1GJBB

Engineering inhibitors highly selective for the s1 sites of ser190 trypsin-like serine protease drug targets
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
246
structure length
246
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKEASTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR
publication title Engineering inhibitors highly selective for the S1 sites of Ser190 trypsin-like serine protease drug targets.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting, hydrolase
total genus 50
structure length 246
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2001-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gjbB02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gjbB01
1ZMNA 4D8NA 3ZZBA 5IDKA 2EA3A 1MBMA 1SPJA 2EI6A 1ZTLA 1C2HA 1TBQH 1AUTC 1O38A 2O8MA 1LHFH 2OC0A 4D9RA 1BTPA 1ELFA 1TGNA 1GMDG 5HYOA 2C3SA 4K8BA 4DT7B 1GBDA 2SGFE 5JDUB 1J9CH 2HPQH 2XNIA 3RM2H 1GI5A 5EXLA 1C1NA 1IQIA 1K21H 5LPFA 4X6MA 3UQVA 1YCPH 1BBRE 2FI4E 3GOVB 1HBTH 4Y8YA 1VCPA 1GMCG 3QZQA 2O8WA 1Q2WA 1QL7A 1BMNH 2FLBH 4RN6A 1AB9B 3VPKA 2IJOB 2YNAA 1ZTJA 3V13A 2FOFA 1A5HA 1MKXH 1UMAH 1BJVA 4HI3A 1LKBA 3RXKA 3TJNA 4KKDA 2GMTB 3SZNA 1ZPCA 4BTIB 1Z8GA 1T8OA 1NRRH 3MH5A 1QBNA 2P59A 1OWEA 1Y3VA 2ZHDA 3V7TA 3BN9A 2XBVA 1P05A 3LOXA 2GZ8A 7LPRA 2VWOA 2VH6A 1EUFA 4NIXA 1JRTA 4FUGA 5CE1A 2ZU3A 2C93B 4DY7B 2CJIA 3QX5H 8GCHF 2UUJB 3TJUA 4I8LA 1ZPZA 3R0FA 1ESTA 3F9HA 1QB1A 3TGJE 1IQHA 4IC5A 2OUAA 1EB2A 4A1VA 3M37A 1BQYA 4ABGA 1ETRH 5L30H 2GGVB 2QAAA 1A7SA 1O3IA 2FEQH 4VGCB 3BG4C 1F0RA 3GY3A 2XC5A 2AMQA 1AFQB 1O5BB 1TPSA 2BY6X 2VNTA 3KF2A 4XFQA 2BX4A 2PKAB 1YPKH 2GCTC 1GI3A 3VFEA 3O8DA 4Y0YE 3FP6E 4ZH8A 2V3OH 1K1JA 1J8AA 2ANYA 1PYTD 4ESTE 5AFYH 1TBRH 4FXGH 3DFLA 2SGEE 1GI8B 2LNCA 1IQJA 1QY6A 4RKOB 1ZHMA 4GSOA 1OP8A 1TPPA 4ZKNU 4XOJA 1S84A 2ZGHA 1QR3E 3E0NB 1C5VA 5DP6A 4X2XA 2WPKS 8GCHG 1EZQA 1ARCA 4TWWA 2WUCA 5EW2H 3SV9A 1DXPA 3SU0A 3M7UA 3C27B 3RXTA 3ZZ4A 1F5RA 3ZZ6A 2OC8A 1HAOH 2ALPA 1TONA 4ZROA 2HRVA 5CHAC 1UK4A 4JZFH 2QN5T 1N6XA 2UUKB 3M5NA 5FPSA 1NT1A 1TNIA 4X2WA 1J17T 1W11U 3MI4A 2ZDKA 6CHAC 2ZCHP 3SJIA 1GI0A 4I33A 4JK5A 1WU1A 3QN7A 1LTOA 1N6YA 3E8LA 3GISB 2ZDLA 2SFAA 1K1IA 1SGFG 4F4OC 2FXRA 3QLPH 2BDIA 1D3TB 4DCDA 1NFUA 3CS0A 2P3UB 4AGJA 3WY8A 2QXHA 2TBSA 4BANB 1QA0A 1QB9A 2F83A 2ZHFH 3E3TA 2BD3A 2C8XB 1GJ6A 2Y7XA 1MAXA 1FZZA 3EAJA 3UQOA 4B76A 1C1SA 4TY6A 1ANDA 1BB0B 1K22H 1WQSA 2H2ZA 2TGPZ 1BIOA 1EP5A 1FY5A 1AFEH 4UE7H 2GX4A 2D26C 4H6SB 4ABEA 3LC5A 1ZRKA 1N8OC 1P06A 5FAHA 3E6PH 2PSYA 1FY3A 1DX5M 2STBE 3LGIA 5HGGA 4I8JA 2ZQ2A 4MPWA 1XM1A 1O3EA 5HMAA 1AWFH 1MCTA 1ZPBA 2B9LA 3UPEA 4WMFA 5HXFA 4MQAA 1O2NA 1SGEE 1VGCC 1UCYH 3ODDA 4Y8ZA 3ESTA 4JMYA 2GTBA 1O5AB 2ZFSA 1V2UT 1PJPA 5EU8A 1EPTA 1C5NH 4SGAE 2BVSH 1UTNA 2FOBA 2WPIS 4GVUA 3M7TA 5A0CA 4Y10E 1SGYE 1KDQA 1BHXF 1LCYA 1D3DB 1RD3B 1RFNA 1LPZB 3QWCH 1OS8A 1GCTB 1ANBA 1X7AC 2BDAA 1QIXB 5K0HA 3P8OA 2FP7B 2BX3A 3BG8A 4BAMB 3T28A 5K7RA 1QHRB 1GG6B 1KXEA 2XBWA 3T62A 1SSXA 1Y3XA 1O37A 3T29A 2BD2A 1FN6A 3SJ8A 2KAIB 2VGCC 3RU4E 3Q77A 3OU0A 3M3SA 1C5MD 3RM0H 3UNQA 1O2OA 3RXOA 1MMJN 1IQFA 3ATMA 2HGTH 2XWBI 4ISNA 1LHEH 1P57B 2CMYA 3FVFB 1O3NA 4WH8A 4YLQH 3GCTF 1PQAA 2P93A 1UK3A 2NWNA 1XUGA 2Z3DA 3LJOA 5EXNA 3QUMP 1SLVB 4THNH 1AGJA 2H5DA 1UHBB 3MU1A 4Q2KA 1MZAA 4K1EA 1ZMJA 5CMXH 3LJJA 1TMBH 3MO6A 4X1SU 3LPRA 1DVAH 2QXGA 1O3LA 1AKSB 3RMMH 4OS6A 1BRCE 2ANKH 8ESTE 1YPGH 1JIRA 1IAUA 3K6YA 3PTNA 2FM2A 4MPXA 1QNJA 1RRKA 3NPSA 1V2PT 3KN2A 2JH0D 3HK3B 3RXRA 5JBBS 3TJVA 1DOJA 1QGFA 1AIXH 1E35B 2RA3A 5FBEA 4BXWA 1SG8B 1ZOMA 1Y3WA 1C5RA 3JZ2B 1YCPK 4FUEA 1GJAB 5I46H 3UWJH 1UCYE 1KXBA 3BTWE 1EB1H 5E0GA 2R0LA 1P0SH 3STIA 1BTXA 3AVZA 1KY9A 2VIDA 1O5EH 1MTVA 2G4TA 1P2OA 3MU5A 1C2MA 1GWAA 1MKXK 1TBZH 2THFB 4JCNA 4MPVA 3FANA 3P92A 1VJAU 4UFFH 1O3JA 3TGIE 4Y79A 3UOUA 2GD4B 4NSVA 1VZQH 6GCHF 2EI7A 1FY4A 3ATLA 2AGIX 1A3EH 3SV2H 1UJ1A 1T8MA 3P8FA 1EXFA 1KLJH 1S83A 1KXCA 5DGJA 1UVPA 1ELCA 1GBTA 1LQDB 3TLOA 4DIIH 1HJ8A 1G30B 2ZP0H 3BG4B 2XWAA 1YKTA 5B6OA 1VITF 4KTCA 1P3CA 1FY8E 4B75A 2BDBA 1BMAA 3LGUA 2GCTB 3A7ZA 4DG4A 4CBNA 2GV7A 1YLDA 1FONA 1XUHA 2QXJA 2BOHB 2AMDA 3AW0A 3HK6B 1GMHF 4IBLH 5E2OA 1C5YB 1PQ7A 3VGCC 1EJMA 3U8OH 1CSOE 1C2DA 3DHKH 1S82A 1MTNB 1AVWA 3BTEE 2C8YB 4WJG2 1OP0A 2ZU5A 5C1YA 2C90B 1UTKA 4H4FA 3TNTA 2H5CA 1GJ8B 4ZKOU 2AYWA 4VGCC 2WPLS 1HRTH 1BTZA 1FI8A 1HAGE 3PLPA 2IN2A 4WMEA 1P11E 1YBWA 1CO7E 2VIPA 1NO9H 1B7XB 1QCPA 1GHWH 1HPGA 2F9PA 3GYMA 2XW9A 1NM6A 4FVDA 1P2QA 2Y6TA 5A09A 5JPMH 3SU5A 2IPHA 1FMGA 2K1QA 4MLFB 3O8RA 1MU8B 1CHGA 1C2EA 4U2WA 2J94A 5CHAB 2H6MA 1D3PB 4A6LA 3SU6A 5JBAS 2Z94A 2BDHA 4CR9A 1FIZA 2B7DH 3ZZ9A 2ZWLH 2XCNA 1V2OT 1D9IA 3K65B 3E90B 1HGTH 1GJDB 3A86A 4FU8A 2D8WA 4CR5A 1H9IE 1AMHA 3LIWA 5C3NA 1S5SA 1G32B 1PPHE 3HATH 2ZGXH 1HJ9A 4NIVA 1LHGH 1V2LT 1QQ4A 3FFGA 1C5QA 2Y81A 3GDUA 1P2JA 5T6DA 1LO6A 3RXAA 3SU1A 4X1PU 4CH8B 3ZZ8A 2F9BH 1GBKA 1P9UA 3AAVA 1W2KH 2OD3B 1THRH 1BTHH 1Z6EA 4AYVB 3EA8A 1C1UH 3SGBE 4XBBA 1EJAA 1TIOA 1TE0A 2ZDVH 3ODFA 2VIWA 4FU9A 2PGBB 3SJOA 1NU9A 1W0YH 4CH2B 1ABJH 1JBUH 1HDTH 3BIUH 1C1RA 3FP7E 3A85A 4NWLA 4D7GA 1GI6A 1AD8H 1O3FA 2NU2E 3QDZB 4YM9A 4BAHB 1O39A 4LOYH 5A8XA 1VGCB 2P95A 4AX9H 1GHAG 2PUXB 1BBRH 5GPIB 4B2CA 3FAOA 1TAWA 1DWBH 3CS7A 1ZHPA 1PQ8A 3T25A 3L6PA 3ZVEA 5DO4H 1ANEA 2SGQE 1E37B 2DE8A 2WYJA 2NU3E 3H5CB 2ZPRA 2TPIZ 4YT7H 1UTJA 4O03A 1TA6A 1TRMA 1T32A 1P8VC 3KCGH 1PQ5A 2ZDAH 1SGCA 1CA8B 3KHVA 4D7FA 1ZJKA 1UCYK 3UWIA 2R0KA 3RC5A 2F9OA 4O9VA 1MAYA 1IQNA 2PGQB 3W95A 4E06H 1GI1A 5HM9A 2ZA5A 1TPAE 2G52A 2I6QA 1T7CA 1BZXE 1DT2A 1H8IH 1DICA 1Z71A 3A8CA 1JOUB 1DDJA 1H8DH 2AEIH 3MTYA 1NRQH 3ENSB 1JXPA 1DUEA 1YGCH 2BD8A 3PV4A 1HAHH 2PHBA 3EGKH 3VXFH 2ANWA 1N1LA 4JZEH 1AUJA 3M61U 2V6NA 3SOSA 3Q00A 2SGPE 3UNRA 3NZIA 2PTCE 3A7VA 4WH6A 1GG6C 2CN0H 2FYRA 3QO6A 1CE5A 1BITA 2FOCA 4IW4E 1AE8H 4FUFA 2WYGA 1YPMH 5DJ7A 1V2JT 4MG3A 3ZV8A 5E0JA 1C9PA 2BQWB 2O8TA 2BVRH 2H9HA 4KELA 3SUDA 1AE5A 1G37A 4R0IA 1YPHC 5DP9A 1H9HE 2W26A 2XYAA 1CT0E 1THSH 1W12U 4JYVH 3U69H 3A8BA 1A5GH 1FAKH 5T6GA 3TH2H 1P03A 3BTKE 4I8KA 4WMDA 1T4UH 1TX6A 1BUIA 4IN1A 2VIVA 1O2LA 1BTYA 2HALA 6ESTA 1LVBA 7GCHF 1Y3UA 3AAUA 1O5CB 2Z7FE 4LZ4B 1FNIA 1C2IA 3K6ZA 4WF8A 5FPTA 4CRFA 1GJCB 1UTQA 1C2JA 1O3KA 2YOLA 3LKWA 1CQQA 4FU7A 1CGIE 2J92A 2P3FH 1TABE 2ZQ1A 4UEHH 5L6NH 3SU2A 3Q3YA 1EZSC 3GY7A 1HAVB 5T3HA 4Y76A 3A7TA 3RXPA 2H9TH 1F0TA 4YT6H 1W7GH 1TX8A 3VXEH 1K1PA 1QRXA 1E36B 3A81A 1HIAB 1KIGH 2ODQA 1LDTT 3BTTE 5EG4A 2Y5HA 2J95A 4MPUA 1DANH 1WCZA 1IHTH 2R2MB 3RUOA 1C5LH 4QT8C 1NTPA 1DPOA 4ZMAH 1O3HA 2Z9KA 3F9EA 1GVLA 5F03A 3TH4H 3MNBA 3QGJA 5J4SA 1GL1A 1MU6B 4FUBA 5GJ4B 2ZI2H 1O2XA 1QB6A 1HNEE 1XKBC 4NCYA 5EODA 1OWKA 1TALA 4FVBA 2RG3A 4DVAU 7GCHG 3VGCB 2BZ6H 2CV3A 4OS1A 1K1NA 1LVMA 1P9SA 2AIPA 2R3UA 1O2RA 1CHOF 1QURH 4KGAA 4Z6AH 3NK8A 1YYY1 4JZIA 1D6WA 3LDXH 1TPOA 2R3YA 2ZC9H 1CGHA 1TOCB 1GI7B 3A84A 3A87A 2VWLA 4FUIA 4B73A 1SMFE 1C5XB 4U30A 4X1NU 3S69A 4ZHMU 1IQGA 3SV8A 5DP3A 1RTLA 2V35A 1V2NT 1YPLH 2D1JA 3VEQB 4CHAC 3MOCA 1BRAA 1HAXB 3MNCA 1EPTC 3RXIA 1O3DA 2W3KA 1SGIB 1W14U 1NN6A 1A1RA 4X8UH 1DWDH 1BT7A 3TITA 2ULLA 4LK4A 1ZJDA 1F92A 2A45B 3RC4A 1Y5AT 5ABWA 4NA7A 1MTNC 1LKAA 3AW1A 2EEKA 3MU8A 3F1SB 1KSNA 4JZ1A 3GY8A 1UVSH 3A83A 3NUMA 1FPHH 5FX5A 3KQBA 3MH7A 4ISLA 3VB6A 1VJ9U 4NGAH 3U8RH 1GHXH 3GY5A 1JIMA 3MU4A 3SNAA 4D9QA 2PSXA 4ASHA 3LH1A 1BDAA 4NIYA 1L1NA 2ZU2A 4OGYA 1E38B 1C2GA 1NRSH 4ZXYH 1ESAA 1K1OA 2XXLA 3S7KB 5ESBA 2JETC 5LPEA 5ESTE 3TK6A 3QTOH 3RXFA 1ELAA 2ZF0H 4AGKA 1SLXB 1IHSH 1E0FD 2FLRH 1Z8IB 1NROH 1IQEA 1HXEH 1HAZB 3A8AA 4UD9H 2Z9IA 4MNVA 2ZCKP 3SJ9A 3NWUA 1ZYOA 1TMUH 4X8SH 3SW2B 3KNXA 2ZEBA 4UONA 1O2SA 5AVDA 4ZAEA 1HXFH 2SNWA 3CP7A 5FHTA 3UIRA 4YTAA 4ZKRU 1HUTH 1ELGA 1EATA 1PPCE 1V2VT 5L2ZH 5JYIA 3A88A 2XC4A 1O2MA 4O3TA 1YLCA 2BLWA 5F8TA 3T5FH 1AZZA 1LVYA 3Q3XA 1GBLA 1MTUA 1LVOA 4BOHA 2SNVA 3TK5A 3GICB 4YZUA 2SGDE 1TB6H 1WBGB 5EPYA 5JBCS 1S0RA 1O3CA 4FUHA 4PROA 5DP7A 1S6HA 1ZSLA 1G36A 3OTJE 1A46H 1CVWH 2Z6BD 4K3JA 3GCOA 4MVNA 2ZTYA 1BBRK 1NS3A 1QBOA 1QRWA 3NCLA 3GCHB 1UTPA 3MH4A 3KL6A 1DM4B 4CREA 1FJSA 1MCVA 4O3UA 4WVPE 3RXJA 1W7XH 1O2VA 1S85A 2OLGA 4ISOA 3BTHE 3UNSA 1J14A 2PUQH 3MYWA 1CBWB 3D49H 2EC9H 1FAXA 1TGBA 1JWTA 2R2WU 3F68H 4X8TH 3SUFA 3TJOA 1A4WH 4Y6DA 5DP5A 3LGYA 4CBOA 1THPB 1V6DA 1Z1IA 1NESE 3LGTA 3LH3A 3ZZ5A 1VITH 3TVJB 1AU8A 1GDNA 3PB1E 2Y5GA 4TWYA 4TYDA 2G81E 1ZSKA 1O3OA 3RLWH 3ZYDA 4GCHF 1GDQA 1GJ5H 4HZHA 4JZDH 1DY8A 2WV5A 4XDEA 3U8TH 1TLDA 2ZGJA 1AY6H 1ELEE 1GBFA 1NC6A 1GBHA 2J34A 2Z3EA 3F6UH 1ZLRA 1ZSJA 1GJ7B 1TNLA 1EJNA 5HM2A 2QA9E 1YM0A 1DWCH 2A7JA 4HGCA 5GDSH 1YPEH 4K60A 3RDZA 2FTLE 1UVTH 5JB9S 1EOLA 3SHAH 4X6PA 1C1MA 1FY1A 2QC2A 2ZGBH 2BMGB 3BTME 2RA0A 1SFQB 1NRPH 1SOTA 5PTPA 3RU4T 2PW8H 2P3TB 3GY2A 3ZVBA 2ZFTA 1GCDA 3UOPA 1MH0A 3ITIA 1ETSH 1YC0A 1D6RA 1ORFA 2ZU4A 4GCHG 1SGNE 4Q80A 4DJZB 3GCTG 2VVVA 4ISIH 1SBWA 1ZTKA 4TPYA 2O8UA 1P10A 3ZYEA 2CXVA 1O2HA 4ZXXH 2BD7A 2ZKSA 3RXBA 4AFSA 4JYTA 1O2IA 2GV6A 1A3BH 1AI8H 2BXUH 3GYLB 3MH6A 5DKMA 5EXMA 2OBQA 1SOZA 3PWBA 5A0AE 3BTDE 2ZHQH 1Q31A 3M5LA 3PTBA 5IYTA 3ELAH 1DSTA 5FX6A 4YO9A 5EOKA 1PFXC 3A89A 5GIBA 1GBEA 3RXLA 1V2RT 3F9FA 2F9NA 2FDAA 1SGQE 3B23B 3UY9A 1NPMA 5A8YA 3K2UA 4X2VA 3ZVDA 4CHAB 1FXYA 1OSSA 1YF4A 1GGDC 1NFXA 1D4PB 1ZR0A 4I8HA 1TWXB 1HFDA 2C8WB 1EPTB 1AZ8A 4ABBA 1ESBA 1O2UA 2VWNA 1K1MA 3P8GA 1O2ZA 3E91A 4IMZA 3EYDA 3G01A 1DITH 1KDQB 1HAPH 1O36A 3PYHA 1UTMA 2OBOA 1S6FA 3QZRA 2ASUB 2A1DB 1G9IE 3N7OA 1FLEE 5C20A 3NXPA 1SLWB 2ZTZA 4AOQA 1YP9A 5A2MH 1K2I1 2G4UA 2A5IA 5LGOA 1OWIA 3HGPA 6GCHG 4GHQA 3OYPA 5C1XA 1KLTA 1Q3XA 1EX3A 3OY5U 2HNTE 2UUYA 1GJ9B 4CRBA 1P2IA 3W94A 2BLOA 2LPRA 1EQ9A 9LPRA 3T2NA 1V2ST 2P8OB 4H6TA 2HNTF 3IITA 1VITG 1FV9A 1C1WH 1O0DH 2BM2A 2PKSC 2JETB 3Q3KA 1ELDE 1SGRE 2Y82A 1O2TA 1GMHG 1GHBF 3P70B 3I78A 4YLUA 1SGDE 4X1RU 1W13U 1C1VH 5GXPA 2QV1A 1LHCH 3BF6H 1O3PB 1MUEB 5J4QA 2OP9A 2ZTXA 3RXHA 4Q7XA 3LC3A 4AN7A 3BTGE 1P04A 2BB4A 1EZUC 3TNSA 2ZHEH 3AASA 2ZFPH 2FIRH 1IOEA 2XTTB 1W8BH 2H1UA 3M5OA 2ZGCA 1G2LA 2A4GA 2Q6FA 3RP2A 2OQUA 2V0BA 3CENA 3D65E 2QIQA 2A31A 1SB1H 3UFAA 1BTUA 1SLUB 1G2MA 1UO6A 1EP6A 1WYKA 1O32A 1WTGH 1K28D 3MWIU 1VCWA 1EAWA 2ZO3H 4BTTB 4HTCH 1EAXA 1E34B 2TGAA 1P2KA 1EOJA 3A80A 2ZZUH 1F2SE 1OYQA 2R9PA 2I6SA 2M5TA 1GVKB 1AO5A 5T6FA 4BXSA 1C2LA 3HKIB 3ATWA 3SQEE 1L4ZA 4MNYA 4BAQB 1BHXB 1L4DA 2P94A 3TGKE 2FMJA 3EA7A 4NZQA 3PMHB 2XBXA 1A0JA 3UR6A 1ELBA 1P09A 2J4IA 2Q6GA 3URDA 4ABIA 2UUFB 1T4VH 1CU1A 4UFGH 4AZ2B 1OKXA 2AH4X 1GVZA 3MU0A 4D76A 1LPGB 4R8TB 5GWZA 2BOKA 1DS2E 3HGNA 3DFJA 2BDGA 1IQLA 2ESTE 2AERH 3GCHC 3ZZ3A 1O3GA 3SBKA 1QJ6B 4WY3A 4ZUHA 3SNBA 1ABIH 3ZVAA 2Y5FA 4I32A 5LPRA 3BTQE 3RXCA 2QYIA 2AS9A 2XC0A 3U9AH 3A82A 2GDDA 3DUXH 2HVXA 4BAOB 1OX1A 4OS5A 1ZGIA 1CBWC 1FN8A 1MTWA 1SQTA 1VCQA 1XKAC 4YOJA 2YNBA 2PKAA 3V12A 1GMDF 3TIUA 3O8CA 5EQQA 2GDEH 1KTSB 3LGWA 1GHVH 1CA0C 4E7NA 1MQ5A 4CRGA 1S0QA 2DE9A 3KIDU 3I77A 2JH6D 2FOAA 1VR1H 1IQMA 1TGCA 3F9GA 3UR9A 1C5TA 2QY0B 1GMCF 5EPNA 3OY6U 3URCA 1GBJA 3I29A 1SC8U 2IOTA 1P3EA 1TNJA 3SNEA 3B9FH 1V2KT 3K9XB 3SV6A 1P01A 4GUXA 4MDSA 3UUZA 1O2QA 2QGRA 3PMBB 4ABAA 1CT4E 1LQEA 3Q76A 2XRCA 4B71A 4B2AA 5FCRA 3D23A 2QXIA 1MZDA 3SJKA 1LMWB 5E0HA 1C5OH 1TNGA 4GHTA 3BEUA 3MO9A 4Y8XA 1K1LA 4ABHA 2GZ7A 1QJ7B 2UWOA 4MTBA 1GHZA 1P12E 4WXVA 3E1XB 1RIWC 1RS0A 1QRZA 4I8GA 2O9QA 3ZVGA 2JKHA 3ZV9A 3LT3A 2VH0A 1DFPA 1F0UA 3IG6B 2BHGA 3ZVCA 1Z1JA 1DXWA 1Y3YA 5TCCA 1BJUA 4SGBE 4X2YA 2OCVB 5C5OA 3KQDA 1MD8A 3MMGA 1DE7H 1SQOA 1MBQA 3RXQA 4E05H 3RXVA 2TGDA 2B0FA 2F9VA 3HPTB 4A7IB 1L2EA 3S7HB 1QL9A 1TYNA 1C4V2 4OS2A 5DP4A 2ZU1A 2FO9A 3BIVH 4AFUA 2W5EA 5E2PA 2HOBA 5EW1H 4J2YB 1ANCA 1GGDB 1EZXC 1O5GH 1Y5UT 3RMNH 4INKA 1C1OA 2XCFA 2W7SA 1XUKA 3LGVA 4E7RG 2BY5X 3LONA 5FBIA 1BRBE 2XBYA 1FUJA 2RCEA 3SV7A 1P02A 4NFEA 5A0BA 4AFZA 4F49A 2PTNA 5A8ZA 1NFYA 3H7OA 1Y5BT 4CRCA 1C1QA 3BTFE 4FUJA 1CGJE 1C9TA 1IQKA 4LXBH 2OQ5A 1GJ4H 2OINA 4B1TA 1TGSZ 3RXGA 1AN1E 2OXSA 2GT7A 3SO3A 4DURA 1DLEA 3PLKA 2UWPA 2VWMA 5JB8S 1QFKH 5EQSA 2ANMH 2JH5D 3A7YA 2BLVA 5BPEA 5F8ZA 2G5NA 2A4OA 1SHHB 2P16A 2TIOA 2ILNA 2G00A 2BYAX 3T26A 2ZFFH 3SU4A 5C2ZA 2CHAC 2WPHS 2Z3CA 3STJA 3SI4H 2OTVA 2PKSB 2SGAA 3OX7U 2ZG0H 2Z9JA 9ESTA 2FI3E 3EE0B 4WXIA 3SN8A 5DG6A 1Z7KA 4M7GA 1TNKA 4MNWA 1RXPA 1XXFA 2KAIA 1DSUA 4LZ1H 4Y11E 3R3GB 1DWEH 3RU4D 1TGTA 2WV4A 4X1QU 1TX7A 2BTCE 1ZHRA 1CHOG 1HJAC 3B8JA 4NWKA 1TQ7B 1V2WT 1T8LA 4NG9H 7KMEH 2BD5A 2CF8H 4YOGA 3PMJA 3M5MA 4TY7A 3GDSA 3RMOH 4NSYA 3M36A 8LPRA 4ABDA 1UHBA 1XUFA 1GBMA 3A7XA 2P8OC 1MQ6A 1EASA 2VIQA 2QCYA 1U6QA 1OWJA 4HFPB 4AORA 1XX9A 5FPYA 1AKSA 2ALVA 3BEIB 3TH3H 3M3VA 1OPHB 2Q1JA 1NFWA 1KXFA 4XSKU 4Y7AA 3DD2H 1GHYH 2FS9A 3MO3A 1XVOA 4B2BA 1DY9A 4OS4A 1O5FH 5BRRE 4OGXA 2FYQA 3SHCH 1C5ZB 1GBBA 2CGAA 2Y7ZA 4K1SA 3RC6A 1O31A 3GY4A 3SGQE 1NZQH 4X6OA 4X8VH 2BXTH 2AMPA 1G3BA 1AWHB 2ZECA 3IWMA 3RXEA 1O35A 2F9UA 4K2YA 3ZVFA 2A32A 2RDLA 4AG1A 2VB0A 1SR5C 2VJ1A 1UK2A 2ZFRH 3L3TA 2WINI 4A1TA 2FOEA 1PPBH 3O8BA 1BTWA 4GAWA 1SGPE 1WOFA 3KEEA 3QGNB 4NFFA 3ZZ7A 5AFZH 4NIWA 3P6ZB 3LU9B 3ZZAA 2ZDMA 3M35A 3P8NA 1WTHD 5F8XA 4K5ZA 5ETXA 5H4IB 4AB9A 1RJXB 2ZDNA 2A4QA 3SUGA 3U1IB 1V2QT 1H1BA 2H9EH 3PWCA 1F5KU 3SORA 1JRSA 4IGDA 2BDYA 1LPKB 1MTSA 1ZMLA 1J15A 1SGTA 5EQRA 1O2PA 4KP0A 4ISHH 2BDCA 2FS8A 3GY6A 1AQ7A 3PLBA 1MKWH 2FWWA 2G51A 3UTUH 4DOQA 2HLCA 3EA9A 3RXUA 1GDUA 1A2CH 2FESH 4K8YA 4AB8A 1HB0B 3QTVH 2FOGA 3QK1A 1TMTH 1EAIA 1TFXA 5DPAA 1PPEE 4JK6A 4B74A 1ELVA 4UFEH 4DW2U 3BSQA 1SI5H 1PPFE 1CA0B 1UVUH 2FX6A 1QQUA 1ETTH 1DLKB 1TRYA 2BY7X 3C1KA 3GCNA 3RLYH 2ZHWH 3PO1B 4NA8A 1SGFA 1O2KA 4Y0ZE 1S81A 2B8OH 1PYTC 1SL3A 5AF9H 3M3TA 1L1GA 3DA9B 1INCA 4J1YA 4Q7YA 2A0QB 2BVXH 4O97A 2HPPH 1W10U 4X6NA 3SUEA 2HWLB 4YOIA 1C4Y2 3NKKA 5JBTA 1OYTH 1G3DA 2FX4A 5C1UA 1W3CA 5AHGH 5LH8A 2WPMS 2AGEX 1SVPA 2Z9GA 2ODYB 4OS7A 2ZIQH 1RIWB 2FOHA 4RKJB 2ZCLP 5GCHF 1UTOA 4Q7ZA 2W3IA 2QF3A 2FPZA 1H9LB 2DUCA 1TRNA 2FZZA 1D3QB 3FZZA 1UVOA 1Y8TA 1SQAA 5DK1A 2GP9B 1XVMA 2D2DA 1HCGA 1SHYA 2ZFQH 2TGTA 2FOMB 3TU7H 1EKBB 1UTLM 1TNHA 1PPGE 3DT0H 3P95A 1GBAA 1G3CA 2FI5E 1J16A 2VU8E 1XXDA 4XBDA 4DIHH 3E0PB 3VB3A 1WAYB 3A8DA 1GJBB 1TOMH 1OWHA 1NY22 2J38A 3SI3H 3SGAE 2A2XH 4WWYA 1O3BA 5E8EH 1Y59T 1HAYB 4XE4A 5GCHG 2W7UA 4INLA 1B0EA 1O2WA 4FUCA 4IN2A 1K9OE 3RXMA 2BZAA 2GZ9A 1C2KA 1AB9C 1V2MT 6LPRA 1A5IA 1GPZA 1Z8JB 1W0ZU 1WV7H 3BEFB 3KQCA 3ATIA 1C5UA 4Z0KA 1BMMH 1WQVH 2BY8X 2EI8A 5DP8A 4ZHLU 4U01A 4ABFA 2BD4A 2GMTC 1ZRBA 5EGMA 4IMQA 4UDWH 4Y7BA 2CF9H 1FIWA 1ZZZA 1GI9B 2CHAB 3PMAB 1KXDA 4U32A 3E16B 4A5TS 1P2MA 1QTFA 2VINA 1G3EA 1GBIA 1C5WB 3EDXB 3FZDA 2J2UA 4AFQA 2PLXA 3KQEA 2GCHF 3S9AA 1BCUH 1C5PA 1NU7B 2FODA 5G4BA 1RTFB 3MNSA 2A2QH 3TPIZ 3RXSA 4K69A 1AVGH 3HKJB 2AGGX 1GL0E 1B5GH 5F6MA 2STAE 1H4WA 2B5TB 4A1XA 2PV9B 3L33A 1M9UA 1FPCH 1HJAB 2BD9A 1ACBE 2V3HH 1LHDH 8KME2 2BLQA 1OOKB 1O34A 2Z9LA 5SGAE 1PPZA 4TPIZ 4BTUB 2HNTC 2BQ7B 2NU0E 1Z8RA 1HAIH 4UFDH 1F7ZA 1C5SA 2J9NA 1AFQC 2A4RA 1QA7A 3SU3A 2C4FH 4X0WU 3S9CA 1NRNH 4ZKSU 3A7WA 1L0ZA 1KTTB 1HLTH 1P2NA 3H7TA 3ZZDA 2OC7A 2VVCA 4ABJA 3MHWU 1HV7A 2F91A 2GCHG 4BNRA 5TCAA 3VB5A 4FUDA 4IS5A 1DUAA 4KTUA 2G55A 3V3MA 3VB7A 2A7CA 1O3AA 1XUJA 6CHAB 2BQ6B 3UREA 1GHAF 1MD7A 2VVUA 3T27A 1O30A 2C8ZB 1TA2A 2GT8A 4IC6A 4KTSA 1F0SA 2Q6DA 3ZZCA 4AYYB 3S9BA 1O3MA 1SFIA 4K1TA 1QL8A 3V0XA 3D62A 2OC1A 1C1TA 1O33A 1GBCA 4CRAA 1FQ3A 5I25A 1AHTH 1A0HB 1T31A 4NZLA 1HAVA 1A0LA 1BRUP 1F5LA 3GDVA 3S0NA 3MFJA 2GVFA 4RSPA 1O2JA 4DGJA 1GHBG 4AG2A 2ZPQA 1KXAA 2ODPA 1JMOH 1ARBA 1AVXA 1HIAA 1N8OB 4INHA 1C2FA 1CT2E 1O5DH 1OXGA 1C1PA 3U1JB 2UWLA 1O2GH 1YCPM 1YPJH 1ZGVA 2VIOA 4GLYA 5C67A 2GKVE 1XUIA 4BAKB 2F3CE 4YESB 4XBCA 1C4U2 2AIQA 1Z6JH 4A92A 3M7QA 2O8LA 3SNCA 1MKWK 3KGPA 5FXLA 2A5AA 1EAUA 1V2TT 2A7HA 1KLIH 1ELTA 1WSSH 2PR3A 1V3XA 1GI2A 2WPJS 3JZ1B 1B0FA 1QBVH 1BA8B 1RTKA 4I31A 1FDPA 2BY9X 5TJXA 7ESTE 2Y80A 1KYNA 2WUBA 1TQ0B 1T8NA 2VGCB 1OP2A 2NU4E 1L1JA 3RXDA 3ATKA 2TRMA 4GPGA 3U98H 1A61H 3SNDA 1XMNB 1HYLA 2PFEA 2G5VA 3TK9A 3SQHE 5L2YH 3RMLH 2QF0A 2A5KA 4ZHAA 1RGQA 3PM3A 5C5NA 3OSYA 4H42U 2AFQB 3BV9B 3PO1C 1ID5H 5FCKA 1GCTC 2NU1E 4I7YH 4NA9H 1BMLA 1O2YA 2ZPSA 4CRDA 3PROA 3VB4A 1GI4A 3P17H 2FTMA 3FP8E 1QJ1B 1WUNH 4Y71A 1OWDA 1BOQA 4MNXA 1YPHE 2PWXA 3MNXA 3EQ0H 4JYUH 2ZNKH 2G8TA
chains in the Genus database with same CATH superfamily
1ZMNA 4D8NA 3ZZBA 5IDKA 2EA3A 1MBMA 1SPJA 2EI6A 1ZTLA 1C2HA 1TBQH 2WV9A 1AUTC 1O38A 2O8MA 1LHFH 2OC0A 4D9RA 1BTPA 1ELFA 1TGNA 1GMDG 5HYOA 2C3SA 4K8BA 4DT7B 1GBDA 2SGFE 5JDUB 1J9CH 2HPQH 2XNIA 3RM2H 1GI5A 5EXLA 1C1NA 1IQIA 1K21H 5LPFA 4X6MA 3UQVA 1YCPH 1BBRE 2FI4E 3GOVB 1HBTH 4Y8YA 1VCPA 1GMCG 3QZQA 2O8WA 1Q2WA 1QL7A 1BMNH 2FLBH 4RN6A 5EJLA 4FETA 1AB9B 3VPKA 2IJOB 5HKKD 2YNAA 1ZTJA 3V13A 2FOFA 1A5HA 1MKXH 1UMAH 1BJVA 4HI3A 1LKBA 3RXKA 3TJNA 4KKDA 2GMTB 3SZNA 1ZPCA 4BTIB 1Z8GA 1T8OA 1NRRH 3MH5A 1QBNA 2VBCA 2P59A 1OWEA 1Y3VA 2ZHDA 3V7TA 3BN9A 2XBVA 1P05A 3LOXA 2GZ8A 7LPRA 2VWOA 2VH6A 1EUFA 4NIXA 1JRTA 4FUGA 5CE1A 2ZU3A 2C93B 4DY7B 2CJIA 3QX5H 8GCHF 2UUJB 3TJUA 4I8LA 1ZPZA 3R0FA 1ESTA 3F9HA 1QB1A 3TGJE 1IQHA 4IC5A 2OUAA 1EB2A 4A1VA 3M37A 1BQYA 4ABGA 1ETRH 4Z1MD 5L30H 2GGVB 2QAAA 3MQKC 1A7SA 1O3IA 2FEQH 2LP6A 4VGCB 3BG4C 1F0RA 3GY3A 2XC5A 2AMQA 1AFQB 1O5BB 1TPSA 2BY6X 2VNTA 3KF2A 2M2AA 4XFQA 2BX4A 2PKAB 1YPKH 2GCTC 1GI3A 3VFEA 3O8DA 3OAAD 4Y0YE 3FP6E 4ZH8A 2V3OH 1K1JA 1J8AA 2ANYA 1PYTD 4ESTE 5AFYH 1TBRH 4FXGH 3DFLA 2SGEE 1GI8B 2LNCA 1IQJA 1QY6A 4RKOB 1ZHMA 4GSOA 1OP8A 1TPPA 4ZKNU 4XOJA 4AC9A 1S84A 2ZGHA 1QR3E 3E0NB 1C5VA 5DP6A 4X2XA 2WPKS 8GCHG 1EZQA 2F43B 1ARCA 4TWWA 2WUCA 5EW2H 3SV9A 1OHHD 2HLDD 1DXPA 3SU0A 3M7UA 3C27B 3RXTA 3ZZ4A 1F5RA 3ZZ6A 2OC8A 1HAOH 2ALPA 1TONA 4ZROA 2HRVA 5CHAC 1UK4A 4JZFH 2QN5T 1N6XA 2UUKB 1BMFD 3M5NA 5FPSA 1NT1A 1TNIA 4X2WA 1J17T 1W11U 3MI4A 2ZDKA 6CHAC 2ZCHP 3SJIA 1GI0A 4I33A 4JK5A 1WU1A 3QN7A 1LTOA 5B6LA 1N6YA 3E8LA 3GISB 2ZDLA 5DSFA 3KYGA 2SFAA 1K1IA 1SGFG 4F4OC 2FXRA 3QLPH 2BDIA 1D3TB 4DCDA 1NFUA 5EJ1A 3CS0A 2P3UB 4AGJA 3WY8A 2QXHA 2TBSA 4BANB 1QA0A 1QB9A 2F83A 2ZHFH 3E3TA 2BD3A 2C8XB 1S6LA 1GJ6A 2J98A 2Y7XA 1FX0B 1MAXA 1FZZA 3EAJA 3UQOA 4B76A 1C1SA 4TY6A 1ANDA 1BB0B 1K22H 1WQSA 2H2ZA 2TGPZ 1BIOA 1EP5A 1FY5A 1AFEH 4UE7H 2GX4A 2D26C 4H6SB 4ABEA 3LC5A 1ZRKA 1N8OC 1P06A 5FAHA 3E6PH 2PSYA 1FY3A 1DX5M 2STBE 3LGIA 5HGGA 4I8JA 2ZQ2A 4MPWA 1XM1A 2CK3D 1O3EA 5HMAA 1AWFH 1MCTA 1ZPBA 2B9LA 3UPEA 4WMFA 5HXFA 4MQAA 1O2NA 1SGEE 1VGCC 1UCYH 3ODDA 4Y8ZA 3ESTA 4JMYA 1YLNA 1O5AB 2GTBA 2ZFSA 1V2UT 1PJPA 5EU8A 1EPTA 1C5NH 4SGAE 2BVSH 1UTNA 2FOBA 2WPIS 4GVUA 3M7TA 5A0CA 4Y10E 1SGYE 1KDQA 1BHXF 1LCYA 1D3DB 1RD3B 1RFNA 1LPZB 3QWCH 1OS8A 4B6EA 5C0TA 1GCTB 1ANBA 1X7AC 2BDAA 1QIXB 2RFKC 5K0HA 3P8OA 2FP7B 2BX3A 3BG8A 4BAMB 3T28A 5K7RA 1QHRB 1GG6B 1KXEA 2XBWA 3T62A 1SSXA 1Y3XA 3F0OA 1O37A 3T29A 2BD2A 1FN6A 1EFRD 3SJ8A 2KAIB 2VGCC 3RU4E 3Q77A 3OU0A 3M3SA 1C5MD 3RM0H 3UNQA 1O2OA 3RXOA 1MMJN 1IQFA 3ATMA 2HGTH 2XWBI 2QF5A 4ISNA 1LHEH 1P57B 2CMYA 3FVFB 1O3NA 4WH8A 4YLQH 3GCTF 1PQAA 2P93A 1UK3A 2NWNA 1XUGA 2Z3DA 5C17A 3LJOA 5EXNA 3QUMP 1SLVB 4THNH 1AGJA 2H5DA 1UHBB 2PP6A 3MU1A 4Q2KA 1MZAA 4K1EA 1ZMJA 5CMXH 3LJJA 1TMBH 3MO6A 4X1SU 3LPRA 1DVAH 2QXGA 1O3LA 1AKSB 3RMMH 4OS6A 1BRCE 2ANKH 8ESTE 1YPGH 1JIRA 1IAUA 3K6YA 3PTNA 2FM2A 4MPXA 1QNJA 1RRKA 3FKSD 3NPSA 1V2PT 3KN2A 2JH0D 3HK3B 2KX4A 5JBBS 3RXRA 3OEED 3TJVA 1DOJA 1QGFA 1AIXH 1E35B 2RA3A 5FBEA 4BXWA 1SG8B 3AK5A 1ZOMA 1Y3WA 1C5RA 3JZ2B 1YCPK 2J97A 4FUEA 1GJAB 5I46H 3UWJH 1UCYE 1KXBA 3BTWE 4FOUC 1EB1H 5E0GA 2R0LA 1P0SH 3STIA 1BTXA 3AVZA 1KY9A 2VIDA 1O5EH 1MTVA 2G4TA 1P2OA 3MU5A 1E1RD 5DN6D 1C2MA 1GWAA 1MKXK 1TBZH 2THFB 4JCNA 4MPVA 3FANA 3P92A 1VJAU 4UFFH 1O3JA 3TGIE 4Y79A 3UOUA 2GD4B 4NSVA 1VZQH 6GCHF 2EI7A 5T1VA 1FY4A 3ATLA 2AGIX 1A3EH 3SV2H 1UJ1A 1T8MA 3P8FA 1EXFA 1KLJH 1S83A 1KXCA 2KFWA 5DGJA 2WZQA 1UVPA 1ELCA 1GBTA 1LQDB 3TLOA 4DIIH 1HJ8A 1G30B 2ZP0H 3BG4B 2XWAA 1YKTA 5B6OA 1VITF 4KTCA 1P3CA 1FY8E 4B75A 2BDBA 1BMAA 3LGUA 2GCTB 3A7ZA 4DG4A 4CBNA 2GV7A 1YLDA 1FONA 1XUHA 2QXJA 2BOHB 2AMDA 3AW0A 3DSOA 3HK6B 1GMHF 4IBLH 5E2OA 1C5YB 1PQ7A 3VGCC 1EJMA 3U8OH 1CSOE 1C2DA 3DHKH 1S82A 3F2GA 1MTNB 1AVWA 3BTEE 2C8YB 4WJG2 1OP0A 2ZU5A 5C1YA 2C90B 1UTKA 4H4FA 3TNTA 2H5CA 1GJ8B 4ZKOU 2AYWA 4VGCC 2WPLS 1HRTH 1BTZA 1FI8A 4XD7D 1HAGE 3PLPA 2IN2A 4WMEA 1P11E 1YBWA 1CO7E 2VIPA 1NO9H 1B7XB 1QCPA 1GHWH 1HPGA 2F9PA 3GYMA 2XW9A 1NM6A 4FVDA 1P2QA 2Y6TA 5A09A 5JPMH 3SU5A 2IPHA 1FMGA 2K1QA 4MLFB 3O8RA 1MU8B 1CHGA 1C2EA 3WW7A 4U2WA 2J94A 5CHAB 2H6MA 1D3PB 4A6LA 3SU6A 3DSPA 5JBAS 2Z94A 2BDHA 4CR9A 1FIZA 2B7DH 3ZZ9A 2ZWLH 2XCNA 1V2OT 1D9IA 3K65B 3E90B 1HGTH 1GJDB 3A86A 4FU8A 2D8WA 5EIYA 4CR5A 1H9IE 1AMHA 3LIWA 5C3NA 1S5SA 1G32B 1PPHE 3HATH 2ZGXH 1HJ9A 4NIVA 1LHGH 1V2LT 1QQ4A 3FFGA 1C5QA 2Y81A 1MABB 3GDUA 1P2JA 5T6DA 1LO6A 3RXAA 3SU1A 4X1PU 4CH8B 3ZZ8A 2F9BH 1GBKA 1P9UA 3AAVA 1W2KH 2OD3B 1THRH 1BTHH 1Z6EA 4AYVB 3EA8A 1C1UH 3SGBE 4XBBA 1EJAA 1TIOA 1TE0A 2ZDVH 3ODFA 2VIWA 4FU9A 2PGBB 3SJOA 1NU9A 1W0YH 4CH2B 1ABJH 1JBUH 1HDTH 3BIUH 1C1RA 3FP7E 3A85A 4NWLA 4D7GA 1GI6A 1AD8H 1O3FA 2NU2E 3QDZB 4YM9A 4BAHB 1O39A 4LOYH 5A8XA 1VGCB 2P95A 4AX9H 2V7QD 1GHAG 2PUXB 1BBRH 5GPIB 4B2CA 3FAOA 1TAWA 1DWBH 3CS7A 1ZHPA 1PQ8A 3T25A 3L6PA 3ZVEA 5DO4H 1ANEA 2SGQE 1E37B 2DE8A 2YMSC 2WYJA 3F2HA 2NU3E 3H5CB 2ZPRA 2TPIZ 4YT7H 1UTJA 4O03A 1TA6A 1TRMA 1T32A 1P8VC 3KCGH 1PQ5A 2ZDAH 1SGCA 1CA8B 3KHVA 4D7FA 1ZJKA 2KCYA 1UCYK 3UWIA 2R0KA 3RC5A 2F9OA 4O9VA 1MAYA 1IQNA 2PGQB 3W95A 4E06H 1GI1A 5HM9A 2ZA5A 1TPAE 2G52A 2I6QA 1T7CA 2LELA 1BZXE 3PV2A 1DT2A 1H8IH 1DICA 1Z71A 3A8CA 1JOUB 1DDJA 3WWBA 1H8DH 2AEIH 3MTYA 1NRQH 3ENSB 1JXPA 1DUEA 1YGCH 2BD8A 3PV4A 3N7DA 1HAHH 2PHBA 3EGKH 3VXFH 2ANWA 1N1LA 4JZEH 1AUJA 3M61U 2V6NA 3SOSA 3Q00A 2SGPE 3UNRA 3NZIA 2PTCE 3A7VA 3CNRA 4WH6A 1GG6C 2CN0H 2FYRA 3QO6A 1CE5A 1BITA 2FOCA 4IW4E 1AE8H 4FUFA 2WYGA 1YPMH 5DJ7A 1V2JT 4MG3A 3ZV8A 5E0JA 1C9PA 2BQWB 2O8TA 2BVRH 2H9HA 4KELA 3SUDA 1AE5A 1G37A 4R0IA 1YPHC 5DP9A 1H9HE 2W26A 2XYAA 1CT0E 1THSH 1W12U 3F0PA 4JYVH 3U69H 3A8BA 4DT4A 1A5GH 1FAKH 5T6GA 3TH2H 1P03A 3BTKE 4I8KA 2JIZD 4WMDA 1T4UH 1TX6A 1BUIA 4IN1A 2VIVA 1O2LA 1BTYA 2HALA 5HIYA 6ESTA 1LVBA 7GCHF 1Y3UA 3AAUA 1O5CB 2Z7FE 4LZ4B 1FNIA 1C2IA 3K6ZA 4WF8A 5FPTA 4CRFA 1GJCB 1UTQA 1C2JA 1O3KA 2YOLA 3LKWA 1CQQA 4FU7A 1CGIE 2J92A 2P3FH 1TABE 2ZQ1A 1UW7A 4UEHH 5L6NH 3SU2A 3Q3YA 1EZSC 3GY7A 1HAVB 5T3HA 4Y76A 3A7TA 3PRBA 3RXPA 2H9TH 1F0TA 4YT6H 1W7GH 1TX8A 3VXEH 1K1PA 1QRXA 1E36B 3A81A 1HIAB 1KIGH 2ODQA 1LDTT 3BTTE 5EG4A 2Y5HA 2J95A 4MPUA 1DANH 1WCZA 1IHTH 2R2MB 3RUOA 1C5LH 4QT8C 1NTPA 1DPOA 4ZMAH 1O3HA 2Z9KA 3F9EA 1GVLA 5F03A 3TH4H 3MNBA 3QGJA 5J4SA 1GL1A 1MU6B 4FUBA 3N99A 5GJ4B 2ZI2H 1O2XA 1QB6A 1HNEE 1XKBC 4NCYA 5EODA 1OWKA 1TALA 4FVBA 2RG3A 4DVAU 7GCHG 3VGCB 2BZ6H 2CV3A 4OS1A 1K1NA 1E79D 1LVMA 1P9SA 2AIPA 2R3UA 1O2RA 1CHOF 1QURH 4KGAA 4Z6AH 3NK8A 1YYY1 4JZIA 1D6WA 3LDXH 1TPOA 2R3YA 2ZC9H 1CGHA 1TOCB 1GI7B 3A84A 3A87A 2VWLA 4FUIA 4B73A 1SMFE 1C5XB 4U30A 2KCPA 4X1NU 3N7EA 3S69A 4ZHMU 1IQGA 3SV8A 4TSFD 5DP3A 1RTLA 2V35A 1V2NT 2EQNA 1YPLH 2D1JA 3VEQB 4CHAC 3MOCA 1BRAA 1HAXB 3MNCA 1EPTC 4F55A 3RXIA 1O3DA 2W3KA 1SGIB 1COWD 1H8HD 1W14U 1NN6A 1A1RA 4X8UH 1DWDH 1BT7A 3TITA 2ULLA 4LK4A 1ZJDA 1F92A 2A45B 3RC4A 1Y5AT 5ABWA 4NA7A 1MTNC 1LKAA 3AW1A 5C94A 2EEKA 3MU8A 3F1SB 1KSNA 4JZ1A 3GY8A 1UVSH 3A83A 3NUMA 1FPHH 5FX5A 3KQBA 3MH7A 4RT1A 4ISLA 3VB6A 1VJ9U 4NGAH 3U8RH 1GHXH 3GY5A 1JIMA 3MU4A 3SNAA 4D9QA 2PSXA 4ASHA 3LH1A 1BDAA 4NIYA 1L1NA 2ZU2A 4OGYA 4F48B 1E38B 1C2GA 1NRSH 4ZXYH 1ESAA 1K1OA 2XXLA 3S7KB 5ESBA 2JETC 5LPEA 5ESTE 3TK6A 3QTOH 3RXFA 1ELAA 2ZF0H 4AGKA 1SLXB 1IHSH 1E0FD 2FLRH 1Z8IB 1NROH 1IQEA 1HXEH 1HAZB 3A8AA 4UD9H 2Z9IA 4MNVA 2ZCKP 3SJ9A 3NWUA 1ZYOA 3NRLA 1TMUH 4X8SH 3SW2B 3KNXA 2ZEBA 4UONA 1O2SA 5AVDA 4ZAEA 1HXFH 2SNWA 3CP7A 5FHTA 3UIRA 4YTAA 4ZKRU 1HUTH 1ELGA 1EATA 1PPCE 1V2VT 5L2ZH 5JYIA 3A88A 2XC4A 1O2MA 4O3TA 1YLCA 2BLWA 5F8TA 3T5FH 1AZZA 1LVYA 3Q3XA 1GBLA 1MTUA 4HG6A 1LVOA 4BOHA 2SNVA 3TK5A 3GICB 2YMSB 4YZUA 5F53A 2SGDE 5KGOA 1TB6H 1WBGB 5EPYA 5JBCS 1S0RA 1O3CA 4FUHA 4PROA 5DP7A 1S6HA 1ZSLA 1G36A 3OTJE 1A46H 1CVWH 2Z6BD 4K3JA 3GCOA 4MVNA 2JJ2D 2ZTYA 1BBRK 1NS3A 1QBOA 1QRWA 3NCLA 3GCHB 1UTPA 3MH4A 3KL6A 1DM4B 4CREA 1FJSA 1MCVA 4O3UA 4WVPE 3RXJA 1W7XH 1O2VA 1S85A 2OLGA 4ISOA 3BTHE 3UNSA 1J14A 2PUQH 3MYWA 1CBWB 3D49H 1QZ8A 2EC9H 1FAXA 1TGBA 1JWTA 2R2WU 3F68H 4X8TH 3SUFA 3TJOA 3FOAA 1A4WH 4Y6DA 5DP5A 3LGYA 4CBOA 1THPB 1V6DA 1Z1IA 1NESE 3LGTA 3LH3A 3ZZ5A 1VITH 3TVJB 1AU8A 1GDNA 3PB1E 2Y5GA 4TWYA 4TYDA 2G81E 1ZSKA 1O3OA 3RLWH 3ZYDA 4GCHF 1GDQA 1GJ5H 4HZHA 4JZDH 3UB0A 1DY8A 2WV5A 4XDEA 3U8TH 1TLDA 2ZGJA 1AY6H 1ELEE 1GBFA 2JJ1D 1NC6A 1GBHA 2J34A 2Z3EA 3F6UH 1ZLRA 1ZSJA 1GJ7B 1TNLA 1EJNA 3FO8D 5HM2A 2QA9E 1YM0A 1DWCH 2A7JA 4HGCA 5GDSH 1YPEH 2OK5A 4K60A 3RDZA 2FTLE 1UVTH 5JB9S 1EOLA 3SHAH 4X6PA 1C1MA 1FY1A 2QC2A 2ZGBH 4TT3D 2BMGB 3BTME 2RA0A 3SZEA 1SFQB 1NRPH 1SOTA 5PTPA 3RU4T 2PW8H 2KR7A 2P3TB 3GY2A 3ZVBA 2ZFTA 1GCDA 3UOPA 1MH0A 3ITIA 1ETSH 1YC0A 1D6RA 1ORFA 2ZU4A 4GCHG 3H09A 1SGNE 4Q80A 4DJZB 3GCTG 2VVVA 4ISIH 1SBWA 1ZTKA 4TPYA 2O8UA 1P10A 3ZYEA 2CXVA 1O2HA 4ZXXH 2BD7A 2ZKSA 3RXBA 3KYFA 4AFSA 4JYTA 1O2IA 2GV6A 1A3BH 1AI8H 2BXUH 2J98B 3GYLB 3MH6A 5DKMA 5EXMA 2OBQA 1SOZA 3PWBA 5A0AE 3BTDE 2ZHQH 1Q31A 3M5LA 3PTBA 5IYTA 3ELAH 1DSTA 5FX6A 4YO9A 5EOKA 1PFXC 3A89A 5GIBA 1GBEA 3RXLA 1V2RT 3F9FA 2F9NA 2FDAA 1SGQE 3B23B 3UY9A 1NPMA 5A8YA 3K2UA 4X2VA 2YMSD 3ZVDA 4CHAB 1FXYA 1OSSA 1YF4A 1GGDC 1NFXA 1D4PB 1ZR0A 4I8HA 1TWXB 1HFDA 2C8WB 1EPTB 1AZ8A 4ABBA 1ESBA 1O2UA 2VWNA 1K1MA 3P8GA 1O2ZA 3E91A 4IMZA 3EYDA 3G01A 1DITH 1KDQB 1HAPH 1O36A 3PYHA 1UTMA 2OBOA 1S6FA 3QZRA 2ASUB 2A1DB 1G9IE 3N7OA 1FLEE 5C20A 3NXPA 1SLWB 2ZTZA 4AOQA 1YP9A 5A2MH 1K2I1 2G4UA 2A5IA 5LGOA 1OWIA 3HGPA 6GCHG 4GHQA 3OYPA 1K0HA 5C1XA 1KLTA 1Q3XA 1EX3A 4XRNA 3OTPA 3OY5U 2HNTE 2UUYA 3VG8A 1GJ9B 4CRBA 1P2IA 3W94A 2BLOA 2LPRA 1EQ9A 9LPRA 3T2NA 1V2ST 2P8OB 4H6TA 2HNTF 3IITA 1VITG 1FV9A 1C1WH 1O0DH 2BM2A 2PKSC 2JETB 3Q3KA 1ELDE 1SGRE 2Y82A 1NBMD 4Q63A 1O2TA 1GMHG 1GHBF 3P70B 3I78A 4YLUA 4Q4LA 5KECA 1SGDE 4X1RU 1W13U 1C1VH 5GXPA 2QV1A 1LHCH 3BF6H 1O3PB 1MUEB 5J4QA 2OP9A 2ZTXA 3RXHA 4Q7XA 3LC3A 4AN7A 3BTGE 1P04A 2BB4A 1EZUC 3TNSA 2ZHEH 3AASA 2ZFPH 2FIRH 1IOEA 2XTTB 1W8BH 1SKYE 2H1UA 3M5OA 2ZGCA 1G2LA 2A4GA 2Q6FA 3RP2A 2OQUA 2V0BA 3CENA 2W6ID 2QIQA 3D65E 2A31A 4P00A 1SB1H 3UFAA 1BTUA 1SLUB 1G2MA 1UO6A 1EP6A 1WYKA 1O32A 1WTGH 1K28D 3MWIU 1VCWA 5CDFE 1EAWA 2ZO3H 2HVYB 4BTTB 4HTCH 1EAXA 1E34B 2JDID 2TGAA 1P2KA 1EOJA 3A80A 4RT0A 2ZZUH 1F2SE 1OYQA 2R9PA 2I6SA 4ACAA 2M5TA 1GVKB 2W6JD 1AO5A 5T6FA 4ASUD 4BXSA 1C2LA 3HKIB 3ATWA 3SQEE 1L4ZA 4MNYA 4BAQB 1BHXB 1L4DA 2P94A 3TGKE 1H8ED 2FMJA 3EA7A 4NZQA 3PMHB 2XBXA 1A0JA 3UR6A 1ELBA 1P09A 2J4IA 2Q6GA 2WHXA 3URDA 4ABIA 2UUFB 1T4VH 1CU1A 4UFGH 4AZ2B 1OKXA 2AH4X 1GVZA 3MU0A 4D76A 1LPGB 4R8TB 5GWZA 1E1QD 2BOKA 3EE7A 1DS2E 3HGNA 3DFJA 2BDGA 1IQLA 2ESTE 2AERH 3GCHC 3ZZ3A 1O3GA 3SBKA 1QJ6B 4WY3A 4ZUHA 3SNBA 1ABIH 3ZVAA 2Y5FA 4I32A 5LPRA 3BTQE 3RXCA 2QYIA 2AS9A 2XC0A 3U9AH 3A82A 2GDDA 3DUXH 2HVXA 4BAOB 1OX1A 4OS5A 1ZGIA 1CBWC 1FN8A 1MTWA 1SQTA 1VCQA 1XKAC 3F3BA 4YOJA 2YNBA 2PKAA 3V12A 1YWUA 1GMDF 3TIUA 3O8CA 3U28C 5EQQA 2GDEH 1KTSB 3LGWA 1GHVH 1CA0C 4E7NA 1MQ5A 4CRGA 1S0QA 2DE9A 3KIDU 3I77A 2JH6D 2FOAA 1KMHB 1VR1H 1IQMA 1TGCA 3F9GA 3SYJA 3UR9A 1C5TA 2QY0B 5C0UA 1GMCF 5EPNA 3FN8A 3OY6U 3URCA 1GBJA 3I29A 1SC8U 2IOTA 1P3EA 1TNJA 3SNEA 3B9FH 1V2KT 3K9XB 3SV6A 1P01A 4GUXA 4P02A 4MDSA 3UUZA 1O2QA 2QGRA 2XNDD 3PMBB 4ABAA 1CT4E 3OE7D 1LQEA 3Q76A 2XRCA 4B71A 4B2AA 5FCRA 3D23A 2QXIA 1MZDA 3SJKA 1LMWB 5E0HA 2L6OA 1C5OH 1TNGA 4GHTA 3BEUA 3MO9A 4Y8XA 1K1LA 4ABHA 2GZ7A 1QJ7B 2UWOA 4MTBA 1GHZA 1P12E 4WXVA 3E1XB 1RIWC 1RS0A 1QRZA 4I8GA 2O9QA 3ZVGA 2JKHA 3ZV9A 3LT3A 2VH0A 1DFPA 1F0UA 3IG6B 2BHGA 3ZVCA 1Z1JA 1DXWA 1Y3YA 5TCCA 1BJUA 4SGBE 4X2YA 2OCVB 3PRDA 3KQDA 5C5OA 1MD8A 3MMGA 1DE7H 1SQOA 1MBQA 3RXQA 4E05H 3RXVA 2TGDA 2B0FA 2F9VA 3HPTB 4A7IB 1L2EA 3S7HB 1QL9A 1TYNA 1C4V2 4OS2A 5DP4A 2ZU1A 2FO9A 3BIVH 4AFUA 2W5EA 5E2PA 2HOBA 5EW1H 4J2YB 1ANCA 1GGDB 1EZXC 1O5GH 1Y5UT 3RMNH 4INKA 1C1OA 2XCFA 2W7SA 1XUKA 3LGVA 4E7RG 2BY5X 2K8IA 3LONA 5FBIA 1BRBE 2XBYA 1FUJA 2RCEA 3SV7A 1P02A 4NFEA 5A0BA 4AFZA 4F49A 2PTNA 5A8ZA 1NFYA 3H7OA 1Y5BT 4CRCA 3DSGA 1C1QA 3BTFE 4FUJA 1CGJE 1C9TA 1IQKA 4LXBH 2OQ5A 1GJ4H 2OINA 4B1TA 1TGSZ 3RXGA 1AN1E 2OXSA 2GT7A 3SO3A 4DURA 1DLEA 2V3MA 3PLKA 2UWPA 2VWMA 5JB8S 1QFKH 5EQSA 2ANMH 2JH5D 3A7YA 2BLVA 5BPEA 5F8ZA 2G5NA 2A4OA 2GJGA 3KQ5A 1SHHB 2P16A 2J5UA 2TIOA 2ILNA 2G00A 2BYAX 3T26A 2ZFFH 3SU4A 5C2ZA 2CHAC 2WPHS 2Z3CA 5HIZA 3STJA 3SI4H 4RI0A 2OTVA 2PKSB 2SGAA 3OX7U 2ZG0H 2Z9JA 9ESTA 2FI3E 3EE0B 4WXIA 3SN8A 5DG6A 1Z7KA 4M7GA 1TNKA 4MNWA 1RXPA 1XXFA 2KAIA 1DSUA 4LZ1H 4Y11E 3R3GB 1DWEH 3RU4D 1TGTA 2WV4A 4X1QU 1TX7A 2BTCE 1ZHRA 1CHOG 1HJAC 3B8JA 4NWKA 1TQ7B 1V2WT 1T8LA 4NG9H 7KMEH 2BD5A 2CF8H 4YOGA 3W1EA 3PMJA 3M5MA 4TY7A 3GDSA 3RMOH 4NSYA 3M36A 8LPRA 4ABDA 1UHBA 1XUFA 1GBMA 3A7XA 2P8OC 1MQ6A 1EASA 2VIQA 2QCYA 3GS9A 1U6QA 1OWJA 4HFPB 4AORA 1XX9A 5FPYA 1AKSA 2ALVA 3BEIB 3TH3H 3M3VA 1OPHB 2Q1JA 1NFWA 1KXFA 5FL7D 4XSKU 4Y7AA 3DD2H 1GHYH 2FS9A 3MO3A 1XVOA 4B2BA 1DY9A 4OS4A 1O5FH 5BRRE 4OGXA 2FYQA 3SHCH 1C5ZB 1GBBA 2CGAA 2Y7ZA 4K1SA 3RC6A 3DCLA 1O31A 3GY4A 3SGQE 1NZQH 4X6OA 2F4LA 4X8VH 2BXTH 2AMPA 1G3BA 1AWHB 1W0JD 2ZECA 4OM9A 3IWMA 3RXEA 1O35A 2F9UA 4K2YA 3ZVFA 2A32A 2RDLA 4AG1A 2VB0A 1SR5C 2VJ1A 1UK2A 2ZFRH 3L3TA 2WINI 4A1TA 2FOEA 1PPBH 3O8BA 1BTWA 4GAWA 1SGPE 1WOFA 3KEEA 3QGNB 4NFFA 3ZZ7A 5AFZH 4NIWA 3P6ZB 3LU9B 3ZZAA 2ZDMA 3F2FA 3M35A 3P8NA 1WTHD 5F8XA 4K5ZA 5ETXA 5H4IB 4AB9A 1RJXB 2ZDNA 2A4QA 3SUGA 3U1IB 1V2QT 1H1BA 2H9EH 3PWCA 1F5KU 5CHBA 3SORA 1JRSA 4IGDA 2BDYA 1LPKB 1MTSA 1ZMLA 1J15A 1SGTA 5EQRA 1O2PA 4KP0A 4ISHH 2BDCA 2FS8A 3GY6A 1AQ7A 3PLBA 1WXRA 1MKWH 2FWWA 2G51A 3UTUH 4DOQA 2HLCA 3EA9A 3RXUA 1GDUA 1A2CH 2FESH 4K8YA 4AB8A 1HB0B 3QTVH 2FOGA 3QK1A 3WWFA 1TMTH 1EAIA 3ZIAD 1TFXA 5DPAA 1PPEE 4JK6A 4B74A 1ELVA 4UFEH 4DW2U 3BSQA 1SI5H 2KM0A 1PPFE 1CA0B 1UVUH 2FX6A 1QQUA 1ETTH 1DLKB 1TRYA 2BY7X 2WPDD 3C1KA 3GCNA 3RLYH 2ZHWH 3PO1B 4NA8A 1SGFA 1O2KA 4Y0ZE 1S81A 2B8OH 1PYTC 1SL3A 5AF9H 3M3TA 1L1GA 3DA9B 1INCA 4J1YA 4Q7YA 2A0QB 2BVXH 4O97A 2HPPH 1W10U 4X6NA 3SUEA 2HWLB 4YOIA 1C4Y2 3NKKA 5JBTA 1OYTH 1G3DA 2FX4A 5C1UA 1W3CA 5AHGH 5LH8A 2WPMS 2AGEX 1SVPA 2Z9GA 2ODYB 4OS7A 2ZIQH 1RIWB 2FOHA 4RKJB 2ZCLP 5GCHF 1UTOA 4Q7ZA 2W3IA 2QF3A 2FPZA 1H9LB 5GNDA 2DUCA 5EJZA 1TRNA 2FZZA 1D3QB 4ZCNA 3FZZA 1UVOA 1Y8TA 1SQAA 5DK1A 2GP9B 1XVMA 2D2DA 1HCGA 1SHYA 2ZFQH 2TGTA 2FOMB 3TU7H 1EKBB 1UTLM 2KZ4A 1TNHA 1PPGE 3DT0H 3P95A 1GBAA 1G3CA 2FI5E 1J16A 2VU8E 1XXDA 2AHME 4XBDA 4DIHH 3E0PB 3VB3A 1WAYB 3A8DA 1GJBB 1TOMH 1OWHA 1NY22 2J38A 3SI3H 3SGAE 2A2XH 4WWYA 1O3BA 5E8EH 1Y59T 1HAYB 4XE4A 2WSSD 5GCHG 2W7UA 4INLA 1B0EA 1O2WA 4FUCA 4IN2A 1K9OE 3RXMA 2BZAA 2GZ9A 1C2KA 1AB9C 1V2MT 6LPRA 1A5IA 2RDEA 1GPZA 1Z8JB 1W0ZU 1WV7H 3BEFB 3KQCA 3ATIA 1C5UA 4Z0KA 1BMMH 1WQVH 2BY8X 2EI8A 5DP8A 4ZHLU 4U01A 4ABFA 2IPQX 2BD4A 2GMTC 1ZRBA 5EGMA 4IMQA 4UDWH 4Y7BA 2CF9H 1FIWA 1ZZZA 1GI9B 2CHAB 3PMAB 1KXDA 4U32A 3E16B 4A5TS 1P2MA 1QTFA 2VINA 1G3EA 1GBIA 1C5WB 3EDXB 3FZDA 2J2UA 4AFQA 2PLXA 3KQEA 2GCHF 3S9AA 1BCUH 4I86A 1C5PA 1NU7B 2FODA 5G4BA 1RTFB 3MNSA 2A2QH 3TPIZ 3RXSA 4K69A 1AVGH 3HKJB 2AGGX 1GL0E 1B5GH 5F6MA 2STAE 1H4WA 2B5TB 4A1XA 1SQRA 2PV9B 3L33A 1M9UA 1FPCH 1HJAB 2BD9A 1ACBE 2V3HH 1LHDH 8KME2 2BLQA 1OOKB 1O34A 2Z9LA 5SGAE 1PPZA 4TPIZ 2K0QA 4BTUB 1YY3A 2HNTC 2BQ7B 2NU0E 1Z8RA 1HAIH 4UFDH 1F7ZA 1C5SA 2J9NA 1AFQC 2A4RA 1QA7A 3SU3A 2C4FH 4X0WU 3S9CA 1NRNH 4ZKSU 3A7WA 1L0ZA 1KTTB 1HLTH 1P2NA 2KCOA 3H7TA 3ZZDA 2OC7A 2KCAA 2VVCA 4ABJA 3MHWU 1HV7A 2F91A 2GCHG 5KEDA 4BNRA 5TCAA 3VB5A 4FUDA 4IS5A 1DUAA 4KTUA 2G55A 1W0KD 3V3MA 3VB7A 2A7CA 1O3AA 1XUJA 6CHAB 2BQ6B 3OFND 4YXWD 3UREA 1GHAF 1MD7A 2VVUA 3T27A 1O30A 2C8ZB 1TA2A 2GT8A 4IC6A 4KTSA 1F0SA 2Q6DA 3ZZCA 4AYYB 3S9BA 1O3MA 1SFIA 4K1TA 1QL8A 3V0XA 3D62A 2OC1A 1C1TA 1O33A 3OEHD 1GBCA 4CRAA 1WDIA 1FQ3A 5I25A 1AHTH 1A0HB 1T31A 4NZLA 1HAVA 1A0LA 1BRUP 1F5LA 3GDVA 3S0NA 3MFJA 2GVFA 4RSPA 1O2JA 4DGJA 1GHBG 4AG2A 2ZPQA 1KXAA 2ODPA 1JMOH 1ARBA 2L74A 1AVXA 1HIAA 1N8OB 4INHA 3UAIC 1C2FA 1CT2E 1O5DH 1OXGA 4B6FA 1C1PA 2IJD1 3U1JB 2UWLA 1O2GH 1YCPM 4M9FA 1YPJH 1ZGVA 2VIOA 4GLYA 5C67A 2QF4A 2GKVE 1XUIA 4BAKB 2F3CE 4YESB 4XBCA 1C4U2 2AIQA 2QE7D 1Z6JH 4A92A 3M7QA 2O8LA 3SNCA 1MKWK 3KGPA 5FXLA 2A5AA 1EAUA 3PV5A 1V2TT 2A7HA 1KLIH 1ELTA 1WSSH 2PR3A 1V3XA 1GI2A 1VKYA 2WPJS 3JZ1B 1B0FA 1QBVH 1BA8B 1RTKA 2EY4C 4I31A 1FDPA 2BY9X 5TJXA 7ESTE 2Y80A 1KYNA 2WUBA 1TQ0B 1T8NA 2VGCB 1OP2A 2NU4E 1L1JA 3RXDA 3ATKA 2TRMA 4GPGA 3U98H 1A61H 3SNDA 1XMNB 1HYLA 2PFEA 2G5VA 3TK9A 3SQHE 5L2YH 3RMLH 2QF0A 2A5KA 4ZHAA 1RGQA 3PM3A 5C5NA 3OSYA 4H42U 2AFQB 3BV9B 3PO1C 1ID5H 5FCKA 1GCTC 2NU1E 4I7YH 4NA9H 1BMLA 1O2YA 2ZPSA 4CRDA 3PROA 3VB4A 1GI4A 1NBME 3P17H 2FTMA 4ACBA 5IK2D 3FP8E 1QJ1B 1WUNH 4Y71A 2XOKD 1OWDA 1BOQA 4MNXA 1YPHE 2PWXA 3MNXA 3EQ0H 4JYUH 2ZNKH 2G8TA
chains in the Genus database with same CATH topology
1ZMNA 4D8NA 3ZZBA 5IDKA 2EA3A 1MBMA 1SPJA 2EI6A 1ZTLA 1C2HA 1TBQH 1AUTC 1O38A 2O8MA 1LHFH 2OC0A 4D9RA 1BTPA 1ELFA 1TGNA 1GMDG 5HYOA 2C3SA 4K8BA 4DT7B 1GBDA 2SGFE 5JDUB 1J9CH 2HPQH 2XNIA 3RM2H 1GI5A 5EXLA 1C1NA 1IQIA 1K21H 5LPFA 4X6MA 3UQVA 1YCPH 1BBRE 2FI4E 3GOVB 1HBTH 4Y8YA 1VCPA 1GMCG 3QZQA 2O8WA 1Q2WA 1QL7A 1BMNH 2FLBH 4RN6A 1AB9B 3VPKA 2IJOB 2YNAA 1ZTJA 3V13A 2FOFA 1A5HA 1MKXH 1UMAH 1BJVA 4HI3A 1LKBA 3RXKA 3TJNA 4KKDA 2GMTB 3SZNA 1ZPCA 4BTIB 1Z8GA 1T8OA 1NRRH 3MH5A 1QBNA 2P59A 1OWEA 1Y3VA 2ZHDA 3V7TA 3BN9A 2XBVA 1P05A 3LOXA 2GZ8A 7LPRA 2VWOA 2VH6A 1EUFA 4NIXA 1JRTA 4FUGA 5CE1A 2ZU3A 2C93B 4DY7B 2CJIA 3QX5H 8GCHF 2UUJB 3TJUA 4I8LA 1ZPZA 3R0FA 1ESTA 3F9HA 1QB1A 3TGJE 1IQHA 4IC5A 2OUAA 1EB2A 4A1VA 3M37A 1BQYA 4ABGA 1ETRH 5L30H 2GGVB 2QAAA 1A7SA 1O3IA 2FEQH 4VGCB 3BG4C 1F0RA 3GY3A 2XC5A 2AMQA 1AFQB 1O5BB 1TPSA 2BY6X 2VNTA 3KF2A 4XFQA 2BX4A 2PKAB 1YPKH 2GCTC 1GI3A 3VFEA 3O8DA 4Y0YE 3FP6E 4ZH8A 2V3OH 1K1JA 1J8AA 2ANYA 1PYTD 4ESTE 5AFYH 1TBRH 4FXGH 3DFLA 2SGEE 1GI8B 2LNCA 1IQJA 1QY6A 4RKOB 1ZHMA 4GSOA 1OP8A 1TPPA 4ZKNU 4XOJA 1S84A 2ZGHA 1QR3E 3E0NB 1C5VA 5DP6A 4X2XA 2WPKS 8GCHG 1EZQA 1ARCA 4TWWA 2WUCA 5EW2H 3SV9A 1DXPA 3SU0A 3M7UA 3C27B 3RXTA 3ZZ4A 1F5RA 3ZZ6A 2OC8A 1HAOH 2ALPA 1TONA 4ZROA 2HRVA 5CHAC 1UK4A 4JZFH 2QN5T 1N6XA 2UUKB 3M5NA 5FPSA 1NT1A 1TNIA 4X2WA 1J17T 1W11U 3MI4A 2ZDKA 6CHAC 2ZCHP 3SJIA 1GI0A 4I33A 4JK5A 1WU1A 3QN7A 1LTOA 1N6YA 3E8LA 3GISB 2ZDLA 2SFAA 1K1IA 1SGFG 4F4OC 2FXRA 3QLPH 2BDIA 1D3TB 4DCDA 1NFUA 3CS0A 2P3UB 4AGJA 3WY8A 2QXHA 2TBSA 4BANB 1QA0A 1QB9A 2F83A 2ZHFH 3E3TA 2BD3A 2C8XB 1GJ6A 2Y7XA 1MAXA 1FZZA 3EAJA 3UQOA 4B76A 1C1SA 4TY6A 1ANDA 1BB0B 1K22H 1WQSA 2H2ZA 2TGPZ 1BIOA 1EP5A 1FY5A 1AFEH 4UE7H 2GX4A 2D26C 4H6SB 4ABEA 3LC5A 1ZRKA 1N8OC 1P06A 5FAHA 3E6PH 2PSYA 1FY3A 1DX5M 2STBE 3LGIA 5HGGA 4I8JA 2ZQ2A 4MPWA 1XM1A 1O3EA 5HMAA 1AWFH 1MCTA 1ZPBA 2B9LA 3UPEA 4WMFA 5HXFA 4MQAA 1O2NA 1SGEE 1VGCC 1UCYH 3ODDA 4Y8ZA 3ESTA 4JMYA 2GTBA 1O5AB 2ZFSA 1V2UT 1PJPA 5EU8A 1EPTA 1C5NH 4SGAE 2BVSH 1UTNA 2FOBA 2WPIS 4GVUA 3M7TA 5A0CA 4Y10E 1SGYE 1KDQA 1BHXF 1LCYA 1D3DB 1RD3B 1RFNA 1LPZB 3QWCH 1OS8A 1GCTB 1ANBA 1X7AC 2BDAA 1QIXB 5K0HA 3P8OA 2FP7B 2BX3A 3BG8A 4BAMB 3T28A 5K7RA 1QHRB 1GG6B 1KXEA 2XBWA 3T62A 1SSXA 1Y3XA 1O37A 3T29A 2BD2A 1FN6A 3SJ8A 2KAIB 2VGCC 3RU4E 3Q77A 3OU0A 3M3SA 1C5MD 3RM0H 3UNQA 1O2OA 3RXOA 1MMJN 1IQFA 3ATMA 2HGTH 2XWBI 4ISNA 1LHEH 1P57B 2CMYA 3FVFB 1O3NA 4WH8A 4YLQH 3GCTF 1PQAA 2P93A 1UK3A 2NWNA 1XUGA 2Z3DA 3LJOA 5EXNA 3QUMP 1SLVB 4THNH 1AGJA 2H5DA 1UHBB 3MU1A 4Q2KA 1MZAA 4K1EA 1ZMJA 5CMXH 3LJJA 1TMBH 3MO6A 4X1SU 3LPRA 1DVAH 2QXGA 1O3LA 1AKSB 3RMMH 4OS6A 1BRCE 2ANKH 8ESTE 1YPGH 1JIRA 1IAUA 3K6YA 3PTNA 2FM2A 4MPXA 1QNJA 1RRKA 3NPSA 1V2PT 3KN2A 2JH0D 3HK3B 3RXRA 5JBBS 3TJVA 1DOJA 1QGFA 1AIXH 1E35B 2RA3A 5FBEA 4BXWA 1SG8B 1ZOMA 1Y3WA 1C5RA 3JZ2B 1YCPK 4FUEA 1GJAB 5I46H 3UWJH 1UCYE 1KXBA 3BTWE 1EB1H 5E0GA 2R0LA 1P0SH 3STIA 1BTXA 3AVZA 1KY9A 2VIDA 1O5EH 1MTVA 2G4TA 1P2OA 3MU5A 1C2MA 1GWAA 1MKXK 1TBZH 2THFB 4JCNA 4MPVA 3FANA 3P92A 1VJAU 4UFFH 1O3JA 3TGIE 4Y79A 3UOUA 2GD4B 4NSVA 1VZQH 6GCHF 2EI7A 1FY4A 3ATLA 2AGIX 1A3EH 3SV2H 1UJ1A 1T8MA 3P8FA 1EXFA 1KLJH 1S83A 1KXCA 5DGJA 1UVPA 1ELCA 1GBTA 1LQDB 3TLOA 4DIIH 1HJ8A 1G30B 2ZP0H 3BG4B 2XWAA 1YKTA 5B6OA 1VITF 4KTCA 1P3CA 1FY8E 4B75A 2BDBA 1BMAA 3LGUA 2GCTB 3A7ZA 4DG4A 4CBNA 2GV7A 1YLDA 1FONA 1XUHA 2QXJA 2BOHB 2AMDA 3AW0A 3HK6B 1GMHF 4IBLH 5E2OA 1C5YB 1PQ7A 3VGCC 1EJMA 3U8OH 1CSOE 1C2DA 3DHKH 1S82A 1MTNB 1AVWA 3BTEE 2C8YB 4WJG2 1OP0A 2ZU5A 5C1YA 2C90B 1UTKA 4H4FA 3TNTA 2H5CA 1GJ8B 4ZKOU 2AYWA 4VGCC 2WPLS 1HRTH 1BTZA 1FI8A 1HAGE 3PLPA 2IN2A 4WMEA 1P11E 1YBWA 1CO7E 2VIPA 1NO9H 1B7XB 1QCPA 1GHWH 1HPGA 2F9PA 3GYMA 2XW9A 1NM6A 4FVDA 1P2QA 2Y6TA 5A09A 5JPMH 3SU5A 2IPHA 1FMGA 2K1QA 4MLFB 3O8RA 1MU8B 1CHGA 1C2EA 4U2WA 2J94A 5CHAB 2H6MA 1D3PB 4A6LA 3SU6A 5JBAS 2Z94A 2BDHA 4CR9A 1FIZA 2B7DH 3ZZ9A 2ZWLH 2XCNA 1V2OT 1D9IA 3K65B 3E90B 1HGTH 1GJDB 3A86A 4FU8A 2D8WA 4CR5A 1H9IE 1AMHA 3LIWA 5C3NA 1S5SA 1G32B 1PPHE 3HATH 2ZGXH 1HJ9A 4NIVA 1LHGH 1V2LT 1QQ4A 3FFGA 1C5QA 2Y81A 3GDUA 1P2JA 5T6DA 1LO6A 3RXAA 3SU1A 4X1PU 4CH8B 3ZZ8A 2F9BH 1GBKA 1P9UA 3AAVA 1W2KH 2OD3B 1THRH 1BTHH 1Z6EA 4AYVB 3EA8A 1C1UH 3SGBE 4XBBA 1EJAA 1TIOA 1TE0A 2ZDVH 3ODFA 2VIWA 4FU9A 2PGBB 3SJOA 1NU9A 1W0YH 4CH2B 1ABJH 1JBUH 1HDTH 3BIUH 1C1RA 3FP7E 3A85A 4NWLA 4D7GA 1GI6A 1AD8H 1O3FA 2NU2E 3QDZB 4YM9A 4BAHB 1O39A 4LOYH 5A8XA 1VGCB 2P95A 4AX9H 1GHAG 2PUXB 1BBRH 5GPIB 4B2CA 3FAOA 1TAWA 1DWBH 3CS7A 1ZHPA 1PQ8A 3T25A 3L6PA 3ZVEA 5DO4H 1ANEA 2SGQE 1E37B 2DE8A 2WYJA 2NU3E 3H5CB 2ZPRA 2TPIZ 4YT7H 1UTJA 4O03A 1TA6A 1TRMA 1T32A 1P8VC 3KCGH 1PQ5A 2ZDAH 1SGCA 1CA8B 3KHVA 4D7FA 1ZJKA 1UCYK 3UWIA 2R0KA 3RC5A 2F9OA 4O9VA 1MAYA 1IQNA 2PGQB 3W95A 4E06H 1GI1A 5HM9A 2ZA5A 1TPAE 2G52A 2I6QA 1T7CA 1BZXE 1DT2A 1H8IH 1DICA 1Z71A 3A8CA 1JOUB 1DDJA 1H8DH 2AEIH 3MTYA 1NRQH 3ENSB 1JXPA 1DUEA 1YGCH 2BD8A 3PV4A 1HAHH 2PHBA 3EGKH 3VXFH 2ANWA 1N1LA 4JZEH 1AUJA 3M61U 2V6NA 3SOSA 3Q00A 2SGPE 3UNRA 3NZIA 2PTCE 3A7VA 4WH6A 1GG6C 2CN0H 2FYRA 3QO6A 1CE5A 1BITA 2FOCA 4IW4E 1AE8H 4FUFA 2WYGA 1YPMH 5DJ7A 1V2JT 4MG3A 3ZV8A 5E0JA 1C9PA 2BQWB 2O8TA 2BVRH 2H9HA 4KELA 3SUDA 1AE5A 1G37A 4R0IA 1YPHC 5DP9A 1H9HE 2W26A 2XYAA 1CT0E 1THSH 1W12U 4JYVH 3U69H 3A8BA 1A5GH 1FAKH 5T6GA 3TH2H 1P03A 3BTKE 4I8KA 4WMDA 1T4UH 1TX6A 1BUIA 4IN1A 2VIVA 1O2LA 1BTYA 2HALA 6ESTA 1LVBA 7GCHF 1Y3UA 3AAUA 1O5CB 2Z7FE 4LZ4B 1FNIA 1C2IA 3K6ZA 4WF8A 5FPTA 4CRFA 1GJCB 1UTQA 1C2JA 1O3KA 2YOLA 3LKWA 1CQQA 4FU7A 1CGIE 2J92A 2P3FH 1TABE 2ZQ1A 4UEHH 5L6NH 3SU2A 3Q3YA 1EZSC 3GY7A 1HAVB 5T3HA 4Y76A 3A7TA 3RXPA 2H9TH 1F0TA 4YT6H 1W7GH 1TX8A 3VXEH 1K1PA 1QRXA 1E36B 3A81A 1HIAB 1KIGH 2ODQA 1LDTT 3BTTE 5EG4A 2Y5HA 2J95A 4MPUA 1DANH 1WCZA 1IHTH 2R2MB 3RUOA 1C5LH 4QT8C 1NTPA 1DPOA 4ZMAH 1O3HA 2Z9KA 3F9EA 1GVLA 5F03A 3TH4H 3MNBA 3QGJA 5J4SA 1GL1A 1MU6B 4FUBA 5GJ4B 2ZI2H 1O2XA 1QB6A 1HNEE 1XKBC 4NCYA 5EODA 1OWKA 1TALA 4FVBA 2RG3A 4DVAU 7GCHG 3VGCB 2BZ6H 2CV3A 4OS1A 1K1NA 1LVMA 1P9SA 2AIPA 2R3UA 1O2RA 1CHOF 1QURH 4KGAA 4Z6AH 3NK8A 1YYY1 4JZIA 1D6WA 3LDXH 1TPOA 2R3YA 2ZC9H 1CGHA 1TOCB 1GI7B 3A84A 3A87A 2VWLA 4FUIA 4B73A 1SMFE 1C5XB 4U30A 4X1NU 3S69A 4ZHMU 1IQGA 3SV8A 5DP3A 1RTLA 2V35A 1V2NT 1YPLH 2D1JA 3VEQB 4CHAC 3MOCA 1BRAA 1HAXB 3MNCA 1EPTC 3RXIA 1O3DA 2W3KA 1SGIB 1W14U 1NN6A 1A1RA 4X8UH 1DWDH 1BT7A 3TITA 2ULLA 4LK4A 1ZJDA 1F92A 2A45B 3RC4A 1Y5AT 5ABWA 4NA7A 1MTNC 1LKAA 3AW1A 2EEKA 3MU8A 3F1SB 1KSNA 4JZ1A 3GY8A 1UVSH 3A83A 3NUMA 1FPHH 5FX5A 3KQBA 3MH7A 4ISLA 3VB6A 1VJ9U 4NGAH 3U8RH 1GHXH 3GY5A 1JIMA 3MU4A 3SNAA 4D9QA 2PSXA 4ASHA 3LH1A 1BDAA 4NIYA 1L1NA 2ZU2A 4OGYA 1E38B 1C2GA 1NRSH 4ZXYH 1ESAA 1K1OA 2XXLA 3S7KB 5ESBA 2JETC 5LPEA 5ESTE 3TK6A 3QTOH 3RXFA 1ELAA 2ZF0H 4AGKA 1SLXB 1IHSH 1E0FD 2FLRH 1Z8IB 1NROH 1IQEA 1HXEH 1HAZB 3A8AA 4UD9H 2Z9IA 4MNVA 2ZCKP 3SJ9A 3NWUA 1ZYOA 1TMUH 4X8SH 3SW2B 3KNXA 2ZEBA 4UONA 1O2SA 5AVDA 4ZAEA 1HXFH 2SNWA 3CP7A 5FHTA 3UIRA 4YTAA 4ZKRU 1HUTH 1ELGA 1EATA 1PPCE 1V2VT 5L2ZH 5JYIA 3A88A 2XC4A 1O2MA 4O3TA 1YLCA 2BLWA 5F8TA 3T5FH 1AZZA 1LVYA 3Q3XA 1GBLA 1MTUA 1LVOA 4BOHA 2SNVA 3TK5A 3GICB 4YZUA 2SGDE 1TB6H 1WBGB 5EPYA 5JBCS 1S0RA 1O3CA 4FUHA 4PROA 5DP7A 1S6HA 1ZSLA 1G36A 3OTJE 1A46H 1CVWH 2Z6BD 4K3JA 3GCOA 4MVNA 2ZTYA 1BBRK 1NS3A 1QBOA 1QRWA 3NCLA 3GCHB 1UTPA 3MH4A 3KL6A 1DM4B 4CREA 1FJSA 1MCVA 4O3UA 4WVPE 3RXJA 1W7XH 1O2VA 1S85A 2OLGA 4ISOA 3BTHE 3UNSA 1J14A 2PUQH 3MYWA 1CBWB 3D49H 2EC9H 1FAXA 1TGBA 1JWTA 2R2WU 3F68H 4X8TH 3SUFA 3TJOA 1A4WH 4Y6DA 5DP5A 3LGYA 4CBOA 1THPB 1V6DA 1Z1IA 1NESE 3LGTA 3LH3A 3ZZ5A 1VITH 3TVJB 1AU8A 1GDNA 3PB1E 2Y5GA 4TWYA 4TYDA 2G81E 1ZSKA 1O3OA 3RLWH 3ZYDA 4GCHF 1GDQA 1GJ5H 4HZHA 4JZDH 1DY8A 2WV5A 4XDEA 3U8TH 1TLDA 2ZGJA 1AY6H 1ELEE 1GBFA 1NC6A 1GBHA 2J34A 2Z3EA 3F6UH 1ZLRA 1ZSJA 1GJ7B 1TNLA 1EJNA 5HM2A 2QA9E 1YM0A 1DWCH 2A7JA 4HGCA 5GDSH 1YPEH 4K60A 3RDZA 2FTLE 1UVTH 5JB9S