1O2UA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2uA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2uA02
3MNXA 1C2EA 2BD3A 8KME2 2XCNA 1HFDA 1K1PA 1O3HA 1SLXB 1G3EA 3TH4H 4LXBH 1SLVB 3QGNB 4DIHH 3BV9B 4ZKSU 3HGPA 5EQSA 1AVWA 1TPSA 1LHFH 1EZSC 1NRQH 1MMJN 3P8FA 3UPEA 4ABJA 1KY9A 4ISIH 2A5KA 1FY8E 2ALPA 2QV1A 4F49A 2WPKS 2ZDNA 1LPGB 2SGEE 3UOPA 1LHEH 1V2JT 1MTUA 1EAIA 3E0NB 1T8LA 3ZZ6A 3M7TA 5C2ZA 1O39A 1GI4A 2G4TA 1A3EH 1KXCA 2H5DA 1C5PA 1QGFA 4A92A 3LGTA 2I6SA 1EZXC 4IMQA 1THRH 2BOHB 1K2I1 1ZSLA 5BRRE 3V13A 2FOBA 3NK8A 1B0EA 1Y3VA 1QL9A 2FWWA 1UTKA 3PTNA 3TK6A 1AKSB 4I32A 1AU8A 1Y5AT 1FV9A 2A0QB 3I29A 4A7IB 4A1XA 3FP7E 1G36A 1NRSH 2AS9A 3VXFH 2FOMB 1TNIA 2VB0A 2PV9B 4NSVA 1TBQH 2BD8A 3OY6U 2A4OA 5EG4A 5FX6A 2Y5GA 5A8YA 2XW9A 3V12A 1OP0A 2P8OC 1CGJE 1XX9A 2IJOB 4ZHLU 3A8DA 4X6PA 1EPTA 3SNDA 1O2TA 1SGNE 1LVOA 1O5GH 1CT4E 3BTQE 3SV2H 3U8RH 3RXJA 2Z9IA 3WY8A 3SJOA 1J16A 1O31A 1INCA 2O8UA 3RXGA 4IBLH 1DM4B 2F9VA 3VB6A 4AYVB 1YC0A 2WV5A 3SV7A 1P8VC 3I78A 1CBWC 1T8MA 1F92A 1TE0A 2FPZA 1TB6H 4AX9H 2OP9A 2ZTYA 2GCTC 1SGEE 4O9VA 2XBWA 2FEQH 1CGIE 3GICB 4NCYA 4WMFA 3TJUA 1VITG 1GBAA 2AMPA 2JH6D 2A4GA 4XOJA 2PGQB 1HJAC 3MH4A 1A7SA 1EP6A 1TGTA 3HK6B 1W3CA 5A2MH 1QQ4A 3LJJA 1O5BB 5L30H 1UMAH 1VGCC 1GJ4H 1E34B 2OBOA 1TNJA 4X2VA 1SHHB 2B5TB 3E90B 2VH6A 5C5NA 5AF9H 1C1MA 4INKA 4WMDA 1G3DA 1RXPA 1ZMNA 4ABHA 4JMYA 3E0PB 4I8LA 2Z3DA 3E91A 1GBCA 5F8TA 1C2DA 1XKAC 1DOJA 1FPCH 1YPKH 3BG8A 1W14U 1S82A 3KQCA 3SUFA 2WV4A 2FX4A 4KP0A 4MLFB 1SGQE 3AVZA 1JBUH 3A80A 3F9GA 1TALA 3QUMP 5FPTA 3GY4A 1GVKB 2CF8H 2OXSA 4E7NA 4JCNA 1TGNA 1AWFH 1W0ZU 1W7XH 2ZQ2A 5T6GA 1HV7A 1GMHG 2VIVA 1GVZA 2OC7A 1TA6A 1UVSH 5HYOA 3T2NA 1AKSA 1BMAA 5A0AE 4A1VA 4Y8ZA 1P2IA 1JXPA 1SGYE 2GCHG 3UNSA 1ZOMA 1GJ9B 3RU4E 2UWPA 2H6MA 3UOUA 2FLRH 3BTEE 5FCKA 4K3JA 2ZWLH 1C9PA 1OS8A 2ZFPH 1L1NA 1SGFG 2VIOA 3SUDA 2HWLB 3M3TA 1IQLA 1BBRE 3T26A 2CHAB 1QB6A 3EDXB 4K5ZA 1O2UA 3RMLH 1C2MA 1OWHA 2XC4A 4MQAA 4WVPE 1ZSJA 1GMCG 1B5GH 1SFIA 4ABIA 2EA3A 1EZUC 2C8WB 3ITIA 2HGTH 3U9AH 1T7CA 1AVXA 5EPYA 1KSNA 5SGAE 3EAJA 1W7GH 3LONA 2BY5X 1C1SA 2ZHQH 1H9HE 3UNRA 2SNWA 3KIDU 2GT8A 1ZMJA 2HNTE 1QIXB 1O2QA 5K0HA 1ELEE 1LPKB 3EQ0H 4NGAH 1FUJA 2J34A 3A89A 2ODYB 2AIPA 8ESTE 3QTVH 1ZRBA 3T29A 3LJOA 1G30B 3SNCA 1MUEB 1O2MA 4KGAA 1MBQA 1D6RA 2FOAA 1AE5A 2Y7XA 4X8TH 1S6FA 4D7FA 4ABFA 1GBMA 3UQOA 2VJ1A 5L2ZH 2H9EH 3D23A 1A61H 3L33A 1ID5H 2PSXA 3BTGE 1ZPCA 2WYGA 1ESBA 1O3KA 2Z9JA 1O3GA 1ZHMA 1DWBH 1DLEA 1BJUA 4ZKNU 1DITH 2VWLA 4KTUA 3RM2H 1RTFB 4MNWA 1KIGH 5TCAA 2G52A 2Y6TA 1TOMH 1MTWA 2HLCA 5GPIB 4AGKA 3SJ9A 1CHOG 1AMHA 3Q77A 4X0WU 1C2KA 4MPVA 2WPMS 3FZZA 3RXPA 4PROA 3SU5A 2NU4E 1GDUA 1ESAA 1RFNA 4FUDA 1FN6A 1XM1A 4YOJA 2ZDLA 1HJ9A 1V3XA 1PFXC 2SNVA 1TX8A 3UTUH 1KTTB 2DUCA 3C1KA 5FBIA 4CRGA 3MWIU 1ANDA 1YPEH 2ZTXA 2FYQA 1HB0B 3SO3A 1LKBA 2VVVA 2PHBA 4FVDA 4CRBA 1V2RT 4X2XA 4MTBA 4AFQA 3SN8A 4OGYA 2BDIA 5C1XA 2IPHA 1N8OB 1BQYA 1Z8GA 5EPNA 1O37A 1ELAA 1O2ZA 1O5AB 4FUCA 3UIRA 1D4PB 3A8BA 1N6YA 1N1LA 1EZQA 4ZH8A 1VJAU 4X1PU 5J4QA 2Q6DA 3TIUA 2QN5T 2H9HA 3SNBA 2BB4A 4CHAB 5T3HA 2ZPQA 4AG1A 2ESTE 2OUAA 3CP7A 2C8YB 3GY8A 4DOQA 1GBDA 1K28D 3SHAH 3K65B 2XC5A 2FI4E 1FIZA 2IN2A 3ZYDA 1O2HA 4GUXA 1DUAA 1E0FD 3M7QA 4JK6A 4AFSA 1O34A 1L1JA 1UTNA 1O3NA 1LHCH 1NZQH 1RRKA 1S84A 1BZXE 4AORA 1MTNB 3F68H 4MNYA 9ESTA 3KEEA 1GBEA 2ZHDA 1V2VT 2BDGA 1EP5A 1KXEA 2ZDVH 2BD4A 2O9QA 2P95A 1C2HA 4E7RG 3M7UA 2ANKH 5AHGH 3OTJE 1ELTA 3MTYA 4TWYA 1P11E 3TGIE 6GCHG 1SQTA 1P01A 2PSYA 1O3IA 1ZTJA 3Q76A 4B1TA 1LTOA 1AO5A 1H4WA 2ZFTA 2R3YA 4Y8YA 2H5CA 2C3SA 3DA9B 1GBLA 3TJVA 2ZA5A 5C20A 5DKMA 2ZEBA 1GHWH 4YLUA 4A5TS 1UCYE 1O3JA 4FUEA 4K69A 2G51A 1CT0E 3AW1A 3FP6E 1HIAB 4KELA 2ZFQH 4JYUH 3BTDE 2ODPA 1UTLM 1KLJH 1RIWC 2EC9H 1EXFA 2DE9A 4B75A 2A5IA 3SU2A 2QC2A 3S7HB 3ATIA 1RTLA 4I8KA 3BEFB 1UTJA 4U2WA 1HLTH 1FONA 1UHBB 1KLTA 1V2WT 1FY5A 3E3TA 3ESTA 1C4V2 1P10A 1BUIA 3E6PH 1PJPA 2SGDE 1GBBA 2AFQB 4YT7H 2C90B 4SGAE 2GMTB 4ISOA 1O2IA 2CJIA 1THPB 4YTAA 1O3MA 3D65E 1GL0E 4X1SU 5GIBA 3RXCA 3TITA 1XXFA 1E36B 4B2CA 3KQBA 1K1NA 1QRZA 2FMJA 1O3DA 3S0NA 1BMLA 5CHAB 2A5AA 1VJ9U 3U8TH 1V6DA 3MYWA 1A1RA 1TPOA 3U1IB 2O8LA 1V2QT 4E05H 2G8TA 2P8OB 5AVDA 3GYMA 3LIWA 1GMDG 1W12U 4ISHH 1P2MA 5GCHF 1A0LA 3S7KB 5FBEA 1NU7B 1C1WH 3H7TA 5CMXH 1O0DH 3RXQA 1ETTH 3BG4C 5GXPA 1O30A 1SQOA 2ZCLP 1BHXB 4XBCA 5BPEA 2FTMA 2BOKA 5HMAA 1C5UA 4K1EA 1TQ0B 3M5LA 3MU1A 2PUQH 3SU1A 4MDSA 1GJ5H 3GISB 1AB9C 5L6NH 2AH4X 1G2MA 4ZMAH 1CBWB 3LDXH 4X8SH 3TJOA 3EYDA 2W5EA 4NG9H 5EXLA 3E16B 1UVOA 4RN6A 2F9BH 1YPJH 1N6XA 5T6FA 4TY7A 3ZVBA 1HJAB 4K60A 4FU9A 1V2TT 4FUHA 1QR3E 3GY6A 4NZLA 3A88A 1HAIH 1BBRK 4ISLA 2FI3E 1C4Y2 4IN1A 1HRTH 1GGDB 2WPHS 3U98H 2STBE 1FQ3A 2B9LA 1OYTH 1QJ7B 1IQNA 1O2PA 4DY7B 2BQ6B 4X1RU 2FM2A 1PYTD 1C5LH 3P8NA 2BM2A 1ZRKA 3SUGA 1RTKA 1QB1A 5EU8A 4NIWA 4BAQB 4A6LA 4OS1A 4ABAA 3STIA 5ESTE 4TY6A 2EI8A 1EASA 3IITA 5LPFA 3MH7A 1BITA 1VCPA 3SUEA 1RS0A 2TGTA 1SGIB 1DWCH 3ZZ5A 1SVPA 4DIIH 3FFGA 3PLPA 1J8AA 1TPPA 1Q2WA 3MMGA 5DP8A 3UWIA 1JRSA 2WPIS 1WTGH 5DK1A 2GX4A 3M3VA 1JMOH 2SGAA 2LNCA 1SI5H 5G4BA 1CA0C 1UVTH 5FXLA 3GCHC 1GHYH 1S6HA 1DS2E 5CE1A 3EA7A 5DP3A 4AB8A 2BY7X 3MH6A 2GZ8A 3PO1B 1HXFH 3MNSA 1C2GA 4H6SB 1P9SA 4M7GA 1KXBA 2QF0A 3DHKH 1C5QA 3SQEE 1BTYA 1C1VH 1GJAB 2TRMA 1UK4A 3SQHE 1QBNA 3ZVEA 4VGCB 2SGQE 5HGGA 1NFUA 3LU9B 2HPQH 2W26A 4DG4A 1O3CA 1TQ7B 1V2PT 3RXDA 1RJXB 1A5IA 1C2IA 1Y3UA 4NA7A 2ZU5A 2VIWA 3SGQE 2ANYA 3KQEA 8GCHF 4AN7A 1IQJA 1FI8A 2BDAA 1GG6B 7GCHF 3BEUA 1CT2E 3NCLA 1SSXA 4NIYA 2ZGHA 1SPJA 1LPZB 3TK9A 3NKKA 2UUKB 2V0BA 1MQ6A 3U8OH 1GI8B 1V2UT 1YP9A 2B0FA 2ALVA 5FX5A 3SI3H 1S83A 2ZU2A 1O2VA 3UQVA 5F03A 4MNXA 3P17H 1WBGB 1AGJA 1QL7A 2HRVA 1AVGH 4LZ1H 2I6QA 4E06H 2UUFB 3PV4A 2WPLS 1NM6A 3M35A 2OC8A 5ABWA 1SLUB 1L4ZA 1O3AA 1NRNH 1EOLA 1HAXB 1F0SA 2ZGXH 1F0RA 1HYLA 1EB2A 1YPHC 2H2ZA 1W0YH 1C5XB 1P04A 3RC5A 2VWNA 1A0HB 2BD5A 2ZHFH 1H8IH 2H1UA 1NTPA 2SFAA 3GDSA 1O3PB 2Y5FA 1SLWB 4Y71A 4Q7XA 1LKAA 1PYTC 4WMEA 1BTHH 1UVPA 3A81A 2GGVB 2QXHA 4OGXA 2FOEA 3VXEH 4X2YA 1IQIA 1TRYA 1YCPM 2GD4B 2FOGA 2P94A 3ZZCA 4NA8A 1C5YB 3RXTA 2QYIA 1P2OA 1YBWA 3PWBA 3GY7A 1HNEE 1G32B 1EKBB 3TPIZ 2GZ9A 5JDUB 2XBVA 4X2WA 1SOTA 2YNBA 3A82A 1IQKA 1IHSH 4GCHF 2RCEA 1J15A 1MD7A 2UUYA 1SBWA 1ARCA 3A83A 3H5CB 2D1JA 1W8BH 2AERH 3M5OA 1TA2A 1QBVH 1GI7B 1QFKH 2J2UA 1BA8B 4DGJA 1YM0A 5DP4A 2ZTZA 4HI3A 1GHAF 1SHYA 3PMAB 1GI0A 2QCYA 4KTSA 3RXHA 1Y5BT 1PPGE 2ZF0H 2W7UA 4NWKA 2F9UA 5IDKA 2K1QA 3GDVA 2F83A 2ZU3A 1BIOA 5A09A 1MKWK 3VGCC 4XFQA 2AEIH 1QBOA 2FOFA 3N7OA 4FUGA 2A7CA 3UR9A 3GY5A 4MPUA 1UCYK 4MPXA 2BDBA 2ZDMA 2WUBA 2XBXA 2ILNA 3NZIA 2ZFFH 3A86A 1DWEH 3U69H 3L3TA 3ZZ4A 2BXTH 1T32A 1NU9A 1NFXA 3TH2H 4MNVA 2ZHWH 4O97A 1EAXA 1P06A 4Y7BA 5GJ4B 4FUIA 1P03A 3BIUH 4KTCA 2VNTA 2CGAA 3MHWU 1TPAE 3HATH 2JETC 4BAHB 2JKHA 1TFXA 2GKVE 4JZFH 2R2MB 1MU6B 1ABIH 2J95A 3LT3A 3R0FA 4ABEA 1T31A 2J4IA 4CRAA 3MNBA 5JBAS 2Z3CA 1OYQA 1QJ1B 5LPEA 2CXVA 3SU4A 1HAVB 4CH2B 4CR5A 1QURH 2PKAB 1Z71A 3A85A 3RM0H 1TX6A 1GDNA 1P3CA 1ETSH 1BTUA 4BNRA 3BTHE 1DSTA 1T8NA 1GBHA 3TVJB 4GPGA 2VWOA 5FPSA 3RU4T 3ZVCA 3DFLA 1NC6A 2BXUH 1DY9A 2PTNA 2QGRA 3ENSB 1YYY1 1CHGA 5DP5A 4OS5A 3SV8A 3VB3A 1F5RA 2Q6FA 1GPZA 2CMYA 1RIWB 2VH0A 1QB9A 1MKXK 3Q3KA 4OS7A 1KYNA 4I8GA 1C4U2 4WJG2 1E35B 1P3EA 1C9TA 2PR3A 1HDTH 2VIQA 1YLCA 1TWXB 4UFEH 1O2XA 4WH8A 1NRPH 3UUZA 1PPHE 1EX3A 4NIXA 4X8UH 1BHXF 3QZQA 1LVMA 1FDPA 1E38B 2Z9GA 1P57B 3RC4A 1VCQA 5FHTA 5DG6A 4FVBA 3B8JA 1Z8RA 1ZPBA 3Q3YA 2KAIB 4CREA 2J94A 2Q6GA 3PMJA 1IQGA 1K1JA 1C1UH 1CA8B 2VVCA 3PB1E 1SGCA 4OS6A 4YZUA 1OPHB 4AZ2B 1ZMLA 1FMGA 1BTPA 3LH3A 4CRCA 4CBOA 7ESTE 1L0ZA 4ESTE 3KL6A 3K6ZA 1D3PB 1YPGH 1J14A 1V2KT 2GDDA 2D8WA 3RXVA 1ZSKA 3LGVA 1ZHRA 2A2XH 5GCHG 2PLXA 3MU4A 3ZZ9A 2GT7A 4O3TA 1QY6A 1O2LA 2FXRA 2HALA 1NESE 2XC0A 1DXWA 4TPIZ 4B74A 1C2JA 2G5NA 3ZVFA 1HAHH 1OP8A 1AB9B 2WUCA 1YLDA 3MO3A 1BRAA 2PWXA 4K8BA 3RXKA 4UEHH 2PW8H 2A32A 1BRBE 2TPIZ 3A7XA 5LH8A 2BLWA 1HAVA 3HPTB 1XUFA 2B8OH 2PKAA 1KXFA 2A1DB 2Y82A 1QHRB 3ZVGA 1ZZZA 4X1QU 1C1PA 2H9TH 1OSSA 1AHTH 4XSKU 4DT7B 1SFQB 3IWMA 1EAUA 1YCPK 1W11U 1AZZA 3RXBA 2JH0D 5JB9S 1A5HA 1D6WA 9LPRA 3FZDA 1AQ7A 3EA9A 4BXWA 2ASUB 5T6DA 2OC0A 1L2EA 1QA7A 4I33A 1ELGA 2UUJB 1V2LT 3QN7A 4CRDA 3JZ2B 3PMHB 1WUNH 4AYYB 4GSOA 3MNCA 4BAMB 4Z6AH 1LHDH 2FS9A 1XVMA 1CQQA 1NROH 1GHBF 3QX5H 3SV9A 4FU8A 4X6NA 4OS4A 4THNH 4WXVA 4K8YA 4BANB 5DP9A 1T8OA 1HPGA 1DANH 2D2DA 1AE8H 1C5RA 3DT0H 4ZKRU 3RXMA 5J4SA 1GBIA 1LQEA 1OX1A 3CENA 4JZDH 1O2YA 2R9PA 2GDEH 1P12E 5HM2A 3PYHA 1W2KH 3B9FH 2OC1A 1C1NA 5TJXA 1O2NA 1AUTC 5FPYA 3OX7U 2KAIA 2C93B 3GCHB 1G2LA 3GOVB 3STJA 3T27A 2HVXA 1QRWA 4I7YH 3ZZ7A 1GCTC 2FTLE 2FIRH 4JK5A 4Y0YE 3MFJA 5AFYH 5EW2H 4K1TA 1V2MT 4Q80A 2V3OH 1AWHB 1O2SA 3SGAE 1MZDA 1RGQA 4WH6A 2HOBA 1S0RA 2OLGA 1YPHE 1BT7A 3QDZB 3SJKA 3E8LA 4IMZA 1CVWH 1UTPA 2BHGA 4Z0KA 1QA0A 1T4UH 4IC6A 3VPKA 4X6OA 1C2LA 4H4FA 1GMCF 3QTOH 4B71A 1IQHA 1WYKA 1UK2A 2QAAA 1P2KA 2RA0A 3KCGH 1V2ST 1P02A 3MU8A 3PLKA 1SL3A 3BN9A 8GCHG 2ZPRA 2XWAA 4ABDA 2EI7A 3LC5A 1VCWA 1ANEA 1S85A 3F9FA 2CN0H 4GAWA 3RDZA 1UTMA 2A31A 1SQAA 3BIVH 2QXJA 1G9IE 1FY3A 1SG8B 1Y5UT 2BY9X 2VVUA 3E1XB 5JYIA 3RXFA 4LOYH 5E8EH 1KTSB 5JBBS 1K1IA 4NIVA 3P8OA 1ZGIA 1BCUH 3G01A 4NFEA 2BDYA 1JRTA 1TNLA 2Y5HA 4U30A 4X1NU 3C27B 2BDHA 2FS8A 1Y3YA 4Y79A 1GBFA 4INLA 2ULLA 5EXNA 3RMNH 1O3FA 3EE0B 2ZFSA 3KGPA 4D8NA 3UREA 1XMNB 1O2WA 2UWLA 1BB0B 2ZC9H 1QNJA 1QJ6B 4ZXXH 3VB5A 4DVAU 1H1BA 3SORA 2A45B 4Y6DA 6ESTA 3TLOA 3UFAA 4BAKB 1PQ5A 2CV3A 1WSSH 4K1SA 4X6MA 2A7HA 5AFZH 3MI4A 2GCTB 4XDEA 3ATWA 1GI3A 3T5FH 1YF4A 4GCHG 3GYLB 3HGNA 1P05A 2TGDA 1O5FH 1ELBA 1EATA 4IC5A 1BTXA 1CGHA 5H4IB 4D9RA 3ZYEA 1VGCB 5DO4H 1QL8A 1AY6H 3A7VA 4FUFA 3VB4A 3BTKE 1GHAG 4YOGA 5E0JA 1FJSA 2FX6A 4ZXYH 3VGCB 1N8OC 3W95A 1O2GH 3SU0A 1FZZA 5TCCA 1HIAA 4Q7ZA 1IHTH 3GCTF 3TJNA 2OD3B 1JIMA 1O3OA 2OTVA 4O03A 3LC3A 1K1LA 3KNXA 4A1TA 1QTFA 1DY8A 5IYTA 1SGDE 3ZV8A 4YM9A 3P8GA 3CS0A 2R0LA 3QLPH 1YPMH 1UHBA 1HUTH 2AGGX 4CHAC 1C2FA 1NO9H 3PM3A 3EGKH 1UVUH 2NU0E 4HGCA 3A7YA 2VGCC 1PQAA 1Y3XA 2JETB 2ZFRH 1Z8IB 1SC8U 1A5GH 1O3BA 3P6ZB 1GDQA 2BZ6H 1TIOA 1FXYA 1YKTA 2YOLA 4BTTB 3BF6H 3LGUA 2QY0B 3RXRA 4ABGA 1TNGA 2P3FH 4AFZA 1WCZA 3SZNA 2V6NA 2FDAA 3F9HA 1A0JA 5C5OA 3M36A 1GJCB 3UY9A 1W10U 6GCHF 3ELAH 3TK5A 1LDTT 4B2BA 1O35A 2BYAX 3PTBA 1FAXA 1O3EA 2G55A 3PROA 2ZHEH 4K2YA 2D26C 2XTTB 1DUEA 1ZYOA 1F2SE 4YT6H 4DW2U 2Z3EA 1CSOE 3LH1A 1GJ6A 2F9PA 1KXDA 2SGPE 1OWEA 5A0CA 3SOSA 1JWTA 1MAXA 4Q2KA 2FP7B 1GBJA 1Z6EA 3ZZ8A 2G4UA 2AGEX 2HNTF 1NFWA 1FLEE 5DGJA 4WWYA 2BQWB 3GCOA 2ZCHP 3QWCH 1TABE 6CHAC 4D76A 5HXFA 5LGOA 4LZ4B 3IG6B 1P2QA 2ZGBH 3FANA 1UTOA 1MTVA 1MCTA 1DT2A 2AMDA 2BX3A 3KQDA 3LOXA 4FXGH 2AIQA 4KKDA 3A7TA 3F6UH 2FLBH 1SB1H 1MQ5A 4IGDA 2RDLA 1F5KU 2CF9H 3BTFE 1MH0A 1H8DH 1XUJA 2O8MA 5E0GA 5FAHA 1TRNA 4MVNA 2GMTC 1PPBH 3RLWH 4XE4A 4FUBA 4JZIA 3D49H 1HAPH 2NU1E 4U32A 1FIWA 4ZHMU 5I46H 1OWIA 1TGCA 3FVFB 1B7XB 2ZDAH 1AFQC 2QF3A 2XRCA 1XUGA 2PUXB 1TGSZ 3P95A 4AGJA 2R3UA 4UFFH 1YPLH 3A87A 5CHAC 1EUFA 1THSH 2VU8E 4Y0ZE 1LQDB 1FY1A 1PPZA 2NWNA 1GMDF 1GHZA 3OYPA 3NWUA 2VIDA 1SR5C 1SGRE 2TBSA 3RXIA 1C5VA 3DUXH 4X8VH 1DSUA 2C4FH 3TU7H 3PMBB 2UWOA 1OWDA 1U6QA 2W3KA 3TGJE 3BEIB 1C5TA 2SGFE 5JB8S 1NS3A 3LGIA 1MD8A 4UFDH 3Q3XA 3K9XB 2FESH 3V3MA 3MO9A 4I31A 4DJZB 2FO9A 1CU1A 3K6YA 1PQ8A 1NFYA 2ZECA 3F9EA 5EQQA 2HPPH 1ELDE 5C67A 1Y8TA 1TRMA 1MBMA 2BTCE 1ESTA 3ZZDA 1D9IA 1VZQH 3CS7A 4YOIA 3URCA 1O2JA 2ZQ1A 3MO6A 1C1QA 3RXUA 1K22H 4J1YA 1XXDA 5C1YA 3LPRA 2ZGJA 2RG3A 4HTCH 1C5OH 2PFEA 1ZTKA 4I8JA 4Y10E 1ELVA 1KLIH 1DXPA 2ZCKP 2VWMA 1C5NH 4RKOB 4GHTA 1Q3XA 2ZPSA 3S69A 3O8CA 1OWJA 1Q31A 2J92A 2F9OA 3P70B 4O3UA 1GGDC 3V0XA 2OCVB 1QQUA 2IOTA 4BXSA 1SGTA 2XCFA 4INHA 1TNKA 3SV6A 1C5MD 1GHBG 2EI6A 2GVFA 1H9IE 1MCVA 1F0TA 1K21H 1G3CA 4OS2A 1X7AC 2G81E 4JZ1A 1BMMH 2BY6X 3RMOH 2BVXH 1E37B 1EPTC 2WYJA 1TGBA 1SGFA 4Y7AA 4CR9A 3JZ1B 3M37A 4TYDA 2Y81A 1J9CH 2STAE 1BBRH 1ZPZA 2FYRA 3QGJA 2LPRA 5JBCS 4IS5A 4JYVH 4YLQH 1RD3B 3PLBA 3OU0A 1GCTB 1YGCH 1OXGA 2YNAA 2XWBI 1H9LB 1S81A 1EJAA 3P92A 1GHXH 4SGBE 1QCPA 1LO6A 2BVRH 3BTTE 2BLOA 5JPMH 1AIXH 1ANBA 4QT8C 1PQ7A 3RP2A 4UONA 2ZNKH 4R0IA 2PKSC 1TBZH 3L6PA 5EODA 1ZR0A 3OY5U 1KDQB 1SOZA 1BTZA 3ODFA 1XUIA 3PO1C 2BY8X 1ORFA 2WPJS 1A46H 1CO7E 1FAKH 3OSYA 1Y3WA 2P3UB 5F8XA 1GHVH 3H7OA 4VGCC 3SU3A 4UFGH 3A7ZA 2ZP0H 1GI1A 2ANWA 2BD2A 2OINA 4JYTA 2J38A 3A8CA 5B6OA 1O33A 1Z1JA 2C8XB 4ASHA 1IAUA 4HZHA 1AZ8A 3EA8A 1V2OT 5F8ZA 5A8XA 1W13U 1GG6C 1GL1A 1PPFE 2G5VA 1ACBE 4UD9H 2QXGA 2C8ZB 4TWWA 3TH3H 3ZZBA 1C1TA 3A7WA 2A2QH 3RC6A 1P0SH 1K9OE 1LHGH 3KN2A 1T4VH 4B76A 5DP7A 1WU1A 2GV7A 1BMNH 1O5DH 2P3TB 2ZGCA 3ODDA 5E2PA 2Z94A 1TMUH 3SI4H 1ETRH 3QO6A 1GI5A 3TNTA 3M3SA 2BLVA 4HFPB 3AASA 1AUJA 1K1MA 1MU8B 1DLKB 1O36A 2Q1JA 1NPMA 3BG4B 1HAZB 5JBTA 3T28A 1NT1A 2QIQA 3B23B 7LPRA 1ZTLA 2A7JA 3VEQB 3RLYH 2F91A 4BOHA 1XKBC 2XNIA 4WY3A 1ELFA 2TGPZ 4NWLA 2Z9LA 2M5TA 3TGKE 1O5EH 1GVLA 5K7RA 1L1GA 1Z1IA 2ZU4A 2P59A 2XXLA 2F9NA 3HKIB 3QK1A 4ZAEA 3O8RA 4H6TA 1VITF 1HJ8A 3NXPA 1O38A 3AAVA 2V3HH 2ZG0H 1Y59T 4CRFA 1F0UA 4XBDA 1FN8A 2GV6A 3RU4D 3LGWA 3VB7A 1JIRA 1C5WB 3A8AA 4U01A 1WQSA 4GLYA 3ZV9A 3SGBE 1BOQA 1BRCE 1O2RA 1KDQA 4D9QA 1C1OA 4BTIB 4RSPA 3SHCH 4Y11E 1DFPA 4CBNA 3UR6A 1VR1H 1BDAA 1KXAA 2Y7ZA 4ISNA 1LVBA 1ANCA 3GCTG 3AAUA 4ZKOU 1PPEE 3T62A 1K1OA 1EB1H 5ESBA 1HAOH 2FOCA 3PWCA 3MH5A 1SGPE 1GWAA 2AMQA 2R0KA 2BQ7B 3HKJB 2DE8A 2VGCB 2V35A 2FOHA 2ZI2H 4D7GA 3SJIA 1P2JA 5EW1H 3BSQA 1WTHD 3RUOA 4AOQA 2BVSH 1O2KA 3MU0A 4J2YB 5HM9A 3M5MA 1EJMA 1CA0B 4AG2A 1GMHF 3AW0A 1MKWH 1Z7KA 3URDA 1S0QA 1M9UA 1TLDA 1LVYA 2FZZA 2OBQA 1TYNA 2A4QA 2GCHF 1F5LA 1IQFA 1WV7H 3Q00A 4WXIA 2G00A 3ZVAA 1UCYH 1GJBB 1EOJA 4BAOB 1O5CB 2B7DH 2WINI 1MAYA 4YO9A 1A3BH 1D3TB 2O8TA 2Z6BD 4NA9H 1ZJDA 2ZZUH 8LPRA 3SW2B 3ATMA 5DPAA 4ZUHA 1SMFE 2F3CE 4TPYA 7KMEH 1UK3A 1HXEH 1TAWA 1OKXA 4MPWA 1O3LA 1UTQA 1J17T 3BTME 2W7SA 1OOKB 3S9AA 4LK4A 1TMBH 1L4DA 5LPRA 4AFUA 3BTWE 1C5ZB 1WAYB 6LPRA 4B2AA 1ZJKA 1V2NT 1GI9B 2CHAC 1G37A 3DFJA 3KF2A 3RMMH 1DPOA 3SBKA 4NFFA 1Z6JH 3RXEA 4MG3A 1S5SA 2Y80A 2XBYA 2ZDKA 7GCHG 1BRUP 1DVAH 1AN1E 3A84A 4FU7A 5A8ZA 3D62A 3GY2A 2ZKSA 5A0BA 3O8DA 1TONA 1HBTH 6CHAB 1GBKA 1OWKA 1XUKA 4NSYA 2OQ5A 1XUHA 3SJ8A 1DWDH 1NY22 4I8HA 2GZ7A 4B73A 2Z7FE 3ATLA 2RA3A 3ATKA 5I25A 5E2OA 1GI6A 2J9NA 1EJNA 3SNEA 2P93A 4IN2A 2P16A 1ARBA 3KHVA 3DD2H 3NUMA 1TMTH 1D3QB 3GDUA 4GVUA 1EQ9A 1GI2A 2TGAA 3RXAA 5EGMA 5EOKA 1MKXH 4ZHAA 1AFQB 1DX5M 2ANMH 2BLQA 1ZGVA 1FPHH 3LGYA 3W94A 2BD7A 5FCRA 4JZEH 4ABBA 1ZLRA 4XBBA 5F6MA 1JOUB 1TNHA 3U1JB 1NN6A 1TBRH 3O8BA 2JH5D 5GWZA 5DJ7A 4NZQA 3R3GB 1VITH 2BZAA 1CHOF 1TX7A 2AGIX 1EAWA 1XVOA 3VFEA 1GJDB 1F7ZA 2FI5E 3ZZ3A 3TNSA 1LMWB 2HNTC 2QA9E 1Z8JB 3I77A 2ZO3H 3M5NA 1BJVA 1HAYB 2PGBB 3F1SB 5ETXA 2THFB 2GTBA 3S9BA 2FODA 4F4OC 4R8TB 2NU2E 1FNIA 4UE7H 4AB9A 4Y8XA 2AYWA 1A4WH 1IQMA 1UJ1A 1HGTH 2BMGB 4GHQA 1P2NA 2Z9KA 4DCDA 1P9UA 3SNAA 1WOFA 1D3DB 1MZAA 4YESB 2XYAA 2EEKA 4DURA 4H42U 1OP2A 1HCGA 1ZHPA 5EXMA 5C3NA 4UDWH 2VINA 5PTPA 3UWJH 1O2OA 1GBTA 2ZU1A 1MTSA 4ZROA 1C5SA 1BTWA 1AFEH 1GJ8B 4Y76A 1QRXA 2A4RA 2ZIQH 2TIOA 4FUJA 5E0HA 1AI8H 3SU6A 3MOCA 1FY4A 5DP6A 1GJ7B 1O32A 3HK3B 1LCYA 1C1RA 1IOEA 2QXIA 3V7TA 1DE7H 1UO6A 5EQRA 1WQVH 3GY3A 2NU3E 3ZVDA 3GCNA 4WF8A 1A2CH 5GDSH 3UNQA 1EPTB 3S9CA 1GCDA 2W3IA 1B0FA 1P09A 1YCPH 3K2UA 2VIPA 5C1UA 2O8WA 3FAOA 1MTNC 2ODQA 3FP8E 2BDCA 2OQUA 3RXSA 4Q7YA 3T25A 1AD8H 2PTCE 4IW4E 3MU5A 1TOCB 4BTUB 1DDJA 1G3BA 3LKWA 1ELCA 1PPCE 2GP9B 3NPSA 3RXOA 1HAGE 2R2WU 1CE5A 3RXLA 3M61U 2BD9A 4CH8B 3QZRA 1ABJH 3ZZAA 2BX4A 1IQEA 4RKJB 2PKSB 5L2YH 1NRRH 1DICA
chains in the Genus database with same CATH superfamily
3KYGA 3MNXA 1C2EA 2BD3A 5DSFA 2XCNA 1HFDA 1K1PA 8KME2 1O3HA 1SLXB 1G3EA 3TH4H 4LXBH 1SLVB 3QGNB 4DIHH 3BV9B 4ZKSU 3HGPA 5EQSA 1AVWA 1TPSA 1LHFH 1EZSC 1NRQH 1MMJN 3P8FA 3UPEA 4ABJA 3DSOA 1KY9A 4ISIH 2A5KA 1FY8E 2ALPA 2QV1A 4F49A 2WPKS 2ZDNA 1LPGB 5EIYA 2SGEE 3UOPA 1LHEH 1V2JT 1MTUA 1EAIA 3E0NB 1T8LA 3ZZ6A 3M7TA 5C2ZA 1O39A 1GI4A 2G4TA 1A3EH 1KXCA 2H5DA 1C5PA 1QGFA 4A92A 3LGTA 2I6SA 1EZXC 4IMQA 1THRH 2BOHB 1K2I1 1ZSLA 5BRRE 3V13A 2FOBA 3NK8A 5KECA 1B0EA 1Y3VA 1QL9A 2FWWA 1UTKA 3PTNA 3TK6A 1AKSB 4I32A 1AU8A 1Y5AT 1FV9A 2A0QB 3I29A 4A7IB 4A1XA 3FP7E 1G36A 1NRSH 2AS9A 2WPDD 3VXFH 2FOMB 1TNIA 2VB0A 2PV9B 4NSVA 1TBQH 2QF5A 2BD8A 3OY6U 2A4OA 5EG4A 5FX6A 2Y5GA 5A8YA 2XW9A 3V12A 1OP0A 2P8OC 1CGJE 1XX9A 2IJOB 4ZHLU 3A8DA 4X6PA 1QZ8A 1EPTA 3SNDA 1O2TA 1SGNE 1LVOA 1O5GH 1CT4E 3BTQE 3SV2H 3U8RH 3RXJA 2Z9IA 3WY8A 3SJOA 1WDIA 1J16A 1O31A 1INCA 2O8UA 3GS9A 3RXGA 4IBLH 1DM4B 2F9VA 3VB6A 4AYVB 1YC0A 2WV5A 3SV7A 1P8VC 3I78A 1CBWC 1T8MA 1F92A 1TE0A 2FPZA 1TB6H 4AX9H 2OP9A 2ZTYA 2GCTC 1SGEE 4O9VA 2XBWA 2FEQH 1CGIE 3GICB 4NCYA 4WMFA 3TJUA 1VITG 1GBAA 2AMPA 2JH6D 2A4GA 4XOJA 2PGQB 4Q63A 1HJAC 3MH4A 1A7SA 1EP6A 1TGTA 3HK6B 1W3CA 5A2MH 1QQ4A 3LJJA 1O5BB 5L30H 1UMAH 1VGCC 1GJ4H 2M2AA 2YMSD 1E34B 2OBOA 1TNJA 4X2VA 1SHHB 2B5TB 3E90B 2VH6A 5C5NA 5AF9H 1C1MA 4INKA 4WMDA 1G3DA 1RXPA 1ZMNA 4ABHA 3FKSD 4JMYA 3E0PB 4I8LA 2Z3DA 3KYFA 3E91A 5HIYA 1GBCA 5F8TA 1C2DA 1XKAC 1DOJA 1FPCH 1YPKH 3BG8A 1W14U 1S82A 3KQCA 3SUFA 2WV4A 2FX4A 4KP0A 4MLFB 1SGQE 3AVZA 1JBUH 3A80A 3F9GA 1TALA 3QUMP 5FPTA 3GY4A 1GVKB 2CF8H 2OXSA 4E7NA 4JCNA 1TGNA 1AWFH 1W0ZU 1W7XH 2ZQ2A 5T6GA 1HV7A 1GMHG 2VIVA 1GVZA 4P00A 1H8ED 2OC7A 1TA6A 1UVSH 5HYOA 3T2NA 4B6FA 1AKSA 1BMAA 5A0AE 4Q4LA 4Y8ZA 4A1VA 1P2IA 1JXPA 1SGYE 2GCHG 3UNSA 1ZOMA 2XNDD 1GJ9B 3RU4E 1E79D 2JIZD 2UWPA 2H6MA 3DCLA 3UOUA 2FLRH 3BTEE 5FCKA 4K3JA 2QF4A 2ZWLH 1C9PA 1OS8A 2ZFPH 1L1NA 1SGFG 2VIOA 3SUDA 2HWLB 3M3TA 1IQLA 1BBRE 3T26A 2CHAB 1QB6A 3EDXB 4K5ZA 1O2UA 2QE7D 3RMLH 1C2MA 1OWHA 2XC4A 4MQAA 4WVPE 1ZSJA 1GMCG 1B5GH 1SFIA 4ABIA 2EA3A 1EZUC 2C8WB 3ITIA 2HGTH 3U9AH 1T7CA 1AVXA 5EPYA 1KSNA 5SGAE 3EAJA 1W7GH 3LONA 2BY5X 1C1SA 2ZHQH 1H9HE 3UNRA 2SNWA 3KIDU 2GT8A 1ZMJA 2HNTE 1QIXB 1O2QA 5K0HA 1ELEE 4XD7D 1LPKB 3EQ0H 4NGAH 1FUJA 2J34A 3A89A 2ODYB 2AIPA 8ESTE 3QTVH 1ZRBA 3T29A 3LJOA 2HVYB 1G30B 3SNCA 1MUEB 1O2MA 4KGAA 1MBQA 1D6RA 2FOAA 1AE5A 2Y7XA 4X8TH 1S6FA 4D7FA 4ABFA 2YMSC 1GBMA 3UQOA 2VJ1A 5L2ZH 2H9EH 4TT3D 3D23A 2K8IA 1A61H 3L33A 1ID5H 2PSXA 3BTGE 1ZPCA 2WYGA 1ESBA 1O3KA 2Z9JA 1MABB 1O3GA 1ZHMA 5CDFE 1DWBH 1DLEA 1BJUA 4ZKNU 1DITH 2VWLA 4KTUA 3RM2H 1RTFB 4MNWA 4B6EA 1KIGH 5TCAA 2G52A 2Y6TA 1TOMH 1MTWA 2HLCA 5GPIB 4AGKA 5C0TA 3SJ9A 1CHOG 1AMHA 1S6LA 3Q77A 4X0WU 3U28C 1C2KA 4MPVA 2WPMS 3FZZA 3RXPA 4PROA 3SU5A 2NU4E 1GDUA 1ESAA 1RFNA 4FUDA 1FN6A 1XM1A 4YOJA 2ZDLA 1HJ9A 3SZEA 1V3XA 1PFXC 2SNVA 1TX8A 3UTUH 1KTTB 2DUCA 5DN6D 3C1KA 5FBIA 4CRGA 3MWIU 1ANDA 1YPEH 2ZTXA 2FYQA 1HB0B 3SO3A 1LKBA 2VVVA 2PHBA 4FVDA 4CRBA 1V2RT 4X2XA 4MTBA 4AFQA 2J98B 3SN8A 4M9FA 4OGYA 2BDIA 5C1XA 2IPHA 1N8OB 1BQYA 1Z8GA 5EPNA 1O37A 1ELAA 1O2ZA 1O5AB 4FUCA 2CK3D 3UIRA 1E1QD 1D4PB 3A8BA 1N6YA 1N1LA 1EZQA 4ZH8A 1VJAU 4X1PU 5J4QA 2Q6DA 3TIUA 2QN5T 2KFWA 2H9HA 3SNBA 2BB4A 4CHAB 5T3HA 2ZPQA 4AG1A 2ESTE 2OUAA 2WV9A 3CP7A 2C8YB 3GY8A 4DOQA 1GBDA 1K28D 3SHAH 3K65B 2XC5A 2FI4E 1FIZA 2IN2A 3ZYDA 1O2HA 4GUXA 1DUAA 1E0FD 3M7QA 4JK6A 5B6LA 4AFSA 3F3BA 1O34A 1L1JA 1UTNA 1O3NA 1LHCH 1NZQH 1RRKA 1S84A 1BZXE 4AORA 1MTNB 3F68H 4MNYA 9ESTA 3KEEA 1GBEA 2ZHDA 1V2VT 2BDGA 1EP5A 1KXEA 2ZDVH 2BD4A 2O9QA 2P95A 1C2HA 4E7RG 3M7UA 2ANKH 5AHGH 3OTJE 1ELTA 3MTYA 4TWYA 1P11E 3TGIE 6GCHG 1SQTA 1P01A 2PSYA 1O3IA 2WHXA 1ZTJA 3Q76A 4B1TA 1LTOA 1AO5A 1H4WA 2ZFTA 2R3YA 4Y8YA 2H5CA 2C3SA 3DA9B 1GBLA 3TJVA 2ZA5A 5C20A 5DKMA 2ZEBA 1GHWH 3H09A 4YLUA 4A5TS 1UCYE 1O3JA 4FUEA 4K69A 2G51A 1CT0E 3AW1A 3FP6E 2RFKC 1HIAB 4KELA 2ZFQH 4JYUH 3BTDE 2ODPA 1UTLM 1KLJH 1RIWC 2EC9H 1EXFA 2DE9A 3F0PA 4B75A 2A5IA 3DSPA 2QC2A 3SU2A 3S7HB 3ATIA 1RTLA 4I8KA 3BEFB 1UTJA 4U2WA 1HLTH 1FONA 1UHBB 1KLTA 1V2WT 1FY5A 3E3TA 3ESTA 1C4V2 1P10A 1BUIA 3E6PH 1PJPA 2SGDE 1GBBA 2J98A 2AFQB 2F4LA 2KCYA 2EQNA 4YT7H 2C90B 4SGAE 2GMTB 4ISOA 1O2IA 2CJIA 1THPB 4YTAA 1O3MA 3D65E 1GL0E 4X1SU 5GIBA 1K0HA 3RXCA 3TITA 1XXFA 1E36B 4B2CA 3KQBA 1K1NA 1QRZA 2FMJA 1O3DA 3S0NA 1BMLA 5CHAB 2A5AA 1VJ9U 3U8TH 1V6DA 3MYWA 1A1RA 1TPOA 3U1IB 2O8LA 1V2QT 4E05H 2G8TA 2P8OB 5AVDA 3GYMA 3LIWA 1GMDG 1W12U 4ISHH 1P2MA 5GCHF 1A0LA 3S7KB 5FBEA 1NU7B 1C1WH 3H7TA 5CMXH 1O0DH 3RXQA 1ETTH 3BG4C 4F48B 5GXPA 1O30A 1SQOA 2ZCLP 5HIZA 1BHXB 4XBCA 5BPEA 2FTMA 2BOKA 5HMAA 1UW7A 1C5UA 4K1EA 1TQ0B 3M5LA 3MU1A 2PUQH 3SU1A 4MDSA 1GJ5H 3GISB 1AB9C 5L6NH 2AH4X 1G2MA 4ZMAH 1CBWB 3LDXH 4X8SH 3TJOA 3EYDA 2W5EA 4NG9H 5EXLA 3E16B 1UVOA 2L6OA 2K0QA 2F9BH 4RN6A 1YPJH 1N6XA 5T6FA 5EJ1A 4TY7A 3ZVBA 4ACBA 1HJAB 4K60A 4FU9A 1V2TT 3PV5A 4FUHA 1QR3E 3GY6A 4NZLA 3A88A 1HAIH 1BBRK 4ISLA 2FI3E 1C4Y2 4IN1A 1HRTH 1GGDB 2WPHS 3U98H 2STBE 1FQ3A 2B9LA 1OYTH 1QJ7B 1IQNA 1O2PA 4DY7B 2BQ6B 4X1RU 2FM2A 1PYTD 1C5LH 3P8NA 2BM2A 1ZRKA 3SUGA 1RTKA 1QB1A 5EU8A 4NIWA 4BAQB 4A6LA 4OS1A 4ABAA 3STIA 5ESTE 4TY6A 2EI8A 1EASA 3IITA 5LPFA 3MH7A 1BITA 1VCPA 3SUEA 1RS0A 2TGTA 1SGIB 1DWCH 3ZZ5A 1SVPA 4DIIH 3FFGA 3PLPA 1J8AA 1TPPA 1Q2WA 3MMGA 5DP8A 3UWIA 1JRSA 2WPIS 1WTGH 5DK1A 1VKYA 1W0JD 2GX4A 3M3VA 1JMOH 2SGAA 2LNCA 1SI5H 5G4BA 1CA0C 1UVTH 5FXLA 3GCHC 1GHYH 1S6HA 1DS2E 5CE1A 3EA7A 5DP3A 4AB8A 2BY7X 3MH6A 2GZ8A 3PO1B 1HXFH 3MNSA 1C2GA 4H6SB 1P9SA 4M7GA 1KXBA 2QF0A 3DHKH 1C5QA 3SQEE 1BTYA 1C1VH 1GJAB 2TRMA 1UK4A 3SQHE 1QBNA 3ZVEA 4VGCB 2SGQE 5HGGA 1NFUA 3LU9B 2HPQH 2W26A 4DG4A 1O3CA 1TQ7B 1V2PT 3RXDA 1RJXB 1A5IA 1C2IA 1Y3UA 4NA7A 2ZU5A 2VIWA 3SGQE 2ANYA 3KQEA 8GCHF 4AN7A 1IQJA 1FI8A 2BDAA 1GG6B 7GCHF 3BEUA 1CT2E 3NCLA 1SSXA 4NIYA 2ZGHA 3OEHD 1SPJA 1LPZB 3TK9A 3NKKA 2UUKB 2EY4C 2V0BA 1MQ6A 2KCAA 3U8OH 3WW7A 1GI8B 1V2UT 2B0FA 1YP9A 2ALVA 5FX5A 3SI3H 1S83A 2ZU2A 1O2VA 3UQVA 5F03A 4MNXA 3P17H 1WBGB 1AGJA 1QL7A 2HRVA 1AVGH 4LZ1H 1E1RD 2I6QA 4E06H 2UUFB 3PV4A 2WPLS 1NM6A 3N7EA 4F55A 3M35A 2OC8A 5ABWA 1SLUB 1L4ZA 1O3AA 1NRNH 2YMSB 1EOLA 1HAXB 1F0SA 2ZGXH 1F0RA 1HYLA 1EB2A 1YPHC 2H2ZA 1W0YH 1C5XB 1P04A 3RC5A 2VWNA 1A0HB 2BD5A 2ZHFH 1H8IH 2H1UA 1NTPA 2SFAA 3GDSA 1O3PB 2Y5FA 1SLWB 4Y71A 4Q7XA 1LKAA 1PYTC 4WMEA 1BTHH 1UVPA 3A81A 2GGVB 2QXHA 4OGXA 2FOEA 3VXEH 4X2YA 1IQIA 1TRYA 1YCPM 2GD4B 2FOGA 5EJLA 3W1EA 2P94A 3ZZCA 4NA8A 1C5YB 3RXTA 2QYIA 1P2OA 1YBWA 2KM0A 3PWBA 3GY7A 1HNEE 1G32B 1EKBB 3TPIZ 2GZ9A 5JDUB 2XBVA 4X2WA 1SOTA 2HLDD 2V7QD 2YNBA 1IQKA 1IHSH 3A82A 4GCHF 2RCEA 1J15A 1MD7A 2UUYA 4DT4A 1SBWA 1ARCA 3A83A 3H5CB 2D1JA 1W8BH 2AERH 3M5OA 1TA2A 1QBVH 1GI7B 1QFKH 2J2UA 1BA8B 4DGJA 1YM0A 5DP4A 2ZTZA 4HI3A 2RDEA 2AHME 1GHAF 1SHYA 3PMAB 1GI0A 2QCYA 4KTSA 3RXHA 3VG8A 1Y5BT 1PPGE 2ZF0H 2W7UA 4NWKA 2F9UA 5IDKA 2K1QA 3GDVA 2F83A 2ZU3A 1BIOA 5A09A 1MKWK 3VGCC 4XFQA 2AEIH 1QBOA 2FOFA 3N7OA 4FUGA 2A7CA 3UR9A 3GY5A 4MPUA 1UCYK 4MPXA 2BDBA 2ZDMA 2WUBA 2XBXA 2ILNA 3NZIA 2ZFFH 3A86A 1DWEH 3U69H 3L3TA 3ZZ4A 2BXTH 1T32A 1NU9A 2F43B 3UAIC 1NFXA 3TH2H 4MNVA 2ZHWH 4O97A 1EAXA 1P06A 4Y7BA 5GJ4B 4FUIA 1P03A 3BIUH 4KTCA 2VNTA 2CGAA 3MHWU 1TPAE 3HATH 2JETC 4BAHB 2JKHA 1TFXA 3MQKC 2GKVE 4JZFH 2R2MB 1MU6B 1ABIH 2J95A 3LT3A 3R0FA 4ABEA 1T31A 2J4IA 3OEED 4CRAA 3MNBA 5JBAS 2Z3CA 1OYQA 1QJ1B 5LPEA 2CXVA 3SU4A 1HAVB 4CH2B 4CR5A 1QURH 2PKAB 1Z71A 3A85A 3RM0H 1TX6A 1GDNA 1P3CA 1ETSH 1BTUA 4BNRA 3BTHE 1DSTA 1T8NA 1GBHA 3TVJB 4GPGA 2VWOA 5FPSA 3RU4T 3ZVCA 3DFLA 1NC6A 2BXUH 1DY9A 2PTNA 2QGRA 3ENSB 1YYY1 1CHGA 1OHHD 5DP5A 4OS5A 3SV8A 3VB3A 1F5RA 2Q6FA 1GPZA 2CMYA 1RIWB 2VH0A 1QB9A 1MKXK 3Q3KA 4OS7A 1KYNA 4I8GA 1C4U2 4WJG2 1E35B 1P3EA 1C9TA 2PR3A 1HDTH 2VIQA 1YLCA 1TWXB 4UFEH 1O2XA 2GJGA 4WH8A 1NRPH 3UUZA 1PPHE 1EX3A 4NIXA 4X8UH 1BHXF 3QZQA 1LVMA 1FDPA 2KX4A 1E38B 2Z9GA 1P57B 3RC4A 1VCQA 5FHTA 5DG6A 4FVBA 3B8JA 1Z8RA 1ZPBA 3Q3YA 2KAIB 4CREA 2J94A 2Q6GA 3PMJA 1NBMD 1IQGA 1K1JA 1C1UH 1CA8B 2VVCA 3PB1E 1SGCA 4OS6A 4YZUA 1OPHB 4AZ2B 1ZMLA 1FMGA 1BTPA 3LH3A 3F2GA 4CRCA 4CBOA 7ESTE 1L0ZA 4ESTE 3KL6A 3K6ZA 1D3PB 1YPGH 1J14A 1V2KT 2GDDA 2D8WA 3RXVA 1ZSKA 3LGVA 1ZHRA 2A2XH 5GCHG 2PLXA 3MU4A 3ZZ9A 2GT7A 4O3TA 1QY6A 1O2LA 2FXRA 2HALA 1NESE 2XC0A 1DXWA 4TPIZ 4B74A 1C2JA 2G5NA 3ZVFA 1HAHH 1OP8A 1AB9B 2WUCA 1YLDA 3MO3A 1BRAA 2PWXA 4K8BA 3RXKA 4UEHH 2PW8H 2A32A 4P02A 1BRBE 2TPIZ 3A7XA 5LH8A 2BLWA 1HAVA 3HPTB 1XUFA 4YXWD 2B8OH 2PKAA 1YY3A 1KXFA 2A1DB 2Y82A 1QHRB 3ZVGA 1ZZZA 4X1QU 1C1PA 2H9TH 1OSSA 1AHTH 4XSKU 4DT7B 1SFQB 3IWMA 1EAUA 1YCPK 1W11U 1AZZA 3RXBA 2JH0D 5JB9S 1A5HA 1D6WA 9LPRA 3FZDA 1AQ7A 2PP6A 3EA9A 4BXWA 2ASUB 5T6DA 2OC0A 3F2FA 2LELA 1L2EA 1H8HD 1QA7A 1ELGA 4I33A 2UUJB 1V2LT 3QN7A 4CRDA 3JZ2B 3PMHB 1WUNH 4AYYB 4GSOA 3EE7A 3MNCA 4BAMB 4Z6AH 1LHDH 2FS9A 1XVMA 1CQQA 1NROH 1GHBF 3QX5H 3SV9A 4FU8A 4X6NA 4OS4A 2JJ2D 4THNH 4WXVA 4K8YA 4BANB 5DP9A 1T8OA 1HPGA 1DANH 2D2DA 1AE8H 1C5RA 3DT0H 4ZKRU 3RXMA 5J4SA 1GBIA 1LQEA 1OX1A 3CENA 4JZDH 1O2YA 2R9PA 2GDEH 1P12E 5CHBA 5HM2A 3PYHA 1W2KH 3B9FH 2OC1A 1EFRD 1C1NA 5TJXA 3OE7D 1O2NA 1AUTC 5FPYA 3OX7U 2KAIA 2C93B 3GCHB 1G2LA 3GOVB 3STJA 3T27A 2HVXA 1QRWA 3F0OA 4I7YH 3ZZ7A 1GCTC 2FTLE 2FIRH 4JK5A 4Y0YE 3MFJA 5AFYH 5EW2H 4K1TA 1V2MT 4Q80A 2V3OH 1AWHB 1O2SA 3SGAE 1MZDA 1RGQA 4WH6A 2HOBA 1S0RA 2OLGA 1YPHE 1BT7A 3QDZB 3SJKA 3E8LA 4IMZA 1CVWH 2KZ4A 1UTPA 2BHGA 4Z0KA 1QA0A 1T4UH 4IC6A 3VPKA 4X6OA 1C2LA 4H4FA 1GMCF 3QTOH 4B71A 3WWBA 1IQHA 1WYKA 1UK2A 2QAAA 1P2KA 2RA0A 3KCGH 1V2ST 1P02A 3MU8A 3PLKA 1SL3A 3BN9A 8GCHG 2ZPRA 2XWAA 4ABDA 2EI7A 3LC5A 1VCWA 1ANEA 1S85A 3F9FA 2CN0H 4GAWA 3RDZA 4OM9A 1UTMA 2A31A 1SQAA 2WSSD 3BIVH 2QXJA 1G9IE 1FY3A 1SG8B 1Y5UT 2BY9X 2VVUA 3N99A 3E1XB 5JYIA 3RXFA 4LOYH 5E8EH 1KTSB 5JBBS 1K1IA 4NIVA 3P8OA 4RT0A 1ZGIA 1BCUH 3G01A 4RT1A 4NFEA 2BDYA 1JRTA 1TNLA 5C17A 2Y5HA 4U30A 4X1NU 3C27B 2BDHA 2FS8A 1Y3YA 4Y79A 1GBFA 4INLA 2ULLA 5EXNA 3RMNH 1O3FA 3EE0B 2ZFSA 3KGPA 4D8NA 3UREA 2W6JD 1XMNB 1O2WA 2UWLA 1BB0B 2ZC9H 1QNJA 1QJ6B 4ZXXH 3VB5A 4DVAU 1H1BA 3SORA 2A45B 4Y6DA 6ESTA 3TLOA 3UFAA 4BAKB 1PQ5A 2CV3A 1WSSH 3ZIAD 4K1SA 4X6MA 2A7HA 5AFZH 3MI4A 2GCTB 4XDEA 3ATWA 1GI3A 3T5FH 1YF4A 4AC9A 4GCHG 3GYLB 3HGNA 1P05A 2TGDA 1O5FH 1ELBA 1EATA 4IC5A 1BTXA 1CGHA 5H4IB 4D9RA 3ZYEA 1VGCB 5DO4H 1QL8A 1AY6H 3A7VA 4FUFA 3VB4A 3BTKE 1GHAG 4YOGA 5E0JA 4Z1MD 1FJSA 2FX6A 4ZXYH 3VGCB 1N8OC 3W95A 1O2GH 3SU0A 1FZZA 5TCCA 1HIAA 4Q7ZA 1IHTH 3GCTF 3TJNA 2OD3B 1JIMA 1O3OA 4XRNA 2OTVA 4O03A 3LC3A 1K1LA 3KNXA 4A1TA 1QTFA 1DY8A 5IYTA 1SGDE 3ZV8A 4YM9A 3P8GA 3CS0A 2R0LA 3QLPH 1YPMH 1UHBA 1HUTH 2AGGX 4CHAC 2JJ1D 1C2FA 1NO9H 3PM3A 3EGKH 1UVUH 2NU0E 4HGCA 3A7YA 2VGCC 1PQAA 1Y3XA 2JETB 2ZFRH 1Z8IB 1SC8U 1FX0B 1A5GH 1O3BA 3P6ZB 1GDQA 2BZ6H 1TIOA 1FXYA 1YKTA 2YOLA 2OK5A 4BTTB 3BF6H 1KMHB 3LGUA 2QY0B 3RXRA 4ABGA 1TNGA 2P3FH 4AFZA 1WCZA 3SZNA 2V6NA 2FDAA 3F9HA 1A0JA 5C5OA 2L74A 3M36A 1GJCB 3UY9A 1W10U 6GCHF 3ELAH 3TK5A 2V3MA 1LDTT 4B2BA 1O35A 2BYAX 3PTBA 1FAXA 2XOKD 1O3EA 2G55A 3PROA 2ZHEH 4K2YA 3NRLA 2D26C 2XTTB 1DUEA 1ZYOA 1F2SE 4YT6H 4DW2U 2Z3EA 1CSOE 3LH1A 1GJ6A 2F9PA 1KXDA 2SGPE 1OWEA 5A0CA 3SOSA 1JWTA 1MAXA 4Q2KA 5HKKD 2FP7B 1GBJA 1Z6EA 3ZZ8A 2G4UA 2AGEX 2J97A 2HNTF 1NFWA 1FLEE 5DGJA 4WWYA 2BQWB 3GCOA 2ZCHP 3QWCH 1TABE 6CHAC 4D76A 5HXFA 5LGOA 4LZ4B 3IG6B 1P2QA 2ZGBH 3FANA 1UTOA 1MTVA 1MCTA 1DT2A 2AMDA 2BX3A 3KQDA 3LOXA 4FXGH 2AIQA 4KKDA 3A7TA 3F6UH 2FLBH 1SB1H 1MQ5A 4IGDA 2RDLA 1F5KU 2CF9H 3BTFE 1MH0A 1H8DH 1XUJA 2O8MA 5E0GA 5FAHA 1TRNA 4MVNA 2GMTC 1PPBH 3RLWH 4XE4A 4FUBA 4JZIA 3D49H 2W6ID 2NU1E 1HAPH 4U32A 1FIWA 4ZHMU 5I46H 1OWIA 1TGCA 3FVFB 1B7XB 2ZDAH 1AFQC 2QF3A 2XRCA 2VBCA 1XUGA 2PUXB 1TGSZ 1BMFD 3P95A 4AGJA 2R3UA 4UFFH 1YPLH 3A87A 5CHAC 5GNDA 1EUFA 1THSH 2VU8E 4Y0ZE 1LQDB 1FY1A 1PPZA 2NWNA 1GMDF 1GHZA 3OYPA 3NWUA 2VIDA 1SR5C 3DSGA 1SGRE 2TBSA 3RXIA 1C5VA 3DUXH 4X8VH 1DSUA 2C4FH 3TU7H 1YLNA 3PMBB 2UWOA 1OWDA 1U6QA 2W3KA 3TGJE 3BEIB 1C5TA 2SGFE 5JB8S 1NS3A 3LGIA 1MD8A 3CNRA 3Q3XA 1W0KD 3K9XB 4UFDH 2FESH 3V3MA 3MO9A 4I31A 4DJZB 2FO9A 1CU1A 2KCOA 3K6YA 1PQ8A 1NFYA 2ZECA 3F9EA 5EQQA 2HPPH 1ELDE 5C67A 1Y8TA 1TRMA 5FL7D 1MBMA 2BTCE 1ESTA 3ZZDA 1D9IA 1VZQH 3CS7A 4YOIA 3URCA 1O2JA 2ZQ1A 3MO6A 1C1QA 2KR7A 3RXUA 1K22H 1NBME 4J1YA 1XXDA 5C1YA 3LPRA 2ZGJA 2RG3A 2LP6A 1COWD 4HTCH 1C5OH 2PFEA 1ZTKA 4I8JA 4Y10E 1ELVA 1KLIH 1DXPA 2ZCKP 2VWMA 1C5NH 4RKOB 4GHTA 1Q3XA 2ZPSA 5KEDA 3S69A 3O8CA 1OWJA 1Q31A 2J92A 2F9OA 3P70B 4O3UA 1GGDC 3V0XA 2OCVB 1QQUA 2IOTA 4BXSA 1SGTA 2XCFA 4INHA 1TNKA 3SV6A 1C5MD 1GHBG 2EI6A 2GVFA 1H9IE 1MCVA 1F0TA 1K21H 1G3CA 4OS2A 1X7AC 2G81E 4JZ1A 1BMMH 2BY6X 3RMOH 2BVXH 1E37B 1EPTC 2WYJA 1TGBA 1SGFA 4Y7AA 4CR9A 3JZ1B 3M37A 4TYDA 2Y81A 1J9CH 2STAE 1BBRH 1ZPZA 2FYRA 3QGJA 2LPRA 5JBCS 4IS5A 4JYVH 4YLQH 1RD3B 3PLBA 3OU0A 1GCTB 1YGCH 1OXGA 2YNAA 2XWBI 1H9LB 1S81A 1WXRA 3FO8D 1EJAA 3P92A 1GHXH 4SGBE 1QCPA 1LO6A 2BVRH 3BTTE 2BLOA 5JPMH 1AIXH 1ANBA 4QT8C 1PQ7A 3RP2A 4UONA 2ZNKH 4R0IA 2PKSC 1TBZH 3L6PA 5EODA 3N7DA 1ZR0A 3OY5U 1KDQB 1SOZA 1BTZA 3ODFA 1XUIA 3PO1C 2BY8X 1ORFA 2WPJS 1A46H 1CO7E 1FAKH 4ASUD 3OSYA 1Y3WA 2P3UB 5F8XA 1GHVH 3H7OA 4VGCC 4FETA 3SU3A 2IJD1 4UFGH 3A7ZA 2ZP0H 1GI1A 2ANWA 2BD2A 2OINA 4JYTA 2J38A 3A8CA 5B6OA 1O33A 1Z1JA 2C8XB 4ASHA 1IAUA 3PV2A 4HZHA 1AZ8A 3EA8A 1V2OT 5F8ZA 5A8XA 1W13U 1GG6C 1GL1A 1PPFE 2G5VA 1ACBE 4UD9H 2QXGA 2C8ZB 4TWWA 3TH3H 3ZZBA 1C1TA 2IPQX 3OAAD 5IK2D 3A7WA 2A2QH 3RC6A 1P0SH 1K9OE 5KGOA 5F53A 1LHGH 3KN2A 1T4VH 4B76A 5DP7A 1WU1A 2GV7A 1BMNH 1O5DH 2P3TB 2ZGCA 3ODDA 5E2PA 2Z94A 1TMUH 3SI4H 1ETRH 3QO6A 1GI5A 3TNTA 3M3SA 2BLVA 3KQ5A 4HFPB 3AASA 1AUJA 4ACAA 1K1MA 1MU8B 1DLKB 1O36A 2Q1JA 1NPMA 3BG4B 1HAZB 5JBTA 3T28A 1NT1A 2QIQA 3B23B 7LPRA 1ZTLA 2A7JA 3VEQB 3RLYH 2F91A 4BOHA 1XKBC 2XNIA 4WY3A 1ELFA 3PRDA 2TGPZ 4NWLA 2Z9LA 2M5TA 3TGKE 1O5EH 4HG6A 1GVLA 5K7RA 1L1GA 1Z1IA 2ZU4A 2P59A 2XXLA 2F9NA 3HKIB 3QK1A 1SKYE 4ZAEA 3O8RA 4H6TA 1VITF 3AK5A 1HJ8A 3NXPA 4FOUC 1O38A 3AAVA 2V3HH 2ZG0H 1Y59T 4CRFA 1F0UA 4XBDA 1FN8A 2GV6A 3RU4D 3LGWA 3VB7A 1JIRA 1C5WB 3A8AA 4U01A 1WQSA 4GLYA 3ZV9A 3SGBE 1BOQA 1BRCE 1O2RA 1KDQA 4D9QA 1C1OA 4BTIB 4RSPA 3SHCH 4Y11E 1DFPA 3OFND 4CBNA 3UR6A 1VR1H 1BDAA 1YWUA 1KXAA 2Y7ZA 4ISNA 1LVBA 1ANCA 3GCTG 3AAUA 4ZKOU 1PPEE 3T62A 1K1OA 2J5UA 1EB1H 5ESBA 1HAOH 2FOCA 3PWCA 3MH5A 1SGPE 1GWAA 2AMQA 2R0KA 2BQ7B 3HKJB 2DE8A 2VGCB 2V35A 2FOHA 2ZI2H 4D7GA 3SJIA 1P2JA 5EW1H 3BSQA 1WTHD 3RUOA 4AOQA 2BVSH 1O2KA 3MU0A 4J2YB 5HM9A 3M5MA 1EJMA 1CA0B 4AG2A 1GMHF 3AW0A 1MKWH 1Z7KA 3URDA 5C94A 1S0QA 1M9UA 1TLDA 1LVYA 2FZZA 2OBQA 1TYNA 2A4QA 2GCHF 1F5LA 1IQFA 1WV7H 3Q00A 4WXIA 2G00A 3ZVAA 1UCYH 1GJBB 1EOJA 4BAOB 1O5CB 2B7DH 2WINI 1MAYA 4YO9A 1A3BH 1D3TB 2O8TA 2Z6BD 4NA9H 1ZJDA 2ZZUH 8LPRA 3SW2B 3ATMA 5DPAA 4ZUHA 1SMFE 4RI0A 2F3CE 4TPYA 7KMEH 1UK3A 1HXEH 1TAWA 1OKXA 4MPWA 5C0UA 1O3LA 1UTQA 1J17T 3BTME 2W7SA 1OOKB 3S9AA 4LK4A 2JDID 1TMBH 1L4DA 3PRBA 4AFUA 3BTWE 5LPRA 1C5ZB 1WAYB 6LPRA 4B2AA 1ZJKA 1V2NT 1GI9B 2CHAC 1G37A 3DFJA 3KF2A 3RMMH 1DPOA 3SBKA 4NFFA 1Z6JH 3RXEA 4MG3A 1S5SA 2Y80A 1SQRA 2XBYA 2ZDKA 7GCHG 1BRUP 1DVAH 1AN1E 3A84A 4ZCNA 4FU7A 5A8ZA 2KCPA 3D62A 3GY2A 2ZKSA 5A0BA 3O8DA 1TONA 1HBTH 6CHAB 1GBKA 1OWKA 1XUKA 4NSYA 2OQ5A 1XUHA 3SJ8A 1DWDH 1NY22 4I8HA 2GZ7A 4B73A 2Z7FE 3ATLA 2RA3A 3ATKA 5I25A 5E2OA 1GI6A 2J9NA 1EJNA 3SNEA 2P93A 4IN2A 2P16A 1ARBA 3KHVA 3DD2H 2WZQA 3NUMA 1TMTH 1D3QB 3GDUA 4GVUA 1EQ9A 1GI2A 2TGAA 3RXAA 5EGMA 5EJZA 5EOKA 1MKXH 4ZHAA 1AFQB 1DX5M 2ANMH 2BLQA 3FOAA 1ZGVA 1FPHH 3LGYA 3W94A 2BD7A 5FCRA 4JZEH 4ABBA 1ZLRA 4XBBA 5F6MA 1JOUB 1TNHA 3U1JB 1NN6A 1TBRH 3O8BA 2JH5D 5GWZA 5DJ7A 4NZQA 3R3GB 1VITH 2BZAA 1CHOF 1TX7A 2AGIX 1EAWA 1XVOA 3VFEA 1GJDB 1F7ZA 2FI5E 3ZZ3A 3F2HA 3TNSA 1LMWB 2HNTC 2QA9E 1Z8JB 3I77A 2ZO3H 3M5NA 1BJVA 1HAYB 2PGBB 3F1SB 5ETXA 2THFB 2GTBA 3S9BA 2FODA 4F4OC 4R8TB 2NU2E 1FNIA 4UE7H 4AB9A 4Y8XA 2AYWA 1A4WH 1IQMA 1UJ1A 1HGTH 2BMGB 4GHQA 1P2NA 2Z9KA 4DCDA 1P9UA 3SNAA 1WOFA 1D3DB 1MZAA 4YESB 2XYAA 2EEKA 4DURA 4H42U 1OP2A 1HCGA 1ZHPA 5EXMA 5C3NA 4UDWH 2VINA 5PTPA 3UWJH 1O2OA 1GBTA 2ZU1A 1MTSA 4ZROA 1C5SA 1BTWA 1AFEH 1GJ8B 4Y76A 1QRXA 2A4RA 2ZIQH 2TIOA 4FUJA 5E0HA 1AI8H 3SU6A 3MOCA 1FY4A 5DP6A 1GJ7B 1O32A 3HK3B 1LCYA 1C1RA 1IOEA 2QXIA 3V7TA 1DE7H 1UO6A 3UB0A 5EQRA 3WWFA 1WQVH 3GY3A 2NU3E 3ZVDA 4TSFD 3GCNA 4WF8A 1A2CH 5GDSH 3UNQA 1EPTB 3S9CA 1GCDA 2W3IA 1B0FA 1P09A 1YCPH 3K2UA 2VIPA 5C1UA 2O8WA 3FAOA 1MTNC 2ODQA 5T1VA 3OTPA 3FP8E 2BDCA 2OQUA 3RXSA 4Q7YA 3T25A 1AD8H 2PTCE 4IW4E 3MU5A 1TOCB 4BTUB 1DDJA 1G3BA 3LKWA 1ELCA 1PPCE 2GP9B 3FN8A 3NPSA 3RXOA 1HAGE 2R2WU 1CE5A 3RXLA 3M61U 2BD9A 4CH8B 3QZRA 1ABJH 3SYJA 4I86A 3ZZAA 2BX4A 1IQEA 4RKJB 2PKSB 5L2YH 1NRRH 1DICA
chains in the Genus database with same CATH topology
3MNXA 1C2EA 2BD3A 8KME2 2XCNA 1HFDA 1K1PA 1O3HA 1SLXB 1G3EA 3TH4H 4LXBH 1SLVB 3QGNB 4DIHH 3BV9B 4ZKSU 3HGPA 5EQSA 1AVWA 1TPSA 1LHFH 1EZSC 1NRQH 1MMJN 3P8FA 3UPEA 4ABJA 1KY9A 4ISIH 2A5KA 1FY8E 2ALPA 2QV1A 4F49A 2WPKS 2ZDNA 1LPGB 2SGEE 3UOPA 1LHEH 1V2JT 1MTUA 1EAIA 3E0NB 1T8LA 3ZZ6A 3M7TA 5C2ZA 1O39A 1GI4A 2G4TA 1A3EH 1KXCA 2H5DA 1C5PA 1QGFA 4A92A 3LGTA 2I6SA 1EZXC 4IMQA 1THRH 2BOHB 1K2I1 1ZSLA 5BRRE 3V13A 2FOBA 3NK8A 1B0EA 1Y3VA 1QL9A 2FWWA 1UTKA 3PTNA 3TK6A 1AKSB 4I32A 1AU8A 1Y5AT 1FV9A 2A0QB 3I29A 4A7IB 4A1XA 3FP7E 1G36A 1NRSH 2AS9A 3VXFH 2FOMB 1TNIA 2VB0A 2PV9B 4NSVA 1TBQH 2BD8A 3OY6U 2A4OA 5EG4A 5FX6A 2Y5GA 5A8YA 2XW9A 3V12A 1OP0A 2P8OC 1CGJE 1XX9A 2IJOB 4ZHLU 3A8DA 4X6PA 1EPTA 3SNDA 1O2TA 1SGNE 1LVOA 1O5GH 1CT4E 3BTQE 3SV2H 3U8RH 3RXJA 2Z9IA 3WY8A 3SJOA 1J16A 1O31A 1INCA 2O8UA 3RXGA 4IBLH 1DM4B 2F9VA 3VB6A 4AYVB 1YC0A 2WV5A 3SV7A 1P8VC 3I78A 1CBWC 1T8MA 1F92A 1TE0A 2FPZA 1TB6H 4AX9H 2OP9A 2ZTYA 2GCTC 1SGEE 4O9VA 2XBWA 2FEQH 1CGIE 3GICB 4NCYA 4WMFA 3TJUA 1VITG 1GBAA 2AMPA 2JH6D 2A4GA 4XOJA 2PGQB 1HJAC 3MH4A 1A7SA 1EP6A 1TGTA 3HK6B 1W3CA 5A2MH 1QQ4A 3LJJA 1O5BB 5L30H 1UMAH 1VGCC 1GJ4H 1E34B 2OBOA 1TNJA 4X2VA 1SHHB 2B5TB 3E90B 2VH6A 5C5NA 5AF9H 1C1MA 4INKA 4WMDA 1G3DA 1RXPA 1ZMNA 4ABHA 4JMYA 3E0PB 4I8LA 2Z3DA 3E91A 1GBCA 5F8TA 1C2DA 1XKAC 1DOJA 1FPCH 1YPKH 3BG8A 1W14U 1S82A 3KQCA 3SUFA 2WV4A 2FX4A 4KP0A 4MLFB 1SGQE 3AVZA 1JBUH 3A80A 3F9GA 1TALA 3QUMP 5FPTA 3GY4A 1GVKB 2CF8H 2OXSA 4E7NA 4JCNA 1TGNA 1AWFH 1W0ZU 1W7XH 2ZQ2A 5T6GA 1HV7A 1GMHG 2VIVA 1GVZA 2OC7A 1TA6A 1UVSH 5HYOA 3T2NA 1AKSA 1BMAA 5A0AE 4A1VA 4Y8ZA 1P2IA 1JXPA 1SGYE 2GCHG 3UNSA 1ZOMA 1GJ9B 3RU4E 2UWPA 2H6MA 3UOUA 2FLRH 3BTEE 5FCKA 4K3JA 2ZWLH 1C9PA 1OS8A 2ZFPH 1L1NA 1SGFG 2VIOA 3SUDA 2HWLB 3M3TA 1IQLA 1BBRE 3T26A 2CHAB 1QB6A 3EDXB 4K5ZA 1O2UA 3RMLH 1C2MA 1OWHA 2XC4A 4MQAA 4WVPE 1ZSJA 1GMCG 1B5GH 1SFIA 4ABIA 2EA3A 1EZUC 2C8WB 3ITIA 2HGTH 3U9AH 1T7CA 1AVXA 5EPYA 1KSNA 5SGAE 3EAJA 1W7GH 3LONA 2BY5X 1C1SA 2ZHQH 1H9HE 3UNRA 2SNWA 3KIDU 2GT8A 1ZMJA 2HNTE 1QIXB 1O2QA 5K0HA 1ELEE 1LPKB 3EQ0H 4NGAH 1FUJA 2J34A 3A89A 2ODYB 2AIPA 8ESTE 3QTVH 1ZRBA 3T29A 3LJOA 1G30B 3SNCA 1MUEB 1O2MA 4KGAA 1MBQA 1D6RA 2FOAA 1AE5A 2Y7XA 4X8TH 1S6FA 4D7FA 4ABFA 1GBMA 3UQOA 2VJ1A 5L2ZH 2H9EH 3D23A 1A61H 3L33A 1ID5H 2PSXA 3BTGE 1ZPCA 2WYGA 1ESBA 1O3KA 2Z9JA 1O3GA 1ZHMA 1DWBH 1DLEA 1BJUA 4ZKNU 1DITH 2VWLA 4KTUA 3RM2H 1RTFB 4MNWA 1KIGH 5TCAA 2G52A 2Y6TA 1TOMH 1MTWA 2HLCA 5GPIB 4AGKA 3SJ9A 1CHOG 1AMHA 3Q77A 4X0WU 1C2KA 4MPVA 2WPMS 3FZZA 3RXPA 4PROA 3SU5A 2NU4E 1GDUA 1ESAA 1RFNA 4FUDA 1FN6A 1XM1A 4YOJA 2ZDLA 1HJ9A 1V3XA 1PFXC 2SNVA 1TX8A 3UTUH 1KTTB 2DUCA 3C1KA 5FBIA 4CRGA 3MWIU 1ANDA 1YPEH 2ZTXA 2FYQA 1HB0B 3SO3A 1LKBA 2VVVA 2PHBA 4FVDA 4CRBA 1V2RT 4X2XA 4MTBA 4AFQA 3SN8A 4OGYA 2BDIA 5C1XA 2IPHA 1N8OB 1BQYA 1Z8GA 5EPNA 1O37A 1ELAA 1O2ZA 1O5AB 4FUCA 3UIRA 1D4PB 3A8BA 1N6YA 1N1LA 1EZQA 4ZH8A 1VJAU 4X1PU 5J4QA 2Q6DA 3TIUA 2QN5T 2H9HA 3SNBA 2BB4A 4CHAB 5T3HA 2ZPQA 4AG1A 2ESTE 2OUAA 3CP7A 2C8YB 3GY8A 4DOQA 1GBDA 1K28D 3SHAH 3K65B 2XC5A 2FI4E 1FIZA 2IN2A 3ZYDA 1O2HA 4GUXA 1DUAA 1E0FD 3M7QA 4JK6A 4AFSA 1O34A 1L1JA 1UTNA 1O3NA 1LHCH 1NZQH 1RRKA 1S84A 1BZXE 4AORA 1MTNB 3F68H 4MNYA 9ESTA 3KEEA 1GBEA 2ZHDA 1V2VT 2BDGA 1EP5A 1KXEA 2ZDVH 2BD4A 2O9QA 2P95A 1C2HA 4E7RG 3M7UA 2ANKH 5AHGH 3OTJE 1ELTA 3MTYA 4TWYA 1P11E 3TGIE 6GCHG 1SQTA 1P01A 2PSYA 1O3IA 1ZTJA 3Q76A 4B1TA 1LTOA 1AO5A 1H4WA 2ZFTA 2R3YA 4Y8YA 2H5CA 2C3SA 3DA9B 1GBLA 3TJVA 2ZA5A 5C20A 5DKMA 2ZEBA 1GHWH 4YLUA 4A5TS 1UCYE 1O3JA 4FUEA 4K69A 2G51A 1CT0E 3AW1A 3FP6E 1HIAB 4KELA 2ZFQH 4JYUH 3BTDE 2ODPA 1UTLM 1KLJH 1RIWC 2EC9H 1EXFA 2DE9A 4B75A 2A5IA 3SU2A 2QC2A 3S7HB 3ATIA 1RTLA 4I8KA 3BEFB 1UTJA 4U2WA 1HLTH 1FONA 1UHBB 1KLTA 1V2WT 1FY5A 3E3TA 3ESTA 1C4V2 1P10A 1BUIA 3E6PH 1PJPA 2SGDE 1GBBA 2AFQB 4YT7H 2C90B 4SGAE 2GMTB 4ISOA 1O2IA 2CJIA 1THPB 4YTAA 1O3MA 3D65E 1GL0E 4X1SU 5GIBA 3RXCA 3TITA 1XXFA 1E36B 4B2CA 3KQBA 1K1NA 1QRZA 2FMJA 1O3DA 3S0NA 1BMLA 5CHAB 2A5AA 1VJ9U 3U8TH 1V6DA 3MYWA 1A1RA 1TPOA 3U1IB 2O8LA 1V2QT 4E05H 2G8TA 2P8OB 5AVDA 3GYMA 3LIWA 1GMDG 1W12U 4ISHH 1P2MA 5GCHF 1A0LA 3S7KB 5FBEA 1NU7B 1C1WH 3H7TA 5CMXH 1O0DH 3RXQA 1ETTH 3BG4C 5GXPA 1O30A 1SQOA 2ZCLP 1BHXB 4XBCA 5BPEA 2FTMA 2BOKA 5HMAA 1C5UA 4K1EA 1TQ0B 3M5LA 3MU1A 2PUQH 3SU1A 4MDSA 1GJ5H 3GISB 1AB9C 5L6NH 2AH4X 1G2MA 4ZMAH 1CBWB 3LDXH 4X8SH 3TJOA 3EYDA 2W5EA 4NG9H 5EXLA 3E16B 1UVOA 4RN6A 2F9BH 1YPJH 1N6XA 5T6FA 4TY7A 3ZVBA 1HJAB 4K60A 4FU9A 1V2TT 4FUHA 1QR3E 3GY6A 4NZLA 3A88A 1HAIH 1BBRK 4ISLA 2FI3E 1C4Y2 4IN1A 1HRTH 1GGDB 2WPHS 3U98H 2STBE 1FQ3A 2B9LA 1OYTH 1QJ7B 1IQNA 1O2PA 4DY7B 2BQ6B 4X1RU 2FM2A 1PYTD 1C5LH 3P8NA 2BM2A 1ZRKA 3SUGA 1RTKA 1QB1A 5EU8A 4NIWA 4BAQB 4A6LA 4OS1A 4ABAA 3STIA 5ESTE 4TY6A 2EI8A 1EASA 3IITA 5LPFA 3MH7A 1BITA 1VCPA 3SUEA 1RS0A 2TGTA 1SGIB 1DWCH 3ZZ5A 1SVPA 4DIIH 3FFGA 3PLPA 1J8AA 1TPPA 1Q2WA 3MMGA 5DP8A 3UWIA 1JRSA 2WPIS 1WTGH 5DK1A 2GX4A 3M3VA 1JMOH 2SGAA 2LNCA 1SI5H 5G4BA 1CA0C 1UVTH 5FXLA 3GCHC 1GHYH 1S6HA 1DS2E 5CE1A 3EA7A 5DP3A 4AB8A 2BY7X 3MH6A 2GZ8A 3PO1B 1HXFH 3MNSA 1C2GA 4H6SB 1P9SA 4M7GA 1KXBA 2QF0A 3DHKH 1C5QA 3SQEE 1BTYA 1C1VH 1GJAB 2TRMA 1UK4A 3SQHE 1QBNA 3ZVEA 4VGCB 2SGQE 5HGGA 1NFUA 3LU9B 2HPQH 2W26A 4DG4A 1O3CA 1TQ7B 1V2PT 3RXDA 1RJXB 1A5IA 1C2IA 1Y3UA 4NA7A 2ZU5A 2VIWA 3SGQE 2ANYA 3KQEA 8GCHF 4AN7A 1IQJA 1FI8A 2BDAA 1GG6B 7GCHF 3BEUA 1CT2E 3NCLA 1SSXA 4NIYA 2ZGHA 1SPJA 1LPZB 3TK9A 3NKKA 2UUKB 2V0BA 1MQ6A 3U8OH 1GI8B 1V2UT 1YP9A 2B0FA 2ALVA 5FX5A 3SI3H 1S83A 2ZU2A 1O2VA 3UQVA 5F03A 4MNXA 3P17H 1WBGB 1AGJA 1QL7A 2HRVA 1AVGH 4LZ1H 2I6QA 4E06H 2UUFB 3PV4A 2WPLS 1NM6A 3M35A 2OC8A 5ABWA 1SLUB 1L4ZA 1O3AA 1NRNH 1EOLA 1HAXB 1F0SA 2ZGXH 1F0RA 1HYLA 1EB2A 1YPHC 2H2ZA 1W0YH 1C5XB 1P04A 3RC5A 2VWNA 1A0HB 2BD5A 2ZHFH 1H8IH 2H1UA 1NTPA 2SFAA 3GDSA 1O3PB 2Y5FA 1SLWB 4Y71A 4Q7XA 1LKAA 1PYTC 4WMEA 1BTHH 1UVPA 3A81A 2GGVB 2QXHA 4OGXA 2FOEA 3VXEH 4X2YA 1IQIA 1TRYA 1YCPM 2GD4B 2FOGA 2P94A 3ZZCA 4NA8A 1C5YB 3RXTA 2QYIA 1P2OA 1YBWA 3PWBA 3GY7A 1HNEE 1G32B 1EKBB 3TPIZ 2GZ9A 5JDUB 2XBVA 4X2WA 1SOTA 2YNBA 3A82A 1IQKA 1IHSH 4GCHF 2RCEA 1J15A 1MD7A 2UUYA 1SBWA 1ARCA 3A83A 3H5CB 2D1JA 1W8BH 2AERH 3M5OA 1TA2A 1QBVH 1GI7B 1QFKH 2J2UA 1BA8B 4DGJA 1YM0A 5DP4A 2ZTZA 4HI3A 1GHAF 1SHYA 3PMAB 1GI0A 2QCYA 4KTSA 3RXHA 1Y5BT 1PPGE 2ZF0H 2W7UA 4NWKA 2F9UA 5IDKA 2K1QA 3GDVA 2F83A 2ZU3A 1BIOA 5A09A 1MKWK 3VGCC 4XFQA 2AEIH 1QBOA 2FOFA 3N7OA 4FUGA 2A7CA 3UR9A 3GY5A 4MPUA 1UCYK 4MPXA 2BDBA 2ZDMA 2WUBA 2XBXA 2ILNA 3NZIA 2ZFFH 3A86A 1DWEH 3U69H 3L3TA 3ZZ4A 2BXTH 1T32A 1NU9A 1NFXA 3TH2H 4MNVA 2ZHWH 4O97A 1EAXA 1P06A 4Y7BA 5GJ4B 4FUIA 1P03A 3BIUH 4KTCA 2VNTA 2CGAA 3MHWU 1TPAE 3HATH 2JETC 4BAHB 2JKHA 1TFXA 2GKVE 4JZFH 2R2MB 1MU6B 1ABIH 2J95A 3LT3A 3R0FA 4ABEA 1T31A 2J4IA 4CRAA 3MNBA 5JBAS 2Z3CA 1OYQA 1QJ1B 5LPEA 2CXVA 3SU4A 1HAVB 4CH2B 4CR5A 1QURH 2PKAB 1Z71A 3A85A 3RM0H 1TX6A 1GDNA 1P3CA 1ETSH 1BTUA 4BNRA 3BTHE 1DSTA 1T8NA 1GBHA 3TVJB 4GPGA 2VWOA 5FPSA 3RU4T 3ZVCA 3DFLA 1NC6A 2BXUH 1DY9A 2PTNA 2QGRA 3ENSB 1YYY1 1CHGA 5DP5A 4OS5A 3SV8A 3VB3A 1F5RA 2Q6FA 1GPZA 2CMYA 1RIWB 2VH0A 1QB9A 1MKXK 3Q3KA 4OS7A 1KYNA 4I8GA 1C4U2 4WJG2 1E35B 1P3EA 1C9TA 2PR3A 1HDTH 2VIQA 1YLCA 1TWXB 4UFEH 1O2XA 4WH8A 1NRPH 3UUZA 1PPHE 1EX3A 4NIXA 4X8UH 1BHXF 3QZQA 1LVMA 1FDPA 1E38B 2Z9GA 1P57B 3RC4A 1VCQA 5FHTA 5DG6A 4FVBA 3B8JA 1Z8RA 1ZPBA 3Q3YA 2KAIB 4CREA 2J94A 2Q6GA 3PMJA 1IQGA 1K1JA 1C1UH 1CA8B 2VVCA 3PB1E 1SGCA 4OS6A 4YZUA 1OPHB 4AZ2B 1ZMLA 1FMGA 1BTPA 3LH3A 4CRCA 4CBOA 7ESTE 1L0ZA 4ESTE 3KL6A 3K6ZA 1D3PB 1YPGH 1J14A 1V2KT 2GDDA 2D8WA 3RXVA 1ZSKA 3LGVA 1ZHRA 2A2XH 5GCHG 2PLXA 3MU4A 3ZZ9A 2GT7A 4O3TA 1QY6A 1O2LA 2FXRA 2HALA 1NESE 2XC0A 1DXWA 4TPIZ 4B74A 1C2JA 2G5NA 3ZVFA 1HAHH 1OP8A 1AB9B 2WUCA 1YLDA 3MO3A 1BRAA 2PWXA 4K8BA 3RXKA 4UEHH 2PW8H 2A32A 1BRBE 2TPIZ 3A7XA 5LH8A 2BLWA 1HAVA 3HPTB 1XUFA 2B8OH 2PKAA 1KXFA 2A1DB 2Y82A 1QHRB 3ZVGA 1ZZZA 4X1QU 1C1PA 2H9TH