1O32A

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o32A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o32A02
3SNAA 1SGQE 2O8UA 3TK5A 3DT0H 1S85A 1P2NA 1IQIA 5C2ZA 2GV6A 3SW2B 5FPYA 2G55A 2Y5FA 1LHEH 9LPRA 2I6SA 3P92A 4ZHLU 4TPIZ 1G36A 3A84A 1O3NA 2R0LA 1AY6H 3MMGA 2GDEH 1RTFB 1UO6A 1O2IA 1FIZA 3UPEA 1BTWA 4DCDA 4O9VA 1O3CA 1O3PB 2RA3A 1VZQH 2C93B 3QZRA 4AFUA 3D23A 2SNWA 1LVOA 1OOKB 3A8DA 2BX4A 1TX6A 1GCDA 3UIRA 2BX3A 1D9IA 1AZZA 1EPTA 1QA7A 4ABGA 1BBRH 3RXPA 2BDGA 1AU8A 6CHAB 2F9OA 4ZROA 1OX1A 4X6OA 1SGFG 1EZQA 1CSOE 1LHDH 1ZGVA 2LPRA 1QR3E 3E0PB 4X1QU 1TNHA 4FUGA 3GCTF 2XNIA 3MO6A 4O3TA 3UUZA 4JZDH 1TNKA 3FFGA 3SQEE 1CHGA 5FPTA 2A5KA 5HXFA 4AX9H 5GXPA 1CHOF 3RXVA 5A0BA 2OTVA 2CV3A 1G3CA 2G51A 1V2PT 1HAGE 1SG8B 2FI3E 2G52A 3H7TA 2ZWLH 1XUHA 1UK4A 1J15A 1EQ9A 1HBTH 1DDJA 2BHGA 3TPIZ 4NA7A 5BPEA 2XC5A 3FANA 3BTQE 3R0FA 2BDIA 3BG4C 4WH8A 1DLKB 3QTOH 1C4Y2 1TX8A 2R2WU 1NZQH 1J17T 1SGNE 1YYY1 3BTGE 4IMQA 1THPB 4GCHG 1SI5H 3ZZ9A 4D76A 3ATIA 3F6UH 1TNIA 1GDNA 1TQ7B 2ZHWH 2ZFTA 1ELCA 5DP4A 1C2MA 4Q2KA 1VITH 2EEKA 3ZZBA 4NSVA 4JYUH 1QHRB 1GPZA 1ANCA 5EW1H 3PTNA 2P8OB 3NXPA 3KQEA 1W0YH 1F0RA 1LVMA 5K0HA 1C5RA 1AKSB 5EQQA 3BG4B 2Z3DA 5J4SA 1ARBA 4UFGH 4NZQA 4CH8B 4X2WA 1Z8IB 1DY9A 4NFEA 5EPYA 2W3IA 3GY3A 1Z6JH 3RXJA 1SGPE 2GKVE 1YPMH 4ZXYH 3T26A 1GBIA 3PLPA 2BOHB 1P3EA 1IQNA 1F2SE 2HNTF 3VFEA 3A7WA 1W2KH 2XCNA 1DT2A 1NS3A 1T8LA 5HMAA 2R9PA 1MTNC 1V2KT 3W94A 1CT0E 1O0DH 5IDKA 4X6NA 1ZHPA 4NIVA 1K28D 1O3KA 1QB9A 4A6LA 3SI3H 6ESTA 3BTWE 1SHHB 1TPPA 2GVFA 1WQVH 2JH6D 1O5FH 1O2QA 4I33A 2XWBI 1GMHG 4X8VH 3A89A 5JBCS 4GCHF 2AMDA 2OP9A 1C9PA 2Q6GA 2BY7X 1SC8U 1P8VC 1RFNA 1XUKA 1C2JA 3SO3A 4D7FA 1F5KU 2XWAA 2GD4B 2FTLE 4GUXA 1T8OA 2WUCA 5A0AE 4ZMAH 2J2UA 1UTKA 1C1WH 4B75A 3AVZA 4Y76A 4Y6DA 1DLEA 3F9HA 3UTUH 3D49H 1AKSA 1PPGE 2GZ7A 1TBQH 1MTNB 4YLQH 3LDXH 1ZSLA 1N8OC 3B8JA 1BTZA 3DA9B 3TNTA 1G32B 3ZZ8A 1TRNA 1YGCH 2PTNA 1KXDA 4KTSA 3LIWA 1O2VA 3FZZA 2R3YA 1FN8A 2VIQA 4QT8C 1ANBA 4Q7XA 4ZXXH 3E90B 2WPMS 3UWJH 1AFQC 4AYVB 1QB1A 1CA8B 2AFQB 4BAOB 1DPOA 2XRCA 1O39A 1PQ7A 1ZRBA 3EQ0H 4CR5A 4NIYA 5EPNA 3S9BA 3T29A 5DP8A 1UTOA 3E6PH 1LPZB 1O30A 1L4ZA 2PV9B 1UVSH 4K5ZA 2HOBA 7GCHG 2HPPH 5TCAA 5LPEA 1SSXA 1P2QA 3S9CA 3MU0A 1ZHRA 2FOMB 3LC3A 1N8OB 1YF4A 1Y3XA 2Z9IA 5JYIA 1BTYA 1T8NA 3QUMP 5EXMA 3E16B 1O5EH 1NRRH 1Z1IA 3RDZA 1BJUA 4ZKNU 3TH2H 1C1SA 1PPCE 1ZTLA 1HRTH 2AIQA 3U8RH 1D3PB 2H5DA 1OYQA 2VVVA 4MVNA 1AFQB 5DPAA 1ETSH 4E06H 3U69H 1CQQA 3P8GA 1C2LA 1QFKH 4K3JA 3AW0A 4H6SB 1H8IH 3HKIB 1TMBH 1JMOH 2R0KA 1PQAA 5SGAE 4UD9H 1NTPA 1AE8H 3AASA 1HAYB 1GI9B 3OY6U 2H2ZA 1C1QA 3TLOA 2BQ7B 1S6HA 1PFXC 4XBDA 1SPJA 4JYVH 2H9HA 1KXAA 5JDUB 2ANMH 3TGJE 2V35A 5DP7A 1T8MA 1KLJH 1TA2A 4KKDA 5GJ4B 2SFAA 1RIWB 4CRGA 5GDSH 4NWLA 2P3FH 2P16A 3UR6A 2Y5GA 2BLOA 1FY4A 4ZUHA 1GVZA 4XBBA 1GBEA 1NM6A 3GOVB 4BAHB 3LGIA 1GBHA 1ELFA 1XUGA 4IMZA 1SQAA 2BD4A 3UOPA 2VNTA 2BTCE 1HJ9A 3QWCH 1TALA 3L6PA 3ATLA 3RXQA 2YNAA 1HB0B 2OINA 5AFYH 1HIAB 1TNGA 1ZZZA 1AVXA 1YPJH 3BSQA 4WVPE 1YPHC 8LPRA 3ZVEA 1QBOA 2FXRA 2W26A 1GI8B 1FZZA 2G5NA 3GY2A 5FCKA 2TGAA 3VB6A 2PSXA 3SQHE 1BTPA 4FUIA 1C5LH 1ZHMA 3RXKA 1LKAA 1ELDE 1N6YA 2QYIA 2J38A 3VPKA 2BY6X 2GDDA 4ZKRU 2WPJS 1UVOA 3DUXH 1ID5H 2CHAC 2AH4X 1W0ZU 3LGUA 3I77A 1ZRKA 2ZIQH 5C5NA 1NESE 1THSH 1DICA 2Z3CA 2Y7XA 2FM2A 1O2SA 1UTMA 2OC1A 2WYJA 2ZF0H 4BTUB 3LGTA 2XBXA 3SJOA 1BTXA 1MKWK 4X1PU 2VVCA 4OS4A 1Z8RA 2B9LA 5FBIA 1C5XB 1TMUH 1L0ZA 3BTDE 4MNWA 2NU0E 2P94A 5EGMA 1VJAU 1O2MA 1SFQB 3A81A 1ELBA 4BAQB 1C1PA 1EZSC 3RLWH 1AB9C 3FP8E 3SZNA 1RXPA 2CHAB 1HNEE 2GCTC 3EDXB 3SU2A 3ZV9A 1GJ8B 1IQLA 2FOBA 1WBGB 3D62A 1BHXF 2B7DH 3ODFA 1ZJKA 5E0GA 3RXFA 1CT4E 3PLBA 1IQEA 2BDAA 2BLQA 5T6FA 3A8AA 4LOYH 1CVWH 2FOGA 4X6MA 4ABJA 4AFZA 1LDTT 3F9EA 3Q77A 4NIXA 3SV7A 5I46H 1KTTB 4I8JA 1TGTA 5EXNA 5T3HA 1Y8TA 2ZHFH 1XX9A 4E7NA 1AB9B 3ZVFA 3MFJA 1MTVA 2PKAB 1YCPK 2GCTB 1QQUA 2PLXA 2Y82A 3SJ8A 2NU4E 3V13A 1CBWB 1KTSB 1DWDH 4MG3A 1V6DA 4MTBA 1CU1A 1GDQA 4OGYA 3K6ZA 1ZOMA 4YT7H 3NCLA 3ITIA 1SGIB 5AFZH 3SGAE 1Z8JB 1P02A 1C1UH 1E34B 1PPEE 1UTNA 1P03A 1NFUA 3MYWA 4Y8XA 5LPFA 3P95A 2A2XH 1C1VH 4K8YA 5EW2H 3TU7H 3TH3H 5A2MH 1DWCH 3BN9A 1Y5UT 3M61U 1BBRE 1NRSH 2ZFPH 1K1JA 1EXFA 3GY4A 1JOUB 1ABIH 3HPTB 5F8TA 1EP6A 1Q2WA 1AI8H 4I32A 3A7VA 5L2ZH 1ESBA 1EAIA 1AIXH 4BTIB 3F9FA 3BTFE 1NPMA 2BY9X 3K6YA 5TJXA 3RMOH 1DM4B 3T25A 1AVGH 1ZMJA 3MWIU 1PJPA 3SNBA 2HRVA 1E35B 3M37A 1F7ZA 2VWNA 4WXIA 1L1JA 2ZGJA 3LGVA 3MU5A 2F9NA 1DXWA 2ZG0H 2PKAA 3FAOA 5LH8A 4MDSA 2EA3A 1L4DA 2BOKA 1F5RA 1ZYOA 2RDLA 3MOCA 4ZKSU 3SJKA 5FX5A 1V2OT 3M7TA 4DJZB 2XW9A 4DOQA 1V2VT 5FHTA 1DE7H 4AYYB 3LONA 2J94A 3BEUA 5E2PA 1G3BA 2GCHG 3K65B 3ZZCA 5A0CA 1O2UA 3SU6A 1V2LT 1GI2A 2LNCA 2XXLA 2ZFSA 4FUCA 2P93A 5FX6A 2SGDE 3MHWU 1SQTA 3KQDA 1F0UA 1HUTH 5E8EH 2VIWA 3PYHA 2A5IA 1A7SA 3TJUA 2SGAA 1UTLM 3ELAH 2F9VA 3RXDA 2CN0H 1TA6A 1GG6C 3DFLA 2KAIA 3V7TA 1P06A 4NSYA 4AG2A 1MAXA 2FLRH 1LVYA 3GICB 5DO4H 2ALPA 1YKTA 8KME2 1GGDC 2ZDMA 3QTVH 1TQ0B 3IITA 3M3VA 4Y0ZE 3T62A 1GMCG 2ZTZA 3OX7U 4MLFB 5LGOA 3F9GA 2JETB 1T32A 3SORA 4SGBE 4O3UA 4B71A 3GCOA 2GZ9A 1CO7E 3CP7A 2QXIA 1KY9A 2HNTC 2SGQE 2FOAA 4H42U 1GG6B 3M35A 2XBWA 1WU1A 1BIOA 1O3BA 4FUHA 2W7SA 1GJ6A 1VR1H 2ZTYA 1EKBB 1FN6A 1P2MA 1O3FA 4HTCH 4OS7A 4CH2B 5DK1A 1GGDB 4K2YA 4ZAEA 4MNXA 2TGPZ 4O97A 1W10U 3UREA 4JZ1A 1ZGIA 6CHAC 4TPYA 4CRFA 4DIHH 1EZUC 3JZ2B 1XUFA 4K8BA 1ELEE 1EAWA 3NPSA 7ESTE 3PV4A 1Y3UA 4Y71A 3RXLA 8GCHF 1MBQA 3RC5A 3MH4A 1C5QA 2CF8H 1XXDA 1AQ7A 3MH5A 3SHAH 3P6ZB 1C5WB 2ZU2A 1VJ9U 3MNXA 4OS5A 3QGNB 1CA0C 3F1SB 2ESTE 2V3OH 4Z6AH 1P0SH 2UWPA 1P2IA 1GHXH 2C90B 3SJIA 4KELA 4YESB 2PSYA 1EAXA 4UEHH 2BDCA 4Y0YE 1GMDG 1XUJA 3S0NA 2O8MA 1SGTA 4FU9A 3KHVA 1RGQA 3Q3XA 4OGXA 3RLYH 1FI8A 1E36B 3GCNA 2D2DA 1SHYA 1SVPA 1HAOH 1GCTC 2VWMA 1LMWB 1O3IA 1P09A 2ZGCA 1P12E 1MQ6A 2OLGA 4X2XA 1HXFH 1LPKB 1O5DH 1A1RA 1TGNA 2VJ1A 3RXRA 4F4OC 4AGKA 3UQVA 1CA0B 1D3QB 2VIPA 4X2YA 1K1PA 1MKXH 3SGBE 4ZKOU 2BD2A 4YM9A 5DP5A 1AUTC 1TMTH 1TRMA 2F83A 4YLUA 2ZHEH 5E2OA 2SGEE 3JZ1B 1O5BB 2P8OC 5FBEA 2TIOA 3A7ZA 1FY3A 1GJ4H 3T5FH 3MH7A 1S83A 2R2MB 4U2WA 3GY6A 5EU8A 1GCTB 1K21H 3V0XA 3SNDA 1YPKH 1GBKA 1O3OA 2AMQA 3W95A 1G3EA 3S69A 1OP2A 1O3HA 4B74A 1C5PA 1GHVH 1KXCA 1RTLA 1GI0A 1LKBA 1TGSZ 2O8TA 2GT7A 1HAHH 1P9SA 3NK8A 3TVJB 1QRXA 1F0SA 1YPGH 3F68H 3ZZ3A 7KMEH 1FPCH 1KIGH 2STBE 2ZU5A 3BF6H 1QTFA 3MNBA 4CBNA 4DURA 3SV9A 1BJVA 1K22H 2FI5E 2OQ5A 2A1DB 3GDSA 5BRRE 1V3XA 1KLIH 2ZO3H 3ENSB 3RXIA 3RXEA 2QF3A 3A8BA 1X7AC 4A5TS 4U32A 1DITH 2RCEA 3O8DA 1SGDE 2TRMA 2NWNA 1G30B 1UK2A 2IPHA 1TONA 1BMAA 4A7IB 1BITA 1D4PB 2WPLS 1DSTA 1C2KA 4WXVA 1LHGH 4UONA 4XOJA 2PUQH 2QAAA 3VXFH 3MU8A 1FAKH 2ULLA 4D7GA 4B1TA 2VGCC 1GBLA 1XUIA 3MO3A 1OPHB 1OSSA 2Z9LA 3E91A 2QCYA 3ZYEA 4AORA 4Q80A 1EOJA 3RMMH 1GBCA 1C5NH 1WSSH 2FWWA 3SV6A 2P3TB 1TFXA 1JWTA 1A0LA 4MNVA 2ZNKH 4TY6A 3QZQA 2BB4A 3ZZDA 2J95A 4AB8A 4NIWA 3RMLH 1TLDA 1O35A 1G2MA 2BLWA 4OS2A 3TNSA 1IHSH 1UTPA 1C1RA 2ASUB 4FVBA 4Y7AA 1GJBB 2VGCB 1PPZA 1SLVB 3K9XB 1H9IE 4NA9H 1FXYA 2A4OA 1JRSA 3GCHC 2V3HH 3RU4D 2C8WB 3LT3A 3KCGH 1O2KA 2FOFA 2PTCE 1P2KA 4BAMB 1BRCE 1GI5A 1QL7A 1NU7B 2ZPRA 3B23B 4MPXA 3UFAA 2OUAA 3KQBA 3I78A 1FQ3A 1SGYE 2UWOA 4ISHH 1Z1JA 1K1OA 1V2TT 2R3UA 3NZIA 1T4VH 1WV7H 5GCHG 2J4IA 2ZECA 2O9QA 1DS2E 2ZCKP 5HGGA 2ZPSA 1YCPM 1SOTA 1HAPH 5J4QA 5PTPA 1K1NA 3GCHB 4KTUA 1O32A 2A7CA 1EUFA 1SB1H 5AF9H 1GHZA 2GT8A 4I8LA 3PMBB 1V2WT 2DUCA 1UCYH 1GJ9B 2BLVA 4WY3A 5K7RA 2ZDNA 1DANH 5TCCA 1BHXB 3BEFB 4IN2A 3C1KA 1OS8A 2BDHA 1V2MT 2ZU4A 1RIWC 1ZTJA 2JKHA 2Z3EA 1GMHF 1DUAA 1BMMH 1ELGA 1C1NA 2CXVA 2QIQA 1C4U2 1NT1A 5ABWA 4IS5A 1V2JT 2XC4A 3A82A 3VB7A 1AVWA 1B7XB 1AMHA 2OBOA 1YLCA 2PFEA 2AYWA 2GV7A 4NCYA 2GTBA 3BTEE 4FU7A 1CGIE 3P70B 4RSPA 4YZUA 1AWHB 1AUJA 1C5UA 2F9BH 1SBWA 1C2HA 2QN5T 2ZHQH 2IOTA 4IN1A 3LH3A 4DY7B 1GI1A 4X8SH 1FUJA 2O8WA 2AIPA 2VIVA 5L30H 2ZCHP 3V12A 3T28A 3FP6E 2Z94A 4GHQA 3CS7A 5GCHF 2GGVB 4XBCA 3M5MA 1ANEA 3GYLB 1HAXB 3LGYA 5C5OA 1MTSA 4NA8A 4M7GA 4TY7A 1HAVB 2ZGXH 5F6MA 1D3TB 5AVDA 4NFFA 1NO9H 3BV9B 4CRCA 1F0TA 1QQ4A 2ZI2H 7GCHF 3Q00A 4Y79A 2QY0B 3ATMA 1NROH 1Z71A 2G4UA 3ZVGA 3ZZ4A 1SQOA 1A5GH 4INHA 1ESTA 4WMFA 4Z0KA 1BBRK 1A46H 1D6WA 4I8GA 4WH6A 1BRUP 5DP9A 1FY5A 2G00A 2AGGX 2GP9B 1ZR0A 3TITA 2ZU3A 4X1RU 1O2XA 1GHBG 2AMPA 1W12U 2FS8A 2VWOA 3EYDA 4LXBH 9ESTA 1ELAA 1O3AA 1Q31A 4J2YB 1PYTC 4JZIA 4IGDA 2BZAA 1QURH 4BTTB 1B0FA 4IC6A 4ABFA 2BYAX 1O2RA 3P8OA 1OWDA 1MTWA 1PYTD 3N7OA 3P8FA 4J1YA 2GMTC 1C5TA 2WV5A 1YM0A 1KXBA 3GY8A 1O2PA 2ZFFH 4CRBA 3I29A 3TK6A 3RM2H 1W3CA 4K1SA 4K1EA 1GBDA 1K2I1 1YPEH 2OC0A 2PGBB 1GI7B 5A8ZA 1SGCA 2H6MA 4WMDA 1MD7A 2HVXA 1A5HA 1LVBA 1ZPBA 3DFJA 2FIRH 4CRAA 2HNTE 1HAVA 4WJG2 3S9AA 1ANDA 3RXHA 2FX6A 3RM0H 2VIOA 1CBWC 1LO6A 1HIAA 1EB1H 1MMJN 1XVMA 1TGCA 1MCVA 2GMTB 3SU0A 2CGAA 4I8HA 3BTHE 3M36A 1CGJE 4YTAA 1Y59T 1FDPA 2VH6A 3BTKE 1M9UA 3OSYA 2AEIH 1MTUA 1N1LA 1O5GH 1WUNH 3ZVBA 3K2UA 3MNSA 1G37A 4R0IA 1BA8B 5EOKA 2B0FA 3U1IB 2FP7B 1MAYA 4ISOA 2Z9GA 1FIWA 1TBRH 2CMYA 3PWBA 2W5EA 1HAIH 4Y8YA 1OWIA 1KSNA 2F9PA 1ZPCA 2FLBH 4NG9H 1J8AA 1ZMLA 1KDQB 1SLUB 2Y6TA 3ESTA 6GCHG 2BVRH 2WPKS 1RRKA 2TGTA 1HYLA 4XSKU 1BTHH 1ZSKA 3ZZ7A 1QJ7B 3GY7A 3EA7A 3SGQE 4K1TA 3PMHB 1GBJA 5F8XA 1HAZB 2A7HA 2I6QA 1GWAA 2OCVB 2GX4A 5FAHA 1C4V2 1LQDB 4IBLH 3SNEA 1AZ8A 2VB0A 3MNCA 3M5OA 4GPGA 2BD3A 5GWZA 1EX3A 2ZKSA 1FMGA 2PGQB 4ZHAA 4UDWH 3IG6B 5ESTE 5ETXA 2XBYA 1VCWA 1NY22 1ZJDA 3SOSA 3A8CA 3O8BA 4MPWA 5JPMH 3NUMA 4ABHA 3LH1A 2OXSA 1N6XA 3M7QA 1MU8B 3RUOA 3H5CB 3SV2H 2ZA5A 2JH0D 3HK6B 1PQ5A 5CHAC 5DP6A 3T27A 3FP7E 1C5SA 3UY9A 2Q1JA 1BMLA 1XXFA 2ZDKA 4ASHA 2FODA 1O33A 1NC6A 4X0WU 2STAE 5H4IB 1Z6EA 4D9RA 3SUGA 1F5LA 4JZFH 1BOQA 1GBFA 1XM1A 3KNXA 1AHTH 3KQCA 1A4WH 1O31A 1DX5M 4ZHMU 1BMNH 1KDQA 2M5TA 2ZHDA 1O2ZA 2H5CA 4CR9A 1WYKA 5HYOA 4K60A 1DWEH 3PTBA 1A2CH 3BIVH 2TGDA 2XBVA 4B73A 1O2WA 1SLWB 1T7CA 1Y5BT 1D3DB 4X2VA 5CHAB 4A92A 2VU8E 4JK5A 5EQSA 2JETC 3LKWA 2UUJB 1E37B 3LJOA 2NU3E 2ODQA 3D65E 4YOGA 1O3DA 2B5TB 1Y3WA 1P3CA 3E1XB 4HGCA 2WYGA 1LHCH 2PW8H 2SGFE 5ESBA 3U8OH 3H7OA 1S0QA 2GZ8A 2BY8X 4AZ2B 3QO6A 4LZ1H 1NFYA 2SGPE 1KYNA 3SN8A 5LPRA 2A31A 1IQGA 5FPSA 1O2OA 2BM2A 1O36A 2NU2E 3L3TA 1S5SA 2A2QH 4DVAU 1BB0B 3U1JB 1QNJA 2FS9A 3A85A 4X8UH 2ANKH 3Q3KA 1P57B 1VCQA 1AO5A 2ODYB 1O2YA 4IC5A 5AHGH 3SJ9A 2ZDAH 1O3EA 1Y3VA 1CT2E 1S81A 5CE1A 2AGIX 4D9QA 1GHAG 2EI7A 1FPHH 1C1MA 1FJSA 4OS6A 3UNQA 3GCTG 4AFQA 1NRPH 4ABEA 3MH6A 1P9UA 1QRWA 3P8NA 4B2AA 2ZCLP 3RU4E 1KXFA 1BQYA 1RJXB 2A4GA 2GCHF 3S7HB 2C3SA 4E05H 3SU3A 3NKKA 1GL0E 1GJ5H 1CHOG 2FDAA 2EI8A 1OWKA 2ZTXA 4YT6H 3WY8A 1IQHA 2PR3A 1F92A 3A80A 4ESTE 1BRBE 3GY5A 4BXWA 2XC0A 4BNRA 2JH5D 3R3GB 4OS1A 2HWLB 1DOJA 2ZU1A 3M3SA 3QN7A 1P04A 4SGAE 1C2FA 2BD7A 4BANB 5DP3A 1MZDA 1SR5C 1GVKB 3GDUA 4UFDH 1ABJH 3RC4A 5A8XA 3GYMA 2Y5HA 1JIRA 1IHTH 3PM3A 1GMCF 2ZQ1A 1WTGH 4RKJB 1UTQA 2AGEX 1O2LA 1LQEA 1UVPA 1ZLRA 4ZH8A 2D8WA 1ARCA 2Z7FE 1TNJA 3LU9B 2ILNA 4FUJA 3QGJA 2ZP0H 4IW4E 1NU9A 2QXHA 1SGFA 3V3MA 3T2NA 1O3GA 3ODDA 1TPOA 1QL8A 5GIBA 4MPUA 1QBNA 1UCYE 2OQUA 1MH0A 3RXGA 3U98H 3UNRA 1GHAF 3HGPA 1V2NT 4KP0A 1U6QA 4DIIH 2RG3A 1C1OA 1O37A 2VIDA 1BTUA 3ZVAA 1G3DA 3RXBA 2ZFRH 1BUIA 4HFPB 3PMJA 4JZEH 2XYAA 5B6OA 3VB5A 1ETRH 3U8TH 1SOZA 1P11E 2Q6DA 3BTME 1MKWH 5JB9S 4H6TA 4BOHA 4ABDA 2ANYA 4FVDA 2ZPQA 5EODA 1O2TA 1S0RA 3A83A 2ZQ2A 3MO9A 2HPQH 1K1IA 1HXEH 2D1JA 2P95A 2ZDLA 3U9AH 1UVTH 1A61H 2EC9H 3QK1A 1C5MD 4K69A 4YOIA 4KTCA 4HZHA 1GJCB 2VVUA 1WTHD 2VWLA 4NGAH 1H1BA 3SUFA 4AOQA 1GMDF 2BVSH 3E8LA 2THFB 3MU4A 2WV4A 2Z9KA 2H9TH 3HKJB 1YC0A 1IQFA 1LHFH 4TWWA 1C1TA 4WMEA 1YPHE 1L1NA 7LPRA 1E38B 1QA0A 1IOEA 3O8RA 4F49A 1GBBA 1DFPA 1MZAA 2FO9A 2WINI 2XTTB 4O03A 1NN6A 1XKBC 1TB6H 3EA8A 1RD3B 4ISLA 4Y7BA 1J14A 4GVUA 1HV7A 1MU6B 3EAJA 3SU5A 4CBOA 3E3TA 1YCPH 4I8KA 3RP2A 1OWHA 1C2DA 5A09A 4WWYA 4ABAA 1GJ7B 1QY6A 1SLXB 5T6DA 1L2EA 1HPGA 4RKOB 1T31A 1HDTH 1V2UT 5DG6A 4DGJA 3LJJA 2F91A 1FAXA 2UUYA 1NRQH 1JRTA 3RXMA 1BZXE 1QJ6B 3PWCA 4FU8A 3SBKA 4Y11E 3OY5U 4JYTA 1L1GA 1MBMA 1AD8H 2VINA 3BIUH 1INCA 2BQWB 5HM2A 2FEQH 3TGIE 3ZYDA 2J9NA 1OWEA 2ZFQH 2HGTH 1MD8A 1TE0A 5JBBS 1BCUH 1GJDB 4GHTA 3MU1A 1HLTH 2A32A 3TGKE 4MPVA 1HFDA 4GLYA 1EJNA 1UJ1A 1C2GA 4YOJA 1AN1E 1YBWA 1C2EA 2ZDVH 1VGCC 2UUKB 1RS0A 4FUBA 1TAWA 1ZTKA 3BEIB 5HM9A 5C1XA 5EXLA 1FNIA 3KIDU 1OP0A 1RTKA 5JBAS 1YP9A 2QF0A 2FESH 1DWBH 1XKAC 3RXUA 2AERH 3CENA 1EJMA 1UHBB 1K1LA 1O5AB 1OXGA 3ATKA 1TPSA 4AB9A 1O3JA 1TIOA 1FONA 1P01A 1VITG 2A45B 1GI3A 1W7XH 2WUBA 1O38A 2BD5A 3ZZ5A 1H4WA 1ELVA 3MI4A 1O2HA 2WPHS 3C27B 1O5CB 1QBVH 3QX5H 1C5VA 1AFEH 1VGCB 2ANWA 3LOXA 1BRAA 4D8NA 3OTJE 1PPHE 1P2JA 1S82A 1A0JA 1GBMA 1A3BH 1HGTH 1XMNB 5IYTA 2J92A 2O8LA 3STJA 5C67A 4JMYA 2YNBA 2QC2A 2OD3B 3HGNA 2FI4E 1LCYA 3HK3B 1K9OE 3AAVA 1Y3YA 4B76A 3BG8A 1TGBA 1OP8A 1SFIA 1EZXC 1ACBE 3BTTE 4ABIA 3G01A 3EGKH 2ALVA 1GHWH 4MNYA 2UWLA 2FYRA 2D26C 4Q7ZA 1Q3XA 1UVUH 1V2ST 3OYPA 3SU4A 2QXGA 4A1TA 4DG4A 5A8YA 4I7YH 1ETTH 3M3TA 1AWFH 1EATA 3UNSA 4INLA 2ODPA 1PPFE 5DKMA 1TABE 1THRH 3RXCA 2C8ZB 3TJOA 1GBAA 1O2JA 1IAUA 4I31A 5L2YH 3STIA 3RXTA 1KLTA 1Z8GA 1H8DH 3SV8A 1MUEB 3TJNA 5JBTA 3A7YA 5T6GA 1UHBA 3KL6A 3GISB 1BDAA 1W14U 1QL9A 3P17H 4X6PA 3SI4H 3PROA 2FZZA 4UFEH 1DSUA 3LGWA 1VITF 4U30A 3Q76A 5CMXH 3SU1A 3A7TA 5F03A 1HCGA 3VB4A 1ESAA 1LPGB 2A5AA 1QCPA 1O2NA 1MQ5A 1H9LB 1QJ1B 1TX7A 1ELTA 3ZV8A 1SGEE 1K1MA 2W3KA 5G4BA 3DD2H 4ISIH 2UUFB 2OC8A 1A0HB 1FLEE 3SHCH 1T4UH 1UMAH 2FPZA 1EASA 1EAUA 3RXOA 3UQOA 3AW1A 4LK4A 1TYNA 2AS9A 3TH4H 2BDYA 3SUEA 2F3CE 1TOMH 2EI6A 4B2CA 1W11U 3TJVA 3NWUA 1MKXK 3PO1C 3FVFB 2OC7A 1A5IA 1C5ZB 5C3NA 4PROA 4XDEA 1AE5A 4Q7YA 3E0NB 2TPIZ 2B8OH 4LZ4B 1GI6A 1VCPA 4ISNA 4THNH 4CREA 1Z7KA 3ATWA 1GJAB 3FZDA 1B5GH 1SGRE 2FYQA 1JXPA 1PPBH 1C5OH 4BAKB 1YLDA 1J16A 3PMAB 2V6NA 2Z6BD 3ZVDA 2G5VA 1GVLA 1OWJA 1TPAE 2ZEBA 1IQKA 2XCFA 3OU0A 1J9CH 1QB6A 1AGJA 3PO1B 4JK6A 5JB8S 1JBUH 1O34A 2A7JA 4FXGH 4X8TH 3VB3A 2BXUH 2HALA 1H9HE 1WAYB 1HJ8A 3AAUA 1O3MA 3HATH 1UK3A 1W8BH 1GBTA 5I25A 1JIMA 3A7XA 3IWMA 3LPRA 4UFFH 1Y5AT 1QGFA 1GHBF 3Q3YA 4U01A 3UR9A 2IN2A 3URCA 3EA9A 4X1NU 3TIUA 3TK9A 2WPIS 3KGPA 1B0EA 1EOLA 1G9IE 4XE4A 1V2QT 2BXTH 3QLPH 5GPIB 2BD8A 3RC6A 4MQAA 4X1SU 1P10A 4R8TB 2H1UA 3S7KB 4DW2U 4H4FA 5FXLA 4NZLA 1DXPA 2C4FH 1O2GH 2P59A 2Y81A 1D6RA 1TBZH 2ZZUH 2QV1A 3GDVA 3MTYA 1ORFA 4CRDA 2SNVA 2V0BA 1QIXB 5E0JA 1MCTA 2F9UA 1A3EH 2H9EH 2TBSA 3DHKH 2QGRA 1NRNH 2K1QA 2BD9A 1OYTH 1EJAA 2CF9H 5E0HA 4YO9A 2PUXB 2KAIB 2G4TA 4INKA 1YPLH 3ZZ6A 1CE5A 4AN7A 4FUFA 3QDZB 2CJIA 3SNCA 2BQ6B 3UWIA 3VGCC 1TRYA 1C5YB 2QXJA 4KGAA 1E0FD 1HJAC 2PHBA 2A0QB 5DJ7A 5C1UA 3KF2A 3M5LA 2ZGHA 1NFXA 3O8CA 2J34A 4BXSA 4GAWA 6GCHF 2C8YB 3B9FH 5F8ZA 5C1YA 2ZC9H 4WF8A 2FOEA 3VEQB 3ZVCA 3PB1E 4UE7H 5EG4A 2Y80A 1BT7A 1C2IA 2HLCA 4Y10E 8ESTE 1UTJA 2IJOB 3URDA 3CS0A 3M7UA 4A1VA 2BDBA 2P3UB 2QA9E 1DVAH 4B2BA 1W7GH 1S84A 4VGCC 2A4QA 3RMNH 1NFWA 2Q6FA 2ZGBH 1QRZA 2C8XB 1EP5A 1UCYK 3EE0B 2BVXH 2FX4A 1FY1A 1LTOA 1OKXA 1EPTC 2DE8A 1GL1A 3VGCB 3SUDA 4FUDA 1FV9A 4NWKA 4AFSA 1TWXB 2BMGB 1HJAB 4HI3A 4TYDA 3UOUA 2DE9A 2Y7ZA 2A4RA 1P2OA 1ZPZA 2FMJA 1FY8E 2PKSC 2RA0A 2W7UA 8GCHG 4CHAC 1SL3A 3ZZAA 4TWYA 1XVOA 2FOHA 1WQSA 1GDUA 4ABBA 2FOCA 1S6FA 1V2RT 1EB2A 2BY5X 4XFQA 3M5NA 3RXSA 4AGJA 3LC5A 1KXEA 3A86A 3KN2A 4JCNA 3RXAA 5L6NH 1ZMNA 4RN6A 3L33A 3PLKA 3A87A 4VGCB 1WCZA 1SMFE 1CGHA 5EQRA 1G2LA 2PWXA 1EPTB 1C9TA 1TOCB 3RU4T 2VH0A 1ZSJA 3VXEH 1PQ8A 2G8TA 2PKSB 3KEEA 1DY8A 4CHAB 1P05A 1DUEA 5C20A 1WOFA 5DGJA 4DT7B 1W13U 3A88A 1GHYH 4E7RG 2NU1E 1TNLA 1O3LA 2Z9JA 4GSOA 2G81E 4FUEA 4AG1A 6LPRA 1IQJA 4Y8ZA 2OBQA 5FCRA 1IQMA 1GI4A 4A1XA 2FTMA 2YOLA 2BZ6H
chains in the Genus database with same CATH superfamily
3SNAA 1SGQE 2O8UA 3TK5A 3DT0H 1S85A 1P2NA 1IQIA 5C2ZA 2GV6A 3SW2B 5FPYA 2G55A 2Y5FA 1LHEH 9LPRA 2I6SA 3P92A 4ZHLU 4TPIZ 1G36A 3A84A 1O3NA 2IJD1 2R0LA 1AY6H 3MMGA 5DN6D 2GDEH 1RTFB 1UO6A 1O2IA 1FIZA 4Q63A 3UPEA 1BTWA 4DCDA 4O9VA 1O3CA 1O3PB 2RA3A 1VZQH 2C93B 3QZRA 4AFUA 3D23A 2SNWA 1LVOA 1OOKB 3A8DA 2BX4A 1TX6A 1GCDA 3UIRA 2BX3A 1D9IA 1AZZA 1EPTA 1QA7A 3KQ5A 4ABGA 1BBRH 3RXPA 2BDGA 1AU8A 6CHAB 2F9OA 4ZROA 1OX1A 2AHME 4X6OA 1SGFG 1EZQA 1CSOE 1LHDH 1ZGVA 2LPRA 5HKKD 1QR3E 1YWUA 3E0PB 4X1QU 1TNHA 4FUGA 3GCTF 2XNIA 3MO6A 4O3TA 3UUZA 4JZDH 1TNKA 3FFGA 3SQEE 1CHGA 5FPTA 3FO8D 2A5KA 5HXFA 4AX9H 5GXPA 1CHOF 3RXVA 5A0BA 2OTVA 2CV3A 1G3CA 2G51A 1V2PT 1HAGE 1SG8B 2FI3E 2G52A 3H7TA 3PRBA 3OE7D 2ZWLH 1XUHA 1UK4A 1J15A 1EQ9A 1HBTH 1DDJA 2BHGA 3TPIZ 4NA7A 5BPEA 2XC5A 3FANA 3BTQE 3R0FA 2BDIA 3BG4C 4WH8A 5F53A 1DLKB 3QTOH 1C4Y2 1TX8A 2R2WU 1NZQH 1J17T 1SGNE 1YYY1 3BTGE 4IMQA 1THPB 4GCHG 1SI5H 3ZZ9A 4D76A 3ATIA 3F6UH 1TNIA 1GDNA 1TQ7B 2ZHWH 2ZFTA 1ELCA 5DP4A 1C2MA 4Q2KA 1VITH 2EEKA 3ZZBA 3FOAA 4NSVA 4JYUH 1QHRB 1GPZA 1E1RD 1ANCA 5EW1H 3PTNA 2P8OB 3NXPA 3KQEA 1W0YH 1F0RA 1LVMA 2JJ2D 5K0HA 1C5RA 1SQRA 1AKSB 5EQQA 3BG4B 2Z3DA 5J4SA 1ARBA 4UFGH 4YXWD 4NZQA 4CH8B 4X2WA 1Z8IB 1DY9A 4NFEA 5EPYA 2W3IA 3GY3A 1NBME 1Z6JH 3RXJA 1SGPE 2GKVE 1YPMH 4ZXYH 3T26A 1GBIA 3PLPA 2BOHB 1P3EA 1IQNA 1F2SE 2HNTF 2KM0A 3VFEA 3A7WA 1W2KH 2XCNA 1DT2A 1NS3A 1T8LA 5HMAA 2R9PA 1MTNC 1V2KT 3W94A 1CT0E 1O0DH 5IDKA 4I86A 4X6NA 1ZHPA 4NIVA 1K28D 1O3KA 1QB9A 4A6LA 3SI3H 6ESTA 3BTWE 1SHHB 1TPPA 2GVFA 1WQVH 2JH6D 1O5FH 1O2QA 4I33A 2XWBI 1GMHG 4X8VH 3A89A 5JBCS 4GCHF 2AMDA 2OP9A 1C9PA 2Q6GA 2BY7X 1SC8U 1P8VC 1RFNA 1XUKA 1C2JA 3SO3A 4D7FA 1F5KU 2XWAA 2GD4B 2FTLE 4GUXA 1T8OA 2WUCA 5A0AE 4ZMAH 2J2UA 1UTKA 1C1WH 4B75A 3AVZA 4Y76A 4Y6DA 1DLEA 3F9HA 3UTUH 3D49H 1AKSA 1PPGE 2GZ7A 1TBQH 1MTNB 4YLQH 3LDXH 1ZSLA 1N8OC 3B8JA 1BTZA 3DA9B 3TNTA 1G32B 3ZZ8A 1TRNA 1YGCH 2PTNA 1KXDA 4KTSA 3LIWA 1O2VA 3FZZA 2R3YA 1FN8A 2VIQA 4QT8C 1ANBA 2YMSB 4Q7XA 3E90B 4ZXXH 2WPMS 3OFND 3UWJH 1AFQC 4M9FA 4AYVB 5HIYA 1QB1A 1CA8B 2AFQB 4BAOB 1DPOA 2XRCA 1O39A 1PQ7A 1ZRBA 3EQ0H 3SYJA 4CR5A 4NIYA 1QZ8A 5EPNA 3S9BA 3T29A 5DP8A 1UTOA 3E6PH 1LPZB 1O30A 1L4ZA 2PV9B 1UVSH 4K5ZA 4B6EA 2HOBA 7GCHG 2HPPH 5TCAA 5LPEA 1SSXA 1P2QA 2K8IA 3S9CA 3MU0A 1ZHRA 2FOMB 3LC3A 1N8OB 1YF4A 1Y3XA 2Z9IA 5JYIA 1BTYA 1T8NA 3QUMP 5EXMA 3WWBA 3E16B 1O5EH 1NRRH 1Z1IA 3RDZA 1BJUA 4ZKNU 3TH2H 4TT3D 1C1SA 1PPCE 1ZTLA 1HRTH 2AIQA 3U8RH 1D3PB 2H5DA 1OYQA 2VVVA 4MVNA 1AFQB 5DPAA 1ETSH 4E06H 3U69H 1CQQA 3P8GA 1C2LA 1QFKH 4K3JA 3AW0A 4H6SB 1H8IH 3HKIB 1TMBH 1JMOH 2R0KA 1PQAA 5SGAE 4UD9H 1NTPA 1AE8H 3AASA 2HLDD 1HAYB 1GI9B 3OY6U 2H2ZA 1C1QA 3TLOA 2BQ7B 1S6HA 1PFXC 4XBDA 1SPJA 4JYVH 2H9HA 1KXAA 5JDUB 2ANMH 3N7DA 3TGJE 2V35A 5DP7A 1T8MA 1KLJH 1TA2A 4KKDA 5GJ4B 2SFAA 1RIWB 4CRGA 5GDSH 4NWLA 2P3FH 2P16A 3UR6A 2Y5GA 2BLOA 1FY4A 4ZUHA 1GVZA 4XBBA 4TSFD 1GBEA 1NM6A 3GOVB 4BAHB 3LGIA 1GBHA 1ELFA 1XUGA 4IMZA 1SQAA 2LP6A 2BD4A 3UOPA 5C94A 2VNTA 2WPDD 2BTCE 5CHBA 1HJ9A 2WHXA 3QWCH 1TALA 3L6PA 3ATLA 3RXQA 2YNAA 1HB0B 2OINA 5AFYH 1HIAB 1TNGA 1ZZZA 1AVXA 1YPJH 3BSQA 4WVPE 1YPHC 8LPRA 3ZVEA 1QBOA 2FXRA 2W26A 1GI8B 1FZZA 2G5NA 3GY2A 5FCKA 2TGAA 3VB6A 1YY3A 2PSXA 3F0PA 3SQHE 1BTPA 4FUIA 1C5LH 1ZHMA 3RXKA 1LKAA 1ELDE 1N6YA 2QYIA 2J38A 3VPKA 2BY6X 1FX0B 2GDDA 4ZKRU 2WPJS 1UVOA 3DUXH 1ID5H 2CHAC 2CK3D 2AH4X 1W0ZU 3LGUA 5C17A 3I77A 1ZRKA 2ZIQH 2J98B 5C5NA 1NESE 1THSH 1DICA 4Q4LA 2Z3CA 5C0UA 2Y7XA 2FM2A 1O2SA 1UTMA 2OC1A 2WYJA 2ZF0H 4BTUB 3LGTA 2XBXA 3SJOA 1BTXA 1MKWK 4X1PU 2VVCA 4OS4A 1Z8RA 2B9LA 5FBIA 1C5XB 1TMUH 1L0ZA 3BTDE 4MNWA 2NU0E 2P94A 5EGMA 1VJAU 1O2MA 3OTPA 1SFQB 3A81A 1ELBA 4BAQB 1C1PA 1EZSC 3RLWH 1AB9C 3FP8E 3SZNA 1RXPA 2CHAB 1HNEE 2GCTC 3EDXB 3SU2A 3ZV9A 1GJ8B 1IQLA 2FOBA 1WBGB 3D62A 1BHXF 2B7DH 3ODFA 1ZJKA 5E0GA 3RXFA 1CT4E 3PLBA 1IQEA 2BDAA 2BLQA 5T6FA 3A8AA 4LOYH 1CVWH 2FOGA 4X6MA 4ABJA 4AFZA 1LDTT 3F9EA 3OEED 3Q77A 4NIXA 3SV7A 5I46H 1KTTB 4I8JA 1TGTA 5EXNA 5T3HA 1Y8TA 2ZHFH 1XX9A 4E7NA 1AB9B 1COWD 3ZVFA 3MFJA 1MTVA 2PKAB 1YCPK 2GCTB 1QQUA 2W6ID 5HIZA 2PLXA 2Y82A 3SJ8A 2NU4E 2J98A 3V13A 1CBWB 1KTSB 1DWDH 4MG3A 1V6DA 4MTBA 1CU1A 1GDQA 4OGYA 3K6ZA 1ZOMA 4YT7H 3NCLA 3ITIA 1SGIB 5AFZH 3SGAE 1Z8JB 1P02A 1C1UH 1E34B 1PPEE 1UTNA 2F4LA 4FOUC 1P03A 1NFUA 3MYWA 4Y8XA 5LPFA 3P95A 2A2XH 1C1VH 4K8YA 5EW2H 3TU7H 3TH3H 5A2MH 1DWCH 3BN9A 1Y5UT 3M61U 3N7EA 1BBRE 1NRSH 2ZFPH 1K1JA 1EXFA 3GY4A 1JOUB 1ABIH 3HPTB 5F8TA 1EP6A 1VKYA 1Q2WA 1AI8H 4I32A 3A7VA 5L2ZH 1ESBA 1EAIA 1AIXH 4BTIB 3F9FA 3BTFE 1NPMA 2BY9X 3K6YA 5TJXA 3RMOH 1DM4B 3T25A 1AVGH 1ZMJA 3MWIU 1PJPA 3SNBA 2HRVA 1E35B 3M37A 2VBCA 1F7ZA 2VWNA 4WXIA 1L1JA 2LELA 2ZGJA 3LGVA 3MU5A 2F9NA 1DXWA 2WSSD 2PKAA 2ZG0H 3FAOA 5LH8A 4MDSA 2EA3A 1L4DA 2BOKA 1F5RA 1ZYOA 2RDLA 3MOCA 4ZKSU 3SJKA 5FX5A 1V2OT 3M7TA 4DJZB 2XW9A 4DOQA 1V2VT 5FHTA 1DE7H 4AYYB 3LONA 2J94A 3BEUA 5E2PA 1G3BA 2GCHG 3K65B 3ZZCA 5A0CA 1O2UA 3SU6A 1V2LT 1GI2A 2LNCA 2XXLA 2ZFSA 4FUCA 2P93A 5FX6A 2SGDE 3MHWU 1SQTA 3KQDA 1F0UA 1HUTH 5E8EH 2VIWA 3PYHA 2A5IA 1A7SA 3TJUA 2SGAA 1UTLM 3ELAH 2F9VA 2IPQX 3RXDA 2CN0H 1TA6A 1GG6C 3DFLA 2KAIA 3V7TA 1P06A 5KGOA 4NSYA 4ACAA 4AG2A 1MAXA 2FLRH 1LVYA 3GICB 5DO4H 2ALPA 1YKTA 8KME2 1GGDC 2ZDMA 3QTVH 1TQ0B 3IITA 3M3VA 4Y0ZE 3T62A 1GMCG 2ZTZA 1H8ED 3OX7U 4MLFB 5LGOA 3F9GA 2JETB 1T32A 3SORA 4SGBE 4O3UA 4B71A 3GCOA 2GZ9A 1CO7E 3CP7A 2QXIA 1KY9A 2HNTC 2SGQE 2FOAA 4H42U 1GG6B 3M35A 2XBWA 1WU1A 1BIOA 1O3BA 4FUHA 2W7SA 1GJ6A 1VR1H 2ZTYA 1EKBB 1FN6A 1P2MA 1O3FA 4HTCH 4OS7A 4CH2B 5DK1A 1GGDB 4K2YA 4ZAEA 4MNXA 2TGPZ 4ZCNA 4FETA 4O97A 1W10U 3UREA 4JZ1A 1ZGIA 6CHAC 4TPYA 4CRFA 4DIHH 1EZUC 3JZ2B 1WXRA 1XUFA 4K8BA 1ELEE 1EAWA 2GJGA 3NPSA 7ESTE 3PV4A 4P02A 1Y3UA 4Y71A 3RXLA 8GCHF 1MBQA 3RC5A 3MH4A 1C5QA 2CF8H 1XXDA 1AQ7A 3MH5A 3SHAH 3P6ZB 2XOKD 1C5WB 2ZU2A 1VJ9U 3MNXA 4OS5A 3QGNB 1CA0C 3F1SB 2ESTE 2V3OH 4Z6AH 1P0SH 2UWPA 1P2IA 1GHXH 2C90B 3SJIA 4KELA 4YESB 2PSYA 1EAXA 1SKYE 2BDCA 4UEHH 5EJZA 4Y0YE 1GMDG 1XUJA 3S0NA 1W0JD 2O8MA 1SGTA 4FU9A 3KHVA 1RGQA 3Q3XA 4OGXA 3RLYH 1FI8A 1E36B 3GCNA 2D2DA 1SHYA 1SVPA 1HAOH 1GCTC 2VWMA 1LMWB 1O3IA 1P09A 2ZGCA 1P12E 1MQ6A 2OLGA 4X2XA 1HXFH 1LPKB 1O5DH 1A1RA 1TGNA 2VJ1A 3RXRA 4F4OC 4AGKA 3UQVA 1CA0B 1D3QB 2VIPA 4X2YA 1K1PA 1MKXH 3SGBE 4ZKOU 2BD2A 4YM9A 5DP5A 1AUTC 1TMTH 1TRMA 2F83A 4YLUA 2ZHEH 5E2OA 2SGEE 3JZ1B 1O5BB 2P8OC 5FBEA 2TIOA 3A7ZA 1FY3A 1GJ4H 3T5FH 3MH7A 1S83A 2R2MB 4U2WA 3DSGA 3GY6A 5EU8A 1GCTB 1K21H 3V0XA 3SNDA 1YPKH 1GBKA 1O3OA 2AMQA 3W95A 1G3EA 3S69A 1OP2A 1O3HA 4B74A 1C5PA 1GHVH 1KXCA 1RTLA 1GI0A 1LKBA 1TGSZ 2O8TA 2GT7A 1HAHH 1P9SA 3NK8A 3TVJB 1QRXA 1F0SA 1YPGH 3F68H 3ZZ3A 7KMEH 1FPCH 1KIGH 2STBE 2ZU5A 3BF6H 1QTFA 3MNBA 4CBNA 4DURA 3SV9A 1BJVA 1K22H 2FI5E 2OQ5A 2A1DB 3GDSA 5BRRE 1V3XA 1KLIH 2ZO3H 3ENSB 3RXIA 3RXEA 2QF3A 3A8BA 1X7AC 4A5TS 4U32A 1DITH 1UW7A 2RCEA 3O8DA 1SGDE 2TRMA 2NWNA 1G30B 1UK2A 2IPHA 1TONA 1BMAA 4A7IB 1BITA 1D4PB 2WPLS 1DSTA 1C2KA 3FN8A 4WXVA 1LHGH 4UONA 4XOJA 2PUQH 2QAAA 3VXFH 3MU8A 1FAKH 2ULLA 1S6LA 4D7GA 4B1TA 2VGCC 3WW7A 3U28C 1GBLA 1XUIA 3MO3A 1OPHB 1OSSA 2Z9LA 3E91A 2QCYA 3ZYEA 4AORA 4Q80A 1EOJA 3RMMH 1GBCA 1C5NH 1WSSH 2FWWA 3SV6A 2P3TB 1TFXA 3CNRA 1JWTA 1A0LA 4MNVA 2ZNKH 4TY6A 3QZQA 2BB4A 3ZZDA 2YMSC 2J95A 4AB8A 4NIWA 3RMLH 1TLDA 1BMFD 1O35A 1G2MA 2BLWA 4OS2A 3TNSA 1IHSH 1UTPA 2YMSD 1C1RA 2ASUB 4FVBA 1EFRD 4Y7AA 1GJBB 2VGCB 1PPZA 1SLVB 3K9XB 1H9IE 4NA9H 1FXYA 2A4OA 1JRSA 3GCHC 2V3HH 3RU4D 2C8WB 3LT3A 3KCGH 1O2KA 2FOFA 2PTCE 1P2KA 4BAMB 1BRCE 1GI5A 1QL7A 1NU7B 2ZPRA 3B23B 4MPXA 2J97A 3UFAA 2OUAA 3KQBA 3I78A 2HVYB 1FQ3A 1SGYE 5KECA 2UWOA 4ISHH 1Z1JA 1K1OA 1V2TT 2R3UA 3NZIA 1T4VH 1WV7H 5GCHG 2J4IA 2ZECA 2O9QA 1DS2E 2ZCKP 5HGGA 2ZPSA 1YCPM 1SOTA 1HAPH 5J4QA 5PTPA 1K1NA 3GCHB 4KTUA 1O32A 2A7CA 1EUFA 1SB1H 5AF9H 1GHZA 2GT8A 4I8LA 3PMBB 1V2WT 2DUCA 1UCYH 1GJ9B 2BLVA 4WY3A 5K7RA 2ZDNA 1DANH 5TCCA 1BHXB 3OAAD 4F48B 3BEFB 4IN2A 3C1KA 1OS8A 2BDHA 1V2MT 2ZU4A 1RIWC 1ZTJA 2WV9A 1KMHB 2JKHA 2Z3EA 1GMHF 1DUAA 1BMMH 2XNDD 1ELGA 2JDID 1C1NA 2CXVA 2QIQA 4HG6A 1C4U2 1NT1A 5ABWA 4IS5A 1V2JT 5T1VA 2XC4A 3A82A 3VB7A 1AVWA 1B7XB 1AMHA 2OBOA 1YLCA 2PFEA 2AYWA 1YLNA 2GV7A 4NCYA 2GTBA 3BTEE 4FU7A 1CGIE 3P70B 4RSPA 4YZUA 1AWHB 1AUJA 1C5UA 2F9BH 1SBWA 1C2HA 2QN5T 2ZHQH 2IOTA 4IN1A 3LH3A 4DY7B 1GI1A 4X8SH 1FUJA 2O8WA 1W0KD 2F43B 2AIPA 2VIVA 5L30H 2ZCHP 3V12A 3T28A 3FP6E 2Z94A 4GHQA 3CS7A 5GCHF 4XRNA 2GGVB 1E79D 4AC9A 4XBCA 3M5MA 1ANEA 3GYLB 1HAXB 3LGYA 5C5OA 1MTSA 4NA8A 4M7GA 4TY7A 1HAVB 5B6LA 2ZGXH 5F6MA 1D3TB 5AVDA 4NFFA 1NO9H 3BV9B 2EQNA 1F0TA 1QQ4A 2ZI2H 4CRCA 7GCHF 3Q00A 4Y79A 2QY0B 3F3BA 3ATMA 1NROH 1Z71A 2G4UA 3ZVGA 3ZZ4A 1SQOA 1A5GH 4INHA 1ESTA 4WMFA 4Z0KA 1BBRK 5EJ1A 1A46H 1D6WA 4I8GA 4WH6A 5C0TA 1BRUP 5DP9A 1FY5A 2G00A 2AGGX 2GP9B 1ZR0A 3TITA 2ZU3A 4X1RU 1O2XA 1GHBG 2AMPA 1W12U 2FS8A 2VWOA 3EYDA 4LXBH 9ESTA 1ELAA 1O3AA 1Q31A 4J2YB 1PYTC 4JZIA 4IGDA 2BZAA 1QURH 4BTTB 1B0FA 4IC6A 4ABFA 2BYAX 1O2RA 3P8OA 1OWDA 1MTWA 1PYTD 3N7OA 3P8FA 4J1YA 2GMTC 1C5TA 2WV5A 1YM0A 1KXBA 3GY8A 1O2PA 2ZFFH 4CRBA 3I29A 3TK6A 3RM2H 1W3CA 4K1SA 4K1EA 1GBDA 2KZ4A 1K2I1 1YPEH 2OC0A 2PGBB 1GI7B 5A8ZA 1SGCA 2H6MA 4WMDA 1MD7A 2HVXA 1A5HA 1LVBA 1ZPBA 3VG8A 3DFJA 2FIRH 4CRAA 2HNTE 1HAVA 4WJG2 3S9AA 1ANDA 3RXHA 2FX6A 3RM0H 2VIOA 1CBWC 1LO6A 1HIAA 1EB1H 1MMJN 5EJLA 1XVMA 1TGCA 1MCVA 2GMTB 3SU0A 2M2AA 2CGAA 3DSPA 3BTHE 3M36A 4I8HA 1CGJE 4YTAA 1Y59T 1FDPA 2VH6A 3BTKE 1M9UA 3OSYA 2AEIH 1MTUA 1N1LA 1O5GH 1WUNH 3ZVBA 3K2UA 3MNSA 1G37A 4R0IA 3W1EA 1BA8B 5EOKA 2B0FA 3U1IB 2FP7B 1MAYA 4ISOA 2Z9GA 1FIWA 1TBRH 2CMYA 2W6JD 3PWBA 2W5EA 1HAIH 4Y8YA 1OWIA 1KSNA 2F9PA 1ZPCA 2FLBH 4NG9H 1J8AA 1ZMLA 1KDQB 1SLUB 2Y6TA 3ESTA 6GCHG 2BVRH 2WPKS 1RRKA 2TGTA 1HYLA 4XSKU 1BTHH 1ZSKA 3ZZ7A 1QJ7B 3GY7A 3EA7A 5IK2D 3KYFA 3SGQE 4K1TA 3PMHB 1GBJA 5F8XA 1HAZB 2A7HA 2I6QA 1GWAA 2OCVB 2GX4A 5FAHA 1C4V2 1LQDB 4IBLH 3SNEA 1AZ8A 2VB0A 3MNCA 4F55A 3M5OA 4GPGA 2BD3A 5GWZA 1EX3A 2JJ1D 2ZKSA 1FMGA 2PGQB 4ZHAA 4UDWH 3IG6B 5ESTE 5ETXA 2XBYA 1VCWA 1NY22 1ZJDA 3SOSA 3A8CA 3O8BA 4MPWA 5JPMH 3NUMA 4ABHA 3LH1A 2OXSA 1N6XA 3M7QA 1MU8B 3RUOA 3H5CB 3SV2H 2ZA5A 2JH0D 3HK6B 1PQ5A 5CHAC 5DP6A 3T27A 3FP7E 1C5SA 3UY9A 2Q1JA 1BMLA 1XXFA 2ZDKA 4ASHA 2FODA 3DCLA 1O33A 1NC6A 4X0WU 2STAE 5H4IB 1Z6EA 4D9RA 3SUGA 1F5LA 4JZFH 1BOQA 1GBFA 1XM1A 3KNXA 1AHTH 3KQCA 1A4WH 1O31A 1DX5M 4ZHMU 1BMNH 4RT0A 1KDQA 2M5TA 2ZHDA 1O2ZA 2H5CA 5DSFA 4CR9A 1WYKA 5HYOA 4K60A 1DWEH 3PTBA 1A2CH 3BIVH 2TGDA 2XBVA 4B73A 1O2WA 1SLWB 1T7CA 1Y5BT 1D3DB 4X2VA 5CHAB 4A92A 2KX4A 2VU8E 3H09A 4JK5A 5EQSA 2JETC 3LKWA 2UUJB 1E37B 3LJOA 4XD7D 2NU3E 2ODQA 3D65E 4YOGA 1O3DA 2B5TB 1Y3WA 1P3CA 3E1XB 4HGCA 2WYGA 1LHCH 2PW8H 2SGFE 5ESBA 3U8OH 3H7OA 1S0QA 2GZ8A 2BY8X 4AZ2B 3QO6A 3DSOA 4LZ1H 1NFYA 2SGPE 1KYNA 3SN8A 5LPRA 2A31A 1IQGA 5FPSA 1O2OA 4DT4A 2BM2A 1O36A 2NU2E 3L3TA 1S5SA 2A2QH 4DVAU 1BB0B 3U1JB 1QNJA 2FS9A 3A85A 4X8UH 2ANKH 3Q3KA 1P57B 1VCQA 3WWFA 1AO5A 2ODYB 1O2YA 4IC5A 5AHGH 3SJ9A 2ZDAH 1O3EA 1Y3VA 1CT2E 1S81A 5CE1A 2AGIX 4D9QA 1GHAG 2EI7A 1FPHH 1C1MA 3GS9A 1FJSA 4OS6A 3UNQA 3GCTG 4AFQA 1NRPH 4ABEA 3MH6A 1P9UA 1QRWA 3P8NA 4B2AA 2ZCLP 3RU4E 1KXFA 1BQYA 1RJXB 2A4GA 2JIZD 2GCHF 2C3SA 3S7HB 4E05H 3SU3A 3NKKA 1GL0E 1GJ5H 2QE7D 1CHOG 2FDAA 2EI8A 1OWKA 2ZTXA 4YT6H 3WY8A 1IQHA 2PR3A 3SZEA 1F92A 3A80A 4ESTE 1BRBE 3GY5A 4BXWA 2XC0A 4BNRA 2JH5D 3R3GB 4OS1A 2HWLB 1DOJA 2ZU1A 3M3SA 3QN7A 1P04A 4SGAE 1C2FA 2BD7A 4BANB 5DP3A 1MZDA 1SR5C 1GVKB 3GDUA 4UFDH 1ABJH 3RC4A 5A8XA 3GYMA 2QF5A 2Y5HA 1JIRA 1IHTH 4RT1A 3PM3A 1E1QD 1GMCF 2ZQ1A 1WTGH 5KEDA 4RKJB 1UTQA 2AGEX 1O2LA 1LQEA 1UVPA 1ZLRA 4B6FA 4ZH8A 2D8WA 1ARCA 2Z7FE 3UAIC 1TNJA 3LU9B 2ILNA 4FUJA 3QGJA 2ZP0H 4IW4E 1NU9A 2QXHA 1SGFA 3V3MA 2WZQA 3T2NA 1O3GA 3ODDA 1TPOA 1QL8A 5GIBA 4MPUA 1QBNA 1UCYE 2OQUA 1MH0A 3RXGA 3U98H 3UNRA 1GHAF 3HGPA 1V2NT 4KP0A 1U6QA 4DIIH 2RG3A 1C1OA 1O37A 2VIDA 1BTUA 3ZVAA 1G3DA 3RXBA 2ZFRH 1BUIA 3MQKC 4HFPB 3PMJA 4JZEH 2XYAA 5B6OA 2PP6A 3VB5A 1ETRH 3U8TH 1SOZA 1P11E 2Q6DA 3BTME 1MKWH 5JB9S 4H6TA 4BOHA 4ABDA 2ANYA 4FVDA 2ZPQA 5EODA 1O2TA 1S0RA 3A83A 2ZQ2A 3MO9A 2HPQH 1K1IA 1HXEH 2D1JA 2P95A 2ZDLA 3U9AH 1UVTH 1A61H 2EC9H 3QK1A 1C5MD 4K69A 4YOIA 4KTCA 4HZHA 1GJCB 2VVUA 1WTHD 2VWLA 4NGAH 1H1BA 3SUFA 4AOQA 1GMDF 2BVSH 3PV2A 3E8LA 2THFB 3MU4A 2WV4A 2Z9KA 2H9TH 3HKJB 1YC0A 1IQFA 1LHFH 4TWWA 1C1TA 4WMEA 1YPHE 1L1NA 2OK5A 7LPRA 1E38B 1QA0A 5GNDA 1IOEA 3O8RA 4F49A 1GBBA 1DFPA 1MZAA 2FO9A 2WINI 1WDIA 2XTTB 4O03A 1NN6A 1XKBC 1TB6H 3EA8A 1RD3B 4ISLA 4Y7BA 1J14A 4GVUA 1HV7A 1MU6B 3EAJA 3SU5A 4CBOA 3E3TA 1YCPH 4I8KA 3RP2A 1OHHD 1OWHA 1C2DA 5A09A 4WWYA 3AK5A 4ABAA 1GJ7B 1QY6A 1SLXB 2KFWA 1MABB 5T6DA 1L2EA 1HPGA 4RKOB 1T31A 1HDTH 1V2UT 5DG6A 4DGJA 3LJJA 2F91A 1FAXA 2UUYA 1NRQH 1JRTA 3RXMA 1BZXE 1QJ6B 3PWCA 4FU8A 3SBKA 4Y11E 3OY5U 4JYTA 1L1GA 1MBMA 1AD8H 2VINA 3BIUH 1INCA 2BQWB 5HM2A 2FEQH 3TGIE 3ZYDA 2J9NA 1OWEA 2ZFQH 2HGTH 1MD8A 1TE0A 5JBBS 1BCUH 2K0QA 1GJDB 4GHTA 3MU1A 1HLTH 2A32A 3TGKE 4MPVA 1HFDA 4GLYA 1EJNA 1UJ1A 1C2GA 4YOJA 1AN1E 1YBWA 1C2EA 2ZDVH 1VGCC 2UUKB 1RS0A 4FUBA 2RDEA 1TAWA 1ZTKA 3BEIB 5HM9A 5C1XA 5EXLA 1FNIA 3KIDU 1OP0A 1RTKA 5JBAS 1YP9A 4ACBA 2QF0A 2FESH 1DWBH 1XKAC 3RXUA 2AERH 3CENA 1EJMA 1UHBB 1K1LA 1O5AB 1OXGA 3ATKA 1TPSA 4AB9A 2QF4A 1O3JA 1TIOA 1FONA 1P01A 1VITG 2A45B 1GI3A 1W7XH 2WUBA 1O38A 2BD5A 3ZZ5A 1H4WA 1ELVA 3MI4A 1O2HA 2WPHS 3C27B 1O5CB 1QBVH 3QX5H 1C5VA 1AFEH 1VGCB 2ANWA 3LOXA 1BRAA 4D8NA 3OTJE 1PPHE 1P2JA 1S82A 1A0JA 1GBMA 1A3BH 1HGTH 1XMNB 5IYTA 2J92A 2O8LA 3STJA 5C67A 4JMYA 2YNBA 2QC2A 2OD3B 3HGNA 2FI4E 1LCYA 3HK3B 4Z1MD 1K9OE 3AAVA 1Y3YA 4B76A 3BG8A 1TGBA 1OP8A 1SFIA 1EZXC 1ACBE 3BTTE 4ABIA 3PRDA 4RI0A 3G01A 3EGKH 2ALVA 1GHWH 4MNYA 2UWLA 2FYRA 2D26C 4Q7ZA 1Q3XA 1UVUH 1V2ST 3OYPA 3SU4A 2QXGA 4A1TA 4DG4A 5A8YA 4I7YH 1ETTH 3M3TA 1AWFH 1EATA 3UNSA 4INLA 2ODPA 1PPFE 5DKMA 1TABE 1THRH 3RXCA 2C8ZB 3TJOA 1GBAA 1O2JA 1IAUA 4I31A 5L2YH 3STIA 3RXTA 1KLTA 1Z8GA 1H8DH 3SV8A 1MUEB 3TJNA 5JBTA 3A7YA 5T6GA 1UHBA 3KL6A 3KYGA 3GISB 1BDAA 1W14U 3UB0A 1QL9A 4ASUD 3P17H 4X6PA 3SI4H 2EY4C 2FZZA 3PROA 4UFEH 1DSUA 3LGWA 1VITF 4U30A 3Q76A 5CMXH 3SU1A 3A7TA 5F03A 1HCGA 5CDFE 3VB4A 1ESAA 1LPGB 2A5AA 1QCPA 1O2NA 1MQ5A 1H9LB 1QJ1B 1TX7A 1ELTA 3ZV8A 1SGEE 1K1MA 2W3KA 5G4BA 3DD2H 4ISIH 2UUFB 2OC8A 1A0HB 1FLEE 3SHCH 2L6OA 4OM9A 1T4UH 1UMAH 2FPZA 1EASA 1EAUA 3RXOA 3UQOA 3AW1A 4LK4A 1TYNA 2AS9A 3TH4H 2BDYA 3ZIAD 3SUEA 2F3CE 1TOMH 2EI6A 4B2CA 1W11U 3TJVA 1NBMD 3NWUA 1MKXK 3PO1C 3FVFB 2OC7A 1A5IA 1C5ZB 5C3NA 4PROA 4XDEA 1AE5A 4Q7YA 3E0NB 2TPIZ 2B8OH 4LZ4B 1GI6A 1K0HA 1VCPA 4ISNA 4THNH 4CREA 1Z7KA 3ATWA 1GJAB 3FZDA 1B5GH 1SGRE 2FYQA 1JXPA 1PPBH 1C5OH 4BAKB 1YLDA 1J16A 3PMAB 2V6NA 2Z6BD 3ZVDA 2G5VA 3NRLA 1GVLA 1OWJA 2L74A 1TPAE 2V3MA 1H8HD 2ZEBA 2RFKC 1IQKA 2XCFA 3OU0A 1J9CH 1QB6A 1AGJA 3PO1B 4JK6A 5JB8S 3PV5A 1JBUH 3EE7A 1O34A 2A7JA 4FXGH 4X8TH 3VB3A 2BXUH 2HALA 1H9HE 1WAYB 1HJ8A 3AAUA 1O3MA 3HATH 1UK3A 1W8BH 1GBTA 2KCOA 5I25A 1JIMA 5EIYA 3A7XA 2KR7A 3IWMA 3LPRA 4UFFH 1Y5AT 1QGFA 1GHBF 3Q3YA 4U01A 3UR9A 2IN2A 3URCA 3EA9A 4P00A 4X1NU 3TIUA 3TK9A 2WPIS 3KGPA 1B0EA 1EOLA 1G9IE 4XE4A 1V2QT 2BXTH 3QLPH 5GPIB 2BD8A 3RC6A 4MQAA 4X1SU 1P10A 4R8TB 2H1UA 3S7KB 4DW2U 4H4FA 3F2GA 5FXLA 4NZLA 1DXPA 2C4FH 1O2GH 3N99A 2P59A 2Y81A 1D6RA 1TBZH 2ZZUH 2QV1A 3GDVA 3MTYA 3F2FA 1ORFA 4CRDA 2SNVA 2V0BA 2V7QD 1QIXB 5E0JA 1MCTA 2F9UA 1A3EH 2H9EH 2TBSA 3DHKH 2QGRA 1NRNH 2K1QA 2BD9A 1OYTH 1EJAA 2CF9H 5E0HA 4YO9A 2PUXB 2KAIB 2G4TA 4INKA 1YPLH 3F0OA 3ZZ6A 1CE5A 4AN7A 4FUFA 3QDZB 2CJIA 3SNCA 2BQ6B 5FL7D 3UWIA 2J5UA 3VGCC 1TRYA 1C5YB 2QXJA 4KGAA 1E0FD 1HJAC 2PHBA 2A0QB 2KCPA 3OEHD 5DJ7A 5C1UA 3KF2A 3M5LA 2ZGHA 1NFXA 3O8CA 2J34A 4BXSA 4GAWA 6GCHF 2C8YB 3B9FH 5F8ZA 5C1YA 2ZC9H 4WF8A 2FOEA 3VEQB 3ZVCA 3PB1E 4UE7H 5EG4A 2Y80A 1BT7A 1C2IA 2HLCA 4Y10E 8ESTE 1UTJA 2IJOB 3URDA 3CS0A 3M7UA 4A1VA 2BDBA 2P3UB 2QA9E 1DVAH 4B2BA 1W7GH 1S84A 4VGCC 2A4QA 3RMNH 1NFWA 2Q6FA 2ZGBH 1QRZA 2C8XB 1EP5A 1UCYK 3EE0B 2BVXH 2FX4A 1FY1A 1LTOA 1OKXA 1EPTC 2DE8A 1GL1A 3VGCB 3SUDA 4FUDA 1FV9A 4NWKA 4AFSA 1TWXB 2BMGB 1HJAB 4HI3A 4TYDA 3UOUA 2DE9A 2Y7ZA 2A4RA 1P2OA 1ZPZA 2FMJA 1FY8E 2PKSC 2RA0A 2W7UA 8GCHG 4CHAC 1SL3A 3ZZAA 4TWYA 1XVOA 2FOHA 1WQSA 1GDUA 4ABBA 2FOCA 1S6FA 1V2RT 1EB2A 2BY5X 4XFQA 3M5NA 3RXSA 4AGJA 3LC5A 1KXEA 3A86A 3KN2A 2KCYA 4JCNA 3RXAA 5L6NH 1ZMNA 4RN6A 3L33A 3PLKA 3A87A 4VGCB 1WCZA 3FKSD 1SMFE 1CGHA 5EQRA 1G2LA 2PWXA 1EPTB 1C9TA 1TOCB 3RU4T 2VH0A 1ZSJA 3VXEH 1PQ8A 2G8TA 2PKSB 3KEEA 1DY8A 4CHAB 1P05A 1DUEA 5C20A 1WOFA 5DGJA 4DT7B 1W13U 3A88A 1GHYH 4E7RG 2NU1E 1TNLA 3F2HA 1O3LA 2Z9JA 4GSOA 2G81E 4FUEA 4AG1A 6LPRA 1IQJA 4Y8ZA 2OBQA 5FCRA 2KCAA 1IQMA 1GI4A 4A1XA 2FTMA 2YOLA 2BZ6H
chains in the Genus database with same CATH topology
3SNAA 1SGQE 2O8UA 3TK5A 3DT0H 1S85A 1P2NA 1IQIA 5C2ZA 2GV6A 3SW2B 5FPYA 2G55A 2Y5FA 1LHEH 9LPRA 2I6SA 3P92A 4ZHLU 4TPIZ 1G36A 3A84A 1O3NA 2R0LA 1AY6H 3MMGA 2GDEH 1RTFB 1UO6A 1O2IA 1FIZA 3UPEA 1BTWA 4DCDA 4O9VA 1O3CA 1O3PB 2RA3A 1VZQH 2C93B 3QZRA 4AFUA 3D23A 2SNWA 1LVOA 1OOKB 3A8DA 2BX4A 1TX6A 1GCDA 3UIRA 2BX3A 1D9IA 1AZZA 1EPTA 1QA7A 4ABGA 1BBRH 3RXPA 2BDGA 1AU8A 6CHAB 2F9OA 4ZROA 1OX1A 4X6OA 1SGFG 1EZQA 1CSOE 1LHDH 1ZGVA 2LPRA 1QR3E 3E0PB 4X1QU 1TNHA 4FUGA 3GCTF 2XNIA 3MO6A 4O3TA 3UUZA 4JZDH 1TNKA 3FFGA 3SQEE 1CHGA 5FPTA 2A5KA 5HXFA 4AX9H 5GXPA 1CHOF 3RXVA 5A0BA 2OTVA 2CV3A 1G3CA 2G51A 1V2PT 1HAGE 1SG8B 2FI3E 2G52A 3H7TA 2ZWLH 1XUHA 1UK4A 1J15A 1EQ9A 1HBTH 1DDJA 2BHGA 3TPIZ 4NA7A 5BPEA 2XC5A 3FANA 3BTQE 3R0FA 2BDIA 3BG4C 4WH8A 1DLKB 3QTOH 1C4Y2 1TX8A 2R2WU 1NZQH 1J17T 1SGNE 1YYY1 3BTGE 4IMQA 1THPB 4GCHG 1SI5H 3ZZ9A 4D76A 3ATIA 3F6UH 1TNIA 1GDNA 1TQ7B 2ZHWH 2ZFTA 1ELCA 5DP4A 1C2MA 4Q2KA 1VITH 2EEKA 3ZZBA 4NSVA 4JYUH 1QHRB 1GPZA 1ANCA 5EW1H 3PTNA 2P8OB 3NXPA 3KQEA 1W0YH 1F0RA 1LVMA 5K0HA 1C5RA 1AKSB 5EQQA 3BG4B 2Z3DA 5J4SA 1ARBA 4UFGH 4NZQA 4CH8B 4X2WA 1Z8IB 1DY9A 4NFEA 5EPYA 2W3IA 3GY3A 1Z6JH 3RXJA 1SGPE 2GKVE 1YPMH 4ZXYH 3T26A 1GBIA 3PLPA 2BOHB 1P3EA 1IQNA 1F2SE 2HNTF 3VFEA 3A7WA 1W2KH 2XCNA 1DT2A 1NS3A 1T8LA 5HMAA 2R9PA 1MTNC 1V2KT 3W94A 1CT0E 1O0DH 5IDKA 4X6NA 1ZHPA 4NIVA 1K28D 1O3KA 1QB9A 4A6LA 3SI3H 6ESTA 3BTWE 1SHHB 1TPPA 2GVFA 1WQVH 2JH6D 1O5FH 1O2QA 4I33A 2XWBI 1GMHG 4X8VH 3A89A 5JBCS 4GCHF 2AMDA 2OP9A 1C9PA 2Q6GA 2BY7X 1SC8U 1P8VC 1RFNA 1XUKA 1C2JA 3SO3A 4D7FA 1F5KU 2XWAA 2GD4B 2FTLE 4GUXA 1T8OA 2WUCA 5A0AE 4ZMAH 2J2UA 1UTKA 1C1WH 4B75A 3AVZA 4Y76A 4Y6DA 1DLEA 3F9HA 3UTUH 3D49H 1AKSA 1PPGE 2GZ7A 1TBQH 1MTNB 4YLQH 3LDXH 1ZSLA 1N8OC 3B8JA 1BTZA 3DA9B 3TNTA 1G32B 3ZZ8A 1TRNA 1YGCH 2PTNA 1KXDA 4KTSA 3LIWA 1O2VA 3FZZA 2R3YA 1FN8A 2VIQA 4QT8C 1ANBA 4Q7XA 4ZXXH 3E90B 2WPMS 3UWJH 1AFQC 4AYVB 1QB1A 1CA8B 2AFQB 4BAOB 1DPOA 2XRCA 1O39A 1PQ7A 1ZRBA 3EQ0H 4CR5A 4NIYA 5EPNA 3S9BA 3T29A 5DP8A 1UTOA 3E6PH 1LPZB 1O30A 1L4ZA 2PV9B 1UVSH 4K5ZA 2HOBA 7GCHG 2HPPH 5TCAA 5LPEA 1SSXA 1P2QA 3S9CA 3MU0A 1ZHRA 2FOMB 3LC3A 1N8OB 1YF4A 1Y3XA 2Z9IA 5JYIA 1BTYA 1T8NA 3QUMP 5EXMA 3E16B 1O5EH 1NRRH 1Z1IA 3RDZA 1BJUA 4ZKNU 3TH2H 1C1SA 1PPCE 1ZTLA 1HRTH 2AIQA 3U8RH 1D3PB 2H5DA 1OYQA 2VVVA 4MVNA 1AFQB 5DPAA 1ETSH 4E06H 3U69H 1CQQA 3P8GA 1C2LA 1QFKH 4K3JA 3AW0A 4H6SB 1H8IH 3HKIB 1TMBH 1JMOH 2R0KA 1PQAA 5SGAE 4UD9H 1NTPA 1AE8H 3AASA 1HAYB 1GI9B 3OY6U 2H2ZA 1C1QA 3TLOA 2BQ7B 1S6HA 1PFXC 4XBDA 1SPJA 4JYVH 2H9HA 1KXAA 5JDUB 2ANMH 3TGJE 2V35A 5DP7A 1T8MA 1KLJH 1TA2A 4KKDA 5GJ4B 2SFAA 1RIWB 4CRGA 5GDSH 4NWLA 2P3FH 2P16A 3UR6A 2Y5GA 2BLOA 1FY4A 4ZUHA 1GVZA 4XBBA 1GBEA 1NM6A 3GOVB 4BAHB 3LGIA 1GBHA 1ELFA 1XUGA 4IMZA 1SQAA 2BD4A 3UOPA 2VNTA 2BTCE 1HJ9A 3QWCH 1TALA 3L6PA 3ATLA 3RXQA 2YNAA 1HB0B 2OINA 5AFYH 1HIAB 1TNGA 1ZZZA 1AVXA 1YPJH 3BSQA 4WVPE 1YPHC 8LPRA 3ZVEA 1QBOA 2FXRA 2W26A 1GI8B 1FZZA 2G5NA 3GY2A 5FCKA 2TGAA 3VB6A 2PSXA 3SQHE 1BTPA 4FUIA 1C5LH 1ZHMA 3RXKA 1LKAA 1ELDE 1N6YA 2QYIA 2J38A 3VPKA 2BY6X 2GDDA 4ZKRU 2WPJS 1UVOA 3DUXH 1ID5H 2CHAC 2AH4X 1W0ZU 3LGUA 3I77A 1ZRKA 2ZIQH 5C5NA 1NESE 1THSH 1DICA 2Z3CA 2Y7XA 2FM2A 1O2SA 1UTMA 2OC1A 2WYJA 2ZF0H 4BTUB 3LGTA 2XBXA 3SJOA 1BTXA 1MKWK 4X1PU 2VVCA 4OS4A 1Z8RA 2B9LA 5FBIA 1C5XB 1TMUH 1L0ZA 3BTDE 4MNWA 2NU0E 2P94A 5EGMA 1VJAU 1O2MA 1SFQB 3A81A 1ELBA 4BAQB 1C1PA 1EZSC 3RLWH 1AB9C 3FP8E 3SZNA 1RXPA 2CHAB 1HNEE 2GCTC 3EDXB 3SU2A 3ZV9A 1GJ8B 1IQLA 2FOBA 1WBGB 3D62A 1BHXF 2B7DH 3ODFA 1ZJKA 5E0GA 3RXFA 1CT4E 3PLBA 1IQEA 2BDAA 2BLQA 5T6FA 3A8AA 4LOYH 1CVWH 2FOGA 4X6MA 4ABJA 4AFZA 1LDTT 3F9EA 3Q77A 4NIXA 3SV7A 5I46H 1KTTB 4I8JA 1TGTA 5EXNA 5T3HA 1Y8TA 2ZHFH 1XX9A 4E7NA 1AB9B 3ZVFA 3MFJA 1MTVA 2PKAB 1YCPK 2GCTB 1QQUA 2PLXA 2Y82A 3SJ8A 2NU4E 3V13A 1CBWB 1KTSB 1DWDH 4MG3A 1V6DA 4MTBA 1CU1A 1GDQA 4OGYA 3K6ZA 1ZOMA 4YT7H 3NCLA 3ITIA 1SGIB 5AFZH 3SGAE 1Z8JB 1P02A 1C1UH 1E34B 1PPEE 1UTNA 1P03A 1NFUA 3MYWA 4Y8XA 5LPFA 3P95A 2A2XH 1C1VH 4K8YA 5EW2H 3TU7H 3TH3H 5A2MH 1DWCH 3BN9A 1Y5UT 3M61U 1BBRE 1NRSH 2ZFPH 1K1JA 1EXFA 3GY4A 1JOUB 1ABIH 3HPTB 5F8TA 1EP6A 1Q2WA 1AI8H 4I32A 3A7VA 5L2ZH 1ESBA 1EAIA 1AIXH 4BTIB 3F9FA 3BTFE 1NPMA 2BY9X 3K6YA 5TJXA 3RMOH 1DM4B 3T25A 1AVGH 1ZMJA 3MWIU 1PJPA 3SNBA 2HRVA 1E35B 3M37A 1F7ZA 2VWNA 4WXIA 1L1JA 2ZGJA 3LGVA 3MU5A 2F9NA 1DXWA 2ZG0H 2PKAA 3FAOA 5LH8A 4MDSA 2EA3A 1L4DA 2BOKA 1F5RA 1ZYOA 2RDLA 3MOCA 4ZKSU 3SJKA 5FX5A 1V2OT 3M7TA 4DJZB 2XW9A 4DOQA 1V2VT 5FHTA 1DE7H 4AYYB 3LONA 2J94A 3BEUA 5E2PA 1G3BA 2GCHG 3K65B 3ZZCA 5A0CA 1O2UA 3SU6A 1V2LT 1GI2A 2LNCA 2XXLA 2ZFSA 4FUCA 2P93A 5FX6A 2SGDE 3MHWU 1SQTA 3KQDA 1F0UA 1HUTH 5E8EH 2VIWA 3PYHA 2A5IA 1A7SA 3TJUA 2SGAA 1UTLM 3ELAH 2F9VA 3RXDA 2CN0H 1TA6A 1GG6C 3DFLA 2KAIA 3V7TA 1P06A 4NSYA 4AG2A 1MAXA 2FLRH 1LVYA 3GICB 5DO4H 2ALPA 1YKTA 8KME2 1GGDC 2ZDMA 3QTVH 1TQ0B 3IITA 3M3VA 4Y0ZE 3T62A 1GMCG 2ZTZA 3OX7U 4MLFB 5LGOA 3F9GA 2JETB 1T32A 3SORA 4SGBE 4O3UA 4B71A 3GCOA 2GZ9A 1CO7E 3CP7A 2QXIA 1KY9A 2HNTC 2SGQE 2FOAA 4H42U 1GG6B 3M35A 2XBWA 1WU1A 1BIOA 1O3BA 4FUHA 2W7SA 1GJ6A 1VR1H 2ZTYA 1EKBB 1FN6A 1P2MA 1O3FA 4HTCH 4OS7A 4CH2B 5DK1A 1GGDB 4K2YA 4ZAEA 4MNXA 2TGPZ 4O97A 1W10U 3UREA 4JZ1A 1ZGIA 6CHAC 4TPYA 4CRFA 4DIHH 1EZUC 3JZ2B 1XUFA 4K8BA 1ELEE 1EAWA 3NPSA 7ESTE 3PV4A 1Y3UA 4Y71A 3RXLA 8GCHF 1MBQA 3RC5A 3MH4A 1C5QA 2CF8H 1XXDA 1AQ7A 3MH5A 3SHAH 3P6ZB 1C5WB 2ZU2A 1VJ9U 3MNXA 4OS5A 3QGNB 1CA0C 3F1SB 2ESTE 2V3OH 4Z6AH 1P0SH 2UWPA 1P2IA 1GHXH 2C90B 3SJIA 4KELA 4YESB 2PSYA 1EAXA 4UEHH 2BDCA 4Y0YE 1GMDG 1XUJA 3S0NA 2O8MA 1SGTA 4FU9A 3KHVA 1RGQA 3Q3XA 4OGXA 3RLYH 1FI8A 1E36B 3GCNA 2D2DA 1SHYA 1SVPA 1HAOH 1GCTC 2VWMA 1LMWB 1O3IA 1P09A 2ZGCA 1P12E 1MQ6A 2OLGA 4X2XA 1HXFH 1LPKB 1O5DH 1A1RA 1TGNA 2VJ1A 3RXRA 4F4OC 4AGKA 3UQVA 1CA0B 1D3QB 2VIPA 4X2YA 1K1PA 1MKXH 3SGBE 4ZKOU 2BD2A 4YM9A 5DP5A 1AUTC 1TMTH 1TRMA 2F83A 4YLUA 2ZHEH 5E2OA 2SGEE 3JZ1B 1O5BB 2P8OC 5FBEA 2TIOA 3A7ZA 1FY3A 1GJ4H 3T5FH 3MH7A 1S83A 2R2MB 4U2WA 3GY6A 5EU8A 1GCTB 1K21H 3V0XA 3SNDA 1YPKH 1GBKA 1O3OA 2AMQA 3W95A 1G3EA 3S69A 1OP2A 1O3HA 4B74A 1C5PA 1GHVH 1KXCA 1RTLA 1GI0A 1LKBA 1TGSZ 2O8TA 2GT7A 1HAHH 1P9SA 3NK8A 3TVJB 1QRXA 1F0SA 1YPGH 3F68H 3ZZ3A 7KMEH 1FPCH 1KIGH 2STBE 2ZU5A 3BF6H 1QTFA 3MNBA 4CBNA 4DURA 3SV9A 1BJVA 1K22H 2FI5E 2OQ5A 2A1DB 3GDSA 5BRRE 1V3XA 1KLIH 2ZO3H 3ENSB 3RXIA 3RXEA 2QF3A 3A8BA 1X7AC 4A5TS 4U32A 1DITH 2RCEA 3O8DA 1SGDE 2TRMA 2NWNA 1G30B 1UK2A 2IPHA 1TONA 1BMAA 4A7IB 1BITA 1D4PB 2WPLS 1DSTA 1C2KA 4WXVA 1LHGH 4UONA 4XOJA 2PUQH 2QAAA 3VXFH 3MU8A 1FAKH 2ULLA 4D7GA 4B1TA 2VGCC 1GBLA 1XUIA 3MO3A 1OPHB 1OSSA 2Z9LA 3E91A 2QCYA 3ZYEA 4AORA 4Q80A 1EOJA 3RMMH 1GBCA 1C5NH 1WSSH 2FWWA 3SV6A 2P3TB 1TFXA 1JWTA 1A0LA 4MNVA 2ZNKH 4TY6A 3QZQA 2BB4A 3ZZDA 2J95A 4AB8A 4NIWA 3RMLH 1TLDA 1O35A 1G2MA 2BLWA 4OS2A 3TNSA 1IHSH 1UTPA 1C1RA 2ASUB 4FVBA 4Y7AA 1GJBB 2VGCB 1PPZA 1SLVB 3K9XB 1H9IE 4NA9H 1FXYA 2A4OA 1JRSA 3GCHC 2V3HH 3RU4D 2C8WB 3LT3A 3KCGH 1O2KA 2FOFA 2PTCE 1P2KA 4BAMB 1BRCE 1GI5A 1QL7A 1NU7B 2ZPRA 3B23B 4MPXA 3UFAA 2OUAA 3KQBA 3I78A 1FQ3A 1SGYE 2UWOA 4ISHH 1Z1JA 1K1OA 1V2TT 2R3UA 3NZIA 1T4VH 1WV7H 5GCHG 2J4IA 2ZECA 2O9QA 1DS2E 2ZCKP 5HGGA 2ZPSA 1YCPM 1SOTA 1HAPH 5J4QA 5PTPA 1K1NA 3GCHB 4KTUA 1O32A 2A7CA 1EUFA 1SB1H 5AF9H 1GHZA 2GT8A 4I8LA 3PMBB 1V2WT 2DUCA 1UCYH 1GJ9B 2BLVA 4WY3A 5K7RA 2ZDNA 1DANH 5TCCA 1BHXB 3BEFB 4IN2A 3C1KA 1OS8A 2BDHA 1V2MT 2ZU4A 1RIWC 1ZTJA 2JKHA 2Z3EA 1GMHF 1DUAA 1BMMH 1ELGA 1C1NA 2CXVA 2QIQA 1C4U2 1NT1A 5ABWA 4IS5A 1V2JT 2XC4A 3A82A 3VB7A 1AVWA 1B7XB 1AMHA 2OBOA 1YLCA 2PFEA 2AYWA 2GV7A 4NCYA 2GTBA 3BTEE 4FU7A 1CGIE 3P70B 4RSPA 4YZUA 1AWHB 1AUJA 1C5UA 2F9BH 1SBWA 1C2HA 2QN5T 2ZHQH 2IOTA 4IN1A 3LH3A 4DY7B 1GI1A 4X8SH 1FUJA 2O8WA 2AIPA 2VIVA 5L30H 2ZCHP 3V12A 3T28A 3FP6E 2Z94A 4GHQA 3CS7A 5GCHF 2GGVB 4XBCA 3M5MA 1ANEA 3GYLB 1HAXB 3LGYA 5C5OA 1MTSA 4NA8A 4M7GA 4TY7A 1HAVB 2ZGXH 5F6MA 1D3TB 5AVDA 4NFFA 1NO9H 3BV9B