0FA 2YOLA 1BQYA 4CH2B 1UTQA 1HLTH 1UTKA 1GMCG 4JYTA 3D65E 1AKSB 1GG6B 1GMHG 3MU0A 2WPHS 1YPHE 2AGGX 3FP6E 2J38A 5LGOA 1G9IE 4MDSA 1SLXB 3RXFA 3SV6A 4RN6A 1EJMA 1K1LA 2Z9KA 3MHWU 3F9FA 2BDAA 1KLTA 4BXSA 4F49A 6ESTA 1CT4E 4X1SU 5AFYH 2BY8X 5TCCA 1FY4A 1NU7B 1O3GA 2ZPSA 1S0QA 4JYVH 5HGGA 4BAHB 3QGNB 2BLWA 5L2YH 3GISB 4OS2A 1EKBB 3ZYDA 1G3BA 5AVDA 1GI9B 1O3HA 2F91A 2XYAA 2FS8A 2NU0E 1BBRK 1CA8B 2FI5E 2VVVA 4JYUH 3RU4D 3RDZA 1HJAB 2HNTF 3LC5A 3TGJE 1C1OA 1S6FA 1HAZB 1EQ9A 2VIVA 4YM9A 2Q6FA 3GYMA 2QN5T 1GBFA 1GVZA 3PROA 3A7TA 2F9OA 3ZVCA 1TNKA 1LQEA 9ESTA 2Z3EA 1B0FA 2V3HH 2C8WB 1TNLA 4H42U 2PGQB 2H2ZA 2D8WA 1NFXA 2HPQH 4NSVA 1P11E 2PHBA 1CE5A 1O3IA 2EEKA 1VCQA 3UNRA 1WAYB 2QF0A 3UTUH 1KDQA 2GKVE 1MKXK 2PKSB 1A1RA 3GCOA 4NG9H 6CHAB 4FUFA 1VGCB 4DY7B 1QJ1B 2ZG0H 4YOJA 4ZKOU 4K3JA 3BTHE 1MQ5A 2FOAA 3WY8A 2CHAC 3LH3A 2ZEBA 3BN9A 4MNXA 1FMGA 1KLJH 3RLWH 5ABWA 4ISLA 1WTGH 3E90B 2DE8A 3SUGA 1CBWB 3UUZA 2XWBI 1DWEH 2ZHFH 1QL8A 5EODA 1NN6A 1YCPH 4KKDA 3LIWA 1UVSH 5PTPA 1NRPH 4F4OC 2R2WU 2VVUA 2WUBA 2PR3A 1UTMA 2Y82A 1Y3XA 4INHA 4GUXA 3A8CA 1ABIH 1HGTH 4LOYH 5JDUB 1OWHA 2J94A 3SJIA 2TGTA 4B76A 3RMLH 4LZ4B 1J16A 1DY8A 1O2MA 4FUBA 3ZZ4A 2FX4A 4UFGH 4JZDH 2XBYA 4Y7BA 2EI6A 1T7CA 2VB0A 1BOQA 2CV3A 4D7GA 1YLDA 1ID5H 1N6XA 1JIRA 2XC5A 1VITF 4WY3A 5J4QA 1W7GH 1IQNA 3TU7H 2FEQH 4ZUHA 3EDXB 3E91A 1V3XA 4Z6AH 1MQ6A 1HXFH 3Q76A 1TFXA 1EUFA 1XUFA 4YESB 2AERH 5JBTA 1MZAA 1Z8GA 2GCHG 2XW9A 4NA8A 1QFKH 4Y71A 4BTTB 1HDTH 2C8ZB 4B75A 1SQOA 3SGBE 1T8LA 1ZSJA 1K1JA 5DP7A 3QK1A 3N7OA 1BMAA 3HATH 4B2AA 1HXEH 1UO6A 2BD2A 1F0UA 3VXFH 2P3UB 3ZVAA 3MU5A 1BITA 1A2CH 1KXCA 1P2NA 4K1EA 1LO6A 1XKAC 2W7UA 2FLRH 2FOMB 2GCHF 2BD4A 2J4IA 3AW0A 3SJOA 3TH3H 4JZFH 1C1QA 1O2HA 1HNEE 3AAUA 3UR9A 4BXWA 4I8HA 3GCHC 1GJ4H 1V2MT 3GYLB 4J1YA 1DPOA 3A8BA 1IOEA 1EPTB 1K28D 3RU4T 1C5MD 2Z9LA 1CSOE 4RKJB 4AG1A 1VGCC 3RP2A 3NKKA 5FXLA 1YPGH 3BEIB 4CR9A 1CU1A 3ZV9A 4WXVA 5A2MH 3RXUA 4AX9H 3GCTG 3OY6U 1RGQA 3BIVH 2A5KA 3U98H 3SU0A 1C1RA 2A4QA 2P93A 1ELGA 3NCLA 2FESH 1KYNA 3RXAA 1V2JT 1E36B 1W10U 4FUCA 3ESTA 1O3PB 2K1QA 4X8UH 2PUQH 2OBQA 1N8OC 3LGVA 5HMAA 1BBRH 3VXEH 3P92A 4GCHG 3LKWA 1BTYA 3MU4A 5C5OA 4GLYA 1KLIH 1GPZA 3DFJA 1XXDA 3U1JB 1OWIA 2GGVB 1O5FH 2BDCA 2ZPQA 1GBJA 2FTLE 2ZHWH 5E0JA 1FAXA 3GY4A 2RA0A 1NFYA 3BG8A 2FI3E 1JIMA 3V7TA 2G55A 1IQEA 1AFQC 2QIQA 1W13U 4YO9A 1EJNA 1HAIH 2G81E 4NGAH 3MNSA 2GT7A 1DT2A 3V12A 4A1VA 1P9SA 3VB6A 3Q3KA 4MVNA 2SNVA 2GTBA 5FX6A 1Z8JB 1D4PB 1P09A 2CXVA 4DIIH 3UIRA 2QXJA 4DURA 1TPPA 1W2KH 5TCAA 1FIWA 2BB4A 1P10A 1AVXA 4U01A 3LJOA 2G8TA 3D49H 2M5TA 5HXFA 1GI4A 1C5OH 3ATLA 3LGUA 2IN2A 4ABGA 1O2UA 3RC6A 1DWCH 5DP3A 2PKAA 1LVYA 3GCNA 4MPWA 3H5CB 1LPZB 5A8YA 1AHTH 4YT7H 2P59A 1K1IA 1O2IA 1GBCA 1UTPA 1JOUB 2A31A 1O2XA 3A7XA 3QLPH 1EAXA 1L4DA 3VB3A 1OYQA 1TMUH 1GBBA 3QWCH 5GXPA 3RXSA 1PYTD 1JRTA 4K69A 1UTJA 3NK8A 1O2ZA 3K6YA 4XFQA 1C5YB 3MFJA 3PTBA 2ZGCA 2BDYA 1FUJA 1QRZA 3UFAA 3ZZ3A 3A82A 3TNSA 1J15A 1Q31A 4DOQA 4ZHLU 1D3TB 1ACBE 1KXBA 4ABFA 2W3IA 2FM2A 1YBWA 5EPYA 1GJ7B 1ESAA 2ZWLH 1AZ8A 2TPIZ 5C3NA 1O2GH 2HRVA 1QNJA 2WV4A 1NC6A 2GZ9A 3LOXA 1ZJKA 3CS7A 1DITH 3KNXA 1O2VA 4X2WA 2G52A 1C2KA 5GDSH 2ZCHP 1O35A 5EXLA 2RG3A 1DE7H 3EAJA 5HYOA 1BT7A 3M7TA 4SGBE 5FBIA 1P06A 4XE4A 8LPRA 1JBUH 1OOKB 3M5LA 2H5DA 4YTAA 5JB9S 2ZU1A 4MPVA 1GMHF 1AFEH 3L3TA 1YF4A 1O32A 1OPHB 1P2QA 1Z6EA 1HAVB 3KIDU 1RTLA 4I33A 1S82A 1XUHA 3SJ8A 1N1LA 2ZQ1A 1PPEE 1C2LA 1UTNA 2I6QA 3A83A 1O3EA 1YYY1 5GJ4B 1P3EA 1EOLA 2SGEE 4FUEA 4OS4A 2CHAB 1A46H 2FOCA 2O8UA 2ASUB 3R0FA 4WJG2 1WYKA 2B8OH 2ZHQH 1WQSA 4O97A 1DOJA 2AGIX 5DGJA 2QF3A 1O0DH 1ANBA 1NTPA 1SOTA 2WPKS 2OC8A 2BD7A 2Z3DA 2ZA5A 1XMNB 2BYAX 2ZQ2A 1O2TA 3BF6H 1IQMA 2VGCC 3RXHA 1J9CH 4IW4E 5DP5A 1AQ7A 1ELTA 1OP0A 2HOBA 1D3PB 2VWOA 3SJKA 3GY5A 4NIYA 1UVPA 2FYQA 2RA3A 3P8GA 2ODPA 3UWIA 5CMXH 5FCKA 3S7HB 4X6MA 2ZKSA 3A88A 2A2XH 2ZGBH 3EQ0H 4MQAA 1E37B 4AN7A 3HKJB 5LH8A 1CHOF 1L1NA 1QCPA 4U30A 2P3FH 4DW2U 3F68H 2JETC 1BHXF 2ODYB 1LKBA 3E8LA 4WMFA 3PMAB 3SBKA 4X1RU 3RXTA 1TABE 3GDUA 5K7RA 3ITIA 4CRAA 3VB5A 3TH2H 1A7SA 1H9LB 4B1TA 1JWTA 2P3TB 7LPRA 1QRWA 1BMNH 1J17T 4ISOA 1LHEH 1THPB 3EA9A 3MNCA 3AW1A 1QURH 1XM1A 1MTNB 1V2TT 1GHXH 1YGCH 1UVTH 1W8BH 4Y76A 1EATA 2BHGA 4MLFB 2AMQA 3ZVEA 1PFXC 1H8DH 1BB0B 2VNTA 1IQLA 1YPJH 4BAKB 1A3BH 3ZZ6A 1ZR0A 1GJCB 3SNCA 1IQJA 2TGAA 3U8RH 1O3NA 1V2UT 4ZROA 1PQAA 4I31A 4O3UA 1LVMA 4DIHH 1F92A 1E38B 1NESE 1RIWC 2UUYA 3HGPA 1SGIB 4MPUA 4HZHA 4YT6H 1Y3YA 3MI4A 2BDBA 2RCEA 3L6PA 3MNBA 5E2OA 1WBGB 1ZMJA 1HAHH 3F6UH 1FY8E 3NPSA 4GHTA 1PPHE 1VZQH 3F9HA 1K1NA 4IS5A 2ZP0H 3SV8A 2O8MA 4ISNA 2ANWA 4UEHH 1GCDA 2ESTE 2FOFA 1FAKH 2Y6TA 3P95A 2ZFRH 1A0HB 3V13A 1GBEA 1SGYE 4B2CA 1ANDA 4UD9H 1QIXB 4U32A 4GPGA 1HIAA 3O8CA 1SC8U 3BTME 5DKMA 1P57B 1TRMA 3O8DA 2D26C 1GL1A 2VIOA 2F9UA 3PWBA 3PO1B 5C1YA 3MTYA 1HRTH 1DSTA 3DHKH 1WQVH 5EQSA 4TWWA 2CGAA 1TNIA 1FV9A 2OQUA 4NIXA 1V2ST 3S9BA 2QGRA 1XUKA 1ELEE 1C4U2 3SI4H 5A8ZA 3QGJA 4XSKU 1QA7A 2PW8H 2HALA 1GHWH 3SV7A 1TYNA 4FVBA 3LGWA 2B5TB 3SNEA 2VIWA 1D3QB 1T32A 3PMJA 4U2WA 1C5SA 1AWHB 1L4ZA 3RXDA 3MH6A 2GT8A 2ZFPH 5T6FA 3B8JA 1Y3VA 3Q00A 1KSNA 1MKWK 1GCTC 5A0BA 4KP0A 2DE9A 3TIUA 2OTVA 1KXDA 4K8YA 1YPEH 3MH5A 1NRNH 1QHRB 1SOZA 5LPEA 1C1SA 4FUGA 3SUFA 2PWXA 3RMOH 2BVSH 2UUKB 2W5EA 2BD3A 1AU8A 1EP5A 1Z1JA 1EP6A 1G3CA 2Z3CA 3OTJE 4YOIA 4FUIA 1O3DA 3A84A 1QQUA 6GCHG 3T29A 1BTUA 4ABEA 1Z7KA 1PPCE 4NIVA 1CA0C 2GP9B 2BTCE 2WPLS 1FJSA 3ZVGA 2WYGA 3Q77A 3P8FA 3LDXH 4H6TA 1ZRKA 3MU8A 1DXPA 1GI1A 3ZZDA 4X1NU 2JH0D 1P02A 1TMBH 1KXAA 4MG3A 1DICA 1KXFA 3M7QA 3HGNA 1C5RA 2J95A 1EZSC 1VITH 1CBWC 1O38A 4D9RA 2SGAA 1SBWA 3UNSA 2BZAA 1Z1IA 1GBKA 1SMFE 2VWMA 1CA0B 1NM6A 1DXWA 4DGJA 1QB1A 1S84A 5I46H 8ESTE 1SGEE 1ZPBA 2OBOA 1ZJDA 3MNXA 2O9QA 3D62A 4VGCB 1SGTA 2AMPA 5FX5A 4AFSA 5F8ZA 4UFEH 1P9UA 3A80A 4E7NA 2ZI2H 5G4BA 1LTOA 4AOQA 1K22H 1ZRBA 2I6SA 2ZTZA 1KTTB 2CJIA 3V0XA 5JBAS 1W11U 3G01A 2VIDA 5T6DA 1FN6A 4TPIZ 2GV7A 3QTVH 2H1UA 4Q7ZA 1MD7A 1C2DA 5FPTA 4ABIA 2FX6A 4I8GA 4R8TB 1EAIA 3TGKE 1WCZA 3MOCA 2VIPA 4FXGH 3M3SA 1DX5M 4RKOB 3Q3XA 2FOHA 1V2KT 3PV4A 2SGQE 3LONA 1TGTA 3QX5H 5ESBA 1UK4A 2BQWB 1SGRE 2VGCB 2FODA 1O5BB 2FS9A 1BRCE 1FPCH 2JH6D 3OU0A 4GAWA 2WUCA 3S9CA 2SNWA 3P8NA 5EGMA 5FPYA 1IAUA 1DFPA 4BNRA 1G30B 1VR1H 4CR5A 1ZLRA 3DFLA 1H1BA 1Y3WA 3BSQA 3SV2H 1C5LH 1AE5A 2FZZA 1SGFA 3U8OH 4OS7A 1MTVA 4X6PA 2VWNA 5BRRE 2ANKH 1C1MA 4O3TA 1C1TA 3QZRA 1C1VH 1O31A 2H9EH 4YLUA 1GI5A 1GVKB 2BVRH 4INKA 3M5OA 2UWLA 4Y11E 3URCA 1IQGA 1FDPA 4Q7YA 2P94A 2ZHEH 1QBVH 4CRFA 3MU1A 4CH8B 1GJBB 1BJUA 1HAGE 1O3KA 4D7FA 1GBMA 2A7HA 3EE0B 1T8NA 9LPRA 3L33A 2YNAA 3MYWA 3RXJA 3GY2A 2F9PA 2QAAA 3RXPA 1O2RA 1RD3B 1FLEE 5EQRA 4AG2A 4ISIH 3D23A 1O2PA 1Y3UA 1NRSH 2OC1A 2A7CA 2ULLA 1LHCH 3PM3A 4CHAC 4I8KA 1IQHA 5A0CA 1AB9C 3KL6A 1BCUH 1L1JA 5B6OA 2PGBB 1QJ7B 3A7VA 3UREA 3PMHB 1OWKA 1AIXH 2B7DH 2W26A 2GZ8A 4NA7A 2BD5A 3DUXH 1C2MA 1LHFH 1GBHA 1V2QT 3M3VA 3UPEA 1XKBC 3TGIE 5DP9A 3AVZA 3URDA 1MTNC 3MO3A 1G37A 3IG6B 3SQEE 1J14A 1V2VT 2ILNA 5JBBS 1RTKA 3VB4A 1ZTLA 3U8TH 1FY3A 2H6MA 1G36A 1S0RA 1EASA 2HNTE 1C4Y2 2V0BA 2G5NA 2JETB 1GVLA 1LHGH 1X7AC 3FFGA 1TGNA 4XBDA 2C90B 1C5XB 3HKIB 4CRDA 2QXIA 2R0KA 2R0LA 1TMTH 2VH6A 1DLKB 3B23B 2CMYA 3FZZA 4OGXA 5BPEA 3UR6A 2UUJB 1O2LA 5GPIB 3QO6A 1UCYE 1B0EA 1TPSA 1GJ6A 1HAYB 1Y5AT 1BTZA 1D3DB 4ZH8A 2Y5GA 3OYPA 3A7WA 1YM0A 1LPKB 4HGCA 3S9AA 2WPIS 3RXVA 3MH4A 1UVUH 1ZMNA 4DJZB 1UMAH 5A0AE 3UQVA 1AVGH 3ATWA 4MTBA 5A09A 1O5AB 3SNDA 2THFB 4ABBA 4NZLA 4WH6A 3UOPA 3B9FH 1HPGA 1VCWA 3GY3A 1L2EA 4ZXYH 3CS0A 1P12E 3RXMA 2YNBA 2O8TA 3U1IB 1OP2A 2AS9A 2LNCA 1F5KU 1NRQH 2O8LA 3RM0H 1ZHMA 1OKXA 2FP7B 1H9HE 1GI0A 3M61U 2XBWA 4H6SB 5F8TA 3V3MA 2XBXA 1YCPM 1GGDB 5JYIA 3UOUA 2D1JA 1UK2A 5C1XA 5ETXA 4I7YH 4BAOB 1HAOH 1HJ8A 3ZZ5A 5CHAB 4BANB 3QDZB 1TX8A 1C9PA 4FUHA 1FZZA 1C1UH 4BAMB 1TNGA 2HGTH 4E05H 3FAOA 2BLQA 1ZGIA 2Z7FE 1AZZA 3BTQE 2VU8E 1HV7A 2XC0A 4A1TA 1CHGA 4ZKSU 1C5ZB 5I25A 1O2OA 4E7RG 1Q2WA 3BTKE 1GMDF 1GJDB 2ANYA 1G2MA 1HCGA 1QB9A 2P8OB 2V6NA 2OC0A 1K1OA 1SPJA 2OP9A 1GCTB 5GCHF 2EI7A 3EA8A 4K1SA 3TLOA 4LZ1H 1FN8A 2V3OH 1KDQB 2OINA 2ZU4A 1ESTA 2G00A 3BTTE 4MNYA 1GHZA 1VCPA 1A61H 1QB6A 1C4V2 4KTUA 5C1UA 4DG4A 3SORA 1V2RT 2QC2A 1KIGH 1D6RA 2ZU3A 1EJAA 3H7OA 4A7IB 2XRCA 1CT2E 3RMMH 2GMTC 3A8DA 1HFDA 3JZ2B 1SGDE 1W7XH 3ZVBA 2BVXH 2ZDAH 3BTGE 2FO9A 1DUEA 2BDGA 1GL0E 2OD3B 2G51A 1YKTA 1QJ6B 1TOMH 1ELVA 4K1TA 4TY6A 1QRXA 1HJ9A 4MNWA 3M3TA 1GGDC 2XWAA 1AB9B 2XBVA 1S6HA 2BXTH 3U69H 4AZ2B 1SHYA 4Y8ZA 3A86A 4Y0YE 3E6PH 3VGCB 3P8OA 5GCHG 3QTOH 1ZPZA 2PFEA 1E34B 1W14U 1VJ9U 2AGEX 1EXFA 4THNH 1M9UA 4ZHMU 2A1DB 1AUTC 3LJJA 2P95A 2ALVA 2XCFA 3C27B 4XDEA 1WTHD 4B2BA 3BV9B 5DP6A 8GCHG 1CHOG 4X2XA 4CREA 1HBTH 2Z6BD 3P17H 3UNQA 1H4WA 3GY8A 1Z6JH 2XTTB 1SL3A 1MMJN 2JKHA 1MTSA 4PROA 1ZMLA 2CF8H 1GI6A 1WU1A 5E2PA 4UE7H 2SGDE 1J8AA 1TBRH 3H7TA 4JK5A 4X8SH 1W3CA 3W94A 1UJ1A 1OWEA 2EA3A 4O03A 1TA2A 1C2FA 4B71A 1BRAA 1FQ3A 3A8AA 1CGHA 2ZDMA 2TIOA 1ABJH 1SFIA 2IPHA 3KGPA 5E0HA 2QA9E 1SR5C 1TWXB 1Y59T 2OXSA 3AAVA 4TY7A 3SU4A 1GHBG 3DT0H 2R2MB 2ZCKP 1TE0A 2TBSA 4YLQH 1O3BA 2A4OA 1C2EA 3E16B 2FOEA 4M7GA 3LGYA 4D9QA 1EB1H 1C5WB 1RIWB 1Y8TA 4ABJA 2A5AA 3RU4E 5C20A 1NROH 3TJVA 1A5HA 2WPJS 4FUJA 1UK3A 1TGCA 1BA8B 1UCYK 4Y6DA 4GCHF 4X6OA 1OXGA 3GDVA 1SGPE 3I29A 3U9AH 1DWDH 1SGNE 2A5IA 2GD4B 3ZZ8A 1O2WA 4JK6A 1C2HA 4AGJA 1TPAE 2DUCA 3GY7A 1O3OA 2IOTA 1NRRH 1P2KA 1LPGB 3BEUA 2ZIQH 4TPYA 2SGFE 3STIA 3ZZBA 4FU7A 3BTFE 1F2SE 3ODDA 1A4WH 2WYJA 1GHBF 4ZKRU 1Y5BT 1EAUA 2SGPE 3LGTA 2C8XB 1BZXE 2ODQA 4FU8A 2P8OC 3K6ZA 2UUFB 2PLXA 1P0SH 1RTFB 2FWWA 5FAHA 4YZUA 5DJ7A 3T62A 1O2SA 3TK6A 2BX3A 2R9PA 1GG6C 4AGKA 1V6DA 1BIOA 1NFWA 2STAE 1TA6A 1O5DH 1GHAG 1O3JA 1C5QA 2OLGA 2G5VA 4I8LA 3KQCA 4MNVA 2R3YA 1CQQA 1SI5H 2GX4A 1LVBA 4LK4A 1ZGVA 4AFQA 1MCVA 1C5VA 1K9OE 7GCHG 2BM2A 3E0NB 1HAVA 4NWLA 3KF2A 1ETSH 4FVDA 4JCNA 2FYRA 2GV6A 4K5ZA 3TJNA 2Z9IA 2Y81A 2TGPZ
chains in the Genus database with same CATH superfamily
3PV2A 1F0TA 1WSSH 1WOFA 2HVXA 3KN2A 4ZHAA 3SQHE 3FANA 4WXIA 1ANEA 1S81A 1GBIA 1GJ5H 3VEQB 3EE7A 2BDHA 1QR3E 3BTWE 2QF4A 1KY9A 5EXMA 2B9LA 4NSYA 5AF9H 1F5LA 1PQ7A 5EU8A 1PQ8A 3O8RA 1XUGA 1AN1E 1EZQA 3VFEA 1FIZA 5L6NH 2QY0B 1BTWA 4IC6A 1ESBA 3STJA 2J9NA 1AVWA 4ASHA 1ETRH 5AFZH 5EW1H 1YPLH 3PB1E 1FX0B 4K60A 1NT1A 1GJ9B 1O39A 3FP8E 3M5MA 2NU4E 1ZOMA 1O37A 4Y8YA 1MUEB 5EQQA 3BTDE 3ELAH 1GI7B 1ARBA 1S83A 1F5RA 2O8WA 3RLYH 5C17A 2ZFSA 2ZCLP 4X8TH 4KGAA 3QUMP 2PP6A 1G2LA 2UWPA 4ABDA 5K0HA 1TGSZ 4D76A 2ZFFH 1NFUA 1P2MA 2EC9H 2JJ1D 1YPHC 1OSSA 1DLEA 1OS8A 2NU2E 3RXOA 4INLA 2GMTB 3TH4H 1AO5A 2NWNA 1S5SA 1CO7E 1PPZA 2HLCA 5DO4H 1P04A 2VWLA 5LPFA 3DA9B 3ATKA 2BD8A 1LHDH 4QT8C 1G32B 6CHAC 3E0PB 4NWKA 1ZZZA 3PWCA 3GCTF 1MCTA 1FY1A 1ARCA 1O5GH 2D2DA 3TPIZ 1AY6H 1NS3A 1HUTH 2VIQA 2A2QH 4ZAEA 1XVMA 5IK2D 3F0PA 4B73A 2BXUH 2LP6A 3SU1A 1UHBA 2BOKA 3T27A 1RJXB 1V2OT 3RXLA 3RC5A 4CRGA 3TJUA 1TIOA 3LC3A 2NU1E 2C4FH 1C1NA 2FLBH 1TGBA 4Z0KA 2IJOB 4A5TS 1SSXA 2WV9A 2AEIH 4ABAA 4IC5A 1GBTA 1GHYH 1GBAA 3I77A 1RRKA 1LDTT 1BDAA 3EGKH 1SLWB 1T8MA 3RXKA 1IQKA 4E06H 2BY6X 2JH5D 5EXNA 4K8BA 1TX6A 3ATMA 1SGCA 1XX9A 3SNAA 1NO9H 2Y7ZA 3NRLA 4HTCH 1Z71A 1O33A 7ESTE 3MMGA 3T26A 1QGFA 1O34A 3NWUA 3GOVB 1L0ZA 1HIAB 1T31A 4JMYA 5EG4A 1UCYH 4Q2KA 1TB6H 5FL7D 4IN1A 1CGIE 2ZF0H 1BTHH 4NA9H 4CHAB 3OX7U 5F6MA 2C3SA 4AYYB 4NFFA 2GCTB 1XUIA 5J4SA 4AFZA 1BMLA 1GHVH 2BD9A 5EPNA 1LMWB 1W0ZU 1EX3A 3TK5A 5DPAA 1C5UA 4ZMAH 1UHBB 1ELAA 1K1PA 1K21H 4IMQA 2FI4E 2TRMA 3OEED 1Y5UT 1BHXB 2EI8A 5T6GA 2SFAA 3PTNA 2ZNKH 3QZQA 1SGQE 3ZZAA 1O3LA 4UONA 2ZGHA 1QA0A 3A7ZA 4X0WU 4H4FA 2BQ7B 4WWYA 2ZFQH 4HFPB 1AUJA 2KCAA 1O5CB 1SLVB 3QN7A 5EOKA 3ZZ7A 1T4VH 2QV1A 3SHAH 2V35A 3SNBA 1O3FA 4XOJA 2ANMH 1UTOA 3GCHB 3PLKA 1P2IA 1EB2A 1GWAA 2Q1JA 1C5TA 1ZYOA 1SQTA 3EYDA 4ACBA 2KFWA 2PKAB 1ZHRA 1IQIA 3ODFA 4OS5A 1GJAB 4X2VA 1HJAC 3BG4C 1O5EH 1TRNA 4Y10E 4DCDA 4I32A 5DP4A 1DSUA 1P2OA 1DUAA 1AE8H 3A89A 3HK3B 2F83A 3RXBA 4ESTE 2A0QB 2Y80A 5DG6A 4OGYA 5LPRA 1F0SA 2ZPRA 5CHAC 2A4RA 3SJ9A 3LT3A 2BY7X 4ABHA 8KME2 3IITA 1MD8A 1DWBH 3IWMA 1XVOA 3GDSA 1F7ZA 4SGAE 2KAIA 1HAPH 4WVPE 1PPBH 3ZVDA 1O2JA 4XBBA 3RM2H 1ZSKA 2J92A 1SGFG 2VINA 3NZIA 2P16A 2A32A 1NPMA 2R3UA 2W7SA 4R0IA 5KGOA 3BEFB 2PUXB 3M7UA 1RS0A 2WPMS 5HM2A 1SHHB 5HM9A 1K1MA 1FONA 4Y79A 4ZXXH 3TVJB 1NU9A 2QXGA 5IYTA 5EW2H 2VVCA 4JZIA 3EA7A 5JB8S 2AMDA 2J5UA 1W0YH 2F3CE 3E3TA 1PYTC 2Y5HA 3RXIA 4CRCA 2ZO3H 2Q6DA 4D8NA 1C1PA 1BRBE 1SFQB 3FKSD 1EOJA 1RXPA 3A7YA 3ATIA 2AIPA 3UWJH 1H8IH 3AK5A 2L74A 4XBCA 2H5CA 3HPTB 2PTNA 2BX4A 1BTPA 4AORA 3CENA 3F9GA 3MWIU 1PPFE 5T3HA 1XXFA 4J2YB 2J34A 4RSPA 3RUOA 1HB0B 1AD8H 1GHAF 1GI8B 1ELBA 1ZTKA 1INCA 2AFQB 2XC4A 2FDAA 1UTLM 1P01A 4AFUA 1CT0E 1MAXA 2HVYB 3FVFB 3F2FA 2FOBA 3KYGA 4AB8A 1A5IA 1AWFH 1MAYA 5C67A 1C1WH 5AHGH 2ZDVH 2TGDA 1QY6A 1GDUA 2Q6GA 2G4UA 3OEHD 1U6QA 4FU9A 5TJXA 1H8ED 1FXYA 4HI3A 1A0LA 3T2NA 1EPTC 1ZTJA 5GIBA 3K9XB 5DP8A 1HAXB 2ZDNA 4B6FA 4TYDA 1GBDA 4DVAU 2QXHA 4IBLH 2RDLA 2CF9H 1MTUA 2C93B 3KQBA 2BQ6B 4A92A 2BMGB 1O3CA 3PMBB 1A0JA 7KMEH 3BTEE 3C1KA 1GDNA 1MBQA 2GDDA 1ORFA 3PLPA 5F8XA 2OUAA 2ZGXH 3RXGA 3W95A 3DD2H 2Z94A 3PO1C 3MO6A 1SG8B 1YPMH 2WV5A 1P3CA 1O2NA 3UQOA 2ZTYA 4WF8A 1DS2E 5CDFE 2ZU2A 1YC0A 1P05A 3CP7A 3T5FH 1O3AA 3SYJA 1OP8A 1TQ0B 3KQEA 1C2IA 5FPSA 3RMNH 2FOGA 1IQFA 2F43B 1G3DA 3M36A 4FUDA 7GCHF 1EAWA 5F03A 4CRBA 4P00A 4TWYA 3I78A 1AI8H 3TK9A 1THSH 2GVFA 1TALA 1K2I1 2FIRH 4O9VA 3DSGA 5FBEA 5H4IB 3ZYEA 1Z8IB 1ZPCA 4NZQA 4OM9A 1E0FD 1LQDB 2Z9JA 1N8OB 3KEEA 3ZZ9A 3RXRA 2JJ2D 3AASA 3ZZCA 3LH1A 1QL7A 4A1XA 3LPRA 4Q7XA 1BMMH 1NY22 1VITG 2VJ1A 1ZHPA 1TAWA 2ZZUH 1UVOA 3F1SB 3PLBA 1ELFA 1TBZH 1O2YA 3GY6A 4B74A 3BG4B 2BY5X 4CBNA 5FHTA 1ANCA 1O3MA 5ESTE 1TBQH 1C2JA 1HYLA 1B7XB 2ZECA 1MH0A 2ZTXA 2HWLB 8GCHF 1QZ8A 4JZ1A 2STBE 4X1QU 1V2WT 1F0RA 1H9IE 4HG6A 3DSOA 4KELA 1XUJA 2JIZD 3A81A 1D9IA 2PTCE 1V2NT 4UFFH 1TNHA 1ELDE 3E1XB 2BY9X 5L2ZH 4LXBH 1TX7A 3P6ZB 2VH0A 1TNJA 1L1GA 1V2PT 5GWZA 2A45B 2JDID 3BIUH 2A7JA 1P8VC 1TPOA 2PKSC 4KTSA 1Q3XA 3ZV8A 2GDEH 4UFDH 2H9TH 4BAQB 1N6YA 4GSOA 2L6OA 5E0GA 3SUEA 5JBCS 3GICB 4NIWA 2H9HA 3FZDA 3S7KB 5CHBA 1MU8B 2FTMA 4GHQA 2CN0H 3K65B 3VGCC 4WMDA 3Q3YA 3M35A 3F9EA 5A8XA 1C5PA 3MQKC 1YP9A 1PJPA 3MH7A 2A4GA 3JZ1B 1P03A 1BBRE 2G4TA 2FMJA 2M2AA 1UW7A 1QBOA 3A85A 2PSXA 2ALPA 1GI3A 1OWJA 2KAIB 3KQDA 1B5GH 4MPXA 2OC7A 1G3EA 1VJAU 3ENSB 2FPZA 4FOUC 2NU3E 3M37A 1DY9A 1SVPA 4AYVB 3R3GB 2AH4X 1IHTH 4X8VH 1T8OA 1GMCF 2ZFTA 1QQ4A 3O8BA 1A3EH 1W12U 4I8JA 1PPGE 1QTFA 2ZGJA 3FP7E 1COWD 2F9VA 5DSFA 4X6NA 3T25A 3MO9A 2QCYA 3KCGH 2W3KA 1LCYA 2UWOA 1RFNA 1GDQA 4BTUB 3RXCA 3TNTA 1BTXA 4GVUA 3SOSA 1TONA 4NFEA 5E8EH 5C2ZA 5JPMH 3SU2A 1BJVA 4Q80A 1FI8A 1GI2A 2F9NA 2GJGA 3OSYA 3S69A 4BTIB 1JMOH 2ZU5A 3S0NA 3W1EA 2ZDKA 2XXLA 3M5NA 4KTCA 1E35B 1BRUP 2ZHDA 1MTWA 1TRYA 2XNIA 2ZC9H 1CVWH 2BZ6H 1C2GA 1BUIA 3RXQA 1YCPK 1FPHH 1THRH 1YPKH 2XCNA 3KHVA 4OS1A 3LGIA 2HPPH 4NCYA 1JXPA 3TITA 3SGAE 1QBNA 2OQ5A 1DANH 4YOGA 1P2JA 2PSYA 1O36A 5IDKA 1O2KA 4IMZA 1NZQH 1CGJE 2ZDLA 2Y5FA 1LKAA 3LU9B 3UY9A 1WV7H 3RXEA 2BLVA 1MKXH 1O30A 3P70B 4JZEH 2WHXA 1IHSH 1GJ8B 2GZ7A 1OYTH 1AMHA 2BLOA 3K2UA 1D6WA 1GMDG 1FY5A 1ETTH 1AGJA 2PV9B 2IJD1 1PQ5A 2OCVB 4DT7B 1MZDA 2Z9GA 2FXRA 2C8YB 3FO8D 4IN2A 1DVAH 1W0JD 1S6LA 1C5NH 1MBMA 1WUNH 3A87A 4CBOA 4BOHA 5C5NA 2AIQA 3SW2B 1EZUC 2V3MA 3VPKA 1LVOA 2J2UA 1FNIA 3OY5U 1VKYA 3SZNA 1YLCA 5FCRA 4ISHH 3NUMA 4X2YA 1C9TA 1QL9A 4Y8XA 1AKSA 2F9BH 1KTSB 3NXPA 2WINI 1SQAA 4Y7AA 1Z8RA 3PYHA 1OWDA 1ZSLA 6GCHF 1SLUB 1JRSA 3SN8A 3SO3A 4A6LA 4X1PU 2GCTC 4AB9A 1GBLA 3VB7A 1DDJA 4K2YA 2BOHB 3SUDA 2XNDD 2BDIA 1T4UH 4UDWH 1ELCA 2AYWA 1O2QA 3SU5A 3SV9A 1EPTA 2HNTC 4Y0ZE 3SU3A 2KCPA 1MU6B 2Y7XA 5SGAE 1DM4B 3SGQE 1KXEA 3SHCH 2LPRA 1TOCB 3RC4A 4IGDA 3TJOA 4VGCC 4WH8A 3SU6A 3HK6B 1S85A 5EJ1A 4OS6A 5DK1A 1OX1A 1AFQB 4ZKNU 1V2LT 1TQ7B 2QYIA 4DT4A 6LPRA 1MKWH 3SI3H 1EZXC 1TLDA 3ZVFA 5CE1A 5L30H 4Q4LA 4WMEA 3T28A 1A5GH 1SB1H 2B0FA 2YOLA 1BQYA 4CH2B 1UTQA 1HLTH 1UTKA 1GMCG 4JYTA 3D65E 1AKSB 1GG6B 1GMHG 3MU0A 2WPHS 1YPHE 2AGGX 3FP6E 2J38A 5LGOA 1G9IE 4MDSA 1SLXB 3RXFA 3SV6A 4RN6A 1EJMA 1K1LA 2Z9KA 3MHWU 3F9FA 2BDAA 1KLTA 4BXSA 4F49A 6ESTA 4P02A 1CT4E 4X1SU 5AFYH 2BY8X 5TCCA 1FY4A 4ZCNA 1NU7B 1O3GA 2ZPSA 1S0QA 4JYVH 5HGGA 4BAHB 3QGNB 2BLWA 5L2YH 3GISB 4OS2A 1EKBB 3ZYDA 1G3BA 5AVDA 1GI9B 1O3HA 2F91A 2XYAA 2FS8A 2NU0E 1BBRK 1CA8B 2FI5E 2VVVA 4JYUH 3RU4D 3RDZA 1HJAB 2HNTF 3LC5A 3TGJE 1C1OA 1S6FA 1HAZB 1EQ9A 2VIVA 2V7QD 4YM9A 2Q6FA 3GYMA 2QN5T 1GBFA 1GVZA 3PROA 3A7TA 2F9OA 3ZVCA 1TNKA 1LQEA 9ESTA 2Z3EA 1B0FA 2V3HH 4ASUD 2C8WB 1TNLA 4H42U 2PGQB 2H2ZA 2D8WA 1NFXA 2HPQH 4NSVA 1P11E 2PHBA 1CE5A 1O3IA 2EEKA 1VCQA 3WW7A 3UNRA 1WAYB 2QF0A 3UTUH 1KDQA 2GKVE 1MKXK 2PKSB 1A1RA 3GCOA 4NG9H 6CHAB 1EFRD 4FUFA 1VGCB 4DY7B 1QJ1B 2ZG0H 4YOJA 4ZKOU 4K3JA 3BTHE 1MQ5A 5GNDA 2FOAA 3WY8A 2CHAC 3LH3A 2ZEBA 3F2GA 3BN9A 4MNXA 1FMGA 1KLJH 3RLWH 5ABWA 4ISLA 1WTGH 3E90B 2DE8A 3SUGA 1CBWB 3UUZA 2XWBI 1DWEH 2CK3D 2ZHFH 1QL8A 5EODA 1NN6A 1YCPH 4KKDA 3LIWA 1UVSH 5PTPA 1NRPH 4F4OC 2R2WU 2RDEA 2VVUA 2WUBA 2PR3A 1UTMA 2Y82A 1Y3XA 4INHA 4GUXA 3A8CA 1ABIH 1HGTH 4LOYH 5JDUB 1OWHA 2J94A 3SJIA 2TGTA 4B76A 3RMLH 4LZ4B 1J16A 1DY8A 1O2MA 4FUBA 3ZZ4A 2FX4A 4UFGH 4JZDH 2XBYA 4Y7BA 2EI6A 1T7CA 2VB0A 1BOQA 2CV3A 4D7GA 1YLDA 1ID5H 1N6XA 1JIRA 2XC5A 1VITF 4F55A 4WY3A 5J4QA 1W7GH 1IQNA 3TU7H 2FEQH 4ZUHA 3EDXB 3E91A 1V3XA 4Z6AH 1MQ6A 1HXFH 3Q76A 3DCLA 1TFXA 1EUFA 1XUFA 4YESB 2AERH 5JBTA 1MZAA 1Z8GA 2GCHG 2XW9A 4NA8A 1QFKH 4Y71A 4BTTB 1HDTH 2C8ZB 4B75A 1SQOA 3SGBE 1T8LA 1ZSJA 1K1JA 4Z1MD 5DP7A 3QK1A 3UB0A 3N7OA 1BMAA 3HATH 4B2AA 1HXEH 3DSPA 1UO6A 2BD2A 2J98A 1F0UA 3VXFH 2P3UB 3ZVAA 3MU5A 1BITA 1A2CH 1H8HD 1KXCA 1P2NA 4K1EA 1LO6A 1XKAC 2W7UA 2FLRH 2FOMB 2GCHF 2BD4A 2J4IA 3AW0A 3SJOA 3TH3H 4JZFH 1C1QA 5EIYA 1O2HA 1HNEE 3AAUA 3UR9A 4BXWA 4I8HA 5B6LA 3GCHC 1GJ4H 1V2MT 3GYLB 4J1YA 1DPOA 3A8BA 1IOEA 1EPTB 1K28D 3RU4T 1C5MD 2Z9LA 2OK5A 1CSOE 4RKJB 4AG1A 3FOAA 1VGCC 3RP2A 3NKKA 5FXLA 1YPGH 3BEIB 4CR9A 1CU1A 3ZV9A 4WXVA 5A2MH 3RXUA 4AX9H 3GCTG 3OY6U 1RGQA 3BIVH 3OTPA 2A5KA 3U98H 3SU0A 1C1RA 2A4QA 2P93A 1ELGA 3NCLA 2FESH 1KYNA 3RXAA 1V2JT 1E36B 1W10U 4FUCA 3ESTA 1O3PB 2K1QA 4X8UH 2PUQH 2OBQA 1N8OC 3KYFA 3LGVA 5HMAA 1BBRH 3VXEH 2WZQA 3P92A 4GCHG 3LKWA 1BTYA 3MU4A 5C5OA 4GLYA 1KLIH 1GPZA 3DFJA 1XXDA 3U1JB 1OWIA 2GGVB 1O5FH 2BDCA 2ZPQA 1GBJA 2FTLE 2ZHWH 3F0OA 5E0JA 1FAXA 3GY4A 2RA0A 1NFYA 3BG8A 2FI3E 1JIMA 3V7TA 2G55A 1IQEA 1AFQC 2QIQA 1W13U 4YO9A 1EJNA 1HAIH 2G81E 4NGAH 3MNSA 2GT7A 1DT2A 3V12A 4A1VA 1P9SA 3VB6A 3Q3KA 4MVNA 2SNVA 2GTBA 5FX6A 1Z8JB 1D4PB 1P09A 2CXVA 4DIIH 3UIRA 2QXJA 4DURA 1TPPA 1W2KH 5TCAA 1FIWA 2BB4A 1P10A 1AVXA 4U01A 3LJOA 2G8TA 3D49H 2M5TA 5HXFA 1GI4A 1C5OH 5C0TA 3ATLA 3LGUA 2IN2A 4ABGA 1O2UA 3RC6A 1DWCH 3PRDA 5DP3A 2PKAA 4I86A 1LVYA 3GCNA 4MPWA 3H5CB 1LPZB 5A8YA 1AHTH 4YT7H 2P59A 1K1IA 3GS9A 1O2IA 1GBCA 1UTPA 1JOUB 2A31A 1O2XA 3A7XA 3QLPH 1EAXA 1L4DA 3VB3A 1OYQA 1TMUH 1GBBA 3QWCH 1OHHD 5GXPA 3RXSA 1PYTD 1JRTA 4K69A 1UTJA 3NK8A 1O2ZA 3K6YA 4XFQA 1C5YB 3MFJA 2W6JD 3PTBA 2ZGCA 2BDYA 1FUJA 1QRZA 3UFAA 3ZZ3A 3A82A 3TNSA 1J15A 1Q31A 4DOQA 4ZHLU 1D3TB 1ACBE 1KXBA 4ABFA 2W3IA 3PRBA 2FM2A 1YBWA 5EPYA 1GJ7B 1ESAA 2ZWLH 1AZ8A 2TPIZ 5C3NA 1O2GH 2HRVA 1QNJA 2WV4A 1NC6A 2GZ9A 3LOXA 1ZJKA 3CS7A 1DITH 3KNXA 1O2VA 4X2WA 2G52A 1C2KA 5GDSH 2ZCHP 1O35A 5EXLA 2RG3A 1DE7H 3EAJA 5HYOA 1BT7A 3M7TA 2KCYA 4SGBE 5FBIA 1P06A 4XE4A 8LPRA 1JBUH 1OOKB 3M5LA 2H5DA 4TT3D 4YTAA 5JB9S 4YXWD 2ZU1A 4MPVA 3OE7D 1GMHF 1AFEH 3L3TA 1YF4A 1O32A 1OPHB 1P2QA 1Z6EA 1HAVB 3KIDU 1RTLA 4I33A 1S82A 1XUHA 3SJ8A 1N1LA 2J98B 2YMSD 2ZQ1A 1PPEE 1C2LA 1UTNA 2I6QA 3A83A 1O3EA 1YYY1 5GJ4B 1P3EA 1EOLA 2SGEE 4FUEA 4OS4A 2CHAB 1A46H 2FOCA 2O8UA 2ASUB 3R0FA 4WJG2 1WYKA 2B8OH 2ZHQH 1WQSA 4O97A 1DOJA 2AGIX 5DGJA 2QF3A 2WPDD 1O0DH 1ANBA 1NTPA 1SOTA 2WPKS 2OC8A 2BD7A 2Z3DA 2ZA5A 1XMNB 2BYAX 2ZQ2A 1O2TA 3BF6H 1IQMA 2VGCC 3RXHA 1J9CH 4IW4E 5DP5A 1AQ7A 1ELTA 1OP0A 3N7DA 2HOBA 1D3PB 2VWOA 3SJKA 3GY5A 4NIYA 5F53A 1UVPA 2FYQA 2RA3A 3P8GA 2ODPA 3UWIA 5CMXH 5FCKA 3S7HB 4X6MA 2ZKSA 3A88A 2A2XH 2ZGBH 3EQ0H 4MQAA 1E37B 4AN7A 5DN6D 3HKJB 5LH8A 1CHOF 1L1NA 1QCPA 4U30A 2P3FH 4DW2U 3F68H 2JETC 1BHXF 2ODYB 1LKBA 3E8LA 4WMFA 3PMAB 3SBKA 4X1RU 3RXTA 1TABE 3GDUA 5K7RA 3ITIA 2HLDD 4CRAA 3VB5A 3TH2H 1A7SA 1H9LB 4B1TA 1JWTA 2P3TB 7LPRA 1QRWA 1BMNH 1J17T 4ISOA 1LHEH 1THPB 3EA9A 3MNCA 4F48B 3AW1A 1QURH 1XM1A 1MTNB 1V2TT 1GHXH 1YGCH 1UVTH 1W8BH 4Y76A 2AHME 1EATA 2BHGA 4MLFB 2AMQA 3ZVEA 1PFXC 1H8DH 1BB0B 2VNTA 1IQLA 1YPJH 4BAKB 1A3BH 3ZZ6A 1ZR0A 1GJCB 3SNCA 1IQJA 2TGAA 3U8RH 1O3NA 1V2UT 4ZROA 1PQAA 4I31A 4O3UA 1LVMA 4DIHH 1F92A 1E38B 5KECA 4RT0A 1NESE 1RIWC 2UUYA 3HGPA 1SGIB 4MPUA 4HZHA 4YT6H 1Y3YA 3MI4A 2BDBA 2RCEA 3L6PA 3MNBA 5E2OA 1WBGB 1ZMJA 1HAHH 3F6UH 1FY8E 3NPSA 4GHTA 1SQRA 1PPHE 3CNRA 1VZQH 3F9HA 1K1NA 4IS5A 2ZP0H 3SV8A 2O8MA 4ISNA 2ANWA 4UEHH 1GCDA 2ESTE 4TSFD 2FOFA 1FAKH 2Y6TA 3P95A 2ZFRH 1A0HB 3V13A 1GBEA 1SGYE 4B2CA 3N7EA 1ANDA 4UD9H 1QIXB 4U32A 4GPGA 1HIAA 3O8CA 1SC8U 3BTME 5DKMA 1P57B 1TRMA 3O8DA 2D26C 1GL1A 2VIOA 2KCOA 2F9UA 2K0QA 3PWBA 3PO1B 5C1YA 3MTYA 1HRTH 4M9FA 1DSTA 3DHKH 1WQVH 5EQSA 4TWWA 3KQ5A 4B6EA 2CGAA 1TNIA 1FV9A 2OQUA 4NIXA 1V2ST 3S9BA 2LELA 2QGRA 1XUKA 1ELEE 1C4U2 3SI4H 5A8ZA 3QGJA 4XSKU 1QA7A 2PW8H 2HALA 1GHWH 3SV7A 1TYNA 4FVBA 3LGWA 2B5TB 3SNEA 3ZIAD 2VIWA 1D3QB 1T32A 3PMJA 4U2WA 1C5SA 1AWHB 1L4ZA 3RXDA 3MH6A 2GT8A 2ZFPH 5T6FA 3B8JA 1Y3VA 3U28C 3Q00A 3UAIC 1KSNA 1MKWK 1GCTC 5A0BA 4KP0A 2DE9A 3TIUA 2OTVA 1KXDA 4K8YA 4RI0A 1YPEH 3MH5A 1NRNH 1QHRB 1SOZA 5LPEA 1C1SA 4FUGA 3SUFA 4Q63A 2PWXA 3RMOH 2BVSH 2UUKB 2BD3A 2W5EA 1AU8A 1EP5A 1Z1JA 1EP6A 1G3CA 2Z3CA 3OTJE 4YOIA 4FUIA 2IPQX 1O3DA 3A84A 2EQNA 1QQUA 6GCHG 3T29A 1BTUA 4ABEA 1Z7KA 2RFKC 1PPCE 4NIVA 1CA0C 2GP9B 2BTCE 2WPLS 1FJSA 3ZVGA 2WYGA 3Q77A 3P8FA 3LDXH 4H6TA 1ZRKA 3MU8A 4FETA 1DXPA 1GI1A 3ZZDA 4X1NU 2JH0D 1P02A 1TMBH 1KXAA 4MG3A 1DICA 1KXFA 3M7QA 3HGNA 1C5RA 2J95A 1EZSC 1VITH 1CBWC 1O38A 4D9RA 2SGAA 1SBWA 3UNSA 2BZAA 1Z1IA 1GBKA 1SMFE 4ACAA 2VWMA 1CA0B 1NM6A 1DXWA 4DGJA 1QB1A 1S84A 5I46H 8ESTE 1SGEE 1ZPBA 2OBOA 1ZJDA 3MNXA 2KX4A 2O9QA 3D62A 4VGCB 1SGTA 2AMPA 5FX5A 4AFSA 5F8ZA 4UFEH 1P9UA 3A80A 4E7NA 2ZI2H 5G4BA 1LTOA 2KZ4A 4AOQA 1K22H 1ZRBA 2I6SA 2ZTZA 1KTTB 2CJIA 3V0XA 5JBAS 1W11U 3G01A 2VIDA 5T6DA 1FN6A 4TPIZ 2GV7A 3QTVH 2H1UA 4Q7ZA 1MD7A 1C2DA 5FPTA 4ABIA 2FX6A 4I8GA 4R8TB 2VBCA 1EAIA 1BMFD 1WCZA 3TGKE 3MOCA 4RT1A 2VIPA 4FXGH 3M3SA 1DX5M 4RKOB 3F2HA 3Q3XA 2FOHA 1V2KT 3PV4A 2SGQE 3LONA 1TGTA 3QX5H 5ESBA 1UK4A 2BQWB 1SGRE 5HIZA 2VGCB 2FODA 1O5BB 2FS9A 1BRCE 1FPCH 2JH6D 3OU0A 2WSSD 4GAWA 2WUCA 3S9CA 1NBME 2SNWA 3P8NA 5EGMA 5FPYA 1IAUA 1DFPA 4BNRA 1G30B 3H09A 1VR1H 1YLNA 1E1QD 1NBMD 4CR5A 1ZLRA 3DFLA 1H1BA 1Y3WA 3BSQA 3SV2H 1C5LH 1AE5A 2FZZA 1SGFA 3U8OH 4OS7A 1MTVA 4X6PA 2VWNA 3WWFA 5BRRE 2ANKH 1C1MA 4O3TA 3VG8A 1C1TA 3QZRA 5C94A 1C1VH 1O31A 2H9EH 4YLUA 1GI5A 1GVKB 2BVRH 4INKA 3M5OA 2UWLA 4Y11E 2F4LA 3URCA 1IQGA 1E79D 1FDPA 4Q7YA 2P94A 2ZHEH 1QBVH 4CRFA 3MU1A 4CH8B 1GJBB 1K0HA 1BJUA 1HAGE 1O3KA 4D7FA 3N99A 1GBMA 2A7HA 3EE0B 1T8NA 9LPRA 3L33A 2YNAA 3MYWA 3RXJA 3GY2A 2F9PA 2QAAA 3RXPA 1O2RA 1RD3B 1FLEE 5EQRA 4AG2A 4ISIH 1MABB 3D23A 1O2PA 1Y3UA 1NRSH 2OC1A 2A7CA 2ULLA 1LHCH 5C0UA 3F3BA 3PM3A 4CHAC 4I8KA 1IQHA 5A0CA 1AB9C 3KL6A 1BCUH 1L1JA 5B6OA 2PGBB 1QJ7B 3A7VA 3UREA 3PMHB 1OWKA 1AIXH 2B7DH 2W26A 2GZ8A 4NA7A 2BD5A 3DUXH 5T1VA 1C2MA 1LHFH 1GBHA 1V2QT 3M3VA 3UPEA 1XKBC 3TGIE 2XOKD 5DP9A 3AVZA 3URDA 1MTNC 3MO3A 1G37A 3IG6B 3SQEE 1J14A 1V2VT 1E1RD 2ILNA 5JBBS 1RTKA 3VB4A 1ZTLA 3U8TH 1FY3A 1YWUA 2H6MA 1G36A 1S0RA 1EASA 2HNTE 1C4Y2 2V0BA 2G5NA 2JETB 1GVLA 1LHGH 1X7AC 3WWBA 3FFGA 1TGNA 4XBDA 2C90B 1C5XB 1WXRA 2YMSC 1YY3A 3HKIB 4CRDA 2QXIA 2R0KA 4XD7D 2R0LA 1TMTH 2VH6A 1DLKB 3B23B 2CMYA 3FZZA 4OGXA 5BPEA 3UR6A 2UUJB 1O2LA 5GPIB 3QO6A 1UCYE 1B0EA 1TPSA 1GJ6A 1HAYB 1Y5AT 2KM0A 3OFND 1BTZA 1D3DB 4ZH8A 2Y5GA 3OYPA 3A7WA 3PV5A 1YM0A 1LPKB 4HGCA 3S9AA 2WPIS 3RXVA 3MH4A 1UVUH 1ZMNA 4DJZB 1UMAH 2EY4C 5A0AE 3UQVA 1AVGH 3ATWA 4MTBA 5A09A 1O5AB 3SNDA 2THFB 4ABBA 4NZLA 4WH6A 3UOPA 3B9FH 1HPGA 1VCWA 3GY3A 1L2EA 4ZXYH 3CS0A 1P12E 3RXMA 2YNBA 2O8TA 3U1IB 1OP2A 2AS9A 2LNCA 1F5KU 1NRQH 2O8LA 3RM0H 1ZHMA 1OKXA 2FP7B 1H9HE 1GI0A 3M61U 2XBWA 4H6SB 5F8TA 3V3MA 2XBXA 2KR7A 1YCPM 1GGDB 5JYIA 3UOUA 2D1JA 1UK2A 5C1XA 5ETXA 4I7YH 4BAOB 1HAOH 1HJ8A 3ZZ5A 5CHAB 4BANB 3QDZB 1TX8A 1C9PA 4FUHA 1FZZA 5EJLA 1C1UH 4BAMB 1TNGA 2HGTH 4E05H 3FAOA 2BLQA 1ZGIA 2Z7FE 4AC9A 1AZZA 3BTQE 2YMSB 2VU8E 1HV7A 2XC0A 4A1TA 1CHGA 4ZKSU 1C5ZB 5I25A 1O2OA 4E7RG 1Q2WA 3BTKE 1GMDF 1GJDB 2ANYA 1G2MA 1HCGA 1QB9A 2P8OB 2V6NA 2OC0A 1K1OA 1SPJA 2OP9A 1GCTB 5GCHF 2EI7A 3EA8A 4K1SA 3TLOA 4LZ1H 1FN8A 2V3OH 1KDQB 2OINA 2ZU4A 1ESTA 2G00A 3BTTE 4MNYA 1GHZA 1VCPA 1A61H 1QB6A 1C4V2 4KTUA 5C1UA 4DG4A 3SORA 1W0KD 1V2RT 2QC2A 1KIGH 1D6RA 2ZU3A 1EJAA 3H7OA 4A7IB 2XRCA 1CT2E 3RMMH 2GMTC 3A8DA 1HFDA 3JZ2B 1SGDE 1W7XH 3ZVBA 2BVXH 2ZDAH 3BTGE 2FO9A 1DUEA 2BDGA 1GL0E 2OD3B 1KMHB 2G51A 1YKTA 1QJ6B 1TOMH 1ELVA 4K1TA 4TY6A 1QRXA 1HJ9A 4MNWA 3M3TA 1GGDC 2XWAA 1AB9B 2XBVA 1S6HA 2BXTH 3U69H 4AZ2B 1SHYA 4Y8ZA 3A86A 4Y0YE 3E6PH 3VGCB 3P8OA 5GCHG 3QTOH 1ZPZA 2PFEA 1E34B 1W14U 1VJ9U 2AGEX 1EXFA 4THNH 1M9UA 4ZHMU 2A1DB 1AUTC 3LJJA 2P95A 5HKKD 2ALVA 2XCFA 3C27B 4XDEA 1WTHD 4B2BA 3BV9B 5DP6A 8GCHG 1CHOG 4X2XA 4CREA 1HBTH 2Z6BD 3P17H 3UNQA 1H4WA 3GY8A 1Z6JH 2XTTB 1SL3A 1MMJN 2JKHA 1MTSA 4PROA 1ZMLA 2CF8H 1GI6A 1WU1A 5E2PA 4UE7H 3FN8A 2SGDE 2QE7D 1J8AA 1TBRH 3H7TA 5HIYA 4JK5A 4X8SH 1W3CA 3W94A 1UJ1A 1OWEA 2EA3A 1SKYE 5EJZA 4O03A 1TA2A 1C2FA 4B71A 1BRAA 2W6ID 1FQ3A 3A8AA 1CGHA 2ZDMA 2TIOA 1ABJH 1SFIA 2IPHA 3KGPA 5E0HA 2QA9E 1SR5C 1TWXB 1Y59T 2OXSA 3AAVA 4TY7A 3SU4A 1GHBG 3DT0H 2R2MB 2ZCKP 1TE0A 2TBSA 4YLQH 1O3BA 2A4OA 1C2EA 3E16B 2FOEA 4M7GA 3LGYA 4D9QA 1EB1H 1C5WB 1RIWB 1Y8TA 4ABJA 2A5AA 3RU4E 5C20A 1NROH 3TJVA 1A5HA 2WPJS 4FUJA 2K8IA 1UK3A 1TGCA 1BA8B 1UCYK 4Y6DA 4GCHF 4X6OA 1OXGA 1WDIA 3GDVA 1SGPE 3I29A 3U9AH 1DWDH 1SGNE 2A5IA 2GD4B 3OAAD 1O2WA 3SZEA 3ZZ8A 4JK6A 1C2HA 4AGJA 1TPAE 2DUCA 3GY7A 1O3OA 2IOTA 1NRRH 1P2KA 1LPGB 3BEUA 2ZIQH 4TPYA 2SGFE 3STIA 3ZZBA 4FU7A 3BTFE 1F2SE 3ODDA 1A4WH 2QF5A 2WYJA 1GHBF 2J97A 4ZKRU 1Y5BT 1EAUA 2SGPE 3LGTA 2C8XB 1BZXE 2ODQA 4FU8A 2P8OC 3K6ZA 2UUFB 2PLXA 1P0SH 1RTFB 2FWWA 5FAHA 4YZUA 5DJ7A 3T62A 1O2SA 3TK6A 2BX3A 2R9PA 1GG6C 4AGKA 1V6DA 1BIOA 1NFWA 5KEDA 2STAE 1TA6A 1O5DH 1GHAG 1O3JA 1C5QA 2OLGA 2G5VA 4I8LA 3KQCA 4MNVA 2R3YA 1CQQA 1SI5H 2GX4A 1LVBA 4LK4A 1ZGVA 4AFQA 1MCVA 1C5VA 1K9OE 7GCHG 2BM2A 3E0NB 1HAVA 4NWLA 3KF2A 1ETSH 4FVDA 4JCNA 2FYRA 2GV6A 4K5ZA 3TJNA 4XRNA 2Z9IA 2Y81A 2TGPZ
chains in the Genus database with same CATH topology
1F0TA 1WSSH 1WOFA 2HVXA 3KN2A 4ZHAA 3SQHE 3FANA 4WXIA 1ANEA 1S81A 1GBIA 1GJ5H 3VEQB 2BDHA 1QR3E 3BTWE 5EXMA 1KY9A 2B9LA 4NSYA 5AF9H 1F5LA 1PQ7A 5EU8A 1PQ8A 3O8RA 1XUGA 1AN1E 1EZQA 3VFEA 1FIZA 5L6NH 2QY0B 1BTWA 4IC6A 1ESBA 3STJA 2J9NA 1AVWA 4ASHA 1ETRH 5AFZH 5EW1H 1YPLH 3PB1E 4K60A 1NT1A 1GJ9B 1O39A 3FP8E 3M5MA 2NU4E 1ZOMA 1O37A 4Y8YA 1MUEB 5EQQA 3BTDE 3ELAH 1GI7B 1ARBA 1S83A 1F5RA 2O8WA 3RLYH 2ZFSA 2ZCLP 4X8TH 4KGAA 3QUMP 1G2LA 2UWPA 4ABDA 5K0HA 1TGSZ 4D76A 2ZFFH 1NFUA 1P2MA 2EC9H 1YPHC 1OSSA 1DLEA 1OS8A 2NU2E 3RXOA 4INLA 2GMTB 3TH4H 1AO5A 2NWNA 1S5SA 1CO7E 1PPZA 2HLCA 5DO4H 1P04A 2VWLA 5LPFA 3DA9B 3ATKA 2BD8A 1LHDH 4QT8C 1G32B 6CHAC 3E0PB 4NWKA 1ZZZA 3PWCA 3GCTF 1MCTA 1FY1A 1ARCA 1O5GH 2D2DA 3TPIZ 1AY6H 1NS3A 1HUTH 2VIQA 2A2QH 4ZAEA 1XVMA 4B73A 2BXUH 3SU1A 1UHBA 2BOKA 3T27A 1RJXB 1V2OT 3RXLA 3RC5A 4CRGA 3TJUA 1TIOA 3LC3A 2NU1E 2C4FH 1C1NA 2FLBH 1TGBA 4Z0KA 2IJOB 4A5TS 1SSXA 2AEIH 4ABAA 4IC5A 1GBTA 1GHYH 1GBAA 3I77A 1RRKA 1LDTT 1BDAA 3EGKH 1SLWB 1T8MA 3RXKA 1IQKA 4E06H 2BY6X 2JH5D 5EXNA 4K8BA 1TX6A 3ATMA 1SGCA 1XX9A 3SNAA 1NO9H 2Y7ZA 4HTCH 1Z71A 1O33A 7ESTE 3MMGA 3T26A 1QGFA 1O34A 3NWUA 3GOVB 1L0ZA 1HIAB 1T31A 4JMYA 5EG4A 1UCYH 4Q2KA 1TB6H 4IN1A 1CGIE 2ZF0H 1BTHH 4NA9H 4CHAB 3OX7U 5F6MA 2C3SA 4AYYB 4NFFA 2GCTB 1XUIA 5J4SA 4AFZA 1BMLA 1GHVH 2BD9A 5EPNA 1LMWB 1W0ZU 1EX3A 3TK5A 5DPAA 1C5UA 4ZMAH 1UHBB 1ELAA 1K1PA 1K21H 4IMQA 2FI4E 2TRMA 1Y5UT 1BHXB 2EI8A 5T6GA 2SFAA 3PTNA 2ZNKH 3QZQA 1SGQE 3ZZAA 1O3LA 4UONA 2ZGHA 1QA0A 3A7ZA 4X0WU 4H4FA 2BQ7B 4WWYA 2ZFQH 4HFPB 1AUJA 1O5CB 1SLVB 3QN7A 5EOKA 3ZZ7A 1T4VH 2QV1A 3SHAH 2V35A 3SNBA 1O3FA 4XOJA 2ANMH 1UTOA 3GCHB 3PLKA 1P2IA 1EB2A 1GWAA 2Q1JA 1C5TA 1ZYOA 1SQTA 3EYDA 2PKAB 1ZHRA 1IQIA 3ODFA 4OS5A 1GJAB 4X2VA 1HJAC 3BG4C 1O5EH 1TRNA 4Y10E 4DCDA 4I32A 5DP4A 1DSUA 1P2OA 1DUAA 1AE8H 3A89A 3HK3B 2F83A 3RXBA 4ESTE 2A0QB 2Y80A 5DG6A 4OGYA 5LPRA 1F0SA 2ZPRA 5CHAC 2A4RA 3SJ9A 3LT3A 2BY7X 4ABHA 8KME2 3IITA 1MD8A 1DWBH 3IWMA 1XVOA 3GDSA 1F7ZA 4SGAE 2KAIA 1HAPH 4WVPE 1PPBH 3ZVDA 1O2JA 4XBBA 3RM2H 1ZSKA 2J92A 1SGFG 2VINA 3NZIA 2P16A 2A32A 1NPMA 2R3UA 2W7SA 4R0IA 3BEFB 2PUXB 3M7UA 1RS0A 2WPMS 5HM2A 1SHHB 5HM9A 1K1MA 1FONA 4Y79A 4ZXXH 3TVJB 1NU9A 2QXGA 5IYTA 5EW2H 2VVCA 4JZIA 3EA7A 5JB8S 2AMDA 1W0YH 2F3CE 3E3TA 1PYTC 2Y5HA 3RXIA 4CRCA 2ZO3H 2Q6DA 4D8NA 1C1PA 1BRBE 1SFQB 1EOJA 1RXPA 3A7YA 3ATIA 2AIPA 3UWJH 1H8IH 4XBCA 2H5CA 3HPTB 2PTNA 2BX4A 1BTPA 4AORA 3CENA 3F9GA 3MWIU 1PPFE 5T3HA 1XXFA 4J2YB 2J34A 4RSPA 3RUOA 1HB0B 1AD8H 1GHAF 1GI8B 1ELBA 1ZTKA 1INCA 2AFQB 2XC4A 2FDAA 1UTLM 1P01A 4AFUA 1CT0E 1MAXA 3FVFB 2FOBA 4AB8A 1A5IA 1AWFH 1MAYA 5C67A 1C1WH 5AHGH 2ZDVH 2TGDA 1QY6A 1GDUA 2Q6GA 2G4UA 1U6QA 4FU9A 5TJXA 1FXYA 4HI3A 1A0LA 3T2NA 1EPTC 1ZTJA 5GIBA 3K9XB 5DP8A 1HAXB 2ZDNA 4TYDA 1GBDA 4DVAU 2QXHA 4IBLH 2RDLA 2CF9H 1MTUA 2C93B 3KQBA 2BQ6B 4A92A 2BMGB 1O3CA 3PMBB 1A0JA 7KMEH 3BTEE 3C1KA 1GDNA 1MBQA 2GDDA 1ORFA 3PLPA 5F8XA 2OUAA 2ZGXH 3RXGA 3W95A 3DD2H 2Z94A 3PO1C 3MO6A 1SG8B 1YPMH 2WV5A 1P3CA 1O2NA 3UQOA 2ZTYA 4WF8A 1DS2E 2ZU2A 1YC0A 1P05A 3CP7A 3T5FH 1O3AA 1OP8A 1TQ0B 3KQEA 1C2IA 5FPSA 3RMNH 2FOGA 1IQFA 1G3DA 3M36A 4FUDA 7GCHF 1EAWA 5F03A 4CRBA 4TWYA 3I78A 1AI8H 3TK9A 1THSH 2GVFA 1TALA 1K2I1 2FIRH 4O9VA 5FBEA 5H4IB 3ZYEA 1Z8IB 1ZPCA 4NZQA 1E0FD 1LQDB 2Z9JA 1N8OB 3KEEA 3ZZ9A 3RXRA 3AASA 3ZZCA 3LH1A 1QL7A 4A1XA 3LPRA 4Q7XA 1BMMH 1NY22 1VITG 2VJ1A 1ZHPA 1TAWA 2ZZUH 1UVOA 3F1SB 3PLBA 1ELFA 1TBZH 1O2YA 3GY6A 4B74A 3BG4B 2BY5X 4CBNA 5FHTA 1ANCA 1O3MA 5ESTE 1TBQH 1C2JA 1HYLA 1B7XB 2ZECA 1MH0A 2ZTXA 2HWLB 8GCHF 4JZ1A 2STBE 4X1QU 1V2WT 1F0RA 1H9IE 4KELA 1XUJA 3A81A 1D9IA 2PTCE 1V2NT 4UFFH 1TNHA 1ELDE 3E1XB 2BY9X 5L2ZH 4LXBH 1TX7A 3P6ZB 2VH0A 1TNJA 1L1GA 1V2PT 5GWZA 2A45B 3BIUH 2A7JA 1P8VC 1TPOA 2PKSC 4KTSA 1Q3XA 3ZV8A 2GDEH 4UFDH 2H9TH 4BAQB 1N6YA 4GSOA 5E0GA 3SUEA 5JBCS 3GICB 4NIWA 2H9HA 3FZDA 3S7KB 1MU8B 2FTMA 4GHQA 2CN0H 3K65B 3VGCC 4WMDA 3Q3YA 3M35A 3F9EA 5A8XA 1C5PA 1YP9A 1PJPA 3MH7A 2A4GA 3JZ1B 1P03A 1BBRE 2G4TA 2FMJA 1QBOA 3A85A 2PSXA 2ALPA 1GI3A 1OWJA 2KAIB 3KQDA 1B5GH 4MPXA 2OC7A 1G3EA 1VJAU 3ENSB 2FPZA 2NU3E 3M37A 1DY9A 1SVPA 4AYVB 3R3GB 2AH4X 1IHTH 4X8VH 1T8OA 1GMCF 2ZFTA 1QQ4A 3O8BA 1A3EH 1W12U 4I8JA 1PPGE 1QTFA 2ZGJA 3FP7E 2F9VA 4X6NA 3T25A 3MO9A 2QCYA 3KCGH 2W3KA 1LCYA 2UWOA 1RFNA 1GDQA 4BTUB 3RXCA 3TNTA 1BTXA 4GVUA 3SOSA 1TONA 4NFEA 5E8EH 5C2ZA 5JPMH 3SU2A 1BJVA 4Q80A 1FI8A 1GI2A 2F9NA 3OSYA 3S69A 4BTIB 1JMOH 2ZU5A 3S0NA 2ZDKA 2XXLA 3M5NA 4KTCA 1E35B 1BRUP 2ZHDA 1MTWA 1TRYA 2XNIA 2ZC9H 1CVWH 2BZ6H 1C2GA 1BUIA 3RXQA 1YCPK 1FPHH 1THRH 1YPKH 2XCNA 3KHVA 4OS1A 3LGIA 2HPPH 4NCYA 1JXPA 3TITA 3SGAE 1QBNA 2OQ5A 1DANH 4YOGA 1P2JA 2PSYA 1O36A 5IDKA 1O2KA 4IMZA 1NZQH 1CGJE 2ZDLA 2Y5FA 1LKAA 3LU9B 3UY9A 1WV7H 3RXEA 2BLVA 1MKXH 1O30A 3P70B 4JZEH 1IHSH 1GJ8B 2GZ7A 1OYTH 1AMHA 2BLOA 3K2UA 1D6WA 1GMDG 1FY5A 1ETTH 1AGJA 2PV9B 1PQ5A 2OCVB 4DT7B 1MZDA 2Z9GA 2FXRA 2C8YB 4IN2A 1DVAH 1C5NH 1MBMA 1WUNH 3A87A 4CBOA 4BOHA 5C5NA 2AIQA 3SW2B 1EZUC 3VPKA 1LVOA 2J2UA 1FNIA 3OY5U 3SZNA 1YLCA 5FCRA 4ISHH 3NUMA 4X2YA 1C9TA 1QL9A 4Y8XA 1AKSA 2F9BH 1KTSB 3NXPA 2WINI 1SQAA 4Y7AA 1Z8RA 3PYHA 1OWDA 1ZSLA 6GCHF 1SLUB 1JRSA 3SN8A 3SO3A 4A6LA 4X1PU 2GCTC 4AB9A 1GBLA 3VB7A 1DDJA 4K2YA 2BOHB 3SUDA 2BDIA 1T4UH 4UDWH 1ELCA 2AYWA 1O2QA 3SU5A 3SV9A 1EPTA 2HNTC 4Y0ZE 3SU3A 1MU6B 2Y7XA 5SGAE 1DM4B 3SGQE 1KXEA 3SHCH 2LPRA 1TOCB 3RC4A 4IGDA 3TJOA 4VGCC 4WH8A 3SU6A 3HK6B 1S85A 4OS6A 5DK1A 1OX1A 1AFQB 4ZKNU 1V2LT 1TQ7B 2QYIA 6LPRA 1MKWH 3SI3H 1EZXC 1TLDA 3ZVFA 5CE1A 5L30H 4WMEA 3T28A 1A5GH 1SB1H 2B0FA 2YOLA 1BQYA 4CH2B 1UTQA 1HLTH 1UTKA 1GMCG 4JYTA 3D65E 1AKSB 1GG6B 1GMHG 3MU0A 2WPHS 1YPHE 2AGGX 3FP6E 2J38A 5LGOA 1G9IE 4MDSA 1SLXB 3RXFA 3SV6A 4RN6A 1EJMA 1K1LA 2Z9KA 3MHWU 3F9FA 2BDAA 1KLTA 4BXSA 4F49A 6ESTA 1CT4E 4X1SU 5AFYH 2BY8X 5TCCA 1FY4A 1NU7B 1O3GA 2ZPSA 1S0QA 4JYVH 5HGGA 4BAHB 3QGNB 2BLWA 5L2YH 3GISB 4OS2A 1EKBB 3ZYDA 1G3BA 5AVDA 1GI9B 1O3HA 2F91A 2XYAA 2FS8A 2NU0E 1BBRK 1CA8B 2FI5E 2VVVA 4JYUH 3RU4D 3RDZA 1HJAB 2HNTF 3LC5A 3TGJE 1C1OA 1S6FA 1HAZB 1EQ9A 2VIVA 4YM9A 2Q6FA 3GYMA 2QN5T 1GBFA 1GVZA 3PROA 3A7TA 2F9OA 3ZVCA 1TNKA 1LQEA 9ESTA 2Z3EA 1B0FA 2V3HH 2C8WB 1TNLA 4H42U 2PGQB 2H2ZA 2D8WA 1NFXA 2HPQH 4NSVA 1P11E 2PHBA 1CE5A 1O3IA 2EEKA 1VCQA 3UNRA 1WAYB 2QF0A 3UTUH 1KDQA 2GKVE 1MKXK 2PKSB 1A1RA 3GCOA 4NG9H 6CHAB 4FUFA 1VGCB 4DY7B 1QJ1B 2ZG0H 4YOJA 4ZKOU 4K3JA 3BTHE 1MQ5A 2FOAA 3WY8A 2CHAC 3LH3A 2ZEBA 3BN9A 4MNXA 1FMGA 1KLJH 3RLWH 5ABWA 4ISLA 1WTGH 3E90B 2DE8A 3SUGA 1CBWB 3UUZA 2XWBI 1DWEH 2ZHFH 1QL8A 5EODA 1NN6A 1YCPH 4KKDA 3LIWA 1UVSH 5PTPA 1NRPH 4F4OC 2R2WU 2VVUA 2WUBA 2PR3A 1UTMA 2Y82A 1Y3XA 4INHA 4GUXA 3A8CA 1ABIH 1HGTH 4LOYH 5JDUB 1OWHA 2J94A 3SJIA 2TGTA 4B76A 3RMLH 4LZ4B 1J16A 1DY8A 1O2MA 4FUBA 3ZZ4A 2FX4A 4UFGH 4JZDH 2XBYA 4Y7BA 2EI6A 1T7CA 2VB0A 1BOQA 2CV3A 4D7GA 1YLDA 1ID5H 1N6XA 1JIRA 2XC5A 1VITF 4WY3A 5J4QA 1W7GH 1IQNA 3TU7H 2FEQH 4ZUHA 3EDXB 3E91A 1V3XA 4Z6AH 1MQ6A 1HXFH 3Q76A 1TFXA 1EUFA 1XUFA 4YESB 2AERH 5JBTA 1MZAA 1Z8GA 2GCHG 2XW9A 4NA8A 1QFKH 4Y71A 4BTTB 1HDTH 2C8ZB 4B75A 1SQOA 3SGBE 1T8LA 1ZSJA 1K1JA 5DP7A 3QK1A 3N7OA 1BMAA 3HATH 4B2AA 1HXEH 1UO6A 2BD2A 1F0UA 3VXFH 2P3UB 3ZVAA 3MU5A 1BITA 1A2CH 1KXCA 1P2NA 4K1EA 1LO6A 1XKAC 2W7UA 2FLRH 2FOMB 2GCHF 2BD4A 2J4IA 3AW0A 3SJOA 3TH3H 4JZFH 1C1QA 1O2HA 1HNEE 3AAUA 3UR9A 4BXWA 4I8HA 3GCHC 1GJ4H 1V2MT 3GYLB 4J1YA 1DPOA 3A8BA 1IOEA 1EPTB 1K28D 3RU4T 1C5MD 2Z9LA 1CSOE 4RKJB 4AG1A 1VGCC 3RP2A 3NKKA 5FXLA 1YPGH 3BEIB 4CR9A 1CU1A 3ZV9A 4WXVA 5A2MH 3RXUA 4AX9H 3GCTG 3OY6U 1RGQA 3BIVH 2A5KA 3U98H 3SU0A 1C1RA 2A4QA 2P93A 1ELGA 3NCLA 2FESH 1KYNA 3RXAA 1V2JT 1E36B 1W10U 4FUCA 3ESTA 1O3PB 2K1QA 4X8UH 2PUQH 2OBQA 1N8OC 3LGVA 5HMAA 1BBRH 3VXEH 3P92A 4GCHG 3LKWA 1BTYA 3MU4A 5C5OA 4GLYA 1KLIH 1GPZA 3DFJA 1XXDA 3U1JB 1OWIA 2GGVB 1O5FH 2BDCA 2ZPQA 1GBJA 2FTLE 2ZHWH 5E0JA 1FAXA 3GY4A 2RA0A 1NFYA 3BG8A 2FI3E 1JIMA 3V7TA 2G55A 1IQEA 1AFQC 2QIQA