1GJBB

Engineering inhibitors highly selective for the s1 sites of ser190 trypsin-like serine protease drug targets
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
246
structure length
246
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKEASTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting, hydrolase
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR
publication title Engineering inhibitors highly selective for the S1 sites of Ser190 trypsin-like serine protease drug targets.
pubmed doi rcsb
source organism Homo sapiens
total genus 50
structure length 246
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2001-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gjbB02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gjbB01
2PUQH 3BTEE 2FOBA 4AFQA 2VH6A 1EJNA 3QGNB 2Q6GA 1MD7A 2CXVA 1AE5A 2F9BH 1ZHRA 2IPHA 2WPIS 1HLTH 4IW4E 5A09A 1VITG 1BRAA 2ANMH 3QO6A 1QTFA 1TFXA 2UUFB 3BV9B 3QTOH 1SGFA 1GI4A 1BBRH 2ZIQH 3F9HA 1BJUA 2ZC9H 2O9QA 3M61U 3GICB 2ULLA 1SMFE 2RCEA 3NPSA 1P03A 1TONA 1V2LT 2UWLA 4AB9A 2ZFRH 5ETXA 4FUGA 1GHAG 4KP0A 3TU7H 2DE9A 3URDA 3U8RH 1Z8JB 3Q3KA 1YCPK 3KQCA 4MVNA 4TYDA 1HAPH 2EA3A 1C4U2 3MOCA 2XBVA 2ANKH 2C90B 4K69A 1TWXB 1S84A 1EAWA 2VWNA 3A8CA 2FX4A 3M3SA 3SI3H 3ZYDA 1HUTH 1N1LA 1IQLA 2Z94A 1CT4E 1DY8A 1PYTD 4OGXA 1D3TB 2B5TB 4CH2B 2P93A 3P17H 4X2WA 4GHQA 4X1RU 2CHAC 3D23A 6CHAB 3TNTA 3P6ZB 1GL0E 4MPVA 3HK6B 1DFPA 1PFXC 1VGCB 3LC5A 3T5FH 1XUIA 1FN6A 3E0PB 1HAGE 5B6OA 3RU4D 3S7HB 4BTIB 1C1SA 1BRUP 2UWOA 1AVWA 2ZDLA 3SV7A 3UQOA 4ABGA 1IQNA 1TA2A 4Y8YA 3RC4A 1ETRH 1GBTA 4ABBA 1W8BH 3RXCA 1IQEA 2D26C 3BEIB 5EODA 2GMTC 1SLXB 5GCHG 1JRTA 1NU9A 2P59A 3SNBA 2BLVA 3NUMA 1F0TA 2J34A 5CHAB 5L2YH 3RDZA 1CT2E 3HGNA 1PPGE 2ZHWH 4ISHH 3RXOA 2QXIA 2ODQA 1DT2A 1KTSB 4HTCH 1GGDB 1GBLA 2A4OA 4AORA 2VVCA 4AGKA 4B76A 1AB9B 4TWWA 1HIAB 3ITIA 2SNVA 1NS3A 1W10U 4BAMB 1A1RA 4MNYA 1CA0C 1PPBH 2FLBH 1UCYH 3VGCB 3RMNH 3RXUA 5C2ZA 3MMGA 2STBE 2O8TA 1YBWA 1O2YA 2A31A 2P3FH 3M36A 4FUBA 1ID5H 8GCHG 4RN6A 1SB1H 3MH7A 3GYMA 1K1NA 3P70B 1OYQA 1MAXA 1O2JA 3SU6A 3PTNA 1KY9A 1TNJA 1KTTB 1BTUA 4NWLA 3QDZB 4X6PA 3BEUA 1EPTB 1NTPA 2ZP0H 4E7NA 2VGCC 2GT7A 3URCA 1HAVB 1RIWB 4JYTA 2ZTYA 1E38B 1FONA 3V3MA 4BOHA 2TGAA 2GZ7A 1Z7KA 1P09A 1HJ9A 2ZQ2A 1ETSH 2FOEA 3KHVA 5EQSA 2ZPSA 1P9UA 2BXUH 1S6HA 4FXGH 2QA9E 2BXTH 1F5LA 1C1VH 2SGQE 3UREA 3NWUA 1LHCH 1O5AB 3SJKA 1P2JA 1OWEA 3ZZ7A 4TPIZ 2FLRH 1TRMA 1MQ5A 1UJ1A 1P10A 3P8FA 3U98H 1PQ5A 1LTOA 1CA8B 4DJZB 1BRBE 1AD8H 1H1BA 1E34B 1S5SA 3UWJH 3ZZCA 1HJAB 1Z6JH 1FY8E 3B9FH 3A7YA 1C5RA 1TE0A 3PLBA 1QURH 1AKSB 3GISB 3DUXH 2HPQH 1VITF 4QT8C 1J15A 1XUFA 1GI2A 2AGGX 4MDSA 4NZLA 1ZMNA 1W14U 1C5YB 1LVMA 1O32A 1O2OA 3Q77A 3A7ZA 1Z1IA 4X0WU 3TH4H 1ELDE 1C2KA 1TOMH 2SGPE 4KTSA 1L2EA 2EI8A 1DITH 2ZCHP 4HGCA 1O2QA 4LXBH 4XBBA 5HM9A 1RGQA 3GCTG 1GHAF 2TGPZ 2ZNKH 1PPHE 3M3TA 5F03A 4YOJA 2JH6D 4OS7A 1EP5A 2C93B 5DP3A 3M35A 1SLUB 1TALA 1BTZA 1YP9A 1ZTKA 3T62A 2AS9A 5FCKA 4GHTA 2A2XH 2HGTH 4Y0ZE 4CRAA 1CSOE 3TH2H 3BTTE 1GMHG 1BHXB 1AFEH 3A7XA 2QC2A 3BF6H 2TGTA 5EPNA 2CMYA 2ZDKA 5E2PA 1L1JA 1DOJA 2A0QB 1BMAA 1GJDB 1IHSH 1F2SE 3A89A 5G4BA 3Q76A 3S9CA 4Y8XA 1LHFH 1N8OC 4IC5A 4ISNA 1O3FA 2ZFQH 1AWHB 1IQIA 3SHAH 1ANEA 1OWHA 3VFEA 2PV9B 2R3YA 4AG2A 4GSOA 1FPCH 4X1SU 4LZ4B 2BLOA 3UNRA 2HNTE 1QBOA 4FUDA 4Q2KA 3VB3A 4E06H 5GCHF 3HK3B 3PTBA 1RS0A 1BZXE 3AAVA 1HIAA 2QV1A 1EQ9A 4XBDA 5DO4H 1DSUA 5EQRA 3IG6B 2BMGB 1V2RT 1QGFA 1DUAA 1FY4A 1O3IA 3SNEA 3NK8A 3VB4A 1CHOG 3ZZBA 1GJAB 4J2YB 3RXMA 1O2KA 2FOCA 2A4GA 1TNHA 1XX9A 4WXVA 3EA8A 4ZXXH 1YPKH 2J9NA 9LPRA 1Z8RA 1Y8TA 1HXFH 1YPJH 1K1JA 4NFEA 4Y0YE 1F5KU 1TPSA 1D6WA 1C1PA 2AMPA 1J8AA 4ZMAH 1Y5BT 1O34A 5EPYA 2GCTC 1EPTA 4K1SA 4A1TA 5JBCS 3PYHA 1O2GH 3BIVH 1HAVA 1T8MA 2ZI2H 2D8WA 8GCHF 3SV2H 2R9PA 2LNCA 1SR5C 4DW2U 4JZ1A 3FANA 4ZHAA 5EQQA 1L4ZA 1O3LA 1KLTA 3AASA 1ORFA 2A2QH 1K1MA 1BDAA 1BBRE 4CBOA 3SV8A 3B23B 3A7VA 1L0ZA 3KQDA 3TJOA 1IQMA 2HPPH 4FU8A 3F68H 2BY7X 2F83A 1QQUA 2W3IA 4YLQH 3SU3A 3VB6A 3ZZ5A 3W94A 4AOQA 1PQAA 1GBJA 2TRMA 1MH0A 2GDDA 1A4WH 3RXAA 4BANB 4H6TA 2NU1E 1SQAA 3QLPH 2QXJA 1P2MA 1HPGA 2QGRA 1KXDA 3A83A 1ZHMA 1FAKH 1ABIH 1HAXB 1QB9A 3SGAE 2RA0A 1ZSJA 1UVSH 4AN7A 1IQGA 1ZPZA 2UUJB 3GY3A 4GLYA 3GCHB 3NCLA 3SUFA 1O3GA 4GAWA 1OXGA 1Z6EA 5FAHA 2AH4X 2PFEA 2Z3EA 3E16B 2G4TA 1G2MA 3TPIZ 1UMAH 1V2PT 4K1TA 3SI4H 4I7YH 4WH6A 1TGNA 2OC0A 1YPMH 4B73A 1V3XA 3PB1E 4OS1A 1MKWH 3EA9A 6CHAC 1T4UH 1AUTC 2JKHA 2XBWA 1KLIH 4I8HA 4CBNA 1D3QB 3UTUH 1AUJA 1O5FH 2Y5GA 1OWDA 3BTDE 3GCTF 1T8NA 3ENSB 4NIWA 3LT3A 4XBCA 1TB6H 3ZZAA 8ESTE 3FVFB 3EAJA 2P8OC 3MU5A 2W26A 1WCZA 1E0FD 1BRCE 1ELCA 2OQ5A 4B71A 2VWLA 1GCTC 2BY5X 2HRVA 2SFAA 1RFNA 4XOJA 3ESTA 2PHBA 3ATKA 2TBSA 5CHAC 3TIUA 4WH8A 1B0EA 1W13U 5DP6A 4K1EA 3ZVAA 2ZCKP 1LPKB 1ZRBA 2G5VA 1Z8IB 3M5MA 1UCYE 2GT8A 2GTBA 1FIZA 4AFSA 1MKXK 1AB9C 5DPAA 1SGCA 4WJG2 1F0RA 1GBKA 4IN2A 3UUZA 4CRDA 4YT6H 1SC8U 2P95A 4KELA 2W7SA 1GJ4H 3PMJA 1QBVH 1FN8A 1YGCH 4ZKOU 1JIMA 1DLEA 3RXVA 1AIXH 2R0LA 5EW1H 3LC3A 1ESTA 3UFAA 5CE1A 1PYTC 1E37B 4RKOB 1D4PB 5EG4A 3A85A 1O31A 4YT7H 3ZZ4A 4DT7B 2ZPQA 4X6MA 7KMEH 1EOJA 2QF3A 1MMJN 4THNH 1QFKH 2Z3CA 3CENA 4BNRA 3KQEA 3AW1A 5HGGA 1FIWA 6GCHG 1A0JA 1RJXB 4VGCC 1SGFG 1CHOF 2EI6A 5C1XA 3H7TA 5GXPA 3MWIU 1BUIA 4AB8A 3A82A 3RXRA 4H42U 2OTVA 1TMUH 2F9NA 1C1QA 2BDIA 1AZ8A 1GHXH 1VR1H 3GY5A 1H9LB 1TA6A 2BX3A 5EU8A 5HXFA 4D8NA 3SU4A 4TWYA 3UR9A 1T32A 3C27B 2AGIX 2FWWA 2ZGCA 3K65B 3I29A 2FTMA 3UNSA 1UK2A 1QL9A 2AIQA 1P57B 3O8DA 1SGIB 3SBKA 4A5TS 1G3EA 4O3TA 1HJAC 5EXNA 2CF8H 5IDKA 1J16A 3T2NA 5E8EH 3MI4A 5CMXH 4O97A 1ELEE 1S85A 3H7OA 1GPZA 4H6SB 2PTCE 2CGAA 1XKBC 4O9VA 1MTNB 2R0KA 2BD4A 1WU1A 1TAWA 3MU8A 1AMHA 1C1OA 2XC4A 3TGJE 1HAHH 3PMAB 2R2MB 1Q31A 5JB8S 4NA7A 2OC8A 2BD9A 1HAZB 3KQBA 2Z7FE 2Z3DA 4CH8B 2A7JA 2ANYA 1ELGA 1O2XA 3PWBA 1MCTA 3MO9A 3V12A 1OWKA 5GPIB 2BDHA 3TJUA 2O8LA 4K5ZA 2WV4A 4GCHG 4R8TB 1CBWC 2EC9H 1HFDA 2C8ZB 4NGAH 3LH3A 1LKBA 1AO5A 1O3JA 5FPTA 2FIRH 1T31A 4WMEA 1TGTA 2GVFA 1CE5A 2WPMS 1AN1E 3AVZA 1J17T 1P2OA 2ILNA 3W95A 1W7XH 1HYLA 2A5IA 1FLEE 1ZLRA 4M7GA 2IJOB 2AERH 2F9UA 2NU2E 2UWPA 2ANWA 1V2OT 1GVZA 1S0QA 3U8TH 1T4VH 1UHBB 4A6LA 2V3HH 1QL8A 5LPEA 3E0NB 4JK5A 2PKSB 1DICA 4F4OC 1YLDA 1TQ0B 2FEQH 3UNQA 1SGRE 3PM3A 1ANBA 1Y59T 1G30B 9ESTA 1P01A 2HALA 1NRNH 1IQJA 1O37A 2PR3A 1S81A 1ABJH 4CHAB 3K6ZA 2JH5D 3N7OA 3ZZ8A 2Y5FA 2ODPA 3RXBA 1HAIH 5AHGH 2ZGJA 1H8IH 2QIQA 1QY6A 2PKAB 1OPHB 1W12U 1MZAA 2O8WA 3QTVH 1TNKA 2ZU5A 3U9AH 2VIPA 1QA0A 1IQHA 4HZHA 1QL7A 2F9OA 2XW9A 3ZVGA 2HOBA 3OY6U 2JETB 2VWMA 1DS2E 3SGBE 1C5QA 1C5SA 4YTAA 2VIDA 3RXKA 4XFQA 3AAUA 3D49H 1UTKA 1O33A 1P2QA 3VPKA 1EZQA 3BEFB 1T8OA 1ZZZA 1TNGA 3RMMH 1C5XB 2YNAA 1C5NH 2ZEBA 3KF2A 2FYRA 1DWEH 1OP2A 1NT1A 1S6FA 3DA9B 1ZR0A 3EQ0H 3GY8A 1WSSH 1GI5A 1FI8A 4O3UA 1VJ9U 2XBXA 4K2YA 4WY3A 3RMOH 2ZA5A 6GCHF 1CT0E 1BT7A 2FYQA 4IS5A 4U32A 2Q6FA 4ZKRU 2AIPA 2Q6DA 4JYVH 2F9PA 2GV6A 4B2BA 1ESAA 1EAXA 1EB1H 2B9LA 1YPHC 2QCYA 3SO3A 3I78A 1G9IE 1VJAU 1YPEH 4DVAU 1Y3VA 2ZDNA 1O3PB 1BITA 2Y82A 5GIBA 4MPUA 3BTQE 1BBRK 1HAYB 4X8VH 3SJ9A 5A0CA 1ZPBA 1LMWB 4BAOB 4MNXA 1SGTA 5ESTE 3GOVB 2FZZA 3BTFE 1O2WA 1CGIE 1O2PA 5F6MA 4X6OA 2XCNA 1NFUA 5DKMA 4OGYA 3FP6E 3GY7A 3ZZ9A 1ZTJA 2BDBA 3F9GA 1Q3XA 2W7UA 2VINA 2J94A 4U01A 4ABHA 1KYNA 2VH0A 1UTMA 2ZHQH 3P95A 4JZIA 1BOQA 1AFQC 1GG6B 2NU4E 5A8XA 1AE8H 1UTLM 2ZDAH 1V2QT 1K21H 4IGDA 4CREA 1BMMH 5F8XA 3GCHC 3PMBB 1A5HA 2RA3A 2XWAA 3CP7A 1GJ9B 5ABWA 2GZ9A 2Z9GA 2Z6BD 3UOUA 1A0HB 4FVBA 4FUFA 1DY9A 1FUJA 4ZHMU 4B1TA 4NIXA 1IQFA 1YCPM 3A84A 2WYJA 3O8RA 1C1UH 3M5LA 2J92A 4INKA 5F8TA 1VCWA 2Z9KA 2BTCE 3LIWA 1TPAE 4TY6A 4Z6AH 3RXPA 1TX6A 3GY4A 2BM2A 2HWLB 3TJVA 3GDSA 2H9TH 4FUJA 4GCHF 1O5CB 3E1XB 1PPFE 1YKTA 2J38A 4Y7AA 2C3SA 1K1OA 2A4RA 3EGKH 3MU0A 4H4FA 4UFFH 4SGBE 2LPRA 2QN5T 5DP4A 2PGBB 3SJ8A 2ALVA 1TPPA 1D3PB 2BD7A 1GHYH 1UHBA 5TJXA 1GBDA 2CN0H 3UOPA 2A1DB 3T26A 5JYIA 3D65E 1G3CA 2BQ7B 1WAYB 1GBIA 2UUYA 5EXMA 2OP9A 1MD8A 3LGYA 3DHKH 1MBMA 1MAYA 1TX8A 3KL6A 2BQ6B 1FDPA 1UVTH 1ANDA 2PKAA 1DANH 1NU7B 3QN7A 1FJSA 4B75A 4YOGA 5BRRE 4IC6A 1KXAA 1UCYK 3PO1B 1O3CA 1QRWA 1INCA 3SUEA 3CS7A 2FOMB 2BOKA 4X8SH 2ZDVH 4OS5A 5DP8A 3BTKE 2AYWA 2ZDMA 4ISIH 5FX6A 1JIRA 1O2IA 1LHGH 1EZSC 1D9IA 3LJOA 4INHA 2Q1JA 1V2UT 1KXCA 3H5CB 2ZFFH 1ZRKA 1GCDA 2VIOA 4FU9A 1THRH 3PLPA 1TGBA 2UUKB 1O30A 3U1IB 2R3UA 3BTME 4PROA 1K1IA 4ISLA 3SNDA 2V3OH 2VVVA 3T29A 1C2JA 4NSVA 1H8DH 1UTQA 2ZU4A 3OSYA 1P12E 3V13A 1EZUC 1P3EA 1GJ8B 2NWNA 1MTUA 3QZRA 1TYNA 1O3AA 1F92A 1S0RA 2OBQA 3DT0H 1C1WH 4UONA 1NPMA 1GWAA 2ZTXA 1WTHD 2PGQB 1UO6A 2KAIB 4XE4A 1EB2A 2ZHFH 5L6NH 3A80A 3UR6A 4RKJB 3Q3YA 1ZHPA 1K9OE 4CR5A 1MTNC 3VEQB 2OCVB 1A3BH 3P8NA 1DE7H 3M5NA 1B5GH 3R0FA 4F49A 5T6DA 1OOKB 5E0JA 3NZIA 1OKXA 1ZSLA 3RXTA 1DSTA 4DIIH 1ZPCA 2BVRH 3TH3H 3LONA 3RXSA 1SGPE 1C5TA 3B8JA 1KXFA 1LHEH 4IMQA 3ZV8A 1VITH 1QNJA 3GCOA 3M7UA 1NC6A 3MFJA 2FOFA 2WYGA 1SSXA 1TRNA 1AGJA 1MU8B 3A8AA 1JOUB 2ZHDA 1MU6B 2ASUB 2Y80A 1GDUA 3M3VA 3MNSA 1EX3A 1BTXA 3A8DA 6LPRA 2BQWB 3KGPA 2EEKA 3L6PA 2OC1A 2CHAB 4AYYB 4D7FA 1DPOA 5A2MH 1C5PA 1C5WB 1MZDA 1UVPA 3HGPA 1NROH 4JZEH 2ODYB 5FXLA 1EATA 5DG6A 1O5BB 1TX7A 1SPJA 4A7IB 1BTHH 3GCNA 2WPHS 1O5GH 3M7QA 1XMNB 2OINA 4A92A 3BTHE 1G37A 1W2KH 1CO7E 1SBWA 1EP6A 4FUHA 3SORA 6ESTA 5AFZH 2HLCA 2F91A 1JWTA 2IOTA 2GMTB 3GDVA 1HXEH 1O2RA 1UTNA 3MNXA 1GI0A 4NIYA 4J1YA 4LOYH 4NZQA 1PJPA 5PTPA 3IWMA 2BHGA 2Y81A 1X7AC 1DX5M 2XC5A 3TK5A 1QJ7B 4D9RA 1XXDA 1OX1A 4DURA 2FDAA 1WYKA 1XUKA 2QXHA 1KDQB 1GHWH 1ZMJA 5ESBA 1QRZA 4SGAE 3SNCA 1UTPA 2G5NA 1ZJDA 1Y3YA 3GYLB 4MNWA 1C2HA 1P3CA 3SHCH 3L33A 3S7KB 1GMDF 3UY9A 3GDUA 3TLOA 1VGCC 3E91A 3LGIA 2V35A 4Y8ZA 1K28D 3SUDA 1YLCA 3OTJE 4YLUA 3BG4B 4FUEA 1LPGB 4Y76A 4I8KA 1BIOA 2ZF0H 1F5RA 1P0SH 5DP5A 1SOZA 4UEHH 2M5TA 2PSYA 2PWXA 1O2NA 1QJ1B 1WOFA 2ZPRA 2VGCB 2P94A 1GBCA 1DXPA 7ESTE 5HMAA 3SGQE 1GI1A 2B0FA 2H1UA 4FU7A 3RLWH 1SOTA 1C5UA 5F8ZA 5FBIA 1FPHH 3SU0A 1GGDC 3SW2B 2HNTF 2KAIA 1P2NA 1DWDH 4WMDA 1P11E 1GBMA 1NFWA 4Y6DA 1EASA 3RM0H 3U69H 4Y11E 1SG8B 1P9SA 1GBHA 1H9IE 4MPWA 3LH1A 1Y5UT 3A88A 5T6FA 3MO6A 1GG6C 3VGCC 5K7RA 4Y79A 1ELAA 2XRCA 2WPKS 4CRCA 2QXGA 3RC6A 2ZGHA 5L2ZH 3S69A 1WBGB 1LO6A 1XM1A 1ELBA 2J95A 4ASHA 1BCUH 1ZGIA 2ZHEH 1LVBA 5DK1A 2XC0A 1BHXF 3LGTA 1EPTC 1MKWK 3PLKA 3VB7A 1GBEA 1QR3E 2ZTZA 1GJ6A 1RIWC 1NRRH 5JBTA 2GGVB 1Y3UA 2FMJA 1FZZA 2Z9LA 2ZQ1A 5HYOA 1TNLA 2W3KA 3T25A 5C5OA 3LDXH 3ZVFA 1JBUH 1GI9B 1KIGH 2TPIZ 4AFUA 3I77A 2QF0A 2VJ1A 2G51A 1XVOA 3VXEH 1ZJKA 1IQKA 4OS4A 2FX6A 3SQEE 1V2ST 5FHTA 4Y71A 1N6XA 2ZKSA 3SZNA 5AF9H 1WQVH 2TGDA 3MHWU 1F0SA 1EAIA 2P16A 3MH6A 1C1RA 3V0XA 3OY5U 1O5DH 1W0ZU 4JZDH 1P02A 3LGVA 2VWOA 2Y7ZA 2ZU1A 3LKWA 1G3DA 4DCDA 4MTBA 1V6DA 3MH4A 1P06A 3SU2A 1TMBH 2IN2A 1N8OB 2DE8A 2ZFTA 1C5LH 3MNBA 3D62A 3SJIA 3UQVA 2HNTC 1W0YH 2BD5A 1P2IA 7GCHG 1GHZA 1NM6A 3PO1C 1CGHA 1NY22 2QYIA 4BXSA 4ABFA 1TQ7B 2OUAA 2P3UB 3RUOA 3RXFA 2EI7A 2OC7A 1KDQA 4ZAEA 2ZFSA 5FCRA 1MQ6A 1FAXA 3SN8A 3L3TA 5AFYH 3G01A 3O8BA 1FXYA 2XWBI 1A5IA 1G32B 4B74A 3E6PH 1QB1A 1C2IA 1HAOH 1V2VT 3NKKA 3UPEA 2GKVE 1TRYA 1G3BA 4Q7ZA 2RG3A 3KN2A 1T8LA 1L1GA 1HV7A 3FZZA 5LGOA 1O2MA 3LOXA 1O3HA 1UTOA 1V2TT 2BVXH 1O0DH 3Q00A 1TOCB 1P8VC 5L30H 3A7TA 4ESTE 4I8JA 2ZECA 4A1XA 1A5GH 3TK9A 1AZZA 2XCFA 4IN1A 4MNVA 3FFGA 2GCTB 1LVYA 3LGUA 3LPRA 1JMOH 1B7XB 4GVUA 4ZKSU 2Y5HA 5IYTA 2XYAA 1BMNH 1DWCH 3F9FA 1HJ8A 1XVMA 4ABIA 5DGJA 1C5ZB 4MG3A 3PROA 1UK3A 4CRFA 1DLKB 2VB0A 4AFZA 1C5MD 3NXPA 2OXSA 3A86A 4I33A 1MUEB 1BTPA 2AFQB 5A0BA 3TGKE 1GI3A 2ESTE 4R0IA 3BSQA 2SNWA 1W11U 4IBLH 3M37A 1P2KA 2SGFE 1GBBA 1SL3A 1AU8A 4RSPA 2NU3E 2ZG0H 4X6NA 5FBEA 1S83A 1Y3WA 1RTFB 2VIQA 1UTJA 5JDUB 1GJ7B 4INLA 3ODDA 3SV9A 5GDSH 1QBNA 2FOGA 4IMZA 2TIOA 4NA9H 3ELAH 1XUGA 1KSNA 2AMQA 1QRXA 1O3DA 3FAOA 3P8GA 1VZQH 1GDQA 2BD2A 3ZVCA 1OYTH 1C1MA 1A46H 3RU4T 3PWCA 2BDYA 2FESH 1TBZH 5EOKA 2F9VA 4KGAA 5DJ7A 5C67A 1O3KA 4AGJA 3PMHB 2Z9IA 3ZV9A 4DY7B 1SQTA 1W3CA 2OBOA 1V2NT 2BDCA 5LH8A 1EJMA 2PSXA 3K9XB 2BD3A 1A0LA 1YM0A 3E3TA 1LPZB 4Q7YA 1RD3B 4FVDA 3EYDA 1O2HA 4ZXYH 2GX4A 1MTWA 2BDAA 1ETTH 2ZWLH 2XTTB 1ZSKA 3SUGA 2BB4A 2WUCA 1K22H 1ZYOA 2P8OB 1K2I1 1EZXC 1J14A 1E35B 4UDWH 3LU9B 5FX5A 1GCTB 1CGJE 3ATWA 1T7CA 2CF9H 1TIOA 3A81A 4Q7XA 1AWFH 5J4SA 3VXFH 1GVKB 1QJ6B 4FUCA 1DUEA 3RXGA 3ATLA 3E8LA 2FPZA 1NFYA 1O3NA 3Q3XA 1HB0B 2H5DA 4B2AA 2CJIA 3FZDA 3IITA 2XBYA 1XUHA 1C2LA 2B8OH 3BIUH 1Q2WA 3OX7U 1CQQA 2FM2A 4I8LA 4HI3A 1AVGH 1SQOA 2G8TA 7GCHF 1RRKA 5EW2H 1C5OH 1NESE 3TK6A 4JMYA 2VNTA 1FY5A 5C1YA 2ZCLP 1QHRB 1EXFA 1RTKA 2OLGA 3RC5A 4JK6A 3S0NA 3U1JB 2C8XB 3SV6A 3MU4A 4Y10E 2WPJS 2O8MA 3BG4C 1ARBA 5C3NA 3RXJA 4ABEA 1ZOMA 4I8GA 1C5VA 3P8OA 1TBQH 3MTYA 1OWJA 1LCYA 1LHDH 1C2FA 7LPRA 2H2ZA 1GMCG 4VGCB 1DVAH 5E0HA 2YNBA 4NSYA 1PPCE 1AI8H 1EOLA 5JBAS 1PQ8A 4NWKA 1E36B 5JB9S 1SLVB 1BJVA 4AYVB 5A8ZA 2VVUA 4ZHLU 3TJNA 1GI6A 1GDNA 2YOLA 1GHBG 5H4IB 2V6NA 2J4IA 1GL1A 2A5AA 2H6MA 5T6GA 2GCHG 2A7CA 4O03A 2AMDA 2BDGA 1GMDG 3BTGE 1HCGA 4XSKU 3K2UA 1QQ4A 1UK4A 4E05H 2WUBA 5DP9A 1SFQB 4DOQA 1LVOA 3GY6A 3ODFA 2G4UA 2ZGXH 3U8OH 3DFJA 2H9EH 3LGWA 1BMLA 1OS8A 5GJ4B 1ZMLA 3VB5A 2W5EA 1SGEE 1OSSA 2BLWA 1GBFA 2O8UA 5I25A 5JPMH 3RU4E 3MO3A 4X1NU 2ZO3H 2FS8A 1V2KT 2Z9JA 4OS2A 4BAHB 1FQ3A 1U6QA 5E2OA 4LK4A 1CBWB 2P3TB 1LQEA 1Y5AT 1CU1A 1TNIA 3RLYH 4X2YA 1MBQA 4K60A 5BPEA 3HKIB 3MH5A 4DIHH 1QA7A 1C4V2 4TY7A 2BYAX 3ATMA 5EGMA 3F6UH 5HM2A 1S82A 1JXPA 1TLDA 1YPGH 1C2GA 3RXIA 2THFB 1PPEE 2FODA 4ZKNU 3SU1A 1FNIA 3AW0A 2GZ8A 1H4WA 1F7ZA 1O2SA 1P05A 3JZ2B 4CRGA 2G55A 4DG4A 2ZU2A 2VU8E 4UFDH 1SGNE 3KNXA 5EXLA 4HFPB 3SOSA 1CVWH 3MYWA 3WY8A 2I6SA 2I6QA 2BZ6H 1ARCA 1BA8B 1NO9H 1HDTH 4ABJA 3QGJA 3TITA 4K8YA 4Y7BA 4D76A 3TNSA 2G00A 4X8UH 1VCPA 3FP8E 1A2CH 3A8BA 5J4QA 5T3HA 3BTWE 3C1KA 2WINI 1KXEA 3GY2A 4BTTB 4X2XA 3TGIE 1DWBH 1EAUA 1N6YA 1KLJH 1NRQH 3QX5H 1GJBB 1O3BA 1LKAA 1RXPA 2K1QA 2ZU3A 1PPZA 2J2UA 1P04A 2F3CE 2BOHB 4JYUH 3KCGH 8KME2 1NRSH 1TGSZ 2FI4E 5SGAE 4KKDA 4WWYA 4ZROA 4X8TH 1O36A 1OP0A 1KXBA 1BB0B 3EE0B 4WXIA 4D7GA 1C1TA 2OQUA 3CS0A 1YF4A 2FI5E 1SHYA 1J9CH 4CR9A 4BAKB 2BLQA 2C4FH 4ABDA 1Z71A 3A7WA 1O2LA 4XDEA 1RTLA 1EKBB 2AEIH 4AX9H 3S9AA 2PKSC 3PV4A 4YZUA 3F9EA 1UVOA 1WTGH 3RXQA 1O2VA 5JBBS 1IHTH 2XNIA 4KTCA 2D1JA 1Z1JA 1NN6A 1GMCF 1THPB 1SLWB 2VIVA 2QAAA 1XXFA 4CHAC 1ANCA 2HVXA 5TCCA 4OS6A 3A87A 3RXHA 3BG8A 4JCNA 4X2VA 2B7DH 3ZVEA 2SGEE 1OWIA 1W7GH 4NG9H 4X1QU 5TCAA 1TABE 3ZYEA 4YO9A 5I46H 3T28A 1JRSA 4MPXA 3MU1A 3OYPA 4ZH8A 1O5EH 2V0BA 4Q80A 2JETC 1GHBF 1YC0A 4FUIA 1GJCB 4I31A 1C2EA 1EJAA 1TGCA 1MKXH 1AKSA 2RDLA 3T27A 3UWIA 3DD2H 1F0UA 3E90B 2GCHF 1SI5H 1UVUH 1AHTH 1HRTH 2PLXA 2GP9B 1O3MA 1C4Y2 3F1SB 1AFQB 1CA0B 5A8YA 2DUCA 1XKAC 1PQ7A 1AQ7A 1BTWA 1O35A 2D2DA 4Z0KA 2BY6X 3EDXB 1O3OA 3QK1A 4KTUA 4U30A 2GDEH 1DXWA 1O39A 1IOEA 4UD9H 2PUXB 5DP7A 5GWZA 1EUFA 5E0GA 3V7TA 2A4QA 4UFGH 2A5KA 3SJOA 4AG1A 3RM2H 4WMFA 1MCVA 1QCPA 1THSH 2CV3A 1GJ5H 4U2WA 1DM4B 4K3JA 5C1UA 4D9QA 1K1PA 1YPHE 3RXEA 1D6RA 4UFEH 1GI7B 4JZFH 2C8WB 2JH0D 1LDTT 3ATIA 2ZGBH 3EA7A 1IAUA 1V2MT 1GI8B 3R3GB 1GVLA 2C8YB 2A7HA 3KEEA 4A1VA 5C20A 2GD4B 1SGYE 2G52A 2WV5A 1GMHF 1V2JT 2A45B 3ZVBA 4I32A 3RXDA 3ZZ6A 1H9HE 3P92A 3K6YA 2ALPA 1AVXA 4LZ1H 3M5OA 4K8BA 3FP7E 2AGEX 2SGAA 1Z8GA 1TMTH 2A32A 2NU0E 1G36A 4NFFA 1NZQH 3ZZ3A 1NFXA 5A0AE 4YOIA 4TPYA 3QZQA 1O2ZA 1ZGVA 1M9UA 2QY0B 1A61H 3OU0A 2BY9X 3JZ1B 1FV9A 2FTLE 1G2LA 1YPLH 4WF8A 5LPFA 1SGDE 1TBRH 1SGQE 1O2TA 1K1LA 2BD8A 3MNCA 2ZFPH 1C9PA 2SGDE 1Y3XA 3DFLA 5AVDA 5FPSA 4AZ2B 4NA8A 2FXRA 4YM9A 1WV7H 1ACBE 1ELVA 4GUXA 4BXWA 2FS9A 1WUNH 1O38A 1A3EH 1GHVH 3HKJB 1BQYA 4YESB 1TPOA 1LQDB 3SNAA 4ZUHA 4GPGA 1O3EA 2PW8H 1C2DA 1FY3A 2GV7A 2XXLA 1QIXB 2PTNA 4X1PU 2BZAA 4ABAA 1HNEE 3BN9A 3QWCH 1DDJA 2FO9A 3ZZDA 5LPRA 4NIVA 3O8CA 3RXLA 1SHHB 2BY8X 5K0HA 3ZVDA 1ELFA 1XUJA 3STJA 3UIRA 1AY6H 2Y6TA 1A7SA 1C2MA 2FI3E 4CRBA 1OP8A 5FPYA 1MTVA 3TVJB 1O2UA 1MTSA 1V2WT 1ESBA 1L4DA 2WPLS 2STAE 1L1NA 2Y7XA 2H5CA 2BVSH 2G81E 4UE7H 1FY1A 1D3DB 4E7RG 2R2WU 1ZTLA 1HGTH 1VCQA 1YYY1 3SU5A 2FP7B 4MLFB 1GBAA 4DGJA 3S9BA 1C9TA 1CHGA 1QB6A 1SVPA 4NCYA 3RP2A 1YCPH 1HBTH 4ISOA 4BAQB 2ZZUH 3KIDU 1NRPH 5C5NA 2BX4A 3HPTB 3HATH 1C1NA 4BTUB 2H9HA 1SFIA 3QUMP 4MQAA 1WQSA 2FOHA 3M7TA 1B0FA 2OD3B 1BTYA 4B2CA 2FOAA 1ELTA 3SQHE 2VIWA 3RMLH 4WVPE 8LPRA 3LJJA 3STIA 1FMGA
chains in the Genus database with same CATH superfamily
2PUQH 3BTEE 2FOBA 4AFQA 2VH6A 1EJNA 3QGNB 2Q6GA 1MD7A 2CXVA 1AE5A 2F9BH 1ZHRA 2IPHA 2WPIS 1HLTH 4IW4E 5A09A 1VITG 1BRAA 2GJGA 3NRLA 2ANMH 3QO6A 1QTFA 1TFXA 2UUFB 3BV9B 3QTOH 1SGFA 1EFRD 1GI4A 1BBRH 2F43B 2ZIQH 3F9HA 1BJUA 2ZC9H 2O9QA 3M61U 3GICB 2ULLA 1SMFE 2RCEA 3NPSA 1P03A 1TONA 1V2LT 2UWLA 4AB9A 2ZFRH 5ETXA 4FUGA 1GHAG 4KP0A 3TU7H 2DE9A 3URDA 3U8RH 1Z8JB 3Q3KA 1YCPK 3KQCA 4MVNA 2WZQA 4TYDA 1HAPH 2EA3A 1C4U2 3MOCA 2XBVA 2ANKH 2C90B 4K69A 1TWXB 1S84A 1EAWA 2VWNA 3A8CA 2FX4A 5C0TA 3M3SA 3SI3H 3ZYDA 1HUTH 1N1LA 1IQLA 2Z94A 1CT4E 1DY8A 1PYTD 4OGXA 1D3TB 2B5TB 4CH2B 2P93A 3P17H 4X2WA 4GHQA 4X1RU 2CHAC 3D23A 6CHAB 3TNTA 3PV5A 3P6ZB 1GL0E 4MPVA 3HK6B 1DFPA 1PFXC 1VGCB 3LC5A 3T5FH 1XUIA 1FN6A 3E0PB 1HAGE 5B6OA 3RU4D 3S7HB 4BTIB 1C1SA 1BRUP 2UWOA 1AVWA 2ZDLA 3FOAA 3SV7A 3UQOA 4ABGA 1IQNA 1TA2A 4Y8YA 3RC4A 1ETRH 1GBTA 4ABBA 1W8BH 3RXCA 1IQEA 2D26C 3BEIB 5EODA 2GMTC 1SLXB 5GCHG 1JRTA 1NU9A 2P59A 3SNBA 2BLVA 5HKKD 3NUMA 1F0TA 2J34A 5CHAB 5L2YH 3RDZA 1CT2E 3HGNA 1PPGE 1NBME 2ZHWH 4ISHH 3RXOA 2QXIA 1DT2A 2ODQA 1KTSB 4HTCH 1GGDB 1GBLA 2A4OA 4AORA 2VVCA 4AGKA 4B76A 1AB9B 4TWWA 1HIAB 3ITIA 2SNVA 1NS3A 1W10U 4BAMB 4M9FA 1A1RA 4MNYA 1CA0C 1PPBH 2FLBH 1UCYH 3VGCB 3RMNH 3RXUA 5C2ZA 3MMGA 2STBE 2O8TA 1YBWA 1O2YA 2A31A 2P3FH 3M36A 4FUBA 1ID5H 8GCHG 4RN6A 1SB1H 3MH7A 3GYMA 1K1NA 3P70B 1OYQA 1MAXA 1O2JA 3SU6A 3PTNA 1KY9A 1TNJA 1KTTB 1BTUA 4NWLA 3QDZB 4X6PA 3BEUA 1EPTB 1NTPA 2ZP0H 4E7NA 2VGCC 2GT7A 3URCA 1HAVB 1RIWB 4JYTA 2ZTYA 1E38B 1KMHB 1FONA 3V3MA 4ACBA 4BOHA 2TGAA 2GZ7A 1Z7KA 1P09A 1HJ9A 2ZQ2A 1ETSH 2FOEA 3KHVA 5EQSA 2ZPSA 1P9UA 2BXUH 2KZ4A 1S6HA 4FXGH 2QA9E 2BXTH 1F5LA 1C1VH 2SGQE 3UREA 3NWUA 1LHCH 1O5AB 3SJKA 1P2JA 1OWEA 3ZZ7A 4TPIZ 2FLRH 1TRMA 1MQ5A 1UJ1A 1P10A 3P8FA 3U98H 1PQ5A 1LTOA 1CA8B 4DJZB 1BRBE 1AD8H 1H1BA 1E34B 1S5SA 3UWJH 3ZZCA 1HJAB 1Z6JH 1FY8E 3B9FH 3A7YA 1C5RA 1TE0A 3PLBA 1QURH 1AKSB 3GISB 3DUXH 2HPQH 1VITF 4QT8C 1J15A 1XUFA 1GI2A 2AGGX 4MDSA 4NZLA 1ZMNA 1W14U 5IK2D 1C5YB 1LVMA 1O32A 1O2OA 4B6FA 3Q77A 3A7ZA 1Z1IA 4X0WU 3TH4H 1ELDE 1C2KA 1TOMH 2SGPE 4KTSA 1L2EA 2EI8A 1DITH 2ZCHP 4HGCA 1O2QA 4LXBH 4XBBA 5HM9A 1RGQA 3GCTG 2HVYB 1GHAF 2TGPZ 2ZNKH 1PPHE 3M3TA 5F03A 3N7EA 4YOJA 2JH6D 4OS7A 1EP5A 2C93B 5DP3A 3M35A 1SLUB 1TALA 1BTZA 1YP9A 1ZTKA 3T62A 2AS9A 5FCKA 4GHTA 2A2XH 2HGTH 4Y0ZE 4CRAA 1CSOE 3TH2H 3BTTE 1GMHG 1BHXB 1AFEH 3A7XA 2QC2A 3BF6H 2TGTA 5EPNA 2CMYA 2ZDKA 4YXWD 5E2PA 1L1JA 1DOJA 3KYGA 2A0QB 1BMAA 1GJDB 1IHSH 1F2SE 3A89A 5G4BA 3Q76A 3S9CA 4Y8XA 1LHFH 1N8OC 4IC5A 4ISNA 1O3FA 2ZFQH 1AWHB 1IQIA 3SHAH 1ANEA 1OWHA 3VFEA 2PV9B 2R3YA 4AG2A 4GSOA 1FPCH 4X1SU 4LZ4B 2BLOA 3UNRA 2HNTE 2KCAA 1QBOA 4FUDA 4Q2KA 3U28C 3VB3A 4E06H 1YLNA 5GCHF 3HK3B 3PTBA 1RS0A 1BZXE 3AAVA 1HIAA 2QV1A 3DSOA 1EQ9A 4XBDA 5DO4H 1DSUA 5EQRA 3IG6B 2BMGB 1V2RT 1QGFA 1DUAA 1FY4A 1O3IA 3SNEA 3NK8A 3VB4A 1CHOG 3ZZBA 1GJAB 4J2YB 3RXMA 1O2KA 1WDIA 2FOCA 2A4GA 1TNHA 1XX9A 4WXVA 3EA8A 4ZXXH 1YPKH 2J9NA 9LPRA 1Z8RA 1Y8TA 1HXFH 1YPJH 1K1JA 4NFEA 4Y0YE 1F5KU 1TPSA 1D6WA 1C1PA 2AMPA 1J8AA 4ZMAH 1Y5BT 1O34A 5EPYA 2GCTC 1EPTA 4K1SA 4A1TA 5JBCS 3PYHA 1O2GH 3BIVH 1HAVA 1T8MA 2ZI2H 2D8WA 8GCHF 3SV2H 2R9PA 2LNCA 1SR5C 4DW2U 4JZ1A 3FANA 4ZHAA 5EQQA 1L4ZA 1O3LA 5CDFE 1KLTA 3AASA 1ORFA 2A2QH 1K1MA 1BDAA 1BBRE 4CBOA 3SV8A 3B23B 3A7VA 1L0ZA 3KQDA 3TJOA 1IQMA 3N7DA 2HPPH 4FU8A 4XRNA 3F68H 2BY7X 2F83A 1QQUA 2L6OA 4FETA 2W3IA 4YLQH 3SU3A 3VB6A 3ZZ5A 3W94A 4AOQA 1PQAA 1GBJA 2TRMA 1MH0A 2GDDA 1A4WH 3RXAA 4BANB 4H6TA 2NU1E 1SQAA 3QLPH 2QXJA 1P2MA 1HPGA 2QGRA 1KXDA 3A83A 1ZHMA 1FAKH 1ABIH 1HAXB 1QB9A 3SGAE 1BMFD 2RA0A 1ZSJA 1UVSH 4AN7A 1IQGA 1ZPZA 2UUJB 3GY3A 4GLYA 3GCHB 3NCLA 3SUFA 1O3GA 4GAWA 1OXGA 1Z6EA 5FAHA 2AH4X 2PFEA 2Z3EA 3E16B 2G4TA 1G2MA 3TPIZ 1UMAH 1V2PT 4K1TA 3SI4H 4I7YH 3PRBA 1TGNA 2OC0A 4WH6A 1YPMH 4B73A 1V3XA 3PB1E 4OS1A 1MKWH 3EA9A 6CHAC 1T4UH 1AUTC 2JKHA 2XBWA 1KLIH 4I8HA 4CBNA 1D3QB 3UTUH 1AUJA 1O5FH 2Y5GA 1OWDA 3BTDE 1COWD 3WWFA 3GCTF 1T8NA 3ENSB 4NIWA 3LT3A 4XBCA 1TB6H 3ZZAA 8ESTE 3UB0A 3FVFB 3EAJA 2P8OC 3MU5A 2W26A 1WCZA 1E0FD 1BRCE 1ELCA 2OQ5A 4B71A 2VWLA 1GCTC 2BY5X 2HRVA 2SFAA 1RFNA 4XOJA 3ESTA 2PHBA 3ATKA 2TBSA 5CHAC 3TIUA 4WH8A 1B0EA 1W13U 5DP6A 4K1EA 3ZVAA 2ZCKP 1LPKB 1ZRBA 2G5VA 1Z8IB 3M5MA 1UCYE 2GT8A 2GTBA 1FIZA 4AFSA 1MKXK 1AB9C 5DPAA 1SGCA 2V3MA 2KCYA 4WJG2 1F0RA 1GBKA 4IN2A 3UUZA 4CRDA 4YT6H 1SC8U 2P95A 4KELA 2W7SA 1GJ4H 5HIYA 3PMJA 1QBVH 1FN8A 1YGCH 2V7QD 4ZKOU 1JIMA 1DLEA 3RXVA 1AIXH 2R0LA 5EW1H 2WSSD 3LC3A 1ESTA 3UFAA 5CE1A 1PYTC 1E37B 4RKOB 1D4PB 5EG4A 3A85A 1O31A 4YT7H 3ZZ4A 4DT7B 2ZPQA 4X6MA 7KMEH 1EOJA 2LELA 2QF3A 1MMJN 4THNH 5KGOA 1QFKH 2Z3CA 3CENA 4BNRA 3KQEA 3AW1A 5HGGA 1FIWA 6GCHG 1A0JA 1RJXB 4VGCC 1SGFG 1CHOF 2EI6A 5C1XA 3H7TA 5GXPA 3MWIU 1BUIA 3F2FA 4AB8A 3A82A 3RXRA 4H42U 2OTVA 3FKSD 1TMUH 2F9NA 1C1QA 2BDIA 1AZ8A 1GHXH 1VR1H 3GY5A 1H9LB 1TA6A 2BX3A 5EU8A 5HXFA 4D8NA 3SU4A 4TWYA 3UR9A 2W6ID 1T32A 3C27B 1YY3A 2AGIX 2FWWA 2ZGCA 3K65B 3I29A 2FTMA 3UNSA 1UK2A 1QL9A 2AIQA 2JJ2D 1P57B 3O8DA 3H09A 1SGIB 3SBKA 4A5TS 1G3EA 4O3TA 1HJAC 5EXNA 2CF8H 5IDKA 1J16A 3T2NA 2JDID 5E8EH 3MI4A 5CMXH 4O97A 1ELEE 1S85A 3H7OA 1GPZA 4H6SB 2PTCE 2CGAA 2AHME 1XKBC 4O9VA 1MTNB 2R0KA 2BD4A 1WU1A 1TAWA 2JJ1D 3MU8A 1AMHA 1C1OA 2XC4A 3TGJE 1HAHH 1NBMD 3PMAB 2R2MB 1Q31A 5JB8S 4NA7A 2OC8A 2BD9A 1HAZB 3KQBA 2Z7FE 2Z3DA 4CH8B 2A7JA 2ANYA 1ELGA 1O2XA 3PWBA 1MCTA 3MO9A 3V12A 1OWKA 5GPIB 2BDHA 3TJUA 2O8LA 4K5ZA 2WV4A 4GCHG 4R8TB 1CBWC 2EC9H 1HFDA 2C8ZB 4NGAH 3LH3A 1LKBA 1AO5A 1O3JA 5FPTA 1WXRA 2FIRH 1T31A 4WMEA 1TGTA 2GVFA 1CE5A 2WPMS 1YWUA 1AN1E 3AVZA 1J17T 1P2OA 2ILNA 3W95A 1W7XH 1HYLA 2A5IA 1FLEE 5C94A 1ZLRA 4M7GA 2IJOB 2AERH 2F9UA 2NU2E 2UWPA 2ANWA 1V2OT 1GVZA 1S0QA 3U8TH 1T4VH 1UHBB 4A6LA 2V3HH 1QL8A 5LPEA 3E0NB 4JK5A 2PKSB 1DICA 4F4OC 1YLDA 1TQ0B 2FEQH 3UNQA 1SGRE 3PM3A 1ANBA 1Y59T 1G30B 9ESTA 1P01A 2HALA 1NRNH 1IQJA 1O37A 2PR3A 1S81A 2RDEA 1ABJH 4CHAB 3K6ZA 2JH5D 3N7OA 3ZZ8A 2Y5FA 2ODPA 3RXBA 1H8HD 1HAIH 5AHGH 2ZGJA 1H8IH 2QIQA 1QY6A 2PKAB 1OPHB 1W12U 1MZAA 2O8WA 3QTVH 1TNKA 2ZU5A 3U9AH 2VIPA 1QA0A 1IQHA 4HZHA 1QL7A 2F9OA 2XW9A 3ZVGA 2HOBA 3OY6U 2JETB 2VWMA 1DS2E 2K8IA 3SGBE 1C5QA 1C5SA 4YTAA 2VIDA 3RXKA 4XFQA 3AAUA 3D49H 1UTKA 1O33A 1P2QA 3VPKA 1EZQA 3BEFB 1T8OA 1ZZZA 1TNGA 3RMMH 1C5XB 2YNAA 1C5NH 2ZEBA 3KF2A 2FYRA 1DWEH 1OP2A 1NT1A 1S6FA 3DA9B 1ZR0A 3EQ0H 3GY8A 3W1EA 5KEDA 1WSSH 1GI5A 1FI8A 4O3UA 3AK5A 1VJ9U 2XBXA 4K2YA 4WY3A 3RMOH 2ZA5A 6GCHF 1CT0E 1BT7A 2FYQA 4IS5A 4U32A 2Q6FA 4ZKRU 2AIPA 2Q6DA 4JYVH 2F9PA 2GV6A 4B2BA 1ESAA 1EAXA 1EB1H 2B9LA 1YPHC 2QCYA 3SO3A 3I78A 1G9IE 1VJAU 1YPEH 4DVAU 1Y3VA 2ZDNA 1O3PB 1BITA 2Y82A 5GIBA 4MPUA 3BTQE 1BBRK 1HAYB 4X8VH 3SJ9A 5A0CA 1ZPBA 1LMWB 4BAOB 4MNXA 4F55A 1SGTA 5ESTE 3GOVB 2FZZA 3BTFE 1O2WA 1CGIE 1O2PA 5F6MA 4X6OA 2XCNA 1NFUA 1E1QD 5DKMA 4OGYA 3FP6E 3GY7A 3ZZ9A 1ZTJA 2BDBA 3F9GA 1Q3XA 2W7UA 2VINA 2J94A 4U01A 4ABHA 1KYNA 2VH0A 1UTMA 2ZHQH 3P95A 4JZIA 1BOQA 1AFQC 1GG6B 2NU4E 5A8XA 1AE8H 1UTLM 2ZDAH 1V2QT 1K21H 4IGDA 4CREA 1BMMH 5F8XA 3GCHC 3PMBB 1A5HA 2RA3A 2XWAA 3CP7A 1GJ9B 5ABWA 2GZ9A 2Z9GA 5CHBA 2Z6BD 3UOUA 1A0HB 4FVBA 4FUFA 1DY9A 1FUJA 4ZHMU 4B1TA 4NIXA 1IQFA 2KM0A 1YCPM 3A84A 2WYJA 3O8RA 1C1UH 3M5LA 2J92A 4INKA 4I86A 5F8TA 1VCWA 2Z9KA 2BTCE 3LIWA 1TPAE 4TY6A 4Z6AH 3RXPA 1TX6A 3GY4A 2BM2A 2HWLB 3TJVA 4TT3D 3GDSA 2J5UA 2H9TH 4FUJA 4GCHF 1O5CB 2YMSD 3E1XB 1PPFE 1YKTA 2J38A 4Y7AA 2C3SA 1K1OA 2A4RA 3EGKH 3MU0A 4H4FA 4UFFH 4SGBE 2LPRA 2QN5T 5DP4A 2PGBB 3SJ8A 2ALVA 1TPPA 1D3PB 2BD7A 1GHYH 1UHBA 5TJXA 1GBDA 2CN0H 3UOPA 2A1DB 3T26A 5JYIA 3D65E 1G3CA 2BQ7B 1WAYB 1GBIA 2UUYA 5EXMA 2OP9A 1MD8A 3LGYA 3DHKH 3PV2A 1MBMA 1MAYA 1TX8A 3KL6A 2BQ6B 1FDPA 1UVTH 1ANDA 2PKAA 1DANH 1NU7B 3QN7A 1FJSA 4B75A 5KECA 4YOGA 5BRRE 4IC6A 1KXAA 1UCYK 3PO1B 1O3CA 3CNRA 1QRWA 1INCA 3SUEA 3CS7A 2FOMB 2BOKA 4X8SH 2ZDVH 4OS5A 5DP8A 3BTKE 2AYWA 3FN8A 2ZDMA 4ISIH 5FX6A 1JIRA 1O2IA 1LHGH 1EZSC 1D9IA 3LJOA 4INHA 2Q1JA 1V2UT 1KXCA 3H5CB 2ZFFH 1ZRKA 2YMSB 1GCDA 2VIOA 4FU9A 1THRH 3PLPA 1TGBA 2UUKB 1O30A 3U1IB 2R3UA 3BTME 4PROA 1K1IA 4ISLA 3SNDA 2V3OH 2VVVA 3T29A 1C2JA 4NSVA 1H8DH 1UTQA 2M2AA 2ZU4A 3OSYA 3VG8A 1P12E 3V13A 1EZUC 1P3EA 1GJ8B 2NWNA 1MTUA 3QZRA 1TYNA 1O3AA 1F92A 1S0RA 2OBQA 3DT0H 1C1WH 4UONA 1NPMA 1GWAA 2ZTXA 1WTHD 2PGQB 1UO6A 2KAIB 4XE4A 1EB2A 2ZHFH 5L6NH 3A80A 3UR6A 4RKJB 3Q3YA 1ZHPA 1K9OE 4CR5A 1MTNC 3VEQB 2OCVB 1A3BH 3P8NA 1DE7H 3M5NA 1B5GH 3R0FA 4F49A 5T6DA 1OOKB 5E0JA 3EE7A 3NZIA 1OKXA 4Q63A 1ZSLA 3RXTA 1DSTA 4DIIH 1ZPCA 1SQRA 2BVRH 3TH3H 3LONA 3RXSA 1SGPE 1C5TA 3B8JA 1KXFA 1LHEH 3F0PA 4IMQA 3ZV8A 1VITH 1QNJA 3GCOA 3M7UA 1NC6A 3MFJA 2FOFA 2WYGA 1E1RD 1SSXA 1TRNA 1AGJA 1MU8B 3A8AA 1JOUB 2ZHDA 1MU6B 2ASUB 2Y80A 1GDUA 3M3VA 3MNSA 1EX3A 1BTXA 3A8DA 6LPRA 2BQWB 3KGPA 2EEKA 3L6PA 2OC1A 2CHAB 4AYYB 4D7FA 1DPOA 5A2MH 1C5PA 1C5WB 1MZDA 1UVPA 3HGPA 1NROH 4JZEH 2ODYB 5FXLA 1EATA 5DG6A 1O5BB 1TX7A 1SPJA 4A7IB 1BTHH 3GCNA 2WPHS 1O5GH 3M7QA 1XMNB 2OINA 3DSPA 4A92A 3BTHE 1G37A 1W2KH 1CO7E 1SBWA 1EP6A 4FUHA 3SORA 6ESTA 5AFZH 2HLCA 2F91A 1JWTA 2IOTA 2GMTB 3GDVA 1HXEH 1O2RA 1UTNA 3MNXA 1GI0A 4NIYA 4J1YA 4LOYH 4NZQA 1PJPA 3WWBA 5PTPA 3IWMA 2BHGA 2Y81A 1X7AC 1DX5M 2XC5A 3TK5A 1QJ7B 4D9RA 3MQKC 1XXDA 1OX1A 4DURA 2FDAA 1WYKA 1XUKA 2QXHA 1KDQB 1GHWH 2OK5A 1ZMJA 5ESBA 1QRZA 4SGAE 3SNCA 1UTPA 4TSFD 2G5NA 1ZJDA 1Y3YA 3GYLB 4MNWA 1C2HA 1P3CA 3SHCH 3L33A 1FX0B 3S7KB 1GMDF 3UY9A 3GDUA 5EIYA 2HLDD 3TLOA 1VGCC 3E91A 3LGIA 2V35A 4Y8ZA 5HIZA 1K28D 3SUDA 1YLCA 3OTJE 4YLUA 3BG4B 4FUEA 1LPGB 4Y76A 4I8KA 1BIOA 2ZF0H 1F5RA 1P0SH 3F2HA 5DP5A 1SOZA 4UEHH 2M5TA 2PSYA 2PWXA 1O2NA 1QJ1B 1WOFA 2ZPRA 1E79D 2VGCB 2P94A 1GBCA 4P02A 1DXPA 7ESTE 5HMAA 3SGQE 1GI1A 2B0FA 2H1UA 4FU7A 3RLWH 1SOTA 1C5UA 2KFWA 2XOKD 5F8ZA 5FBIA 1FPHH 3SU0A 1GGDC 3SW2B 2HNTF 2KAIA 1P2NA 1DWDH 4WMDA 1P11E 1GBMA 1NFWA 4Y6DA 1EASA 3RM0H 3U69H 4Y11E 1SG8B 4Q4LA 1P9SA 1GBHA 1H9IE 4MPWA 3LH1A 3WW7A 1Y5UT 3A88A 5T6FA 3MO6A 1GG6C 3VGCC 5K7RA 4Y79A 3OAAD 1ELAA 2XRCA 2WPKS 4CRCA 2QXGA 3RC6A 2ZGHA 5L2ZH 3S69A 1WBGB 1LO6A 1XM1A 1ELBA 2J95A 4ASHA 1BCUH 1ZGIA 2ZHEH 1LVBA 5DK1A 2XC0A 1BHXF 3LGTA 2CK3D 1EPTC 1MKWK 3PLKA 3VB7A 1GBEA 1QR3E 2ZTZA 1GJ6A 1RIWC 1NRRH 5JBTA 2GGVB 1Y3UA 2FMJA 1OHHD 1FZZA 2Z9LA 2ZQ1A 5HYOA 1TNLA 2W3KA 3T25A 5C5OA 3LDXH 3ZVFA 1JBUH 1GI9B 1KIGH 2TPIZ 4AFUA 3I77A 2EQNA 2QF0A 2VJ1A 2G51A 1XVOA 3VXEH 1ZJKA 1IQKA 4OS4A 2FX6A 3SQEE 1V2ST 5FHTA 4Y71A 1N6XA 2ZKSA 3SZNA 5AF9H 1WQVH 2TGDA 3MHWU 1F0SA 1EAIA 2P16A 3MH6A 1C1RA 3V0XA 2IJD1 2WHXA 3OY5U 1O5DH 1W0ZU 4JZDH 1P02A 3LGVA 2VWOA 2Y7ZA 2ZU1A 3LKWA 1G3DA 4DCDA 4MTBA 1V6DA 3MH4A 1P06A 3SU2A 4Z1MD 1TMBH 2IN2A 1N8OB 4HG6A 4RT0A 2DE8A 2ZFTA 1C5LH 3MNBA 3D62A 3SJIA 3UQVA 2HNTC 1W0YH 2BD5A 1P2IA 7GCHG 1GHZA 1NM6A 3PO1C 1CGHA 1NY22 2QYIA 4BXSA 4ABFA 1TQ7B 2OUAA 2P3UB 3RUOA 3RXFA 2EI7A 2OC7A 1KDQA 4ZAEA 2ZFSA 5FCRA 1MQ6A 1FAXA 3PRDA 3L3TA 3SN8A 5AFYH 3G01A 3O8BA 1FXYA 2XWBI 1A5IA 1G32B 4B74A 3E6PH 1QB1A 1C2IA 1HAOH 1V2VT 3NKKA 3UPEA 2GKVE 1TRYA 1G3BA 4Q7ZA 2RG3A 3KN2A 1T8LA 1L1GA 1HV7A 3FZZA 5T1VA 5LGOA 1O2MA 3LOXA 1O3HA 1UTOA 1V2TT 2BVXH 1O0DH 3Q00A 1TOCB 1P8VC 2WV9A 5L30H 3A7TA 4ESTE 4I8JA 2ZECA 4A1XA 1VKYA 1A5GH 3TK9A 1AZZA 2XCFA 2VBCA 4IN1A 3FFGA 4MNVA 2PP6A 2GCTB 1LVYA 3LGUA 3LPRA 1JMOH 1B7XB 4GVUA 4ZKSU 2Y5HA 5IYTA 2XYAA 5EJZA 5EJLA 1BMNH 1DWCH 3F9FA 1HJ8A 1XVMA 4ABIA 5DGJA 1C5ZB 4MG3A 3PROA 1UK3A 4CRFA 1DLKB 2VB0A 4AFZA 1C5MD 3NXPA 2OXSA 3A86A 4I33A 1MUEB 1BTPA 2AFQB 5A0BA 3TGKE 1GI3A 2ESTE 4R0IA 3BSQA 2SNWA 1W11U 4IBLH 3M37A 1P2KA 2SGFE 1GBBA 1SL3A 1AU8A 4RSPA 2NU3E 2ZG0H 4X6NA 5FBEA 1S83A 1Y3WA 1RTFB 2VIQA 1UTJA 5JDUB 2EY4C 2LP6A 1GJ7B 4INLA 3ODDA 3SV9A 5GDSH 1QBNA 2FOGA 4IMZA 2TIOA 4NA9H 3ELAH 1XUGA 1KSNA 4XD7D 2AMQA 1QRXA 1O3DA 3FAOA 3P8GA 1VZQH 1GDQA 2BD2A 3ZVCA 1OYTH 1C1MA 1A46H 2F4LA 3RU4T 3PWCA 2BDYA 2FESH 1TBZH 5EOKA 2F9VA 4KGAA 5DJ7A 5C67A 1O3KA 4AGJA 3PMHB 2Z9IA 3ZV9A 4DY7B 1SQTA 1W3CA 2OBOA 1V2NT 2BDCA 3DSGA 5LH8A 1EJMA 2PSXA 3K9XB 4ZCNA 2BD3A 1A0LA 1YM0A 3E3TA 1LPZB 4Q7YA 1RD3B 4FVDA 3EYDA 1O2HA 4ZXYH 2GX4A 1MTWA 2BDAA 1ETTH 2ZWLH 2XTTB 1ZSKA 3SUGA 2BB4A 2WUCA 1K22H 1ZYOA 2P8OB 1K2I1 1EZXC 1J14A 1E35B 4UDWH 3LU9B 5FX5A 1GCTB 1CGJE 3ATWA 1T7CA 2CF9H 1TIOA 3F0OA 3A81A 4Q7XA 1AWFH 5J4SA 1W0KD 3VXFH 1GVKB 1QJ6B 2KX4A 1DUEA 4FUCA 2RFKC 5DSFA 3RXGA 3ATLA 3E8LA 2FPZA 1NFYA 1O3NA 3Q3XA 3SZEA 1HB0B 2H5DA 4B6EA 4B2AA 2CJIA 3FZDA 3IITA 2XBYA 1XUHA 1C2LA 2B8OH 3BIUH 1Q2WA 3OX7U 1CQQA 2FM2A 4I8LA 4HI3A 4AC9A 1AVGH 1SQOA 2G8TA 7GCHF 1RRKA 5EW2H 1C5OH 1NESE 3TK6A 4JMYA 2VNTA 1FY5A 5C1YA 2ZCLP 1QHRB 1EXFA 1RTKA 2OLGA 3RC5A 4JK6A 3S0NA 3U1JB 2C8XB 3SV6A 3MU4A 4Y10E 2WPJS 2KCOA 2O8MA 3BG4C 1ARBA 5C3NA 3RXJA 4ABEA 1ZOMA 4I8GA 1C5VA 3P8OA 1TBQH 3MTYA 1OWJA 1LCYA 1LHDH 1C2FA 7LPRA 2H2ZA 1GMCG 4VGCB 1DVAH 5E0HA 2YNBA 2KCPA 4NSYA 1PPCE 1AI8H 1EOLA 5JBAS 1PQ8A 4NWKA 1E36B 5JB9S 1SLVB 1BJVA 4AYVB 5A8ZA 2VVUA 4ZHLU 3TJNA 1GI6A 1GDNA 1H8ED 2YOLA 1GHBG 5H4IB 2V6NA 2J4IA 1GL1A 2A5AA 4F48B 2H6MA 5T6GA 2GCHG 3OEHD 2A7CA 4O03A 2AMDA 2BDGA 1GMDG 3BTGE 1HCGA 4XSKU 3F3BA 3K2UA 5F53A 1QQ4A 1UK4A 4E05H 2WUBA 5DP9A 1SFQB 4DOQA 1LVOA 3GY6A 3ODFA 2G4UA 2ZGXH 3U8OH 3DFJA 2H9EH 3LGWA 3OE7D 1BMLA 1OS8A 5GJ4B 4FOUC 1ZMLA 3VB5A 2W5EA 1SGEE 1OSSA 2BLWA 1GBFA 2O8UA 5I25A 5JPMH 3RU4E 3MO3A 4X1NU 2KR7A 2ZO3H 2FS8A 1V2KT 2Z9JA 4OS2A 4BAHB 1FQ3A 1U6QA 5E2OA 4LK4A 1CBWB 2P3TB 1LQEA 1Y5AT 1CU1A 1TNIA 3RLYH 4X2YA 1MBQA 4K60A 5BPEA 3HKIB 3MH5A 4DIHH 3FO8D 1QA7A 1C4V2 4TY7A 2BYAX 3ATMA 5EGMA 3F6UH 5HM2A 1S82A 1JXPA 1TLDA 1YPGH 1C2GA 3RXIA 2THFB 1PPEE 2FODA 4ZKNU 3SU1A 1FNIA 3AW0A 2GZ8A 1H4WA 1F7ZA 1O2SA 1P05A 3JZ2B 4CRGA 2G55A 4DG4A 2ZU2A 2VU8E 4UFDH 1SGNE 3KNXA 5EXLA 4HFPB 3SOSA 1CVWH 3MYWA 3WY8A 2I6SA 2I6QA 2BZ6H 1ARCA 1BA8B 1NO9H 1HDTH 2IPQX 4ABJA 3QGJA 3TITA 4K8YA 4Y7BA 4D76A 3TNSA 2G00A 4X8UH 1VCPA 3FP8E 1A2CH 3A8BA 5J4QA 5T3HA 3BTWE 5EJ1A 3C1KA 2WINI 1KXEA 3GY2A 4BTTB 4X2XA 1MABB 3TGIE 1DWBH 1EAUA 1K0HA 1N6YA 1KLJH 1NRQH 3QX5H 1GJBB 1O3BA 2XNDD 1LKAA 1RXPA 2K1QA 2ZU3A 1PPZA 2J2UA 1P04A 2F3CE 2BOHB 4JYUH 3KCGH 8KME2 1NRSH 1TGSZ 2FI4E 5SGAE 4KKDA 4WWYA 4ZROA 4X8TH 1O36A 1OP0A 1KXBA 1BB0B 3EE0B 4WXIA 4D7GA 1C1TA 2OQUA 3CS0A 1YF4A 2FI5E 1SHYA 1J9CH 4CR9A 4BAKB 2BLQA 2C4FH 4ABDA 1Z71A 3A7WA 1O2LA 4XDEA 1RTLA 1EKBB 2AEIH 4AX9H 3S9AA 2PKSC 3PV4A 4YZUA 3F9EA 1UVOA 1WTGH 3RXQA 1O2VA 5JBBS 1IHTH 2XNIA 4KTCA 2D1JA 1Z1JA 1NN6A 1GMCF 1THPB 1SLWB 2VIVA 2QAAA 1XXFA 4CHAC 1ANCA 2HVXA 1UW7A 5TCCA 4OS6A 3A87A 3RXHA 3BG8A 4JCNA 4X2VA 2B7DH 3ZVEA 2SGEE 1OWIA 1W7GH 4NG9H 4X1QU 5TCAA 1TABE 3ZYEA 4YO9A 5DN6D 5I46H 3T28A 1JRSA 4MPXA 3MU1A 3OYPA 4ZH8A 1O5EH 2V0BA 4Q80A 2JETC 1GHBF 1YC0A 4FUIA 1SKYE 1GJCB 3SYJA 4I31A 1C2EA 1EJAA 1TGCA 1MKXH 1AKSA 2JIZD 2RDLA 3T27A 3UWIA 3DD2H 1F0UA 3E90B 4RT1A 2GCHF 1SI5H 1UVUH 1AHTH 5C0UA 1HRTH 2PLXA 2GP9B 1O3MA 1C4Y2 3F1SB 1AFQB 1CA0B 5A8YA 2DUCA 1XKAC 1PQ7A 1AQ7A 1BTWA 1O35A 2D2DA 4Z0KA 3UAIC 2BY6X 3EDXB 3F2GA 1O3OA 3QK1A 4KTUA 4U30A 2GDEH 1DXWA 1O39A 1IOEA 4P00A 4UD9H 2PUXB 4ASUD 2J98B 5DP7A 5GWZA 1EUFA 5E0GA 3V7TA 2A4QA 4UFGH 2A5KA 3SJOA 4AG1A 3RM2H 4WMFA 1MCVA 4OM9A 1QCPA 1THSH 1S6LA 2CV3A 1GJ5H 4U2WA 1DM4B 4K3JA 5C1UA 4D9QA 1K1PA 1YPHE 3RXEA 1D6RA 4UFEH 3KQ5A 1GI7B 4JZFH 2C8WB 2JH0D 1LDTT 3OTPA 3ATIA 2ZGBH 3EA7A 1IAUA 1V2MT 1GI8B 3R3GB 1GVLA 1W0JD 2C8YB 2A7HA 3KEEA 4A1VA 3OFND 5C20A 2GD4B 1SGYE 2G52A 2WV5A 1GMHF 1V2JT 2A45B 3ZVBA 4I32A 2QF4A 3RXDA 3ZZ6A 1H9HE 3P92A 3K6YA 2ALPA 1AVXA 2WPDD 3M5OA 4K8BA 4LZ1H 3FP7E 2AGEX 2SGAA 1Z8GA 1TMTH 2A32A 2NU0E 1G36A 4NFFA 5GNDA 1NZQH 3ZZ3A 1NFXA 5A0AE 2K0QA 4YOIA 4TPYA 3QZQA 5B6LA 1O2ZA 1ZGVA 1M9UA 2QY0B 1A61H 3OU0A 2BY9X 3JZ1B 1FV9A 2FTLE 3OEED 1G2LA 1YPLH 4WF8A 2W6JD 5LPFA 4ACAA 1SGDE 1TBRH 1SGQE 1O2TA 1K1LA 2BD8A 3MNCA 2ZFPH 1C9PA 2SGDE 1Y3XA 3DFLA 5AVDA 5FPSA 4AZ2B 4NA8A 2FXRA 4YM9A 1WV7H 1ACBE 1ELVA 4GUXA 4BXWA 2FS9A 1WUNH 1O38A 1A3EH 1GHVH 2QF5A 1BQYA 3HKJB 4YESB 1TPOA 3ZIAD 1LQDB 3SNAA 4ZUHA 4GPGA 1O3EA 2PW8H 1C2DA 1FY3A 2GV7A 2XXLA 1QIXB 2PTNA 4X1PU 2BZAA 4ABAA 1HNEE 3BN9A 3QWCH 1DDJA 3N99A 2FO9A 3ZZDA 5C17A 4NIVA 5LPRA 3O8CA 3RXLA 1SHHB 2BY8X 5K0HA 3KYFA 3ZVDA 1ELFA 1XUJA 3STJA 3UIRA 1AY6H 2Y6TA 2J97A 1A7SA 1C2MA 2FI3E 4CRBA 1OP8A 5FPYA 1MTVA 3TVJB 1O2UA 1MTSA 1V2WT 1ESBA 1L4DA 2WPLS 2STAE 1L1NA 2Y7XA 1QZ8A 2BVSH 2H5CA 2G81E 4UE7H 1FY1A 3GS9A 1D3DB 4DT4A 4E7RG 2R2WU 5FL7D 1ZTLA 3DCLA 1HGTH 1VCQA 1YYY1 3SU5A 2L74A 2FP7B 4MLFB 1GBAA 4DGJA 3S9BA 1C9TA 1CHGA 1QB6A 1SVPA 4NCYA 3RP2A 1YCPH 1HBTH 4ISOA 4BAQB 2ZZUH 3KIDU 1NRPH 5C5NA 2BX4A 2YMSC 3HPTB 3HATH 1C1NA 4BTUB 2H9HA 1SFIA 3QUMP 4MQAA 2QE7D 1WQSA 2FOHA 3M7TA 4RI0A 1B0FA 2OD3B 2J98A 1BTYA 4B2CA 2FOAA 1ELTA 3SQHE 2VIWA 3RMLH 4WVPE 8LPRA 3LJJA 3STIA 1FMGA
chains in the Genus database with same CATH topology
2PUQH 3BTEE 2FOBA 4AFQA 2VH6A 1EJNA 3QGNB 2Q6GA 1MD7A 2CXVA 1AE5A 2F9BH 1ZHRA 2IPHA 2WPIS 1HLTH 4IW4E 5A09A 1VITG 1BRAA 2ANMH 3QO6A 1QTFA 1TFXA 2UUFB 3BV9B 3QTOH 1SGFA 1GI4A 1BBRH 2ZIQH 3F9HA 1BJUA 2ZC9H 2O9QA 3M61U 3GICB 2ULLA 1SMFE 2RCEA 3NPSA 1P03A 1TONA 1V2LT 2UWLA 4AB9A 2ZFRH 5ETXA 4FUGA 1GHAG 4KP0A 3TU7H 2DE9A 3URDA 3U8RH 1Z8JB 3Q3KA 1YCPK 3KQCA 4MVNA 4TYDA 1HAPH 2EA3A 1C4U2 3MOCA 2XBVA 2ANKH 2C90B 4K69A 1TWXB 1S84A 1EAWA 2VWNA 3A8CA 2FX4A 3M3SA 3SI3H 3ZYDA 1HUTH 1N1LA 1IQLA 2Z94A 1CT4E 1DY8A 1PYTD 4OGXA 1D3TB 2B5TB 4CH2B 2P93A 3P17H 4X2WA 4GHQA 4X1RU 2CHAC 3D23A 6CHAB 3TNTA 3P6ZB 1GL0E 4MPVA 3HK6B 1DFPA 1PFXC 1VGCB 3LC5A 3T5FH 1XUIA 1FN6A 3E0PB 1HAGE 5B6OA 3RU4D 3S7HB 4BTIB 1C1SA 1BRUP 2UWOA 1AVWA 2ZDLA 3SV7A 3UQOA 4ABGA 1IQNA 1TA2A 4Y8YA 3RC4A 1ETRH 1GBTA 4ABBA 1W8BH 3RXCA 1IQEA 2D26C 3BEIB 5EODA 2GMTC 1SLXB 5GCHG 1JRTA 1NU9A 2P59A 3SNBA 2BLVA 3NUMA 1F0TA 2J34A 5CHAB 5L2YH 3RDZA 1CT2E 3HGNA 1PPGE 2ZHWH 4ISHH 3RXOA 2QXIA 2ODQA 1DT2A 1KTSB 4HTCH 1GGDB 1GBLA 2A4OA 4AORA 2VVCA 4AGKA 4B76A 1AB9B 4TWWA 1HIAB 3ITIA 2SNVA 1NS3A 1W10U 4BAMB 1A1RA 4MNYA 1CA0C 1PPBH 2FLBH 1UCYH 3VGCB 3RMNH 3RXUA 5C2ZA 3MMGA 2STBE 2O8TA 1YBWA 1O2YA 2A31A 2P3FH 3M36A 4FUBA 1ID5H 8GCHG 4RN6A 1SB1H 3MH7A 3GYMA 1K1NA 3P70B 1OYQA 1MAXA 1O2JA 3SU6A 3PTNA 1KY9A 1TNJA 1KTTB 1BTUA 4NWLA 3QDZB 4X6PA 3BEUA 1EPTB 1NTPA 2ZP0H 4E7NA 2VGCC 2GT7A 3URCA 1HAVB 1RIWB 4JYTA 2ZTYA 1E38B 1FONA 3V3MA 4BOHA 2TGAA 2GZ7A 1Z7KA 1P09A 1HJ9A 2ZQ2A 1ETSH 2FOEA 3KHVA 5EQSA 2ZPSA 1P9UA 2BXUH 1S6HA 4FXGH 2QA9E 2BXTH 1F5LA 1C1VH 2SGQE 3UREA 3NWUA 1LHCH 1O5AB 3SJKA 1P2JA 1OWEA 3ZZ7A 4TPIZ 2FLRH 1TRMA 1MQ5A 1UJ1A 1P10A 3P8FA 3U98H 1PQ5A 1LTOA 1CA8B 4DJZB 1BRBE 1AD8H 1H1BA 1E34B 1S5SA 3UWJH 3ZZCA 1HJAB 1Z6JH 1FY8E 3B9FH 3A7YA 1C5RA 1TE0A 3PLBA 1QURH 1AKSB 3GISB 3DUXH 2HPQH 1VITF 4QT8C 1J15A 1XUFA 1GI2A 2AGGX 4MDSA 4NZLA 1ZMNA 1W14U 1C5YB 1LVMA 1O32A 1O2OA 3Q77A 3A7ZA 1Z1IA 4X0WU 3TH4H 1ELDE 1C2KA 1TOMH 2SGPE 4KTSA 1L2EA 2EI8A 1DITH 2ZCHP 4HGCA 1O2QA 4LXBH 4XBBA 5HM9A 1RGQA 3GCTG 1GHAF 2TGPZ 2ZNKH 1PPHE 3M3TA 5F03A 4YOJA 2JH6D 4OS7A 1EP5A 2C93B 5DP3A 3M35A 1SLUB 1TALA 1BTZA 1YP9A 1ZTKA 3T62A 2AS9A 5FCKA 4GHTA 2A2XH 2HGTH 4Y0ZE 4CRAA 1CSOE 3TH2H 3BTTE 1GMHG 1BHXB 1AFEH 3A7XA 2QC2A 3BF6H 2TGTA 5EPNA 2CMYA 2ZDKA 5E2PA 1L1JA 1DOJA 2A0QB 1BMAA 1GJDB 1IHSH 1F2SE 3A89A 5G4BA 3Q76A 3S9CA 4Y8XA 1LHFH 1N8OC 4IC5A 4ISNA 1O3FA 2ZFQH 1AWHB 1IQIA 3SHAH 1ANEA 1OWHA 3VFEA 2PV9B 2R3YA 4AG2A 4GSOA 1FPCH 4X1SU 4LZ4B 2BLOA 3UNRA 2HNTE 1QBOA 4FUDA 4Q2KA 3VB3A 4E06H 5GCHF 3HK3B 3PTBA 1RS0A 1BZXE 3AAVA 1HIAA 2QV1A 1EQ9A 4XBDA 5DO4H 1DSUA 5EQRA 3IG6B 2BMGB 1V2RT 1QGFA 1DUAA 1FY4A 1O3IA 3SNEA 3NK8A 3VB4A 1CHOG 3ZZBA 1GJAB 4J2YB 3RXMA 1O2KA 2FOCA 2A4GA 1TNHA 1XX9A 4WXVA 3EA8A 4ZXXH 1YPKH 2J9NA 9LPRA 1Z8RA 1Y8TA 1HXFH 1YPJH 1K1JA 4NFEA 4Y0YE 1F5KU 1TPSA 1D6WA 1C1PA 2AMPA 1J8AA 4ZMAH 1Y5BT 1O34A 5EPYA 2GCTC 1EPTA 4K1SA 4A1TA 5JBCS 3PYHA 1O2GH 3BIVH 1HAVA 1T8MA 2ZI2H 2D8WA 8GCHF 3SV2H 2R9PA 2LNCA 1SR5C 4DW2U 4JZ1A 3FANA 4ZHAA 5EQQA 1L4ZA 1O3LA 1KLTA 3AASA 1ORFA 2A2QH 1K1MA 1BDAA 1BBRE 4CBOA 3SV8A 3B23B 3A7VA 1L0ZA 3KQDA 3TJOA 1IQMA 2HPPH 4FU8A 3F68H 2BY7X 2F83A 1QQUA 2W3IA 4YLQH 3SU3A 3VB6A 3ZZ5A 3W94A 4AOQA 1PQAA 1GBJA 2TRMA 1MH0A 2GDDA 1A4WH 3RXAA 4BANB 4H6TA 2NU1E 1SQAA 3QLPH 2QXJA 1P2MA 1HPGA 2QGRA 1KXDA 3A83A 1ZHMA 1FAKH 1ABIH 1HAXB 1QB9A 3SGAE 2RA0A 1ZSJA 1UVSH 4AN7A 1IQGA 1ZPZA 2UUJB 3GY3A 4GLYA 3GCHB 3NCLA 3SUFA 1O3GA 4GAWA 1OXGA 1Z6EA 5FAHA 2AH4X 2PFEA 2Z3EA 3E16B 2G4TA 1G2MA 3TPIZ 1UMAH 1V2PT 4K1TA 3SI4H 4I7YH 4WH6A 1TGNA 2OC0A 1YPMH 4B73A 1V3XA 3PB1E 4OS1A 1MKWH 3EA9A 6CHAC 1T4UH 1AUTC 2JKHA 2XBWA 1KLIH 4I8HA 4CBNA 1D3QB 3UTUH 1AUJA 1O5FH 2Y5GA 1OWDA 3BTDE 3GCTF 1T8NA 3ENSB 4NIWA 3LT3A 4XBCA 1TB6H 3ZZAA 8ESTE 3FVFB 3EAJA 2P8OC 3MU5A 2W26A 1WCZA 1E0FD 1BRCE 1ELCA 2OQ5A 4B71A 2VWLA 1GCTC 2BY5X 2HRVA 2SFAA 1RFNA 4XOJA 3ESTA 2PHBA 3ATKA 2TBSA 5CHAC 3TIUA 4WH8A 1B0EA 1W13U 5DP6A 4K1EA 3ZVAA 2ZCKP 1LPKB 1ZRBA 2G5VA 1Z8IB 3M5MA 1UCYE 2GT8A 2GTBA 1FIZA 4AFSA 1MKXK 1AB9C 5DPAA 1SGCA 4WJG2 1F0RA 1GBKA 4IN2A 3UUZA 4CRDA 4YT6H 1SC8U 2P95A 4KELA 2W7SA 1GJ4H 3PMJA 1QBVH 1FN8A 1YGCH 4ZKOU 1JIMA 1DLEA 3RXVA 1AIXH 2R0LA 5EW1H 3LC3A 1ESTA 3UFAA 5CE1A 1PYTC 1E37B 4RKOB 1D4PB 5EG4A 3A85A 1O31A 4YT7H 3ZZ4A 4DT7B 2ZPQA 4X6MA 7KMEH 1EOJA 2QF3A 1MMJN 4THNH 1QFKH 2Z3CA 3CENA 4BNRA 3KQEA 3AW1A 5HGGA 1FIWA 6GCHG 1A0JA 1RJXB 4VGCC 1SGFG 1CHOF 2EI6A 5C1XA 3H7TA 5GXPA 3MWIU 1BUIA 4AB8A 3A82A 3RXRA 4H42U 2OTVA 1TMUH 2F9NA 1C1QA 2BDIA 1AZ8A 1GHXH 1VR1H 3GY5A 1H9LB 1TA6A 2BX3A 5EU8A 5HXFA 4D8NA 3SU4A 4TWYA 3UR9A 1T32A 3C27B 2AGIX 2FWWA 2ZGCA 3K65B 3I29A 2FTMA 3UNSA 1UK2A 1QL9A 2AIQA 1P57B 3O8DA 1SGIB 3SBKA 4A5TS 1G3EA 4O3TA 1HJAC 5EXNA 2CF8H 5IDKA 1J16A 3T2NA 5E8EH 3MI4A 5CMXH 4O97A 1ELEE 1S85A 3H7OA 1GPZA 4H6SB 2PTCE 2CGAA 1XKBC 4O9VA 1MTNB 2R0KA 2BD4A 1WU1A 1TAWA 3MU8A 1AMHA 1C1OA 2XC4A 3TGJE 1HAHH 3PMAB 2R2MB 1Q31A 5JB8S 4NA7A 2OC8A 2BD9A 1HAZB 3KQBA 2Z7FE 2Z3DA 4CH8B 2A7JA 2ANYA 1ELGA 1O2XA 3PWBA 1MCTA 3MO9A 3V12A 1OWKA 5GPIB 2BDHA 3TJUA 2O8LA 4K5ZA 2WV4A 4GCHG 4R8TB 1CBWC 2EC9H 1HFDA 2C8ZB 4NGAH 3LH3A 1LKBA 1AO5A 1O3JA 5FPTA 2FIRH 1T31A 4WMEA 1TGTA 2GVFA 1CE5A 2WPMS 1AN1E 3AVZA 1J17T 1P2OA 2ILNA 3W95A 1W7XH 1HYLA 2A5IA 1FLEE 1ZLRA 4M7GA 2IJOB 2AERH 2F9UA 2NU2E 2UWPA 2ANWA 1V2OT 1GVZA 1S0QA 3U8TH 1T4VH 1UHBB 4A6LA 2V3HH 1QL8A 5LPEA 3E0NB 4JK5A 2PKSB 1DICA 4F4OC 1YLDA 1TQ0B 2FEQH 3UNQA 1SGRE 3PM3A 1ANBA 1Y59T 1G30B 9ESTA 1P01A 2HALA 1NRNH 1IQJA 1O37A 2PR3A 1S81A 1ABJH 4CHAB 3K6ZA 2JH5D 3N7OA 3ZZ8A 2Y5FA 2ODPA 3RXBA 1HAIH 5AHGH 2ZGJA 1H8IH 2QIQA 1QY6A 2PKAB 1OPHB 1W12U 1MZAA 2O8WA 3QTVH 1TNKA 2ZU5A 3U9AH 2VIPA 1QA0A 1IQHA 4HZHA 1QL7A 2F9OA 2XW9A 3ZVGA 2HOBA 3OY6U 2JETB 2VWMA 1DS2E 3SGBE 1C5QA 1C5SA 4YTAA 2VIDA 3RXKA 4XFQA 3AAUA 3D49H 1UTKA 1O33A 1P2QA 3VPKA 1EZQA 3BEFB 1T8OA 1ZZZA 1TNGA 3RMMH 1C5XB 2YNAA 1C5NH 2ZEBA 3KF2A 2FYRA 1DWEH 1OP2A 1NT1A 1S6FA 3DA9B 1ZR0A 3EQ0H 3GY8A 1WSSH 1GI5A 1FI8A 4O3UA 1VJ9U 2XBXA 4K2YA 4WY3A 3RMOH 2ZA5A 6GCHF 1CT0E 1BT7A 2FYQA 4IS5A 4U32A 2Q6FA 4ZKRU 2AIPA 2Q6DA 4JYVH 2F9PA 2GV6A 4B2BA 1ESAA 1EAXA 1EB1H 2B9LA 1YPHC 2QCYA 3SO3A 3I78A 1G9IE 1VJAU 1YPEH 4DVAU 1Y3VA 2ZDNA 1O3PB 1BITA 2Y82A 5GIBA 4MPUA 3BTQE 1BBRK 1HAYB 4X8VH 3SJ9A 5A0CA 1ZPBA 1LMWB 4BAOB 4MNXA 1SGTA 5ESTE 3GOVB 2FZZA 3BTFE 1O2WA 1CGIE 1O2PA 5F6MA 4X6OA 2XCNA 1NFUA 5DKMA 4OGYA 3FP6E 3GY7A 3ZZ9A 1ZTJA 2BDBA 3F9GA 1Q3XA 2W7UA 2VINA 2J94A 4U01A 4ABHA 1KYNA 2VH0A 1UTMA 2ZHQH 3P95A 4JZIA 1BOQA 1AFQC 1GG6B 2NU4E 5A8XA 1AE8H 1UTLM 2ZDAH 1V2QT 1K21H 4IGDA 4CREA 1BMMH 5F8XA 3GCHC 3PMBB 1A5HA 2RA3A 2XWAA 3CP7A 1GJ9B 5ABWA 2GZ9A 2Z9GA 2Z6BD 3UOUA 1A0HB 4FVBA 4FUFA 1DY9A 1FUJA 4ZHMU 4B1TA 4NIXA 1IQFA 1YCPM 3A84A 2WYJA 3O8RA 1C1UH 3M5LA 2J92A 4INKA 5F8TA 1VCWA 2Z9KA 2BTCE 3LIWA 1TPAE 4TY6A 4Z6AH 3RXPA 1TX6A 3GY4A 2BM2A 2HWLB 3TJVA 3GDSA 2H9TH 4FUJA 4GCHF 1O5CB 3E1XB 1PPFE 1YKTA 2J38A 4Y7AA 2C3SA 1K1OA 2A4RA 3EGKH 3MU0A 4H4FA 4UFFH 4SGBE 2LPRA 2QN5T 5DP4A 2PGBB 3SJ8A 2ALVA 1TPPA 1D3PB 2BD7A 1GHYH 1UHBA 5TJXA 1GBDA 2CN0H 3UOPA 2A1DB 3T26A 5JYIA 3D65E 1G3CA 2BQ7B 1WAYB 1GBIA 2UUYA 5EXMA 2OP9A 1MD8A 3LGYA 3DHKH 1MBMA 1MAYA 1TX8A 3KL6A 2BQ6B 1FDPA 1UVTH 1ANDA 2PKAA 1DANH 1NU7B 3QN7A 1FJSA 4B75A 4YOGA 5BRRE 4IC6A 1KXAA 1UCYK 3PO1B 1O3CA 1QRWA 1INCA 3SUEA 3CS7A 2FOMB 2BOKA 4X8SH 2ZDVH 4OS5A 5DP8A 3BTKE 2AYWA 2ZDMA 4ISIH 5FX6A 1JIRA 1O2IA 1LHGH 1EZSC 1D9IA 3LJOA 4INHA 2Q1JA 1V2UT 1KXCA 3H5CB 2ZFFH 1ZRKA 1GCDA 2VIOA 4FU9A 1THRH 3PLPA 1TGBA 2UUKB 1O30A 3U1IB 2R3UA 3BTME 4PROA 1K1IA 4ISLA 3SNDA 2V3OH 2VVVA 3T29A 1C2JA 4NSVA 1H8DH 1UTQA 2ZU4A 3OSYA 1P12E 3V13A 1EZUC 1P3EA 1GJ8B 2NWNA 1MTUA 3QZRA 1TYNA 1O3AA 1F92A 1S0RA 2OBQA 3DT0H 1C1WH 4UONA 1NPMA 1GWAA 2ZTXA 1WTHD 2PGQB 1UO6A 2KAIB 4XE4A 1EB2A 2ZHFH 5L6NH 3A80A 3UR6A 4RKJB 3Q3YA 1ZHPA 1K9OE 4CR5A 1MTNC 3VEQB 2OCVB 1A3BH 3P8NA 1DE7H