2OP9A

Substrate specificity profiling and identification of a new class of inhibitor for the major protease of the sars coronavirus
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
302
structure length
302
Chain Sequence
ASGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replicase polyprotein 1ab (pp1ab, ORF1AB) 3C-like proteinase
publication title Substrate Specificity Profiling and Identification of a New Class of Inhibitor for the Major Protease of the SARS Coronavirus.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
total genus 88
structure length 302
sequence length 302
chains with identical sequence B
ec nomenclature ec 3.4.22.-:
pdb deposition date 2007-01-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2op9A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2op9A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2op9A02
1A0LA 3GY8A 1K22H 1N6YA 2P3UB 2W3IA 5A8YA 2V3OH 4H6TA 2AIQA 2ESTE 1GDQA 3FAOA 3RXEA 2ZFRH 1C5XB 1YC0A 5A2MH 1C2IA 4ZKOU 1LHEH 4NIYA 1SSXA 4X1QU 4I8GA 3VB6A 2IN2A 2ZHFH 3PO1C 5AHGH 1EJMA 1EUFA 1TALA 1FAKH 1ANEA 3K6YA 3LH1A 2BQ7B 1Y8TA 1YYY1 2B7DH 2WPIS 2ZI2H 3FP7E 5EQRA 1GHWH 5BPEA 4XBCA 2DUCA 1FDPA 1AFEH 2P3FH 2ZKSA 4JMYA 5GIBA 5TCAA 3MU8A 1IQEA 2Z9IA 1QBNA 2PV9B 1SR5C 1QQUA 4AX9H 3JZ1B 1EXFA 1SGFA 4X0WU 1SHHB 3SU0A 1LCYA 3RXTA 4XDEA 4KTCA 1FQ3A 2ZU1A 2D26C 2SGFE 3ZVCA 1B5GH 2GX4A 1H9LB 1SI5H 2Z7FE 2XCFA 1D9IA 1TMUH 3GCOA 2QIQA 2Z9JA 1OP2A 2OC8A 4CHAC 1UK2A 9LPRA 1K1JA 4JZEH 1GMCG 1YKTA 3KNXA 3OTJE 3A8AA 1NU7B 4VGCC 3RXAA 3M7UA 3A83A 2SGAA 1UVUH 2FESH 3ITIA 1XVOA 3RXCA 1BRAA 2AIPA 1D4PB 3E16B 1FPHH 1HXEH 2FMJA 2PUQH 1MTVA 4KTUA 5HYOA 4YT7H 1P9UA 4ESTE 5J4SA 2Y80A 3ZYEA 1O3FA 1TAWA 5HM9A 1QJ1B 1YP9A 5T6GA 2C8WB 1T4UH 4UD9H 3RU4D 2O8TA 3V7TA 1SQOA 3ZZ4A 3GCNA 2BXUH 1G30B 1QURH 1W3CA 1DWEH 2HLCA 4MQAA 4OS1A 4CH2B 2BTCE 1EAUA 3LIWA 1EKBB 1P57B 5F8TA 3SV8A 5C1XA 2J34A 1HJAC 4NZLA 3DHKH 2XBYA 3NCLA 1MTNB 1LTOA 1FXYA 1SGFG 3LPRA 4LOYH 5ESTE 1K28D 1M9UA 2HPQH 2ZFSA 1CHOF 1LHCH 3E0NB 2QY0B 1E36B 1AVGH 1NTPA 1RFNA 2J95A 2UWPA 2SGDE 3Q77A 4HGCA 3E6PH 4XBBA 1QJ7B 1A5IA 4Y8XA 3D23A 1CVWH 1GCTC 5I46H 1W12U 1GMDF 1QQ4A 2TPIZ 4U01A 1BTZA 4BTUB 3TK6A 1GI1A 3LONA 1G2LA 2ZHWH 1C5MD 1HRTH 3RXGA 2BZAA 4IS5A 2ANMH 3RXPA 5F8XA 3U9AH 3SUGA 1UHBB 4AG2A 2Z9GA 3LDXH 1O2KA 1YLCA 1BTPA 1GL1A 1ZRKA 4GLYA 2TGAA 1KXCA 3URCA 1GG6C 1MZAA 2ZA5A 3AAVA 1SMFE 3TVJB 1TWXB 5FHTA 1EZXC 2KAIB 2VU8E 3P8NA 2JETB 2UUKB 3GY6A 3I77A 1FN8A 3TJNA 1MTWA 4AFSA 1HFDA 2IJOB 2TIOA 1V6DA 3BG4B 1SLXB 1P09A 1LVYA 1FMGA 4WY3A 2I6QA 4JK5A 3PLPA 4NFFA 5E0HA 4CRAA 1SHYA 3ZVGA 2BY8X 2Y6TA 1G3BA 3MYWA 4WJG2 5ETXA 1NM6A 1PYTC 1WBGB 2FM2A 3H7TA 1MAYA 4MNVA 4IW4E 4JK6A 4WH8A 1GI0A 3EA8A 1PPFE 4B74A 1GBMA 1THSH 2ZU2A 1GI3A 1UTKA 1EAIA 1LVMA 3F9HA 1YCPH 3AVZA 1NY22 1TNHA 2LNCA 4ZAEA 1TRYA 3W94A 3EQ0H 4I31A 2QXIA 3RMMH 5EPYA 4DT7B 1F92A 4ZMAH 1TGTA 3VEQB 2ODPA 2FZZA 3O8CA 4I32A 2GZ7A 2PHBA 2KAIA 5L6NH 2SNWA 3O8DA 1IHTH 3SJ9A 4RKOB 3GISB 2GV7A 4Y0ZE 1DY8A 2OC7A 1P02A 4K1SA 1GHXH 1O2MA 2EI7A 1C2EA 2FOFA 2FOBA 4Y71A 1P11E 1UTPA 3AW1A 2BHGA 2BZ6H 3AAUA 1NS3A 1ZSLA 3ZZ5A 1ZTLA 4WMFA 3LJJA 1UK4A 1LVBA 1H9IE 4NG9H 5LPEA 1XUKA 2GMTC 2ZNKH 2SGEE 3GYMA 3LGWA 3SJKA 1BRBE 3V0XA 4HZHA 4AFZA 3LH3A 2VH6A 3KF2A 5DPAA 3MNBA 1ANDA 2WUBA 2FXRA 2QGRA 1GJCB 4FXGH 3CS7A 1C1UH 5FPYA 3SU3A 1AU8A 1GDNA 1TNGA 1V2QT 2ZCHP 1O32A 2C8ZB 2Q1JA 1AZZA 1O2SA 4AOQA 1TONA 3F6UH 1D3QB 4ZXYH 3UNSA 2OCVB 1VITF 1AD8H 2FDAA 1VCPA 2GDDA 1O3AA 4AGJA 2RG3A 2SGPE 1H8IH 1OKXA 3U1JB 1V2PT 1JIRA 5FCKA 3TJOA 1GJ8B 1TABE 1FY4A 5F6MA 4Z0KA 5L2YH 1XKAC 2XRCA 2GDEH 2BDBA 1KSNA 2J94A 1ZTJA 1SVPA 2V35A 1C5LH 2BD7A 3K9XB 4KTSA 1KYNA 2A4GA 1O5FH 4VGCB 3KEEA 2HNTC 1EX3A 2QCYA 1HAZB 1VITH 1WV7H 4TWYA 1DOJA 1GMHG 1WTGH 4NWLA 1Y3WA 3ZZ9A 2BYAX 2W5EA 4UFFH 1DE7H 2ANWA 2XTTB 2ALVA 1EJAA 1W7GH 1DSTA 4JYVH 1OSSA 4ABJA 2J9NA 4AGKA 5EXMA 1FLEE 2G4TA 1F0RA 2Z3DA 5BRRE 1EATA 3TGKE 1K1OA 2RA3A 1OWHA 3HKIB 2ILNA 3GCTG 2SNVA 1DICA 5HXFA 2EI6A 1SFQB 1GBEA 4JZDH 4HFPB 1NFUA 3RXQA 1NU9A 1T8NA 2CHAB 1Y3YA 1AO5A 1O3OA 1MZDA 1YBWA 1DX5M 1TNKA 1AKSB 3MO3A 4ISLA 2ANKH 2XXLA 1ELAA 2D2DA 1GJAB 1QB6A 5JYIA 1Z8RA 1H8DH 1LHGH 1B0FA 1QRWA 1T8MA 2PGBB 2JH5D 3RDZA 4ZXXH 3U8TH 1ABIH 4YM9A 3GICB 2ZDAH 3VB4A 1RTFB 1TFXA 4ZKNU 2H1UA 1GI8B 5GCHG 1P10A 1O39A 4BNRA 1SPJA 1TOCB 2O8UA 2PTNA 3UQOA 1HCGA 2FOAA 1DSUA 1GBIA 1P0SH 2ZTYA 1MQ5A 2ZPSA 4ABDA 1E37B 3SW2B 3QX5H 3R0FA 1IQGA 3RXDA 3UR6A 2AYWA 2I6SA 4X1PU 2AS9A 1OWDA 2G5NA 4XFQA 1YCPM 4DIHH 2QF3A 5DP5A 1E38B 2GCHF 1AY6H 1C1PA 1NRQH 1GJ7B 1EOLA 1UTJA 2BMGB 2ZFPH 5E0JA 1ETTH 1S0QA 5J4QA 1P06A 4WF8A 2AGGX 2OINA 4BAHB 1AKSA 5LPFA 3M5MA 3RXLA 1EZUC 1SOTA 1GI9B 2ZHEH 5L30H 2BVXH 1TX7A 4Y0YE 2QXJA 1V2RT 2XWAA 1E35B 3NKKA 1C1RA 4BTTB 1LKBA 1TPAE 1YPLH 4Q7XA 3OU0A 1NPMA 2BY5X 2FOHA 1NRNH 3P8GA 2AH4X 2ZTXA 4AFUA 1ZGIA 3A87A 7GCHG 2ZDNA 4M7GA 7ESTE 2O8LA 2XWBI 4WMDA 1F2SE 1ANBA 4AN7A 1WYKA 1NFXA 3SO3A 1PQAA 1SGIB 1BDAA 1KDQB 3BF6H 1C5UA 2OLGA 4E06H 4O3TA 1K1PA 3WY8A 1MTNC 1V2VT 1XUIA 2JKHA 1TA2A 4WH6A 1PPZA 4AZ2B 3E0PB 3TK9A 1W7XH 4DJZB 1DXPA 3S9AA 1HAVB 1O2WA 4Y10E 1H1BA 1ZSJA 3STIA 3R3GB 4ZHAA 1GBJA 2VWOA 3QTOH 3AASA 1G2MA 2F9NA 3RXVA 4GHTA 5FBIA 3GY5A 1S84A 4SGAE 5DP4A 2FOGA 4IC5A 2F9PA 1A7SA 4UDWH 4X6MA 1QFKH 3C1KA 5C5OA 2P8OC 2AFQB 4MPWA 2O9QA 3BEIB 1K9OE 1XUJA 2HOBA 1IHSH 2UWOA 3DD2H 2R3UA 1EB2A 1NFWA 1QL7A 3OY6U 4BXWA 3ZVAA 1P2IA 3E91A 4THNH 4GCHF 1OX1A 3GDUA 3QUMP 8ESTE 5C2ZA 4ABFA 2JETC 4NCYA 2GT8A 2FOCA 1KDQA 2F9BH 1ZGVA 1MKXH 2R3YA 2R2WU 3BG4C 1FY8E 3PMJA 6GCHG 1O2XA 6LPRA 2B8OH 4YOGA 4Y76A 3B9FH 4A92A 1ZLRA 1D3TB 3SU1A 2BX3A 1HAVA 3LGTA 1ELVA 5JB8S 2QXGA 3P8OA 5C1YA 3SUFA 2V0BA 1FIWA 2Q6DA 5A0CA 5JBAS 1OS8A 2B5TB 3MNSA 3SHAH 4BAOB 4FUDA 5LH8A 1IQLA 3TH2H 1Y5BT 3RXJA 2VJ1A 3PMAB 1SC8U 2ZDKA 4ABEA 2W7UA 4BTIB 1VZQH 1DUEA 3V3MA 3DFJA 2FODA 1C5SA 4XSKU 1UVPA 1O2NA 1CU1A 3ZVEA 3S9CA 1TX6A 4D76A 1LO6A 3ZYDA 3PTNA 2D1JA 3PYHA 4JZFH 5A0BA 3OX7U 2WPKS 1WU1A 1GI4A 1O2ZA 3TNSA 1GVLA 3TGJE 1OP8A 2J2UA 1EB1H 1BB0B 3VXFH 2G81E 3ATWA 2C4FH 1LQDB 3TGIE 3IWMA 4J2YB 2OQUA 1GMCF 1BHXB 1P8VC 1NN6A 4ZH8A 1UTMA 2Z9LA 4TYDA 3S7KB 2QA9E 3ATLA 1C5QA 1IOEA 1SB1H 4MPVA 1ELFA 1ELDE 1S83A 1SL3A 1TMBH 2WPHS 3SNAA 1PPHE 4FUGA 3QK1A 3RU4T 1O2OA 1RTLA 1A5GH 2NU3E 2AMQA 1AGJA 1EOJA 1Y3XA 2BOHB 4O03A 3SUEA 4A1XA 3EE0B 3N7OA 2GP9B 1XMNB 2J4IA 2HNTF 2RA0A 2SFAA 5TJXA 4CBOA 1ELCA 4K1EA 3M35A 1AUJA 3ZZ7A 5GXPA 2UWLA 3KQDA 1UTLM 3PV4A 1N8OB 1LHFH 4ISNA 4O9VA 3SBKA 1LDTT 4NIXA 3D49H 5GDSH 1SLUB 2W26A 1YPJH 1LPZB 5AVDA 1C4V2 2OBOA 3M7QA 4OS6A 4Q80A 3RC4A 2XC4A 1C2LA 3EBNA 2QAAA 2HGTH 4BOHA 1QL9A 1VJ9U 3M3TA 4DIIH 3U8OH 4BXSA 4X6NA 2W3KA 2A31A 2WPMS 1BBRH 2P16A 2AMDA 4D7GA 2AERH 3S9BA 1NFYA 2H5DA 4NSVA 1Z6JH 3UTUH 2NU4E 3RMOH 1O5CB 1HYLA 1TGNA 5DG6A 3A84A 3A89A 4B75A 3FZDA 2K7XA 1OWIA 2A4RA 4KELA 4X1SU 2F9UA 1BTXA 3M5LA 3QGJA 3E8LA 1O2JA 1WTHD 3A88A 1C2FA 1NROH 4CRGA 3F9FA 2EA3A 2TGPZ 2ZFTA 5EXNA 1YPHC 1GJBB 2GD4B 4KKDA 2QF0A 4IN2A 1C1TA 1A0JA 2ZZUH 3F68H 3SGBE 1L1NA 1UMAH 1P3CA 4LXBH 1T7CA 3A7TA 1A61H 1S81A 1D6RA 2CHAC 3MH7A 4B1TA 1C4Y2 1P04A 3O8RA 1IQNA 3ZZCA 2PWXA 5GWZA 1BQYA 1UVSH 3TITA 5JDUB 4Y8YA 1GDUA 1ZPZA 1S82A 1QBVH 1MKWK 3GCHC 1XXFA 3HGNA 1SGQE 1IQKA 1F0SA 3P95A 2BLQA 3D65E 1O38A 3ZV8A 1XUFA 1U6QA 2GZ9A 2RDLA 1SGDE 1ESAA 4DGJA 1C1MA 3PMHB 2P8OB 1BUIA 2GCTB 2WV4A 1W2KH 4X8SH 2BDGA 3A7XA 4FUFA 2BX4A 1A3BH 3T5FH 9ESTA 2XW9A 1MAXA 4JZIA 5ESBA 3HK3B 4B2CA 3TPIZ 1GPZA 4YOJA 4F4OC 3B8JA 3A7YA 3RXBA 1DDJA 3FZZA 1O35A 3EDXB 3T2NA 4D8NA 5DP7A 1W8BH 1AN1E 2STBE 1O2VA 4YO9A 3P17H 4X6OA 2R0KA 4U2WA 1CE5A 5GJ4B 1CO7E 1V2LT 1E0FD 2EC9H 4JCNA 5C20A 1AWFH 1HDTH 4I8JA 5JBCS 4Y79A 1KXFA 1MD8A 1NRPH 3F1SB 4RSPA 3BSQA 2O8MA 3UWIA 4A1TA 1BTWA 3H5CB 2FI3E 2VWNA 4H6SB 3KN2A 1KTSB 1O3IA 4AYYB 1C5OH 1G9IE 1YGCH 1HAGE 5SGAE 1SOZA 1ZMLA 1JIMA 5FPTA 2BLOA 1CHOG 4I8HA 3ZZ3A 2C90B 4NIWA 1Y3VA 3ATIA 2OC0A 2BY9X 1GWAA 1B0EA 3IITA 1BMAA 4INLA 3GDVA 2FI4E 4GSOA 3BTWE 1GMDG 3SQHE 4IGDA 1UCYH 2ZECA 1ZJDA 5I25A 2FOMB 1GBFA 1J8AA 2H9TH 3HGPA 1MQ6A 1QHRB 3SU2A 1KY9A 1P2MA 1IQJA 1O3KA 3QN7A 1KXAA 1XUGA 1Z6EA 1AB9B 1TA6A 3LT3A 3BTEE 2BD8A 5IYTA 1MU6B 1XXDA 3NUMA 2HVXA 4X2VA 4NA7A 1GI5A 1O5EH 1ESBA 1ZMNA 1KXEA 5CHAB 1FZZA 4X2XA 2A2XH 1CSOE 2BLWA 1QNJA 3SUDA 3BIUH 1L4ZA 4OGYA 1CGHA 1C2KA 2BOKA 4WXIA 1CGIE 3LGIA 5E8EH 4K3JA 1EPTB 3BTTE 1O3JA 4BAKB 1PJPA 3BEUA 1Y59T 4WWYA 1NRSH 3BIVH 3VB5A 1O36A 2NU0E 3NPSA 2FPZA 1ZSKA 2VVVA 2UUYA 4FUHA 4PROA 1GI6A 1C2JA 1RIWB 1GHVH 3A7ZA 2H9HA 1WOFA 5EG4A 3VXEH 1BMMH 2XBXA 1TIOA 4ABGA 2VIWA 4I8LA 2BDHA 3GDSA 1HBTH 1C9PA 2ZU3A 1ANCA 1C4U2 4Y11E 4E7RG 1C2DA 5AFZH 2J92A 3SU4A 1LPKB 4GUXA 3BN9A 1GHYH 4Y7BA 5C67A 4FVBA 3T29A 4NZQA 1B7XB 1PFXC 2BDCA 1BOQA 2PLXA 2A5AA 1P3EA 4K60A 1QB1A 3UPEA 3MU4A 4D7FA 3BTKE 1NRRH 4H42U 1BMNH 1PQ7A 1BA8B 2VIQA 1RRKA 5GCHF 3SN8A 3SNBA 3A81A 3PROA 3EA9A 1EPTA 3KIDU 1NC6A 1P9SA 3VPKA 5FX6A 1V2UT 2VIDA 4TY6A 3UNRA 3M7TA 3MH6A 1V3XA 3QZRA 2ZDVH 1P01A 1FNIA 1CA0B 3E3TA 3K65B 1H9HE 2ASUB 3KL6A 1O3BA 4LK4A 1O3LA 3ZVBA 4NSYA 2F91A 2SGQE 2A0QB 1CHGA 4CRBA 3B23B 3E90B 3L3TA 1A4WH 2FEQH 3SV2H 5DP8A 1GHBG 1AFQC 4BANB 1C2GA 2OQ5A 1L1JA 3LKWA 3K2UA 4Q7ZA 1A3EH 3GCHB 1FONA 3VGCC 3QZQA 1F5RA 1V2MT 1FIZA 5HMAA 1WQSA 4JYUH 1O2IA 1VCWA 1BT7A 3MMGA 1JRSA 2BQWB 4H4FA 2ZDMA 2WINI 2WUCA 3LGUA 2BDYA 3V12A 1DITH 3PB1E 3U69H 1GI7B 1TQ0B 1TLDA 1BRCE 2QV1A 5F8ZA 1N8OC 4XE4A 1OYTH 3BTQE 1CT4E 1CT2E 2FO9A 2PW8H 4O97A 3MWIU 1AVXA 2BD3A 1GHAF 3G01A 3MO6A 1BCUH 1YPMH 1QGFA 1SGTA 1TNLA 3SZNA 1F5KU 1SGYE 4WVPE 3ZVDA 1HAIH 2ODQA 3MU1A 2QN5T 1O3NA 2OC1A 2YNBA 1HIAB 1KIGH 2YOLA 4B73A 1UTQA 3SV9A 1KLTA 1ZYOA 3CS0A 1AVWA 1HJ9A 1TRMA 5FX5A 1LPGB 3T62A 2BB4A 3ZVFA 2ODYB 1Q2WA 1HJ8A 2GV6A 1FAXA 2IPHA 1ETSH 3RU4E 2XCNA 8GCHG 2FIRH 2PR3A 3CENA 2GGVB 3A8DA 1YCPK 4ZUHA 1XKBC 1QIXB 2ZTZA 3RXFA 2GKVE 2BD2A 3PWBA 3A8BA 2A45B 3P92A 2FTMA 2Y81A 1XUHA 4UFEH 1C2MA 5HGGA 1VR1H 2ZQ1A 2PKSC 1ID5H 2M5TA 4OS5A 2CF9H 1N6XA 2PKAB 4JYTA 1G37A 3UNQA 5L2ZH 1QA0A 2FTLE 6GCHF 1JWTA 4J1YA 1RXPA 1GCDA 2ULLA 2ZGJA 3PTBA 3F9GA 1GJ4H 2VH0A 4B71A 1EASA 1HIAA 1G3DA 3U1IB 5EXLA 1UO6A 3SJIA 1QY6A 2FOEA 2H9EH 2BY6X 3MH4A 3EGKH 3GY4A 1FV9A 3UR9A 1ORFA 3LC3A 1XX9A 3QDZB 3O8BA 2OXSA 2VIVA 1G36A 2ZHQH 1O2YA 1W13U 4MTBA 5FPSA 4MNXA 1O31A 4DVAU 2GCTC 2ZCKP 3ATMA 4CR5A 4DW2U 4IN1A 1MKWH 1HAPH 4OS7A 3A80A 3Q76A 1O2HA 1ABJH 1T31A 1AE5A 2F3CE 1GBTA 4FUIA 2W7SA 3SNDA 1BIOA 3BG8A 1GVKB 2FS9A 2F9OA 2HALA 1TGBA 5A0AE 2A2QH 4R0IA 1Q31A 3P8FA 3NWUA 2PKAA 1YPKH 1SBWA 2EEKA 4NA9H 1CBWB 2BD5A 4A1VA 4MNWA 6ESTA 2F9VA 3GY7A 4Y8ZA 5DO4H 2CN0H 3TLOA 3RXSA 1V2OT 2C8YB 3ELAH 3HKJB 2Y5FA 1OWEA 3SHCH 1NZQH 2VVCA 3FFGA 7LPRA 2BLVA 1MD7A 2TGTA 1H4WA 2V6NA 1GBCA 2ZGCA 2R0LA 1EZSC 4TPYA 3TJVA 3RC5A 1GGDB 2VVUA 5ABWA 3KGPA 3MTYA 2YNAA 2XBVA 2FLBH 4BAQB 2VWMA 3TU7H 1EAWA 3RMLH 2AMPA 2H5CA 3RLWH 1N1LA 3MOCA 4OS2A 4YZUA 4D9RA 1G32B 2JH0D 1DS2E 1WSSH 1AE8H 4AFQA 1HUTH 3I78A 2FWWA 1P2NA 3PLKA 3ZZ6A 1SG8B 3RXIA 5EQQA 2TRMA 1OYQA 2JH6D 3KHVA 4UE7H 4Y7AA 1DLEA 3UFAA 1PPEE 1AHTH 2BVSH 1G3EA 1OPHB 4X2WA 1OWKA 4LZ1H 1AFQB 1AB9C 2G00A 2VGCB 4Q7YA 3T27A 2VNTA 2Z9KA 5CHAC 1AWHB 1TMTH 4NGAH 3UOPA 2H6MA 2J38A 3UUZA 1KTTB 3VGCB 1AUTC 1SQAA 4E05H 1QJ6B 1HNEE 5LGOA 2Z6BD 2VWLA 1EPTC 2CJIA 1WQVH 5AF9H 5LPRA 3PMBB 3SU6A 2A7HA 2GZ8A 1K2I1 4E7NA 2C3SA 4ZKRU 1PPGE 3FP8E 2PSXA 5JBBS 2ZF0H 3M5NA 1P2OA 1O34A 4KP0A 1RIWC 2A5KA 2R9PA 4DY7B 1C5NH 7KMEH 3C27B 4K5ZA 2BY7X 1TGSZ 4Z6AH 5PTPA 1GL0E 2HPPH 2Y7ZA 1F7ZA 4AYVB 2QC2A 3RC6A 1KLIH 1MH0A 1BRUP 2LPRA 2A1DB 3H7OA 1MBQA 2Z3EA 2ANYA 1JOUB 3SNEA 3Q00A 2FX4A 2NU1E 3L6PA 3SOSA 1OWJA 2ZDLA 4YESB 3T26A 4AB9A 1HLTH 1YM0A 3U8RH 1C1VH 5C5NA 4UONA 1BHXF 1MMJN 2XBWA 1EP5A 4FUBA 1F0UA 3BTME 3A85A 2P93A 4ABHA 1O2UA 1C1WH 3DFLA 1TOMH 4FUCA 1DT2A 1C5RA 1GBAA 1YPHE 1K1IA 2Z94A 1TNIA 1TBZH 2A4OA 2PUXB 3T28A 3UWJH 2ZG0H 1GVZA 3LJOA 3OY5U 1GBHA 3QO6A 3KQBA 1TGCA 3RXUA 1IQMA 4DG4A 1K1NA 4ISIH 2ZGHA 3RUOA 4X8TH 1J14A 2BD9A 3ATKA 1O3EA 1JBUH 1MUEB 1CA0C 2PKSB 3QLPH 1WCZA 2QXHA 1EAXA 1W0ZU 3SI3H 3I29A 5T3HA 1O3DA 2PGQB 4K2YA 4DCDA 4ZROA 1KXDA 5K0HA 2CF8H 3K6ZA 2GT7A 2G51A 3T25A 1C1QA 2FYRA 4CRDA 2DE8A 3MI4A 1DWBH 5DGJA 2STAE 3QWCH 5E2OA 4LZ4B 4MNYA 2GTBA 4ISOA 1ZTKA 1DVAH 3VB3A 4Q2KA 4A5TS 2ZHDA 1D3PB 1C1NA 3M3VA 1FUJA 2A4QA 1LHDH 3ENSB 3SI4H 5DK1A 1O2GH 1TE0A 1SLWB 1JRTA 2CGAA 4YLUA 3DA9B 2HWLB 5CMXH 3SU5A 1IAUA 1SQTA 4X8UH 4R8TB 3LOXA 1FN6A 1BTUA 1DLKB 1MTSA 1T8OA 5C3NA 1ELTA 1W11U 2Y82A 3BEFB 1EP6A 1ZPCA 2OD3B 2WV5A 4K8YA 1A2CH 1KLJH 1O3HA 3ODDA 1INCA 3EAJA 4BAMB 3EA7A 1MKXK 4X1NU 1C5VA 1O2TA 3RXMA 1MTUA 5FAHA 1C5TA 1QRZA 4TPIZ 5DP9A 1HGTH 1G3CA 1O37A 3MNCA 3FP6E 1TX8A 1MCTA 1HV7A 1NESE 1O5DH 4YTAA 1NT1A 2TBSA 4FU8A 4D9QA 5EQSA 1TPSA 4QT8C 3E1XB 3RXOA 1O3MA 2ZIQH 2K1QA 3TJUA 4AG1A 3RMNH 1O3PB 1L2EA 3AW0A 3OYPA 1ESTA 1QTFA 2LIZA 2Z3CA 4JZ1A 1AQ7A 1Z1IA 1P2QA 2G8TA 4XBDA 1DUAA 5G4BA 3MH5A 2OUAA 3RM2H 5A8XA 4TY7A 3SGAE 2F83A 4MPUA 1SGPE 4FVDA 4MVNA 4CH8B 1P03A 3ESTA 5GPIB 1HPGA 3SV6A 1IQIA 4K1TA 1THRH 1CA8B 4INKA 1PQ8A 4IC6A 2Q6GA 1GBLA 1SGNE 3VB7A 1HXFH 4ABIA 3GY2A 3UIRA 4HI3A 2RCEA 1C5PA 2XC0A 3PM3A 4NA8A 5EOKA 1VCQA 2TGDA 2ZGXH 3KQCA 1FY1A 1P2JA 3MO9A 4GVUA 1VGCC 1UHBA 3ODFA 3UOUA 1Q3XA 1J15A 3IG6B 1MBMA 2VINA 1QCPA 1ZMJA 1T32A 3RP2A 2ZU5A 3RXHA 1LQEA 5A8ZA 1GMHF 1Y3UA 4AB8A 2BQ6B 1O5BB 1O2PA 1V2KT 3NK8A 2XNIA 4HTCH 2BM2A 2UUFB 1Y5AT 2PFEA 1BITA 1UJ1A 1ZPBA 1SFIA 3BTGE 1Z8IB 4YOIA 4X6PA 1ELBA 3GCTF 1PPCE 1S0RA 1BJVA 3A82A 4ZHMU 1ACBE 5A09A 3NZIA 1K1LA 1OP0A 4SGBE 3PO1B 1CBWC 2ZP0H 3ZZBA 3LGYA 2NU2E 1GHBF 2PTCE 2PSYA 1O2QA 1C5WB 4NIVA 2VIOA 1DY9A 1WAYB 4RKJB 5EPNA 1TBRH 2V3HH 1BBRK 1QB9A 3GOVB 1F5LA 1AMHA 1C5YB 3Q3XA 2BVRH 1BBRE 6CHAC 5EGMA 3RXKA 3URDA 4IBLH 1S5SA 2HNTE 5FBEA 1BTYA 4OGXA 3UREA 4B76A 1GBDA 3RLYH 3LGVA 3BTHE 2VIPA 1GJ6A 1MU8B 1GGDC 1PQ5A 3QGNB 4U30A 2D8WA 2WYJA 2WPJS 1YLDA 1Z71A 3A8CA 5E0GA 4CBNA 1LVOA 1O2LA 1V2WT 3P6ZB 1K1MA 2ZU4A 1EJNA 4TWWA 3MFJA 4WXVA 3Q3KA 3ZZ8A 3CP7A 4UFDH 2BDIA 5IDKA 3SQEE 4CHAB 1GJ9B 1Z8JB 1UTNA 4A6LA 1ZHPA 4XOJA 2HRVA 1A1RA 1DM4B 2P94A 3TNTA 1RTKA 3STJA 1W0YH 5E2PA 2ALPA 3U98H 1FPCH 5DP6A 5K7RA 1UTOA 4B2AA 5JBTA 2B0FA 2VGCC 2R2MB 4B2BA 4UFGH 3M3SA 1S6HA 2Y5GA 4ASHA 1L4DA 4X8VH 1JMOH 2G4UA 2GVFA 1VITG 3MU5A 1L1GA 2ZC9H 4GPGA 1QRXA 2A7JA 8GCHF 1IQFA 3UY9A 1DWDH 1JXPA 1HJAB 3P70B 1SGRE 2THFB 1FY5A 4X1RU 3Q3YA 4CRCA 1HAXB 4K8BA 5B6OA 3DUXH 1C9TA 7GCHF 3KCGH 4F49A 1RGQA 1YPEH 2FX6A 1PPBH 4FU7A 2OP9A 3PLBA 4NFEA 3EYDA 1DWCH 3TK5A 3SJOA 1L0ZA 1J17T 1P2KA 2Q6FA 2ZEBA 2ZCLP 2EI8A 1ZHMA 5HM2A 5EU8A 3BTDE 1ZHRA 1ELGA 1GCTB 2AEIH 4MG3A 1YPGH 2ZFQH 3BV9B 1C1SA 2OBQA 3HPTB 4KGAA 1FI8A 1Z8GA 3S0NA 1BJUA 1THPB 5JPMH 2FYQA 2P59A 1V2NT 1LMWB 1Y5UT 2IOTA 1BZXE 5TCCA 1GG6B 2OTVA 4OS4A 1ARBA 5DKMA 2O8WA 5EW2H 1CGJE 3S7HB 3TIUA 1RJXB 4CR9A 3A7WA 4CRFA 2ZFFH 4FUJA 1ARCA 2H2ZA 1QR3E 2QYIA 1SGEE 1ZJKA 1V2JT 3DT0H 3MNXA 1Z7KA 3VFEA 1FJSA 3LC5A 4Y6DA 1P12E 1TYNA 3M36A 3MHWU 3PWCA 4NWKA 1AZ8A 1V2ST 4O3UA 1QA7A 2G5VA 1PYTD 3ZZAA 1K21H 2A5IA 1UCYK 4I8KA 3FANA 1SGCA 2P95A 2ZGBH 4K69A 3A86A 5AFYH 3TH4H 1HAOH 1O3CA 1YF4A 1UCYE 2ZPRA 1TRNA 4IMZA 4ISHH 2A7CA 3F9EA 2ZQ2A 3ZZDA 1E34B 1NO9H 1D6WA 2AGEX 2CV3A 1F0TA 1BTHH 1GJDB 1S6FA 1A0HB 1S85A 1VJAU 2AGIX 2C93B 8LPRA 1GBKA 1VGCB 1KXBA 2A32A 1WUNH 4INHA 4X2YA 5CE1A 1TQ7B 3D62A 2Y7XA 3W95A 5DP3A 1TBQH 1GHAG 1OOKB 3MU0A 5T6FA 1O3GA 3FVFB 2GCHG 4FU9A 3S69A 1P05A 1D3DB 3UQVA 1DPOA 4MLFB 2FS8A 3GYLB 4IMQA 2BXTH 1C2HA 1CT0E 3M61U 1FY3A 2Y5HA 1TB6H 2CMYA 5JB9S 3SV7A 1A5HA 1EQ9A 2GMTB 1DFPA 2FI5E 5H4IB 1C5ZB 1Z1JA 5DJ7A 3M5OA 2ZPQA 1RD3B 1W14U 1DANH 4FUEA 1T4VH 1ELEE 1ZRBA 4AORA 4MPXA 5C1UA 2BDAA 1UVTH 4I33A 4ZKSU 2CXVA 2WPLS 2G55A 5F03A 1X7AC 4ZHLU 2BD4A 2P3TB 3NXPA 4DURA 1GBBA 1RS0A 3SGQE 5FXLA 6CHAB 1J16A 1EZQA 3BTFE 3RM0H 4MDSA 1ZZZA 2XC5A 4CREA 2NWNA 1O0DH 3SORA 1MCVA 4GHQA 3KQEA 2UUJB 2DE9A 2G52A 2ZO3H 3L33A 4ABAA 8KME2 4RN6A 5EW1H 1HAYB 1A46H 3M37A 1DXWA 2FLRH 5T6DA 5FCRA 1IQHA 5EODA 1UK3A 3TH3H 3HATH 4A7IB 1GJ5H 3QTVH 1HB0B 1UVOA 1TPOA 1ETRH 2XYAA 4I7YH 4YT6H 4U32A 3RXRA 2C8XB 3ZV9A 1BMLA 1HAHH 3V13A 3GY3A 4ABBA 2WYGA 1ZOMA 1AIXH 1O30A 1XM1A 3OSYA 1CQQA 1C1OA 3HK6B 1O33A 1QL8A 1J9CH 1GHZA 4GAWA 4UEHH 1TNJA 3SNCA 1GI2A 1TPPA 3JZ2B 1ZR0A 1O5AB 1V2TT 1XVMA 1OXGA 1O2RA 2B9LA 4DOQA 4WMEA 3A7VA 1QBOA 2ZWLH 4YLQH 3SJ8A 1W10U 3LU9B 4GCHG 2FP7B 1SLVB 1LKAA 1O5GH 1AI8H 1T8LA 2VB0A
chains in the Genus database with same CATH superfamily
1A0LA 3GY8A 1K22H 1N6YA 2P3UB 2W3IA 5A8YA 2V3OH 4F55A 4H6TA 2AIQA 2ESTE 1GDQA 3FAOA 3RXEA 2ZFRH 1C5XB 1YC0A 5A2MH 1C2IA 1WDIA 4ZKOU 1LHEH 4NIYA 1SSXA 4X1QU 4I8GA 3VB6A 2IN2A 2ZHFH 3PO1C 5AHGH 1EJMA 1EUFA 1TALA 1FAKH 1FX0B 1ANEA 3K6YA 3LH1A 2BQ7B 1Y8TA 1YYY1 2B7DH 2WPIS 2ZI2H 3FP7E 5EQRA 1GHWH 5BPEA 4XBCA 2DUCA 1FDPA 1AFEH 2P3FH 2ZKSA 4JMYA 3WWBA 5GIBA 5TCAA 3MU8A 1IQEA 2Z9IA 1QBNA 2PV9B 1SR5C 1QQUA 4AX9H 3JZ1B 1EXFA 1SGFA 4X0WU 1SHHB 3SU0A 1LCYA 3RXTA 4XDEA 4KTCA 2AHME 1FQ3A 2ZU1A 2D26C 2SGFE 3ZVCA 1B5GH 2GX4A 1H9LB 1SI5H 2Z7FE 5EJZA 2XCFA 1D9IA 1TMUH 3GCOA 2QIQA 2Z9JA 1OP2A 2OC8A 4CHAC 1UK2A 9LPRA 1K1JA 4JZEH 1GMCG 1YKTA 3KNXA 3OTJE 3A8AA 1NU7B 4VGCC 3RXAA 3M7UA 3A83A 2SGAA 1UVUH 2FESH 3ITIA 1XVOA 3RXCA 1BRAA 2AIPA 1D4PB 3E16B 1FPHH 1HXEH 2FMJA 2PUQH 1MTVA 4KTUA 5HYOA 4YT7H 1P9UA 4ESTE 5J4SA 2Y80A 2IJD1 3KYFA 3ZYEA 1O3FA 1TAWA 3F0OA 5HM9A 1QJ1B 1YP9A 5T6GA 2C8WB 1T4UH 4UD9H 3RU4D 2O8TA 3V7TA 1SQOA 3ZZ4A 3SYJA 3GCNA 2BXUH 1G30B 1QURH 1W3CA 1DWEH 2HLCA 4MQAA 4OS1A 4CH2B 2BTCE 1EAUA 3LIWA 1EKBB 1P57B 5F8TA 3SV8A 5C1XA 2J34A 1HJAC 4NZLA 3DHKH 2XBYA 3NCLA 1MTNB 1LTOA 5KGOA 1FXYA 1SGFG 3LPRA 4LOYH 5ESTE 1K28D 1M9UA 2HPQH 2ZFSA 1CHOF 1LHCH 3E0NB 2QY0B 4B6EA 1E36B 1AVGH 1NTPA 1RFNA 2J95A 2UWPA 2SGDE 3Q77A 4HGCA 3E6PH 4XBBA 1QJ7B 1A5IA 4Y8XA 3D23A 1CVWH 1GCTC 5I46H 1W12U 1GMDF 1QQ4A 2TPIZ 4U01A 1BTZA 4BTUB 3TK6A 1GI1A 3LONA 1G2LA 2ZHWH 3UAIC 1C5MD 1HRTH 3RXGA 2BZAA 4IS5A 2ANMH 3RXPA 5F8XA 3U9AH 3SUGA 1UHBB 4AG2A 2Z9GA 3LDXH 1O2KA 1YLCA 1BTPA 1GL1A 1ZRKA 4GLYA 2TGAA 1KXCA 3URCA 1GG6C 1MZAA 2ZA5A 3AAVA 1SMFE 3TVJB 3KQ5A 1TWXB 5FHTA 1EZXC 2KAIB 2VU8E 3P8NA 2JETB 2UUKB 3GY6A 3I77A 1FN8A 3TJNA 4I86A 1MTWA 4AFSA 1HFDA 2IJOB 1SQRA 2TIOA 1V6DA 3BG4B 4HG6A 1SLXB 2K0QA 1P09A 1LVYA 1FMGA 4WY3A 2HLDD 2I6QA 4JK5A 3PLPA 4NFFA 5E0HA 4CRAA 1SHYA 3ZVGA 2BY8X 2Y6TA 1G3BA 3MYWA 4WJG2 5ETXA 1NM6A 1PYTC 3DSGA 1WBGB 2FM2A 3H7TA 1MAYA 4MNVA 4IW4E 4JK6A 4WH8A 1GI0A 3EA8A 1MABB 1PPFE 4B74A 1GBMA 1THSH 2RDEA 2ZU2A 1GI3A 2GJGA 1UTKA 1EAIA 5C94A 1LVMA 3F9HA 1YCPH 3AVZA 2QE7D 1NY22 1TNHA 2LNCA 4ZAEA 1TRYA 3W94A 3EQ0H 4I31A 2QXIA 2VBCA 3RMMH 2LP6A 5EPYA 4DT7B 1F92A 4ZMAH 1TGTA 3VEQB 2ODPA 2FZZA 3O8CA 4I32A 2GZ7A 2PHBA 2KAIA 5L6NH 2SNWA 3O8DA 1IHTH 3SJ9A 4RKOB 3GISB 2GV7A 4Y0ZE 1DY8A 2OC7A 1P02A 4K1SA 1GHXH 1O2MA 2EI7A 1C2EA 2FOFA 2FOBA 4Y71A 1P11E 1UTPA 3AW1A 2BHGA 2BZ6H 3AAUA 1NS3A 1ZSLA 3ZZ5A 1ZTLA 4WMFA 3LJJA 1UK4A 1LVBA 1H9IE 4NG9H 5LPEA 1XUKA 2GMTC 2XOKD 2ZNKH 2SGEE 3GYMA 3LGWA 3SJKA 1BRBE 3V0XA 3OFND 4HZHA 4AFZA 3LH3A 2VH6A 3KF2A 5DPAA 2L74A 3MNBA 1ANDA 2WUBA 2FXRA 2QGRA 1GJCB 2JDID 3FO8D 3CS7A 4FXGH 1C1UH 5FPYA 3SU3A 1AU8A 1GDNA 1TNGA 1V2QT 2ZCHP 1O32A 2C8ZB 2Q1JA 1AZZA 1O2SA 4AOQA 1TONA 3F6UH 1D3QB 4ZXYH 3UNSA 2OCVB 1VITF 1AD8H 2FDAA 1VCPA 2GDDA 1O3AA 4AGJA 2RG3A 3DSPA 2SGPE 1H8IH 3CNRA 1OKXA 3U1JB 1V2PT 1JIRA 5FCKA 3TJOA 1GJ8B 1TABE 1FY4A 5F6MA 4Z0KA 5L2YH 1XKAC 2XRCA 2GDEH 2BDBA 1KSNA 2J94A 1ZTJA 1SVPA 2V35A 1C5LH 2BD7A 3K9XB 4KTSA 1KYNA 2A4GA 1O5FH 3OEED 4VGCB 3KEEA 2HNTC 1EX3A 5B6LA 2QCYA 1HAZB 1VITH 1WV7H 4TWYA 1DOJA 1GMHG 1WTGH 4NWLA 1Y3WA 3ZZ9A 2BYAX 2W5EA 4UFFH 1DE7H 1KMHB 2ANWA 2XTTB 2ALVA 1EJAA 1W7GH 1DSTA 4JYVH 1OSSA 4ABJA 2J9NA 4AGKA 5EXMA 1FLEE 2G4TA 1F0RA 2Z3DA 5BRRE 1EATA 3TGKE 1K1OA 2RA3A 1OWHA 3HKIB 2ILNA 2J5UA 3GCTG 2SNVA 1DICA 5HXFA 2EI6A 1SFQB 1GBEA 4JZDH 4HFPB 1NFUA 3RXQA 1NU9A 5C0TA 1T8NA 2CHAB 1Y3YA 1AO5A 1O3OA 1MZDA 1YBWA 1DX5M 1TNKA 3KYGA 1AKSB 3MO3A 4ISLA 2ANKH 2XXLA 1ELAA 2D2DA 1GJAB 1QB6A 5JYIA 1Z8RA 1H8DH 1LHGH 1B0FA 1QRWA 1T8MA 2PGBB 3UB0A 2JH5D 3RDZA 4ZXXH 3U8TH 1ABIH 4YM9A 3GICB 2ZDAH 3VB4A 1RTFB 1TFXA 2M2AA 4ZKNU 2H1UA 1GI8B 5GCHG 1P10A 1O39A 4BNRA 1SPJA 1TOCB 2O8UA 2PTNA 3UQOA 1HCGA 2FOAA 1DSUA 1GBIA 1P0SH 2ZTYA 1MQ5A 2ZPSA 4ABDA 1E37B 3SW2B 3QX5H 5T1VA 3R0FA 1IQGA 3RXDA 5HIYA 3UR6A 2AYWA 2I6SA 4X1PU 2AS9A 1OWDA 2G5NA 4XFQA 1YCPM 4DIHH 2QF3A 5DP5A 1E38B 2GCHF 1AY6H 1C1PA 1NRQH 1GJ7B 1EOLA 1UTJA 2BMGB 2ZFPH 5E0JA 1ETTH 1S0QA 5J4QA 1P06A 4WF8A 2AGGX 2OINA 3OAAD 4BAHB 1AKSA 5LPFA 3M5MA 2EQNA 3RXLA 1EZUC 1SOTA 1GI9B 2ZHEH 5L30H 2BVXH 1TX7A 4Y0YE 3AK5A 2QXJA 1V2RT 2XWAA 1E35B 3NKKA 1C1RA 4BTTB 1LKBA 1TPAE 1YPLH 4Q7XA 3OU0A 1NPMA 2BY5X 2FOHA 1NRNH 3P8GA 2AH4X 2ZTXA 1QZ8A 4AFUA 1ZGIA 3A87A 7GCHG 2ZDNA 4M7GA 7ESTE 2O8LA 2JJ2D 2XWBI 4WMDA 1F2SE 1ANBA 4AN7A 1WYKA 1NFXA 3SO3A 1PQAA 1SGIB 1BDAA 1KDQB 3BF6H 1C5UA 2OLGA 4E06H 4O3TA 1K1PA 3WY8A 1MTNC 1V2VT 1XUIA 2JKHA 1TA2A 4WH6A 1PPZA 4AZ2B 3E0PB 3TK9A 1W7XH 4DJZB 1DXPA 3S9AA 1HAVB 1O2WA 4Y10E 1H1BA 1ZSJA 3STIA 3R3GB 4ACAA 4ZHAA 1GBJA 2VWOA 3QTOH 3AASA 1G2MA 2F9NA 3RXVA 4GHTA 5FBIA 2V7QD 3GY5A 1S84A 4SGAE 5DP4A 2FOGA 4IC5A 2F9PA 1A7SA 3N7DA 4UDWH 4X6MA 1QFKH 3C1KA 5C5OA 2P8OC 2AFQB 4MPWA 2O9QA 3BEIB 1K9OE 1XUJA 2HOBA 1IHSH 2UWOA 3DD2H 2R3UA 1EB2A 1NFWA 1OHHD 1QL7A 3OY6U 4BXWA 3ZVAA 1P2IA 3E91A 3N99A 1NBME 4THNH 4GCHF 1OX1A 3GDUA 3QUMP 8ESTE 1H8HD 5C2ZA 4ABFA 2JETC 4NCYA 2GT8A 2FOCA 1KDQA 2F9BH 1ZGVA 1MKXH 2R3YA 2R2WU 3BG4C 1FY8E 3PMJA 6GCHG 1O2XA 6LPRA 2B8OH 4YOGA 4Y76A 5DN6D 3B9FH 4A92A 1ZLRA 1D3TB 3SU1A 2BX3A 1HAVA 3LGTA 1ELVA 5JB8S 2QXGA 3P8OA 5C1YA 3SUFA 2V0BA 1FIWA 2Q6DA 5A0CA 5JBAS 1OS8A 2B5TB 3MNSA 3SHAH 4BAOB 4FUDA 5LH8A 1IQLA 3TH2H 2F4LA 1Y5BT 3RXJA 2VJ1A 3PMAB 1SC8U 2ZDKA 4ABEA 2W7UA 4BTIB 1VZQH 1DUEA 3V3MA 3DFJA 2FODA 1C5SA 4XSKU 1UVPA 3N7EA 1O2NA 1CU1A 3ZVEA 3S9CA 1TX6A 4D76A 1LO6A 4TSFD 3ZYDA 1YWUA 3PTNA 2D1JA 3PYHA 4JZFH 5A0BA 3OX7U 2WPKS 1WU1A 1GI4A 1O2ZA 3TNSA 1GVLA 3TGJE 1OP8A 2J2UA 2QF5A 1EB1H 1BB0B 3VXFH 2G81E 3ATWA 2C4FH 1LQDB 5CDFE 3TGIE 3IWMA 4J2YB 2OQUA 1GMCF 1BHXB 1P8VC 1NN6A 4ZH8A 1UTMA 2Z9LA 4TYDA 3S7KB 2QA9E 3ATLA 1C5QA 1IOEA 1SB1H 4MPVA 1ELFA 1ELDE 1S83A 1SL3A 1TMBH 2WPHS 3SNAA 1PPHE 4FUGA 3QK1A 3RU4T 1O2OA 1RTLA 1A5GH 2NU3E 4RT1A 2AMQA 1AGJA 1EOJA 1Y3XA 2BOHB 4O03A 3SUEA 4A1XA 3EE0B 3N7OA 2GP9B 1XMNB 2J4IA 2HNTF 2RA0A 2SFAA 5TJXA 4CBOA 1ELCA 4K1EA 3M35A 1AUJA 3ZZ7A 5GXPA 2UWLA 3KQDA 1UTLM 3PV4A 1N8OB 1LHFH 4ISNA 4O9VA 3SBKA 1LDTT 4NIXA 3D49H 5GDSH 1SLUB 2W26A 1YPJH 1LPZB 5AVDA 1C4V2 2OBOA 3M7QA 4OS6A 4Q80A 5HKKD 3RC4A 2XC4A 1C2LA 3EBNA 2QAAA 2HGTH 4BOHA 2CK3D 1QL9A 1VJ9U 3M3TA 4DIIH 3U8OH 4BXSA 4X6NA 2W3KA 2A31A 2WPMS 1BBRH 2P16A 2AMDA 4D7GA 2AERH 3S9BA 1NFYA 2H5DA 4NSVA 1Z6JH 3UTUH 2NU4E 3RMOH 1O5CB 1HYLA 1TGNA 5DG6A 3A84A 3A89A 4B75A 3FZDA 5GNDA 2K7XA 1OWIA 2A4RA 4KELA 4X1SU 2F9UA 1BTXA 3M5LA 3QGJA 3E8LA 1O2JA 3WW7A 1WTHD 3A88A 1C2FA 1NROH 4CRGA 3F9FA 2EA3A 2TGPZ 2ZFTA 5EXNA 1YPHC 3DCLA 1GJBB 2GD4B 4KKDA 2QF0A 4IN2A 1C1TA 1A0JA 2ZZUH 3F68H 3SGBE 1L1NA 1UMAH 1P3CA 4LXBH 4AC9A 1T7CA 3A7TA 1A61H 4Q63A 1S81A 1D6RA 2CHAC 3MH7A 4B1TA 2F43B 1C4Y2 1P04A 3O8RA 1IQNA 3ZZCA 4Z1MD 2PWXA 5GWZA 1BQYA 1UVSH 3TITA 5JDUB 4Y8YA 1GDUA 1ZPZA 1S82A 5KEDA 1QBVH 1MKWK 3GCHC 1XXFA 3HGNA 1SGQE 1IQKA 1F0SA 3P95A 2BLQA 3D65E 1O38A 3ZV8A 1XUFA 1U6QA 2GZ9A 2RDLA 1H8ED 1SGDE 1ESAA 4DGJA 1C1MA 3PMHB 2P8OB 1BUIA 2GCTB 2WV4A 1W2KH 4X8SH 2BDGA 3A7XA 4FUFA 2BX4A 1A3BH 3T5FH 9ESTA 2XW9A 3MQKC 1MAXA 2LELA 4JZIA 5ESBA 3H09A 3HK3B 4B2CA 3TPIZ 1GPZA 4YOJA 4F4OC 3B8JA 3A7YA 3RXBA 1DDJA 2WZQA 3FZZA 1O35A 3EDXB 3T2NA 4D8NA 5DP7A 1W8BH 1AN1E 2STBE 1O2VA 4YO9A 3P17H 4X6OA 2R0KA 4U2WA 1CE5A 1E79D 1UW7A 5GJ4B 1CO7E 1V2LT 1E0FD 2EC9H 4JCNA 5C20A 1AWFH 1HDTH 4I8JA 5JBCS 4Y79A 1KXFA 1MD8A 1NRPH 3F1SB 4RSPA 3BSQA 2O8MA 3UWIA 4A1TA 3OE7D 1BTWA 3H5CB 2FI3E 2VWNA 4H6SB 3KN2A 1KTSB 1O3IA 4AYYB 1C5OH 1G9IE 1YGCH 1HAGE 5SGAE 1SOZA 1ZMLA 1JIMA 5FPTA 2BLOA 2OK5A 1CHOG 4I8HA 3ZZ3A 2C90B 4NIWA 1Y3VA 3ATIA 2OC0A 2BY9X 1GWAA 1B0EA 3IITA 1BMAA 4INLA 3GDVA 2FI4E 1W0KD 4GSOA 3BTWE 1GMDG 3SQHE 4IGDA 5EJ1A 1UCYH 2ZECA 1ZJDA 5EJLA 5I25A 2FOMB 1GBFA 1J8AA 2H9TH 3HGPA 1MQ6A 1QHRB 3SU2A 1KY9A 1P2MA 1IQJA 1O3KA 3QN7A 1KXAA 1XUGA 1Z6EA 1AB9B 1TA6A 3LT3A 3BTEE 2BD8A 5IYTA 1MU6B 1XXDA 3NUMA 2HVXA 4X2VA 4NA7A 1GI5A 1O5EH 1ESBA 1ZMNA 1KXEA 5CHAB 1FZZA 2EY4C 4X2XA 2A2XH 1CSOE 2BLWA 1QNJA 3SUDA 5KECA 3BIUH 2IPQX 1L4ZA 4OGYA 1CGHA 1C2KA 2BOKA 4WXIA 1CGIE 3LGIA 5E8EH 4K3JA 1EPTB 3BTTE 1O3JA 4BAKB 1PJPA 3BEUA 1Y59T 4WWYA 1NRSH 2KZ4A 3BIVH 3VB5A 1O36A 2NU0E 3NPSA 2FPZA 1ZSKA 2VVVA 2UUYA 4FUHA 2J97A 4PROA 1GI6A 1C2JA 1RIWB 1GHVH 3A7ZA 2H9HA 1WOFA 5EG4A 3VXEH 1BMMH 2XBXA 1TIOA 4ABGA 2VIWA 4I8LA 2BDHA 3GDSA 1HBTH 4M9FA 1C9PA 1COWD 1ANCA 1C4U2 2ZU3A 3PV5A 4Y11E 4E7RG 4XD7D 1C2DA 5AFZH 2J92A 3SU4A 1LPKB 4GUXA 3BN9A 1GHYH 4Y7BA 5C67A 4FVBA 3T29A 4NZQA 1B7XB 1PFXC 2BDCA 1BOQA 2PLXA 2A5AA 1P3EA 4K60A 1QB1A 3UPEA 3MU4A 4D7FA 3BTKE 1NRRH 4H42U 1BMNH 1PQ7A 1BA8B 2VIQA 1RRKA 5GCHF 3SN8A 3SNBA 3A81A 3PROA 3EA9A 1EPTA 3KIDU 1NC6A 1P9SA 3VPKA 5FX6A 1V2UT 2VIDA 4TY6A 3UNRA 3M7TA 3MH6A 1V3XA 3QZRA 2ZDVH 1P01A 1FNIA 1CA0B 3E3TA 3K65B 1H9HE 2ASUB 3KL6A 1O3BA 4LK4A 1O3LA 3ZVBA 4NSYA 2F91A 2SGQE 2A0QB 1CHGA 4CRBA 3B23B 3E90B 3L3TA 1A4WH 2FEQH 3SV2H 5DP8A 1GHBG 1AFQC 4BANB 1C2GA 2OQ5A 1L1JA 3LKWA 3K2UA 4Q7ZA 1A3EH 3GCHB 1FONA 3VGCC 3QZQA 1F5RA 1V2MT 1FIZA 5HMAA 1WQSA 4JYUH 1O2IA 1VCWA 1BT7A 3MMGA 1JRSA 2BQWB 4H4FA 2WPDD 2ZDMA 2WINI 2WUCA 3LGUA 2BDYA 3V12A 1DITH 3PB1E 3U69H 1GI7B 2W6JD 1TQ0B 1TLDA 1BRCE 2QV1A 5F8ZA 1N8OC 4XE4A 1OYTH 1YY3A 3BTQE 1CT4E 1CT2E 2FO9A 2PW8H 3F2HA 4O97A 4B6FA 3EE7A 2HVYB 3MWIU 3WWFA 1AVXA 2BD3A 1GHAF 3G01A 3MO6A 1BCUH 1YPMH 1QGFA 1SGTA 1TNLA 3SZNA 1F5KU 1SGYE 4WVPE 3ZVDA 1HAIH 2ODQA 3MU1A 3FOAA 2QN5T 1O3NA 2OC1A 2YNBA 1HIAB 1KIGH 2KFWA 2YOLA 4DT4A 4B73A 1UTQA 3SV9A 1KLTA 1ZYOA 3CS0A 1AVWA 1HJ9A 1TRMA 5FX5A 1LPGB 3T62A 2BB4A 3ZVFA 2ODYB 1Q2WA 1HJ8A 2GV6A 1FAXA 2IPHA 1ETSH 3RU4E 2XCNA 3F3BA 8GCHG 2FIRH 2PR3A 3CENA 2GGVB 3A8DA 1YCPK 4ZUHA 1XKBC 1QIXB 2ZTZA 3RXFA 2GKVE 2BD2A 3PWBA 3A8BA 2A45B 3P92A 2FTMA 2Y81A 1XUHA 4UFEH 1C2MA 5HGGA 1VR1H 2ZQ1A 2PKSC 3PV2A 1ID5H 2M5TA 4OS5A 2CF9H 1N6XA 2PKAB 4JYTA 1G37A 3UNQA 5L2ZH 1EFRD 1QA0A 2FTLE 6GCHF 1JWTA 4J1YA 1RXPA 1GCDA 2ULLA 2ZGJA 3PTBA 3F9GA 1GJ4H 1YLNA 2VH0A 4B71A 3OEHD 1EASA 1HIAA 1G3DA 3U1IB 5EXLA 1UO6A 3SJIA 1QY6A 2FOEA 2H9EH 2BY6X 3MH4A 3EGKH 3GY4A 1FV9A 3UR9A 1ORFA 3LC3A 1XX9A 3QDZB 2WV9A 2JJ1D 3O8BA 2OXSA 2VIVA 1G36A 2ZHQH 1O2YA 1W13U 4MTBA 5FPSA 4MNXA 1O31A 3VG8A 4DVAU 2GCTC 2ZCKP 3ATMA 4CR5A 4DW2U 4IN1A 1MKWH 1HAPH 4OS7A 4TT3D 3A80A 3Q76A 1O2HA 1ABJH 1T31A 1AE5A 2F3CE 5CHBA 1GBTA 4FUIA 2W7SA 3SNDA 1BIOA 3BG8A 1GVKB 2FS9A 2F9OA 2HALA 1TGBA 5A0AE 2A2QH 4R0IA 1Q31A 3P8FA 3NWUA 2PKAA 1YPKH 1SBWA 2EEKA 4NA9H 1CBWB 2BD5A 4A1VA 4MNWA 6ESTA 2F9VA 3GY7A 4Y8ZA 5DO4H 2CN0H 3TLOA 3RXSA 1V2OT 2C8YB 3ELAH 3HKJB 2Y5FA 1OWEA 3SHCH 1NZQH 2VVCA 3FFGA 7LPRA 2BLVA 1MD7A 2TGTA 3GS9A 1H4WA 2V6NA 1GBCA 2ZGCA 2R0LA 1EZSC 4TPYA 3TJVA 3RC5A 1GGDB 2VVUA 5ABWA 3KGPA 3MTYA 2YNAA 2XBVA 2FLBH 4BAQB 2VWMA 3TU7H 1EAWA 3RMLH 2AMPA 4P02A 2H5CA 3RLWH 1N1LA 3MOCA 4OS2A 4YZUA 4D9RA 1G32B 2JH0D 1DS2E 1WSSH 1AE8H 4AFQA 1HUTH 3FN8A 3I78A 2FWWA 1P2NA 3PLKA 3ZZ6A 1SG8B 3DSOA 3RXIA 5EQQA 2TRMA 1OYQA 2JH6D 3KHVA 4UE7H 4Y7AA 1W0JD 1DLEA 3UFAA 1PPEE 1AHTH 2BVSH 4OM9A 1G3EA 1OPHB 4X2WA 1OWKA 4LZ1H 1AFQB 1AB9C 2G00A 2VGCB 4Q7YA 3T27A 2VNTA 2Z9KA 5CHAC 1AWHB 1TMTH 4NGAH 3UOPA 2H6MA 2J38A 3UUZA 1KTTB 5HIZA 3VGCB 1AUTC 1SQAA 4E05H 1QJ6B 1HNEE 5LGOA 2Z6BD 2VWLA 1EPTC 2CJIA 1WQVH 5AF9H 5LPRA 3PMBB 3SU6A 2A7HA 2GZ8A 2K8IA 1K2I1 4E7NA 2C3SA 4ZKRU 1PPGE 3FP8E 2PSXA 5JBBS 2ZF0H 3M5NA 1P2OA 1O34A 4KP0A 1RIWC 2A5KA 2R9PA 4DY7B 1C5NH 7KMEH 3C27B 4K5ZA 2BY7X 1TGSZ 4Z6AH 5PTPA 1GL0E 2HPPH 2Y7ZA 1F7ZA 4AYVB 4RT0A 4FETA 4P00A 2QC2A 3RC6A 1KLIH 1MH0A 1BRUP 2LPRA 2A1DB 3H7OA 1MBQA 2Z3EA 2ANYA 1JOUB 3SNEA 3Q00A 2FX4A 2NU1E 3L6PA 3SOSA 1OWJA 2ZDLA 4YESB 3T26A 4AB9A 1HLTH 1YM0A 3U8RH 1C1VH 5C5NA 4UONA 1BHXF 1MMJN 2XBWA 1EP5A 4FUBA 1F0UA 3BTME 3A85A 2P93A 4ABHA 1O2UA 1C1WH 3DFLA 1TOMH 4FUCA 1DT2A 1C5RA 1GBAA 1YPHE 1K1IA 2Z94A 4Q4LA 1TNIA 1TBZH 2A4OA 2PUXB 3T28A 3UWJH 2ZG0H 1GVZA 3LJOA 3OY5U 1GBHA 3QO6A 3KQBA 1TGCA 3RXUA 1IQMA 4DG4A 1K1NA 4ISIH 1SKYE 2ZGHA 3RUOA 4X8TH 1J14A 4RI0A 2BD9A 3ATKA 1O3EA 1JBUH 1MUEB 1CA0C 2PKSB 3QLPH 1WCZA 2QXHA 1EAXA 1W0ZU 3SI3H 3I29A 5T3HA 1O3DA 2PGQB 2WSSD 4K2YA 4DCDA 4ZROA 1KXDA 5K0HA 2CF8H 3K6ZA 2GT7A 2G51A 3T25A 1C1QA 2FYRA 4CRDA 2DE8A 3MI4A 1DWBH 5DGJA 2KR7A 2STAE 3QWCH 5E2OA 4LZ4B 4MNYA 2GTBA 4ISOA 1ZTKA 1DVAH 3VB3A 4Q2KA 4A5TS 2ZHDA 1D3PB 1C1NA 3M3VA 1FUJA 2A4QA 1LHDH 4ASUD 3ENSB 3SI4H 5DK1A 1O2GH 1TE0A 1SLWB 1JRTA 2CGAA 4YLUA 3DA9B 2HWLB 5CMXH 3SU5A 1IAUA 1SQTA 4X8UH 4R8TB 3LOXA 1FN6A 1BTUA 1DLKB 1MTSA 1T8OA 5C3NA 1ELTA 1W11U 2Y82A 3BEFB 1EP6A 1ZPCA 2OD3B 2WV5A 4K8YA 1A2CH 1KLJH 1O3HA 3ODDA 1INCA 3EAJA 4BAMB 3EA7A 1MKXK 3F2GA 4X1NU 1C5VA 1O2TA 3RXMA 1MTUA 5FAHA 1C5TA 1QRZA 4TPIZ 5DP9A 1HGTH 1G3CA 1O37A 3MNCA 3FP6E 1TX8A 1MCTA 1HV7A 1NESE 1O5DH 4YTAA 1NT1A 2TBSA 4FU8A 4D9QA 5EQSA 1TPSA 4QT8C 3E1XB 3RXOA 1O3MA 1VKYA 3PRBA 2ZIQH 2K1QA 3TJUA 4AG1A 3RMNH 1O3PB 1L2EA 3AW0A 3OYPA 1ESTA 1QTFA 2LIZA 2Z3CA 4JZ1A 1AQ7A 5IK2D 1Z1IA 1P2QA 2G8TA 1NBMD 4XBDA 1DUAA 5G4BA 3MH5A 2OUAA 3RM2H 5A8XA 2YMSB 4TY7A 3SGAE 2F83A 4MPUA 1SGPE 4FVDA 4MVNA 4CH8B 2YMSD 1P03A 4XRNA 3ESTA 5GPIB 1HPGA 3SV6A 1IQIA 4K1TA 1THRH 1CA8B 4F48B 4INKA 1PQ8A 4IC6A 1WXRA 2Q6GA 1GBLA 3U28C 1SGNE 3VB7A 1HXFH 4ABIA 3GY2A 3UIRA 4HI3A 2RCEA 1C5PA 2XC0A 3PM3A 4NA8A 5EOKA 1VCQA 2TGDA 2ZGXH 3KQCA 1FY1A 1P2JA 2JIZD 3MO9A 4GVUA 1VGCC 1UHBA 3ODFA 3UOUA 1Q3XA 1J15A 3IG6B 1MBMA 2VINA 1QCPA 1ZMJA 1T32A 3RP2A 2ZU5A 3RXHA 1LQEA 5A8ZA 1GMHF 1Y3UA 4AB8A 2BQ6B 1O5BB 1O2PA 2KCOA 3ZIAD 1V2KT 3NK8A 2XNIA 5C17A 4HTCH 2BM2A 2UUFB 1Y5AT 2PFEA 1BITA 1UJ1A 1ZPBA 1SFIA 3BTGE 1Z8IB 5FL7D 4YOIA 5C0UA 4X6PA 1ELBA 3GCTF 1PPCE 1S0RA 1BJVA 3A82A 4ZHMU 4YXWD 1ACBE 5A09A 3NZIA 1K1LA 1OP0A 4SGBE 3PO1B 1CBWC 2ZP0H 3ZZBA 2KX4A 3LGYA 2NU2E 1GHBF 2PTCE 2PSYA 1O2QA 1C5WB 4NIVA 2VIOA 1DY9A 1WAYB 4RKJB 5EPNA 1TBRH 2V3HH 1BBRK 1QB9A 3GOVB 1F5LA 1AMHA 1C5YB 3Q3XA 2BVRH 1BBRE 6CHAC 5EGMA 3RXKA 3URDA 4IBLH 1S5SA 2HNTE 5FBEA 1BTYA 4OGXA 3UREA 4B76A 1GBDA 3RLYH 3LGVA 3BTHE 2VIPA 1K0HA 1GJ6A 2J98B 3F0PA 1MU8B 1GGDC 1PQ5A 3QGNB 4U30A 2D8WA 2WYJA 2WPJS 1YLDA 1Z71A 3A8CA 5E0GA 4CBNA 1LVOA 1O2LA 1V2WT 3P6ZB 1K1MA 2ZU4A 1EJNA 4TWWA 3MFJA 4WXVA 3Q3KA 3ZZ8A 3CP7A 4UFDH 2BDIA 5IDKA 3SQEE 4CHAB 1GJ9B 1Z8JB 1UTNA 4A6LA 1ZHPA 4XOJA 2HRVA 1A1RA 1DM4B 2RFKC 2P94A 5DSFA 3TNTA 1RTKA 3STJA 1W0YH 5E2PA 2ALPA 3U98H 1FPCH 5DP6A 5K7RA 1UTOA 4B2AA 5JBTA 2B0FA 2VGCC 2R2MB 4B2BA 4UFGH 3M3SA 1S6HA 2Y5GA 4ASHA 1L4DA 4X8VH 1JMOH 2G4UA 2GVFA 1VITG 3MU5A 1L1GA 2ZC9H 4GPGA 1QRXA 1S6LA 2A7JA 8GCHF 1IQFA 3UY9A 1DWDH 1JXPA 1HJAB 3P70B 1SGRE 2THFB 1FY5A 4X1RU 3Q3YA 2J98A 4CRCA 1HAXB 4K8BA 5B6OA 3DUXH 2KM0A 1C9TA 7GCHF 3KCGH 4F49A 1RGQA 1YPEH 2FX6A 1PPBH 4FU7A 2OP9A 3PLBA 4NFEA 3EYDA 1DWCH 3TK5A 3SJOA 1L0ZA 1J17T 1P2KA 2QF4A 2Q6FA 5F53A 2ZEBA 2ZCLP 2EI8A 1ZHMA 5HM2A 5EU8A 3BTDE 1ZHRA 1ELGA 1GCTB 2AEIH 4MG3A 1YPGH 2ZFQH 3BV9B 1C1SA 2OBQA 3HPTB 4KGAA 1FI8A 1Z8GA 3S0NA 3W1EA 1BJUA 1THPB 5JPMH 2FYQA 3F2FA 2P59A 1V2NT 1LMWB 1Y5UT 3PRDA 2IOTA 1BZXE 5TCCA 1GG6B 2OTVA 4OS4A 1ARBA 5DKMA 2O8WA 5EW2H 1CGJE 3S7HB 3TIUA 1RJXB 4CR9A 3A7WA 4CRFA 4FOUC 2ZFFH 4FUJA 1ARCA 2H2ZA 1QR3E 2QYIA 3NRLA 1SGEE 1ZJKA 1V2JT 2WHXA 3DT0H 3MNXA 4ZCNA 1Z7KA 3VFEA 1FJSA 3LC5A 4Y6DA 1P12E 1TYNA 3M36A 3MHWU 3PWCA 4NWKA 1AZ8A 1V2ST 4O3UA 1QA7A 2G5VA 1PYTD 3ZZAA 1K21H 2A5IA 1UCYK 2KCPA 3FANA 1SGCA 2P95A 2ZGBH 4I8KA 4K69A 3A86A 5AFYH 3TH4H 1HAOH 1O3CA 1YF4A 1UCYE 2ZPRA 1TRNA 4IMZA 4ISHH 2A7CA 3F9EA 2ZQ2A 3ZZDA 1E34B 1NO9H 1D6WA 2AGEX 2CV3A 1F0TA 1BTHH 1GJDB 1S6FA 1A0HB 1S85A 1VJAU 2AGIX 2C93B 8LPRA 1GBKA 1VGCB 1KXBA 2A32A 2KCAA 1WUNH 4INHA 2PP6A 4X2YA 5CE1A 1TQ7B 3D62A 2Y7XA 3W95A 5DP3A 1TBQH 1GHAG 1OOKB 3MU0A 5T6FA 1O3GA 3FVFB 2GCHG 3FKSD 4FU9A 3S69A 1P05A 1D3DB 3UQVA 1DPOA 4MLFB 2FS8A 3GYLB 4IMQA 2BXTH 1C2HA 1CT0E 3M61U 1FY3A 2Y5HA 1TB6H 2CMYA 2XNDD 5JB9S 3SV7A 1A5HA 1EQ9A 2GMTB 1DFPA 2FI5E 5H4IB 1C5ZB 1Z1JA 5DJ7A 3M5OA 2ZPQA 1RD3B 1W14U 1DANH 4FUEA 1T4VH 1ELEE 1ZRBA 4AORA 4MPXA 5C1UA 2BDAA 1UVTH 4I33A 4ZKSU 1E1QD 2CXVA 2WPLS 2G55A 5F03A 1X7AC 4ZHLU 2V3MA 2BD4A 2P3TB 3NXPA 4DURA 1GBBA 1RS0A 3SGQE 5FXLA 6CHAB 1J16A 1EZQA 3BTFE 3RM0H 4MDSA 1ZZZA 2XC5A 4CREA 2NWNA 1O0DH 3SORA 1MCVA 4GHQA 3KQEA 2UUJB 2DE9A 2G52A 2ZO3H 1E1RD 3L33A 4ABAA 3SZEA 8KME2 4RN6A 5EW1H 2YMSC 1HAYB 1A46H 3M37A 1DXWA 2FLRH 5T6DA 5FCRA 1IQHA 5EODA 1UK3A 3TH3H 3HATH 4A7IB 1GJ5H 3QTVH 1HB0B 1UVOA 1TPOA 1ETRH 2XYAA 4I7YH 4YT6H 4U32A 3RXRA 2C8XB 3ZV9A 1BMLA 1HAHH 1BMFD 3V13A 3GY3A 2W6ID 4ABBA 2WYGA 1ZOMA 1AIXH 1O30A 1XM1A 3OSYA 3OTPA 1CQQA 5EIYA 1C1OA 3HK6B 1O33A 1QL8A 1J9CH 1GHZA 2L6OA 4GAWA 4UEHH 1TNJA 3SNCA 1GI2A 1TPPA 3JZ2B 1ZR0A 1O5AB 1V2TT 4ACBA 2KCYA 1XVMA 1OXGA 1O2RA 2B9LA 4DOQA 4WMEA 3A7VA 1QBOA 2ZWLH 4YLQH 3SJ8A 1W10U 3LU9B 4GCHG 2FP7B 1SLVB 1LKAA 1O5GH 1AI8H 1T8LA 2VB0A
chains in the Genus database with same CATH topology
1A0LA 3GY8A 1K22H 1N6YA 2P3UB 2W3IA 5A8YA 2V3OH 4H6TA 2AIQA 2ESTE 1GDQA 3FAOA 3RXEA 2ZFRH 1C5XB 1YC0A 5A2MH 1C2IA 4ZKOU 1LHEH 4NIYA 1SSXA 4X1QU 4I8GA 3VB6A 2IN2A 2ZHFH 3PO1C 5AHGH 1EJMA 1EUFA 1TALA 1FAKH 1ANEA 3K6YA 3LH1A 2BQ7B 1Y8TA 1YYY1 2B7DH 2WPIS 2ZI2H 3FP7E 5EQRA 1GHWH 5BPEA 4XBCA 2DUCA 1FDPA 1AFEH 2P3FH 2ZKSA 4JMYA 5GIBA 5TCAA 3MU8A 1IQEA 2Z9IA 1QBNA 2PV9B 1SR5C 1QQUA 4AX9H 3JZ1B 1EXFA 1SGFA 4X0WU 1SHHB 3SU0A 1LCYA 3RXTA 4XDEA 4KTCA 1FQ3A 2ZU1A 2D26C 2SGFE 3ZVCA 1B5GH 2GX4A 1H9LB 1SI5H 2Z7FE 2XCFA 1D9IA 1TMUH 3GCOA 2QIQA 2Z9JA 1OP2A 2OC8A 4CHAC 1UK2A 9LPRA 1K1JA 4JZEH 1GMCG 1YKTA 3KNXA 3OTJE 3A8AA 1NU7B 4VGCC 3RXAA 3M7UA 3A83A 2SGAA 1UVUH 2FESH 3ITIA 1XVOA 3RXCA 1BRAA 2AIPA 1D4PB 3E16B 1FPHH 1HXEH 2FMJA 2PUQH 1MTVA 4KTUA 5HYOA 4YT7H 1P9UA 4ESTE 5J4SA 2Y80A 3ZYEA 1O3FA 1TAWA 5HM9A 1QJ1B 1YP9A 5T6GA 2C8WB 1T4UH 4UD9H 3RU4D 2O8TA 3V7TA 1SQOA 3ZZ4A 3GCNA 2BXUH 1G30B 1QURH 1W3CA 1DWEH 2HLCA 4MQAA 4OS1A 4CH2B 2BTCE 1EAUA 3LIWA 1EKBB 1P57B 5F8TA 3SV8A 5C1XA 2J34A 1HJAC 4NZLA 3DHKH 2XBYA 3NCLA 1MTNB 1LTOA 1FXYA 1SGFG 3LPRA 4LOYH 5ESTE 1K28D 1M9UA 2HPQH 2ZFSA 1CHOF 1LHCH 3E0NB 2QY0B 1E36B 1AVGH 1NTPA 1RFNA 2J95A 2UWPA 2SGDE 3Q77A 4HGCA 3E6PH 4XBBA 1QJ7B 1A5IA 4Y8XA 3D23A 1CVWH 1GCTC 5I46H 1W12U 1GMDF 1QQ4A 2TPIZ 4U01A 1BTZA 4BTUB 3TK6A 1GI1A 3LONA 1G2LA 2ZHWH 1C5MD 1HRTH 3RXGA 2BZAA 4IS5A 2ANMH 3RXPA 5F8XA 3U9AH 3SUGA 1UHBB 4AG2A 2Z9GA 3LDXH 1O2KA 1YLCA 1BTPA 1GL1A 1ZRKA 4GLYA 2TGAA 1KXCA 3URCA 1GG6C 1MZAA 2ZA5A 3AAVA 1SMFE 3TVJB 1TWXB 5FHTA 1EZXC 2KAIB 2VU8E 3P8NA 2JETB 2UUKB 3GY6A 3I77A 1FN8A 3TJNA 1MTWA 4AFSA 1HFDA 2IJOB 2TIOA 1V6DA 3BG4B 1SLXB 1P09A 1LVYA 1FMGA 4WY3A 2I6QA 4JK5A 3PLPA 4NFFA 5E0HA 4CRAA 1SHYA 3ZVGA 2BY8X 2Y6TA 1G3BA 3MYWA 4WJG2 5ETXA 1NM6A 1PYTC 1WBGB 2FM2A 3H7TA 1MAYA 4MNVA 4IW4E 4JK6A 4WH8A 1GI0A 3EA8A 1PPFE 4B74A 1GBMA 1THSH 2ZU2A 1GI3A 1UTKA 1EAIA 1LVMA 3F9HA 1YCPH 3AVZA 1NY22 1TNHA 2LNCA 4ZAEA 1TRYA 3W94A 3EQ0H 4I31A 2QXIA 3RMMH 5EPYA 4DT7B 1F92A 4ZMAH 1TGTA 3VEQB 2ODPA 2FZZA 3O8CA 4I32A 2GZ7A 2PHBA 2KAIA 5L6NH 2SNWA 3O8DA 1IHTH 3SJ9A 4RKOB 3GISB 2GV7A 4Y0ZE 1DY8A 2OC7A 1P02A 4K1SA 1GHXH 1O2MA 2EI7A 1C2EA 2FOFA 2FOBA 4Y71A 1P11E 1UTPA 3AW1A 2BHGA 2BZ6H 3AAUA 1NS3A 1ZSLA 3ZZ5A 1ZTLA 4WMFA 3LJJA 1UK4A 1LVBA 1H9IE 4NG9H 5LPEA 1XUKA 2GMTC 2ZNKH 2SGEE 3GYMA 3LGWA 3SJKA 1BRBE 3V0XA 4HZHA 4AFZA 3LH3A 2VH6A 3KF2A 5DPAA 3MNBA 1ANDA 2WUBA 2FXRA 2QGRA 1GJCB 4FXGH 3CS7A 1C1UH 5FPYA 3SU3A 1AU8A 1GDNA 1TNGA 1V2QT 2ZCHP 1O32A 2C8ZB 2Q1JA 1AZZA 1O2SA 4AOQA 1TONA 3F6UH 1D3QB 4ZXYH 3UNSA 2OCVB 1VITF 1AD8H 2FDAA 1VCPA 2GDDA 1O3AA 4AGJA 2RG3A 2SGPE 1H8IH 1OKXA 3U1JB 1V2PT 1JIRA 5FCKA 3TJOA 1GJ8B 1TABE 1FY4A 5F6MA 4Z0KA 5L2YH 1XKAC 2XRCA 2GDEH 2BDBA 1KSNA 2J94A 1ZTJA 1SVPA 2V35A 1C5LH 2BD7A 3K9XB 4KTSA 1KYNA 2A4GA 1O5FH 4VGCB 3KEEA 2HNTC 1EX3A 2QCYA 1HAZB 1VITH 1WV7H 4TWYA 1DOJA 1GMHG 1WTGH 4NWLA 1Y3WA 3ZZ9A 2BYAX 2W5EA 4UFFH 1DE7H 2ANWA 2XTTB 2ALVA 1EJAA 1W7GH 1DSTA 4JYVH 1OSSA 4ABJA 2J9NA 4AGKA 5EXMA 1FLEE 2G4TA 1F0RA 2Z3DA 5BRRE 1EATA 3TGKE 1K1OA 2RA3A 1OWHA 3HKIB 2ILNA 3GCTG 2SNVA 1DICA 5HXFA 2EI6A 1SFQB 1GBEA 4JZDH 4HFPB 1NFUA 3RXQA 1NU9A 1T8NA 2CHAB 1Y3YA 1AO5A 1O3OA 1MZDA 1YBWA 1DX5M 1TNKA 1AKSB 3MO3A 4ISLA 2ANKH 2XXLA 1ELAA 2D2DA 1GJAB 1QB6A 5JYIA 1Z8RA 1H8DH 1LHGH 1B0FA 1QRWA 1T8MA 2PGBB 2JH5D 3RDZA 4ZXXH 3U8TH 1ABIH 4YM9A 3GICB 2ZDAH 3VB4A 1RTFB 1TFXA 4ZKNU 2H1UA 1GI8B 5GCHG 1P10A 1O39A 4BNRA 1SPJA 1TOCB 2O8UA 2PTNA 3UQOA 1HCGA 2FOAA 1DSUA 1GBIA 1P0SH 2ZTYA 1MQ5A 2ZPSA 4ABDA 1E37B 3SW2B 3QX5H 3R0FA 1IQGA 3RXDA 3UR6A 2AYWA 2I6SA 4X1PU 2AS9A 1OWDA 2G5NA 4XFQA 1YCPM 4DIHH 2QF3A 5DP5A 1E38B 2GCHF 1AY6H 1C1PA 1NRQH 1GJ7B 1EOLA 1UTJA 2BMGB 2ZFPH 5E0JA 1ETTH 1S0QA 5J4QA 1P06A 4WF8A 2AGGX 2OINA 4BAHB 1AKSA 5LPFA 3M5MA 3RXLA 1EZUC 1SOTA 1GI9B 2ZHEH 5L30H 2BVXH 1TX7A 4Y0YE 2QXJA 1V2RT 2XWAA 1E35B 3NKKA 1C1RA 4BTTB 1LKBA 1TPAE 1YPLH 4Q7XA 3OU0A 1NPMA 2BY5X 2FOHA 1NRNH 3P8GA 2AH4X 2ZTXA 4AFUA 1ZGIA 3A87A 7GCHG 2ZDNA 4M7GA 7ESTE 2O8LA 2XWBI 4WMDA 1F2SE 1ANBA 4AN7A 1WYKA 1NFXA 3SO3A 1PQAA 1SGIB 1BDAA 1KDQB 3BF6H 1C5UA 2OLGA 4E06H 4O3TA 1K1PA 3WY8A 1MTNC 1V2VT 1XUIA 2JKHA 1TA2A 4WH6A 1PPZA 4AZ2B 3E0PB 3TK9A 1W7XH 4DJZB 1DXPA 3S9AA 1HAVB 1O2WA 4Y10E 1H1BA 1ZSJA 3STIA 3R3GB 4ZHAA 1GBJA 2VWOA 3QTOH 3AASA 1G2MA 2F9NA 3RXVA 4GHTA 5FBIA 3GY5A 1S84A 4SGAE 5DP4A 2FOGA 4IC5A 2F9PA 1A7SA 4UDWH 4X6MA 1QFKH 3C1KA 5C5OA 2P8OC 2AFQB 4MPWA 2O9QA 3BEIB 1K9OE 1XUJA 2HOBA 1IHSH 2UWOA 3DD2H 2R3UA 1EB2A 1NFWA 1QL7A 3OY6U 4BXWA 3ZVAA 1P2IA 3E91A 4THNH 4GCHF 1OX1A 3GDUA 3QUMP 8ESTE 5C2ZA 4ABFA 2JETC 4NCYA 2GT8A 2FOCA 1KDQA 2F9BH 1ZGVA 1MKXH 2R3YA 2R2WU 3BG4C 1FY8E 3PMJA 6GCHG 1O2XA 6LPRA 2B8OH 4YOGA 4Y76A 3B9FH 4A92A 1ZLRA 1D3TB 3SU1A 2BX3A 1HAVA 3LGTA 1ELVA 5JB8S 2QXGA 3P8OA 5C1YA 3SUFA 2V0BA 1FIWA 2Q6DA 5A0CA 5JBAS 1OS8A 2B5TB 3MNSA 3SHAH 4BAOB 4FUDA 5LH8A 1IQLA 3TH2H 1Y5BT 3RXJA 2VJ1A 3PMAB 1SC8U 2ZDKA 4ABEA 2W7UA 4BTIB 1VZQH 1DUEA 3V3MA 3DFJA 2FODA 1C5SA 4XSKU 1UVPA 1O2NA 1CU1A 3ZVEA 3S9CA 1TX6A 4D76A 1LO6A 3ZYDA 3PTNA 2D1JA 3PYHA 4JZFH 5A0BA 3OX7U 2WPKS 1WU1A 1GI4A 1O2ZA 3TNSA 1GVLA 3TGJE 1OP8A 2J2UA 1EB1H 1BB0B 3VXFH 2G81E 3ATWA 2C4FH 1LQDB 3TGIE 3IWMA 4J2YB 2OQUA 1GMCF 1BHXB 1P8VC 1NN6A 4ZH8A 1UTMA 2Z9LA 4TYDA 3S7KB 2QA9E 3ATLA 1C5QA 1IOEA 1SB1H 4MPVA 1ELFA 1ELDE 1S83A 1SL3A 1TMBH 2WPHS 3SNAA 1PPHE 4FUGA 3QK1A 3RU4T 1O2OA 1RTLA 1A5GH 2NU3E 2AMQA 1AGJA 1EOJA 1Y3XA 2BOHB 4O03A 3SUEA 4A1XA 3EE0B 3N7OA 2GP9B 1XMNB 2J4IA 2HNTF 2RA0A 2SFAA 5TJXA 4CBOA 1ELCA 4K1EA 3M35A 1AUJA 3ZZ7A 5GXPA 2UWLA 3KQDA 1UTLM 3PV4A 1N8OB 1LHFH 4ISNA 4O9VA 3SBKA 1LDTT 4NIXA 3D49H 5GDSH 1SLUB 2W26A 1YPJH 1LPZB 5AVDA 1C4V2 2OBOA 3M7QA 4OS6A 4Q80A 3RC4A 2XC4A 1C2LA 3EBNA 2QAAA 2HGTH 4BOHA 1QL9A 1VJ9U 3M3TA 4DIIH 3U8OH 4BXSA 4X6NA 2W3KA 2A31A 2WPMS 1BBRH 2P16A 2AMDA 4D7GA 2AERH 3S9BA 1NFYA 2H5DA 4NSVA 1Z6JH 3UTUH 2NU4E 3RMOH 1O5CB 1HYLA 1TGNA 5DG6A 3A84A 3A89A 4B75A 3FZDA 2K7XA 1OWIA 2A4RA 4KELA 4X1SU 2F9UA 1BTXA 3M5LA 3QGJA 3E8LA 1O2JA 1WTHD 3A88A 1C2FA 1NROH 4CRGA 3F9FA 2EA3A 2TGPZ 2ZFTA 5EXNA 1YPHC 1GJBB 2GD4B 4KKDA 2QF0A 4IN2A 1C1TA 1A0JA 2ZZUH 3F68H 3SGBE 1L1NA 1UMAH 1P3CA 4LXBH 1T7CA 3A7TA 1A61H 1S81A 1D6RA 2CHAC 3MH7A 4B1TA 1C4Y2 1P04A 3O8RA 1IQNA 3ZZCA 2PWXA 5GWZA 1BQYA 1UVSH 3TITA 5JDUB 4Y8YA 1GDUA 1ZPZA 1S82A 1QBVH 1MKWK 3GCHC 1XXFA 3HGNA 1SGQE 1IQKA 1F0SA 3P95A 2BLQA 3D65E 1O38A 3ZV8A 1XUFA 1U6QA 2GZ9A 2RDLA 1SGDE 1ESAA 4DGJA 1C1MA 3PMHB 2P8OB 1BUIA 2GCTB 2WV4A 1W2KH 4X8SH 2BDGA 3A7XA 4FUFA 2BX4A 1A3BH 3T5FH 9ESTA 2XW9A 1MAXA 4JZIA 5ESBA 3HK3B 4B2CA 3TPIZ 1GPZA 4YOJA 4F4OC 3B8JA 3A7YA 3RXBA 1DDJA 3FZZA 1O35A 3EDXB 3T2NA 4D8NA 5DP7A 1W8BH 1AN1E 2STBE 1O2VA 4YO9A 3P17H 4X6OA 2R0KA 4U2WA 1CE5A 5GJ4B 1CO7E 1V2LT 1E0FD 2EC9H 4JCNA 5C20A 1AWFH 1HDTH 4I8JA 5JBCS 4Y79A 1KXFA 1MD8A 1NRPH 3F1SB 4RSPA 3BSQA 2O8MA 3UWIA 4A1TA 1BTWA 3H5CB 2FI3E 2VWNA 4H6SB 3KN2A 1KTSB 1O3IA 4AYYB 1C5OH 1G9IE 1YGCH 1HAGE 5SGAE 1SOZA 1ZMLA 1JIMA 5FPTA 2BLOA 1CHOG 4I8HA 3ZZ3A 2C90B 4NIWA 1Y3VA 3ATIA 2OC0A 2BY9X 1GWAA 1B0EA 3IITA 1BMAA 4INLA 3GDVA 2FI4E 4GSOA 3BTWE 1GMDG 3SQHE 4IGDA 1UCYH 2ZECA 1ZJDA 5I25A 2FOMB 1GBFA 1J8AA 2H9TH 3HGPA 1MQ6A 1QHRB 3SU2A 1KY9A 1P2MA 1IQJA 1O3KA 3QN7A 1KXAA 1XUGA 1Z6EA 1AB9B 1TA6A 3LT3A 3BTEE 2BD8A 5IYTA 1MU6B 1XXDA 3NUMA 2HVXA 4X2VA 4NA7A 1GI5A 1O5EH 1ESBA 1ZMNA 1KXEA 5CHAB 1FZZA 4X2XA 2A2XH 1CSOE 2BLWA 1QNJA 3SUDA 3BIUH 1L4ZA 4OGYA 1CGHA 1C2KA 2BOKA 4WXIA 1CGIE 3LGIA 5E8EH 4K3JA 1EPTB 3BTTE 1O3JA 4BAKB 1PJPA 3BEUA 1Y59T 4WWYA 1NRSH 3BIVH 3VB5A 1O36A 2NU0E 3NPSA 2FPZA 1ZSKA 2VVVA 2UUYA 4FUHA 4PROA 1GI6A 1C2JA 1RIWB 1GHVH 3A7ZA 2H9HA 1WOFA 5EG4A 3VXEH 1BMMH 2XBXA 1TIOA 4ABGA 2VIWA 4I8LA 2BDHA 3GDSA 1HBTH 1C9PA 2ZU3A 1ANCA 1C4U2 4Y11E 4E7RG 1C2DA 5AFZH 2J92A 3SU4A 1LPKB 4GUXA 3BN9A 1GHYH 4Y7BA 5C67A 4FVBA 3T29A 4NZQA 1B7XB 1PFXC 2BDCA 1BOQ<