2OP9A

Substrate specificity profiling and identification of a new class of inhibitor for the major protease of the sars coronavirus
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
302
structure length
302
Chain Sequence
ASGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replicase polyprotein 1ab (pp1ab, ORF1AB) 3C-like proteinase
publication title Substrate Specificity Profiling and Identification of a New Class of Inhibitor for the Major Protease of the SARS Coronavirus.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
total genus 88
structure length 302
sequence length 302
chains with identical sequence B
ec nomenclature ec 3.4.22.-:
pdb deposition date 2007-01-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2op9A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2op9A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2op9A02
4BXWA 4NA9H 1SC8U 4K1EA 2ZDKA 1ANDA 1QRZA 1IQGA 4A7IB 7KMEH 1EZSC 4FU9A 4K1TA 2UUKB 1AHTH 3BIUH 1HJAB 1H4WA 1S84A 4BANB 1DUAA 2WYGA 1CBWB 1E0FD 1BTXA 1GJ9B 2F9BH 2Z9KA 2GDEH 4ZROA 1EJNA 3LGVA 4DGJA 6GCHG 1HAPH 3VB7A 3DFLA 2D8WA 4A1XA 2HOBA 4CR5A 5DP5A 4ZH8A 1BBRK 2F9PA 1DXWA 4CBNA 2ZCHP 1NFUA 1O2YA 4AYYB 1ORFA 1TX7A 1O2JA 2F9UA 1ZZZA 1TNHA 1HJ9A 2Y7ZA 1TBQH 2O8MA 4X1SU 1T4UH 2FLBH 2V3OH 3GCTF 4DJZB 1F0UA 1GDNA 2BYAX 4R0IA 3MTYA 3EDXB 1HAHH 1Y3YA 4HTCH 1AB9C 1TIOA 3V3MA 1ANEA 1K9OE 3SUFA 2V0BA 2A32A 1KLTA 1UK2A 4ISNA 4F4OC 5F8TA 3CENA 1NU7B 3UQVA 1ETTH 1TA2A 2R0LA 1D3TB 3VPKA 2H5CA 1Y8TA 4ZKSU 4IGDA 3KEEA 2ZC9H 1TGTA 4KTSA 1O39A 3TK9A 1P8VC 5JPMH 2BQWB 2BVXH 1KTSB 1O38A 1UTLM 3MH5A 1TPPA 2GMTC 3UTUH 3C1KA 2XC5A 3U8RH 3ZZCA 3SQEE 2VVCA 3E8LA 3ZYDA 3P92A 1ZLRA 3RU4E 1L4DA 5C5OA 2F3CE 2AMQA 2ZNKH 3GY4A 1ID5H 1OWIA 1C5VA 2P3TB 2VIWA 3QUMP 1P3CA 1TYNA 1NS3A 4CRBA 4MPUA 1FI8A 1GBJA 2ZA5A 1BJVA 3UPEA 1K1NA 1MQ6A 3K9XB 1SI5H 2C8XB 3B9FH 2QGRA 1HUTH 1P2IA 1J16A 3VFEA 2Q6GA 1GBHA 1LKBA 1V3XA 2LNCA 1O2VA 1PJPA 1AVWA 1BIOA 3A84A 1OXGA 2QY0B 4NWLA 1QR3E 2THFB 4AB9A 2HGTH 3OU0A 5FHTA 1O2TA 1EATA 2XBXA 3SNBA 1TMBH 3QGJA 1O31A 1BMMH 2BVSH 2CV3A 1XX9A 1C2JA 1ESBA 1C2GA 2ZDAH 4YOJA 1DICA 5A0CA 1IQMA 2HNTC 1P06A 1O2IA 2FIRH 4GLYA 2FYQA 2ALPA 2W3IA 2P3FH 1RTKA 2AH4X 1V2RT 1XUGA 2AERH 2YOLA 1O3IA 1GCTC 4X2VA 3BG8A 1L4ZA 3URDA 3ZZ7A 3EYDA 2IJOB 3GYLB 4Z0KA 3TLOA 1C4Y2 1BB0B 3GCNA 1THRH 2GKVE 1EP5A 1QY6A 3EE0B 1A5HA 2BY6X 1G2MA 3QK1A 3TNSA 2OC0A 2Z6BD 3TGIE 1KIGH 2BD9A 3UR9A 1LQEA 1SGDE 4AGJA 3TITA 3KQBA 2CF9H 4NA8A 1AMHA 1O3OA 2OC1A 1N6XA 1UVUH 3PV4A 1IQNA 1NRQH 1HIAA 4Y11E 1GPZA 1KSNA 4UEHH 3TGKE 4ABBA 4XBDA 3FZDA 1CVWH 2XTTB 3PMHB 2XCNA 4JZFH 1G32B 2PUQH 1H9IE 1V2PT 2OXSA 1FXYA 2BD7A 2WPHS 2ZU5A 2D26C 2PKAB 5J4QA 4RKJB 4SGAE 1HRTH 2GGVB 3P8GA 1ZRKA 2QXHA 2TGPZ 1AO5A 3QTOH 3E91A 3F68H 5HM2A 1NTPA 1LHEH 4XE4A 5BPEA 5G4BA 1O2OA 3NZIA 5ABWA 1IQLA 1Z6JH 2QAAA 1C5OH 4GCHG 3A7WA 1GI3A 4CRAA 1TWXB 4ISOA 1YLDA 5JBBS 2BDAA 2WPJS 4YO9A 1TGCA 3ITIA 3Q3XA 2WPKS 4MNYA 1J17T 1TLDA 3VEQB 1D3QB 3PMBB 2I6QA 2OINA 3STJA 1DPOA 1EJAA 4X8VH 1BA8B 5ETXA 3GDUA 3BV9B 2W3KA 1C1UH 1ZTJA 3GISB 2XWAA 4KELA 1ZGVA 3A8BA 2BXUH 3T5FH 3M5MA 3O8CA 4B76A 1QB6A 4WF8A 1C4U2 1G9IE 1XUHA 3MMGA 1DX5M 3VGCC 3H5CB 1TGNA 2ZTXA 2H5DA 5EOKA 2H2ZA 2K1QA 4NIVA 2BLWA 1A1RA 1OKXA 1OSSA 2Q6DA 1PPGE 1SGFG 2VGCB 2GZ9A 4VGCB 4DW2U 5FBEA 3CS0A 1TMUH 3RMLH 1MU8B 5AHGH 5FPSA 4ZKRU 1JIRA 1AE5A 1EZXC 3UOPA 3QZQA 4YT6H 3MU4A 5TJXA 2EEKA 3RLWH 3F9GA 3I29A 3ESTA 2V6NA 3F9EA 5GDSH 3M3TA 4K8BA 2CJIA 3LH1A 5HGGA 1ELBA 1ZHPA 1KXEA 1O2PA 4AG1A 2UWLA 4IMZA 3SQHE 4NG9H 2FI4E 1KXCA 3OY5U 1HAIH 2AYWA 3SU1A 1P02A 1RTLA 3BIVH 1G30B 1QB1A 2GP9B 3F1SB 1MMJN 2STBE 2WV4A 1YP9A 1F5KU 4H6TA 4YESB 3QGNB 1O2QA 3RXAA 2EA3A 3M5NA 1ANCA 1RGQA 2R3UA 3RXQA 3BEIB 4DT7B 3B8JA 3BTDE 1EXFA 1QHRB 1TA6A 2C8WB 4GPGA 1SQOA 2FP7B 5GCHG 1K1OA 4MPWA 1O3MA 2W7UA 1VCQA 3MFJA 1KYNA 1GJBB 2IOTA 2NU2E 1BT7A 3GCTG 3U69H 1DSUA 3MNSA 5C1YA 1Y3VA 1YPHC 1O32A 2DE8A 3ZZ6A 1W3CA 2B9LA 1HCGA 4K60A 2OD3B 3FVFB 1GBBA 4NIYA 2G51A 1TQ0B 1NESE 1AGJA 1HPGA 1O2UA 3KQEA 1XM1A 5FX5A 1HAGE 1YPKH 4WVPE 2NU1E 2VB0A 2XYAA 1ZHMA 1P9UA 4WWYA 2XC0A 1MQ5A 1A4WH 3PLKA 3ZVDA 1EAWA 2FI5E 1YKTA 1ABJH 1C2HA 2R3YA 1E36B 2ANMH 2C3SA 4Q7ZA 1Z6EA 2G55A 1IQFA 5A8XA 2FODA 4TPYA 2GZ7A 1H9HE 1SBWA 2GD4B 3BG4B 2ZFTA 1GBCA 5EXNA 1UVPA 2KAIA 1CU1A 3T2NA 6ESTA 1GBIA 1F7ZA 4O3TA 2A31A 2EI8A 1T8NA 2ESTE 2J94A 5DP4A 1UHBB 3FZZA 1N8OC 1Z7KA 1GG6C 5A2MH 2AIPA 3BSQA 5BRRE 2CGAA 2FWWA 1W7GH 1MKWK 2O9QA 3E0NB 1HYLA 5F6MA 4GSOA 3QDZB 1FY3A 3GYMA 8ESTE 1ELDE 4XSKU 2OC7A 2PKSB 1K1PA 1HJ8A 2FTMA 3U1JB 3WY8A 1BDAA 1NRNH 3SO3A 2CN0H 1H8IH 2SGAA 4TYDA 4AB8A 5EG4A 1P0SH 1KDQB 1NPMA 2BD2A 4MNXA 5E8EH 3RUOA 1JWTA 1MZDA 3NK8A 1SLUB 1XMNB 2GV6A 2EI7A 4AZ2B 2OCVB 5DK1A 1ZPZA 1QBNA 2P8OC 1PPEE 2Z3EA 1EZQA 3U1IB 3RMNH 1GVKB 3LIWA 3PTBA 1O34A 4H42U 1GJ8B 3RC4A 4OS4A 3V0XA 3A86A 4ZAEA 2Z9GA 4D7GA 3KQDA 1AFQC 7GCHF 4ZHLU 3U9AH 1UTNA 4H4FA 4B1TA 4XOJA 2EI6A 1BTZA 3RXKA 3LOXA 5F8XA 1C2EA 2ZHFH 3P70B 4KTUA 3KIDU 3ODFA 1EUFA 1OOKB 3UWIA 1AU8A 1O2WA 3R3GB 4GVUA 3ZVCA 4ABAA 2FOBA 4Y71A 2W5EA 1SPJA 2QF3A 2SGFE 3A82A 2Z9JA 2QXGA 1F0RA 1DWDH 3D62A 4E7RG 3ATIA 3D49H 3FFGA 1O3CA 4Q80A 3MNXA 4AFQA 1FV9A 1C5WB 1MD7A 1MD8A 1KXFA 3MU5A 3SV7A 1ZTLA 3ATLA 1AWHB 3BTEE 1V2NT 3P8NA 3UOUA 2ODYB 1HAVB 1HXFH 3DFJA 1HB0B 1DS2E 2PUXB 2BB4A 4TPIZ 1H8DH 4K3JA 4FVDA 3BEUA 3A7VA 5C67A 1DVAH 2OBQA 4AFUA 6LPRA 2PV9B 3M7UA 3E16B 4YTAA 3M37A 3OX7U 3BTGE 1GBTA 1AQ7A 1KTTB 5C5NA 3MU8A 3ATMA 1GHVH 1Y3UA 1J9CH 4OS1A 1S6FA 4MTBA 4UFFH 1OWDA 6CHAB 1QIXB 3RXSA 1XVOA 1Z8JB 4K5ZA 2G00A 2TGAA 1C5NH 1L1JA 1V2QT 2FO9A 4AFZA 5CHAC 1GI8B 1E38B 1HBTH 3ZZ4A 3URCA 5LPRA 1SVPA 3HGPA 1BCUH 3RXRA 1OYTH 2HPPH 3RU4D 1V2VT 3P17H 2FI3E 1C5PA 3E0PB 2Z9LA 1FLEE 1AN1E 5LGOA 3U98H 3M3SA 1O2LA 3ZVFA 1MUEB 1DY9A 2F9NA 2XW9A 1VJAU 1A46H 4A1TA 1TNGA 2VWNA 3N7OA 1O3NA 1LPZB 2G5VA 1UCYE 2NWNA 3MNCA 1G3BA 3QO6A 2Q6FA 3IG6B 1Q31A 4DVAU 1DANH 3A85A 1HJAC 5E0JA 2AFQB 1Q2WA 3ZYEA 1CBWC 5A8ZA 1ZMJA 4D8NA 4FUJA 1IHTH 3A7TA 1VGCB 1UCYH 3H7OA 4GHTA 1YPMH 3MHWU 2Z7FE 1FN8A 3E3TA 3TPIZ 3EA7A 3ATWA 1P05A 2BMGB 1SR5C 1OWJA 4PROA 1IQKA 1PQAA 4F49A 1EAUA 5EXLA 2JKHA 4I33A 2VJ1A 3BTFE 2A5AA 1TMTH 4BTUB 1TAWA 3A80A 3RXFA 4JZIA 3GY6A 1QRXA 3SV9A 2FTLE 2CMYA 1BTUA 1MTUA 3RMMH 1THSH 4DOQA 1P2KA 4X6NA 2HRVA 2G5NA 1MTNB 4FU8A 1T4VH 3T25A 5GCHF 1TPAE 1BMAA 4OS7A 3QWCH 3TJOA 1IQIA 1F0SA 2ZGHA 1BZXE 2XBWA 5B6OA 1BRAA 2ZU1A 1V2MT 2ODQA 1CGHA 2OLGA 1ACBE 1T7CA 2XRCA 1EPTA 1VITH 3AAUA 3SJIA 4UONA 2B8OH 2SNWA 3K6YA 3SHCH 4MNWA 4U32A 1ZYOA 4AGKA 1K1LA 3P6ZB 3SU0A 3O8RA 1O2XA 5PTPA 2ZTZA 3E1XB 3MO6A 5A8YA 3LDXH 1XKAC 2AS9A 1P01A 1B7XB 1TNJA 3ZVGA 1UTPA 1GBLA 1C5UA 1OP8A 1WQVH 4GHQA 1FAXA 1S81A 4THNH 1EPTC 3MH7A 1LPGB 5GIBA 2H9EH 2P95A 3PB1E 1QTFA 2YNAA 3RU4T 3MH4A 1CGIE 4MNVA 4X2WA 1GDUA 2UWOA 2V35A 5FPYA 4LXBH 1DM4B 2G81E 2A45B 3A8DA 1FPCH 1GHBG 3AW1A 3C27B 1LHGH 1JMOH 4GAWA 3V7TA 1AIXH 1LDTT 4UD9H 2NU3E 4LZ4B 1ESTA 2VIDA 1L0ZA 5CMXH 4TWYA 1THPB 2PTCE 2BVRH 3SGQE 1O2MA 2GCTB 2XXLA 3SGAE 1TONA 1BRCE 2LIZA 4KTCA 2OP9A 1IQHA 1MTWA 3VB4A 1OX1A 3GY2A 1C5XB 2HWLB 1K28D 1Y3XA 1MTVA 3QLPH 1W14U 1YPEH 1YPHE 4X6MA 4K8YA 1BBRE 1DUEA 2ZQ2A 2QXIA 3L33A 2ZPRA 3U8TH 7GCHG 1VCWA 1C2LA 1CHGA 1GI7B 1MKXK 1QBOA 2PW8H 4BTIB 1GBEA 1C1QA 1P2QA 1BHXF 1UTJA 3NWUA 1ZGIA 1BBRH 4CR9A 1AKSA 5C3NA 2GDDA 1MH0A 1O2HA 4J2YB 1AI8H 3SI3H 2VH0A 1ZPBA 9LPRA 4WH6A 1P10A 1G37A 1T8LA 4Y0ZE 4SGBE 3BF6H 1YCPM 1FNIA 2AGGX 1UTQA 1RIWC 1GI2A 2C90B 1LHFH 4NZQA 2WINI 1S85A 1ZSLA 2XBYA 1O5AB 1WOFA 4ISIH 4YLQH 2QIQA 1JBUH 2WPIS 2AGIX 1EQ9A 3D23A 2ZFFH 1O3HA 3SU6A 5JBTA 1GL0E 2D1JA 1OWKA 4ASHA 1GJ6A 2R2MB 2BX3A 4UFEH 3SOSA 2RCEA 3HPTB 1WV7H 4JYTA 1C2FA 4LOYH 4AOQA 1EKBB 1YPJH 4OS5A 1YC0A 3T28A 3LC3A 2PHBA 2O8TA 2F9VA 3M5LA 2PLXA 1TFXA 1CE5A 1QJ6B 3NCLA 3UR6A 3TU7H 1O5CB 3SJ9A 1DY8A 2PFEA 3RXUA 1B0FA 4U30A 1INCA 1ETSH 2WPMS 3OY6U 5LH8A 1NFYA 4VGCC 4HGCA 3A7YA 1C5MD 1ZMLA 2BQ7B 1D6WA 1BTPA 1NRPH 2OUAA 1FY1A 3S69A 1FIWA 7ESTE 5DJ7A 2YNBA 1TGBA 1IAUA 4X1PU 1VJ9U 1GBMA 1EASA 1P11E 1O3JA 1HGTH 1SGNE 1S82A 3KF2A 1HAOH 5AF9H 1LVYA 3SJOA 3LC5A 1LTOA 2PSYA 2FEQH 4AFSA 4AG2A 4BTTB 5C2ZA 2O8LA 2F9OA 3PROA 3HKIB 1UTOA 1TABE 1O3GA 2ZGBH 3PWCA 1KLIH 1HIAB 2ZEBA 3GY7A 4MPXA 4WY3A 1O5DH 5GPIB 4JYVH 4DY7B 5EPYA 2BLVA 1A3BH 4DIIH 2ZO3H 1GHXH 1YBWA 1G2LA 1NZQH 1F5LA 1SFIA 1ETRH 2ZF0H 3F6UH 5T3HA 1O2SA 1Q3XA 4NSYA 5EODA 1QL9A 1ZPCA 2RA0A 1HNEE 1PQ7A 3KQCA 1YCPK 2UUJB 3Q00A 4IC6A 3KN2A 1A0LA 1L2EA 4MPVA 4A92A 1O3KA 1Y5UT 3PM3A 3FP6E 3U8OH 3Q77A 3UWJH 1O2GH 1CHOF 1QL7A 4JZDH 2Z9IA 4K1SA 1NFXA 1L1NA 1QURH 1O3EA 3CP7A 3OTJE 4CBOA 1HDTH 1HV7A 3UFAA 2ZU3A 1S83A 4ZKNU 3IWMA 2BDHA 2HPQH 3Q3KA 1VITG 5FX6A 2H6MA 3ZZ5A 1O2NA 4B74A 1TQ7B 1SB1H 3TIUA 5F8ZA 1PPZA 4ABFA 3FP7E 2ZCKP 4I8HA 1TNIA 5DGJA 2FOAA 3ZZ9A 4Q2KA 4IS5A 3CS7A 5TCAA 3SUEA 1AUTC 1O3FA 1SGPE 3LGYA 2ZHDA 3SJ8A 2ZDMA 2LPRA 1TGSZ 1V2LT 2BDBA 1LVOA 3VB6A 1JOUB 1SOZA 2XWBI 1A7SA 3EA9A 2H9TH 2FS9A 2XCFA 2R9PA 1V2WT 3IITA 5A0BA 1V2TT 1ABIH 1W10U 5K7RA 2QV1A 3DHKH 3HKJB 1K1MA 4OGYA 1LMWB 5L6NH 1NC6A 3SGBE 5EGMA 2G4UA 4WMFA 3GCHC 1ELVA 2A4QA 5K0HA 3VB5A 1TALA 4JK5A 3M61U 3DD2H 4X1NU 1O33A 1NN6A 4Z6AH 2BY8X 1K22H 2A4GA 1S5SA 1CA0C 1MCVA 2BD4A 3EBNA 1GHAG 2FDAA 1GDQA 4BOHA 2GZ8A 3KNXA 3AW0A 4CRGA 1GL1A 4YOIA 1PPBH 4IN1A 1O2ZA 3GY3A 1DITH 1DWCH 3A8CA 1WCZA 3MYWA 4FUGA 1DWBH 3ZZ8A 3MOCA 1GHBF 3HK6B 2OQUA 1SQTA 3TJUA 2CHAC 2BDGA 1P9SA 3LGWA 1C5SA 1DXPA 1UVTH 5C1UA 3R0FA 2GVFA 1P2OA 2STAE 1YCPH 2BXTH 2ZHQH 3ATKA 2C8YB 4MG3A 1QFKH 2PSXA 4IMQA 1BHXB 5JBAS 4E05H 3GICB 3M7TA 4X1QU 3MO9A 2BD5A 5T6FA 2C93B 2RA3A 1Y3WA 3ENSB 1A3EH 3TK6A 1EJMA 2V3HH 1Z8IB 1HAXB 1BQYA 1CO7E 1GGDB 4FUFA 1ZHRA 1QBVH 5LPEA 5JB8S 1RFNA 3W95A 3MNBA 4WJG2 2GTBA 1NT1A 1SMFE 3M35A 4XFQA 4NIWA 2ZTYA 1BMNH 1G3EA 3V12A 4KKDA 3MO3A 1QB9A 1GG6B 1CSOE 5C20A 5EQRA 1BTHH 2SNVA 4A1VA 5I25A 1XUKA 4NGAH 1TRMA 2ZCLP 4K69A 1EOLA 4JZEH 2FOGA 2BDCA 1G36A 3UY9A 4ISHH 4YT7H 1HXEH 1ZJDA 1GJCB 2KAIB 2VINA 1FPHH 1ESAA 2JH6D 2JH0D 2XC4A 3PMAB 1BRUP 2BDIA 5TCCA 1C4V2 1GHYH 1TPOA 2ZGXH 3GOVB 3M36A 1MBMA 2DE9A 3G01A 3SV2H 1LVMA 3GCOA 1O5BB 4INLA 2BY7X 2JETB 1QNJA 3E90B 6CHAC 1DFPA 1OS8A 3RLYH 2P8OB 4CHAB 1LO6A 1UVOA 1A2CH 2QN5T 3T26A 4DCDA 4ZHMU 2HLCA 2SGQE 5GXPA 2UUFB 2ZWLH 2ZGJA 1V2KT 3ZV8A 2NU0E 1VR1H 1EZUC 5A09A 2Y7XA 4JYUH 1LPKB 1QA0A 2TBSA 1ELEE 1GCDA 3SU3A 3L6PA 1MKWH 3RXDA 1C2IA 1TBZH 1FJSA 1O0DH 3RXOA 2IN2A 2A5KA 1TNKA 2HNTE 2ASUB 1B5GH 4JK6A 1GMCG 2HNTF 1AWFH 3UREA 1AZ8A 1FN6A 4CRDA 1C5QA 5AFZH 4CRFA 4AN7A 3TH3H 1PPCE 3RXLA 1V6DA 2R0KA 1QGFA 1E35B 2J95A 1H1BA 1ZSKA 2BY5X 3SV8A 1VGCC 3TH4H 4HZHA 4X6OA 4JMYA 2PR3A 3TJNA 2UWPA 4IW4E 3STIA 3M7QA 2ZGCA 3A88A 1LQDB 2A5IA 1UK4A 4MDSA 2ANYA 2OTVA 1UTMA 1SLVB 3SN8A 1X7AC 3BEFB 2A1DB 2J92A 4XBBA 4ZXYH 2AMDA 1FIZA 3VXEH 2DUCA 2ZHEH 3LGIA 1XXDA 2Z3DA 3RC5A 3SU5A 1SHHB 1QL8A 3JZ1B 2A7CA 2BDYA 2P16A 1AVGH 1A5IA 2J2UA 5IYTA 2WUCA 4CREA 4INHA 2GT8A 1WUNH 1WQSA 4I31A 1DWEH 3A87A 4MQAA 1SGIB 3A7XA 1A0HB 1KLJH 1P03A 1Y5AT 4NA7A 4FVBA 4ZXXH 4BAHB 4Y8XA 2FM2A 1CT4E 2GT7A 2P94A 1MTNC 1CHOG 2FXRA 2ZFSA 2FS8A 1NROH 4WH8A 5EW2H 4MVNA 2Y5FA 4MLFB 3LPRA 3K2UA 4HFPB 5E0GA 3HK3B 1SSXA 3SJKA 1CGJE 4Y8ZA 5HXFA 2B7DH 4NWKA 3PO1B 1CT0E 1WU1A 4LK4A 4O03A 4UFDH 3S7KB 2ZQ1A 1TRYA 3A83A 4ZHAA 3TVJB 3S7HB 1U6QA 2FPZA 2HVXA 4FUEA 1N6YA 4NZLA 1C9PA 3MWIU 1JRTA 3MU0A 1VITF 3GDVA 4I7YH 1SOTA 3PLPA 4J1YA 1WAYB 1WYKA 1T8OA 1RXPA 2Y81A 3SV6A 5ESTE 8GCHF 1SGYE 1P2NA 1O30A 1T31A 1YLCA 3KGPA 1W11U 1GI0A 1O5GH 1GHZA 2OBOA 2D2DA 4WMEA 1Y5BT 1YPLH 3LJJA 3EQ0H 5A0AE 2ZDLA 2TGTA 3S9CA 1O3LA 2FX6A 1ZOMA 4E7NA 1PQ8A 5L2ZH 5HMAA 1Z8GA 3SI4H 4X8SH 1FQ3A 1ZMNA 2QYIA 1FY5A 3RDZA 2ZP0H 1PYTD 5FBIA 1B0EA 1BTYA 4O9VA 5ESBA 1VCPA 2GCTC 4BAQB 3PMJA 5L2YH 2H1UA 2BM2A 2Y80A 1FUJA 1D3DB 1W12U 2ZIQH 3BTWE 2GCHF 1PPHE 1C2DA 1C2KA 1BMLA 3SU4A 2BZ6H 2VNTA 1KXBA 5I46H 2VU8E 2A4RA 1W2KH 2R2WU 4I32A 1F92A 1O5FH 4X0WU 1GHAF 2VWLA 2ZFRH 1P09A 3DUXH 2TGDA 4RKOB 1ARBA 4CH8B 1SLXB 2I6SA 3Q3YA 1P2JA 3P8FA 1AB9B 1N1LA 1T8MA 2ULLA 3RC6A 3LH3A 3ZZBA 2ZPQA 1BITA 5EPNA 2WYJA 1O3DA 4ZMAH 4ZUHA 3TNTA 3HGNA 1O37A 1F2SE 3NKKA 4OS6A 4ISLA 3RXCA 2PKAA 2FOFA 1SGTA 1XUJA 1SGCA 1D9IA 1GHWH 5EQQA 1CQQA 1SGRE 2FZZA 2ZZUH 5EQSA 3VB3A 1C1TA 1SLWB 1HLTH 1O3PB 3TJVA 1MAXA 2A2XH 2SGEE 1ZTKA 2VWMA 1SGEE 1OYQA 2BX4A 1EPTB 2GMTB 2FYRA 2AGEX 3T27A 5DKMA 3FAOA 1W0ZU 3JZ2B 1NY22 1O35A 1GMHG 3QZRA 3GY5A 2Y6TA 2OC8A 1GJ7B 3GY8A 4U01A 4CH2B 1KY9A 3AAVA 1FDPA 1OPHB 3OSYA 4IC5A 3A7ZA 4Y76A 3NXPA 3K65B 1FY8E 1ELCA 2ZG0H 3RXPA 1SGFA 2Y82A 2BY9X 4WXIA 3SW2B 4HI3A 4DURA 5DP8A 1O3AA 4INKA 1XUIA 2QA9E 1ZSJA 3T29A 2ZFPH 3SUDA 7LPRA 1K1IA 2ALVA 1W13U 1Y59T 2G4TA 5EU8A 1GI4A 4X8TH 1K21H 1EOJA 1QJ7B 5FXLA 5DP3A 3I78A 1GBDA 2P3UB 2J38A 1NO9H 2FMJA 4AX9H 4D9RA 1GJAB 1WTHD 1C5RA 4A5TS 1XVMA 3PLBA 4BAKB 1RS0A 3P8OA 1W0YH 3L3TA 1O36A 1GBKA 1XUFA 3LJOA 1GCTB 1KXAA 3K6ZA 4Y6DA 5FPTA 4TY6A 1D6RA 1LHDH 2BHGA 1BJUA 1A5GH 3SHAH 2SGPE 3BTTE 1S6HA 1YYY1 4AYVB 2XNIA 4B2CA 3ZZDA 2FOMB 3QTVH 1FZZA 2TPIZ 4Y79A 2UUYA 1EX3A 2VGCC 1ELFA 4YOGA 4I8LA 1G3DA 3HATH 2Y5GA 1RD3B 5FCRA 1SGQE 3MH6A 1RIWB 4ABIA 1C2MA 3A81A 5T6GA 3EGKH 1GMCF 2PTNA 3S0NA 1NFWA 4BAMB 4OGXA 2FOCA 5DO4H 1C1RA 1J15A 1AFEH 4JZ1A 1AKSB 1L1GA 3ZZ3A 3GDSA 1C1OA 3SNAA 1NM6A 1PPFE 3W94A 2BTCE 1NRRH 3SBKA 4AORA 3V13A 3RXBA 1GMDF 3FP8E 3BTKE 4Y0YE 1CT2E 3O8DA 5AVDA 1QQUA 3S9BA 1IQEA 1MKXH 2HALA 1LVBA 4Y8YA 2G52A 2ZDVH 3AASA 2WUBA 1P3EA 1O5EH 2BOHB 1WSSH 1P12E 9ESTA 4BXSA 1TX6A 1AZZA 3UUZA 3LKWA 3RM2H 3S9AA 4Y7AA 1O2KA 5H4IB 1OP0A 3PWBA 1H9LB 2XBVA 4Q7XA 3P95A 4NIXA 3B23B 2ZPSA 1C1SA 1DSTA 1PQ5A 1DOJA 1SQAA 2BQ6B 5JYIA 1K2I1 1TOMH 2J9NA 2M5TA 5HM9A 1C5ZB 1Z1IA 2P59A 1W7XH 3O8BA 2ZU4A 1F0TA 1P2MA 4XBCA 1D3PB 1O2RA 3VGCB 1C1NA 3PYHA 1UHBA 1E37B 1DLKB 2IPHA 2Q1JA 1WTGH 4K2YA 3LGUA 3LONA 3LGTA 5E2PA 1ZRBA 2F83A 1MZAA 4Q7YA 8GCHG 1RRKA 3H7TA 3I77A 2ILNA 3RXVA 3FANA 3BG4C 4I8KA 5IDKA 1C5TA 4B71A 1AE8H 2B0FA 4B73A 3QX5H 4UE7H 5CE1A 2G8TA 5E2OA 1DDJA 4FUIA 1KDQA 4X1RU 2QC2A 1S0RA 1UVSH 2ODPA 4D7FA 5LPFA 1J8AA 2SFAA 3MI4A 1BRBE 6GCHF 1GI6A 2FOHA 2WV5A 1GWAA 1YPGH 2JH5D 2RG3A 2GCHG 2BLQA 4RSPA 2BZAA 2A2QH 5EXMA 2PKSC 5JBCS 2ANKH 1TE0A 4X6PA 3RMOH 1TNLA 2VIVA 2RDLA 3M3VA 1LCYA 3DA9B 3EA8A 4D9QA 2ZU2A 4X8UH 5F03A 4NCYA 3TH2H 2VIOA 3VXFH 2FLRH 8KME2 4O3UA 2BD3A 2OQ5A 3A8AA 1ARCA 5EW1H 1GGDC 2TRMA 1S0QA 3RXGA 1C5LH 2O8WA 2VH6A 3SZNA 2AMPA 2J4IA 4KGAA 1F5RA 1QCPA 1YM0A 1GBAA 1OP2A 1V2ST 2C8ZB 1MCTA 4H6SB 2SGDE 1EP6A 1LKAA 1SFQB 5C1XA 1ANBA 3T62A 1V2OT 2VIQA 1FAKH 1UK3A 1IOEA 1DLEA 1GJ5H 4NFEA 1G3CA 1A0JA 4XDEA 2BOKA 3RXJA 2ANWA 1C5YB 4B2AA 3UNRA 2VIPA 1FMGA 1HAVA 1Z8RA 3TGJE 1EB2A 1AD8H 4E06H 4I8JA 1E34B 1JXPA 3SNDA 1NU9A 3GCHB 2A0QB 4UFGH 2FX4A 1TRNA 2EC9H 4I8GA 1PYTC 2ZFQH 1TB6H 1TPSA 1RTFB 2P93A 2ZDNA 1J14A 2AEIH 1ZJKA 4RN6A 1CA0B 2CXVA 1P57B 3ELAH 1EB1H 2ZI2H 1PFXC 2PGQB 2JETC 1N8OB 2TIOA 3KL6A 2PGBB 4IBLH 4FUHA 1GMHF 3ZVAA 4ABHA 2PWXA 5GWZA 1UTKA 1Z1JA 1EAIA 3F9HA 1BUIA 4CHAC 3ZVBA 5HYOA 1M9UA 1EAXA 3PTNA 4FUCA 2Z3CA 2F91A 2W7SA 2CHAB 3DT0H 4ABDA 3NPSA 3RXTA 4NFFA 1ELGA 3BTQE 3UNQA 8LPRA 3M5OA 4NSVA 1DE7H 1OWHA 4JCNA 4B2BA 4Y10E 2QCYA 1VZQH 3RXEA 1O3BA 1TBRH 1UCYK 1FONA 2A7JA 4R8TB 1IHSH 3LT3A 5JDUB 5DP6A 3A89A 1BOQA 4ABGA 3D65E 4YM9A 2FOEA 1C1MA 4OS2A 1WBGB 1KXDA 3OYPA 1OWEA 3Q76A 3ZV9A 1GI9B 1MBQA 3AVZA 2VVUA 4TWWA 5JB9S 2QF0A 3MU1A 1HAZB 3BTME 4FUDA 3UIRA 2K7XA 3F9FA 1XXFA 2A4OA 1MAYA 1GJDB 5FCKA 1UJ1A 1UMAH 3ZVEA 1AVXA 1JRSA 5FAHA 2Z94A 4Y7BA 1AFQB 1GBFA 1V2JT 2BLOA 1A61H 5SGAE 4YLUA 4B75A 4M7GA 3RM0H 4X2YA 4FU7A 1JIMA 2J34A 2QXJA 4CRCA 3RXMA 1GI5A 5E0HA 2WPLS 5DPAA 1T32A 1QQ4A 1XKBC 1AUJA 2FESH 4O97A 2Y5HA 3SORA 1BTWA 2NU4E 4WMDA 4DG4A 2B5TB 1DT2A 3LU9B 3KCGH 4FXGH 5DP7A 3RXHA 4UDWH 4GCHF 1QRWA 1ELAA 5J4SA 1GI1A 1SHYA 1TOCB 1FY4A 5L30H 1UO6A 2ZECA 1QJ1B 1C1WH 3E6PH 4QT8C 1GMDG 3ZZAA 4A6LA 2AIQA 1P04A 1ELTA 4DIHH 1CA8B 1Z71A 3QN7A 1QA7A 2O8UA 4WXVA 1MTSA 2GX4A 1HAYB 1D4PB 4BAOB 3UQOA 1LHCH 2W26A 3SNEA 3SU2A 5AFYH 2GV7A 1GJ4H 3RP2A 4GUXA 5DP9A 1SL3A 3PO1C 3EAJA 3ODDA 4IN2A 1SG8B 2CF8H 3BTHE 3RXIA 1ZR0A 1GVLA 3SUGA 4D76A 4X2XA 1K1JA 1HFDA 2ZHWH 4LZ1H 3TK5A 1NRSH 1GVZA 4ABJA 5GJ4B 4YZUA 1MU6B 4ESTE 3KHVA 1IQJA 3SNCA 5CHAB 1C1VH 4KP0A 2BD8A 2VWOA 1RJXB 1YGCH 4U2WA 2A7HA 4FUBA 5DG6A 2C4FH 4ZKOU 2VVVA 1TX8A 4TY7A 2H9HA 4BNRA 5T6DA 4ABEA 3NUMA 3UNSA 1W8BH 1V2UT 1YF4A 3BN9A 2ZKSA 1AY6H 1C9TA 1C1PA
chains in the Genus database with same CATH superfamily
4BXWA 4NA9H 3SYJA 1SC8U 4K1EA 2ZDKA 1ANDA 1QRZA 1IQGA 4A7IB 7KMEH 1EZSC 4FU9A 4K1TA 2UUKB 1AHTH 3BIUH 1HJAB 1H4WA 1S84A 4BANB 1DUAA 2WYGA 1CBWB 1E0FD 1BTXA 1GJ9B 2F9BH 2Z9KA 2GDEH 4ZROA 1EJNA 3LGVA 2GJGA 4DGJA 6GCHG 1HAPH 2KR7A 3VB7A 3DFLA 2D8WA 4A1XA 1H8HD 2HOBA 4CR5A 5DP5A 4XD7D 1H8ED 1BBRK 2F9PA 4TSFD 4ZH8A 2ZCHP 4CBNA 1DXWA 1NFUA 1O2YA 3DSPA 4AYYB 1ORFA 1TX7A 1O2JA 2F9UA 1ZZZA 1TNHA 2RFKC 1HJ9A 2Y7ZA 1TBQH 2O8MA 4X1SU 1T4UH 2FLBH 2V3OH 3GCTF 4DJZB 1F0UA 1GDNA 2BYAX 4R0IA 3MTYA 3EDXB 1HAHH 1Y3YA 4HTCH 1AB9C 1TIOA 3V3MA 1ANEA 1K9OE 3SUFA 2V0BA 2A32A 1KLTA 1UK2A 4ISNA 4F4OC 5F8TA 3CENA 1NU7B 3UQVA 1ETTH 1TA2A 2R0LA 1D3TB 3VPKA 2H5CA 1Y8TA 4ZKSU 4IGDA 3KEEA 5EJLA 2ZC9H 1TGTA 4KTSA 1O39A 3TK9A 1P8VC 5JPMH 2BQWB 2BVXH 1KTSB 1O38A 1UTLM 3MH5A 1TPPA 2GMTC 3UTUH 3C1KA 2XC5A 3U8RH 3ZZCA 3SQEE 2VVCA 3E8LA 3ZYDA 3P92A 1ZLRA 3RU4E 1L4DA 5C5OA 2F3CE 2AMQA 2ZNKH 3GY4A 1ID5H 1OWIA 1C5VA 2P3TB 2VIWA 3QUMP 1P3CA 1TYNA 1NS3A 4CRBA 4MPUA 1FI8A 1GBJA 2ZA5A 1BJVA 5C94A 1UW7A 3UPEA 1K1NA 1MQ6A 3K9XB 1SI5H 2C8XB 3B9FH 2QGRA 1HUTH 1P2IA 3F3BA 1J16A 2KM0A 3VFEA 2Q6GA 1GBHA 1LKBA 1V3XA 2LNCA 1O2VA 1PJPA 1AVWA 1BIOA 3A84A 1OXGA 2QY0B 4NWLA 1QR3E 2THFB 4AB9A 2HGTH 5C0UA 3OU0A 5FHTA 1O2TA 1EATA 2XBXA 3SNBA 1TMBH 3QGJA 1O31A 1BMMH 2BVSH 2CV3A 1XX9A 1C2JA 1ESBA 1C2GA 2ZDAH 4YOJA 1K0HA 1DICA 5A0CA 1IQMA 2HNTC 1P06A 1O2IA 2FIRH 4GLYA 2FYQA 2ALPA 2W3IA 2P3FH 1RTKA 2AH4X 1V2RT 1XUGA 2AERH 2YOLA 1O3IA 1GCTC 1NBME 4X2VA 3BG8A 1L4ZA 3URDA 3ZZ7A 3EYDA 2IJOB 3GYLB 4Z0KA 3TLOA 1C4Y2 1BB0B 3GCNA 1THRH 2GKVE 1EP5A 1QY6A 3EE0B 1A5HA 2BY6X 1G2MA 3QK1A 3TNSA 2OC0A 2Z6BD 3TGIE 1KIGH 2BD9A 4P00A 3UR9A 5DSFA 1LQEA 1SGDE 4AGJA 3TITA 2WV9A 2CF9H 3KQBA 4NA8A 1AMHA 2KZ4A 1O3OA 2OC1A 1N6XA 1UVUH 3PV4A 1IQNA 1NRQH 1HIAA 4Y11E 1GPZA 1KSNA 4UEHH 3TGKE 4ABBA 4XBDA 3FZDA 3DSOA 1CVWH 3OFND 2XTTB 3PMHB 2XCNA 4JZFH 1G32B 2PUQH 1H9IE 1V2PT 2OXSA 2JIZD 1E79D 1FXYA 2BD7A 2WPHS 2ZU5A 2D26C 2PKAB 5J4QA 4RKJB 4SGAE 1HRTH 2GGVB 3P8GA 1ZRKA 1WXRA 2QXHA 2TGPZ 1AO5A 3QTOH 3E91A 3F68H 5EJ1A 5HM2A 1NTPA 1LHEH 4XE4A 5BPEA 5G4BA 4RT0A 1O2OA 3NZIA 5ABWA 1IQLA 1Z6JH 2QAAA 1C5OH 4GCHG 3A7WA 1GI3A 4CRAA 3N7DA 1TWXB 4ISOA 1YLDA 5JBBS 2BDAA 2WPJS 4YO9A 1TGCA 3ITIA 3Q3XA 2WPKS 4MNYA 1J17T 1TLDA 3VEQB 1D3QB 2L6OA 3PMBB 2I6QA 2OINA 3STJA 1DPOA 1EJAA 4X8VH 1BA8B 5ETXA 3GDUA 3BV9B 2W3KA 1C1UH 1ZTJA 3GISB 2XWAA 4KELA 1ZGVA 3A8BA 2BXUH 3T5FH 3M5MA 3O8CA 4B76A 1QB6A 4WF8A 1C4U2 1G9IE 1XUHA 3MMGA 2K8IA 1DX5M 3VGCC 3H5CB 1TGNA 2ZTXA 2H5DA 5EOKA 2H2ZA 2K1QA 4NIVA 2BLWA 1A1RA 1OKXA 1OSSA 2Q6DA 1PPGE 1SGFG 2VGCB 2GZ9A 4VGCB 4DW2U 5FBEA 3CS0A 1TMUH 3RMLH 1MU8B 5AHGH 5FPSA 4ZKRU 1JIRA 1AE5A 1EZXC 5T1VA 3UOPA 3QZQA 4YT6H 3MU4A 5TJXA 2EEKA 3RLWH 3F9GA 3I29A 3ESTA 2V6NA 3F9EA 5GDSH 3M3TA 4K8BA 2CJIA 3LH1A 5HGGA 1ELBA 1ZHPA 1KXEA 1O2PA 4AG1A 2UWLA 4IMZA 3SQHE 4NG9H 2FI4E 1KXCA 3OY5U 1HAIH 2AYWA 3SU1A 1P02A 1RTLA 3BIVH 1G30B 1QB1A 2GP9B 3F1SB 2J5UA 1MMJN 2STBE 2WV4A 1YP9A 1F5KU 4H6TA 4YESB 3QGNB 1O2QA 3RXAA 2EA3A 3M5NA 1ANCA 1RGQA 2R3UA 3RXQA 3BEIB 4DT7B 3B8JA 3BTDE 1EXFA 1QHRB 1TA6A 2C8WB 4GPGA 3PV5A 1SQOA 2FP7B 5GCHG 1K1OA 4MPWA 1O3MA 2W7UA 1VCQA 3WWBA 3MFJA 3W1EA 1KYNA 1GJBB 2IOTA 2NU2E 1BT7A 5C17A 3GCTG 3U69H 1DSUA 2KCOA 3MNSA 5C1YA 1Y3VA 1YPHC 1O32A 2DE8A 3ZZ6A 1W3CA 2B9LA 1HCGA 4K60A 2OD3B 3FVFB 1GBBA 4NIYA 2G51A 2YMSC 1TQ0B 2WHXA 1NESE 2F4LA 1AGJA 1HPGA 1O2UA 3KQEA 1XM1A 5FX5A 1HAGE 1YPKH 4WVPE 1YY3A 2NU1E 2VB0A 2XYAA 1ZHMA 1P9UA 4WWYA 2XC0A 1MQ5A 1A4WH 4P02A 3PLKA 3ZVDA 1EAWA 2FI5E 1YKTA 1ABJH 3GS9A 1MABB 1C2HA 2R3YA 1E36B 2ANMH 2C3SA 4Q7ZA 1Z6EA 2G55A 1IQFA 5A8XA 2FODA 4TPYA 2GZ7A 1H9HE 1SBWA 2GD4B 3BG4B 2ZFTA 1GBCA 5EXNA 1UVPA 2KAIA 1CU1A 3T2NA 6ESTA 1GBIA 1F7ZA 4O3TA 2A31A 2EI8A 1T8NA 2ESTE 2J94A 5DP4A 1UHBB 3FZZA 1N8OC 1Z7KA 1GG6C 5A2MH 2AIPA 3BSQA 5BRRE 2CGAA 2FWWA 1W7GH 1MKWK 2O9QA 3E0NB 1HYLA 5F6MA 4GSOA 3UB0A 3QDZB 1FY3A 3GYMA 8ESTE 3PRBA 1ELDE 4XSKU 1YLNA 2OC7A 2PKSB 1K1PA 1HJ8A 2FTMA 3U1JB 3WY8A 1BDAA 1NRNH 3SO3A 1SQRA 1H8IH 2CN0H 2SGAA 4TYDA 4AB8A 5EG4A 1P0SH 1KDQB 1NPMA 2BD2A 4MNXA 5E8EH 3RUOA 1BMFD 1JWTA 1MZDA 3NK8A 1SLUB 1XMNB 2GV6A 2WPDD 2EI7A 4AZ2B 2OCVB 5DK1A 1ZPZA 1QBNA 2P8OC 1PPEE 2Z3EA 1EZQA 3U1IB 3RMNH 1GVKB 3LIWA 3PTBA 1O34A 2J97A 4H42U 1GJ8B 3RC4A 4OS4A 3V0XA 3A86A 4ZAEA 2Z9GA 4D7GA 3KQDA 1AFQC 7GCHF 4ZHLU 3U9AH 1UTNA 4H4FA 4B1TA 4XOJA 2EI6A 1BTZA 2LELA 3LOXA 5F8XA 3RXKA 1C2EA 2ZHFH 3P70B 4KTUA 3KIDU 3ODFA 1EUFA 1OOKB 3UWIA 1AU8A 1O2WA 3R3GB 4GVUA 5FL7D 3ZVCA 2FOBA 4ABAA 4Y71A 3H09A 2W5EA 1SPJA 2QF3A 2SGFE 3A82A 2Z9JA 2QXGA 1F0RA 2V7QD 1DWDH 3D62A 4E7RG 3ATIA 3D49H 3FFGA 1O3CA 4Q80A 3MNXA 4AFQA 1FV9A 1C5WB 1MD7A 1MD8A 1KXFA 3MU5A 3SV7A 1ZTLA 3ATLA 1AWHB 3BTEE 1V2NT 3P8NA 3UOUA 2ODYB 1HAVB 1HXFH 3DFJA 1HB0B 1DS2E 2PUXB 1OHHD 2BB4A 4TPIZ 1H8DH 4K3JA 4FVDA 3BEUA 3A7VA 4XRNA 5C67A 1FX0B 5CDFE 1DVAH 2OBQA 4AFUA 6LPRA 2PV9B 3M7UA 3E16B 4YTAA 3M37A 3OX7U 3BTGE 1GBTA 1AQ7A 1KTTB 5C5NA 3MU8A 3ATMA 1GHVH 1Y3UA 1J9CH 2QE7D 4OS1A 1S6FA 4MTBA 4UFFH 1OWDA 6CHAB 1QIXB 3RXSA 1KMHB 1XVOA 1Z8JB 4K5ZA 2G00A 2TGAA 1C5NH 1L1JA 1V2QT 2FO9A 4AFZA 5CHAC 1GI8B 1E38B 1HBTH 3WWFA 3ZZ4A 3URCA 2LP6A 1SVPA 5LPRA 3HGPA 1BCUH 3RXRA 1OYTH 2HPPH 3RU4D 1V2VT 3P17H 2FI3E 1C5PA 3E0PB 3F2GA 2Z9LA 1FLEE 1AN1E 5LGOA 3U98H 3M3SA 1O2LA 3ZVFA 1MUEB 1DY9A 2F9NA 2XW9A 1VJAU 1A46H 4A1TA 1TNGA 2VWNA 3N7OA 1O3NA 1LPZB 2G5VA 1UCYE 2NWNA 3MNCA 1G3BA 3QO6A 2Q6FA 2YMSD 2XNDD 3IG6B 1Q31A 4DVAU 1DANH 3A85A 1HJAC 5E0JA 2AFQB 1Q2WA 3ZYEA 1CBWC 3PV2A 5A8ZA 1ZMJA 4D8NA 4FUJA 4F55A 1IHTH 3A7TA 1VGCB 1UCYH 3H7OA 4GHTA 1YPMH 3MHWU 2Z7FE 1FN8A 2J98A 3E3TA 3TPIZ 3EA7A 3ATWA 1P05A 2BMGB 1SR5C 1OWJA 2QF5A 4PROA 1IQKA 1PQAA 4F49A 1EAUA 5EXLA 2JKHA 4I33A 2VJ1A 3BTFE 4F48B 2A5AA 1TMTH 4BTUB 1TAWA 3A80A 3RXFA 4JZIA 3GY6A 1QRXA 3SV9A 2FTLE 2CMYA 1BTUA 1MTUA 3RMMH 1THSH 4DOQA 1P2KA 4X6NA 2HRVA 2G5NA 1MTNB 4FU8A 1T4VH 3T25A 5GCHF 1TPAE 1BMAA 4OS7A 3QWCH 3TJOA 4Q4LA 1IQIA 1F0SA 2ZGHA 1BZXE 2XBWA 5B6OA 1BRAA 2ZU1A 1V2MT 2ODQA 1CGHA 2OLGA 1ACBE 1T7CA 2XRCA 1EPTA 1VITH 1QZ8A 3AAUA 3SJIA 4UONA 2B8OH 2SNWA 3K6YA 2JJ2D 3SHCH 4MNWA 4U32A 1ZYOA 4AGKA 1K1LA 3P6ZB 3SU0A 3O8RA 1O2XA 5PTPA 2ZTZA 3E1XB 3MO6A 5A8YA 3LDXH 1XKAC 2AS9A 1P01A 1B7XB 1TNJA 3ZVGA 1UTPA 1GBLA 1C5UA 3F0PA 1OP8A 1WQVH 4GHQA 1FAXA 1S81A 4THNH 1EPTC 3MH7A 1LPGB 5GIBA 2H9EH 2P95A 3PB1E 1QTFA 2YNAA 3RU4T 3MH4A 1CGIE 4MNVA 4X2WA 1GDUA 2UWOA 2V35A 5FPYA 4LXBH 1DM4B 2G81E 2A45B 3A8DA 1FPCH 1GHBG 3VG8A 2F43B 3AW1A 1E1QD 3C27B 1LHGH 1JMOH 4GAWA 3V7TA 1AIXH 1LDTT 4UD9H 2NU3E 4LZ4B 1ESTA 2VIDA 1L0ZA 3KYFA 4TWYA 1THPB 5CMXH 2PTCE 2BVRH 3SGQE 5KECA 1O2MA 2GCTB 2XXLA 3SGAE 1TONA 1BRCE 2LIZA 4KTCA 2OP9A 1IQHA 1MTWA 3VB4A 3OEED 1OX1A 3GY2A 1C5XB 2HWLB 1K28D 1Y3XA 1MTVA 2QF4A 3QLPH 1W14U 1YPEH 1YPHE 4X6MA 5F53A 4K8YA 1BBRE 1DUEA 2ZQ2A 2QXIA 4Q63A 5IK2D 3L33A 2ZPRA 3U8TH 7GCHG 1VCWA 1C2LA 1CHGA 1GI7B 1MKXK 1QBOA 2PW8H 4BTIB 1GBEA 1C1QA 1P2QA 1BHXF 1UTJA 3NWUA 1ZGIA 3MQKC 1BBRH 4CR9A 1AKSA 5C3NA 2GDDA 1MH0A 1O2HA 4J2YB 1AI8H 3SI3H 2VH0A 1ZPBA 9LPRA 4WH6A 1P10A 1G37A 1T8LA 4Y0ZE 2IPQX 4SGBE 3BF6H 1YCPM 1FNIA 2AGGX 1UTQA 1RIWC 1GI2A 2C90B 1LHFH 4NZQA 2WINI 1S85A 1ZSLA 2XBYA 1O5AB 1WOFA 2KX4A 4ISIH 4YLQH 2QIQA 1JBUH 2WPIS 2AGIX 1EQ9A 3D23A 2ZFFH 1O3HA 3SU6A 5JBTA 1GL0E 2D1JA 1OWKA 4ASHA 1GJ6A 2R2MB 2BX3A 4UFEH 3SOSA 1YWUA 2RCEA 3HPTB 1WV7H 2KFWA 4JYTA 1C2FA 4LOYH 4AOQA 1EKBB 1YPJH 4OS5A 1YC0A 3T28A 3LC3A 2PHBA 2O8TA 2F9VA 3UAIC 3M5LA 2PLXA 1TFXA 1CE5A 1QJ6B 3NCLA 3UR6A 3TU7H 1O5CB 3SJ9A 1DY8A 2PFEA 3RXUA 1B0FA 4U30A 1INCA 1ETSH 2WPMS 3OY6U 3F2FA 5LH8A 1NFYA 4VGCC 4HGCA 3A7YA 1C5MD 1ZMLA 2BQ7B 1D6WA 1BTPA 1NRPH 2OUAA 1FY1A 3N99A 3S69A 1FIWA 7ESTE 5DJ7A 2YNBA 1TGBA 1IAUA 4X1PU 1VJ9U 1GBMA 1EASA 1P11E 1O3JA 1HGTH 1SGNE 1S82A 3KF2A 1HAOH 5AF9H 1LVYA 3SJOA 3LC5A 1LTOA 2PSYA 2FEQH 4AFSA 4AG2A 4BTTB 5C2ZA 2O8LA 2F9OA 1S6LA 3PROA 3HKIB 1UTOA 1TABE 1O3GA 2ZGBH 3PWCA 1KLIH 1HIAB 2ZEBA 3GY7A 4MPXA 4WY3A 1O5DH 3KQ5A 5GPIB 4JYVH 4DY7B 5EPYA 2BLVA 1A3BH 4DIIH 2ZO3H 1GHXH 1YBWA 1G2LA 1NZQH 1F5LA 1SFIA 1ETRH 2ZF0H 3F6UH 5T3HA 4DT4A 3CNRA 1O2SA 1Q3XA 4NSYA 5EODA 1QL9A 1ZPCA 2RA0A 1HNEE 1PQ7A 3KQCA 1YCPK 2UUJB 3Q00A 4IC6A 3OTPA 3KN2A 1A0LA 1L2EA 3NRLA 4MPVA 4A92A 1O3KA 1Y5UT 3PM3A 3FP6E 4FETA 3U8OH 3Q77A 3UWJH 1O2GH 1CHOF 1QL7A 4JZDH 2Z9IA 4K1SA 1NFXA 1L1NA 1QURH 1O3EA 3CP7A 3OTJE 4CBOA 1HDTH 1HV7A 3UFAA 2ZU3A 1S83A 4ZKNU 3IWMA 2BDHA 2HPQH 3Q3KA 2WSSD 1VITG 5FX6A 2H6MA 3ZZ5A 1O2NA 4B74A 1TQ7B 1SB1H 3TIUA 5F8ZA 1PPZA 4ABFA 3FP7E 2ZCKP 4I8HA 1TNIA 5DGJA 2FOAA 3ZZ9A 4Q2KA 4IS5A 3CS7A 5TCAA 3SUEA 1AUTC 1O3FA 1SGPE 3LGYA 2ZHDA 3SJ8A 2ZDMA 2LPRA 1TGSZ 1V2LT 2BDBA 1LVOA 3VB6A 1JOUB 1SOZA 2XWBI 1A7SA 3EA9A 2H9TH 2FS9A 2XCFA 2R9PA 1V2WT 3IITA 5A0BA 1V2TT 1ABIH 1W10U 5K7RA 2QV1A 3DHKH 3HKJB 1K1MA 4OGYA 1LMWB 5L6NH 1NC6A 3SGBE 5EGMA 2G4UA 4WMFA 3GCHC 1ELVA 2A4QA 5K0HA 3VB5A 1TALA 4JK5A 3M61U 3DD2H 4X1NU 1O33A 1NN6A 2W6ID 4Z6AH 2BY8X 1K22H 2A4GA 1S5SA 1CA0C 1MCVA 2BD4A 3EBNA 1GHAG 2FDAA 1GDQA 4BOHA 2GZ8A 3KNXA 3AW0A 4CRGA 1GL1A 4YOIA 1PPBH 4IN1A 1O2ZA 3GY3A 1DITH 1DWCH 3A8CA 1WCZA 3MYWA 4FUGA 1DWBH 3ZZ8A 3MOCA 1GHBF 3HK6B 2OQUA 1SQTA 3TJUA 2BDGA 2CHAC 1P9SA 3LGWA 1C5SA 1DXPA 1UVTH 5C1UA 3R0FA 2GVFA 1P2OA 2STAE 1YCPH 2BXTH 2ZHQH 3ATKA 2C8YB 4MG3A 2KCAA 1QFKH 2PSXA 4IMQA 5HKKD 3WW7A 1BHXB 3OEHD 5JBAS 4E05H 3GICB 3M7TA 4X1QU 3MO9A 2BD5A 5T6FA 2C93B 2RA3A 1Y3WA 3ENSB 1A3EH 3TK6A 1EJMA 2V3HH 1Z8IB 1HAXB 1BQYA 1CO7E 1GGDB 4FUFA 1ZHRA 1QBVH 5LPEA 5JB8S 1RFNA 3W95A 3MNBA 4WJG2 2GTBA 1NT1A 1SMFE 3M35A 4XFQA 4NIWA 2ZTYA 1BMNH 1G3EA 3V12A 4KKDA 3MO3A 1QB9A 5DN6D 1GG6B 1CSOE 5C20A 5EQRA 1BTHH 2SNVA 4A1VA 5I25A 1XUKA 4NGAH 1TRMA 2ZCLP 4K69A 1EOLA 4JZEH 2FOGA 2BDCA 1G36A 3UY9A 4ISHH 4YT7H 1HXEH 1E1RD 1ZJDA 1GJCB 2KAIB 2VINA 1FPHH 1ESAA 2JH6D 2JH0D 2XC4A 3PMAB 1BRUP 2BDIA 5TCCA 1C4V2 1GHYH 1TPOA 2ZGXH 3GOVB 3M36A 1MBMA 2DE9A 3G01A 3SV2H 1LVMA 3GCOA 1O5BB 3DSGA 4INLA 2BY7X 2JETB 1QNJA 3E90B 6CHAC 1DFPA 1OS8A 3RLYH 2P8OB 4CHAB 1LO6A 1UVOA 1A2CH 2QN5T 3T26A 4DCDA 4ZHMU 2HLCA 2SGQE 5GXPA 2UUFB 2ZWLH 2ZGJA 1V2KT 3ZV8A 2NU0E 1VR1H 1EZUC 5A09A 2Y7XA 4JYUH 1LPKB 1QA0A 2TBSA 1ELEE 1GCDA 3FOAA 3SU3A 3L6PA 1MKWH 3RXDA 1C2IA 1TBZH 1FJSA 1O0DH 3RXOA 2IN2A 2PP6A 3DCLA 2A5KA 1TNKA 2HNTE 2ASUB 1B5GH 4JK6A 1GMCG 2HNTF 4ACAA 1AWFH 3UREA 1AZ8A 1FN6A 3FKSD 1C5QA 4CRDA 5AFZH 4CRFA 4AN7A 3TH3H 1PPCE 3RXLA 1V6DA 2R0KA 1QGFA 2VBCA 1E35B 2J95A 1H1BA 1ZSKA 2BY5X 3SV8A 1VGCC 3TH4H 4HZHA 4X6OA 4JMYA 2PR3A 3TJNA 2UWPA 4IW4E 3STIA 3M7QA 2ZGCA 3A88A 1LQDB 2A5IA 1UK4A 4MDSA 2ANYA 2OTVA 1UTMA 1SLVB 3SN8A 5HIYA 1X7AC 2W6JD 3BEFB 2A1DB 2J92A 4XBBA 4ZXYH 2AMDA 1FIZA 3VXEH 2DUCA 2ZHEH 3LGIA 1XXDA 2Z3DA 2CK3D 3RC5A 3SU5A 1SHHB 1QL8A 3JZ1B 2A7CA 2BDYA 2P16A 2M2AA 1AVGH 1A5IA 2J2UA 5IYTA 2WUCA 4CREA 4INHA 2GT8A 1WUNH 1WQSA 4I31A 1DWEH 3A87A 4MQAA 1SGIB 3A7XA 1A0HB 1KLJH 1P03A 1Y5AT 4NA7A 4FVBA 4ZXXH 4BAHB 2OK5A 4ACBA 4Y8XA 2FM2A 1CT4E 2GT7A 2P94A 1MTNC 1CHOG 2FXRA 2ZFSA 2FS8A 1NROH 4WH8A 5EW2H 4MVNA 2Y5FA 4MLFB 3LPRA 3K2UA 4HFPB 5E0GA 3HK3B 1SSXA 1NBMD 3SJKA 1CGJE 4Y8ZA 5HXFA 2B7DH 4NWKA 1SKYE 3PO1B 1CT0E 1WU1A 4LK4A 4O03A 4UFDH 3S7KB 2ZQ1A 1TRYA 3A83A 4ZHAA 3TVJB 3S7HB 1U6QA 2FPZA 2HVXA 4FUEA 1N6YA 4NZLA 1C9PA 3MWIU 1EFRD 1JRTA 3MU0A 1VITF 3GDVA 4I7YH 1SOTA 3PLPA 4J1YA 1WAYB 1WYKA 1T8OA 1RXPA 2Y81A 3SV6A 5ESTE 8GCHF 1SGYE 1P2NA 1O30A 1T31A 1YLCA 3KGPA 1W11U 1GI0A 1O5GH 1GHZA 2OBOA 2D2DA 4WMEA 1Y5BT 1YPLH 3LJJA 3EQ0H 5A0AE 2ZDLA 2TGTA 3U28C 3S9CA 1O3LA 2FX6A 1ZOMA 4E7NA 1PQ8A 5L2ZH 5HMAA 3EE7A 1Z8GA 3SI4H 4X8SH 1FQ3A 1ZMNA 2QYIA 1FY5A 3RDZA 2ZP0H 1PYTD 5FBIA 1B0EA 1BTYA 5CHBA 4O9VA 5ESBA 1VCPA 2GCTC 4BAQB 3PMJA 5L2YH 2BM2A 2H1UA 2Y80A 1FUJA 1D3DB 1W12U 2ZIQH 3BTWE 2GCHF 1PPHE 1C2DA 1C2KA 1BMLA 3SU4A 2BZ6H 2VNTA 2J98B 1KXBA 5I46H 2VU8E 2A4RA 1W2KH 2R2WU 1W0JD 4I32A 1F92A 1O5FH 4B6FA 4X0WU 1GHAF 2VWLA 2ZFRH 1P09A 3FO8D 3DUXH 2TGDA 4RKOB 1ARBA 4CH8B 1SLXB 2I6SA 3Q3YA 1P2JA 3P8FA 1AB9B 1N1LA 1T8MA 3OAAD 2ULLA 3RC6A 3LH3A 3ZZBA 1VKYA 2ZPQA 1BITA 5EPNA 2WYJA 1O3DA 2RDEA 4ZMAH 2EY4C 4ZUHA 3TNTA 3HGNA 1O37A 1F2SE 3NKKA 4OS6A 4AC9A 4ISLA 4RT1A 2PKAA 3RXCA 2FOFA 1SGTA 1XUJA 1SGCA 1D9IA 1GHWH 4RI0A 5EQQA 1CQQA 1SGRE 2FZZA 2ZZUH 5EQSA 3VB3A 1C1TA 1SLWB 1HLTH 1O3PB 3TJVA 1MAXA 2A2XH 2SGEE 1ZTKA 2VWMA 1SGEE 1OYQA 2BX4A 1EPTB 2GMTB 2FYRA 2AGEX 3T27A 5DKMA 3FAOA 3FN8A 1W0ZU 3JZ2B 5KGOA 1NY22 1O35A 1GMHG 3QZRA 3GY5A 2Y6TA 2OC8A 1GJ7B 3GY8A 4U01A 4CH2B 1KY9A 3AAVA 1FDPA 1OPHB 5EJZA 3OSYA 4IC5A 2HVYB 3A7ZA 4Y76A 3NXPA 3K65B 1FY8E 1ELCA 2ZG0H 3RXPA 1SGFA 2Y82A 2BY9X 4WXIA 3SW2B 4HI3A 4DURA 5DP8A 1O3AA 4INKA 1XUIA 2QA9E 1ZSJA 3T29A 2ZFPH 3SUDA 7LPRA 1K1IA 2ALVA 1W13U 1Y59T 2G4TA 5EU8A 1GI4A 4X8TH 1K21H 5B6LA 1EOJA 1QJ7B 3F0OA 5FXLA 5DP3A 3I78A 1W0KD 1GBDA 2P3UB 2J38A 1NO9H 2FMJA 4AX9H 4D9RA 1GJAB 1WTHD 1C5RA 4A5TS 1XVMA 3PLBA 4BAKB 1RS0A 3P8OA 1W0YH 3L3TA 1O36A 1GBKA 1XUFA 3LJOA 1GCTB 1KXAA 3K6ZA 4Y6DA 5FPTA 4TY6A 1D6RA 1LHDH 2BHGA 1BJUA 1A5GH 3SHAH 2SGPE 3BTTE 1S6HA 1YYY1 4AYVB 2XNIA 4B2CA 3ZZDA 2FOMB 3QTVH 1FZZA 2TPIZ 4Y79A 2UUYA 2AHME 2WZQA 1EX3A 2VGCC 1ELFA 4YOGA 4I8LA 1G3DA 3HATH 2Y5GA 1RD3B 5FCRA 1SGQE 3MH6A 1RIWB 4ABIA 1C2MA 3A81A 5T6GA 3EGKH 1GMCF 2PTNA 3S0NA 1NFWA 4BAMB 4OGXA 2FOCA 5DO4H 1C1RA 1J15A 1AFEH 4JZ1A 1AKSB 1L1GA 3ZZ3A 3GDSA 1C1OA 3SNAA 1NM6A 1PPFE 3W94A 2BTCE 1NRRH 3SBKA 4AORA 3V13A 3RXBA 1GMDF 3FP8E 4ASUD 1COWD 3BTKE 3OE7D 4Y0YE 1CT2E 3O8DA 5AVDA 1QQUA 3S9BA 1IQEA 1MKXH 2HALA 1LVBA 4Y8YA 2G52A 2ZDVH 3AASA 2WUBA 1P3EA 5HIZA 1O5EH 2BOHB 1WSSH 1P12E 9ESTA 4BXSA 1TX6A 1AZZA 3UUZA 3LKWA 3RM2H 3S9AA 4Y7AA 1O2KA 5H4IB 1OP0A 3PWBA 1H9LB 3AK5A 2XBVA 4Q7XA 3P95A 4NIXA 3B23B 2ZPSA 1C1SA 1DSTA 1PQ5A 4HG6A 1DOJA 1SQAA 2BQ6B 5JYIA 1K2I1 1TOMH 2J9NA 2M5TA 5HM9A 1C5ZB 1Z1IA 2P59A 1W7XH 3O8BA 2ZU4A 1F0TA 1P2MA 4XBCA 1D3PB 1O2RA 3VGCB 1C1NA 3PYHA 1UHBA 1E37B 1DLKB 4FOUC 2IPHA 2Q1JA 1WTGH 4K2YA 3LGUA 3LONA 3LGTA 5E2PA 1ZRBA 2F83A 1MZAA 4Q7YA 8GCHG 1RRKA 3H7TA 3I77A 2ILNA 3RXVA 3FANA 3BG4C 4YXWD 4I8KA 5IDKA 1C5TA 4B71A 2IJD1 1AE8H 2B0FA 4B73A 4M9FA 3QX5H 4UE7H 5CE1A 2G8TA 5E2OA 1DDJA 4FUIA 1KDQA 4X1RU 2QC2A 1S0RA 1UVSH 2ODPA 4D7FA 5LPFA 1J8AA 2SFAA 3MI4A 1BRBE 6GCHF 1GI6A 2FOHA 1WDIA 2WV5A 1GWAA 1YPGH 2JH5D 2RG3A 2GCHG 2BLQA 4RSPA 2BZAA 2A2QH 2JDID 2PKSC 5EXMA 5JBCS 2ANKH 1TE0A 4X6PA 3RMOH 1TNLA 2VIVA 2RDLA 3M3VA 1LCYA 3DA9B 3EA8A 4D9QA 2ZU2A 4X8UH 2K0QA 5F03A 4NCYA 3TH2H 2VIOA 3VXFH 4TT3D 2FLRH 8KME2 4O3UA 2BD3A 2OQ5A 3A8AA 5KEDA 1ARCA 5EW1H 1GGDC 2TRMA 1S0QA 3RXGA 1C5LH 5EIYA 2O8WA 2VH6A 3SZNA 2KCPA 2AMPA 2J4IA 4KGAA 1F5RA 1QCPA 2YMSB 1YM0A 1GBAA 1OP2A 1V2ST 2C8ZB 1MCTA 4H6SB 2SGDE 1EP6A 1LKAA 1SFQB 5C1XA 1ANBA 3T62A 1V2OT 2VIQA 1FAKH 1UK3A 1IOEA 1DLEA 1GJ5H 4NFEA 1G3CA 1A0JA 4XDEA 2BOKA 3RXJA 2ANWA 1C5YB 4B2AA 3UNRA 2VIPA 1FMGA 1HAVA 4ZCNA 1Z8RA 3TGJE 1EB2A 1AD8H 4E06H 4I8JA 1E34B 1JXPA 3SNDA 1NU9A 3GCHB 2A0QB 2V3MA 4UFGH 3ZIAD 2FX4A 1TRNA 2EC9H 4I8GA 1PYTC 2ZFQH 1TB6H 1TPSA 1RTFB 2P93A 2ZDNA 1J14A 2AEIH 1ZJKA 4RN6A 1CA0B 2CXVA 1P57B 3ELAH 1EB1H 2ZI2H 2HLDD 1PFXC 2PGQB 2JETC 1N8OB 2TIOA 3KL6A 4I86A 2PGBB 4IBLH 4FUHA 1GMHF 3ZVAA 4OM9A 4ABHA 2PWXA 5GWZA 1UTKA 1Z1JA 1EAIA 3F9HA 1BUIA 4CHAC 3ZVBA 5HYOA 1M9UA 1EAXA 3PTNA 5GNDA 4FUCA 2Z3CA 2F91A 2W7SA 2CHAB 3DT0H 4ABDA 3NPSA 3RXTA 4NFFA 1ELGA 3BTQE 3UNQA 8LPRA 3F2HA 3M5OA 4NSVA 1DE7H 1OWHA 4JCNA 4B2BA 4Y10E 3PRDA 2QCYA 1VZQH 3RXEA 1O3BA 1TBRH 1UCYK 1FONA 2A7JA 4R8TB 1IHSH 3LT3A 5JDUB 5DP6A 3A89A 1BOQA 4ABGA 3D65E 4YM9A 2FOEA 1C1MA 4OS2A 1WBGB 1KXDA 3OYPA 1OWEA 3Q76A 3ZV9A 1GI9B 1MBQA 3AVZA 2VVUA 4TWWA 5JB9S 2QF0A 3MU1A 1HAZB 3BTME 4FUDA 3UIRA 2K7XA 3F9FA 1XXFA 2A4OA 1MAYA 1GJDB 5FCKA 1UJ1A 1UMAH 3ZVEA 1AVXA 2XOKD 1JRSA 5FAHA 2Z94A 4Y7BA 1AFQB 2L74A 1GBFA 1V2JT 2BLOA 1A61H 5SGAE 3N7EA 4YLUA 4B75A 4M7GA 3RM0H 4X2YA 4FU7A 1JIMA 2JJ1D 2J34A 5C0TA 2QXJA 4CRCA 3RXMA 1GI5A 5E0HA 2WPLS 5DPAA 1T32A 1QQ4A 1XKBC 1AUJA 2FESH 4O97A 2Y5HA 3SORA 1BTWA 2NU4E 3SZEA 4WMDA 4DG4A 2B5TB 1DT2A 3LU9B 3KCGH 4FXGH 5DP7A 3RXHA 4UDWH 4GCHF 1QRWA 1ELAA 5J4SA 1GI1A 1SHYA 1TOCB 1FY4A 5L30H 1UO6A 2ZECA 1QJ1B 3KYGA 1C1WH 3E6PH 4QT8C 4B6EA 1GMDG 3ZZAA 4A6LA 2AIQA 1P04A 1ELTA 4DIHH 1CA8B 1Z71A 3QN7A 1QA7A 2O8UA 4WXVA 1MTSA 2GX4A 1HAYB 1D4PB 4BAOB 3UQOA 1LHCH 2W26A 3SNEA 3SU2A 5AFYH 2GV7A 1GJ4H 3RP2A 4GUXA 5DP9A 1SL3A 3PO1C 3EAJA 3ODDA 4IN2A 1SG8B 2CF8H 3BTHE 3RXIA 1ZR0A 1GVLA 3SUGA 4D76A 4X2XA 1K1JA 1HFDA 2ZHWH 4LZ1H 3TK5A 1NRSH 1GVZA 4ABJA 5GJ4B 4YZUA 1MU6B 4ESTE 3KHVA 1IQJA 3SNCA 5CHAB 1C1VH 4KP0A 2EQNA 2BD8A 2VWOA 1RJXB 1YGCH 4U2WA 2A7HA 4FUBA 5DG6A 2C4FH 4ZKOU 2VVVA 1TX8A 4TY7A 4Z1MD 2H9HA 4BNRA 5T6DA 4ABEA 3NUMA 3UNSA 1W8BH 1V2UT 1YF4A 2KCYA 3BN9A 2ZKSA 1AY6H 1C9TA 1C1PA
chains in the Genus database with same CATH topology
4BXWA 4NA9H 1SC8U 4K1EA 2ZDKA 1ANDA 1QRZA 1IQGA 4A7IB 7KMEH 1EZSC 4FU9A 4K1TA 2UUKB 1AHTH 3BIUH 1HJAB 1H4WA 1S84A 4BANB 1DUAA 2WYGA 1CBWB 1E0FD 1BTXA 1GJ9B 2F9BH 2Z9KA 2GDEH 4ZROA 1EJNA 3LGVA 4DGJA 6GCHG 1HAPH 3VB7A 3DFLA 2D8WA 4A1XA 2HOBA 4CR5A 5DP5A 4ZH8A 1BBRK 2F9PA 1DXWA 4CBNA 2ZCHP 1NFUA 1O2YA 4AYYB 1ORFA 1TX7A 1O2JA 2F9UA 1ZZZA 1TNHA 1HJ9A 2Y7ZA 1TBQH 2O8MA 4X1SU 1T4UH 2FLBH 2V3OH 3GCTF 4DJZB 1F0UA 1GDNA 2BYAX 4R0IA 3MTYA 3EDXB 1HAHH 1Y3YA 4HTCH 1AB9C 1TIOA 3V3MA 1ANEA 1K9OE 3SUFA 2V0BA 2A32A 1KLTA 1UK2A 4ISNA 4F4OC 5F8TA 3CENA 1NU7B 3UQVA 1ETTH 1TA2A 2R0LA 1D3TB 3VPKA 2H5CA 1Y8TA 4ZKSU 4IGDA 3KEEA 2ZC9H 1TGTA 4KTSA 1O39A 3TK9A 1P8VC 5JPMH 2BQWB 2BVXH 1KTSB 1O38A 1UTLM 3MH5A 1TPPA 2GMTC 3UTUH 3C1KA 2XC5A 3U8RH 3ZZCA 3SQEE 2VVCA 3E8LA 3ZYDA 3P92A 1ZLRA 3RU4E 1L4DA 5C5OA 2F3CE 2AMQA 2ZNKH 3GY4A 1ID5H 1OWIA 1C5VA 2P3TB 2VIWA 3QUMP 1P3CA 1TYNA 1NS3A 4CRBA 4MPUA 1FI8A 1GBJA 2ZA5A 1BJVA 3UPEA 1K1NA 1MQ6A 3K9XB 1SI5H 2C8XB 3B9FH 2QGRA 1HUTH 1P2IA 1J16A 3VFEA 2Q6GA 1GBHA 1LKBA 1V3XA 2LNCA 1O2VA 1PJPA 1AVWA 1BIOA 3A84A 1OXGA 2QY0B 4NWLA 1QR3E 2THFB 4AB9A 2HGTH 3OU0A 5FHTA 1O2TA 1EATA 2XBXA 3SNBA 1TMBH 3QGJA 1O31A 1BMMH 2BVSH 2CV3A 1XX9A 1C2JA 1ESBA 1C2GA 2ZDAH 4YOJA 1DICA 5A0CA 1IQMA 2HNTC 1P06A 1O2IA 2FIRH 4GLYA 2FYQA 2ALPA 2W3IA 2P3FH 1RTKA 2AH4X 1V2RT 1XUGA 2AERH 2YOLA 1O3IA 1GCTC 4X2VA 3BG8A 1L4ZA 3URDA 3ZZ7A 3EYDA 2IJOB 3GYLB 4Z0KA 3TLOA 1C4Y2 1BB0B 3GCNA 1THRH 2GKVE 1EP5A 1QY6A 3EE0B 1A5HA 2BY6X 1G2MA 3QK1A 3TNSA 2OC0A 2Z6BD 3TGIE 1KIGH 2BD9A 3UR9A 1LQEA 1SGDE 4AGJA 3TITA 3KQBA 2CF9H 4NA8A 1AMHA 1O3OA 2OC1A 1N6XA 1UVUH 3PV4A 1IQNA 1NRQH 1HIAA 4Y11E 1GPZA 1KSNA 4UEHH 3TGKE 4ABBA 4XBDA 3FZDA 1CVWH 2XTTB 3PMHB 2XCNA 4JZFH 1G32B 2PUQH 1H9IE 1V2PT 2OXSA 1FXYA 2BD7A 2WPHS 2ZU5A 2D26C 2PKAB 5J4QA 4RKJB 4SGAE 1HRTH 2GGVB 3P8GA 1ZRKA 2QXHA 2TGPZ 1AO5A 3QTOH 3E91A 3F68H 5HM2A 1NTPA 1LHEH 4XE4A 5BPEA 5G4BA 1O2OA 3NZIA 5ABWA 1IQLA 1Z6JH 2QAAA 1C5OH 4GCHG 3A7WA 1GI3A 4CRAA 1TWXB 4ISOA 1YLDA 5JBBS 2BDAA 2WPJS 4YO9A 1TGCA 3ITIA 3Q3XA 2WPKS 4MNYA 1J17T 1TLDA 3VEQB 1D3QB 3PMBB 2I6QA 2OINA 3STJA 1DPOA 1EJAA 4X8VH 1BA8B 5ETXA 3GDUA 3BV9B 2W3KA 1C1UH 1ZTJA 3GISB 2XWAA 4KELA 1ZGVA 3A8BA 2BXUH 3T5FH 3M5MA 3O8CA 4B76A 1QB6A 4WF8A 1C4U2 1G9IE 1XUHA 3MMGA 1DX5M 3VGCC 3H5CB 1TGNA 2ZTXA 2H5DA 5EOKA 2H2ZA 2K1QA 4NIVA 2BLWA 1A1RA 1OKXA 1OSSA 2Q6DA 1PPGE 1SGFG 2VGCB 2GZ9A 4VGCB 4DW2U 5FBEA 3CS0A 1TMUH 3RMLH 1MU8B 5AHGH 5FPSA 4ZKRU 1JIRA 1AE5A 1EZXC 3UOPA 3QZQA 4YT6H 3MU4A 5TJXA 2EEKA 3RLWH 3F9GA 3I29A 3ESTA 2V6NA 3F9EA 5GDSH 3M3TA 4K8BA 2CJIA 3LH1A 5HGGA 1ELBA 1ZHPA 1KXEA 1O2PA 4AG1A 2UWLA 4IMZA 3SQHE 4NG9H 2FI4E 1KXCA 3OY5U 1HAIH 2AYWA 3SU1A 1P02A 1RTLA 3BIVH 1G30B 1QB1A 2GP9B 3F1SB 1MMJN 2STBE 2WV4A 1YP9A 1F5KU 4H6TA 4YESB 3QGNB 1O2QA 3RXAA 2EA3A 3M5NA 1ANCA 1RGQA 2R3UA 3RXQA 3BEIB 4DT7B 3B8JA 3BTDE 1EXFA 1QHRB 1TA6A 2C8WB 4GPGA 1SQOA 2FP7B 5GCHG 1K1OA 4MPWA 1O3MA 2W7UA 1VCQA 3MFJA 1KYNA 1GJBB 2IOTA 2NU2E 1BT7A 3GCTG 3U69H 1DSUA 3MNSA 5C1YA 1Y3VA 1YPHC 1O32A 2DE8A 3ZZ6A 1W3CA 2B9LA 1HCGA 4K60A 2OD3B 3FVFB 1GBBA 4NIYA 2G51A 1TQ0B 1NESE 1AGJA 1HPGA 1O2UA 3KQEA 1XM1A 5FX5A 1HAGE 1YPKH 4WVPE 2NU1E 2VB0A 2XYAA 1ZHMA 1P9UA 4WWYA 2XC0A 1MQ5A 1A4WH 3PLKA 3ZVDA 1EAWA 2FI5E 1YKTA 1ABJH 1C2HA 2R3YA 1E36B 2ANMH 2C3SA 4Q7ZA 1Z6EA 2G55A 1IQFA 5A8XA 2FODA 4TPYA 2GZ7A 1H9HE 1SBWA 2GD4B 3BG4B 2ZFTA 1GBCA 5EXNA 1UVPA 2KAIA 1CU1A 3T2NA 6ESTA 1GBIA 1F7ZA 4O3TA 2A31A 2EI8A 1T8NA 2ESTE 2J94A 5DP4A 1UHBB 3FZZA 1N8OC 1Z7KA 1GG6C 5A2MH 2AIPA 3BSQA 5BRRE 2CGAA 2FWWA 1W7GH 1MKWK 2O9QA 3E0NB 1HYLA 5F6MA 4GSOA 3QDZB 1FY3A 3GYMA 8ESTE 1ELDE 4XSKU 2OC7A 2PKSB 1K1PA 1HJ8A 2FTMA 3U1JB 3WY8A 1BDAA 1NRNH 3SO3A 2CN0H 1H8IH 2SGAA 4TYDA 4AB8A 5EG4A 1P0SH 1KDQB 1NPMA 2BD2A 4MNXA 5E8EH 3RUOA 1JWTA 1MZDA 3NK8A 1SLUB 1XMNB 2GV6A 2EI7A 4AZ2B 2OCVB 5DK1A 1ZPZA 1QBNA 2P8OC 1PPEE 2Z3EA 1EZQA 3U1IB 3RMNH 1GVKB 3LIWA 3PTBA 1O34A 4H42U 1GJ8B 3RC4A 4OS4A 3V0XA 3A86A 4ZAEA 2Z9GA 4D7GA 3KQDA 1AFQC 7GCHF 4ZHLU 3U9AH 1UTNA 4H4FA 4B1TA 4XOJA 2EI6A 1BTZA 3RXKA 3LOXA 5F8XA 1C2EA 2ZHFH 3P70B 4KTUA 3KIDU 3ODFA 1EUFA 1OOKB 3UWIA 1AU8A 1O2WA 3R3GB 4GVUA 3ZVCA 4ABAA 2FOBA 4Y71A 2W5EA 1SPJA 2QF3A 2SGFE 3A82A 2Z9JA 2QXGA 1F0RA 1DWDH 3D62A 4E7RG 3ATIA 3D49H 3FFGA 1O3CA 4Q80A 3MNXA 4AFQA 1FV9A 1C5WB 1MD7A 1MD8A 1KXFA 3MU5A 3SV7A 1ZTLA 3ATLA 1AWHB 3BTEE 1V2NT 3P8NA 3UOUA 2ODYB 1HAVB 1HXFH 3DFJA 1HB0B 1DS2E 2PUXB 2BB4A 4TPIZ 1H8DH 4K3JA 4FVDA 3BEUA 3A7VA 5C67A 1DVAH 2OBQA 4AFUA 6LPRA 2PV9B 3M7UA 3E16B 4YTAA 3M37A 3OX7U 3BTGE 1GBTA 1AQ7A 1KTTB 5C5NA 3MU8A 3ATMA 1GHVH 1Y3UA 1J9CH 4OS1A 1S6FA 4MTBA 4UFFH 1OWDA 6CHAB 1QIXB 3RXSA 1XVOA 1Z8JB 4K5ZA 2G00A 2TGAA 1C5NH 1L1JA 1V2QT 2FO9A 4AFZA 5CHAC 1GI8B 1E38B 1HBTH 3ZZ4A 3URCA 5LPRA 1SVPA 3HGPA 1BCUH 3RXRA 1OYTH 2HPPH 3RU4D 1V2VT 3P17H 2FI3E 1C5PA 3E0PB 2Z9LA 1FLEE 1AN1E 5LGOA 3U98H 3M3SA 1O2LA 3ZVFA 1MUEB 1DY9A 2F9NA 2XW9A 1VJAU 1A46H 4A1TA 1TNGA 2VWNA 3N7OA 1O3NA 1LPZB 2G5VA 1UCYE 2NWNA 3MNCA 1G3BA 3QO6A 2Q6FA 3IG6B 1Q31A 4DVAU 1DANH 3A85A 1HJAC 5E0JA 2AFQB 1Q2WA 3ZYEA 1CBWC 5A8ZA 1ZMJA 4D8NA 4FUJA 1IHTH 3A7TA 1VGCB 1UCYH 3H7OA 4GHTA 1YPMH 3MHWU 2Z7FE 1FN8A 3E3TA 3TPIZ 3EA7A 3ATWA 1P05A 2BMGB 1SR5C 1OWJA 4PROA 1IQKA 1PQAA 4F49A 1EAUA 5EXLA 2JKHA 4I33A 2VJ1A 3BTFE 2A5AA 1TMTH 4BTUB 1TAWA 3A80A 3RXFA 4JZIA 3GY6A 1QRXA 3SV9A 2FTLE 2CMYA 1BTUA 1MTUA 3RMMH 1THSH 4DOQA 1P2KA 4X6NA 2HRVA 2G5NA 1MTNB 4FU8A 1T4VH 3T25A 5GCHF 1TPAE 1BMAA 4OS7A 3QWCH 3TJOA 1IQIA 1F0SA 2ZGHA 1BZXE 2XBWA 5B6OA 1BRAA 2ZU1A 1V2MT 2ODQA 1CGHA 2OLGA 1ACBE 1T7CA 2XRCA 1EPTA 1VITH 3AAUA 3SJIA 4UONA 2B8OH 2SNWA 3K6YA 3SHCH 4MNWA 4U32A 1ZYOA 4AGKA 1K1LA 3P6ZB 3SU0A 3O8RA 1O2XA 5PTPA 2ZTZA 3E1XB 3MO6A 5A8YA 3LDXH 1XKAC 2AS9A 1P01A 1B7XB 1TNJA 3ZVGA 1UTPA 1GBLA 1C5UA 1OP8A 1WQVH 4GHQA 1FAXA 1S81A 4THNH 1EPTC 3MH7A 1LPGB 5GIBA 2H9EH 2P95A 3PB1E 1QTFA 2YNAA 3RU4T 3MH4A 1CGIE 4MNVA 4X2WA 1GDUA 2UWOA 2V35A 5FPYA 4LXBH 1DM4B 2G81E 2A45B 3A8DA 1FPCH 1GHBG 3AW1A 3C27B 1LHGH 1JMOH 4GAWA 3V7TA 1AIXH 1LDTT 4UD9H 2NU3E 4LZ4B 1ESTA 2VIDA 1L0ZA 5CMXH 4TWYA 1THPB 2PTCE 2BVRH 3SGQE 1O2MA 2GCTB 2XXLA 3SGAE 1TONA 1BRCE 2LIZA 4KTCA 2OP9A 1IQHA 1MTWA 3VB4A 1OX1A 3GY2A 1C5XB 2HWLB 1K28D 1Y3XA 1MTVA 3QLPH 1W14U 1YPEH 1YPHE 4X6MA 4K8YA 1BBRE 1DUEA 2ZQ2A 2QXIA 3L33A 2ZPRA 3U8TH 7GCHG 1VCWA 1C2LA 1CHGA 1GI7B 1MKXK 1QBOA 2PW8H 4BTIB 1GBEA 1C1QA 1P2QA 1BHXF 1UTJA 3NWUA 1ZGIA 1BBRH 4CR9A 1AKSA 5C3NA 2GDDA 1MH0A 1O2HA 4J2YB 1AI8H 3SI3H 2VH0A 1ZPBA 9LPRA 4WH6A 1P10A 1G37A 1T8LA 4Y0ZE 4SGBE 3BF6H 1YCPM 1FNIA 2AGGX 1UTQA 1RIWC 1GI2A 2C90B 1LHFH 4NZQA 2WINI 1S85A 1ZSLA 2XBYA 1O5AB 1WOFA 4ISIH 4YLQH 2QIQA 1JBUH 2WPIS 2AGIX 1EQ9A 3D23A 2ZFFH 1O3HA 3SU6A 5JBTA 1GL0E 2D1JA 1OWKA 4ASHA 1GJ6A 2R2MB 2BX3A 4UFEH 3SOSA 2RCEA 3HPTB 1WV7H 4JYTA 1C2FA 4LOYH 4AOQA 1EKBB 1YPJH 4OS5A 1YC0A 3T28A 3LC3A 2PHBA 2O8TA 2F9VA 3M5LA 2PLXA 1TFXA 1CE5A 1QJ6B 3NCLA 3UR6A 3TU7H 1O5CB 3SJ9A 1DY8A 2PFEA 3RXUA 1B0FA 4U30A 1INCA 1ETSH 2WPMS 3OY6U 5LH8A 1NFYA 4VGCC 4HGCA 3A7YA 1C5MD 1ZMLA 2BQ7B 1D6WA 1BTPA 1NRPH 2OUAA 1FY1A 3S69A 1FIWA 7ESTE 5DJ7A 2YNBA 1TGBA 1IAUA 4X1PU 1VJ9U 1GBMA 1EASA 1P11E 1O3JA 1HGTH 1SGNE 1S82A 3KF2A 1HAOH 5AF9H 1LVYA 3SJOA 3LC5A 1LTOA 2PSYA 2FEQH 4AFSA 4AG2A 4BTTB 5C2ZA 2O8LA 2F9OA 3PROA 3HKIB 1UTOA 1TABE 1O3GA 2ZGBH 3PWCA 1KLIH 1HIAB 2ZEBA 3GY7A 4MPXA 4WY3A 1O5DH 5GPIB 4JYVH 4DY7B 5EPYA 2BLVA 1A3BH 4DIIH 2ZO3H 1GHXH 1YBWA 1G2LA 1NZQH 1F5LA 1SFIA 1ETRH 2ZF0H 3F6UH 5T3HA 1O2SA 1Q3XA 4NSYA 5EODA 1QL9A 1ZPCA 2RA0A 1HNEE 1PQ7A 3KQCA 1YCPK 2UUJB 3Q00A 4IC6A 3KN2A 1A0LA 1L2EA 4MPVA 4A92A 1O3KA 1Y5UT 3PM3A 3FP6E 3U8OH 3Q77A 3UWJH 1O2GH 1CHOF 1QL7A 4JZDH 2Z9IA 4K1SA 1NFXA 1L1NA 1QURH 1O3EA 3CP7A 3OTJE 4CBOA 1HDTH 1HV7A 3UFAA 2ZU3A 1S83A 4ZKNU 3IWMA 2BDHA 2HPQH 3Q3KA 1VITG 5FX6A 2H6MA 3ZZ5A 1O2NA 4B74A 1TQ7B 1SB1H 3TIUA 5F8ZA 1PPZ<