1O32A

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o32A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o32A02
1KIGH 2UUJB 4UFEH 3O8DA 1BMMH 5F8TA 4TY6A 4XDEA 3MH4A 1QL8A 2SGEE 3NXPA 4DVAU 3PMAB 3RUOA 1E38B 1F0SA 1XUGA 2QAAA 5E0GA 1MTVA 3B8JA 3SGBE 3L3TA 4H4FA 4X2WA 4JZ1A 4DT7B 5B6OA 1EXFA 2TIOA 1L4DA 1ELEE 1ZZZA 4FUGA 3MMGA 1O33A 2XW9A 2ZP0H 1LMWB 1HAPH 2FI3E 1O3NA 4BNRA 1TNHA 1ZPCA 2UUYA 3MU4A 3SV2H 2DE9A 1O39A 3RLWH 3K6ZA 6CHAC 3RMLH 2Z6BD 1KDQA 1WQVH 1BUIA 1P10A 1AWHB 2PR3A 3AASA 1TGTA 3ZZ7A 2BDIA 2PWXA 1G37A 1VCWA 3M3VA 3QZRA 1SFIA 1GBTA 4AFZA 9ESTA 1SI5H 2DE8A 3SNCA 3WY8A 1D6RA 1KTSB 1XMNB 3K65B 2TBSA 3BN9A 2OBQA 2J92A 2HPQH 3LC3A 4ABEA 1F5RA 1IQGA 1XXFA 3FZZA 3MU1A 5PTPA 1G2LA 1U6QA 1YC0A 2OLGA 1TX8A 1XUHA 4GLYA 1BMAA 1SHYA 1JOUB 4XE4A 1PPHE 4YLUA 1ETTH 1N6YA 2OC0A 2FIRH 1MKWK 1DLEA 2ODPA 3Q77A 4OS4A 1C1OA 4FU9A 1QRWA 1A5HA 1UTPA 3U1JB 2QCYA 2H5DA 3L33A 2BZ6H 4Q7XA 3F1SB 3ZZ6A 2Y5HA 1DFPA 2R0KA 4D8NA 5DK1A 1TA2A 1KYNA 1V2KT 2FMJA 1C2FA 3E8LA 1GGDC 4NWKA 1WSSH 2OINA 1T32A 5FBEA 4CREA 4D7FA 2PTCE 4I8LA 1OKXA 1QURH 1CU1A 1PQAA 1WAYB 1ARBA 3E16B 1BBRK 3A86A 1XUFA 4WMDA 1NRSH 2F9PA 3QO6A 4YT7H 2G5VA 1GJ4H 5AFYH 5I46H 1O34A 1FNIA 5AFZH 1V2LT 4XBBA 1HNEE 1Z8JB 2ZU3A 4MG3A 3ZVDA 3QDZB 1C1MA 1YPLH 5TCCA 1TGSZ 4WMEA 1GJ7B 2CV3A 1TALA 1TONA 4CRDA 2TPIZ 1EAXA 3LGVA 5E8EH 1O35A 2VVVA 2P3TB 1HJ9A 3SUGA 4YZUA 3I78A 1XUKA 1K1OA 3U8TH 1A3EH 3GCHC 3SJKA 1P2MA 1PPFE 4FU8A 3PLBA 1AI8H 3UTUH 2WUCA 1ZPZA 3ATMA 1L1NA 3A7YA 3ZVFA 1SGFA 4RKOB 1W3CA 1Q2WA 1GGDB 4OS2A 2AIPA 4CR9A 2RDLA 5C1UA 4TY7A 4WH8A 4GVUA 1V2WT 5T6DA 5FPSA 1G32B 4SGAE 4TYDA 4MPXA 2ULLA 4X0WU 2ZFRH 5DGJA 4LXBH 3TJVA 3ZVGA 4MQAA 1GMHF 1DUAA 4Y8ZA 1DSUA 4K69A 5BRRE 2PFEA 4K8YA 3ZVCA 4IGDA 2A45B 1G9IE 2ZC9H 5GCHF 3RXDA 3VB4A 4AYYB 5F03A 1V2QT 1KXFA 1T4VH 2FZZA 2GX4A 4PROA 3U1IB 1UVOA 2VB0A 2RCEA 5EQQA 2Y81A 4I7YH 3SNBA 2AEIH 4CHAB 3FAOA 1CSOE 2B5TB 2BHGA 4K3JA 1HYLA 2ZU4A 2XRCA 3UOPA 4JMYA 3BEUA 1HPGA 2ZF0H 2PTNA 3VEQB 2UWLA 1Y3YA 1LHGH 4HGCA 3A8AA 1S0QA 2BLQA 3KQEA 1EOJA 3P8NA 3PTNA 4CH2B 4A7IB 2J4IA 5T3HA 1MCVA 2BX4A 4Z6AH 1L4ZA 1FIZA 3MNBA 2BLWA 5FAHA 3H7OA 1GDQA 3SU4A 3LDXH 2J38A 2PGQB 4B74A 1GBDA 1TBZH 3A7VA 2GDEH 1H9LB 1UCYE 1W0YH 4Y10E 1CQQA 1GJAB 1E0FD 1OSSA 4FXGH 1NRRH 1RTFB 4ZKNU 1MU8B 1ZMLA 2HALA 7KMEH 1GI8B 2AMQA 2B7DH 1CHOF 3RXQA 1ZTLA 4BTUB 1KTTB 1SR5C 1C2DA 5K0HA 1DT2A 1T8MA 1E37B 1S6FA 2VVCA 1AVWA 3CENA 1D3PB 2A4QA 1J14A 4XBCA 4WXVA 3ZZ3A 4I8KA 3LPRA 1QB6A 3FZDA 1K1MA 2QXHA 3HKIB 4MNWA 1A46H 2Y7XA 2SGAA 2WPMS 3M37A 2Y5FA 4ABHA 2GV7A 1C4U2 1O2LA 3MHWU 2A0QB 3MO9A 3PV4A 1AB9B 1UJ1A 1CGHA 2AFQB 1YM0A 2FOEA 1GJ9B 1AU8A 1DWBH 1A0JA 2C8XB 3E1XB 1HAVB 2VWMA 4YLQH 1GHAF 2BTCE 3V7TA 2A5KA 2WPJS 1AZ8A 4BAHB 1FPCH 2Z9JA 4XFQA 3LU9B 1O5CB 1UTKA 1QBNA 3M7QA 2VVUA 1SGCA 5GIBA 2WINI 1AVXA 2WV5A 1O3HA 2BLOA 1O5FH 4ABDA 2PW8H 1IAUA 1T8LA 5C1XA 1A2CH 4DIIH 1QBOA 2DUCA 3KL6A 1O37A 1S85A 1EP6A 1RD3B 3A83A 1C1NA 1GMDG 1C5XB 1Y59T 2JKHA 5HMAA 3RC4A 4UONA 2V0BA 4KELA 1TGBA 1EKBB 5K7RA 4FU7A 2ZCLP 1XX9A 1X7AC 1D4PB 1Y3XA 3OY5U 1G3BA 4ABBA 1P2KA 4AGKA 3TGKE 1YPMH 2VIOA 2AGGX 1SG8B 3URDA 1EZUC 2ZG0H 4B75A 4DW2U 1EPTB 1XVOA 1RS0A 1HJAC 3UREA 3S9AA 1C5OH 3VFEA 1S6HA 1OYQA 1UHBA 1WTHD 1LHCH 3VB3A 2J9NA 3FFGA 1BJUA 1F0TA 4FUEA 1O2OA 1P57B 1NROH 3SU6A 3GICB 4X1RU 1JBUH 3SV8A 3VB6A 1QIXB 4Q7ZA 4AB8A 1MTNB 2EA3A 2XC0A 5E0JA 1MCTA 1SLUB 3E0NB 4LZ1H 1V2TT 1UTLM 1L1GA 1TRMA 3A7TA 3GCTG 3OSYA 1G2MA 3CS7A 2Z3CA 2QIQA 3STIA 1ELGA 3A8BA 3CS0A 3RXUA 2C8YB 2NU1E 1ABIH 1TWXB 3P92A 1C5MD 2ZFFH 4B2AA 1K21H 1SL3A 2BVSH 1YF4A 2Y5GA 2SFAA 1O2HA 1SGDE 2TGPZ 2CF8H 5GDSH 5GPIB 2ZGJA 3RDZA 2FX4A 2HOBA 3ATKA 2IOTA 1DY8A 1O5DH 2F9UA 3LIWA 8GCHG 1SGNE 1W10U 4SGBE 3GDSA 2BQWB 1CGIE 3R0FA 1K1PA 3BTKE 1D3DB 1UTJA 2RG3A 2FTMA 2BDCA 2Z7FE 3T29A 1ORFA 3TK6A 2ODYB 2PKAA 4UFFH 1P2NA 1GMHG 4UFGH 3RXEA 1T31A 3CP7A 1UVUH 3P6ZB 1YPHE 5FCRA 1C9TA 2A7JA 4ZKSU 1LVOA 1OOKB 3TH2H 5DP8A 2Q6FA 3A88A 1K9OE 1VJ9U 2PHBA 4Y0ZE 4ABAA 1XUJA 1GVZA 4NIXA 5EW2H 4ZHAA 1THSH 3W94A 1C2EA 3PO1B 1THPB 3KQCA 1HAVA 1SQAA 3MNSA 4K5ZA 2FOFA 2F9BH 3F9FA 3RXVA 1P8VC 4INLA 2BB4A 5FPTA 3SU2A 1B0FA 3LH3A 1NU9A 1NTPA 3MWIU 3RMOH 2GT8A 1W12U 4GUXA 3NKKA 3KQDA 2Z3DA 1LCYA 4B2BA 3RXTA 4AG1A 3AAVA 4YOJA 4B71A 1FY3A 2F3CE 4AFQA 3SW2B 1AHTH 4CH8B 1O3OA 4TPYA 1AE5A 4KGAA 3BTME 2CMYA 2OXSA 4HI3A 1FY1A 2J34A 3UPEA 4JZDH 1AKSB 1KDQB 1TYNA 1A1RA 1BOQA 3RXHA 2BY9X 1O3LA 1K2I1 4BAOB 1ELBA 1O2UA 1UVPA 3BTGE 1Y8TA 1GBIA 2A7HA 2WYGA 2GZ7A 4ABGA 4WXIA 2F9NA 2WPKS 3DT0H 5E2OA 1BA8B 2ZQ2A 1GCTC 1BB0B 3E91A 1ELFA 1VCPA 2ZHQH 2ZDNA 3RXMA 4GSOA 3TK9A 3RC6A 4BOHA 1OWKA 1ARCA 3M5OA 1ZJDA 1M9UA 3ATWA 2ZFQH 4FUIA 1S0RA 4TWWA 3ELAH 4ZHMU 3PWCA 4NGAH 5CHAB 5C2ZA 1P2IA 4GAWA 4AOQA 3TJUA 8KME2 3LGTA 1ELDE 2W3IA 1SLVB 4I8GA 1QRXA 3K9XB 3HK6B 4JZEH 1WBGB 1ZLRA 3ZVEA 1C1TA 1GI3A 1E34B 1H9IE 3BTWE 2QYIA 1F5LA 1K1IA 1UVSH 2ZCHP 4E7RG 1SGFG 1GI9B 3P17H 2H9TH 1MD8A 1YLDA 2CHAB 2ILNA 3KF2A 1GJBB 2BXUH 4AORA 1CBWC 2JH6D 4X6PA 1WOFA 2FOBA 1FN6A 5JYIA 3ZZ8A 1ESAA 2A2XH 2RA0A 1NFWA 1HBTH 3M61U 3U8RH 1ID5H 1HCGA 2D1JA 3MI4A 1C9PA 1PPGE 3GDUA 5A0CA 1IHSH 4NIVA 3GCOA 1O2QA 2HNTE 1DWCH 3STJA 1IOEA 1NRNH 1W2KH 2ZCKP 3SBKA 1QQUA 1HFDA 2FS8A 2SGDE 2W5EA 4Q7YA 1ZGIA 1C2HA 4YM9A 3D23A 2JH0D 4VGCC 2BYAX 5A0AE 4O3TA 4D9RA 1VITH 2GGVB 2UWPA 1HIAA 2WPLS 3F68H 4A5TS 5EU8A 1C5PA 3A8CA 5T6FA 3BTFE 1O2SA 3RM0H 1Y3UA 1ETSH 3ZZBA 4FUFA 5JB8S 3RXAA 1CBWB 3SQHE 3ITIA 1GHWH 2SGQE 1TBQH 4ABJA 5FX5A 2XBXA 4OGXA 1RTKA 1YCPK 3RXCA 5JBBS 4MPVA 1FDPA 1CO7E 2VNTA 1TA6A 4NSYA 1AKSA 3DFLA 4JZIA 3GY8A 4BAQB 4X2YA 5EQRA 1O5GH 1AVGH 1DVAH 3LT3A 4LZ4B 3SJIA 2FOCA 1P01A 1C1RA 1KXEA 3QGNB 3FANA 1NC6A 1NN6A 4DY7B 1O5AB 1TMTH 1TGCA 2HGTH 3RM2H 4B1TA 1NS3A 2XNIA 1O2NA 1Z8RA 2FXRA 4NA8A 3ZZAA 2PKSB 3MU8A 3Q3XA 2ZKSA 5EXMA 1Z6JH 3MYWA 4VGCB 7GCHG 1ANEA 3UWIA 4INKA 3BTHE 3RXKA 5J4QA 3M7TA 1IQKA 4Y71A 1J16A 3C1KA 1UK3A 1BMNH 2OTVA 1F7ZA 1AGJA 1GMDF 1AUJA 4ZMAH 3SZNA 2BVXH 5EPNA 1P12E 4A1VA 1GHBG 3UQOA 3AAUA 1HAHH 3I29A 4WJG2 4BXSA 1BRBE 1Z1JA 4Y8XA 1FPHH 2V3HH 4J2YB 5IYTA 3T25A 2C93B 1B7XB 1V2RT 1LHEH 1O2IA 2FI4E 3P8GA 4X1PU 3S7HB 2ZNKH 3NCLA 5DP7A 2ASUB 1KLTA 2GT7A 2AIQA 1PPBH 1TB6H 4U30A 2ZECA 4DJZB 1C2GA 3KNXA 4B76A 2ESTE 2GMTC 1ZMJA 1TPSA 1C1VH 3BTTE 1RTLA 3GISB 4BAKB 1MQ6A 1GBBA 2ZWLH 1ZSJA 1S82A 1TAWA 1QA0A 1EB1H 1TNIA 1DM4B 2RA3A 2UWOA 2H9HA 3GYLB 1HAOH 5TCAA 1TLDA 3MTYA 4X2VA 1FV9A 1EAWA 1ZSKA 3GCTF 4MTBA 4HZHA 1Y5UT 2BOHB 2FODA 2BD7A 2LNCA 1SB1H 1DY9A 2Z9IA 1FLEE 1YPKH 2ZZUH 2QF3A 4CHAC 2ZTZA 1TOMH 2XTTB 4IBLH 2BVRH 4OS6A 3RXOA 1PQ7A 5L2YH 1K1NA 1SVPA 2STAE 3QX5H 3RP2A 1HAIH 3MH6A 4JYUH 1O2PA 1FMGA 1BRAA 3PWBA 1FY5A 2GD4B 8GCHF 1KLIH 1V2UT 2OC1A 2GZ9A 2K1QA 2QC2A 4K2YA 4BTTB 3KQBA 4AX9H 1BTHH 2VH0A 3TGIE 3P70B 3IITA 4ZXXH 2BX3A 4NG9H 4O97A 1O3IA 4X8VH 1TQ0B 2CF9H 4AGJA 1LHDH 3MH5A 3SGQE 1EZSC 4KTUA 2G4UA 3PMBB 4THNH 2GMTB 1LHFH 1YLCA 4JCNA 3SU0A 1TNGA 2FS9A 3RXPA 2G81E 2FYQA 1GVKB 1GBFA 3F9GA 1ELCA 5EODA 5ABWA 2ZGCA 3GY7A 1UO6A 2Z94A 3KHVA 2BD5A 1EJNA 4NA9H 9LPRA 2XWBI 1AZZA 4M7GA 3SOSA 1Z1IA 3NWUA 5CE1A 4FUCA 2BY6X 1EQ9A 1ZYOA 4RN6A 1YCPM 1B5GH 3BIVH 1AE8H 4JZFH 1UHBB 2Z9KA 3PTBA 2FEQH 5DP4A 5DO4H 1DICA 3A82A 2XCFA 1O5EH 1O3GA 2A4GA 1GI2A 3TH3H 5HYOA 3SO3A 1BQYA 4X1SU 1AFQC 1N8OB 2BOKA 3RXBA 1AB9C 1GI5A 2Q6GA 1EUFA 1ACBE 1JIMA 4NWLA 2ZA5A 4Y79A 4BANB 3A89A 2ANWA 3SQEE 1ESBA 1NM6A 2B0FA 1N1LA 2B8OH 3K6YA 5EGMA 2GDDA 5A0BA 3RU4T 1GJ8B 4A1XA 2QF0A 1MKXH 2ZGXH 4U32A 3ZVAA 2A4OA 1FY4A 2G4TA 1TPPA 2ZTYA 1TMBH 1H1BA 1GBLA 3VB5A 4Y0YE 1O5BB 1HXEH 1H4WA 1O2RA 1RGQA 1LDTT 3E6PH 3GYMA 1MD7A 2ZU5A 1O36A 2J95A 4I31A 2TGTA 5EG4A 4OS7A 3A8DA 3ZYEA 1BTUA 1DX5M 2PKAB 1ELTA 4Z0KA 4ZROA 2H1UA 1AO5A 2AGEX 2UUFB 1OP0A 3HGPA 2H6MA 5A8XA 1P05A 3BEFB 1ZHRA 3KN2A 3QZQA 1AFQB 3T5FH 3EYDA 1EAUA 3LC5A 1XKBC 1KXBA 4BAMB 2PUXB 4NA7A 3MU0A 1Y3WA 2A5IA 2YOLA 1DSTA 3TGJE 1EPTC 1SMFE 1SLWB 3ZZ5A 4OS1A 5EXNA 4ZXYH 2BXTH 1FAKH 3Q3KA 4D7GA 4J1YA 1MTUA 1HAZB 4R0IA 4HTCH 1MTNC 3K2UA 4Q80A 1EX3A 3H7TA 4I8JA 3EE0B 1K22H 3DD2H 1TIOA 1G36A 1TABE 3A7WA 1PYTD 1NFUA 5TJXA 1TFXA 5JBCS 2QXIA 1O32A 2A1DB 4WH6A 5DP3A 1GI6A 1TNLA 3O8BA 2VJ1A 2GTBA 2VWOA 2SGPE 1HV7A 4NCYA 4IN1A 1O2YA 2OP9A 4GHTA 3F6UH 1ZSLA 2UUKB 1TNKA 5EXLA 1C5YB 3ZV8A 1HAXB 3NK8A 3D62A 3DUXH 1GBEA 3TLOA 3SJ8A 4E7NA 3VGCB 3UY9A 2ZU1A 2BDYA 3I77A 3OTJE 1CHGA 1O2XA 3OY6U 1GDUA 2HVXA 4RSPA 1ELAA 4YOGA 1W7XH 2FM2A 1J8AA 3BF6H 3UQVA 2I6SA 1EJMA 4AG2A 3OYPA 3TNTA 2VIDA 3AW1A 1ABJH 1BIOA 3QN7A 1SFQB 2W26A 1HJ8A 2V3OH 2AMDA 1C5VA 2BDHA 4NFEA 1L0ZA 1HGTH 4YTAA 3QLPH 4U01A 1BBRE 3PO1C 4K60A 3RC5A 1HLTH 1PPEE 2OBOA 4K1EA 2NU3E 2Y82A 2PV9B 3LH1A 3SN8A 1W8BH 1SQOA 1C5TA 1GI4A 2LPRA 3UNSA 4UEHH 1P09A 2QGRA 3A81A 3RMNH 1O3MA 1C1UH 4AFUA 3BTEE 1EP5A 2JH5D 1D9IA 1JRTA 2ZFPH 4INHA 2FDAA 2ZO3H 1CGJE 1QNJA 1WTGH 2BQ7B 4DG4A 2XBWA 1BT7A 2ZHDA 3VXFH 3RXRA 2IN2A 2BD3A 3S69A 1BTYA 1EZXC 1GBMA 1ZTKA 1QGFA 3ZYDA 1RRKA 4CRGA 3Q00A 7GCHF 2XC4A 2ZFTA 2NU4E 1MU6B 1O30A 2F83A 3SUEA 5EOKA 1NO9H 2H9EH 3V12A 3P8OA 1SOZA 3DFJA 4ISLA 3UFAA 4YOIA 1SGYE 2FOAA 4X6NA 3H5CB 1GHBF 3SU5A 4ZHLU 2H2ZA 1V2NT 1C5NH 2F9OA 1XM1A 1ZOMA 1F0UA 4F4OC 1QFKH 4F49A 5L6NH 1PQ5A 1BDAA 3QTOH 4UD9H 4Q2KA 1NRQH 5H4IB 1PPZA 1HIAB 2ANMH 1S84A 2Y7ZA 1P3CA 1QRZA 2R3YA 2YNAA 1IHTH 5ESBA 1BCUH 4DGJA 5CHAC 1S83A 2ZU2A 3MU5A 3SV7A 5FX6A 5LPRA 5FHTA 1BITA 3NUMA 1CT4E 2P59A 3E3TA 1AQ7A 5CMXH 1GI1A 8ESTE 1UMAH 1VJAU 1G30B 1G3DA 2AMPA 4BXWA 7LPRA 3W95A 4NIYA 1C5SA 4FVBA 1LKBA 2Y6TA 2V35A 4ABFA 1AFEH 3OX7U 4X8TH 1KY9A 1CVWH 4CBOA 4UFDH 2OC7A 3N7OA 3P8FA 3U9AH 4H6TA 1RFNA 1QHRB 1UCYH 1Z7KA 1OXGA 1KLJH 2ZPQA 2ZDVH 1GHZA 1YKTA 2CHAC 1MZDA 2ZFSA 5EQSA 2FO9A 1ZJKA 1C5QA 5I25A 1UK4A 3F9HA 2AGIX 4MVNA 1LVMA 1P11E 3KEEA 4WY3A 5LPEA 1QCPA 3M3TA 4MNYA 2FOGA 3PLPA 3F9EA 4K8BA 3MO6A 4CRCA 1IQLA 2ALVA 1SGTA 3TU7H 1J9CH 3BTDE 5IDKA 4MPUA 1LTOA 2OQ5A 1VITG 4XSKU 3O8CA 2WUBA 5FPYA 3VXEH 1LQEA 1IQEA 1J15A 2NU0E 2GKVE 1G3EA 1UTNA 3S9CA 1GHVH 3AVZA 3A80A 1TQ7B 3NPSA 3AW0A 3SI3H 6GCHG 3HK3B 2VIQA 4UE7H 1Y5AT 2QN5T 3FVFB 4H6SB 2GCHG 1T8NA 3QWCH 3TVJB 1OWDA 4DIHH 1C5WB 1PQ8A 1UK2A 2BD2A 2C4FH 2R0LA 1QJ7B 4NSVA 1AIXH 1P9UA 3PLKA 1O2JA 3GY2A 1O2TA 1HXFH 3MFJA 1C2MA 5F8XA 1LVBA 1RIWB 3EA8A 1GJDB 4NIWA 4NZLA 1BJVA 1OYTH 1ZR0A 4CRFA 5A2MH 1YBWA 5J4SA 1FQ3A 1GG6B 2G51A 5C67A 1XXDA 4A6LA 1PJPA 1YPHC 1VZQH 1MKWH 3UNQA 1QR3E 3HGNA 3SU1A 2QV1A 2PKSC 1DWEH 2FOMB 3S7KB 3TH4H 1EAIA 3M3SA 4GCHG 1WCZA 2BY7X 3HPTB 4WMFA 1YYY1 1A0HB 3JZ2B 4X2XA 4Y11E 3M36A 1Y5BT 2BD8A 2FLRH 1AMHA 3A7XA 1RXPA 3EAJA 1O3PB 1P9SA 1PFXC 1FXYA 1RJXB 1FI8A 2B9LA 2EI7A 2Z9LA 2OUAA 1SC8U 5A8ZA 4O03A 1W11U 1ZMNA 1CT2E 1ESTA 1O3BA 3RXSA 2XC5A 4O9VA 1F92A 1JMOH 1C5LH 2ALPA 1DXWA 1C1WH 2R2WU 3BG4C 1LO6A 1BBRH 2BLVA 2W3KA 2ZDKA 2C8WB 1FIWA 1NPMA 2SNWA 1O0DH 1THRH 4QT8C 4B73A 3C27B 1DLKB 3HATH 1W14U 3RLYH 1DDJA 3MO3A 2FX6A 3SHAH 1OP8A 5EW1H 1K28D 3KCGH 4DURA 4ZAEA 3ODFA 2P3FH 1GJ5H 3O8RA 4E05H 5AF9H 5BPEA 1SGPE 4DCDA 2O8LA 1SPJA 2GCTB 4FUBA 2VIWA 1QA7A 4ISHH 2W7SA 1DE7H 7ESTE 4IMQA 4AFSA 1YGCH 2ZTXA 1SGEE 1SLXB 1YPGH 2O8UA 4IMZA 1H8IH 4WF8A 1UTMA 3T2NA 3UIRA 3TJOA 3VPKA 1K1JA 4AB9A 1OP2A 4JK5A 4MPWA 1OX1A 2VIVA 3BG4B 3P95A 1TPAE 1QJ1B 1E35B 3BG8A 1BHXB 1F5KU 2OD3B 3R3GB 3A84A 1C2JA 2ZHEH 5A8YA 3LGYA 4OGYA 4KP0A 2VU8E 2BZAA 2STBE 5AVDA 2FESH 2PSYA 3GY3A 3SGAE 1BRUP 2JETC 1EB2A 3RXFA 5GJ4B 3DHKH 1QBVH 2PSXA 1ZGVA 1P2JA 5C1YA 1GMCG 2WV4A 5SGAE 4RKJB 2EEKA 3LOXA 3E0PB 3B9FH 1DUEA 3PMHB 1TOCB 2D2DA 3EQ0H 3MNCA 3TNSA 3T28A 6CHAB 3LJJA 1NZQH 4E06H 2FLBH 1PPCE 1FONA 3EDXB 2W7UA 4K1SA 2GV6A 2R3UA 5T6GA 4KTCA 5C20A 1MAXA 3TPIZ 1VCQA 1UTQA 3UOUA 4KKDA 3G01A 4UDWH 2ZI2H 2A2QH 1NY22 3FP6E 2ZDLA 2BM2A 3BEIB 1O3AA 2ZGHA 1S5SA 1QB9A 1KXCA 3GOVB 4D9QA 2PLXA 1N6XA 1TRNA 2ZDAH 5JB9S 3PROA 2HNTC 2BD9A 5FCKA 2FYRA 2J2UA 3ESTA 3VB7A 1KSNA 5LGOA 3RMMH 1N8OC 1P3EA 1Z6EA 2G55A 2HLCA 3RXLA 4ISIH 4TWYA 1V2OT 1UVTH 4K1TA 2JETB 1O2GH 1MBQA 1WUNH 1ZRKA 4X6OA 1P06A 1XUIA 1EATA 1T8OA 1F0RA 2VWNA 2M5TA 3JZ1B 4LK4A 1BTPA 1L1JA 1SGRE 2O8WA 2A4RA 1TPOA 3SUDA 3TK5A 3IWMA 2XXLA 3GCNA 1WU1A 1O2KA 1CT0E 4TPIZ 2O8TA 2NU2E 2XYAA 4H42U 3Q3YA 3SJOA 1G3CA 1WYKA 5HXFA 1C4Y2 5JBAS 1LKAA 1O2VA 2GZ8A 3PMJA 3LJOA 1T7CA 3M35A 1NRPH 2VGCC 1C5UA 2G52A 2WPHS 3LKWA 4Y6DA 2XBYA 2CXVA 2ZHWH 1V6DA 2BD4A 4YESB 1P02A 1E36B 4X6MA 1AN1E 1IQHA 5HM2A 3BTQE 1HDTH 2A5AA 4ZKOU 8LPRA 2ANKH 2VH6A 2Y80A 1BTWA 2TGDA 1LQDB 1AD8H 1FY8E 1TNJA 2BDGA 3GCHB 3GY5A 2A7CA 2QA9E 1GI7B 5EPYA 3M5NA 4NFFA 1ZTJA 1ANCA 1Q31A 2H5CA 5DJ7A 3UR6A 4A1TA 3RXIA 1HB0B 4LOYH 3ZVBA 5JDUB 2VWLA 3U98H 2VINA 2Z9GA 4FUHA 1V2PT 1P2OA 1LVYA 4IS5A 3TITA 1LPZB 1XKAC 4X8SH 1OWJA 3ATIA 3SI4H 1P04A 5AHGH 3TJNA 3QTVH 1VGCC 1DPOA 2AS9A 2EI8A 3LONA 3ZZDA 5JBTA 1GWAA 1ZPBA 1MBMA 2C8ZB 1C5ZB 2ZDMA 3UNRA 4NZQA 2VGCB 1C4V2 1O2WA 3SNAA 3ZZ9A 2PGBB 3HKJB 1WQSA 1O3JA 2ZPSA 1VITF 3SUFA 1CE5A 5GWZA 1UTOA 3E90B 3S9BA 2F91A 4JK6A 3RXGA 1MTWA 3VGCC 1VR1H 4Y76A 3V0XA 1NU7B 1OWIA 4MLFB 1GL1A 6GCHF 1EZQA 5ESTE 1BRCE 1IQIA 1V3XA 2P16A 2GCHF 1H9HE 1OS8A 2AYWA 5A09A 3UUZA 4CBNA 1O3EA 1O3CA 1T4UH 1V2JT 3PM3A 1V2MT 1BTXA 4O3UA 1C2LA 1O3DA 4JYVH 1L2EA 3LGWA 3ODDA 5FBIA 1ETRH 1B0EA 1QL9A 1J17T 3MOCA 2F9VA 5DPAA 5C5NA 4D76A 1VGCB 3PB1E 2R9PA 1AY6H 1SHHB 1SQTA 1KXDA 2ZIQH 4GHQA 1P0SH 2AERH 1YPJH 2BY5X 2YNBA 1IQNA 1GBKA 2KAIB 3U69H 1MUEB 4AZ2B 4ISOA 2SNVA 1C2IA 1MKXK 3Q76A 2Z3EA 1JWTA 5F8ZA 1SSXA 4CR5A 1CA0C 4I8HA 3SU3A 3URCA 3ENSB 4XOJA 1GBJA 5LH8A 4ZKRU 2O9QA 4IC6A 1MMJN 4MNXA 4GCHF 5ETXA 4ZH8A 3M5LA 1QB1A 4YO9A 5JPMH 2FWWA 2HWLB 2I6QA 1C2KA 4X1NU 1O38A 1QL7A 5LPFA 2QXJA 1OWHA 4MDSA 3M5MA 2J94A 2P8OC 2NWNA 3BIUH 1O2ZA 1C1QA 2Q6DA 1P2QA 1SGIB 2A32A 4CRBA 5DP9A 1BTZA 1DS2E 3EA9A 3IG6B 1XVMA 1A5IA 1GVLA 6LPRA 1OWEA 1TX7A 4X1QU 1ZRBA 2P93A 4IC5A 2HRVA 2V6NA 3GY4A 1OPHB 5HM9A 1DITH 1BHXF 2SGFE 3QK1A 1WV7H 4MNVA 2OQUA 1PYTC 1DWDH 1HAGE 1H8DH 5C3NA 1FN8A 1NT1A 1CA0B 2GP9B 3A85A 3DA9B 1HRTH 3SV9A 4R8TB 1FAXA 1QJ6B 2AH4X 2P95A 2ODQA 3B23B 3L6PA 1SBWA 4WVPE 1IQMA 1GBHA 1Z8IB 1GJCB 5FXLA 2P94A 4BTIB 1IQJA 1IQFA 3A7ZA 3ATLA 2QXGA 2P8OB 2D8WA 1HJAB 5E0HA 1D3QB 1JXPA 1GI0A 3QGJA 5DG6A 3GDVA 1EOLA 3KGPA 3PYHA 3V3MA 5L30H 3MH7A 4ISNA 2CJIA 1A61H 3ZZ4A 4Y7BA 1MZAA 5GCHG 2XCNA 3T27A 2A31A 3RU4E 1HAYB 4IN2A 1DANH 2THFB 2WYJA 1Y3VA 1GDNA 5HGGA 3UR9A 5G4BA 3D49H 1GMCF 1DXPA 4JYTA 3SJ9A 3D65E 2HPPH 1BMLA 1LPKB 2ZGBH 2VIPA 2BMGB 1GPZA 1INCA 4HFPB 1W13U 1V2ST 4XBDA 1TMUH 4U2WA 2CGAA 1TRYA 1GCDA 2TRMA 3FP8E 1MH0A 1JIRA 2KAIA 3NZIA 4AN7A 4DOQA 4CRAA 1GL0E 3SHCH 1W7GH 3LGIA 1TX6A 3BSQA 4YT6H 1ZHPA 1P03A 3A87A 3EGKH 1GBCA 1A7SA 3SV6A 1C5RA 2ANYA 3U8OH 1C1PA 1RIWC 1TE0A 2HNTF 4ESTE 1GHYH 2OCVB 4FUJA 1O2MA 4AYVB 2CN0H 2FTLE 2BY8X 1EASA 1D6WA 1TGNA 4OS5A 2G8TA 1S81A 3M7UA 1CHOG 1GG6C 3FP7E 4ZUHA 2ZQ1A 2P3UB 2TGAA 1ELVA 2ZEBA 1TBRH 3UWJH 5L2ZH 3RXJA 2O8MA 1EPTA 2EI6A 3RU4D 1A3BH 1QY6A 2PUQH 5GXPA 1YP9A 1O31A 2G00A 1ANDA 1FUJA 1GHXH 1YCPH 4Y7AA 2WPIS 1CA8B 1DOJA 1NFYA 3MNXA 5E2PA 3SNEA 4ASHA 4Y8YA 2ZHFH 2GVFA 1F2SE 2ZPRA 3BV9B 1W0ZU 3KIDU 2C3SA 2D26C 2EC9H 1HUTH 3T26A 1QTFA 2BDAA 3SNDA 1GBAA 3QUMP 4WWYA 3TIUA 1A4WH 1FZZA 1D3TB 4GPGA 4KTSA 2IPHA 1QQ4A 1GHAG 4A92A 2FI5E 2XWAA 4B2CA 5F6MA 1K1LA 3T62A 1MQ5A 1SGQE 1ZHMA 2QY0B 4FUDA 1C1SA 2FOHA 2OC8A 3LGUA 2BQ6B 1Z71A 4IW4E 1A0LA 2FPZA 1KXAA 3OU0A 6ESTA 5DP5A 2FP7B 2BDBA 1V2VT 5DP6A 3ZZCA 1BZXE 1Q3XA 1YPEH 1NFXA 4I33A 2R2MB 2XBVA 1GJ6A 1AUTC 2G5NA 1MAYA 1GCTB 4X8UH 4FVDA 2C90B 3S0NA 3V13A 1SOTA 2Q1JA 3GY6A 1Z8GA 1O3KA 2IJOB 1MTSA 1AWFH 5DKMA 3SORA 4I32A 1A5GH 3EA7A 1ANBA 1UCYK 1FJSA 2GCTC 5C5OA 1EJAA 1LPGB 4ABIA 1JRSA 3ZV9A 1NESE 1O3FA
chains in the Genus database with same CATH superfamily
1KIGH 2UUJB 4UFEH 4RT1A 3O8DA 1BMMH 5F8TA 4TY6A 2IJD1 4XDEA 3MH4A 1QL8A 3WWBA 2SGEE 3NXPA 4DVAU 3KYGA 3PMAB 4ACAA 3RUOA 1E38B 1F0SA 1XUGA 2QAAA 5E0GA 1MTVA 3B8JA 4ZCNA 3SGBE 3L3TA 4H4FA 4X2WA 4JZ1A 4DT7B 5B6OA 1EXFA 2TIOA 1L4DA 1ELEE 1ZZZA 4FUGA 3MMGA 1O33A 2XW9A 2ZP0H 1LMWB 1HAPH 2FI3E 1O3NA 4BNRA 1TNHA 1ZPCA 2UUYA 3MU4A 3SV2H 2DE9A 1O39A 3RLWH 3K6ZA 6CHAC 3RMLH 2Z6BD 1KDQA 1WQVH 1BUIA 1P10A 1AWHB 2PR3A 3AASA 1TGTA 3ZZ7A 2BDIA 2PWXA 1G37A 1VCWA 3M3VA 3QZRA 1SFIA 1GBTA 4AFZA 9ESTA 1SI5H 2DE8A 3SNCA 3WY8A 1D6RA 1KTSB 2PP6A 1XMNB 3K65B 2TBSA 3BN9A 2OBQA 2J92A 2HPQH 3LC3A 4ABEA 3VG8A 1F5RA 1IQGA 1XXFA 3FZZA 3MU1A 5PTPA 1G2LA 1U6QA 1YC0A 2OLGA 1TX8A 1XUHA 4GLYA 1BMAA 1SHYA 1JOUB 4XE4A 1PPHE 4YLUA 1ETTH 1N6YA 2OC0A 2FIRH 1SKYE 1MKWK 1DLEA 2ODPA 3Q77A 4OS4A 1C1OA 4FU9A 1QRWA 1A5HA 1UTPA 3U1JB 2QCYA 2H5DA 3L33A 2BZ6H 4Q7XA 3F1SB 3ZZ6A 2Y5HA 1DFPA 2R0KA 4D8NA 5DK1A 1TA2A 1KYNA 1V2KT 2FMJA 1C2FA 3E8LA 1GGDC 4NWKA 1WSSH 2OINA 1T32A 5FBEA 4CREA 4D7FA 2PTCE 4I8LA 1OKXA 1QURH 1CU1A 2KCAA 3OFND 1PQAA 1WAYB 1ARBA 3E16B 1BBRK 3A86A 1XUFA 4WMDA 1NRSH 2F9PA 3QO6A 4YT7H 2G5VA 1GJ4H 5AFYH 5I46H 1O34A 1FNIA 5AFZH 2LP6A 1V2LT 4XBBA 1HNEE 1Z8JB 2ZU3A 4MG3A 3ZVDA 3QDZB 1C1MA 1YPLH 5TCCA 1TGSZ 4WMEA 1GJ7B 2CV3A 1TALA 1TONA 4CRDA 2TPIZ 1EAXA 3LGVA 5E8EH 1O35A 2VVVA 2P3TB 1HJ9A 4XD7D 3SUGA 4YZUA 3I78A 1XUKA 1K1OA 3U8TH 1A3EH 3GCHC 3DSGA 3SJKA 1P2MA 1PPFE 4FU8A 3PLBA 1AI8H 3UTUH 2WUCA 1ZPZA 3ATMA 1L1NA 3A7YA 3ZVFA 1SGFA 4OM9A 2F4LA 4RKOB 1W3CA 1Q2WA 1GGDB 4OS2A 2AIPA 4CR9A 2RDLA 5C1UA 4TY7A 4WH8A 4GVUA 1V2WT 5T6DA 5FPSA 1G32B 4SGAE 4TYDA 4MPXA 2ULLA 4X0WU 2ZFRH 5DGJA 4LXBH 3TJVA 3ZVGA 4MQAA 1GMHF 1DUAA 4Y8ZA 1DSUA 4K69A 5BRRE 2PFEA 4K8YA 3ZVCA 4IGDA 2A45B 1G9IE 2ZC9H 5GCHF 3RXDA 3VB4A 4AYYB 5F03A 1V2QT 1KXFA 1T4VH 2FZZA 2GX4A 4PROA 3U1IB 1UVOA 5CDFE 2VB0A 2RCEA 5EQQA 2Y81A 4I7YH 3SNBA 2AEIH 4CHAB 3FAOA 4F55A 1CSOE 2B5TB 2BHGA 4K3JA 1HYLA 5EJZA 2ZU4A 2XRCA 3UOPA 4JMYA 3BEUA 1HPGA 2ZF0H 2PTNA 3VEQB 2UWLA 1Y3YA 1LHGH 4HGCA 2J98B 3A8AA 1S0QA 2BLQA 3KQEA 1EOJA 3P8NA 3PTNA 4CH2B 4A7IB 2J4IA 5T3HA 1MCVA 2BX4A 4Z6AH 1L4ZA 1FIZA 3MNBA 2BLWA 5FAHA 3H7OA 1GDQA 3SU4A 3LDXH 2J38A 2PGQB 4B74A 1GBDA 1TBZH 3A7VA 2GDEH 2YMSC 1H9LB 1UCYE 1W0YH 4Y10E 1CQQA 1FX0B 1GJAB 1E0FD 1OSSA 4FXGH 1NRRH 1RTFB 4TSFD 4ZKNU 1MU8B 1ZMLA 2HALA 7KMEH 1GI8B 2AMQA 2B7DH 4M9FA 1CHOF 3RXQA 1ZTLA 4BTUB 1KTTB 1SR5C 3NRLA 1C2DA 5K0HA 1DT2A 1T8MA 1E37B 1S6FA 2VVCA 1AVWA 3CENA 1D3PB 2A4QA 1J14A 4XBCA 4WXVA 3ZZ3A 4I8KA 3LPRA 1QB6A 3FZDA 1K1MA 2QXHA 3HKIB 4MNWA 1A46H 2Y7XA 2SGAA 2WPMS 3M37A 2Y5FA 4ABHA 2GV7A 1C4U2 5C17A 1O2LA 3MHWU 2A0QB 3MO9A 3PV4A 1AB9B 1UJ1A 1CGHA 2AFQB 2AHME 1YM0A 2FOEA 1GJ9B 1YY3A 1AU8A 1DWBH 1A0JA 2C8XB 5FL7D 3E1XB 1HAVB 2VWMA 4YLQH 1GHAF 2BTCE 3V7TA 2A5KA 2WPJS 1AZ8A 4BAHB 1FPCH 1BMFD 1W0JD 2YMSB 2Z9JA 4XFQA 3LU9B 1O5CB 1UTKA 1QBNA 3M7QA 2VVUA 1SGCA 5GIBA 2WINI 1AVXA 2WV5A 1O3HA 2BLOA 1O5FH 4ABDA 2PW8H 1IAUA 1T8LA 5C1XA 1A2CH 4DIIH 1QBOA 2DUCA 3KL6A 1O37A 1S85A 1EP6A 1RD3B 3A83A 1C1NA 1GMDG 1C5XB 1Y59T 2JKHA 5HMAA 3RC4A 5C0TA 4UONA 2V0BA 3DSOA 4KELA 1TGBA 1EKBB 5K7RA 4FU7A 2ZCLP 1XX9A 1X7AC 1D4PB 1Y3XA 3OY5U 1G3BA 4ABBA 1P2KA 4AGKA 2W6ID 1YPMH 2VIOA 3TGKE 2AGGX 1SG8B 3URDA 1EZUC 2ZG0H 4B75A 4DW2U 1EPTB 1XVOA 1RS0A 1HJAC 3UREA 3S9AA 1C5OH 3VFEA 1S6HA 1OYQA 1UHBA 1WTHD 1LHCH 3VB3A 2J9NA 3FFGA 1BJUA 1F0TA 4FUEA 3AK5A 1O2OA 1P57B 1NROH 3SU6A 3GICB 4X1RU 1JBUH 3SV8A 3VB6A 1QIXB 4Q7ZA 4AB8A 1MTNB 2EA3A 2XC0A 5E0JA 1MCTA 1SLUB 3E0NB 4LZ1H 1V2TT 1UTLM 3CNRA 1L1GA 1TRMA 3A7TA 3GCTG 3OSYA 1G2MA 3CS7A 2Z3CA 2QIQA 3STIA 1ELGA 3GS9A 2F43B 3A8BA 3CS0A 3RXUA 5KGOA 2C8YB 2NU1E 1ABIH 1TWXB 3P92A 1C5MD 2ZFFH 4B2AA 1K21H 1SL3A 2BVSH 1YF4A 2Y5GA 2SFAA 1O2HA 1SGDE 2TGPZ 2CF8H 5GDSH 5GPIB 2ZGJA 3RDZA 2FX4A 2HOBA 3ATKA 2IOTA 1DY8A 1O5DH 2F9UA 3LIWA 8GCHG 1SGNE 1W10U 4Z1MD 4SGBE 3GDSA 2BQWB 1VKYA 1CGIE 3R0FA 1K1PA 3BTKE 1D3DB 1UTJA 2RG3A 2FTMA 2BDCA 2Z7FE 3T29A 1ORFA 3TK6A 2ODYB 2PKAA 4UFFH 1P2NA 1GMHG 4UFGH 3RXEA 1T31A 3CP7A 1UVUH 3P6ZB 1YPHE 5FCRA 2IPQX 1C9TA 2A7JA 4ZKSU 1LVOA 1OOKB 3TH2H 5DP8A 2J5UA 2Q6FA 3A88A 1K9OE 1VJ9U 2PHBA 4Y0ZE 4ABAA 1XUJA 1GVZA 4NIXA 5EW2H 4ZHAA 1THSH 3W94A 1C2EA 3PO1B 1THPB 3KQCA 1HAVA 1SQAA 3MNSA 4K5ZA 2FOFA 2F9BH 3F9FA 3RXVA 1P8VC 4INLA 2BB4A 5FPTA 3SU2A 1B0FA 3LH3A 1NU9A 1NTPA 3MWIU 3RMOH 5EJ1A 3PRBA 2GT8A 3FOAA 3KQ5A 1W12U 4GUXA 3NKKA 3KQDA 2Z3DA 1LCYA 4B2BA 3RXTA 4AG1A 3AAVA 4YOJA 4P02A 4B71A 1FY3A 2F3CE 4AFQA 2EQNA 1AHTH 3SW2B 4CH8B 1O3OA 4TPYA 1AE5A 2WHXA 4KGAA 3BTME 2CMYA 2OXSA 4HI3A 1FY1A 2J34A 3UPEA 4JZDH 1AKSB 1KDQB 1TYNA 1A1RA 1BOQA 3RXHA 2BY9X 1O3LA 4DT4A 1K2I1 4BAOB 1ELBA 1O2UA 3DSPA 1UVPA 3BTGE 1Y8TA 1GBIA 2A7HA 2WYGA 2GZ7A 4ABGA 4WXIA 2F9NA 2WPKS 3DT0H 5E2OA 1BA8B 2ZQ2A 1GCTC 1BB0B 3E91A 1ELFA 1VCPA 2XNDD 2ZHQH 2ZDNA 3RXMA 4GSOA 3TK9A 3RC6A 4BOHA 1OWKA 1ARCA 3M5OA 1ZJDA 2KZ4A 1M9UA 3ATWA 2ZFQH 4FUIA 1S0RA 4TWWA 3ELAH 4ZHMU 4ASUD 3PWCA 4NGAH 5CHAB 5C2ZA 1P2IA 4GAWA 4AOQA 3TJUA 8KME2 3LGTA 1ELDE 2W3IA 1SLVB 4I8GA 1QRXA 5C94A 3K9XB 3HK6B 4JZEH 3KYFA 1WBGB 1ZLRA 3ZVEA 1C1TA 1GI3A 1E34B 1H9IE 3BTWE 2QYIA 1F5LA 1K1IA 1UVSH 2ZCHP 4E7RG 1SGFG 1GI9B 3P17H 3PV5A 2H9TH 1MD8A 3N7DA 1YLDA 2CHAB 2ILNA 3KF2A 1GJBB 2BXUH 4AORA 1CBWC 2JH6D 4X6PA 1WOFA 2FOBA 1KMHB 1FN6A 5JYIA 3ZZ8A 1ESAA 2A2XH 2RA0A 1NFWA 1HBTH 3M61U 3U8RH 4ACBA 1ID5H 1HCGA 2D1JA 3MI4A 1C9PA 1PPGE 3GDUA 5A0CA 1IHSH 4NIVA 3GCOA 1O2QA 4RI0A 2HLDD 4HG6A 2HNTE 1DWCH 3STJA 1IOEA 1NRNH 1W2KH 2ZCKP 3SBKA 1QQUA 1HFDA 2FS8A 2SGDE 2W5EA 4Q7YA 1ZGIA 1C2HA 4YM9A 3D23A 2JH0D 4VGCC 2BYAX 5A0AE 4O3TA 4D9RA 1VITH 2GGVB 2UWPA 1HIAA 2WPLS 3F68H 4A5TS 1K0HA 5EU8A 1C5PA 3A8CA 5T6FA 3BTFE 1O2SA 3RM0H 1Y3UA 1ETSH 5DSFA 3ZZBA 2KR7A 4FUFA 5JB8S 3RXAA 1CBWB 3SQHE 3ITIA 1GHWH 2SGQE 1TBQH 4ABJA 5FX5A 2XBXA 4OGXA 1RTKA 1YCPK 3RXCA 5JBBS 4MPVA 1FDPA 1CO7E 2VNTA 1TA6A 4NSYA 1AKSA 3DFLA 4JZIA 3GY8A 4BAQB 4X2YA 5EQRA 1O5GH 1AVGH 1DVAH 3LT3A 4LZ4B 3SJIA 2FOCA 1P01A 3FO8D 1C1RA 1KXEA 3QGNB 3FANA 1NC6A 1NN6A 4DY7B 1O5AB 1TMTH 1TGCA 2HGTH 3RM2H 4B1TA 1NS3A 2XNIA 1O2NA 1Z8RA 2FXRA 4NA8A 3ZZAA 2PKSB 3MU8A 3Q3XA 2ZKSA 2W6JD 5EXMA 1Z6JH 3MYWA 4VGCB 7GCHG 1ANEA 3UWIA 4INKA 3BTHE 3RXKA 5J4QA 3M7TA 1IQKA 4Y71A 2KCYA 1J16A 3C1KA 1UK3A 1BMNH 2OTVA 2GJGA 1F7ZA 1AGJA 1GMDF 2EY4C 1AUJA 2RFKC 4ZMAH 3SZNA 2BVXH 5EPNA 1P12E 3UB0A 4A1VA 1GHBG 3UQOA 3AAUA 1HAHH 3I29A 4WJG2 4BXSA 1BRBE 4RT0A 1Z1JA 4Y8XA 1FPHH 2V3HH 4J2YB 4FOUC 5IYTA 3T25A 3EE7A 2C93B 1B7XB 1V2RT 1LHEH 1O2IA 2FI4E 3P8GA 4X1PU 3S7HB 2ZNKH 3NCLA 5DP7A 1UW7A 2ASUB 1KLTA 2GT7A 2AIQA 1PPBH 1TB6H 4U30A 2ZECA 4DJZB 1C2GA 3KNXA 4B76A 2ESTE 2GMTC 1ZMJA 1TPSA 1C1VH 3BTTE 1RTLA 3GISB 4BAKB 1MQ6A 1GBBA 2ZWLH 1ZSJA 1S82A 1TAWA 1QA0A 1EB1H 1TNIA 1DM4B 2RA3A 2UWOA 2H9HA 3GYLB 1HAOH 5TCAA 1TLDA 3MTYA 4X2VA 1FV9A 1EAWA 1ZSKA 3GCTF 4MTBA 4HZHA 1Y5UT 2BOHB 2FODA 2BD7A 2LNCA 1SB1H 1DY9A 2Z9IA 1FLEE 1YPKH 2ZZUH 2QF3A 4CHAC 2RDEA 2ZTZA 1TOMH 2XTTB 4IBLH 2BVRH 4OS6A 3RXOA 1PQ7A 2M2AA 5L2YH 1K1NA 1SVPA 2STAE 3QX5H 3RP2A 1HAIH 3MH6A 4JYUH 1O2PA 1FMGA 1QZ8A 1BRAA 3PWBA 5IK2D 1FY5A 2GD4B 8GCHF 1KLIH 1V2UT 2GZ9A 2K1QA 2OC1A 2QC2A 4K2YA 4BTTB 3KQBA 4AX9H 1BTHH 2VH0A 3TGIE 3P70B 3IITA 4ZXXH 2BX3A 4NG9H 4O97A 1O3IA 4X8VH 1TQ0B 2CF9H 3SZEA 4AGJA 1LHDH 3MH5A 3SGQE 2KFWA 1EZSC 4KTUA 2G4UA 3PMBB 4THNH 2GMTB 1H8ED 1LHFH 1YLCA 4JCNA 3SU0A 1TNGA 2FS9A 3RXPA 2G81E 2FYQA 1GVKB 1GBFA 3F9GA 1ELCA 5EODA 5ABWA 2ZGCA 3GY7A 1UO6A 2Z94A 3KHVA 2BD5A 1EJNA 4NA9H 9LPRA 2XWBI 1AZZA 4M7GA 3SOSA 1Z1IA 3NWUA 5CE1A 4FUCA 2BY6X 1EQ9A 1ZYOA 4RN6A 1YCPM 1B5GH 3BIVH 1AE8H 4JZFH 1UHBB 2Z9KA 3PTBA 2FEQH 5DP4A 5DO4H 1DICA 3A82A 2K0QA 2XCFA 3OEHD 1O5EH 1O3GA 2A4GA 4B6EA 1GI2A 2KM0A 3TH3H 5HYOA 3SO3A 1BQYA 4X1SU 1AFQC 1N8OB 2BOKA 3RXBA 1AB9C 1GI5A 2Q6GA 1EUFA 1ACBE 1JIMA 4NWLA 2ZA5A 4Y79A 4BANB 3A89A 2ANWA 3SQEE 1ESBA 1NM6A 2B0FA 1N1LA 2B8OH 3K6YA 5EGMA 2GDDA 5A0BA 3RU4T 1GJ8B 4A1XA 2QF0A 1MKXH 2ZGXH 4U32A 3ZVAA 2A4OA 1FY4A 3N99A 3OE7D 2G4TA 1TPPA 2ZTYA 5EJLA 1TMBH 1H1BA 1GBLA 3VB5A 4Y0YE 1O5BB 1HXEH 1H4WA 1O2RA 1RGQA 1LDTT 3E6PH 3GYMA 1MD7A 2ZU5A 1O36A 2J95A 4I31A 2TGTA 5EG4A 4OS7A 3A8DA 3ZYEA 1BTUA 1DX5M 2PKAB 1ELTA 4Z0KA 1S6LA 4ZROA 2H1UA 1AO5A 2AGEX 2UUFB 1OP0A 3HGPA 2XOKD 2H6MA 5A8XA 1P05A 3BEFB 1ZHRA 3KN2A 3QZQA 1AFQB 3T5FH 3EYDA 1W0KD 1EAUA 3LC5A 5KEDA 1XKBC 1KXBA 4BAMB 2PUXB 4NA7A 3MU0A 1Y3WA 2A5IA 2YOLA 1DSTA 3TGJE 1EPTC 1SMFE 1SLWB 3ZZ5A 4OS1A 5EXNA 4ZXYH 2BXTH 1FAKH 3Q3KA 4D7GA 4J1YA 1MTUA 1HAZB 4R0IA 4HTCH 1MTNC 3K2UA 4Q80A 1EX3A 3H7TA 4I8JA 3EE0B 1K22H 3DD2H 1TIOA 1G36A 1TABE 3A7WA 1PYTD 1NFUA 5TJXA 1TFXA 5JBCS 2QXIA 1O32A 2A1DB 4WH6A 5DP3A 1GI6A 1TNLA 3O8BA 4AC9A 2VJ1A 2GTBA 2VWOA 2SGPE 1HV7A 4NCYA 2J97A 4IN1A 1O2YA 2OP9A 4GHTA 3F6UH 1ZSLA 2UUKB 1TNKA 5EXLA 1C5YB 3ZV8A 1HAXB 3NK8A 2V3MA 3D62A 3F2HA 3DUXH 1GBEA 3TLOA 3SJ8A 4E7NA 3VGCB 3UY9A 2ZU1A 2BDYA 3I77A 3OTJE 1WXRA 1CHGA 1O2XA 3OY6U 1GDUA 2HVXA 1E79D 4RSPA 1ELAA 4YOGA 1W7XH 2FM2A 1J8AA 3BF6H 3UQVA 2LELA 2QF5A 1H8HD 2I6SA 1EJMA 4AG2A 5GNDA 3OYPA 3TNTA 2VIDA 3AW1A 1ABJH 1BIOA 3QN7A 1SFQB 2W26A 1HJ8A 2V3OH 2AMDA 1C5VA 2BDHA 4NFEA 1L0ZA 1HGTH 4YTAA 3QLPH 4U01A 1BBRE 3PO1C 4K60A 3RC5A 1HLTH 1PPEE 2OBOA 4K1EA 2NU3E 2Y82A 2PV9B 3LH1A 3SN8A 1W8BH 1SQOA 1C5TA 1GI4A 2LPRA 3UNSA 4UEHH 1P09A 2QGRA 3A81A 3RMNH 1O3MA 1C1UH 4AFUA 3BTEE 1EP5A 2JH5D 1EFRD 1D9IA 1WDIA 1JRTA 2ZFPH 4INHA 2FDAA 2ZO3H 1CGJE 1QNJA 1WTGH 3H09A 2BQ7B 4DG4A 2XBWA 1BT7A 2ZHDA 3VXFH 3RXRA 2IN2A 2BD3A 3S69A 1BTYA 1EZXC 1GBMA 1ZTKA 1QGFA 3ZYDA 1RRKA 4CRGA 3Q00A 7GCHF 2XC4A 2ZFTA 2NU4E 1MU6B 1O30A 2F83A 3SUEA 5EOKA 1NO9H 2H9EH 3V12A 3P8OA 1SOZA 3DFJA 4ISLA 3ZIAD 3UFAA 4YOIA 1SGYE 2FOAA 4X6NA 3H5CB 1GHBF 3SU5A 4ZHLU 2H2ZA 4I86A 1V2NT 2HVYB 1C5NH 2F9OA 1XM1A 1ZOMA 1F0UA 4F4OC 1QFKH 4F49A 5L6NH 1PQ5A 1BDAA 3QTOH 1COWD 4UD9H 2KX4A 4Q2KA 1NRQH 5H4IB 1YWUA 1NBME 1PPZA 1HIAB 2ANMH 1S84A 2Y7ZA 1P3CA 1QRZA 2R3YA 3FKSD 2YNAA 1IHTH 5ESBA 1BCUH 4DGJA 5CHAC 1S83A 2ZU2A 3MU5A 3SV7A 5FX6A 5LPRA 5FHTA 1BITA 3NUMA 1CT4E 2P59A 3E3TA 1AQ7A 5CMXH 1GI1A 8ESTE 1UMAH 1VJAU 3OEED 1G30B 1G3DA 2AMPA 3WWFA 4BXWA 7LPRA 3W95A 4NIYA 1C5SA 4FVBA 5HKKD 1LKBA 2Y6TA 2V35A 4ABFA 1AFEH 3OX7U 4X8TH 1KY9A 1CVWH 4CBOA 4UFDH 2OC7A 3N7OA 3P8FA 3U9AH 2KCOA 4H6TA 1RFNA 1QHRB 1UCYH 1Z7KA 1OXGA 1KLJH 2ZPQA 2ZDVH 3UAIC 1GHZA 1YKTA 2CHAC 1MZDA 2ZFSA 5EQSA 2FO9A 1ZJKA 1C5QA 5I25A 1UK4A 3F9HA 2AGIX 4MVNA 1LVMA 1P11E 3KEEA 4WY3A 5LPEA 1QCPA 3M3TA 4MNYA 2FOGA 3PLPA 3F9EA 4K8BA 3MO6A 4XRNA 4CRCA 1IQLA 2ALVA 1SGTA 3TU7H 1J9CH 3BTDE 4YXWD 5IDKA 4MPUA 1LTOA 2OQ5A 1VITG 4XSKU 3O8CA 2WUBA 5FPYA 3VXEH 1LQEA 1IQEA 1J15A 2GKVE 2NU0E 1G3EA 1NBMD 1UTNA 3S9CA 1GHVH 3AVZA 3A80A 1TQ7B 3F2FA 3NPSA 3AW0A 3SI3H 6GCHG 3HK3B 2VIQA 4UE7H 1Y5AT 2QN5T 3FVFB 4H6SB 2GCHG 1T8NA 3QWCH 3TVJB 5DN6D 1OWDA 4DIHH 1C5WB 1PQ8A 1UK2A 2BD2A 2C4FH 2R0LA 1QJ7B 4NSVA 1AIXH 1P9UA 5F53A 3PLKA 1O2JA 3GY2A 1O2TA 1HXFH 3MFJA 2JIZD 3U28C 1C2MA 5F8XA 1LVBA 1RIWB 3EA8A 1GJDB 4NIWA 4NZLA 1BJVA 1OYTH 1ZR0A 3SYJA 4CRFA 5A2MH 1YBWA 5J4SA 1FQ3A 5C0UA 1GG6B 2G51A 5C67A 1XXDA 2CK3D 4A6LA 1PJPA 1YPHC 1VZQH 1MKWH 3UNQA 1QR3E 3HGNA 3SU1A 2QV1A 2PKSC 1DWEH 2FOMB 3S7KB 3TH4H 1EAIA 3M3SA 4GCHG 1WCZA 2BY7X 2JDID 3HPTB 4WMFA 1YYY1 1A0HB 3JZ2B 4X2XA 4Y11E 3M36A 1Y5BT 2BD8A 2FLRH 1AMHA 3A7XA 1RXPA 3EAJA 1O3PB 1P9SA 1PFXC 1FXYA 1RJXB 1FI8A 2B9LA 2EI7A 2Z9LA 2OUAA 1SC8U 5A8ZA 4O03A 1W11U 1ZMNA 1CT2E 1ESTA 1O3BA 3RXSA 2XC5A 4O9VA 1F92A 1JMOH 1C5LH 2ALPA 1DXWA 1C1WH 2R2WU 3BG4C 1LO6A 1BBRH 2BLVA 2W3KA 2ZDKA 2C8WB 1FIWA 1NPMA 2SNWA 1O0DH 1THRH 4QT8C 4B73A 3C27B 1DLKB 3HATH 1W14U 3RLYH 1DDJA 3MO3A 2FX6A 3SHAH 1OP8A 5EW1H 1K28D 3KCGH 4DURA 4ZAEA 3ODFA 2P3FH 1GJ5H 3O8RA 4E05H 5AF9H 5BPEA 1SGPE 4DCDA 2WZQA 2O8LA 1SPJA 2GCTB 4FUBA 2VIWA 1QA7A 4ISHH 2W7SA 1DE7H 7ESTE 4IMQA 3PRDA 4AFSA 1YGCH 2ZTXA 1SGEE 1SLXB 1YPGH 2O8UA 4IMZA 1H8IH 4WF8A 1UTMA 3T2NA 3UIRA 3TJOA 3VPKA 1K1JA 4AB9A 1OP2A 4JK5A 4MPWA 1OX1A 2VIVA 3BG4B 3P95A 1TPAE 1QJ1B 1E35B 3BG8A 1BHXB 1F5KU 2OD3B 3R3GB 3A84A 1C2JA 2ZHEH 5A8YA 3LGYA 4OGYA 4KP0A 2VU8E 2BZAA 2STBE 5AVDA 2FESH 2PSYA 3GY3A 3SGAE 3DCLA 1BRUP 2JETC 1EB2A 3RXFA 5GJ4B 3DHKH 1QBVH 2PSXA 1ZGVA 1P2JA 5C1YA 1GMCG 2WV4A 5SGAE 4RKJB 2EEKA 3LOXA 2QF4A 3E0PB 1MABB 3B9FH 1DUEA 3PMHB 1TOCB 2D2DA 3EQ0H 3MNCA 3N7EA 3T28A 3TNSA 6CHAB 3LJJA 1NZQH 4E06H 2FLBH 1PPCE 1FONA 3EDXB 2W7UA 4K1SA 2GV6A 2R3UA 5CHBA 5T6GA 4KTCA 5C20A 1MAXA 3TPIZ 1VCQA 1UTQA 3UOUA 2WSSD 4KKDA 3G01A 4UDWH 2ZI2H 2A2QH 1NY22 3FP6E 2ZDLA 2BM2A 3BEIB 1O3AA 2ZGHA 1S5SA 1QB9A 1KXCA 3GOVB 4D9QA 2PLXA 1N6XA 1TRNA 2ZDAH 5JB9S 3PROA 2HNTC 2BD9A 5FCKA 2FYRA 2J2UA 3ESTA 3VB7A 1KSNA 5LGOA 3RMMH 1N8OC 1P3EA 1Z6EA 2G55A 2HLCA 3RXLA 4ISIH 4TWYA 1V2OT 1UVTH 4K1TA 2JETB 1O2GH 1MBQA 1WUNH 1ZRKA 4X6OA 2YMSD 2KCPA 1P06A 1XUIA 1EATA 1T8OA 1F0RA 2VWNA 2M5TA 3JZ1B 4LK4A 1BTPA 3F0OA 5EIYA 1L1JA 1SGRE 2O8WA 2A4RA 1TPOA 3SUDA 3TK5A 3IWMA 2XXLA 3GCNA 1WU1A 1O2KA 1CT0E 4TPIZ 2O8TA 2NU2E 2XYAA 4H42U 3PV2A 3Q3YA 3SJOA 1G3CA 1WYKA 5HXFA 1C4Y2 5JBAS 1LKAA 1O2VA 2GZ8A 3PMJA 3LJOA 1T7CA 2OK5A 3M35A 1NRPH 2VGCC 1C5UA 2G52A 2WPHS 3LKWA 4Y6DA 2XBYA 2CXVA 2ZHWH 1V6DA 2BD4A 4YESB 1P02A 1E1RD 1E36B 4X6MA 1AN1E 1IQHA 5HM2A 3BTQE 1HDTH 2A5AA 4ZKOU 8LPRA 2ANKH 2VH6A 2Y80A 1BTWA 2TGDA 1LQDB 1AD8H 1FY8E 1TNJA 2BDGA 3GCHB 3GY5A 2A7CA 2QA9E 1GI7B 5EPYA 3M5NA 4NFFA 1ZTJA 2JJ1D 1ANCA 1Q31A 2H5CA 5DJ7A 3UR6A 3F3BA 4A1TA 3RXIA 1HB0B 3OAAD 4LOYH 3ZVBA 5JDUB 2VWLA 3U98H 2VINA 2Z9GA 4FUHA 1V2PT 1P2OA 1LVYA 4IS5A 3TITA 1LPZB 1XKAC 4X8SH 1OWJA 3ATIA 3SI4H 1P04A 5AHGH 3TJNA 3QTVH 1VGCC 1DPOA 2AS9A 2EI8A 3LONA 3ZZDA 5JBTA 2VBCA 1GWAA 1ZPBA 1MBMA 2C8ZB 1C5ZB 2ZDMA 3UNRA 4NZQA 1OHHD 2VGCB 1C4V2 1O2WA 3SNAA 3ZZ9A 2PGBB 3HKJB 1WQSA 1O3JA 2ZPSA 1VITF 3SUFA 1CE5A 5GWZA 1UTOA 3E90B 3S9BA 2F91A 4JK6A 3RXGA 1MTWA 2JJ2D 1VR1H 3VGCC 4Y76A 3V0XA 1NU7B 1OWIA 4MLFB 1GL1A 6GCHF 1EZQA 5ESTE 4F48B 1BRCE 1IQIA 1V3XA 2P16A 2GCHF 1H9HE 1OS8A 2AYWA 5A09A 3UUZA 4CBNA 1O3EA 1O3CA 1T4UH 1V2JT 3PM3A 1V2MT 1BTXA 4O3UA 1C2LA 1O3DA 4JYVH 1L2EA 3LGWA 3ODDA 5FBIA 1ETRH 1B0EA 1QL9A 1J17T 3MOCA 2F9VA 5DPAA 5C5NA 4D76A 1VGCB 2L6OA 3PB1E 2R9PA 1AY6H 1SHHB 1SQTA 1KXDA 2ZIQH 4GHQA 1P0SH 2AERH 1YPJH 2BY5X 2YNBA 1IQNA 1GBKA 2KAIB 5HIYA 3U69H 1MUEB 4AZ2B 5B6LA 4ISOA 2SNVA 1C2IA 1MKXK 3Q76A 2Z3EA 2V7QD 1JWTA 5F8ZA 1SSXA 4CR5A 1CA0C 4I8HA 4Q4LA 3SU3A 3URCA 2L74A 3ENSB 4XOJA 1GBJA 5LH8A 4ZKRU 2O9QA 4IC6A 1MMJN 4MNXA 4GCHF 3FN8A 5ETXA 4ZH8A 3M5LA 1QB1A 4YO9A 5JPMH 2FWWA 2HWLB 2I6QA 1C2KA 4X1NU 5KECA 1O38A 1QL7A 5LPFA 2QXJA 1OWHA 4MDSA 3M5MA 2J94A 2P8OC 2NWNA 3BIUH 1O2ZA 1C1QA 2Q6DA 1P2QA 1SGIB 2A32A 4CRBA 5DP9A 1BTZA 1DS2E 3F2GA 3EA9A 3IG6B 1XVMA 1A5IA 1GVLA 6LPRA 1OWEA 1TX7A 3MQKC 4X1QU 2J98A 1ZRBA 2P93A 4IC5A 2HRVA 2V6NA 3GY4A 1OPHB 5HM9A 1DITH 2K8IA 1BHXF 2SGFE 3QK1A 1WV7H 4MNVA 2OQUA 1PYTC 1DWDH 1HAGE 1H8DH 5C3NA 1SQRA 1FN8A 1NT1A 1CA0B 4Q63A 2GP9B 3A85A 3DA9B 1HRTH 3SV9A 4R8TB 1FAXA 1QJ6B 2AH4X 2P95A 2ODQA 3B23B 3L6PA 1SBWA 4WVPE 1IQMA 1GBHA 1Z8IB 1GJCB 5FXLA 2P94A 4BTIB 1IQJA 1IQFA 3A7ZA 3ATLA 2QXGA 2P8OB 2D8WA 1HJAB 3W1EA 5E0HA 1D3QB 1JXPA 1GI0A 3QGJA 5DG6A 3GDVA 1EOLA 3KGPA 3PYHA 3V3MA 5L30H 3MH7A 4ISNA 2CJIA 1A61H 3ZZ4A 4Y7BA 1MZAA 5GCHG 2XCNA 3T27A 2A31A 3RU4E 1HAYB 4IN2A 1DANH 2THFB 2WYJA 1Y3VA 1GDNA 5HGGA 3UR9A 5G4BA 3D49H 1GMCF 1DXPA 4JYTA 3SJ9A 3D65E 2HPPH 1BMLA 1LPKB 2ZGBH 2VIPA 2BMGB 1GPZA 1INCA 4HFPB 1W13U 1V2ST 4XBDA 2WV9A 1TMUH 4U2WA 2CGAA 1TRYA 1GCDA 2TRMA 3FP8E 1MH0A 1JIRA 2KAIA 3NZIA 4AN7A 4DOQA 4CRAA 1GL0E 3SHCH 1W7GH 3LGIA 1TX6A 3BSQA 4YT6H 1ZHPA 1P03A 3A87A 3EGKH 1GBCA 3WW7A 1A7SA 3SV6A 1C5RA 1E1QD 2ANYA 3U8OH 1C1PA 1RIWC 1TE0A 2HNTF 4ESTE 1GHYH 2OCVB 4FUJA 1O2MA 4AYVB 2CN0H 2FTLE 2BY8X 1EASA 1D6WA 1TGNA 3F0PA 4OS5A 2G8TA 1S81A 3M7UA 1CHOG 1GG6C 3FP7E 4ZUHA 2ZQ1A 3OTPA 2P3UB 2TGAA 1ELVA 2ZEBA 1TBRH 3UWJH 5L2ZH 3RXJA 2O8MA 1EPTA 2EI6A 3RU4D 1A3BH 1QY6A 2PUQH 5GXPA 1YP9A 1O31A 2G00A 1ANDA 1FUJA 1GHXH 1YCPH 4Y7AA 5T1VA 2WPIS 1CA8B 1DOJA 1NFYA 3MNXA 4TT3D 5E2PA 3SNEA 4ASHA 4Y8YA 2ZHFH 2GVFA 1F2SE 2ZPRA 3BV9B 1W0ZU 3KIDU 2C3SA 2D26C 2EC9H 1HUTH 3T26A 1QTFA 2BDAA 3SNDA 1GBAA 3QUMP 4WWYA 3TIUA 1A4WH 1FZZA 1D3TB 4GPGA 4KTSA 2IPHA 1QQ4A 1GHAG 4A92A 2FI5E 2XWAA 4B2CA 5F6MA 1K1LA 3T62A 1MQ5A 1SGQE 1ZHMA 2QY0B 4FUDA 1C1SA 2FOHA 2OC8A 5HIZA 3LGUA 2BQ6B 1Z71A 4IW4E 1A0LA 2FPZA 1KXAA 3OU0A 6ESTA 5DP5A 2FP7B 2BDBA 1V2VT 5DP6A 4FETA 3ZZCA 1BZXE 1Q3XA 1YPEH 2WPDD 1NFXA 4I33A 2R2MB 2XBVA 1GJ6A 1AUTC 2G5NA 1MAYA 1GCTB 4X8UH 4FVDA 2C90B 3S0NA 4P00A 3V13A 1SOTA 1YLNA 2Q1JA 2QE7D 3GY6A 1Z8GA 1O3KA 2IJOB 1MTSA 1AWFH 4B6FA 5DKMA 3SORA 4I32A 1A5GH 3EA7A 1ANBA 1UCYK 1FJSA 2GCTC 5C5OA 1EJAA 1LPGB 4ABIA 1JRSA 3ZV9A 1NESE 1O3FA
chains in the Genus database with same CATH topology
1KIGH 2UUJB 4UFEH 3O8DA 1BMMH 5F8TA 4TY6A 4XDEA 3MH4A 1QL8A 2SGEE 3NXPA 4DVAU 3PMAB 3RUOA 1E38B 1F0SA 1XUGA 2QAAA 5E0GA 1MTVA 3B8JA 3SGBE 3L3TA 4H4FA 4X2WA 4JZ1A 4DT7B 5B6OA 1EXFA 2TIOA 1L4DA 1ELEE 1ZZZA 4FUGA 3MMGA 1O33A 2XW9A 2ZP0H 1LMWB 1HAPH 2FI3E 1O3NA 4BNRA 1TNHA 1ZPCA 2UUYA 3MU4A 3SV2H 2DE9A 1O39A 3RLWH 3K6ZA 6CHAC 3RMLH 2Z6BD 1KDQA 1WQVH 1BUIA 1P10A 1AWHB 2PR3A 3AASA 1TGTA 3ZZ7A 2BDIA 2PWXA 1G37A 1VCWA 3M3VA 3QZRA 1SFIA 1GBTA 4AFZA 9ESTA 1SI5H 2DE8A 3SNCA 3WY8A 1D6RA 1KTSB 1XMNB 3K65B 2TBSA 3BN9A 2OBQA 2J92A 2HPQH 3LC3A 4ABEA 1F5RA 1IQGA 1XXFA 3FZZA 3MU1A 5PTPA 1G2LA 1U6QA 1YC0A 2OLGA 1TX8A 1XUHA 4GLYA 1BMAA 1SHYA 1JOUB 4XE4A 1PPHE 4YLUA 1ETTH 1N6YA 2OC0A 2FIRH 1MKWK 1DLEA 2ODPA 3Q77A 4OS4A 1C1OA 4FU9A 1QRWA 1A5HA 1UTPA 3U1JB 2QCYA 2H5DA 3L33A 2BZ6H 4Q7XA 3F1SB 3ZZ6A 2Y5HA 1DFPA 2R0KA 4D8NA 5DK1A 1TA2A 1KYNA 1V2KT 2FMJA 1C2FA 3E8LA 1GGDC 4NWKA 1WSSH 2OINA 1T32A 5FBEA 4CREA 4D7FA 2PTCE 4I8LA 1OKXA 1QURH 1CU1A 1PQAA 1WAYB 1ARBA 3E16B 1BBRK 3A86A 1XUFA 4WMDA 1NRSH 2F9PA 3QO6A 4YT7H 2G5VA 1GJ4H 5AFYH 5I46H 1O34A 1FNIA 5AFZH 1V2LT 4XBBA 1HNEE 1Z8JB 2ZU3A 4MG3A 3ZVDA 3QDZB 1C1MA 1YPLH 5TCCA 1TGSZ 4WMEA 1GJ7B 2CV3A 1TALA 1TONA 4CRDA 2TPIZ 1EAXA 3LGVA 5E8EH 1O35A 2VVVA 2P3TB 1HJ9A 3SUGA 4YZUA 3I78A 1XUKA 1K1OA 3U8TH 1A3EH 3GCHC 3SJKA 1P2MA 1PPFE 4FU8A 3PLBA 1AI8H 3UTUH 2WUCA 1ZPZA 3ATMA 1L1NA 3A7YA 3ZVFA 1SGFA 4RKOB 1W3CA 1Q2WA 1GGDB 4OS2A 2AIPA 4CR9A 2RDLA 5C1UA 4TY7A 4WH8A 4GVUA 1V2WT 5T6DA 5FPSA 1G32B 4SGAE 4TYDA 4MPXA 2ULLA 4X0WU 2ZFRH 5DGJA 4LXBH 3TJVA 3ZVGA 4MQAA 1GMHF 1DUAA 4Y8ZA 1DSUA 4K69A 5BRRE 2PFEA 4K8YA 3ZVCA 4IGDA 2A45B 1G9IE 2ZC9H 5GCHF 3RXDA 3VB4A 4AYYB 5F03A 1V2QT 1KXFA 1T4VH 2FZZA 2GX4A 4PROA 3U1IB 1UVOA 2VB0A 2RCEA 5EQQA 2Y81A 4I7YH 3SNBA 2AEIH 4CHAB 3FAOA 1CSOE 2B5TB 2BHGA 4K3JA 1HYLA 2ZU4A 2XRCA 3UOPA 4JMYA 3BEUA 1HPGA 2ZF0H 2PTNA 3VEQB 2UWLA 1Y3YA 1LHGH 4HGCA 3A8AA 1S0QA 2BLQA 3KQEA 1EOJA 3P8NA 3PTNA 4CH2B 4A7IB 2J4IA 5T3HA 1MCVA 2BX4A 4Z6AH 1L4ZA 1FIZA 3MNBA 2BLWA 5FAHA 3H7OA 1GDQA 3SU4A 3LDXH 2J38A 2PGQB 4B74A 1GBDA 1TBZH 3A7VA 2GDEH 1H9LB 1UCYE 1W0YH 4Y10E 1CQQA 1GJAB 1E0FD 1OSSA 4FXGH 1NRRH 1RTFB 4ZKNU 1MU8B 1ZMLA 2HALA 7KMEH 1GI8B 2AMQA 2B7DH 1CHOF 3RXQA 1ZTLA 4BTUB 1KTTB 1SR5C 1C2DA 5K0HA 1DT2A 1T8MA 1E37B 1S6FA 2VVCA 1AVWA 3CENA 1D3PB 2A4QA 1J14A 4XBCA 4WXVA 3ZZ3A 4I8KA 3LPRA 1QB6A 3FZDA 1K1MA 2QXHA 3HKIB 4MNWA 1A46H 2Y7XA 2SGAA 2WPMS 3M37A 2Y5FA 4ABHA 2GV7A 1C4U2 1O2LA 3MHWU 2A0QB 3MO9A 3PV4A 1AB9B 1UJ1A 1CGHA 2AFQB 1YM0A 2FOEA 1GJ9B 1AU8A 1DWBH 1A0JA 2C8XB 3E1XB 1HAVB 2VWMA 4YLQH 1GHAF 2BTCE 3V7TA 2A5KA 2WPJS 1AZ8A 4BAHB 1FPCH 2Z9JA 4XFQA 3LU9B 1O5CB 1UTKA 1QBNA 3M7QA 2VVUA 1SGCA 5GIBA 2WINI 1AVXA 2WV5A 1O3HA 2BLOA 1O5FH 4ABDA 2PW8H 1IAUA 1T8LA 5C1XA 1A2CH 4DIIH 1QBOA 2DUCA 3KL6A 1O37A 1S85A 1EP6A 1RD3B 3A83A 1C1NA 1GMDG 1C5XB 1Y59T 2JKHA 5HMAA 3RC4A 4UONA 2V0BA 4KELA 1TGBA 1EKBB 5K7RA 4FU7A 2ZCLP 1XX9A 1X7AC 1D4PB 1Y3XA 3OY5U 1G3BA 4ABBA 1P2KA 4AGKA 3TGKE 1YPMH 2VIOA 2AGGX 1SG8B 3URDA 1EZUC 2ZG0H 4B75A 4DW2U 1EPTB 1XVOA 1RS0A 1HJAC 3UREA 3S9AA 1C5OH 3VFEA 1S6HA 1OYQA 1UHBA 1WTHD 1LHCH 3VB3A 2J9NA 3FFGA 1BJUA 1F0TA 4FUEA 1O2OA 1P57B 1NROH 3SU6A 3GICB 4X1RU 1JBUH 3SV8A 3VB6A 1QIXB 4Q7ZA 4AB8A 1MTNB 2EA3A 2XC0A 5E0JA 1MCTA 1SLUB 3E0NB 4LZ1H 1V2TT 1UTLM 1L1GA 1TRMA 3A7TA 3GCTG 3OSYA 1G2MA 3CS7A 2Z3CA 2QIQA 3STIA 1ELGA 3A8BA 3CS0A 3RXUA 2C8YB 2NU1E 1ABIH 1TWXB 3P92A 1C5MD 2ZFFH 4B2AA 1K21H 1SL3A 2BVSH 1YF4A 2Y5GA 2SFAA 1O2HA 1SGDE 2TGPZ 2CF8H 5GDSH 5GPIB 2ZGJA 3RDZA 2FX4A 2HOBA 3ATKA 2IOTA 1DY8A 1O5DH 2F9UA 3LIWA 8GCHG 1SGNE 1W10U 4SGBE 3GDSA 2BQWB 1CGIE 3R0FA 1K1PA 3BTKE 1D3DB 1UTJA 2RG3A 2FTMA 2BDCA 2Z7FE 3T29A 1ORFA 3TK6A 2ODYB 2PKAA 4UFFH 1P2NA 1GMHG 4UFGH 3RXEA 1T31A 3CP7A 1UVUH 3P6ZB 1YPHE 5FCRA 1C9TA 2A7JA 4ZKSU 1LVOA 1OOKB 3TH2H 5DP8A 2Q6FA 3A88A 1K9OE 1VJ9U 2PHBA 4Y0ZE 4ABAA 1XUJA 1GVZA 4NIXA 5EW2H 4ZHAA 1THSH 3W94A 1C2EA 3PO1B 1THPB 3KQCA 1HAVA 1SQAA 3MNSA 4K5ZA 2FOFA 2F9BH 3F9FA 3RXVA 1P8VC 4INLA 2BB4A 5FPTA 3SU2A 1B0FA 3LH3A 1NU9A 1NTPA 3MWIU 3RMOH 2GT8A 1W12U 4GUXA 3NKKA 3KQDA 2Z3DA 1LCYA 4B2BA 3RXTA 4AG1A 3AAVA 4YOJA 4B71A 1FY3A 2F3CE 4AFQA 3SW2B 1AHTH 4CH8B 1O3OA 4TPYA 1AE5A 4KGAA 3BTME 2CMYA 2OXSA 4HI3A 1FY1A 2J34A 3UPEA 4JZDH 1AKSB 1KDQB 1TYNA 1A1RA 1BOQA 3RXHA 2BY9X 1O3LA 1K2I1 4BAOB 1ELBA 1O2UA 1UVPA 3BTGE 1Y8TA 1GBIA 2A7HA 2WYGA 2GZ7A 4ABGA 4WXIA 2F9NA 2WPKS 3DT0H 5E2OA 1BA8B 2ZQ2A 1GCTC 1BB0B 3E91A 1ELFA 1VCPA 2ZHQH 2ZDNA 3RXMA 4GSOA 3TK9A 3RC6A 4BOHA 1OWKA 1ARCA 3M5OA 1ZJDA 1M9UA 3ATWA 2ZFQH 4FUIA 1S0RA 4TWWA 3ELAH 4ZHMU 3PWCA 4NGAH 5CHAB 5C2ZA 1P2IA 4GAWA 4AOQA 3TJUA 8KME2 3LGTA 1ELDE 2W3IA 1SLVB 4I8GA 1QRXA 3K9XB 3HK6B 4JZEH 1WBGB 1ZLRA 3ZVEA 1C1TA 1GI3A 1E34B 1H9IE 3BTWE 2QYIA 1F5LA 1K1IA 1UVSH 2ZCHP 4E7RG 1SGFG 1GI9B 3P17H 2H9TH 1MD8A 1YLDA 2CHAB 2ILNA 3KF2A 1GJBB 2BXUH 4AORA 1CBWC 2JH6D 4X6PA 1WOFA 2FOBA 1FN6A 5JYIA 3ZZ8A 1ESAA 2A2XH 2RA0A 1NFWA 1HBTH 3M61U 3U8RH 1ID5H 1HCGA 2D1JA 3MI4A 1C9PA 1PPGE 3GDUA 5A0CA 1IHSH 4NIVA 3GCOA 1O2QA 2HNTE 1DWCH 3STJA 1IOEA 1NRNH 1W2KH 2ZCKP 3SBKA 1QQUA 1HFDA 2FS8A 2SGDE 2W5EA 4Q7YA 1ZGIA 1C2HA 4YM9A 3D23A 2JH0D 4VGCC 2BYAX 5A0AE 4O3TA 4D9RA 1VITH 2GGVB 2UWPA 1HIAA 2WPLS 3F68H 4A5TS 5EU8A 1C5PA 3A8CA 5T6FA 3BTFE 1O2SA 3RM0H 1Y3UA 1ETSH 3ZZBA 4FUFA 5JB8S 3RXAA 1CBWB 3SQHE 3ITIA 1GHWH 2SGQE 1TBQH 4ABJA 5FX5A 2XBXA 4OGXA 1RTKA 1YCPK 3RXCA 5JBBS 4MPVA 1FDPA 1CO7E 2VNTA 1TA6A 4NSYA 1AKSA 3DFLA 4JZIA 3GY8A 4BAQB 4X2YA 5EQRA 1O5GH 1AVGH 1DVAH 3LT3A 4LZ4B 3SJIA 2FOCA 1P01A 1C1RA 1KXEA 3QGNB 3FANA 1NC6A 1NN6A 4DY7B 1O5AB 1TMTH 1TGCA 2HGTH 3RM2H 4B1TA 1NS3A 2XNIA 1O2NA 1Z8RA 2FXRA 4NA8A 3ZZAA 2PKSB 3MU8A 3Q3XA 2ZKSA 5EXMA 1Z6JH 3MYWA 4VGCB 7GCHG 1ANEA 3UWIA 4INKA 3BTHE 3RXKA 5J4QA 3M7TA 1IQKA 4Y71A 1J16A 3C1KA 1UK3A 1BMNH 2OTVA 1F7ZA 1AGJA 1GMDF 1AUJA 4ZMAH 3SZNA 2BVXH 5EPNA 1P12E 4A1VA 1GHBG 3UQOA 3AAUA 1HAHH 3I29A 4WJG2 4BXSA 1BRBE 1Z1JA 4Y8XA 1FPHH 2V3HH 4J2YB 5IYTA 3T25A 2C93B 1B7XB 1V2RT 1LHEH 1O2IA 2FI4E 3P8GA 4X1PU 3S7HB 2ZNKH 3NCLA 5DP7A 2ASUB 1KLTA 2GT7A 2AIQA 1PPBH 1TB6H 4U30A 2ZECA 4DJZB 1C2GA 3KNXA 4B76A 2ESTE 2GMTC 1ZMJA 1TPSA 1C1VH 3BTTE 1RTLA 3GISB 4BAKB 1MQ6A 1GBBA 2ZWLH 1ZSJA 1S82A 1TAWA 1QA0A 1EB1H 1TNIA 1DM4B 2RA3A 2UWOA 2H9HA 3GYLB 1HAOH 5TCAA 1TLDA 3MTYA 4X2VA 1FV9A 1EAWA 1ZSKA 3GCTF 4MTBA 4HZHA 1Y5UT 2BOHB 2FODA 2BD7A 2LNCA 1SB1H 1DY9A 2Z9IA 1FLEE 1YPKH 2ZZUH 2QF3A 4CHAC 2ZTZA 1TOMH 2XTTB 4IBLH 2BVRH 4OS6A 3RXOA 1PQ7A 5L2YH 1K1NA 1SVPA 2STAE 3QX5H 3RP2A 1HAIH 3MH6A 4JYUH 1O2PA 1FMGA 1BRAA 3PWBA 1FY5A 2GD4B 8GCHF 1KLIH 1V2UT 2OC1A 2GZ9A 2K1QA 2QC2A 4K2YA 4BTTB 3KQBA 4AX9H 1BTHH 2VH0A 3TGIE 3P70B 3IITA 4ZXXH 2BX3A 4NG9H 4O97A 1O3IA 4X8VH 1TQ0B 2CF9H 4AGJA 1LHDH 3MH5A 3SGQE 1EZSC 4KTUA 2G4UA 3PMBB 4THNH 2GMTB 1LHFH 1YLCA 4JCNA 3SU0A 1TNGA 2FS9A 3RXPA 2G81E 2FYQA 1GVKB 1GBFA 3F9GA 1ELCA 5EODA 5ABWA 2ZGCA 3GY7A 1UO6A 2Z94A 3KHVA 2BD5A 1EJNA 4NA9H 9LPRA 2XWBI 1AZZA 4M7GA 3SOSA 1Z1IA 3NWUA 5CE1A 4FUCA 2BY6X 1EQ9A 1ZYOA 4RN6A 1YCPM 1B5GH 3BIVH 1AE8H 4JZFH 1UHBB 2Z9KA 3PTBA 2FEQH 5DP4A 5DO4H 1DICA 3A82A 2XCFA 1O5EH 1O3GA 2A4GA 1GI2A 3TH3H 5HYOA 3SO3A 1BQYA 4X1SU 1AFQC 1N8OB 2BOKA 3RXBA 1AB9C 1GI5A 2Q6GA 1EUFA 1ACBE 1JIMA 4NWLA 2ZA5A 4Y79A 4BANB 3A89A 2ANWA 3SQEE 1ESBA 1NM6A 2B0FA 1N1LA 2B8OH 3K6YA 5EGMA 2GDDA 5A0BA 3RU4T 1GJ8B 4A1XA 2QF0A 1MKXH 2ZGXH 4U32A 3ZVAA 2A4OA 1FY4A 2G4TA 1TPPA 2ZTYA 1TMBH 1H1BA 1GBLA 3VB5A 4Y0YE 1O5BB 1HXEH 1H4WA 1O2RA 1RGQA 1LDTT 3E6PH 3GYMA 1MD7A 2ZU5A 1O36A 2J95A 4I31A 2TGTA 5EG4A 4OS7A 3A8DA 3ZYEA 1BTUA 1DX5M 2PKAB 1ELTA 4Z0KA 4ZROA 2H1UA 1AO5A 2AGEX 2UUFB 1OP0A 3HGPA 2H6MA 5A8XA 1P05A 3BEFB 1ZHRA 3KN2A 3QZQA 1AFQB 3T5FH 3EYDA 1EAUA 3LC5A 1XKBC 1KXBA 4BAMB 2PUXB 4NA7A 3MU0A 1Y3WA 2A5IA 2YOLA 1DSTA 3TGJE 1EPTC 1SMFE 1SLWB 3ZZ5A 4OS1A 5EXNA 4ZXYH 2BXTH 1FAKH 3Q3KA 4D7GA 4J1YA 1MTUA 1HAZB 4R0IA 4HTCH 1MTNC 3K2UA 4Q80A 1EX3A 3H7TA 4I8JA 3EE0B 1K22H