2OP9A

Substrate specificity profiling and identification of a new class of inhibitor for the major protease of the sars coronavirus
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
302
structure length
302
Chain Sequence
ASGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Replicase polyprotein 1ab (pp1ab, ORF1AB) 3C-like proteinase
publication title Substrate Specificity Profiling and Identification of a New Class of Inhibitor for the Major Protease of the SARS Coronavirus.
pubmed doi rcsb
source organism Sars coronavirus
total genus 88
structure length 302
sequence length 302
chains with identical sequence B
ec nomenclature ec 3.4.22.-:
pdb deposition date 2007-01-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2op9A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2op9A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2op9A02
1H9HE 1PPZA 3L33A 7ESTE 5JBTA 4JZ1A 5TCCA 1GL1A 4U01A 1QQUA 1C5MD 4QT8C 1Z7KA 2BX3A 1NC6A 1QNJA 1P2NA 3S69A 2G4UA 4BTUB 4X1PU 4GHQA 1GI8B 4GPGA 3EA9A 3BEIB 2WUCA 1O2HA 1WCZA 1S83A 2H9HA 2RDLA 3DA9B 1ELCA 1VCWA 5FCRA 1TGBA 3SV2H 2ZHEH 1BBRH 5DP8A 4AYYB 1A5HA 1ZPBA 1UCYE 3VB4A 5DP5A 2BOKA 4K69A 4E7RG 3K6ZA 1WSSH 1SB1H 1SI5H 4MNYA 1LTOA 2BVXH 1QA7A 1TIOA 1QL7A 4FUBA 2RA3A 2FOBA 4IN1A 3D62A 4I8JA 1GBAA 1TQ7B 1NRNH 1Y3YA 1FLEE 1O39A 1O2SA 1UK4A 1SLVB 1O37A 1LHCH 1QJ1B 4TPIZ 4XE4A 5DGJA 2XNIA 3SUFA 2O8LA 3SHAH 2D2DA 1ZRKA 5F03A 1DVAH 2BMGB 3GCTF 2ANMH 5FHTA 3NKKA 1O2OA 1GJ7B 2Q6GA 1WTHD 1EOLA 3MO9A 1OXGA 3BEUA 4X1NU 4AORA 5DJ7A 1TMTH 4YOIA 4KP0A 2QF3A 2GV7A 2ZEBA 2W5EA 2BD5A 4BTTB 1AE5A 3SNCA 3RXBA 1C1SA 1O31A 4WY3A 4IC6A 1ZSKA 1VZQH 1TGCA 5EW1H 5AFZH 1MTVA 6LPRA 3B9FH 3TNTA 3QWCH 1GMHF 1ESBA 3M7UA 4Y7AA 4FU7A 3GISB 1C2IA 2Y7XA 4INLA 4GVUA 3MOCA 1SGDE 2PKAA 3Q3KA 1XUIA 3U9AH 1ANBA 1SL3A 1XUJA 4ZKSU 1MBMA 1ZMLA 1FUJA 3LGUA 4X8VH 4Z0KA 4AFQA 3GDUA 1GWAA 1L4ZA 1GMCG 5JBBS 4XOJA 1GJDB 3PMAB 3RXFA 2R2WU 4D7FA 2BX4A 1WV7H 3BTFE 5C1UA 1C5UA 3O8DA 1LKBA 4ISLA 1BTWA 1ZZZA 1O30A 1AUJA 1YPEH 2JKHA 2R9PA 4I31A 4X1SU 4AZ2B 1Y3WA 3MNSA 1Z8RA 4JMYA 4NIVA 1MMJN 3RXVA 1ZYOA 2SGAA 4OS4A 1Q2WA 1UTQA 1KLTA 3P8FA 3OYPA 4DIIH 4ABBA 1GMCF 1DXPA 4AYVB 2ZKSA 4B2CA 2J95A 2NU4E 3MO6A 3SUEA 5SGAE 2BLWA 4CR9A 2ZU4A 1FDPA 1X7AC 2C93B 3Q77A 1UVOA 1SGFA 1D6WA 1O3NA 1G32B 3EGKH 4UE7H 1G3BA 3U98H 3ZV9A 1TOMH 2A32A 2FTMA 3RC4A 4IS5A 2FTLE 1ELGA 4OS5A 4ZXXH 4NA9H 2J34A 4ZKOU 1ELEE 3Q3XA 2CHAB 3QN7A 1YP9A 1F5KU 4CRDA 3SNAA 3SV8A 1C1MA 3QO6A 1TGTA 1DE7H 1Z8IB 3KQEA 1XM1A 2FOGA 3AASA 3BTWE 1OWHA 1RXPA 1GHYH 1LHFH 5F6MA 1N6YA 2QXIA 2BTCE 4UDWH 5T6FA 1ZJKA 1QFKH 1O2MA 1Z6JH 1C9PA 4I8HA 5EXMA 4Y6DA 3ZZDA 1GPZA 5AF9H 5DP9A 1MTUA 2ZGXH 2ZFPH 4H6TA 3AVZA 3KHVA 2FOFA 5FBIA 3MU1A 5TCAA 2BDAA 1K1PA 2J9NA 1LPGB 1ANCA 4JYTA 2KAIB 1AWFH 2BQ7B 1JOUB 2HPPH 4FUHA 3RC6A 2YOLA 3M5MA 3MU5A 3D49H 1F5RA 1YCPH 4YESB 1DDJA 1MH0A 1BTUA 3UFAA 2AIQA 3JZ2B 2FXRA 1Z1IA 1O33A 4RSPA 4K8YA 4DW2U 1G2LA 4JZIA 4TY7A 1Q3XA 4UFDH 1LVOA 2F9BH 5IDKA 2A7CA 2OXSA 2VWNA 2BD9A 3M3SA 4OS6A 1S6FA 3QLPH 2PLXA 1GBJA 1HIAA 1LPKB 5JYIA 3S9CA 1BJVA 1N8OB 4X2YA 2BDCA 5A0BA 2PUXB 1SVPA 2A4QA 2FX6A 3NCLA 3PWBA 2NU3E 9LPRA 1WTGH 1TAWA 1NPMA 4MPXA 2BD7A 1C5QA 4Y8ZA 3ZZCA 1DY8A 1GHZA 1K1IA 1E35B 1HCGA 3T62A 3TITA 4CH8B 4X8SH 2ZCHP 1ZGVA 2B9LA 2HRVA 1VR1H 1UK3A 4OGYA 1TYNA 1ZPCA 2FYQA 4KELA 1CHOG 4BAQB 5FPTA 1AU8A 5T6GA 2FS9A 1TOCB 2C8WB 3BTHE 3I77A 1P06A 3LGIA 1GG6B 4CREA 1A46H 1AZZA 1PFXC 3BTKE 4MG3A 2F91A 1MKXK 1RGQA 4I8KA 4DOQA 1UK2A 1GBIA 2FI5E 2SGEE 5F8ZA 3BTDE 4X0WU 1ACBE 1D3TB 3RMLH 2PTNA 4WMFA 4IC5A 3A8BA 1EZXC 1SQAA 3R0FA 1O2VA 1XUGA 2AMQA 1Z71A 3P8NA 1FIZA 3RM0H 3UY9A 5HM9A 2AERH 1KXDA 5A8ZA 1JRTA 1A3BH 1FMGA 4XDEA 3RMNH 3SU4A 1GBTA 2BB4A 2SGDE 3SGBE 1BMLA 4D9RA 3V12A 2OQ5A 3ATWA 4MDSA 2ZU3A 4AB8A 1A1RA 2QC2A 1TONA 1INCA 2STBE 2ZU1A 1F0TA 1QIXB 1BRCE 2C8YB 3VB5A 3HK3B 1O5BB 1GBMA 1MTNB 3PTNA 1H9LB 1E36B 1UTNA 1VITG 1GCDA 1SGTA 1NFUA 4MTBA 2PUQH 1ZMJA 4Q7XA 5EQQA 4B71A 1MKWK 5A09A 2ZCKP 5FAHA 5FPYA 4BOHA 2XBVA 1GL0E 1TPAE 1H8IH 1JWTA 1C1OA 2GDDA 1G2MA 4FUGA 1GCTB 2PKAB 3W95A 4KGAA 1P05A 2UWPA 5DO4H 1GG6C 1O3BA 5JBAS 4XSKU 1IQFA 3F68H 1ESTA 4NG9H 1GJ9B 1VITF 2J2UA 1AUTC 1J9CH 1PPGE 3VXEH 4A6LA 1W3CA 1MQ5A 1O2IA 4B76A 1DS2E 4K1SA 2C3SA 2BQ6B 4AFUA 1MCTA 4NFEA 1BIOA 2ZTXA 2OINA 3P17H 1NY22 1W11U 1RRKA 2ZDAH 4TYDA 1TNJA 3EDXB 1G3EA 2ZHWH 1P9SA 2UUFB 4U2WA 3RXQA 1P04A 3E90B 2OCVB 4AB9A 2WV4A 2GTBA 1O36A 2BQWB 2IN2A 1TE0A 2Z9JA 1THSH 2HVXA 1IAUA 1JMOH 3DUXH 4TWYA 1D3QB 2F9OA 2FWWA 2C8ZB 2R3UA 2BD8A 5CE1A 1V2TT 2GD4B 4X8UH 2IPHA 1A0JA 1TPPA 1EAUA 2W7UA 3RXDA 1GBHA 2GCHF 4XBDA 1H8DH 1B5GH 3MU8A 1YPHC 3U1JB 3UOPA 4ZAEA 1DXWA 5JDUB 2R2MB 4WVPE 2CF8H 2B5TB 3F9GA 3GCHB 3E1XB 1P57B 3U8RH 1C5TA 1DICA 3S7HB 1ZTJA 4MNVA 1TBQH 4YZUA 3TK9A 1SOZA 2CGAA 1E38B 2UUKB 2RCEA 2IJOB 1TPSA 2FMJA 1GJCB 1O34A 4U32A 2AFQB 2AGIX 4BXSA 1V2MT 2V3HH 4Y11E 1G3DA 2ZDMA 2C90B 1EUFA 4UFGH 1IQIA 5L30H 2TGTA 1TGNA 4ASHA 1C9TA 3ZZ6A 1TLDA 4ABDA 3M7TA 8GCHF 3ATMA 4Q7YA 1TRMA 4ESTE 2EA3A 1O0DH 4WH8A 1HAVA 4Q80A 1BT7A 1WQVH 4E7NA 2ZFRH 4X6MA 5DP3A 3FZDA 2JETB 1FAKH 5A2MH 4DIHH 5DP7A 1N6XA 1EJAA 1K28D 1HXEH 3F9HA 2CJIA 3KIDU 3FP8E 1K1OA 2Q6FA 2OBOA 4Y0ZE 3TPIZ 3ATLA 1HXFH 2BYAX 3ZVCA 2LPRA 4XBBA 2BXUH 2SFAA 2ZDLA 1LKAA 3GCHC 3EQ0H 5C67A 3NXPA 2H9EH 2ALVA 1QBVH 1HIAB 5FX5A 4Y8XA 2YNAA 5C1XA 3LONA 1FNIA 2DUCA 1Y5AT 1QL9A 3STJA 3SV6A 3UNQA 4PROA 1SFIA 1C5RA 3Q76A 4ZROA 1W10U 1D9IA 1V2UT 4A7IB 4BAHB 2A5KA 1SG8B 3ZZ5A 3MU0A 1BTHH 1FV9A 2P3UB 3MO3A 1SGRE 1GJBB 3PYHA 2VVVA 1HDTH 2ILNA 3PB1E 5HM2A 1C4U2 1TX6A 4YLQH 2GGVB 4ISOA 2JETC 7GCHG 1Q31A 1QGFA 4OS7A 1EKBB 3H7TA 2BOHB 1BRBE 5JB9S 6ESTA 2P3FH 4D9QA 3URCA 3ATIA 2ZHFH 1MQ6A 2ZC9H 3OU0A 1O3LA 1W13U 1GBLA 2ZPQA 3E16B 1EXFA 4Y10E 2QGRA 1CT2E 1NRSH 1V2KT 2WINI 1DT2A 5EODA 1TGSZ 2ODQA 2SNVA 3CS7A 3K6YA 1E34B 3GYMA 1KXFA 1C1NA 3UUZA 2THFB 2AEIH 4X8TH 4J1YA 2Z9LA 3GY4A 3LOXA 1CU1A 2OC0A 1J16A 1SFQB 1DITH 3UWIA 3BTTE 3ZYDA 4KTUA 2OTVA 5E2OA 2VH0A 1UO6A 2P16A 1SGNE 5LH8A 3A8CA 1CA0B 1BTXA 1S84A 1CVWH 1MZDA 1GDNA 1FY4A 1LO6A 4HZHA 1S85A 5K0HA 1B0FA 3HKIB 3IITA 1TX8A 4AGJA 1XXFA 1VJ9U 2FESH 3PV4A 2NWNA 2WPMS 3GDSA 2FS8A 4NGAH 1V2JT 2CXVA 4B74A 3URDA 2BDIA 1JIMA 2UWOA 1W7XH 2ANYA 1RFNA 2QXHA 1NTPA 1IHSH 1QA0A 3SO3A 4ZHLU 1TB6H 2EC9H 2G4TA 4ZH8A 1AZ8A 3GCTG 1YPKH 1PPFE 4NIWA 4UONA 1P8VC 4DVAU 2TGDA 3E91A 2EI6A 1SGYE 1BHXF 3GY6A 2Y5GA 1P11E 1AE8H 2H9TH 2LNCA 3M61U 1AVXA 5DG6A 4BANB 1P02A 1QJ6B 3QUMP 5IYTA 3M5LA 3P70B 3SU0A 2TGAA 3VPKA 1AB9B 1DFPA 5EXNA 2ZO3H 5GCHG 3VB7A 4JK6A 2P94A 1LHDH 2HNTF 2ZA5A 3TJNA 5FCKA 1GMHG 3BV9B 1OWJA 3SNEA 2AMDA 1EQ9A 1OPHB 5E0JA 1MKXH 1OYTH 5GPIB 1O3OA 3VEQB 3GCOA 4ZKRU 4ABFA 2GX4A 1ZHRA 1EPTA 3U8OH 4FUFA 3LT3A 5TJXA 1O5DH 3HK6B 2VIWA 4ISNA 3EAJA 1BMNH 1JIRA 3QTVH 1OYQA 3T29A 3H5CB 1F0SA 3ITIA 3A86A 5GCHF 4X1RU 1O3FA 1WU1A 1BB0B 5EQRA 1OP2A 4B2AA 1ZOMA 5AVDA 2B8OH 5C5NA 3T27A 2VGCB 5LPFA 1ETRH 4Z6AH 4X2WA 3FFGA 3RXMA 3RXTA 1IQNA 2NU0E 1F0UA 2NU1E 3A84A 1CT4E 2ZFTA 1W7GH 3A82A 2BLVA 3BTME 4AG1A 1K1NA 1P2IA 1O3GA 1Y3XA 5HXFA 1GI1A 3P8OA 1ID5H 1HJ9A 1MKWH 4F4OC 4HFPB 2PSYA 3G01A 1HAVB 1QBNA 2FM2A 3LGWA 2A2XH 2VNTA 4X2XA 4LK4A 3CS0A 2SGPE 2XWBI 1V2OT 1MUEB 2XC0A 2OC1A 2D1JA 1YF4A 2ZNKH 2GKVE 3EBNA 4DY7B 4GUXA 3MYWA 1TA2A 1T8MA 2Z6BD 4JK5A 4CHAB 2FDAA 5FXLA 4YLUA 2Z3EA 2PW8H 1CO7E 2FOAA 2Y7ZA 4I8LA 1TALA 4AN7A 2H5DA 3M3TA 2RA0A 1C5VA 2OBQA 2BXTH 1GVZA 2J38A 1YLCA 3A7VA 5L2YH 1HAGE 3V13A 4WXVA 1LHEH 3A8DA 4NWKA 1V2ST 2Y80A 2P59A 1PJPA 2QCYA 2ZIQH 3SHCH 1HAYB 2VIQA 3SZNA 2HNTE 3PMBB 4CBOA 3S9BA 1ZJDA 1AO5A 1GJ4H 1O2WA 1L0ZA 5A0AE 3OTJE 4BAKB 4E06H 1C2DA 3PLBA 4JYVH 1TRNA 4A92A 4BNRA 4FUIA 1SOTA 1EOJA 2R0KA 1EAXA 1AQ7A 3UREA 1S6HA 3ZZBA 1O2KA 2WYJA 5AHGH 2PGBB 3A85A 1GHVH 5C3NA 1UTKA 3UR6A 1P2QA 3BIUH 1YGCH 2BY6X 3RP2A 4I33A 2ZDVH 1VJAU 2OD3B 2VVUA 1Z1JA 4FUDA 1A0HB 1EJMA 1GMDF 1GI7B 2PWXA 1HJAB 4ZXYH 5C1YA 4DURA 3LJJA 1ABJH 1E0FD 3NWUA 1PPEE 3SUGA 3MNCA 3V3MA 2TBSA 2O9QA 1C1RA 1XUHA 3MWIU 3N7OA 1FY3A 1S5SA 3RXUA 2DE8A 2GDEH 2HLCA 3LU9B 4JZFH 1D3DB 2UWLA 2ZHQH 2XRCA 2VVCA 2XXLA 2SGQE 5T6DA 1HPGA 2Z9IA 3ATKA 3RXKA 1DLEA 1EP6A 6GCHF 1O2GH 4HGCA 3A7ZA 2FI4E 3IWMA 1HAXB 1TNKA 2CHAC 3GY8A 2QIQA 3PWCA 1DANH 4NSVA 4FVBA 3DFJA 3K2UA 3W94A 3RXPA 2GP9B 1SMFE 1L4DA 2PR3A 4MPUA 1O3CA 3GDVA 1HAIH 4MPVA 5E2PA 2QXJA 4AGKA 4NZLA 4AFZA 4MVNA 1QCPA 2G8TA 3RU4D 1C5ZB 2Y6TA 3SQEE 1GHWH 2BVRH 2NU2E 1K1JA 1W2KH 2HWLB 3RLWH 1KDQB 1FY8E 4B2BA 1DLKB 2A2QH 1NFYA 2BDBA 4ABIA 1O5GH 1P09A 3MH7A 1A2CH 3BF6H 1K1MA 2SNWA 1HB0B 1EZQA 3FVFB 2TPIZ 1GBFA 3ELAH 1LDTT 4YM9A 3Q3YA 2QN5T 3RXOA 2Y5FA 4INHA 5CHAB 1KXEA 2BZ6H 4IBLH 2G00A 3SORA 1BRUP 3SU1A 1Y3VA 2M5TA 3RXLA 1NFXA 2AH4X 1EZSC 1QY6A 3RXCA 1S82A 4ZUHA 1TWXB 4KTSA 3RC5A 4M7GA 3FANA 2ZP0H 3ZZ9A 4BAMB 2ZU5A 2CN0H 1QRWA 4I7YH 2R0LA 1GHXH 4FU8A 2D8WA 3TH4H 3LH1A 5GIBA 2EEKA 1NRRH 1AWHB 4DCDA 1KY9A 1EPTB 4MLFB 1C1UH 5JB8S 1FZZA 3K9XB 4IW4E 1GI9B 3MU4A 1S0QA 2ANWA 1N8OC 3S7KB 1MBQA 2AYWA 2FLRH 3BN9A 1WOFA 2SGFE 3KQDA 3E3TA 4VGCB 1C2JA 1O3IA 1BRAA 2C8XB 1FPHH 4UEHH 2WPLS 5L2ZH 1T8OA 1QQ4A 2FOHA 2Z7FE 2G81E 4NIXA 2UUYA 4OGXA 1OSSA 1OX1A 3QGNB 3MHWU 4K1EA 1YPGH 3SNBA 3T2NA 2VH6A 1BQYA 1KYNA 5E8EH 3RXHA 3KF2A 4CRAA 1PPHE 1V2LT 1SGCA 4JCNA 3O8BA 3MFJA 4A1TA 3TH3H 1UCYK 2XC5A 4A5TS 1WUNH 3RXJA 1LQEA 1FY5A 2QA9E 4AX9H 2R3YA 5GWZA 1NRQH 2ZZUH 1CA8B 1T32A 2W3IA 1FAXA 3EA7A 2Z9KA 1MU6B 2EI7A 1CBWB 4GHTA 1GJ6A 1V2WT 2CV3A 2FX4A 2GCHG 1AY6H 1HGTH 3UOUA 1EPTC 1FN8A 2WPIS 5F8XA 3EYDA 1K1LA 9ESTA 5G4BA 1MTNC 3SOSA 2TRMA 4O97A 1GJAB 1B7XB 4MQAA 3PMJA 2VB0A 1O2UA 3CP7A 4VGCC 1BMAA 2HGTH 2H6MA 1UTMA 1ZTLA 3RXRA 1CSOE 1JXPA 4NIYA 1RJXB 3SV7A 1BZXE 1P2KA 1OP0A 4YO9A 2HPQH 5JPMH 2GT7A 4TPYA 4BAOB 1ZTKA 1GCTC 4ABGA 2G5VA 1P2JA 3A8AA 1MD8A 1NRPH 1P3CA 2Z9GA 2VU8E 8GCHG 4ZHAA 3SU3A 5C20A 4JYUH 4Q7ZA 1CE5A 1TBRH 1UHBB 5LPEA 1O3AA 1SSXA 1UVUH 1OP8A 1T31A 3E8LA 4CRGA 2XTTB 1AMHA 3VGCB 2I6QA 3VB3A 2H5CA 1TFXA 3M36A 1SLUB 3OY5U 1UVPA 1ZR0A 3A7YA 3BIVH 1BUIA 1HAHH 1O3JA 1C4V2 4ZKNU 1EAIA 1S0RA 4FXGH 2O8TA 4NA8A 3OSYA 3ZVGA 2GZ8A 3LKWA 4YT7H 1RS0A 3GCNA 1V2VT 1ESAA 2F9VA 3GICB 1O2ZA 2Z94A 3TLOA 3UPEA 3UQVA 1YPLH 2F9NA 1ETSH 1AIXH 1KXCA 5LPRA 3QDZB 8KME2 4A1XA 3GY5A 1THRH 1NM6A 3AW1A 5EPNA 1NO9H 2F9UA 2A31A 1T4UH 4X1QU 3M7QA 1ZSLA 2H2ZA 3VXFH 1C1PA 4WMEA 1DY9A 2ZDKA 2ZPRA 3UTUH 3L6PA 3TU7H 4GCHF 2GVFA 4K8BA 3UR9A 1HFDA 1F2SE 1UTLM 1L1GA 1G3CA 2FZZA 2WUBA 2XC4A 1G36A 1HNEE 2XWAA 4D8NA 2G51A 1HAZB 3UWJH 2ZI2H 4YT6H 3VGCC 5A8XA 1O3DA 2EI8A 3QZRA 2GV6A 1LMWB 3CENA 1TNIA 4NWLA 3HPTB 2FOCA 4GAWA 3U8TH 1P2MA 5C5OA 2W7SA 3M37A 1AGJA 1OWDA 3OX7U 2ESTE 3I29A 2BLQA 2FIRH 2P3TB 3ZVAA 3GOVB 3D65E 3TGIE 5DKMA 4K3JA 1TNHA 3A87A 3GY2A 1GBBA 2C4FH 1IQJA 3SGQE 3EA8A 3C1KA 4THNH 2V6NA 4ABAA 1LHGH 3LIWA 1UTJA 1YCPM 1TNLA 2GT8A 3Q00A 2V0BA 4HI3A 3BG8A 1HYLA 1Y59T 1SLWB 1Y5BT 4H6SB 2QF0A 1MAYA 1KXAA 3HATH 3M5NA 2Q1JA 3MTYA 3U1IB 1O38A 2A4OA 2ZGHA 3A83A 3SV9A 2WYGA 1GI4A 2WV5A 3AAVA 1UTPA 3SNDA 2A4GA 3O8RA 1UVTH 1O2QA 1XUKA 3ZVDA 5L6NH 1AKSA 3RXAA 1MTWA 1WBGB 2HNTC 1M9UA 3S9AA 1GVLA 1SQOA 2ZTZA 5CMXH 4K1TA 1ELFA 3FZZA 3EE0B 1PQAA 4J2YB 5B6OA 3TIUA 2A5IA 1L2EA 4YOJA 1DM4B 2J94A 1UVSH 4FU9A 2Q6DA 1YM0A 3PROA 3RM2H 5DP6A 3NPSA 3RXEA 1YYY1 3HKJB 1K9OE 4XFQA 1FIWA 3TJOA 4Q2KA 1ZRBA 1EAWA 4CRFA 3B23B 1EATA 3P92A 1GI5A 1JBUH 3MH5A 3SBKA 4I32A 1GHBF 1C5LH 2CF9H 2PGQB 3UNRA 1DSTA 5EXLA 4CBNA 4OS1A 2HOBA 3K65B 1WYKA 1LVYA 1C2MA 2QYIA 1G30B 1KDQA 1DSUA 1TQ0B 2TIOA 1C5XB 4GLYA 2OLGA 4INKA 2RG3A 3KNXA 4H42U 3F9FA 2Z3DA 1YKTA 5FBEA 1SBWA 2ZQ2A 3QZQA 3OY6U 4FUJA 2GZ7A 1O2XA 2BD2A 4Y76A 1AVWA 3PLPA 1C1QA 2G52A 3RDZA 2ZFQH 1D4PB 3IG6B 3TJUA 1YPHE 4UFEH 4RKJB 2ZFSA 3JZ1B 2VIPA 4FVDA 1A4WH 1CGIE 1F0RA 5PTPA 1KTSB 3RXSA 1O3HA 1NU9A 4BTIB 2D26C 4UFFH 1IQKA 8ESTE 3A81A 5J4SA 2BY7X 3KN2A 1CA0C 2TGPZ 2CMYA 2B7DH 5T3HA 1JRSA 1GI0A 1IQEA 3BTQE 2AIPA 5EW2H 2VINA 3KQBA 1LVBA 4NSYA 5EQSA 1FXYA 2ZCLP 1J15A 1Z8JB 4UD9H 3SI3H 1AFQB 5GXPA 1OKXA 1VCPA 1RIWB 2Y82A 4CH2B 2A7JA 1AI8H 1YPJH 3U69H 3LDXH 3VB6A 1QBOA 2F3CE 3V0XA 2ODYB 3SU2A 1QRXA 1A5IA 3MMGA 5EU8A 1TX7A 1AFEH 1O5EH 2V35A 3RMOH 5EG4A 2BHGA 2BDHA 2AGGX 1C5NH 3M35A 1GJ8B 1DUAA 2FOEA 1H9IE 1KSNA 5DP4A 4K60A 2Y81A 2V3OH 1SGIB 2W3KA 2GMTB 4IN2A 4U30A 4WH6A 4AOQA 1TMBH 1AB9C 1C2EA 1C5PA 1EASA 1WAYB 3MNXA 2XCNA 4D7GA 5E0GA 3SJ9A 5A0CA 3S0NA 3ZV8A 5GDSH 1GBEA 2ALPA 1OOKB 4WXIA 3TGKE 1ZPZA 4LOYH 3GYLB 3KQCA 3ZZAA 1GBDA 5ESBA 3A80A 1ANEA 1ANDA 2FOMB 1FN6A 4H4FA 1E37B 1ZLRA 3DHKH 4XBCA 1J14A 1PYTD 1UCYH 5FX6A 1O5FH 1J17T 3HGNA 2FPZA 3TGJE 3SUDA 2ZQ1A 2ZF0H 1IQLA 1AFQC 4KTCA 1EB2A 1IQMA 1SHHB 3F6UH 1BA8B 1HAOH 4R0IA 1KTTB 1RIWC 1C1TA 2P95A 2QV1A 3M3VA 2BM2A 1W8BH 3QTOH 2Z3CA 1EZUC 3MH6A 2VGCC 1C1VH 3KCGH 4K2YA 1CGJE 1GMDG 4O3TA 1TNGA 4AG2A 1MD7A 1V2PT 2B0FA 1ELVA 1O32A 2XBYA 1KIGH 4Y8YA 3ZZ7A 1O3MA 2FO9A 1NFWA 1W0YH 3LH3A 3T26A 8LPRA 3BG4B 1P2OA 1UHBA 1BTPA 1NZQH 1D6RA 3ZVFA 2XCFA 1EP5A 2GMTC 3DFLA 1O3EA 2P8OB 5F8TA 3V7TA 3LGYA 2AS9A 1B0EA 1LVMA 3F9EA 1DWDH 1ARBA 6GCHG 1MCVA 2ZGBH 1BTZA 7KMEH 1ETTH 3SW2B 1AN1E 1PPBH 4DT7B 1RTKA 4ZHMU 2PKSB 1V6DA 4CHAC 3RXIA 4O9VA 4NA7A 1DUEA 4GSOA 3SI4H 2VIVA 1A61H 1SPJA 2DE9A 4O03A 1CT0E 1C5YB 5H4IB 3SU6A 1QTFA 1SGQE 3E0NB 1W0ZU 1AKSB 1GI3A 4Y71A 2BD4A 3ESTA 1K22H 1PQ8A 1ABIH 1L1NA 2F9PA 2I6SA 4IMZA 4DJZB 3SGAE 3MI4A 2ZG0H 2J92A 1DOJA 1A7SA 1BOQA 1C5WB 2G5NA 1P01A 1XXDA 1O2RA 3T28A 3WY8A 2BD3A 4CRBA 1TBZH 2AGEX 3ZYEA 1HBTH 1Z8GA 4LZ4B 1GI2A 2FP7B 1GDUA 1TMUH 3RMMH 1XVOA 3T25A 4AFSA 4TWWA 4HTCH 3ENSB 3C27B 1L1JA 3BG4C 1O2JA 1C2FA 3FP6E 1XUFA 2XW9A 2P8OC 3ZZ4A 2WPHS 1RD3B 3KGPA 5EGMA 3R3GB 1UTOA 3BTGE 4X2VA 3NUMA 4R8TB 1PYTC 4K5ZA 1OS8A 2VWOA 1BBRK 1P12E 3TH2H 2BZAA 4DGJA 1P0SH 3D23A 2ULLA 1HJAC 2PKSC 2H1UA 3LC3A 4ISIH 1C5SA 2FI3E 1T7CA 3RLYH 1TABE 2O8UA 1IOEA 1VCQA 2BLOA 4ABHA 2OC7A 1MZAA 4WMDA 1QB6A 1C2LA 2BDGA 3E6PH 1O3KA 2VWMA 2QY0B 2BY8X 3ZVBA 1ELAA 1FONA 1O5CB 5LGOA 1SGPE 3O8CA 5ETXA 1HRTH 2LIZA 2BY5X 1ZHMA 3SU5A 3F1SB 4NCYA 3MNBA 1XMNB 5EOKA 1RTLA 3A89A 5K7RA 1PPCE 1QHRB 2BDYA 3LGVA 3SJKA 4B73A 1Z6EA 1N1LA 2ODPA 2VIOA 3A88A 1LPZB 1IQGA 3AAUA 4MNWA 2FODA 5AFYH 2VJ1A 1V3XA 1C4Y2 1F7ZA 3P6ZB 4WWYA 1QURH 1SC8U 2AMPA 1CHOF 1W12U 1OWIA 1AVGH 1QJ7B 3LJOA 4SGAE 1GDQA 3RXGA 1AHTH 1FY1A 4X6NA 1NT1A 2O8MA 1VGCB 1QRZA 3PLKA 3ZZ3A 2ASUB 1U6QA 4LZ1H 1GBCA 5J4QA 1C1WH 3QX5H 2Y5HA 1CGHA 5CHAC 3DT0H 1SLXB 1T8LA 1HV7A 1DWCH 1G37A 4FUEA 2J4IA 3L3TA 1P03A 1O2TA 2O8WA 2A5AA 1KXBA 4A1VA 1C5OH 2OP9A 1YLDA 3ODDA 3GY3A 4IGDA 1XVMA 3E0PB 1ELDE 4Y0YE 2FYRA 7LPRA 2JH5D 4OS2A 1BJUA 2WPJS 2IOTA 1O2NA 3RU4T 3ZZ8A 2JH6D 4B1TA 1BTYA 3PTBA 5BRRE 5GJ4B 3HGPA 3FP7E 5EPYA 2GZ9A 2ZTYA 4O3UA 1DWBH 3KL6A 1W14U 1AD8H 3T5FH 5DK1A 4B75A 5I46H 2JH0D 5JBCS 3TK6A 1XX9A 4X6PA 1O5AB 1VGCC 3I78A 5A8YA 4Y7BA 1A3EH 2QAAA 1GBKA 1O35A 1NS3A 4YTAA 3SJIA 1ZHPA 3A7XA 3ZVEA 1GVKB 1YBWA 2PHBA 1CHGA 1H1BA 4FUCA 1NROH 2A4RA 3RUOA 4JZDH 5FPSA 4I8GA 3SJ8A 1V2NT 1PQ7A 3A7TA 2K7XA 1ORFA 3TK5A 1C2KA 1H4WA 1BCUH 4RN6A 3LGTA 4Y79A 1UMAH 2W26A 1LQDB 1NN6A 2A45B 1Y8TA 1ELBA 2UUJB 3P95A 3AW0A 1CBWC 4KKDA 1IHTH 1ZMNA 1DWEH 1HAPH 5ABWA 1OWEA 1Y5UT 2QXGA 4SGBE 1PQ5A 5BPEA 4JZEH 4GCHG 3NK8A 1CQQA 4CRCA 1C2GA 3LPRA 2ZFFH 3SN8A 2K1QA 2ZPSA 1WQSA 3TNSA 2ZGCA 1YCPK 3TVJB 2GCTB 3UIRA 2ZGJA 5HYOA 3UNSA 1O3PB 2XBXA 1TRYA 1C2HA 1EJNA 3H7OA 1TPOA 2ZECA 5I25A 3MH4A 2FLBH 4ISHH 3SQHE 1V2RT 4E05H 1BDAA 4WF8A 4ABEA 4RKOB 3QK1A 1UJ1A 1EB1H 1BHXB 3PO1B 2ZHDA 1KLIH 4X6OA 1ELTA 3PM3A 2BY9X 4NFFA 1SGEE 2OC8A 1ZSJA 1O2LA 1SR5C 1DX5M 1MTSA 4NZQA 4IMQA 1D3PB 1A5GH 4ABJA 1NESE 1FQ3A 1P3EA 5C2ZA 4YOGA 4CR5A 2ZU2A 1GI6A 3DD2H 5HGGA 2WPKS 2A0QB 3P8GA 1J8AA 1LCYA 1QB9A 1XKAC 2STAE 3GY7A 6CHAB 2PV9B 1YPMH 1HLTH 1T8NA 1F92A 2FEQH 2OUAA 4MPWA 1NU7B 3VFEA 1EX3A 1GGDB 2A7HA 2PTCE 1SQTA 1T4VH 1QL8A 2G55A 3ODFA 1A0LA 1HJ8A 2VIDA 3LC5A 1K2I1 5DPAA 5ESTE 1S81A 1G9IE 1OWKA 1BMMH 1SGFG 3FAOA 2ZDNA 1P9UA 1DPOA 1ARCA 4LXBH 1FI8A 2GCTC 3BSQA 1GJ5H 1FPCH 2ANKH 2F83A 2BVSH 2P93A 4ZMAH 1MU8B 1V2QT 3SJOA 1IQHA 3PO1C 1BBRE 1SHYA 1RTFB 4DG4A 1FJSA 2PSXA 3TJVA 1HUTH 5HMAA 3STIA 1GHBG 1GHAG 1QB1A 2PFEA 1F5LA 1BITA 3KEEA 3QGJA 3A7WA 3BEFB 1YC0A 2XBWA 1MAXA 4F49A 1O2YA 1VITH 3NZIA 3UQOA 3BTEE 1O2PA 1QR3E 5E0HA 1XKBC 1Y3UA 3M5OA 2VWLA 6CHAC 2YNBA 1THPB 4BXWA 2XYAA 2A1DB 3B8JA 2KAIA 4WJG2 1K21H 1KLJH 1TA6A 2ZWLH 4TY6A 4D76A 3RU4E 4MNXA 1GGDC 3PMHB 7GCHF 2HALA 1ZGIA 1GHAF 1P10A 2OQUA
chains in the Genus database with same CATH superfamily
1H9HE 1PPZA 3L33A 7ESTE 5JBTA 4XRNA 4JZ1A 5TCCA 2JIZD 1GL1A 4U01A 1QQUA 1C5MD 4QT8C 1Z7KA 4P00A 2BX3A 1NC6A 1QNJA 1P2NA 3S69A 2G4UA 4BTUB 4X1PU 4ACAA 4GHQA 1GI8B 4GPGA 3EA9A 3BEIB 4TT3D 2WUCA 1O2HA 1WCZA 1S83A 2H9HA 2RDLA 3DA9B 2CK3D 4OM9A 1ELCA 1VCWA 5FCRA 1TGBA 2KX4A 2KCOA 3SV2H 2ZHEH 1BBRH 5CHBA 5DP8A 4AYYB 1A5HA 1ZPBA 1UCYE 3VB4A 5DP5A 2BOKA 4K69A 4E7RG 3K6ZA 1WSSH 1SB1H 1SI5H 4MNYA 1LTOA 2BVXH 1QA7A 1TIOA 1QL7A 4FUBA 2RA3A 2FOBA 4IN1A 2EQNA 3D62A 1KMHB 4B6FA 4I8JA 1GBAA 1TQ7B 1NRNH 1Y3YA 1FLEE 1O39A 1O2SA 1UK4A 1SLVB 1O37A 1LHCH 1QJ1B 4TPIZ 4XE4A 5DGJA 2XNIA 3SUFA 2O8LA 3SHAH 5HIYA 2D2DA 1ZRKA 5F03A 1DVAH 2BMGB 3GCTF 5C0TA 2ANMH 5FHTA 4ACBA 3NKKA 1O2OA 1GJ7B 2Q6GA 1WTHD 1EOLA 3MO9A 1OXGA 3BEUA 4X1NU 4AORA 5DJ7A 1TMTH 4YOIA 4KP0A 2QF3A 2GV7A 2ZEBA 2W5EA 2BD5A 4BTTB 1AE5A 3SNCA 3RXBA 1C1SA 1O31A 4WY3A 4IC6A 1ZSKA 1VZQH 1TGCA 5EW1H 5AFZH 1MTVA 5C17A 6LPRA 3B9FH 3TNTA 3QWCH 1GMHF 1ESBA 3M7UA 4Y7AA 4FU7A 3GISB 1C2IA 2Y7XA 4INLA 4GVUA 3MOCA 1SGDE 2PKAA 3Q3KA 1XUIA 3U9AH 1ANBA 1SL3A 1XUJA 4ZKSU 1MBMA 1ZMLA 1FUJA 3LGUA 4X8VH 4Z0KA 4AFQA 3GDUA 1GWAA 1L4ZA 1GMCG 5JBBS 4XOJA 1GJDB 3PMAB 3RXFA 2R2WU 4D7FA 2BX4A 1WV7H 3BTFE 5C1UA 1C5UA 3O8DA 1LKBA 4ISLA 1BTWA 1ZZZA 1O30A 1AUJA 1YPEH 2JKHA 2R9PA 4I31A 4X1SU 4AZ2B 1Y3WA 3MNSA 1Z8RA 2JJ2D 4JMYA 4NIVA 3SYJA 3FKSD 1MMJN 3RXVA 1ZYOA 2SGAA 4OS4A 1Q2WA 1UTQA 1KLTA 3PRDA 3P8FA 3OYPA 4DIIH 4ABBA 1GMCF 5T1VA 1DXPA 4AYVB 2ZKSA 4B2CA 2J95A 2NU4E 3MO6A 3SUEA 5SGAE 2BLWA 4CR9A 2ZU4A 1FDPA 2F4LA 1X7AC 2C93B 3Q77A 1UVOA 1SGFA 1D6WA 1O3NA 1G32B 3EGKH 3OTPA 1G3BA 4UE7H 3U98H 3ZV9A 1W0KD 1TOMH 2A32A 2FTMA 3RC4A 4IS5A 2FTLE 1ELGA 4OS5A 4ZXXH 4NA9H 2J34A 4ZKOU 1ELEE 5DN6D 3Q3XA 2CHAB 3QN7A 1YP9A 1F5KU 4CRDA 3SNAA 5F53A 3SV8A 1NBME 1C1MA 3QO6A 1TGTA 1DE7H 1Z8IB 3KQEA 1XM1A 2FOGA 3AASA 3BTWE 1OWHA 1RXPA 1GHYH 1LHFH 5F6MA 1N6YA 2QXIA 2BTCE 4UDWH 5T6FA 1ZJKA 1QFKH 1O2MA 1Z6JH 3F2FA 1C9PA 4I8HA 2KCYA 5EXMA 4Y6DA 3ZZDA 1GPZA 5AF9H 5DP9A 1MTUA 2ZGXH 2ZFPH 4H6TA 3AVZA 3KHVA 2FOFA 5FBIA 3MU1A 5TCAA 2BDAA 1K1PA 2J9NA 1LPGB 1ANCA 4JYTA 2KAIB 1AWFH 2BQ7B 1JOUB 2HPPH 4FUHA 3RC6A 2YOLA 3M5MA 3MU5A 3D49H 1F5RA 1YCPH 4ZCNA 4YESB 1DDJA 1MH0A 1BTUA 3UFAA 2AIQA 3JZ2B 2FXRA 1Z1IA 1O33A 4RSPA 4K8YA 4DW2U 1G2LA 4JZIA 4TY7A 1Q3XA 4UFDH 1LVOA 2F9BH 5IDKA 2A7CA 2OXSA 2VWNA 2BD9A 3M3SA 4OS6A 1S6FA 3QLPH 2PLXA 1GBJA 1HIAA 1LPKB 5JYIA 3S9CA 1BJVA 1N8OB 4X2YA 2BDCA 5A0BA 2PUXB 1SVPA 2A4QA 2FX6A 3NCLA 3PWBA 2NU3E 9LPRA 1WTGH 1TAWA 1NPMA 4MPXA 2BD7A 3OEED 1C5QA 4Y8ZA 3ZZCA 1DY8A 1GHZA 1K1IA 1E35B 1HCGA 3T62A 3TITA 4CH8B 4X8SH 2ZCHP 1ZGVA 2B9LA 2HRVA 2J97A 1VR1H 1UK3A 4OGYA 1TYNA 1ZPCA 2FYQA 2W6JD 1CHOG 4KELA 4BAQB 5FPTA 1AU8A 5T6GA 2FS9A 1TOCB 2C8WB 3BTHE 3I77A 1P06A 3LGIA 1GG6B 4CREA 1A46H 1AZZA 1PFXC 3BTKE 4MG3A 2F91A 1MKXK 1RGQA 3GS9A 4I8KA 4DOQA 1UK2A 1GBIA 2FI5E 2SGEE 5F8ZA 3BTDE 4X0WU 1ACBE 1D3TB 3RMLH 2PTNA 4WMFA 4IC5A 3A8BA 1EZXC 1SQAA 3R0FA 1O2VA 1XUGA 2AMQA 1Z71A 3P8NA 1FIZA 3RM0H 2WV9A 3UY9A 5HM9A 2AERH 1KXDA 5A8ZA 1JRTA 1A3BH 1FMGA 4XDEA 3RMNH 3SU4A 1GBTA 2BB4A 2SGDE 3SGBE 1BMLA 4D9RA 3V12A 2OQ5A 3ATWA 4MDSA 2ZU3A 4AB8A 1A1RA 2QC2A 1TONA 1INCA 2STBE 2ZU1A 1F0TA 1QIXB 1BRCE 2C8YB 3VB5A 3HK3B 1O5BB 1GBMA 1MTNB 3PTNA 1H9LB 1E36B 1UTNA 1VITG 2RDEA 3AK5A 1GCDA 4F48B 1SGTA 1NFUA 1SQRA 4MTBA 2PUQH 1ZMJA 4Q7XA 5EQQA 4B71A 1MKWK 5A09A 2ZCKP 5FAHA 5FPYA 4BOHA 2XBVA 1GL0E 1TPAE 1H8IH 1JWTA 1C1OA 2GDDA 1G2MA 4FUGA 1GCTB 2PKAB 3W95A 4KGAA 1P05A 2UWPA 1QZ8A 5DO4H 1GG6C 1O3BA 5JBAS 4XSKU 1IQFA 3F68H 1ESTA 4NG9H 1GJ9B 1VITF 2J2UA 1AUTC 1J9CH 1PPGE 3VXEH 4A6LA 1W3CA 1MQ5A 1O2IA 4B76A 1DS2E 2M2AA 4K1SA 2C3SA 2BQ6B 4AFUA 1MCTA 4NFEA 1BIOA 2ZTXA 5C94A 2OINA 3P17H 1NY22 1W11U 1RRKA 2ZDAH 4TYDA 1TNJA 3EDXB 1G3EA 2ZHWH 1P9SA 2UUFB 5KEDA 4U2WA 3RXQA 1P04A 3E90B 2OCVB 4AB9A 2WV4A 2GTBA 1O36A 2BQWB 2IN2A 1TE0A 2Z9JA 1THSH 2HVXA 1K0HA 1IAUA 1JMOH 3DUXH 4TWYA 1D3QB 2F9OA 2FWWA 2C8ZB 2R3UA 2BD8A 5CE1A 1V2TT 2GD4B 2J98A 2IPHA 4X8UH 1A0JA 1TPPA 1EAUA 2W7UA 3RXDA 1GBHA 2GCHF 4XBDA 1H8DH 1B5GH 3MU8A 1YPHC 3U1JB 3UOPA 4ZAEA 1DXWA 5JDUB 2R2MB 4WVPE 2CF8H 2B5TB 3F9GA 3GCHB 3E1XB 1P57B 3U8RH 1C5TA 1DICA 3S7HB 1ZTJA 4MNVA 1TBQH 4YZUA 3TK9A 1SOZA 2CGAA 1E38B 2UUKB 2RCEA 2IJOB 1TPSA 2FMJA 1GJCB 1O34A 4U32A 2AFQB 2AGIX 4BXSA 1V2MT 2V3HH 4Y11E 1G3DA 2ZDMA 2C90B 1EUFA 4UFGH 1IQIA 5L30H 2TGTA 1TGNA 4ASHA 1C9TA 3ZZ6A 1TLDA 4ABDA 3M7TA 8GCHF 3ATMA 4Q7YA 1TRMA 4ESTE 2EA3A 1O0DH 4WH8A 1SKYE 1HAVA 4Q80A 1BT7A 1WQVH 4E7NA 2ZFRH 4X6MA 5DP3A 3FZDA 2JETB 1FAKH 2QF5A 5A2MH 4DIHH 5DP7A 1N6XA 1EJAA 1K28D 1HXEH 3F9HA 2CJIA 3KIDU 3FP8E 1K1OA 2Q6FA 2OBOA 4Y0ZE 3TPIZ 3ATLA 1HXFH 2BYAX 3ZVCA 2LPRA 3FOAA 4XBBA 2BXUH 2SFAA 2ZDLA 1LKAA 3GCHC 3EQ0H 5C67A 3NXPA 4I86A 2H9EH 2ALVA 1QBVH 1HIAB 5FX5A 3N7EA 4Y8XA 2YNAA 5C1XA 3LONA 1FNIA 2DUCA 1Y5AT 1QL9A 3STJA 3SV6A 3UNQA 4PROA 1SFIA 1C5RA 3Q76A 4ZROA 5IK2D 1W10U 1D9IA 1V2UT 4A7IB 4BAHB 2A5KA 1SG8B 3KYGA 3ZZ5A 3MU0A 1BTHH 1FV9A 2P3UB 5EJZA 3MO3A 1SGRE 1GJBB 3PYHA 2VVVA 1HDTH 2ILNA 3PB1E 5HM2A 1C4U2 1TX6A 4YLQH 2GGVB 3H09A 1YY3A 2HVYB 4ISOA 2JETC 7GCHG 1Q31A 1QGFA 4OS7A 1EKBB 3H7TA 4RI0A 2BOHB 1BRBE 5HIZA 5EIYA 6ESTA 2P3FH 5JB9S 4D9QA 3URCA 3ATIA 2ZHFH 1MQ6A 2ZC9H 3OU0A 1O3LA 1W13U 1GBLA 2ZPQA 3E16B 1EXFA 4Y10E 4FETA 2KCAA 1CT2E 2QGRA 1NRSH 4RT0A 1V2KT 2WINI 1DT2A 5EODA 1TGSZ 2ODQA 2SNVA 3CS7A 4DT4A 3K6YA 1E34B 3GYMA 1KXFA 1C1NA 3UUZA 2THFB 2AEIH 4X8TH 4J1YA 2Z9LA 3GY4A 3LOXA 1CU1A 2OC0A 1J16A 1SFQB 1DITH 3UWIA 3BTTE 3ZYDA 4KTUA 2OTVA 5E2OA 2VH0A 1UO6A 2P16A 1S6LA 1SGNE 5LH8A 3A8CA 1CA0B 1BTXA 1S84A 1CVWH 1MZDA 1GDNA 2AHME 1FY4A 1LO6A 4HZHA 1S85A 4HG6A 5K0HA 1B0FA 3HKIB 3IITA 1TX8A 4AGJA 1XXFA 1VJ9U 2FESH 3PV4A 2NWNA 2WPMS 3GDSA 3F2HA 2FS8A 4NGAH 1V2JT 2CXVA 4B74A 3URDA 2BDIA 1JIMA 2UWOA 1W7XH 2ANYA 1RFNA 2QXHA 1NTPA 1IHSH 1QA0A 3SO3A 4ZHLU 1TB6H 2EC9H 2G4TA 4ZH8A 1AZ8A 3GCTG 1YPKH 1PPFE 4NIWA 4UONA 1P8VC 4DVAU 2TGDA 3E91A 2EI6A 1SGYE 1BHXF 3GY6A 2Y5GA 1P11E 1AE8H 2H9TH 2LNCA 3M61U 1AVXA 5DG6A 4BANB 1P02A 1QJ6B 3QUMP 5IYTA 3M5LA 3P70B 3SU0A 3EE7A 2LELA 2TGAA 3VPKA 1AB9B 1DFPA 5EXNA 2ZO3H 5GCHG 3VB7A 4JK6A 2P94A 1LHDH 2HNTF 2ZA5A 3TJNA 5FCKA 2J98B 1GMHG 3BV9B 1OWJA 3SNEA 2AMDA 1EQ9A 1OPHB 5E0JA 1MKXH 1OYTH 5GPIB 1O3OA 3VEQB 3GCOA 4ZKRU 4ABFA 2GX4A 1ZHRA 1EPTA 3U8OH 4FUFA 3LT3A 5TJXA 1O5DH 3HK6B 2VIWA 4ISNA 3EAJA 1BMNH 1JIRA 3QTVH 1OYQA 3T29A 4Z1MD 3H5CB 1F0SA 4F55A 3ITIA 3A86A 5GCHF 4X1RU 1O3FA 1WU1A 1BB0B 5EQRA 1OP2A 4B2AA 1ZOMA 5AVDA 2B8OH 5C5NA 3T27A 2VGCB 5LPFA 1ETRH 4Z6AH 4X2WA 3FFGA 3RXMA 3RXTA 1IQNA 2NU0E 1F0UA 2NU1E 3A84A 1CT4E 2JJ1D 2ZFTA 1W7GH 3A82A 2BLVA 3BTME 4AG1A 1E1RD 1K1NA 1P2IA 1O3GA 1Y3XA 5HXFA 1GI1A 3P8OA 1ID5H 1HJ9A 3DCLA 1MKWH 4F4OC 2W6ID 4HFPB 2PSYA 3G01A 1HAVB 1QBNA 2FM2A 3LGWA 2A2XH 2VNTA 4X2XA 4LK4A 3CS0A 2SGPE 3OAAD 2XWBI 1V2OT 1MUEB 2XC0A 2OC1A 2D1JA 1YF4A 2ZNKH 2GKVE 3EBNA 4DY7B 4GUXA 3MYWA 1TA2A 1T8MA 2Z6BD 4JK5A 4CHAB 2FDAA 5FXLA 4YLUA 2Z3EA 2PW8H 1CO7E 2FOAA 2Y7ZA 4I8LA 1TALA 4AN7A 2H5DA 3M3TA 2RA0A 1C5VA 1OHHD 2BXTH 2OBQA 1GVZA 2J38A 1YLCA 3A7VA 5L2YH 1HAGE 3V13A 4WXVA 1LHEH 3A8DA 4NWKA 1V2ST 2Y80A 2P59A 1PJPA 2QCYA 2ZIQH 3SHCH 1HAYB 5CDFE 2VIQA 3SZNA 2HNTE 3PMBB 4CBOA 3S9BA 1ZJDA 1AO5A 1GJ4H 1O2WA 1L0ZA 5A0AE 3OTJE 4BAKB 4E06H 1C2DA 3PLBA 4JYVH 1TRNA 4A92A 4BNRA 4FUIA 1SOTA 1EOJA 2R0KA 1EAXA 1AQ7A 3UREA 1S6HA 3ZZBA 1O2KA 2WYJA 5AHGH 2PGBB 3A85A 1GHVH 5C3NA 1UTKA 3UR6A 2KZ4A 1P2QA 3BIUH 1YGCH 2BY6X 3RP2A 4I33A 2ZDVH 1VJAU 2OD3B 2VVUA 1Z1JA 4FUDA 1A0HB 1EJMA 1GMDF 1GI7B 3F2GA 2WSSD 2PWXA 1HJAB 4ZXYH 3MQKC 5C1YA 4DURA 3LJJA 1ABJH 1E0FD 3NWUA 1PPEE 3SUGA 3MNCA 3V3MA 2TBSA 2O9QA 1C1RA 1XUHA 2EY4C 3MWIU 3N7OA 1FY3A 1S5SA 3RXUA 2DE8A 2GDEH 2HLCA 3LU9B 4JZFH 1D3DB 2UWLA 2ZHQH 3PRBA 2XRCA 2VVCA 2XXLA 2SGQE 5T6DA 1HPGA 2Z9IA 3ATKA 3RXKA 1DLEA 1EP6A 6GCHF 1O2GH 4HGCA 4YXWD 3A7ZA 2FI4E 3IWMA 1HAXB 1TNKA 2CHAC 3GY8A 2QIQA 1VKYA 2L74A 3PV2A 3PWCA 1DANH 4NSVA 4FVBA 3DFJA 3K2UA 3W94A 3F0PA 3RXPA 2GP9B 1SMFE 1L4DA 2PR3A 4MPUA 1O3CA 1YLNA 3GDVA 1HAIH 4MPVA 5E2PA 2QXJA 4AGKA 4NZLA 4AFZA 4MVNA 1QCPA 2G8TA 3RU4D 1C5ZB 2Y6TA 3SQEE 1GHWH 2BVRH 2NU2E 1K1JA 1W2KH 2HWLB 3RLWH 1KDQB 1FY8E 4B2BA 1DLKB 2A2QH 1NFYA 2BDBA 4ABIA 4P02A 1O5GH 1P09A 3MH7A 1A2CH 3BF6H 1K1MA 2SNWA 1HB0B 1EZQA 1BMFD 3FVFB 2TPIZ 1GBFA 3ELAH 1LDTT 4YM9A 3Q3YA 2QN5T 3RXOA 2Y5FA 2VBCA 4INHA 5CHAB 5C0UA 1KXEA 2BZ6H 4IBLH 2G00A 2HLDD 3FN8A 3SORA 1BRUP 4M9FA 3SU1A 1Y3VA 2M5TA 3RXLA 1NFXA 2AH4X 1EZSC 1QY6A 3RXCA 1S82A 4ZUHA 1TWXB 4KTSA 3RC5A 2V3MA 4M7GA 3FANA 2ZP0H 3ZZ9A 4BAMB 2ZU5A 2K0QA 2CN0H 1QRWA 4I7YH 2R0LA 1GHXH 4FU8A 2D8WA 3TH4H 3LH1A 3VG8A 5GIBA 2EEKA 3WW7A 1NRRH 1AWHB 2K8IA 4DCDA 1KY9A 1EPTB 4MLFB 1C1UH 5JB8S 1FZZA 3K9XB 4IW4E 1GI9B 1YWUA 3MU4A 1S0QA 2ANWA 1N8OC 3S7KB 1MBQA 2AYWA 2FLRH 3BN9A 1WOFA 2SGFE 3KQDA 3E3TA 4VGCB 1C2JA 1O3IA 1BRAA 2C8XB 1FPHH 4UEHH 2WPLS 5L2ZH 1T8OA 1QQ4A 2FOHA 2Z7FE 2G81E 4NIXA 2UUYA 4OGXA 1OSSA 1OX1A 3QGNB 3MHWU 4K1EA 1YPGH 3SNBA 3T2NA 2VH6A 1BQYA 1KYNA 5E8EH 3RXHA 3OEHD 3KF2A 4CRAA 1COWD 1PPHE 1V2LT 1MABB 1SGCA 4JCNA 3O8BA 3MFJA 3W1EA 4A1TA 3TH3H 1UCYK 2XC5A 4A5TS 1WUNH 3RXJA 1LQEA 1FY5A 2QA9E 4AX9H 2R3YA 5GWZA 1NRQH 2ZZUH 1CA8B 1T32A 2W3IA 1FAXA 3EA7A 2Z9KA 1MU6B 2EI7A 1CBWB 4GHTA 1GJ6A 1V2WT 2CV3A 2FX4A 2GCHG 1AY6H 1HGTH 3UOUA 1EPTC 1FN8A 2WPIS 5F8XA 3EYDA 1K1LA 9ESTA 5G4BA 1MTNC 3SOSA 2TRMA 4O97A 1GJAB 1B7XB 4MQAA 3PMJA 2VB0A 1O2UA 3CP7A 4VGCC 1BMAA 2HGTH 2H6MA 1UTMA 1ZTLA 3RXRA 1CSOE 1JXPA 4NIYA 1RJXB 3SV7A 1BZXE 1P2KA 1OP0A 4YO9A 2HPQH 5JPMH 2GT7A 4TPYA 4BAOB 1ZTKA 1GCTC 4ABGA 2G5VA 1P2JA 3A8AA 1MD8A 1NRPH 1P3CA 2Z9GA 2VU8E 8GCHG 4ZHAA 3SU3A 5C20A 4JYUH 4Q7ZA 1CE5A 1TBRH 1UHBB 5LPEA 1O3AA 1SSXA 1UVUH 1OP8A 1T31A 3E8LA 4CRGA 2XTTB 1AMHA 3VGCB 2KFWA 2I6QA 4Q63A 3VB3A 2H5CA 1TFXA 3M36A 1SLUB 3OY5U 1UVPA 1ZR0A 3A7YA 3BIVH 1BUIA 1HAHH 1O3JA 1C4V2 4ZKNU 1EAIA 1S0RA 4FXGH 2O8TA 4NA8A 3OSYA 3ZVGA 2GZ8A 3LKWA 4YT7H 1NBMD 1RS0A 3GCNA 1V2VT 1ESAA 2F9VA 3GICB 1O2ZA 2Z94A 3TLOA 3UAIC 3UPEA 2IJD1 3UQVA 2KCPA 1YPLH 2F9NA 1ETSH 1AIXH 1KXCA 5LPRA 3QDZB 8KME2 4A1XA 3GY5A 1THRH 1NM6A 3OFND 3AW1A 5EPNA 1NO9H 2F9UA 2A31A 1T4UH 4X1QU 3M7QA 1ZSLA 2H2ZA 3VXFH 1C1PA 4WMEA 1DY9A 2ZDKA 2ZPRA 3UTUH 3L6PA 3TU7H 4GCHF 2RFKC 1E1QD 2GVFA 4K8BA 3UR9A 1HFDA 1F2SE 1UTLM 1L1GA 1G3CA 2FZZA 2WUBA 2XC4A 1G36A 1HNEE 2XWAA 4D8NA 2G51A 1HAZB 3UWJH 3N7DA 2ZI2H 4YT6H 3VGCC 2GJGA 5A8XA 1O3DA 2EI8A 3QZRA 2GV6A 1LMWB 3CENA 1TNIA 4NWLA 3HPTB 2FOCA 4GAWA 3U8TH 1P2MA 5C5OA 2WPDD 2W7SA 3M37A 1AGJA 1OWDA 2QF4A 3OX7U 2ESTE 3I29A 2BLQA 2FIRH 2P3TB 3ZVAA 3GOVB 3D65E 3TGIE 5DKMA 4K3JA 1TNHA 3A87A 3GY2A 1GBBA 2C4FH 1IQJA 3SGQE 3EA8A 3C1KA 4THNH 2V6NA 4ABAA 1LHGH 3LIWA 1UTJA 1YCPM 1TNLA 2GT8A 3Q00A 2V0BA 4HI3A 3BG8A 1HYLA 1Y59T 2PP6A 1SLWB 1Y5BT 4H6SB 2QF0A 1MAYA 1KXAA 3HATH 3M5NA 2Q1JA 3MTYA 3U1IB 5HKKD 1O38A 2A4OA 2ZGHA 3A83A 3SV9A 2WYGA 1GI4A 2WV5A 5GNDA 3AAVA 1UTPA 3SNDA 2A4GA 3O8RA 1H8HD 1UVTH 1O2QA 1XUKA 3ZVDA 5L6NH 1AKSA 3RXAA 1MTWA 1EFRD 1WBGB 2HNTC 3U28C 1M9UA 3S9AA 1GVLA 1SQOA 2ZTZA 5CMXH 4K1TA 1ELFA 3FZZA 3EE0B 1PQAA 4J2YB 5B6OA 3TIUA 2A5IA 1L2EA 4YOJA 1DM4B 2J94A 1UVSH 4FU9A 2Q6DA 1YM0A 3PROA 3RM2H 5DP6A 3NPSA 3RXEA 1YYY1 3HKJB 1K9OE 4XFQA 1FIWA 3TJOA 4Q2KA 1ZRBA 1EAWA 4CRFA 3B23B 1EATA 3P92A 1GI5A 1JBUH 3MH5A 3SBKA 3PV5A 4I32A 1GHBF 2IPQX 1C5LH 2CF9H 2PGQB 3UNRA 1DSTA 5EXLA 4CBNA 4OS1A 2HOBA 3K65B 1WYKA 1LVYA 1C2MA 2QYIA 1G30B 1KDQA 1DSUA 4FOUC 1TQ0B 2TIOA 1C5XB 4GLYA 2OLGA 4INKA 2RG3A 3KNXA 4H42U 3F9FA 2Z3DA 1YKTA 5FBEA 1SBWA 2ZQ2A 3QZQA 3OY6U 4FUJA 2GZ7A 1O2XA 2BD2A 4Y76A 1AVWA 3PLPA 1C1QA 2G52A 3RDZA 2ZFQH 1D4PB 3OE7D 3IG6B 3TJUA 1YPHE 4UFEH 4RKJB 2ZFSA 3JZ1B 2VIPA 4FVDA 1A4WH 1CGIE 1F0RA 5PTPA 1KTSB 3RXSA 1O3HA 1NU9A 2YMSB 4BTIB 2D26C 3F3BA 4UFFH 1IQKA 8ESTE 3A81A 5J4SA 2BY7X 3KN2A 1CA0C 2TGPZ 2CMYA 2B7DH 5T3HA 1JRSA 1GI0A 1IQEA 3BTQE 2AIPA 5EW2H 2VINA 3KQBA 1LVBA 2LP6A 4NSYA 5EQSA 1FXYA 2ZCLP 1J15A 1Z8JB 4UD9H 3SI3H 1AFQB 3DSGA 2KM0A 5GXPA 1OKXA 1VCPA 1RIWB 2Y82A 4CH2B 2A7JA 1AI8H 1YPJH 3U69H 3LDXH 3VB6A 1QBOA 2F3CE 3V0XA 2ODYB 3SU2A 1QRXA 1A5IA 3MMGA 3UB0A 5EU8A 1TX7A 1UW7A 1AFEH 1O5EH 2V35A 3RMOH 5EG4A 2BHGA 2BDHA 2AGGX 1C5NH 3M35A 1GJ8B 1DUAA 2FOEA 1H9IE 1KSNA 5DP4A 4K60A 2Y81A 2V3OH 1SGIB 2W3KA 2GMTB 4IN2A 4U30A 4WH6A 4AOQA 1TMBH 1AB9C 1C2EA 1C5PA 1EASA 1WAYB 3MNXA 2XCNA 4TSFD 4D7GA 2YMSC 5E0GA 3SJ9A 5A0CA 2L6OA 3S0NA 3ZV8A 5GDSH 1GBEA 2ALPA 1OOKB 4WXIA 3TGKE 1ZPZA 4LOYH 3GYLB 3KQCA 3ZZAA 1GBDA 2JDID 5ESBA 3A80A 1ANEA 1ANDA 2FOMB 1FN6A 4H4FA 1E37B 1ZLRA 2XNDD 3DHKH 1J14A 1PYTD 1UCYH 4XBCA 5FX6A 1O5FH 1J17T 3HGNA 2FPZA 3TGJE 3SUDA 2ZQ1A 2ZF0H 1IQLA 1AFQC 4KTCA 1EB2A 3N99A 1IQMA 1SHHB 3F6UH 1BA8B 1HAOH 4R0IA 1KTTB 1RIWC 1C1TA 2P95A 5KGOA 2QV1A 3M3VA 2BM2A 1W8BH 3QTOH 2Z3CA 1EZUC 3MH6A 2VGCC 1W0JD 1C1VH 3KCGH 4K2YA 1CGJE 1GMDG 4O3TA 1TNGA 4AG2A 1MD7A 1V2PT 2B0FA 1ELVA 1O32A 2XBYA 1KIGH 4Y8YA 3ZZ7A 1O3MA 2FO9A 1NFWA 1W0YH 3LH3A 3T26A 8LPRA 3BG4B 1P2OA 1UHBA 1BTPA 1FX0B 1NZQH 1D6RA 3ZVFA 2XCFA 1EP5A 2GMTC 3DFLA 1O3EA 2P8OB 5F8TA 3V7TA 3LGYA 2AS9A 1B0EA 1LVMA 3F9EA 1DWDH 1ARBA 1WDIA 6GCHG 1MCVA 2ZGBH 1BTZA 7KMEH 1ETTH 3SW2B 5KECA 1AN1E 1PPBH 4DT7B 1RTKA 4ZHMU 2PKSB 1V6DA 4CHAC 3RXIA 4O9VA 4NA7A 1DUEA 4GSOA 3SI4H 2VIVA 1A61H 1SPJA 2DE9A 4O03A 1CT0E 1C5YB 5H4IB 3SU6A 1QTFA 1SGQE 3E0NB 1W0ZU 1AKSB 1GI3A 4Y71A 2BD4A 3ESTA 1K22H 1PQ8A 1ABIH 1L1NA 2F9PA 2I6SA 4IMZA 4DJZB 3SGAE 3MI4A 2ZG0H 2J92A 1DOJA 1A7SA 1BOQA 1C5WB 2G5NA 3DSOA 1P01A 1XXDA 3WWBA 1O2RA 3T28A 3WY8A 3ZIAD 2BD3A 4CRBA 1TBZH 2AGEX 3ZYEA 1HBTH 1Z8GA 4LZ4B 1GI2A 2FP7B 2V7QD 1GDUA 1TMUH 3RMMH 1XVOA 3T25A 4AFSA 4TWWA 4HTCH 3ENSB 3C27B 1L1JA 3BG4C 1O2JA 1C2FA 3FP6E 1XUFA 2XW9A 2P8OC 3ZZ4A 2WPHS 1RD3B 3KGPA 5EGMA 3R3GB 1UTOA 3BTGE 4X2VA 3NUMA 4R8TB 1PYTC 4K5ZA 1OS8A 1E79D 2VWOA 1BBRK 1P12E 3TH2H 2BZAA 4DGJA 1P0SH 3D23A 2ULLA 1HJAC 2PKSC 2H1UA 1H8ED 3LC3A 4ISIH 4Q4LA 2WZQA 1C5SA 2FI3E 1T7CA 3RLYH 1TABE 2O8UA 1IOEA 1VCQA 2BLOA 4ABHA 2OC7A 1MZAA 5FL7D 4WMDA 1QB6A 1C2LA 2BDGA 3E6PH 1O3KA 2VWMA 2QY0B 2BY8X 3ZVBA 1ELAA 1FONA 1O5CB 5LGOA 1SGPE 3O8CA 5ETXA 1HRTH 2LIZA 2BY5X 4XD7D 1ZHMA 3SU5A 3F1SB 4NCYA 3MNBA 1XMNB 5EOKA 1RTLA 3A89A 5K7RA 1PPCE 1QHRB 2BDYA 3LGVA 3SJKA 4B73A 1Z6EA 1N1LA 2ODPA 3CNRA 2VIOA 3A88A 1LPZB 1IQGA 3WWFA 3AAUA 4MNWA 2FODA 5AFYH 2VJ1A 1V3XA 1C4Y2 1F7ZA 3P6ZB 2F43B 4WWYA 4B6EA 1QURH 1SC8U 2AMPA 1CHOF 1W12U 1OWIA 5EJ1A 1AVGH 1QJ7B 3LJOA 4SGAE 1GDQA 3RXGA 2QE7D 1AHTH 1FY1A 4X6NA 1NT1A 2O8MA 1VGCB 1QRZA 3PLKA 3ZZ3A 2ASUB 1U6QA 4LZ1H 1GBCA 5J4QA 1C1WH 3QX5H 2Y5HA 1CGHA 5CHAC 3DT0H 1SLXB 1T8LA 1HV7A 1DWCH 1G37A 4FUEA 2J4IA 3L3TA 1P03A 4AC9A 1O2TA 2O8WA 2A5AA 1KXBA 4A1VA 1C5OH 2OP9A 1YLDA 3ODDA 3GY3A 4IGDA 1XVMA 3E0PB 1ELDE 4Y0YE 2FYRA 7LPRA 2JH5D 3DSPA 4OS2A 1BJUA 2WPJS 2IOTA 4RT1A 1O2NA 3RU4T 3ZZ8A 2JH6D 4B1TA 1BTYA 3PTBA 5BRRE 5GJ4B 3HGPA 3FP7E 5EPYA 2GZ9A 2ZTYA 4O3UA 1DWBH 3KL6A 1W14U 1AD8H 2XOKD 3T5FH 5DK1A 4B75A 5I46H 2JH0D 5JBCS 3TK6A 3FO8D 1XX9A 4X6PA 1O5AB 1VGCC 3I78A 5A8YA 4Y7BA 1A3EH 2QAAA 1GBKA 1O35A 1NS3A 4YTAA 3SJIA 1ZHPA 3A7XA 3ZVEA 1GVKB 1YBWA 2J5UA 2PHBA 1CHGA 1H1BA 4FUCA 1NROH 2A4RA 3RUOA 4JZDH 5FPSA 4I8GA 3SJ8A 2WHXA 1V2NT 1PQ7A 3A7TA 2K7XA 1ORFA 3TK5A 1C2KA 1H4WA 1BCUH 3KQ5A 3LGTA 4RN6A 4Y79A 1UMAH 2W26A 1LQDB 1NN6A 2A45B 1Y8TA 1ELBA 2UUJB 3P95A 3AW0A 1CBWC 4KKDA 1IHTH 1ZMNA 1DWEH 1HAPH 5ABWA 1OWEA 1Y5UT 2QXGA 4SGBE 1PQ5A 5BPEA 4JZEH 4GCHG 3NK8A 1CQQA 4CRCA 4ASUD 1C2GA 3LPRA 2ZFFH 3SN8A 2K1QA 2ZPSA 1WQSA 3TNSA 2ZGCA 1YCPK 3TVJB 2GCTB 3UIRA 2ZGJA 5HYOA 3UNSA 1O3PB 2XBXA 1TRYA 1C2HA 1EJNA 3H7OA 1TPOA 2ZECA 5I25A 3MH4A 2FLBH 4ISHH 3SQHE 1V2RT 4E05H 1BDAA 3SZEA 4WF8A 4ABEA 4RKOB 3QK1A 1UJ1A 1EB1H 1BHXB 3PO1B 2ZHDA 1KLIH 4X6OA 1ELTA 3PM3A 2BY9X 4NFFA 1SGEE 2OC8A 1ZSJA 1O2LA 1SR5C 1DX5M 1MTSA 4NZQA 4IMQA 1D3PB 1A5GH 4ABJA 1WXRA 3F0OA 1NESE 1FQ3A 1P3EA 5C2ZA 4YOGA 4CR5A 2ZU2A 1GI6A 5EJLA 3DD2H 5HGGA 2WPKS 2A0QB 3P8GA 1J8AA 1LCYA 1QB9A 1XKAC 2STAE 3GY7A 6CHAB 2OK5A 3NRLA 2PV9B 1YPMH 1HLTH 1T8NA 1F92A 2FEQH 2OUAA 4MPWA 1NU7B 3VFEA 1EX3A 1GGDB 2A7HA 2PTCE 1SQTA 1T4VH 1QL8A 2G55A 3ODFA 1A0LA 1HJ8A 2VIDA 3LC5A 1K2I1 5DPAA 5ESTE 3KYFA 1S81A 1G9IE 1OWKA 1BMMH 1SGFG 3FAOA 2ZDNA 1P9UA 1DPOA 1ARCA 4LXBH 1FI8A 2GCTC 3BSQA 1GJ5H 1FPCH 2ANKH 2F83A 2BVSH 2P93A 4ZMAH 1MU8B 1V2QT 3SJOA 1IQHA 3PO1C 1BBRE 2KR7A 1SHYA 1RTFB 4DG4A 1FJSA 2PSXA 3TJVA 1HUTH 5HMAA 3STIA 1GHBG 1GHAG 1QB1A 2PFEA 1F5LA 1BITA 3KEEA 3QGJA 3A7WA 3BEFB 1YC0A 2XBWA 1MAXA 4F49A 1O2YA 1VITH 3NZIA 3UQOA 3BTEE 1O2PA 1QR3E 5E0HA 1XKBC 1Y3UA 3M5OA 2VWLA 6CHAC 2YNBA 1THPB 4BXWA 2XYAA 2A1DB 3B8JA 2KAIA 4WJG2 1K21H 1KLJH 1TA6A 2YMSD 2ZWLH 5DSFA 4TY6A 4D76A 3RU4E 4MNXA 1GGDC 3PMHB 5B6LA 7GCHF 2HALA 1ZGIA 1GHAF 1P10A 2OQUA
chains in the Genus database with same CATH topology
1H9HE 1PPZA 3L33A 7ESTE 5JBTA 4JZ1A 5TCCA 1GL1A 4U01A 1QQUA 1C5MD 4QT8C 1Z7KA 2BX3A 1NC6A 1QNJA 1P2NA 3S69A 2G4UA 4BTUB 4X1PU 4GHQA 1GI8B 4GPGA 3EA9A 3BEIB 2WUCA 1O2HA 1WCZA 1S83A 2H9HA 2RDLA 3DA9B 1ELCA 1VCWA 5FCRA 1TGBA 3SV2H 2ZHEH 1BBRH 5DP8A 4AYYB 1A5HA 1ZPBA 1UCYE 3VB4A 5DP5A 2BOKA 4K69A 4E7RG 3K6ZA 1WSSH 1SB1H 1SI5H 4MNYA 1LTOA 2BVXH 1QA7A 1TIOA 1QL7A 4FUBA 2RA3A 2FOBA 4IN1A 3D62A 4I8JA 1GBAA 1TQ7B 1NRNH 1Y3YA 1FLEE 1O39A 1O2SA 1UK4A 1SLVB 1O37A 1LHCH 1QJ1B 4TPIZ 4XE4A 5DGJA 2XNIA 3SUFA 2O8LA 3SHAH 2D2DA 1ZRKA 5F03A 1DVAH 2BMGB 3GCTF 2ANMH 5FHTA 3NKKA 1O2OA 1GJ7B 2Q6GA 1WTHD 1EOLA 3MO9A 1OXGA 3BEUA 4X1NU 4AORA 5DJ7A 1TMTH 4YOIA 4KP0A 2QF3A 2GV7A 2ZEBA 2W5EA 2BD5A 4BTTB 1AE5A 3SNCA 3RXBA 1C1SA 1O31A 4WY3A 4IC6A 1ZSKA 1VZQH 1TGCA 5EW1H 5AFZH 1MTVA 6LPRA 3B9FH 3TNTA 3QWCH 1GMHF 1ESBA 3M7UA 4Y7AA 4FU7A 3GISB 1C2IA 2Y7XA 4INLA 4GVUA 3MOCA 1SGDE 2PKAA 3Q3KA 1XUIA 3U9AH 1ANBA 1SL3A 1XUJA 4ZKSU 1MBMA 1ZMLA 1FUJA 3LGUA 4X8VH 4Z0KA 4AFQA 3GDUA 1GWAA 1L4ZA 1GMCG 5JBBS 4XOJA 1GJDB 3PMAB 3RXFA 2R2WU 4D7FA 2BX4A 1WV7H 3BTFE 5C1UA 1C5UA 3O8DA 1LKBA 4ISLA 1BTWA 1ZZZA 1O30A 1AUJA 1YPEH 2JKHA 2R9PA 4I31A 4X1SU 4AZ2B 1Y3WA 3MNSA 1Z8RA 4JMYA 4NIVA 1MMJN 3RXVA 1ZYOA 2SGAA 4OS4A 1Q2WA 1UTQA 1KLTA 3P8FA 3OYPA 4DIIH 4ABBA 1GMCF 1DXPA 4AYVB 2ZKSA 4B2CA 2J95A 2NU4E 3MO6A 3SUEA 5SGAE 2BLWA 4CR9A 2ZU4A 1FDPA 1X7AC 2C93B 3Q77A 1UVOA 1SGFA 1D6WA 1O3NA 1G32B 3EGKH 4UE7H 1G3BA 3U98H 3ZV9A 1TOMH 2A32A 2FTMA 3RC4A 4IS5A 2FTLE 1ELGA 4OS5A 4ZXXH 4NA9H 2J34A 4ZKOU 1ELEE 3Q3XA 2CHAB 3QN7A 1YP9A 1F5KU 4CRDA 3SNAA 3SV8A 1C1MA 3QO6A 1TGTA 1DE7H 1Z8IB 3KQEA 1XM1A 2FOGA 3AASA 3BTWE 1OWHA 1RXPA 1GHYH 1LHFH 5F6MA 1N6YA 2QXIA 2BTCE 4UDWH 5T6FA 1ZJKA 1QFKH 1O2MA 1Z6JH 1C9PA 4I8HA 5EXMA 4Y6DA 3ZZDA 1GPZA 5AF9H 5DP9A 1MTUA 2ZGXH 2ZFPH 4H6TA 3AVZA 3KHVA 2FOFA 5FBIA 3MU1A 5TCAA 2BDAA 1K1PA 2J9NA 1LPGB 1ANCA 4JYTA 2KAIB 1AWFH 2BQ7B 1JOUB 2HPPH 4FUHA 3RC6A 2YOLA 3M5MA 3MU5A 3D49H 1F5RA 1YCPH 4YESB 1DDJA 1MH0A 1BTUA 3UFAA 2AIQA 3JZ2B 2FXRA 1Z1IA 1O33A 4RSPA 4K8YA 4DW2U 1G2LA 4JZIA 4TY7A 1Q3XA 4UFDH 1LVOA 2F9BH 5IDKA 2A7CA 2OXSA 2VWNA 2BD9A 3M3SA 4OS6A 1S6FA 3QLPH 2PLXA 1GBJA 1HIAA 1LPKB 5JYIA 3S9CA 1BJVA 1N8OB 4X2YA 2BDCA 5A0BA 2PUXB 1SVPA 2A4QA 2FX6A 3NCLA 3PWBA 2NU3E 9LPRA 1WTGH 1TAWA 1NPMA 4MPXA 2BD7A 1C5QA 4Y8ZA 3ZZCA 1DY8A 1GHZA 1K1IA 1E35B 1HCGA 3T62A 3TITA 4CH8B 4X8SH 2ZCHP 1ZGVA 2B9LA 2HRVA 1VR1H 1UK3A 4OGYA 1TYNA 1ZPCA 2FYQA 4KELA 1CHOG 4BAQB 5FPTA 1AU8A 5T6GA 2FS9A 1TOCB 2C8WB 3BTHE 3I77A 1P06A 3LGIA 1GG6B 4CREA 1A46H 1AZZA 1PFXC 3BTKE 4MG3A 2F91A 1MKXK 1RGQA 4I8KA 4DOQA 1UK2A 1GBIA 2FI5E 2SGEE 5F8ZA 3BTDE 4X0WU 1ACBE 1D3TB 3RMLH 2PTNA 4WMFA 4IC5A 3A8BA 1EZXC 1SQAA 3R0FA 1O2VA 1XUGA 2AMQA 1Z71A 3P8NA 1FIZA 3RM0H 3UY9A 5HM9A 2AERH 1KXDA 5A8ZA 1JRTA 1A3BH 1FMGA 4XDEA 3RMNH 3SU4A 1GBTA 2BB4A 2SGDE 3SGBE 1BMLA 4D9RA 3V12A 2OQ5A 3ATWA 4MDSA 2ZU3A 4AB8A 1A1RA 2QC2A 1TONA 1INCA 2STBE 2ZU1A 1F0TA 1QIXB 1BRCE 2C8YB 3VB5A 3HK3B 1O5BB 1GBMA 1MTNB 3PTNA 1H9LB 1E36B 1UTNA 1VITG 1GCDA 1SGTA 1NFUA 4MTBA 2PUQH 1ZMJA 4Q7XA 5EQQA 4B71A 1MKWK 5A09A 2ZCKP 5FAHA 5FPYA 4BOHA 2XBVA 1GL0E 1TPAE 1H8IH 1JWTA 1C1OA 2GDDA 1G2MA 4FUGA 1GCTB 2PKAB 3W95A 4KGAA 1P05A 2UWPA 5DO4H 1GG6C 1O3BA 5JBAS 4XSKU 1IQFA 3F68H 1ESTA 4NG9H 1GJ9B 1VITF 2J2UA 1AUTC 1J9CH 1PPGE 3VXEH 4A6LA 1W3CA 1MQ5A 1O2IA 4B76A 1DS2E 4K1SA 2C3SA 2BQ6B 4AFUA 1MCTA 4NFEA 1BIOA 2ZTXA 2OINA 3P17H 1NY22 1W11U 1RRKA 2ZDAH 4TYDA 1TNJA 3EDXB 1G3EA 2ZHWH 1P9SA 2UUFB 4U2WA 3RXQA 1P04A 3E90B 2OCVB 4AB9A 2WV4A 2GTBA 1O36A 2BQWB 2IN2A 1TE0A 2Z9JA 1THSH 2HVXA 1IAUA 1JMOH 3DUXH 4TWYA 1D3QB 2F9OA 2FWWA 2C8ZB 2R3UA 2BD8A 5CE1A 1V2TT 2GD4B 4X8UH 2IPHA 1A0JA 1TPPA 1EAUA 2W7UA 3RXDA 1GBHA 2GCHF 4XBDA 1H8DH 1B5GH 3MU8A 1YPHC 3U1JB 3UOPA 4ZAEA 1DXWA 5JDUB 2R2MB 4WVPE 2CF8H 2B5TB 3F9GA 3GCHB 3E1XB 1P57B 3U8RH 1C5TA 1DICA 3S7HB 1ZTJA 4MNVA 1TBQH 4YZUA 3TK9A 1SOZA 2CGAA 1E38B 2UUKB 2RCEA 2IJOB 1TPSA 2FMJA 1GJCB 1O34A 4U32A 2AFQB 2AGIX 4BXSA 1V2MT 2V3HH 4Y11E 1G3DA 2ZDMA 2C90B 1EUFA 4UFGH 1IQIA 5L30H 2TGTA 1TGNA 4ASHA 1C9TA 3ZZ6A 1TLDA 4ABDA 3M7TA 8GCHF 3ATMA 4Q7YA 1TRMA 4ESTE 2EA3A 1O0DH 4WH8A 1HAVA 4Q80A 1BT7A 1WQVH 4E7NA 2ZFRH 4X6MA 5DP3A 3FZDA 2JETB 1FAKH 5A2MH 4DIHH 5DP7A 1N6XA 1EJAA 1K28D 1HXEH 3F9HA 2CJIA 3KIDU 3FP8E 1K1OA 2Q6FA 2OBOA 4Y0ZE 3TPIZ 3ATLA 1HXFH 2BYAX 3ZVCA 2LPRA 4XBBA 2BXUH 2SFAA 2ZDLA 1LKAA 3GCHC 3EQ0H 5C67A 3NXPA 2H9EH 2ALVA 1QBVH 1HIAB 5FX5A 4Y8XA 2YNAA 5C1XA 3LONA 1FNIA 2DUCA 1Y5AT 1QL9A 3STJA 3SV6A 3UNQA 4PROA 1SFIA 1C5RA 3Q76A 4ZROA 1W10U 1D9IA 1V2UT 4A7IB 4BAHB 2A5KA 1SG8B 3ZZ5A 3MU0A 1BTHH 1FV9A 2P3UB 3MO3A 1SGRE 1GJBB 3PYHA 2VVVA 1HDTH 2ILNA 3PB1E 5HM2A 1C4U2 1TX6A 4YLQH 2GGVB 4ISOA 2JETC 7GCHG 1Q31A 1QGFA 4OS7A 1EKBB 3H7TA 2BOHB 1BRBE 5JB9S 6ESTA 2P3FH 4D9QA 3URCA 3ATIA 2ZHFH 1MQ6A 2ZC9H 3OU0A 1O3LA 1W13U 1GBLA 2ZPQA 3E16B 1EXFA 4Y10E 2QGRA 1CT2E 1NRSH 1V2KT 2WINI 1DT2A 5EODA 1TGSZ 2ODQA 2SNVA 3CS7A 3K6YA 1E34B 3GYMA 1KXFA 1C1NA 3UUZA 2THFB 2AEIH 4X8TH 4J1YA 2Z9LA 3GY4A 3LOXA 1CU1A 2OC0A 1J16A 1SFQB 1DITH 3UWIA 3BTTE 3ZYDA 4KTUA 2OTVA 5E2OA 2VH0A 1UO6A 2P16A 1SGNE 5LH8A 3A8CA 1CA0B 1BTXA 1S84A 1CVWH 1MZDA 1GDNA 1FY4A 1LO6A 4HZHA 1S85A 5K0HA 1B0FA 3HKIB 3IITA 1TX8A 4AGJA 1XXFA 1VJ9U 2FESH 3PV4A 2NWNA 2WPMS 3GDSA 2FS8A 4NGAH 1V2JT 2CXVA 4B74A 3URDA 2BDIA 1JIMA 2UWOA 1W7XH 2ANYA 1RFNA 2QXHA 1NTPA 1IHSH 1QA0A 3SO3A 4ZHLU 1TB6H 2EC9H 2G4TA 4ZH8A 1AZ8A 3GCTG 1YPKH 1PPFE 4NIWA 4UONA 1P8VC 4DVAU 2TGDA 3E91A 2EI6A 1SGYE 1BHXF 3GY6A 2Y5GA 1P11E 1AE8H 2H9TH 2LNCA 3M61U 1AVXA 5DG6A 4BANB 1P02A 1QJ6B 3QUMP 5IYTA 3M5LA 3P70B 3SU0A 2TGAA 3VPKA 1AB9B 1DFPA 5EXNA 2ZO3H 5GCHG 3VB7A 4JK6A 2P94A 1LHDH 2HNTF 2ZA5A 3TJNA 5FCKA 1GMHG 3BV9B 1OWJA 3SNEA 2AMDA 1EQ9A 1OPHB 5E0JA 1MKXH 1OYTH 5GPIB 1O3OA 3VEQB 3GCOA 4ZKRU 4ABFA 2GX4A 1ZHRA 1EPTA 3U8OH 4FUFA 3LT3A 5TJXA 1O5DH 3HK6B 2VIWA 4ISNA 3EAJA 1BMNH 1JIRA 3QTVH 1OYQA 3T29A 3H5CB 1F0SA 3ITIA 3A86A 5GCHF 4X1RU 1O3FA 1WU1A 1BB0B 5EQRA 1OP2A 4B2AA 1ZOMA 5AVDA 2B8OH 5C5NA 3T27A 2VGCB 5LPFA 1ETRH 4Z6AH 4X2WA 3FFGA 3RXMA 3RXTA 1IQNA 2NU0E 1F0UA 2NU1E 3A84A 1CT4E 2ZFTA 1W7GH 3A82A 2BLVA 3BTME 4AG1A 1K1NA 1P2IA 1O3GA 1Y3XA 5HXFA 1GI1A 3P8OA 1ID5H 1HJ9A 1MKWH 4F4OC 4HFPB 2PSYA 3G01A 1HAVB 1QBNA 2FM2A 3LGWA 2A2XH 2VNTA 4X2XA 4LK4A 3CS0A 2SGPE 2XWBI 1V2OT 1MUEB 2XC0A 2OC1A 2D1JA 1YF4A 2ZNKH 2GKVE 3EBNA 4DY7B 4GUXA 3MYWA 1TA2A 1T8MA 2Z6BD 4JK5A 4CHAB 2FDAA 5FXLA 4YLUA 2Z3EA 2PW8H 1CO7E 2FOAA 2Y7ZA 4I8LA 1TALA 4AN7A 2H5DA 3M3TA 2RA0A 1C5VA 2OBQA 2BXTH 1GVZA 2J38A 1YLCA 3A7VA 5L2YH 1HAGE 3V13A 4WXVA 1LHEH 3A8DA 4NWKA 1V2ST 2Y80A 2P59A 1PJPA 2QCYA 2ZIQH 3SHCH 1HAYB 2VIQA 3SZNA 2HNTE 3PMBB 4CBOA 3S9BA 1ZJDA 1AO5A 1GJ4H 1O2WA 1L0ZA 5A0AE 3OTJE 4BAKB 4E06H 1C2DA 3PLBA 4JYVH 1TRNA 4A92A 4BNRA 4FUIA 1SOTA 1EOJA 2R0KA 1EAXA 1AQ7A 3UREA 1S6HA 3ZZBA 1O2KA 2WYJA 5AHGH 2PGBB 3A85A 1GHVH 5C3NA 1UTKA 3UR6A 1P2QA 3BIUH 1YGCH 2BY6X 3RP2A 4I33A 2ZDVH 1VJAU 2OD3B 2VVUA 1Z1JA 4FUDA 1A0HB 1EJMA 1GMDF 1GI7B 2PWXA 1HJAB 4ZXYH 5C1YA 4DURA 3LJJA 1ABJH 1E0FD 3NWUA 1PPEE 3SUGA 3MNCA 3V3MA 2TBSA 2O9QA 1C1RA 1XUHA 3MWIU 3N7OA 1FY3A 1S5SA 3RXUA 2DE8A 2GDEH 2HLCA 3LU9B 4JZFH 1D3DB 2UWLA 2ZHQH 2XRCA 2VVCA 2XXLA 2SGQE 5T6DA 1HPGA 2Z9IA 3ATKA 3RXKA 1DLEA 1EP6A 6GCHF 1O2GH 4HGCA 3A7ZA 2FI4E 3IWMA 1HAXB 1TNKA 2CHAC 3GY8A 2QIQA 3PWCA 1DANH 4NSVA 4FVBA 3DFJA 3K2UA 3W94A 3RXPA 2GP9B 1SMFE 1L4DA 2PR3A 4MPUA 1O3CA 3GDVA 1HAIH 4MPVA 5E2PA 2QXJA 4AGKA 4NZLA 4AFZA 4MVNA 1QCPA 2G8TA 3RU4D 1C5ZB 2Y6TA 3SQEE 1GHWH 2BVRH 2NU2E 1K1JA 1W2KH 2HWLB 3RLWH 1KDQB 1FY8E 4B2BA 1DLKB 2A2QH 1NFYA 2BDBA 4ABIA 1O5GH 1P09A 3MH7A 1A2CH 3BF6H 1K1MA 2SNWA 1HB0B 1EZQA 3FVFB 2TPIZ 1GBFA 3ELAH 1LDTT 4YM9A 3Q3YA 2QN5T 3RXOA 2Y5FA 4INHA 5CHAB 1KXEA 2BZ6H 4IBLH 2G00A 3SORA 1BRUP 3SU1A 1Y3VA 2M5TA 3RXLA 1NFXA 2AH4X 1EZSC 1QY6A 3RXCA 1S82A 4ZUHA