1O2UA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2uA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2uA02
2HOBA 2ANWA 2A32A 1AN1E 1GI5A 1GHVH 1YKTA 2GT8A 5K0HA 4GHTA 5C2ZA 2I6QA 3RLYH 2J38A 4FUIA 1D6RA 2FI3E 3OY5U 1W3CA 1G2LA 3QZQA 2BLQA 1UVOA 2WPHS 3BG4B 4INKA 4X8VH 1GMDG 2FI5E 1G30B 1MD8A 2Q6DA 1HAXB 1BJUA 1A3EH 2WPIS 1YC0A 1S6HA 1BHXF 2A4GA 2ZEBA 2FIRH 2WINI 5DP4A 3SQEE 4ZKRU 1OPHB 3PYHA 4HZHA 1CA8B 3F6UH 2OLGA 1ELDE 1TNHA 2Y82A 1PQAA 4B73A 3P17H 1O5AB 5E0JA 1ZHMA 1FPCH 2J92A 1HAIH 3M5MA 2ILNA 1GPZA 1EUFA 1GBJA 3F9HA 4I33A 1HDTH 4NIVA 5DG6A 4TWYA 1EPTC 5DGJA 3RC5A 1K28D 5GWZA 1Z1IA 4ASHA 2KAIA 4O03A 4K1EA 1TRMA 4IC5A 3T29A 3UNRA 1NFXA 5A8ZA 1TIOA 2Q1JA 4SGAE 3RXFA 1J9CH 2XBYA 3TGIE 2ZGBH 3ZZ4A 2ZDNA 3Q3XA 3IWMA 2D1JA 1FDPA 4QT8C 1AZ8A 1Z6JH 1W0YH 5E2PA 7GCHF 2ZTYA 3HATH 1BMLA 1L2EA 3VXFH 3ZVFA 4D9QA 3MU1A 5DP6A 1SGYE 5AFYH 5ETXA 1NRRH 1QHRB 2P8OB 4THNH 3ESTA 3SHAH 2ZFQH 1KXBA 2HNTC 1RFNA 3PMAB 1O3FA 5EQRA 1HJAB 1TALA 3LJJA 2AERH 1GI9B 1BMMH 1KTTB 1O3MA 3LH1A 1TFXA 1AZZA 3SUDA 4IS5A 4WMFA 4FUGA 3ELAH 3FFGA 1IQEA 1GJ9B 1VZQH 2NU1E 5FCKA 1MMJN 2CXVA 2SGDE 4AG1A 4BNRA 1QBVH 1NM6A 3DHKH 4UONA 1TE0A 1W2KH 2I6SA 3TLOA 4X8SH 3SU0A 1P12E 4YOIA 4E06H 4YZUA 4I8GA 4NSYA 1TBRH 2OC7A 2QN5T 1IQKA 1A3BH 3SU2A 3UTUH 1F5LA 2ZGJA 5AFZH 1QQ4A 3A85A 3TITA 3BSQA 1NRSH 2VIOA 2BXUH 2VB0A 1AMHA 3ITIA 2XC0A 5DP8A 4IBLH 1THRH 3WY8A 4MNVA 1QTFA 1UHBA 2Y6TA 3C1KA 4O3TA 3BF6H 1HIAA 3ATIA 1T8NA 4O3UA 2GMTC 1VGCB 5F6MA 1TNGA 1QA0A 1ID5H 2DE9A 2SFAA 3SHCH 1ABJH 1PYTD 1IQGA 2OP9A 3RP2A 2BDGA 3NCLA 1TX7A 2K1QA 3PWBA 1AVWA 3CENA 1MKXH 1MTNC 1V2WT 3GICB 1DY9A 1ZJKA 2FOGA 2ZF0H 2VJ1A 5IDKA 2FX6A 2O8UA 3PM3A 4A1XA 1ANBA 1Q2WA 2ZFFH 2R0LA 1HB0B 3FP6E 1QBOA 4K8YA 1XVMA 5CMXH 4ZMAH 5EQQA 2R9PA 1O5DH 1O3KA 2A2XH 2ALPA 5DP9A 1LKAA 1GJ7B 2BLOA 2B7DH 4WJG2 1MUEB 2PLXA 3AAUA 1XKBC 3GY5A 3E3TA 1TX8A 3S69A 4YOJA 1P02A 1SI5H 4CBNA 3M35A 4AZ2B 1SLUB 1HNEE 2YNAA 1NY22 1WUNH 1ESTA 1NRNH 4I31A 1QCPA 1D6WA 3NWUA 1WU1A 2A1DB 2LPRA 1RS0A 2FOBA 2DUCA 4ZHAA 1S85A 1O2TA 1UCYK 3MNCA 1V2OT 2IPHA 3DFJA 1GMHG 2AGEX 4A92A 2A7HA 2ZWLH 1GWAA 2WV5A 1C5PA 2ZFSA 1LPKB 4KTCA 4U01A 4GVUA 3LGUA 1P8VC 2FWWA 1QY6A 3ZZ6A 1HUTH 4INLA 1OWIA 1G3DA 1W11U 2AGGX 2G00A 4H6SB 4ABGA 5K7RA 1KXFA 3BTEE 5JPMH 2W3KA 4ZROA 4I8HA 3HPTB 3LPRA 1CQQA 3A82A 1N1LA 1Z1JA 4IGDA 4Y79A 3SV6A 5FCRA 1UTKA 1UTMA 3B9FH 1YPLH 2PKSB 2ZA5A 3GCOA 1EJAA 1P0SH 1VCPA 2V0BA 1ANEA 1L1NA 3UFAA 1P01A 2CHAC 2FEQH 2XNIA 1FXYA 1UMAH 3EYDA 1BRBE 3FANA 3NXPA 3I77A 4ABDA 4B76A 1PPHE 1X7AC 1XUKA 1C5OH 1KXEA 1Y5UT 3GY6A 4AORA 1DE7H 3BIVH 2ANYA 3BEFB 3JZ1B 3HK6B 3SQHE 1SOZA 2QXIA 3AVZA 1SQOA 1AHTH 1NESE 4FUBA 5A09A 3D65E 1J17T 1KY9A 2G55A 4SGBE 1GI3A 2ZG0H 4Q2KA 2BZAA 1RTLA 4CBOA 2AS9A 2XTTB 1QB1A 2NU3E 1CGIE 3U8TH 3TGJE 1DXWA 3KF2A 2ZDVH 3FP7E 1EZUC 3GCNA 2GDEH 2EC9H 4ZXYH 4CRGA 1GBLA 1T8OA 3QTVH 1H1BA 5HM2A 1SGQE 2R3UA 1JXPA 2BZ6H 1SGFA 3QWCH 5HYOA 3L6PA 5EGMA 1PYTC 1INCA 2A45B 4MG3A 1C9PA 1A0LA 1GJ6A 1V6DA 2IOTA 2ZKSA 1YPHE 4Y10E 2WPLS 3P95A 4WH8A 1O3OA 3E16B 4DG4A 1UVPA 1TQ7B 3MFJA 5F8ZA 4XBBA 2PTCE 1HAZB 1MU6B 2FOAA 1BTZA 1SC8U 4XBDA 3M3VA 3LOXA 1B0EA 2C93B 1T31A 3K6YA 1CA0C 1G37A 3RC4A 1A1RA 1O3BA 1ZYOA 2ZDLA 4YESB 1GI7B 3ODDA 2FP7B 3TK5A 3P92A 1O30A 2JETC 4GCHF 3ZZ9A 1V2UT 1KDQB 1QA7A 4K69A 3SJKA 3RM2H 2ZDAH 1C5QA 3UQVA 2ZU2A 1RGQA 1C5TA 1ELAA 1Z7KA 2SGPE 3RXAA 1MAXA 3F9FA 4NIYA 3ZZ5A 1V2TT 1BQYA 2BTCE 1PPFE 2XC5A 3SN8A 3MTYA 3VGCC 4DT7B 1DY8A 1TPPA 1O2ZA 2ZU5A 4Q80A 4NIWA 4J1YA 1W10U 4JCNA 1GBDA 1P9UA 1V2PT 4RN6A 1GHBG 1FN8A 3GDVA 1FIZA 5FPTA 3MI4A 4YT7H 2QF3A 1H9LB 4KKDA 1CT4E 1AVXA 2BY5X 4H6TA 1BT7A 1O5CB 1UK2A 3M36A 3RU4D 2XBXA 1TOMH 2FDAA 1SMFE 4X2VA 1HYLA 1ZLRA 4U32A 2BYAX 4DVAU 4CRBA 5DKMA 3N7OA 7ESTE 3T62A 2OCVB 1EASA 5AF9H 2XC4A 4FU9A 2H5DA 2Y81A 1HGTH 5LH8A 2GVFA 3T2NA 1O2VA 3RXEA 4ZHLU 3LC3A 1C1TA 2ZECA 4JZDH 1SLVB 3FZDA 1KIGH 2EI8A 5FX6A 3V7TA 1HLTH 1ELFA 3HKIB 1O38A 1NPMA 4WF8A 1AUTC 1SB1H 1SLXB 3M3SA 4B75A 4E7RG 3W95A 1BRUP 3M5OA 1A61H 1WSSH 1O3LA 1E38B 3U69H 1HAYB 2BB4A 1F7ZA 1P2IA 1XM1A 4GSOA 3UWIA 1C2FA 1L1GA 2RCEA 1RTFB 2A5KA 2J9NA 3L33A 5C5OA 5SGAE 5JBCS 4XBCA 9LPRA 1O2JA 1UK3A 5CHAB 2ZIQH 2C90B 4JZ1A 4E05H 4TY7A 3HGPA 4AOQA 1QQUA 1JRTA 2BOHB 2VNTA 1CU1A 3CS0A 1NTPA 5AVDA 1O2MA 1VJ9U 1DLEA 3H5CB 1NO9H 3LGIA 4AFZA 4D8NA 1Y3XA 4E7NA 2ULLA 1DITH 1ZMJA 2BX4A 3A87A 4AYYB 1C4Y2 3RMNH 1GMCG 5A8XA 1YPHC 1T32A 1ZHPA 3U1IB 5EXNA 1TWXB 3LGYA 2DE8A 2NU0E 2TRMA 2BD3A 1GBFA 1LHFH 5L2YH 2P94A 1O2PA 3M37A 1FAKH 2O8LA 4GUXA 3VFEA 1G3BA 2VU8E 1ORFA 1EKBB 1CBWB 3ZZ8A 5EG4A 2FS9A 3LU9B 2V3OH 3LDXH 4H42U 3RXIA 1O2HA 3U1JB 3I78A 2C8YB 4K2YA 5E8EH 6GCHG 1TQ0B 1S0RA 3ZZCA 4FXGH 1V2RT 2ZHQH 5HM9A 2BDHA 1HAOH 2OUAA 1XXDA 3TGKE 1HCGA 3KNXA 2ZDKA 1SGTA 2A2QH 3MU4A 1RIWC 2JH5D 1FPHH 3GYLB 5AHGH 5EQSA 2D8WA 2RA0A 2CF8H 3TH3H 5EXLA 1ZPBA 4ABIA 1L4ZA 3VEQB 2Z9JA 2QXHA 4CRCA 1PPEE 1QJ6B 4K8BA 3BTFE 4DIHH 3ZZDA 2ZPSA 3AASA 2J4IA 3ODFA 2Z9KA 2OC8A 1QB6A 2WPMS 3A7VA 1EZSC 1A5IA 2NU4E 2ZCHP 5DJ7A 2Y7XA 3Q00A 1AFQC 3FP8E 1DVAH 2ZFRH 4MDSA 1ZR0A 1NRPH 1LCYA 3ZZ3A 2HWLB 3SV2H 4R8TB 1OX1A 1FQ3A 2BDIA 2H9TH 3ATWA 3E0PB 3EAJA 5TCAA 1GL1A 2XWAA 1UJ1A 4ABJA 3OU0A 4NZLA 3A7ZA 4UDWH 3A88A 1HRTH 1O2UA 1BBRH 2BD5A 2BDYA 3TH4H 5A2MH 1PFXC 1DOJA 4FUHA 2EI6A 1HAVB 1AWFH 1C1WH 1G3CA 5ABWA 1BTHH 2J2UA 2HRVA 3F68H 1P04A 1TMBH 2VINA 2FLBH 4I8KA 2G81E 4D7FA 5JDUB 3T27A 1NT1A 3ZVCA 2THFB 1SPJA 4M7GA 1N6YA 3LIWA 1ESAA 4BAMB 2W3IA 3QLPH 1DWCH 1HPGA 3SI4H 1AB9B 2TIOA 4Y7BA 1MKXK 3DUXH 3NKKA 2A5IA 1DDJA 1GHZA 1GJCB 3RXHA 1MCVA 1O2IA 1F5KU 1PPGE 1F0SA 1TNJA 2ZGCA 1JIRA 3MU0A 2R2MB 2W5EA 3MO9A 2BX3A 1MKWK 2GCTC 4MPUA 1C4V2 1MZAA 1FY8E 1DWDH 2ZCKP 1MD7A 3SNEA 1ZOMA 1F0RA 2VWLA 2O8TA 1TGSZ 1OWKA 1Y5AT 1VITH 7LPRA 3DFLA 1ZPCA 5ESBA 3BEUA 5GCHG 1CSOE 5A0BA 2BQ7B 1Q31A 4Y8XA 1YPGH 2ZU1A 4ZAEA 3RLWH 1O5GH 4D9RA 4CR5A 2SNWA 4TPIZ 5DP7A 5CE1A 2PW8H 1AY6H 3URCA 2UUJB 1DPOA 1ZMLA 2ZFPH 2A4QA 4Y8ZA 1SGFG 1F92A 3O8BA 3U8RH 1E36B 3LT3A 2P93A 3RXRA 3BTGE 1GHWH 1GJ8B 3SNAA 1JOUB 3GCHB 3QN7A 3DD2H 1EZXC 3GDSA 1P03A 2F83A 2VWNA 3BIUH 4I8LA 5HXFA 1C2MA 1PJPA 1Z8IB 4IW4E 1DICA 4FUCA 1TLDA 5DP3A 2VH0A 3L3TA 2Z9GA 5ESTE 2D26C 1C2KA 1THSH 1OWDA 4PROA 1GMHF 2UUFB 3A7WA 3RXSA 3MH7A 1IQMA 2BQ6B 1AU8A 1C5VA 4AGKA 1L0ZA 3OY6U 1AE5A 3TU7H 5I46H 3KEEA 1B0FA 4Q7ZA 3T28A 1FY4A 4ISLA 1KXCA 2C4FH 2PUXB 1FLEE 2WUBA 3NK8A 1EB2A 1O2QA 4JYTA 2QXJA 3M5LA 1GI6A 2FOFA 4HTCH 1Z71A 1PQ8A 2O8WA 2WPKS 1GHXH 4BTIB 2VIQA 2PTNA 1WTGH 1LMWB 1CT0E 1C1VH 1UTPA 4JK5A 3TK9A 1WOFA 1EAIA 3SNBA 4FU8A 1NN6A 4WY3A 3B23B 1C5NH 1NU9A 3KN2A 2XBWA 4NZQA 1W8BH 1GJ5H 2UUYA 1O3CA 1TAWA 1GJDB 1GBKA 1XUIA 1C2HA 2FM2A 1TRYA 1IQLA 1UK4A 4IN2A 3SNCA 3BTTE 4X2XA 2P95A 3LC5A 3BV9B 3S9BA 4ZH8A 1MBMA 4AX9H 3STJA 5EW1H 4LXBH 4OGXA 1B5GH 2GGVB 1MCTA 2J94A 3EGKH 4VGCB 1TMTH 1LVMA 3RXMA 4B2CA 2FPZA 3M5NA 1C2DA 1DS2E 1U6QA 2VGCC 2BD4A 3MH6A 5F8XA 2PWXA 1FAXA 1ZTLA 2QGRA 1VCQA 1W14U 4UE7H 1GGDB 3ZYEA 1ZTJA 3MWIU 1UHBB 2ODPA 1BUIA 1JBUH 1NFYA 1BZXE 1P2NA 5JB9S 4IC6A 1SR5C 1HIAB 1HJ9A 2TGPZ 4Y0YE 1K9OE 2F3CE 2BLWA 1UO6A 3OSYA 1S0QA 1SQAA 4Z6AH 3UIRA 7KMEH 4U2WA 3O8DA 1IHTH 1Y8TA 1PQ7A 1OSSA 1N8OC 1GG6B 1O35A 2F9PA 3ZVBA 3P70B 3Q3YA 3SV8A 2GCHG 3QX5H 2G4TA 1DX5M 1WV7H 2FODA 2AMDA 2BVSH 3GY3A 1V2ST 3A84A 1C5SA 2O8MA 4AFSA 3GY7A 1MTWA 7GCHG 3SU4A 2FI4E 1K22H 1HXFH 4MLFB 1A46H 1TBQH 3S7HB 2IJOB 3UNQA 1XX9A 2ZFTA 4OS2A 2O9QA 2OBOA 1ELCA 6CHAB 1MH0A 4ABBA 1MU8B 1TB6H 2WPJS 3MHWU 3EA8A 1DWEH 3K6ZA 3SUGA 3QZRA 3SU5A 3TPIZ 4UEHH 1GCDA 1E37B 1KYNA 1O2WA 3AAVA 1YLCA 1W12U 2FYQA 3TIUA 4HGCA 1LVOA 2OQ5A 2VVVA 1ETRH 4HFPB 1C9TA 1AO5A 1YGCH 3PTBA 2HALA 2ZU4A 4GAWA 4Y76A 1RRKA 5GIBA 3VPKA 4X2YA 1A5GH 2QV1A 2TBSA 1OOKB 2CV3A 1GHBF 2Q6GA 1TRNA 4Y11E 1K1NA 5PTPA 1HAGE 2GTBA 3D49H 1G3EA 1O3JA 2RDLA 3LGTA 2OINA 3M7QA 1OKXA 2CJIA 3UNSA 1O2NA 3PO1C 1DXPA 2GV7A 5TCCA 1LQEA 3I29A 2UUKB 1V2KT 2XRCA 1UTJA 3RXGA 1GVZA 1O2KA 2C3SA 4CHAC 1GCTC 1FV9A 1XXFA 3E90B 3S0NA 2BQWB 2GV6A 4X6MA 4R0IA 1GBTA 3OX7U 4YO9A 1PQ5A 3F9EA 5JYIA 1TYNA 4XSKU 1XUFA 2GZ7A 1C5MD 4Y71A 4B2AA 3M7TA 1GBMA 2JH6D 1O3NA 4INHA 4I8JA 1YM0A 2G52A 2GX4A 3E0NB 4RSPA 1A0HB 5FHTA 4YM9A 1L1JA 4DCDA 2WYGA 4IN1A 3MNXA 3BG4C 1VCWA 2FMJA 1HFDA 3EA9A 2SGAA 2FXRA 1W7GH 1O5BB 4B1TA 1GDUA 1TA6A 2Y7ZA 3SGBE 3TJNA 2QAAA 2Z9LA 3M61U 3TJUA 4YLUA 5A0AE 3NZIA 1RTKA 2VWOA 1GI0A 1KDQA 4LZ1H 1IQFA 1P57B 1CHGA 1OP8A 4RKOB 2CF9H 1DM4B 3DT0H 4H4FA 2P3UB 4ISOA 1YBWA 1EB1H 3CS7A 1XUGA 1EPTB 3O8CA 1FZZA 4ABEA 1QR3E 3GYMA 4Z0KA 1V2VT 4B74A 1P3CA 1BMNH 2ZDMA 2UWPA 1C2LA 2CN0H 3VB3A 4X0WU 4ZHMU 1Y3YA 1MAYA 3BTKE 2BD9A 1D3TB 4MPVA 1GVLA 3VB5A 4LZ4B 1ETTH 4JZEH 1LTOA 2FTMA 1VJAU 3SU3A 1AFEH 4NG9H 2G51A 1K1JA 3PLPA 3TVJB 3P8NA 1ZZZA 1E35B 1P11E 3GISB 1O2XA 2P8OC 1C5YB 3BTME 1K1LA 1CHOF 2ESTE 4X6OA 2BDAA 1SG8B 3SJOA 3A7TA 3UQOA 2A31A 4ISIH 1A5HA 4JMYA 1Z8GA 2GKVE 4LOYH 2A5AA 2Z9IA 1NRQH 2OC0A 1HJAC 2PUQH 2PGQB 4YOGA 2CGAA 4FU7A 9ESTA 1MZDA 1O5FH 1XUJA 1BBRK 2GD4B 2W26A 3G01A 3LGVA 5E0GA 3SGQE 1Y3VA 2AFQB 4OS6A 3SUEA 8GCHG 4JYUH 4A1VA 3ATLA 1QIXB 4KTSA 1D3DB 1QJ1B 5JBTA 1GI2A 1ZPZA 1SGCA 3KHVA 4BAOB 2TPIZ 1AD8H 2QYIA 2BOKA 1BTWA 1ELTA 2XCFA 1Y3WA 3FVFB 4ZKOU 1SGPE 3ATKA 5TJXA 1EJNA 1ELEE 1GI1A 3STIA 1WAYB 5H4IB 2PHBA 2F91A 2GMTB 2TGTA 2PSYA 1AUJA 1VGCC 1FIWA 1QB9A 2BDCA 4WMDA 1H4WA 1E0FD 2BDBA 1LPZB 2PKAB 1KTSB 4MNXA 2QXGA 3ZVGA 1MTNB 2EA3A 1Y3UA 1C5ZB 1THPB 1A4WH 4GPGA 4X1RU 1LVBA 1T7CA 1WQVH 4CH2B 1N6XA 2G5NA 4MTBA 1TA2A 3PMBB 1O2OA 3A8CA 1C1SA 4ABHA 1VITG 1SOTA 4X8TH 3A86A 1GMDF 3D62A 1OS8A 3MNBA 4X1PU 1DANH 1W13U 5FAHA 2R2WU 4GCHG 4FUFA 3ZYDA 3TNSA 2RG3A 3LKWA 2AMPA 2W7UA 1CGHA 1C2IA 3P8FA 5GXPA 1EP6A 3EDXB 1QNJA 1AQ7A 2AIQA 4TWWA 1PPBH 4Y7AA 1O3HA 2A4RA 3KIDU 4D7GA 4UFDH 1AIXH 4DOQA 5FBEA 1E34B 2OC1A 3E1XB 3IITA 3PROA 1O3EA 1PPCE 1AKSA 1HBTH 1EOLA 4KP0A 5I25A 1WTHD 2FYRA 3S9AA 2B8OH 3UWJH 3UR6A 5F8TA 5DP5A 3H7OA 3BTWE 3KQDA 1YYY1 1UTNA 4WXIA 1BITA 1KXDA 4JK6A 4DY7B 4BANB 3DA9B 4Q7YA 1LO6A 2ZO3H 3Q77A 1GHAG 4X2WA 4TYDA 2ZNKH 4FVBA 1CGJE 4IMQA 3RXDA 3BEIB 1ZRKA 3A8BA 3RXJA 5C1UA 1D9IA 3RXUA 1XUHA 2G8TA 2ALVA 3RU4T 1KLIH 3IG6B 5EODA 1FMGA 1T8MA 2B0FA 2F9OA 1NROH 2ZQ2A 1G32B 4D76A 3A8DA 4WVPE 1BTPA 1FY3A 5A8YA 2AEIH 2Y5HA 1EXFA 1DSUA 2ZZUH 3UREA 2PKSC 2HNTE 3SNDA 1UVUH 2G5VA 4NIXA 1HAPH 4OS4A 1HAVA 4B2BA 1F0UA 1Y59T 4KELA 3CP7A 3RMOH 2CHAB 3MU5A 3ZVEA 1HAHH 4DIIH 1GDNA 3A89A 1CVWH 1W0ZU 3H7TA 3RM0H 1O36A 4X6NA 5A0CA 1K1PA 2P16A 2XWBI 1MTVA 1UVTH 1DFPA 4BTTB 2SGEE 3RXQA 1YLDA 5B6OA 1HJ8A 4X6PA 3TJVA 4MNYA 4OGYA 2QA9E 5L6NH 3SJ9A 2HNTF 2P59A 3SU6A 3KCGH 5L30H 1P2KA 1D3QB 3GY4A 3E6PH 1QL9A 3QGNB 2VIPA 1VR1H 4RKJB 4CRFA 2OTVA 1LPGB 1OP2A 1RXPA 3ZV8A 1K2I1 1QRZA 2ZPRA 2GP9B 1H9HE 3SV9A 1G9IE 1ACBE 2ASUB 1NFWA 2ZTZA 3SGAE 4AN7A 3LJOA 1K21H 1BTYA 1O3DA 2OQUA 1NC6A 1H9IE 3S7KB 1BJVA 2ZGHA 4I7YH 4X8UH 1DUAA 1P2MA 2SNVA 1ELGA 3OTJE 1O5EH 1LDTT 1UTLM 1V2QT 1ZSKA 1SL3A 3MO3A 2A4OA 1J14A 4KTUA 1C1RA 2OXSA 1CA0B 1QRWA 4CRDA 1C5LH 5GJ4B 1SGDE 4CR9A 3T26A 1KSNA 1K1IA 3PTNA 4OS1A 2BLVA 2Z94A 1TPOA 1OWHA 1O2YA 1QL7A 2JETB 1GI8B 1ZTKA 4MNWA 3RDZA 2V3HH 1O31A 2Z3CA 2ANKH 4JYVH 5EPYA 4XE4A 1CE5A 1GBBA 1C2EA 4OS7A 4DURA 2GZ8A 3P8GA 5LPRA 1EX3A 2RA3A 2V6NA 4OS5A 1UCYE 1ETSH 3VGCB 1F2SE 1P2JA 4UFFH 3R0FA 4KGAA 2GCHF 1TGTA 3E91A 2FOCA 3UOUA 2KAIB 5EOKA 4ABAA 1GHYH 4CH8B 1PPZA 1J8AA 1WQSA 3SUFA 1YP9A 1P10A 1TNIA 3UUZA 1LKBA 5C1YA 1BRAA 5LPFA 4XFQA 1ANCA 2ZPQA 1LHDH 3MH5A 1AGJA 2FLRH 3UY9A 4CREA 1C1NA 1P3EA 2AYWA 2Y5FA 2HPPH 1O2GH 3P6ZB 2SGQE 2FZZA 1ZHRA 3BG8A 3ATMA 1FN6A 1TNLA 2ZHEH 4BAQB 4FUJA 4CRAA 4JZFH 1B7XB 1S82A 2H5CA 3JZ2B 2Q6FA 5T6GA 1BA8B 5DPAA 3RUOA 1CT2E 5IYTA 3UOPA 1YPKH 1TOCB 1YPJH 1YCPH 1SGNE 3GCTG 2EEKA 5C67A 3SJIA 1MTUA 2A0QB 4ISNA 1FONA 1TGBA 1O0DH 5DK1A 2HGTH 8ESTE 1QURH 2ZTXA 1WYKA 2ZC9H 3GDUA 2C8XB 2M5TA 3SU1A 5EW2H 5EXMA 4MPWA 5J4QA 3RMMH 3PB1E 3RXLA 3A7YA 4XDEA 1ZSLA 3A80A 1FY5A 2WV4A 1EAUA 3KQEA 1C2JA 3RMLH 3SOSA 2XXLA 1DUEA 1OXGA 3SW2B 2VIVA 1ARBA 1P09A 2PV9B 1QBNA 5CHAC 1Z6EA 1O34A 3QO6A 4K3JA 4BAKB 5J4SA 1FY1A 3A81A 2ZCLP 1TX6A 1D3PB 2GT7A 4UFEH 4AYVB 4NWLA 4A1TA 2HVXA 1IOEA 1S84A 1ZSJA 1UTQA 1QGFA 4TPYA 4O9VA 1JRSA 4NA8A 1F5RA 2AIPA 1V2LT 4TY6A 3QK1A 1DT2A 2F9NA 1SHYA 3PWCA 1MKWH 1V2MT 4WMEA 5GPIB 4NFEA 1ELVA 2BXTH 4O97A 1P2QA 1C5WB 4AGJA 1JWTA 2FO9A 1CBWC 4BXSA 1MTSA 1S83A 3ZZAA 3PMJA 4BTUB 1QJ7B 1W7XH 1SLWB 1V3XA 1RD3B 4Y8YA 2CMYA 2STAE 4AG2A 3RXBA 6LPRA 2QY0B 1GVKB 2FX4A 1BTUA 2HPQH 1RIWB 2BY8X 1T4VH 1AE8H 2Z3EA 3MOCA 3KQCA 3K65B 3TJOA 1LHCH 3NPSA 1KXAA 2XW9A 1O39A 2Y80A 3K9XB 1SFIA 2FS8A 3C27B 3E8LA 4FVDA 1BDAA 1O37A 2BY9X 2Z7FE 2VH6A 1SFQB 1O3GA 4ZKNU 1C4U2 1GBEA 2Z6BD 2W7SA 2UWOA 2QC2A 1TABE 3F1SB 1AFQB 1SGRE 1ARCA 4Y0ZE 3URDA 3RXKA 1C1PA 2H9EH 2J34A 3SZNA 3HKJB 1AI8H 1UTOA 1IQHA 2V35A 3K2UA 2OBQA 2JH0D 4NWKA 4B71A 2ZP0H 1TNKA 3R3GB 2P3FH 5E2OA 4NFFA 1BBRE 2XBVA 3VB6A 2H1UA 2AMQA 1NU7B 1A2CH 4DW2U 1O2SA 2PGBB 2G4UA 3BTDE 2VIWA 4WH6A 2AGIX 3GY8A 1Z8JB 2BY7X 2NU2E 2VWMA 4GLYA 1WBGB 8GCHF 4J2YB 5T3HA 1HXEH 3QUMP 2QIQA 1EOJA 1YF4A 4YTAA 3V0XA 4F49A 3UPEA 3A83A 4BXWA 3O8RA 4NA7A 5T6DA 1O33A 1AB9C 5HMAA 2ZHFH 1IHSH 4YT6H 2ODQA 1V2JT 2BMGB 1KLJH 2B5TB 2WYJA 8LPRA 2P3TB 1O3IA 5BPEA 3RXOA 3FAOA 5L2ZH 1GDQA 4AB8A 1XVOA 3MYWA 1ESBA 4X1SU 2NWNA 2GCTB 1YPMH 4Y6DA 4K1SA 2D2DA 8KME2 1O2LA 3TK6A 1C5XB 2A7JA 1S81A 4ESTE 1C1OA 1BRCE 1OP0A 2B9LA 1QFKH 3U9AH 1P2OA 3MU8A 2F9BH 2ZU3A 3RXVA 1TONA 1OWEA 2F9VA 2SGFE 4X1NU 1SBWA 4DJZB 1TMUH 1EPTA 2H9HA 1HV7A 3Q76A 1BCUH 1GMCF 2BVXH 4MVNA 3S9CA 3M3TA 3BN9A 3SO3A 2F9UA 2VVCA 1BTXA 5F03A 4DGJA 2ZHWH 5FBIA 1ELBA 3AW1A 4Q7XA 3ZVAA 4XOJA 1MQ6A 3B8JA 3TH2H 3VXEH 1G36A 1FNIA 2GZ9A 3U8OH 1VITF 4FUEA 2BD8A 3HGNA 5EPNA 1WCZA 3EE0B 1DWBH 4A7IB 4UFGH 1O2RA 4NCYA 2IN2A 3GCHC 2Y5GA 3W94A 1ANDA 2FESH 1CO7E 1ZJDA 3ZVDA 6GCHF 6ESTA 4WXVA 2ANMH 4ZXXH 1A0JA 1UCYH 1IQJA 2J95A 1A7SA 1EP5A 3T25A 3ZV9A 5C3NA 2TGDA 2JKHA 1GBAA 1BOQA 1K1MA 3SBKA 5T6FA 3LH3A 1AVGH 1SGIB 2LNCA 4K1TA 2C8WB 3QDZB 3AW0A 3ZZBA 3MMGA 3SI3H 1GHAF 1LHEH 3RXCA 2BHGA 5JBBS 1SHHB 1GJ4H 1KLTA 3LGWA 3VB7A 3RXTA 2BY6X 4AFUA 3EA7A 5DO4H 1AWHB 4K60A 1ABIH 3NUMA 1JMOH 2EI7A 1SVPA 2FTLE 2UWLA 5LGOA 1O3PB 3SJ8A 1DLKB 3RU4E 1P05A 1OYTH 1P06A 3V13A 3PLKA 3V3MA 2AH4X 1GBHA 3GOVB 4ZUHA 1C1UH 2R3YA 1BHXB 3D23A 1S6FA 1BIOA 3U98H 3PV4A 3V12A 4WWYA 1EJMA 1C2GA 4FUDA 4NGAH 2PKAA 1NZQH 1EZQA 4GHQA 1NFUA 1K1OA 1D4PB 2A7CA 3MO6A 1TGNA 1DSTA 1GJAB 1ZGVA 3FZZA 4ISHH 4BAHB 4VGCC 4LK4A 1TBZH 2PFEA 1G2MA 2BD2A 2VGCB 2PR3A 1UVSH 3PMHB 3SV7A 1C5RA 3RC6A 1SSXA 1TGCA 5BRRE 1Q3XA 1GGDC 1O3AA 2Z3DA 4K5ZA 3RXPA 1GJBB 2STBE 1C1QA 1YCPM 1SQTA 1GI4A 4AFQA 2ODYB 2OD3B 4ABFA 3ENSB 1IQNA 3UR9A 2XYAA 1M9UA 1TPAE 3MH4A 1N8OB 2ZQ1A 1GG6C 2QF0A 1BMAA 5EU8A 1ZMNA 1V2NT 2GDDA 1OYQA 5FPSA 5JB8S 5C20A 4I32A 4MQAA 1J16A 3QGJA 5GCHF 5JBAS 4AB9A 1YPEH 3EQ0H 1EQ9A 2HLCA 2ZGXH 1T4UH 2ZI2H 1FJSA 1JIMA 4BOHA 1LHGH 2QCYA 3MNSA 1OWJA 1SGEE 1IQIA 4MPXA 5HGGA 3T5FH 3OYPA 2VIDA 1H8IH 1T8LA 4HI3A 1LQDB 4ZKSU 1CHOG 1MQ5A 6CHAC 1NS3A 3Q3KA 1TPSA 1XKAC 5FPYA 5GDSH 3KL6A 5LPEA 1AKSB 1QRXA 3M7UA 5FXLA 1EATA 3TNTA 4A6LA 2ZHDA 4A5TS 1F0TA 1YCPK 4NSVA 2TGAA 4IMZA 2BM2A 1FUJA 3ZZ7A 1LVYA 2H2ZA 3BTHE 3HK3B 1Y5BT 3KGPA 5E0HA 1GBIA 3A7XA 4X1QU 1ZGIA 2BD7A 5G4BA 2FOEA 1O32A 2YOLA 1EAXA 4YLQH 2BVRH 1RJXB 4NA9H 1IAUA 1C1MA 3PO1B 2FOHA 1BB0B 1GL0E 1GBCA 3F9GA 3VB4A 5C5NA 1H8DH 2PSXA 2H6MA 2XCNA 3PLBA 4CHAB 1GCTB 1C5UA 3SORA 4UD9H 3GCTF 1MBQA 1QL8A 5FX5A 3BTQE 1J15A 1ZRBA 2VVUA 3A8AA 3P8OA 1EAWA 1P9SA 1L4DA 2WUCA 4JZIA 4U30A 1XMNB 1Z8RA 1S5SA 3GY2A 3LONA 2FOMB 2YNBA 3KQBA 4F4OC 1FI8A 3QTOH 5C1XA 2C8ZB 2R0KA
chains in the Genus database with same CATH superfamily
2HOBA 2ANWA 2A32A 1AN1E 1GI5A 2KX4A 3PV5A 1GHVH 1YKTA 2GT8A 5K0HA 4GHTA 5C2ZA 2I6QA 3RLYH 2J38A 4FUIA 1D6RA 2FI3E 3OY5U 1W3CA 1QZ8A 1G2LA 3QZQA 2BLQA 1UVOA 2WPHS 3BG4B 4INKA 4X8VH 1GMDG 2FI5E 1G30B 1MD8A 2Q6DA 1HAXB 1BJUA 1A3EH 2WPIS 1YC0A 1S6HA 1BHXF 2A4GA 2ZEBA 2FIRH 2WINI 5DP4A 3SQEE 4ZKRU 1OPHB 3PYHA 4HZHA 2WZQA 1CA8B 3F6UH 2OLGA 1ELDE 3PRDA 1TNHA 2Y82A 1PQAA 4B73A 3P17H 1O5AB 5E0JA 1ZHMA 1FPCH 2J92A 1HAIH 3M5MA 2ILNA 1GPZA 1EUFA 1GBJA 3F9HA 4I33A 1HDTH 4NIVA 5DG6A 4TWYA 1EPTC 3GS9A 5KEDA 5DGJA 3RC5A 3AK5A 1K28D 5GWZA 1Z1IA 4ASHA 2KAIA 4O03A 4K1EA 1TRMA 4IC5A 3T29A 3UNRA 1NFXA 5A8ZA 1TIOA 2Q1JA 4SGAE 3RXFA 1J9CH 2XBYA 3TGIE 2ZGBH 3ZZ4A 2ZDNA 3Q3XA 3IWMA 2D1JA 1FDPA 4QT8C 1AZ8A 1Z6JH 1W0YH 5E2PA 7GCHF 2ZTYA 3HATH 1BMLA 1L2EA 3VXFH 3ZVFA 4D9QA 3MU1A 5DP6A 1SGYE 5AFYH 1COWD 5ETXA 1NRRH 1QHRB 2P8OB 4THNH 3ESTA 3SHAH 2ZFQH 1KXBA 2HNTC 1RFNA 3PMAB 1O3FA 5EQRA 1HJAB 1TALA 3LJJA 2AERH 3FO8D 1GI9B 1BMMH 1KTTB 1O3MA 3LH1A 1TFXA 1W0KD 1AZZA 3SUDA 4IS5A 4WMFA 4FUGA 3ELAH 3FFGA 1IQEA 1GJ9B 1VZQH 2NU1E 5FCKA 1MMJN 2CXVA 2SGDE 4AG1A 4BNRA 1QBVH 1NM6A 3DHKH 4UONA 1TE0A 1W2KH 2I6SA 3TLOA 4X8SH 3SU0A 1P12E 4YOIA 4E06H 4YZUA 4I8GA 4NSYA 1TBRH 2OC7A 2QN5T 1IQKA 1A3BH 3SU2A 3UTUH 1F5LA 2ZGJA 5AFZH 1QQ4A 3A85A 4FETA 3TITA 3BSQA 3OAAD 1NRSH 2VIOA 2BXUH 2VB0A 1AMHA 3ITIA 2XC0A 5DP8A 3FOAA 4IBLH 1THRH 3WY8A 4MNVA 1QTFA 1UHBA 3FN8A 2Y6TA 3C1KA 4O3TA 3BF6H 1HIAA 3ATIA 1T8NA 4O3UA 2GMTC 5EJ1A 1VGCB 5F6MA 1TNGA 1QA0A 1ID5H 2DE9A 2SFAA 3SHCH 1ABJH 1PYTD 1IQGA 2OP9A 3RP2A 2BDGA 3NCLA 1TX7A 2K1QA 3PWBA 1AVWA 3CENA 1MKXH 1MTNC 1V2WT 3GICB 1DY9A 1ZJKA 2FOGA 2ZF0H 2VJ1A 5IDKA 2FX6A 2O8UA 3PM3A 4A1XA 1ANBA 1Q2WA 2ZFFH 2R0LA 1HB0B 3FP6E 1QBOA 5B6LA 4K8YA 1XVMA 5CMXH 4ZMAH 5EQQA 2R9PA 1O5DH 1O3KA 2A2XH 2ALPA 5DP9A 1LKAA 1GJ7B 2BLOA 2B7DH 4WJG2 1MUEB 2PLXA 3AAUA 1XKBC 3GY5A 3E3TA 1TX8A 3S69A 4YOJA 1P02A 1SI5H 4CBNA 3M35A 4AZ2B 1SLUB 1HNEE 2YNAA 1NY22 1WUNH 1ESTA 1NRNH 4I31A 1QCPA 1D6WA 3NWUA 1WU1A 2A1DB 2LPRA 1RS0A 2FOBA 2DUCA 4ZHAA 1S85A 1O2TA 1UCYK 3MNCA 1V2OT 2IPHA 3DFJA 1GMHG 2AGEX 4A92A 2A7HA 2ZWLH 1GWAA 2WV5A 1C5PA 2ZFSA 1LPKB 4KTCA 4U01A 4GVUA 3LGUA 1P8VC 2FWWA 1QY6A 2KCPA 3ZZ6A 1HUTH 4INLA 1OWIA 1G3DA 1W11U 2AGGX 2G00A 4H6SB 4ABGA 5K7RA 1KXFA 3BTEE 5JPMH 2W3KA 4ZROA 4I8HA 3HPTB 3LPRA 1CQQA 3A82A 1N1LA 1Z1JA 4IGDA 4Y79A 3W1EA 3SV6A 5FCRA 1UTKA 1UTMA 3B9FH 1YPLH 2PKSB 2ZA5A 3GCOA 1EJAA 1P0SH 1VCPA 2V0BA 1ANEA 1L1NA 3UFAA 1P01A 2CHAC 2FEQH 2XNIA 1FXYA 1UMAH 3EYDA 1BRBE 3FANA 3NXPA 3I77A 4ABDA 4B76A 1PPHE 1X7AC 1XUKA 2JIZD 1C5OH 1KXEA 1Y5UT 3GY6A 4AORA 1DE7H 3BIVH 1H8ED 2ANYA 3BEFB 2J98A 3HK6B 3JZ1B 3SQHE 1SOZA 3WWFA 2QXIA 3AVZA 1SQOA 1AHTH 1NESE 4FUBA 5A09A 3D65E 1J17T 1MABB 1KY9A 2G55A 4SGBE 1GI3A 2ZG0H 4Q2KA 3DSGA 2BZAA 1RTLA 4CBOA 2AS9A 2XTTB 1QB1A 2NU3E 1CGIE 3U8TH 3TGJE 1DXWA 3KF2A 2ZDVH 3FP7E 1EZUC 3GCNA 2GDEH 2EC9H 4ZXYH 3F3BA 4CRGA 4P02A 1GBLA 1T8OA 3QTVH 1H1BA 5HM2A 1SGQE 2F4LA 2R3UA 1JXPA 4F55A 2BZ6H 3FKSD 1SGFA 3UB0A 3QWCH 5HYOA 3L6PA 5EGMA 1PYTC 1INCA 2A45B 4MG3A 2KCAA 1C9PA 1A0LA 1GJ6A 1V6DA 2IOTA 2ZKSA 2WPDD 1YPHE 4Y10E 2WPLS 3P95A 4WH8A 1O3OA 3E16B 4DG4A 1UVPA 1TQ7B 3MFJA 5F8ZA 4XBBA 2PTCE 1HAZB 1MU6B 2FOAA 1BTZA 4YXWD 1SC8U 4XBDA 3M3VA 3LOXA 1B0EA 2C93B 1T31A 3K6YA 1CA0C 1G37A 3RC4A 1A1RA 1O3BA 1ZYOA 2ZDLA 4YESB 1GI7B 3ODDA 2FP7B 3TK5A 3P92A 1O30A 2JETC 4GCHF 2KCOA 1V2UT 3ZZ9A 1KDQB 1QA7A 4K69A 3SJKA 3RM2H 2ZDAH 1C5QA 3UQVA 2ZU2A 2M2AA 1RGQA 1C5TA 1ELAA 1Z7KA 2SGPE 3RXAA 1MAXA 3F9FA 4NIYA 3ZZ5A 1V2TT 1BQYA 2BTCE 1PPFE 2XC5A 3SN8A 3MTYA 3VGCC 4DT7B 1DY8A 1TPPA 3OTPA 1O2ZA 2ZU5A 4Q80A 4NIWA 4J1YA 1W10U 4JCNA 1GBDA 1P9UA 1V2PT 2V3MA 4RN6A 1GHBG 5EJLA 1FN8A 3GDVA 1FIZA 5FPTA 3MI4A 4YT7H 2QF3A 1H9LB 4KKDA 1CT4E 1AVXA 2BY5X 4H6TA 1BT7A 1O5CB 1UK2A 3M36A 3RU4D 2XBXA 1TOMH 2FDAA 1SMFE 4X2VA 3WW7A 1HYLA 1ZLRA 4U32A 2BYAX 4DVAU 4CRBA 5DKMA 3N7OA 7ESTE 3T62A 2OCVB 1EASA 5AF9H 2XC4A 5FL7D 4FU9A 2H5DA 2Y81A 1HGTH 5LH8A 3CNRA 2GVFA 3T2NA 1O2VA 3RXEA 4ZHLU 3LC3A 1C1TA 2ZECA 4JZDH 1SLVB 3FZDA 1KIGH 2EI8A 5FX6A 3V7TA 1HLTH 1ELFA 3HKIB 1O38A 1NPMA 4WF8A 1AUTC 1SB1H 1SLXB 3M3SA 4B75A 4E7RG 3W95A 1BRUP 3M5OA 1A61H 1WSSH 1O3LA 1E38B 3U69H 1HAYB 2BB4A 1F7ZA 1P2IA 1XM1A 4GSOA 3UWIA 1C2FA 1L1GA 2RCEA 1RTFB 2A5KA 2J9NA 3L33A 5C5OA 5SGAE 5JBCS 4XBCA 9LPRA 1O2JA 1UK3A 5CHAB 2ZIQH 2C90B 4JZ1A 4E05H 4TY7A 3HGPA 4AOQA 1QQUA 1JRTA 2BOHB 2VNTA 1CU1A 3CS0A 1NTPA 5AVDA 1SQRA 1O2MA 1VJ9U 1DLEA 3H5CB 1NO9H 3LGIA 4AFZA 4D8NA 1Y3XA 4E7NA 2ULLA 1DITH 1ZMJA 2BX4A 3A87A 4AYYB 1C4Y2 3RMNH 1GMCG 5A8XA 1YPHC 1T32A 1ZHPA 3U1IB 5EXNA 1YLNA 1TWXB 3LGYA 2DE8A 2NU0E 2V7QD 2TRMA 2BD3A 1GBFA 1LHFH 1E1QD 5L2YH 2PP6A 2P94A 1O2PA 3M37A 1FAKH 2O8LA 4GUXA 3VFEA 1G3BA 2VU8E 1ORFA 1EKBB 1CBWB 3ZZ8A 5EG4A 2FS9A 3LU9B 2V3OH 3LDXH 4H42U 3RXIA 1O2HA 3U1JB 3I78A 2C8YB 4K2YA 5E8EH 6GCHG 1TQ0B 1S0RA 3ZZCA 3MQKC 4FXGH 1V2RT 2ZHQH 5HM9A 2BDHA 1HAOH 2OUAA 1XXDA 3TGKE 1HCGA 3KNXA 2ZDKA 1SGTA 2A2QH 3MU4A 1RIWC 2JH5D 1FPHH 3GYLB 5AHGH 5EQSA 2D8WA 2RA0A 2CF8H 3TH3H 5EXLA 1ZPBA 4ABIA 1L4ZA 3VEQB 2Z9JA 2QXHA 4CRCA 1PPEE 1QJ6B 4K8BA 3BTFE 4DIHH 3ZZDA 2ZPSA 3AASA 2J4IA 3ODFA 2Z9KA 2OC8A 1QB6A 2WPMS 3A7VA 1EZSC 1A5IA 4RT1A 2NU4E 2ZCHP 5DJ7A 2Y7XA 3Q00A 1AFQC 3FP8E 1DVAH 2ZFRH 4MDSA 1ZR0A 1NRPH 1LCYA 3ZZ3A 2HWLB 3SV2H 4R8TB 1OX1A 1FQ3A 2BDIA 2H9TH 3ATWA 3E0PB 3EAJA 5TCAA 1GL1A 2XWAA 1UJ1A 4ABJA 3OU0A 2L6OA 4NZLA 3A7ZA 4UDWH 3A88A 1HRTH 1NBME 4I86A 1O2UA 1BBRH 2BD5A 2BDYA 3U28C 3TH4H 5A2MH 1PFXC 1DOJA 4FUHA 2EI6A 1HAVB 1AWFH 1C1WH 2EY4C 1G3CA 5ABWA 1BTHH 2J2UA 2HRVA 3F68H 1P04A 1TMBH 2VINA 2FLBH 4I8KA 2G81E 4D7FA 4OM9A 5JDUB 2K0QA 3T27A 1NT1A 3ZVCA 1OHHD 2YMSD 2THFB 3VG8A 1SPJA 4M7GA 1N6YA 3LIWA 1ESAA 4BAMB 2W3IA 3QLPH 1DWCH 1HPGA 3SI4H 1AB9B 2TIOA 4TT3D 4Y7BA 1MKXK 3DUXH 3NKKA 2A5IA 1DDJA 1GHZA 1GJCB 3RXHA 1MCVA 1O2IA 1F5KU 1PPGE 1F0SA 3DSPA 1TNJA 2ZGCA 1JIRA 3MU0A 2R2MB 2W5EA 3MO9A 2BX3A 1MKWK 2GCTC 4MPUA 4RI0A 3SZEA 1C4V2 1MZAA 1FY8E 1DWDH 2ZCKP 1MD7A 3SNEA 1ZOMA 1F0RA 2VWLA 2O8TA 1TGSZ 1OWKA 1Y5AT 1VITH 7LPRA 3DFLA 1WXRA 1ZPCA 5ESBA 3BEUA 5GCHG 1CSOE 5A0BA 2BQ7B 1Q31A 4Y8XA 1YPGH 2ZU1A 4ZAEA 3RLWH 1O5GH 4D9RA 4CR5A 2SNWA 4TPIZ 5DP7A 4XRNA 5CE1A 2JDID 2PW8H 1AY6H 3URCA 2UUJB 1DPOA 1ZMLA 2ZFPH 3PV2A 2A4QA 1H8HD 1SGFG 1F92A 3O8BA 4Y8ZA 1E36B 3U8RH 3LT3A 2P93A 3RXRA 3BTGE 1GHWH 1GJ8B 3SNAA 1JOUB 3GCHB 3QN7A 3DD2H 1EZXC 3GDSA 1FX0B 1P03A 2F83A 2VWNA 3BIUH 3KQ5A 4I8LA 1C2MA 1PJPA 1Z8IB 4IW4E 1DICA 5HXFA 3F2GA 5CDFE 4FUCA 1TLDA 4AC9A 5DP3A 2VH0A 3L3TA 2Z9GA 5ESTE 2D26C 1C2KA 1THSH 1OWDA 4PROA 1GMHF 2UUFB 3A7WA 3RXSA 3MH7A 1IQMA 2BQ6B 1AU8A 1C5VA 2QE7D 4AGKA 1L0ZA 3OY6U 1AE5A 3TU7H 5I46H 3KEEA 1B0FA 4Q7ZA 3T28A 1FY4A 4ISLA 1KXCA 2C4FH 2PUXB 1FLEE 2WUBA 3NK8A 3DCLA 1EB2A 1O2QA 4JYTA 4B6FA 2QXJA 3M5LA 1GI6A 2FOFA 4HTCH 1Z71A 1PQ8A 2O8WA 2WPKS 1GHXH 4BTIB 2VIQA 2PTNA 1WTGH 1LMWB 1CT0E 1C1VH 1UTPA 3WWBA 4JK5A 3TK9A 1WOFA 1EAIA 2W6JD 4FU8A 1NN6A 3SNBA 4WY3A 3B23B 1C5NH 1NU9A 3KN2A 2XBWA 4NZQA 1W8BH 5DSFA 1GJ5H 2UUYA 1O3CA 1TAWA 1GJDB 1GBKA 1XUIA 1C2HA 2FM2A 1TRYA 1IQLA 3F2FA 1UK4A 4IN2A 3SNCA 3BTTE 4X2XA 2P95A 3LC5A 3BV9B 4ACAA 3S9BA 4ZH8A 1MBMA 4AX9H 3STJA 5EW1H 4LXBH 4OGXA 1B5GH 2GGVB 1MCTA 2J94A 3EGKH 4VGCB 1TMTH 1LVMA 2YMSC 3RXMA 4B2CA 2FPZA 3M5NA 1C2DA 1DS2E 1U6QA 2VGCC 2BD4A 3MH6A 5F8XA 2PWXA 1FAXA 1ZTLA 2QGRA 1VCQA 1W14U 4UE7H 1GGDB 3ZYEA 1ZTJA 3MWIU 1UHBB 2ODPA 1BUIA 1JBUH 1NFYA 1BZXE 1P2NA 5JB9S 4IC6A 1SR5C 1HIAB 1HJ9A 2TGPZ 4Y0YE 1K9OE 2F3CE 2BLWA 1UO6A 3OSYA 1S0QA 1SQAA 4Z6AH 3UIRA 7KMEH 4U2WA 3O8DA 1IHTH 1Y8TA 1PQ7A 1OSSA 1N8OC 1GG6B 1O35A 2F9PA 3ZVBA 4M9FA 3P70B 3Q3YA 1YY3A 3SV8A 2GCHG 3QX5H 2G4TA 1DX5M 1WV7H 2FODA 2AMDA 2BVSH 3GY3A 1V2ST 3A84A 1C5SA 2O8MA 1KMHB 4AFSA 3GY7A 1MTWA 7GCHG 3SU4A 2FI4E 1K22H 1HXFH 4MLFB 1A46H 1TBQH 3S7HB 2IJOB 3UNQA 1XX9A 2ZFTA 4OS2A 2O9QA 2OBOA 1ELCA 6CHAB 1MH0A 4ABBA 1MU8B 1TB6H 2WPJS 3MHWU 3EA8A 1DWEH 3K6ZA 3SUGA 3QZRA 3SU5A 3TPIZ 4UEHH 1GCDA 1E37B 1KYNA 1O2WA 3AAVA 1YLCA 1W12U 2FYQA 3TIUA 4HGCA 1LVOA 2OQ5A 2VVVA 1ETRH 4HFPB 1C9TA 1AO5A 1YGCH 3PTBA 2HALA 2ZU4A 4GAWA 4Y76A 1RRKA 5GIBA 3VPKA 4X2YA 1A5GH 2QV1A 2TBSA 1OOKB 2CV3A 2AHME 1GHBF 2Q6GA 1TRNA 4Y11E 1K1NA 5PTPA 1HAGE 2GTBA 3D49H 1G3EA 1O3JA 2RDLA 3LGTA 2OINA 3M7QA 1OKXA 2CJIA 2J5UA 3UNSA 1O2NA 3PO1C 1DXPA 2GV7A 5TCCA 1LQEA 3I29A 2UUKB 1V2KT 2XRCA 1UTJA 3RXGA 1GVZA 1O2KA 2C3SA 4CHAC 1GCTC 1FV9A 1XXFA 3E90B 3S0NA 2BQWB 2GV6A 4X6MA 4R0IA 1GBTA 3OX7U 2XOKD 2RDEA 4YO9A 1PQ5A 3F9EA 5JYIA 1TYNA 4XSKU 1XUFA 2GZ7A 1C5MD 2J98B 4Y71A 4B2AA 2KCYA 3M7TA 1GBMA 1K0HA 2JH6D 1O3NA 4INHA 4I8JA 1YM0A 2G52A 2GX4A 3E0NB 4RSPA 1A0HB 5FHTA 4YM9A 1L1JA 4DCDA 2WYGA 4IN1A 3MNXA 3BG4C 1VCWA 2FMJA 1HFDA 3EA9A 2SGAA 2FXRA 1W7GH 1O5BB 4B1TA 1GDUA 1TA6A 2Y7ZA 3SGBE 3TJNA 2QAAA 5CHBA 2Z9LA 3M61U 3TJUA 4YLUA 5A0AE 3NZIA 1RTKA 2VWOA 1GI0A 1KDQA 4LZ1H 1IQFA 1P57B 1CHGA 1OP8A 4RKOB 2CF9H 1DM4B 3DT0H 4H4FA 2P3UB 4ISOA 1YBWA 1EB1H 3CS7A 1XUGA 1EPTB 3O8CA 1FZZA 4ABEA 1QR3E 3GYMA 4Z0KA 4TSFD 1V2VT 4B74A 1P3CA 1BMNH 2ZDMA 5GNDA 2UWPA 1C2LA 2CN0H 3VB3A 4X0WU 4ZHMU 1Y3YA 1MAYA 3BTKE 2BD9A 1D3TB 4MPVA 1GVLA 3VB5A 4LZ4B 1ETTH 4JZEH 1LTOA 2FTMA 1VJAU 3SU3A 1AFEH 4NG9H 2G51A 1K1JA 3PLPA 3TVJB 3P8NA 1ZZZA 1E35B 1P11E 3GISB 2KFWA 1O2XA 2P8OC 1C5YB 3BTME 1K1LA 1CHOF 2ESTE 4X6OA 2BDAA 1SG8B 3SJOA 3A7TA 3UQOA 2A31A 4ISIH 1A5HA 4JMYA 1Z8GA 2GKVE 4LOYH 2A5AA 2Z9IA 1NRQH 2OC0A 1HJAC 2PUQH 2PGQB 4DT4A 4YOGA 2CGAA 4FU7A 9ESTA 1MZDA 1O5FH 1XUJA 1BBRK 2GD4B 2W26A 3G01A 3LGVA 5E0GA 3SGQE 4B6EA 1BMFD 1Y3VA 2AFQB 4OS6A 3SUEA 8GCHG 4JYUH 4A1VA 3ATLA 1QIXB 4KTSA 1D3DB 1QJ1B 5JBTA 1GI2A 1EFRD 1ZPZA 1SGCA 5IK2D 3KHVA 3SYJA 2TPIZ 4BAOB 1AD8H 2QYIA 3F0PA 2BOKA 1BTWA 1ELTA 2XCFA 1Y3WA 3FVFB 4ZKOU 3ZIAD 1SGPE 3ATKA 5TJXA 1EJNA 1ELEE 1GI1A 3STIA 1WAYB 5EIYA 5H4IB 2PHBA 2F91A 2GMTB 2TGTA 2PSYA 1AUJA 1VGCC 1FIWA 1QB9A 2BDCA 4WMDA 1H4WA 1E0FD 2BDBA 1LPZB 2PKAB 1KTSB 4MNXA 2QXGA 3ZVGA 1MTNB 2EA3A 5EJZA 1Y3UA 1C5ZB 1THPB 1A4WH 4GPGA 4X1RU 1LVBA 1T7CA 1WQVH 4CH2B 1N6XA 2G5NA 4MTBA 1TA2A 3PMBB 1O2OA 3A8CA 1C1SA 4RT0A 4ABHA 1VITG 1SOTA 4X8TH 3A86A 1GMDF 2K8IA 3D62A 1OS8A 3MNBA 4X1PU 1DANH 1W13U 5FAHA 2R2WU 4GCHG 4FUFA 3ZYDA 3TNSA 2RG3A 3LKWA 2AMPA 2W7UA 1CGHA 1C2IA 4FOUC 3P8FA 5GXPA 1EP6A 3EDXB 1QNJA 1AQ7A 2AIQA 4TWWA 1PPBH 4Y7AA 1O3HA 2A4RA 3KIDU 4D7GA 4UFDH 1AIXH 4DOQA 5FBEA 1E34B 2OC1A 3E1XB 3IITA 3PROA 1O3EA 1PPCE 1AKSA 1HBTH 1EOLA 4KP0A 5DN6D 5I25A 2L74A 1WTHD 2FYRA 3S9AA 2B8OH 3UWJH 3UR6A 5F8TA 5DP5A 2WSSD 3H7OA 3BTWE 3KQDA 1YYY1 1UTNA 4WXIA 1BITA 1KXDA 4JK6A 4DY7B 4BANB 3DA9B 4Q7YA 5HIZA 1LO6A 2ZO3H 3Q77A 1GHAG 4X2WA 4TYDA 2ZNKH 4FVBA 1YWUA 1CGJE 4IMQA 3RXDA 3BEIB 1ZRKA 3A8BA 3RXJA 5C1UA 1D9IA 3RXUA 1XUHA 2G8TA 1NBMD 2ALVA 3RU4T 1KLIH 3IG6B 5EODA 5C94A 1FMGA 1T8MA 2B0FA 2F9OA 1NROH 2ZQ2A 3DSOA 1G32B 4D76A 3A8DA 1VKYA 4WVPE 1BTPA 1FY3A 5A8YA 2AEIH 2Y5HA 1EXFA 1DSUA 2ZZUH 3UREA 2PKSC 2HNTE 3SNDA 4ZCNA 1UVUH 2G5VA 4NIXA 1HAPH 4OS4A 1HAVA 4B2BA 1F0UA 1Y59T 4KELA 3CP7A 3RMOH 2CHAB 3MU5A 4XD7D 3ZVEA 1HAHH 4DIIH 1GDNA 3A89A 1CVWH 1W0ZU 3H7TA 3RM0H 1O36A 4X6NA 5A0CA 1K1PA 2P16A 2XWBI 1MTVA 1UVTH 1DFPA 4BTTB 2SGEE 3RXQA 1YLDA 5B6OA 1HJ8A 4X6PA 3TJVA 4MNYA 4OGYA 2KZ4A 2QA9E 5L6NH 3SJ9A 2HNTF 2P59A 3SU6A 3KCGH 5L30H 1P2KA 1D3QB 3GY4A 3E6PH 1QL9A 3QGNB 2VIPA 1VR1H 4RKJB 4CRFA 2OTVA 1LPGB 1OP2A 1RXPA 3ZV8A 1K2I1 1QRZA 2ZPRA 2GP9B 1H9HE 3SV9A 1G9IE 1ACBE 2ASUB 1NFWA 2ZTZA 3SGAE 4AN7A 3LJOA 1K21H 1BTYA 1O3DA 4HG6A 2OQUA 1NC6A 1H9IE 3S7KB 1BJVA 2ZGHA 4I7YH 4X8UH 1DUAA 1P2MA 2SNVA 1ELGA 3OTJE 1O5EH 1LDTT 1UTLM 1V2QT 1ZSKA 1SL3A 3MO3A 2A4OA 1J14A 4KTUA 1C1RA 2OXSA 1CA0B 1QRWA 4CRDA 1C5LH 5GJ4B 1SGDE 4CR9A 3T26A 1KSNA 1K1IA 3PTNA 4OS1A 2BLVA 2Z94A 1TPOA 1OWHA 1O2YA 1QL7A 2JETB 1GI8B 1ZTKA 4MNWA 3RDZA 2V3HH 1O31A 2Z3CA 2ANKH 4JYVH 5EPYA 4XE4A 1CE5A 1GBBA 1C2EA 4OS7A 4DURA 2GZ8A 3P8GA 5LPRA 1EX3A 2RA3A 2V6NA 4OS5A 1UCYE 1ETSH 3VGCB 1F2SE 1P2JA 4UFFH 3R0FA 4KGAA 2GCHF 1TGTA 3E91A 2FOCA 3UOUA 2KAIB 5EOKA 4ABAA 1GHYH 4CH8B 1PPZA 1J8AA 1WQSA 3SUFA 1YP9A 3F0OA 1P10A 1TNIA 3UUZA 1LKBA 5C1YA 1BRAA 5LPFA 4XFQA 1ANCA 1UW7A 2ZPQA 1LHDH 3MH5A 1AGJA 2FLRH 3UY9A 4CREA 1C1NA 1P3EA 2AYWA 2Y5FA 2HPPH 1O2GH 3P6ZB 2SGQE 2FZZA 1ZHRA 3BG8A 3ATMA 1FN6A 1TNLA 2ZHEH 4BAQB 4FUJA 4CRAA 4JZFH 1B7XB 1S82A 2H5CA 3JZ2B 2Q6FA 5T6GA 1BA8B 5DPAA 3RUOA 1CT2E 2IJD1 5IYTA 3UOPA 1YPKH 1TOCB 1YPJH 1YCPH 1SGNE 3GCTG 2EEKA 5C0UA 5C67A 5F53A 3SJIA 1MTUA 2A0QB 4ISNA 1FONA 1TGBA 1O0DH 5DK1A 2HGTH 8ESTE 1QURH 2ZTXA 1WYKA 1W0JD 2ZC9H 3GDUA 4Q63A 2C8XB 2M5TA 3SU1A 5EW2H 2CK3D 5EXMA 4MPWA 5J4QA 2LP6A 3RMMH 3EE7A 3PB1E 3RXLA 3A7YA 4XDEA 1ZSLA 3A80A 1FY5A 2WV4A 1EAUA 3KQEA 1C2JA 3RMLH 3SOSA 2IPQX 2XXLA 1DUEA 1OXGA 3SW2B 2VIVA 1ARBA 2QF4A 1P09A 2PV9B 3UAIC 1QBNA 5CHAC 1Z6EA 4ACBA 1O34A 3QO6A 4K3JA 4BAKB 5J4SA 1FY1A 3A81A 2ZCLP 1TX6A 1D3PB 2GT7A 4UFEH 1SKYE 4AYVB 4NWLA 4A1TA 2HVXA 1IOEA 1S84A 1ZSJA 1UTQA 1QGFA 4TPYA 2KM0A 4O9VA 2RFKC 1JRSA 4NA8A 1F5RA 2AIPA 1V2LT 4TY6A 3QK1A 1DT2A 2F9NA 1SHYA 3PWCA 1MKWH 1V2MT 4WMEA 5GPIB 4NFEA 1ELVA 2BXTH 4O97A 1P2QA 1C5WB 4AGJA 1JWTA 2FO9A 1CBWC 4BXSA 1MTSA 1S83A 3ZZAA 3PMJA 4BTUB 1QJ7B 1W7XH 1SLWB 1V3XA 1RD3B 4Y8YA 2CMYA 2STAE 4AG2A 3RXBA 6LPRA 2QY0B 1GVKB 2FX4A 1BTUA 2HPQH 1RIWB 2VBCA 2BY8X 1T4VH 1AE8H 2Z3EA 3MOCA 3KQCA 3K65B 3TJOA 1LHCH 3NPSA 1KXAA 2XW9A 1O39A 2Y80A 3K9XB 1SFIA 2FS8A 3C27B 3E8LA 4FVDA 1BDAA 1O37A 2BY9X 2Z7FE 2VH6A 1SFQB 1O3GA 4ZKNU 1C4U2 1GBEA 2Z6BD 2W7SA 2UWOA 2QC2A 1TABE 3F1SB 1AFQB 1SGRE 1ARCA 2WHXA 4Y0ZE 3URDA 3RXKA 1C1PA 2H9EH 2J34A 3SZNA 3HKJB 1AI8H 1UTOA 1IQHA 2V35A 3K2UA 2OBQA 2JH0D 4NWKA 4B71A 2ZP0H 1TNKA 3R3GB 2P3FH 2KR7A 5E2OA 4NFFA 1BBRE 2XBVA 3VB6A 2H1UA 2EQNA 2AMQA 1NU7B 1A2CH 4DW2U 1O2SA 2PGBB 2G4UA 3BTDE 2VIWA 4WH6A 2AGIX 3GY8A 1Z8JB 2BY7X 2NU2E 2VWMA 4GLYA 1WBGB 8GCHF 4J2YB 5T3HA 1HXEH 3QUMP 2QIQA 1EOJA 1YF4A 4YTAA 3V0XA 4F49A 2W6ID 3UPEA 3A83A 4BXWA 3O8RA 4NA7A 5T6DA 1O33A 1AB9C 5HMAA 2ZHFH 1IHSH 4YT6H 2LELA 2ODQA 1V2JT 2BMGB 1KLJH 2B5TB 2WYJA 3KYFA 8LPRA 2P3TB 1O3IA 5BPEA 3RXOA 3FAOA 2JJ1D 5L2ZH 1GDQA 4AB8A 1XVOA 3MYWA 1ESBA 4X1SU 2NWNA 2GCTB 1YPMH 4Y6DA 4K1SA 2D2DA 8KME2 1O2LA 3TK6A 1C5XB 2A7JA 1S81A 4ESTE 1C1OA 1BRCE 1E1RD 1OP0A 2B9LA 1QFKH 3U9AH 1P2OA 3MU8A 2F9BH 2ZU3A 3RXVA 3PRBA 1TONA 1OWEA 3OFND 2F9VA 5C0TA 2SGFE 5KECA 4X1NU 1SBWA 2JJ2D 1TMUH 4DJZB 1EPTA 2H9HA 1HV7A 3Q76A 1BCUH 1GMCF 2BVXH 4MVNA 3S9CA 3M3TA 3BN9A 3SO3A 2WV9A 2F9UA 2VVCA 1BTXA 5F03A 4DGJA 2ZHWH 5FBIA 1ELBA 3AW1A 4Q7XA 3ZVAA 4XOJA 1MQ6A 2HVYB 3B8JA 3TH2H 3VXEH 1G36A 1FNIA 2GZ9A 3U8OH 1VITF 4FUEA 2BD8A 4P00A 3HGNA 5EPNA 1WCZA 3EE0B 1DWBH 4A7IB 4UFGH 1O2RA 4NCYA 2IN2A 3GCHC 2Y5GA 3W94A 1ANDA 2FESH 1CO7E 1ZJDA 3ZVDA 6GCHF 6ESTA 4WXVA 2ANMH 4ZXXH 1A0JA 1UCYH 1IQJA 2J95A 1A7SA 1EP5A 3T25A 3N99A 3ZV9A 5C3NA 2TGDA 2JKHA 1GBAA 1BOQA 1K1MA 3F2HA 3SBKA 5T6FA 3LH3A 1AVGH 1SGIB 2LNCA 4K1TA 3OEED 2C8WB 3QDZB 3AW0A 3KYGA 3ZZBA 3MMGA 3SI3H 5HKKD 1GHAF 1LHEH 3RXCA 2BHGA 4Q4LA 5JBBS 1SHHB 1GJ4H 1KLTA 3LGWA 3VB7A 3RXTA 2BY6X 4AFUA 3EA7A 5DO4H 1AWHB 4K60A 1ABIH 3NUMA 1JMOH 1E79D 2EI7A 1SVPA 2FTLE 2UWLA 5LGOA 1O3PB 5HIYA 3SJ8A 1DLKB 3RU4E 1P05A 1OYTH 1P06A 3V13A 3PLKA 3V3MA 5C17A 2AH4X 2QF5A 1GBHA 3GOVB 3H09A 4ZUHA 1C1UH 4Z1MD 2R3YA 1BHXB 3D23A 1S6FA 1BIOA 3U98H 3PV4A 3V12A 5T1VA 4WWYA 1EJMA 1C2GA 4FUDA 4NGAH 2PKAA 1NZQH 1EZQA 4GHQA 1NFUA 1K1OA 1D4PB 2A7CA 3OE7D 3MO6A 1TGNA 1DSTA 1GJAB 1ZGVA 3FZZA 4ISHH 2YMSB 4BAHB 4VGCC 4LK4A 1TBZH 2PFEA 1G2MA 2BD2A 2VGCB 3N7EA 2PR3A 1UVSH 3PMHB 3SV7A 1C5RA 3RC6A 1SSXA 1TGCA 5BRRE 1Q3XA 1GGDC 1O3AA 2Z3DA 4K5ZA 3RXPA 1GJBB 2STBE 1C1QA 1YCPM 1SQTA 1GI4A 4AFQA 2ODYB 2OD3B 4ABFA 3ENSB 1IQNA 3UR9A 2XYAA 1M9UA 1TPAE 3MH4A 1N8OB 2ZQ1A 1GG6C 2QF0A 1BMAA 5EU8A 1ZMNA 1V2NT 2GDDA 1OYQA 5FPSA 2OK5A 5JB8S 5C20A 4I32A 4MQAA 1J16A 3QGJA 5GCHF 5JBAS 3OEHD 4AB9A 1YPEH 3EQ0H 1EQ9A 2GJGA 2HLCA 2ZGXH 1T4UH 2ZI2H 1FJSA 1JIMA 4BOHA 1LHGH 2QCYA 3MNSA 1OWJA 1SGEE 1IQIA 4MPXA 5HGGA 3T5FH 3OYPA 2VIDA 1WDIA 1H8IH 1T8LA 4HI3A 1LQDB 4ZKSU 1CHOG 1MQ5A 6CHAC 1NS3A 3Q3KA 1TPSA 1XKAC 5FPYA 5GDSH 3KL6A 5LPEA 1AKSB 1QRXA 3N7DA 3M7UA 5FXLA 1EATA 5KGOA 3TNTA 4A6LA 2ZHDA 4A5TS 1F0TA 1S6LA 1YCPK 4NSVA 2TGAA 4IMZA 2BM2A 1FUJA 3ZZ7A 1LVYA 2H2ZA 3BTHE 3HK3B 1Y5BT 3KGPA 5E0HA 1GBIA 3A7XA 4X1QU 1ZGIA 2BD7A 5G4BA 2HLDD 2FOEA 1O32A 2YOLA 1EAXA 2F43B 2XNDD 4YLQH 2BVRH 1RJXB 4NA9H 1IAUA 1C1MA 3PO1B 2FOHA 1BB0B 1GL0E 1GBCA 3F9GA 3VB4A 5C5NA 1H8DH 2PSXA 2H6MA 2XCNA 3PLBA 4CHAB 1GCTB 1C5UA 3SORA 4UD9H 4F48B 3GCTF 1MBQA 1QL8A 5FX5A 3BTQE 1J15A 1ZRBA 2VVUA 3A8AA 3P8OA 4ASUD 1EAWA 3NRLA 1P9SA 1L4DA 2WUCA 4JZIA 4U30A 1XMNB 1Z8RA 1S5SA 2J97A 3GY2A 2FOMB 2YNBA 3KQBA 3LONA 1FI8A 3QTOH 4F4OC 5C1XA 2C8ZB 2R0KA
chains in the Genus database with same CATH topology
2HOBA 2ANWA 2A32A 1AN1E 1GI5A 1GHVH 1YKTA 2GT8A 5K0HA 4GHTA 5C2ZA 2I6QA 3RLYH 2J38A 4FUIA 1D6RA 2FI3E 3OY5U 1W3CA 1G2LA 3QZQA 2BLQA 1UVOA 2WPHS 3BG4B 4INKA 4X8VH 1GMDG 2FI5E 1G30B 1MD8A 2Q6DA 1HAXB 1BJUA 1A3EH 2WPIS 1YC0A 1S6HA 1BHXF 2A4GA 2ZEBA 2FIRH 2WINI 5DP4A 3SQEE 4ZKRU 1OPHB 3PYHA 4HZHA 1CA8B 3F6UH 2OLGA 1ELDE 1TNHA 2Y82A 1PQAA 4B73A 3P17H 1O5AB 5E0JA 1ZHMA 1FPCH 2J92A 1HAIH 3M5MA 2ILNA 1GPZA 1EUFA 1GBJA 3F9HA 4I33A 1HDTH 4NIVA 5DG6A 4TWYA 1EPTC 5DGJA 3RC5A 1K28D 5GWZA 1Z1IA 4ASHA 2KAIA 4O03A 4K1EA 1TRMA 4IC5A 3T29A 3UNRA 1NFXA 5A8ZA 1TIOA 2Q1JA 4SGAE 3RXFA 1J9CH 2XBYA 3TGIE 2ZGBH 3ZZ4A 2ZDNA 3Q3XA 3IWMA 2D1JA 1FDPA 4QT8C 1AZ8A 1Z6JH 1W0YH 5E2PA 7GCHF 2ZTYA 3HATH 1BMLA 1L2EA 3VXFH 3ZVFA 4D9QA 3MU1A 5DP6A 1SGYE 5AFYH 5ETXA 1NRRH 1QHRB 2P8OB 4THNH 3ESTA 3SHAH 2ZFQH 1KXBA 2HNTC 1RFNA 3PMAB 1O3FA 5EQRA 1HJAB 1TALA 3LJJA 2AERH 1GI9B 1BMMH 1KTTB 1O3MA 3LH1A 1TFXA 1AZZA 3SUDA 4IS5A 4WMFA 4FUGA 3ELAH 3FFGA 1IQEA 1GJ9B 1VZQH 2NU1E 5FCKA 1MMJN 2CXVA 2SGDE 4AG1A 4BNRA 1QBVH 1NM6A 3DHKH 4UONA 1TE0A 1W2KH 2I6SA 3TLOA 4X8SH 3SU0A 1P12E 4YOIA 4E06H 4YZUA 4I8GA 4NSYA 1TBRH 2OC7A 2QN5T 1IQKA 1A3BH 3SU2A 3UTUH 1F5LA 2ZGJA 5AFZH 1QQ4A 3A85A 3TITA 3BSQA 1NRSH 2VIOA 2BXUH 2VB0A 1AMHA 3ITIA 2XC0A 5DP8A 4IBLH 1THRH 3WY8A 4MNVA 1QTFA 1UHBA 2Y6TA 3C1KA 4O3TA 3BF6H 1HIAA 3ATIA 1T8NA 4O3UA 2GMTC 1VGCB 5F6MA 1TNGA 1QA0A 1ID5H 2DE9A 2SFAA 3SHCH 1ABJH 1PYTD 1IQGA 2OP9A 3RP2A 2BDGA 3NCLA 1TX7A 2K1QA 3PWBA 1AVWA 3CENA 1MKXH 1MTNC 1V2WT 3GICB 1DY9A 1ZJKA 2FOGA 2ZF0H 2VJ1A 5IDKA 2FX6A 2O8UA 3PM3A 4A1XA 1ANBA 1Q2WA 2ZFFH 2R0LA 1HB0B 3FP6E 1QBOA 4K8YA 1XVMA 5CMXH 4ZMAH 5EQQA 2R9PA 1O5DH 1O3KA 2A2XH 2ALPA 5DP9A 1LKAA 1GJ7B 2BLOA 2B7DH 4WJG2 1MUEB 2PLXA 3AAUA 1XKBC 3GY5A 3E3TA 1TX8A 3S69A 4YOJA 1P02A 1SI5H 4CBNA 3M35A 4AZ2B 1SLUB 1HNEE 2YNAA 1NY22 1WUNH 1ESTA 1NRNH 4I31A 1QCPA 1D6WA 3NWUA 1WU1A 2A1DB 2LPRA 1RS0A 2FOBA 2DUCA 4ZHAA 1S85A 1O2TA 1UCYK 3MNCA 1V2OT 2IPHA 3DFJA 1GMHG 2AGEX 4A92A 2A7HA 2ZWLH 1GWAA 2WV5A 1C5PA 2ZFSA 1LPKB 4KTCA 4U01A 4GVUA 3LGUA 1P8VC 2FWWA 1QY6A 3ZZ6A 1HUTH 4INLA 1OWIA 1G3DA 1W11U 2AGGX 2G00A 4H6SB 4ABGA 5K7RA 1KXFA 3BTEE 5JPMH 2W3KA 4ZROA 4I8HA 3HPTB 3LPRA 1CQQA 3A82A 1N1LA 1Z1JA 4IGDA 4Y79A 3SV6A 5FCRA 1UTKA 1UTMA 3B9FH 1YPLH 2PKSB 2ZA5A 3GCOA 1EJAA 1P0SH 1VCPA 2V0BA 1ANEA 1L1NA 3UFAA 1P01A 2CHAC 2FEQH 2XNIA 1FXYA 1UMAH 3EYDA 1BRBE 3FANA 3NXPA 3I77A 4ABDA 4B76A 1PPHE 1X7AC 1XUKA 1C5OH 1KXEA 1Y5UT 3GY6A 4AORA 1DE7H 3BIVH 2ANYA 3BEFB 3JZ1B 3HK6B 3SQHE 1SOZA 2QXIA 3AVZA 1SQOA 1AHTH 1NESE 4FUBA 5A09A 3D65E 1J17T 1KY9A 2G55A 4SGBE 1GI3A 2ZG0H 4Q2KA 2BZAA 1RTLA 4CBOA 2AS9A 2XTTB 1QB1A 2NU3E 1CGIE 3U8TH 3TGJE 1DXWA 3KF2A 2ZDVH 3FP7E 1EZUC 3GCNA 2GDEH 2EC9H 4ZXYH 4CRGA 1GBLA 1T8OA 3QTVH 1H1BA 5HM2A 1SGQE 2R3UA 1JXPA 2BZ6H 1SGFA 3QWCH 5HYOA 3L6PA 5EGMA 1PYTC 1INCA 2A45B 4MG3A 1C9PA 1A0LA 1GJ6A 1V6DA 2IOTA 2ZKSA 1YPHE 4Y10E 2WPLS 3P95A 4WH8A 1O3OA 3E16B 4DG4A 1UVPA 1TQ7B 3MFJA 5F8ZA 4XBBA 2PTCE 1HAZB 1MU6B 2FOAA 1BTZA 1SC8U 4XBDA 3M3VA 3LOXA 1B0EA 2C93B 1T31A 3K6YA 1CA0C 1G37A 3RC4A 1A1RA 1O3BA 1ZYOA 2ZDLA 4YESB 1GI7B 3ODDA 2FP7B 3TK5A 3P92A 1O30A 2JETC 4GCHF 3ZZ9A 1V2UT 1KDQB 1QA7A 4K69A 3SJKA 3RM2H 2ZDAH 1C5QA 3UQVA 2ZU2A 1RGQA 1C5TA 1ELAA 1Z7KA 2SGPE 3RXAA 1MAXA 3F9FA 4NIYA 3ZZ5A 1V2TT 1BQYA 2BTCE 1PPFE 2XC5A 3SN8A 3MTYA 3VGCC 4DT7B 1DY8A 1TPPA 1O2ZA 2ZU5A 4Q80A 4NIWA 4J1YA 1W10U 4JCNA 1GBDA 1P9UA 1V2PT 4RN6A 1GHBG 1FN8A 3GDVA 1FIZA 5FPTA 3MI4A 4YT7H 2QF3A 1H9LB 4KKDA 1CT4E 1AVXA 2BY5X 4H6TA 1BT7A 1O5CB 1UK2A 3M36A 3RU4D 2XBXA 1TOMH 2FDAA 1SMFE 4X2VA 1HYLA 1ZLRA 4U32A 2BYAX 4DVAU 4CRBA 5DKMA 3N7OA 7ESTE 3T62A 2OCVB 1EASA 5AF9H 2XC4A 4FU9A 2H5DA 2Y81A 1HGTH 5LH8A 2GVFA 3T2NA 1O2VA 3RXEA 4ZHLU 3LC3A 1C1TA 2ZECA 4JZDH 1SLVB 3FZDA 1KIGH 2EI8A 5FX6A 3V7TA 1HLTH 1ELFA 3HKIB 1O38A 1NPMA 4WF8A 1AUTC 1SB1H 1SLXB 3M3SA 4B75A 4E7RG 3W95A 1BRUP 3M5OA 1A61H 1WSSH 1O3LA 1E38B 3U69H 1HAYB 2BB4A 1F7ZA 1P2IA 1XM1A 4GSOA 3UWIA 1C2FA 1L1GA 2RCEA 1RTFB 2A5KA 2J9NA 3L33A 5C5OA 5SGAE 5JBCS 4XBCA 9LPRA 1O2JA 1UK3A 5CHAB 2ZIQH 2C90B 4JZ1A 4E05H 4TY7A 3HGPA 4AOQA 1QQUA 1JRTA 2BOHB 2VNTA 1CU1A 3CS0A 1NTPA 5AVDA 1O2MA 1VJ9U 1DLEA 3H5CB 1NO9H 3LGIA 4AFZA 4D8NA 1Y3XA 4E7NA 2ULLA 1DITH 1ZMJA 2BX4A 3A87A 4AYYB 1C4Y2 3RMNH 1GMCG 5A8XA 1YPHC 1T32A 1ZHPA 3U1IB 5EXNA 1TWXB 3LGYA 2DE8A 2NU0E 2TRMA 2BD3A 1GBFA 1LHFH 5L2YH 2P94A 1O2PA 3M37A 1FAKH 2O8LA 4GUXA 3VFEA 1G3BA 2VU8E 1ORFA 1EKBB 1CBWB 3ZZ8A 5EG4A 2FS9A 3LU9B 2V3OH 3LDXH 4H42U 3RXIA 1O2HA 3U1JB 3I78A 2C8YB 4K2YA 5E8EH 6GCHG 1TQ0B 1S0RA 3ZZCA 4FXGH 1V2RT 2ZHQH 5HM9A 2BDHA 1HAOH 2OUAA 1XXDA 3TGKE 1HCGA 3KNXA 2ZDKA 1SGTA 2A2QH 3MU4A 1RIWC 2JH5D 1FPHH 3GYLB 5AHGH 5EQSA 2D8WA 2RA0A 2CF8H 3TH3H 5EXLA 1ZPBA 4ABIA 1L4ZA 3VEQB 2Z9JA 2QXHA 4CRCA 1PPEE 1QJ6B 4K8BA 3BTFE 4DIHH 3ZZDA 2ZPSA 3AASA 2J4IA 3ODFA 2Z9KA 2OC8A 1QB6A 2WPMS 3A7VA 1EZSC 1A5IA 2NU4E 2ZCHP 5DJ7A 2Y7XA 3Q00A 1AFQC 3FP8E 1DVAH 2ZFRH 4MDSA 1ZR0A 1NRPH 1LCYA 3ZZ3A 2HWLB 3SV2H 4R8TB 1OX1A 1FQ3A 2BDIA 2H9TH 3ATWA 3E0PB 3EAJA 5TCAA 1GL1A 2XWAA 1UJ1A 4ABJA 3OU0A 4NZLA 3A7ZA 4UDWH 3A88A 1HRTH 1O2UA 1BBRH 2BD5A 2BDYA 3TH4H 5A2MH 1PFXC 1DOJA 4FUHA 2EI6A 1HAVB 1AWFH 1C1WH 1G3CA 5ABWA 1BTHH 2J2UA 2HRVA 3F68H 1P04A 1TMBH 2VINA 2FLBH 4I8KA 2G81E 4D7FA 5JDUB 3T27A 1NT1A 3ZVCA 2THFB 1SPJA 4M7GA 1N6YA 3LIWA 1ESAA 4BAMB 2W3IA 3QLPH 1DWCH 1HPGA 3SI4H 1AB9B 2TIOA 4Y7BA 1MKXK 3DUXH 3NKKA 2A5IA 1DDJA 1GHZA 1GJCB 3RXHA 1MCVA 1O2IA 1F5KU 1PPGE 1F0SA 1TNJA 2ZGCA 1JIRA 3MU0A 2R2MB 2W5EA 3MO9A 2BX3A 1MKWK 2GCTC 4MPUA 1C4V2 1MZAA 1FY8E 1DWDH 2ZCKP 1MD7A 3SNEA 1ZOMA 1F0RA 2VWLA 2O8TA 1TGSZ 1OWKA 1Y5AT 1VITH 7LPRA 3DFLA 1ZPCA 5ESBA 3BEUA 5GCHG 1CSOE 5A0BA 2BQ7B 1Q31A 4Y8XA 1YPGH 2ZU1A 4ZAEA 3RLWH 1O5GH 4D9RA 4CR5A 2SNWA 4TPIZ 5DP7A 5CE1A 2PW8H 1AY6H 3URCA 2UUJB 1DPOA 1ZMLA 2ZFPH 2A4QA 4Y8ZA 1SGFG 1F92A 3O8BA 3U8RH 1E36B 3LT3A 2P93A 3RXRA 3BTGE 1GHWH 1GJ8B 3SNAA 1JOUB 3GCHB 3QN7A 3DD2H 1EZXC 3GDSA 1P03A 2F83A 2VWNA 3BIUH 4I8LA 5HXFA 1C2MA 1PJPA 1Z8IB 4IW4E 1DICA 4FUCA 1TLDA 5DP3A 2VH0A 3L3TA 2Z9GA 5ESTE 2D26C 1C2KA 1THSH 1OWDA 4PROA 1GMHF 2UUFB 3A7WA 3RXSA 3MH7A 1IQMA 2BQ6B 1AU8A 1C5VA 4AGKA 1L0ZA 3OY6U 1AE5A 3TU7H 5I46H 3KEEA 1B0FA 4Q7ZA 3T28A 1FY4A 4ISLA 1KXCA 2C4FH 2PUXB 1FLEE 2WUBA 3NK8A 1EB2A 1O2QA 4JYTA 2QXJA 3M5LA 1GI6A 2FOFA 4HTCH 1Z71A 1PQ8A 2O8WA 2WPKS 1GHXH 4BTIB 2VIQA 2PTNA 1WTGH 1LMWB 1CT0E 1C1VH 1UTPA 4JK5A 3TK9A 1WOFA 1EAIA 3SNBA 4FU8A 1NN6A 4WY3A 3B23B 1C5NH 1NU9A 3KN2A 2XBWA 4NZQA 1W8BH 1GJ5H 2UUYA 1O3CA 1TAWA 1GJDB 1GBKA 1XUIA 1C2HA 2FM2A 1TRYA 1IQLA 1UK4A 4IN2A 3SNCA 3BTTE 4X2XA 2P95A 3LC5A 3BV9B 3S9BA 4ZH8A 1MBMA 4AX9H 3STJA 5EW1H 4LXBH 4OGXA 1B5GH 2GGVB 1MCTA 2J94A 3EGKH 4VGCB 1TMTH 1LVMA 3RXMA 4B2CA 2FPZA 3M5NA 1C2DA 1DS2E 1U6QA 2VGCC 2BD4A 3MH6A 5F8XA 2PWXA 1FAXA 1ZTLA 2QGRA 1VCQA 1W14U 4UE7H 1GGDB 3ZYEA 1ZTJA 3MWIU 1UHBB 2ODPA 1BUIA 1JBUH 1NFYA 1BZXE 1P2NA 5JB9S 4IC6A 1SR5C 1HIAB 1HJ9A 2TGPZ 4Y0YE 1K9OE 2F3CE 2BLWA 1UO6A 3OSYA 1S0QA 1SQAA 4Z6AH 3UIRA 7KMEH 4U2WA 3O8DA 1IHTH 1Y8TA 1PQ7A 1OSSA 1N8OC 1GG6B 1O35A 2F9PA 3ZVBA 3P70B 3Q3YA 3SV8A 2GCHG 3QX5H 2G4TA 1DX5M 1WV7H 2FODA 2AMDA 2BVSH 3GY3A 1V2ST 3A84A 1C5SA 2O8MA 4AFSA 3GY7A 1MTWA 7GCHG 3SU4A 2FI4E 1K22H 1HXFH 4MLFB 1A46H 1TBQH 3S7HB 2IJOB 3UNQA 1XX9A 2ZFTA 4OS2A 2O9QA 2OBOA 1ELCA 6CHAB 1MH0A 4ABBA 1MU8B 1TB6H 2WPJS 3MHWU 3EA8A 1DWEH 3K6ZA 3SUGA 3QZRA 3SU5A 3TPIZ 4UEHH 1GCDA 1E37B 1KYNA 1O2WA 3AAVA 1YLCA 1W12U 2FYQA 3TIUA 4HGCA 1LVOA 2OQ5A 2VVVA 1ETRH 4HFPB 1C9TA 1AO5A 1YGCH 3PTBA 2HALA 2ZU4A 4GAWA 4Y76A 1RRKA 5GIBA 3VPKA 4X2YA 1A5GH 2QV1A 2TBSA 1OOKB 2CV3A 1GHBF 2Q6GA 1TRNA 4Y11E 1K1NA 5PTPA 1HAGE 2GTBA 3D49H 1G3EA 1O3JA 2RDLA 3LGTA 2OINA 3M7QA 1OKXA 2CJIA 3UNSA 1O2NA 3PO1C 1DXPA 2GV7A 5TCCA 1LQEA 3I29A 2UUKB 1V2KT 2XRCA 1UTJA 3RXGA 1GVZA 1O2KA 2C3SA 4CHAC 1GCTC 1FV9A 1XXFA 3E90B 3S0NA 2BQWB 2GV6A 4X6MA 4R0IA 1GBTA 3OX7U 4YO9A 1PQ5A 3F9EA 5JYIA 1TYNA