1O2UA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2uA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2uA02
1DUEA 1ZHRA 3BTME 1P2IA 1TPOA 1WTHD 1QBOA 1NRNH 5L6NH 3QUMP 1EAWA 2ZDAH 1TBQH 3LIWA 1UHBB 3IITA 3H5CB 2ANWA 2VIQA 4I7YH 9ESTA 2CV3A 1XKBC 2PTNA 1LHEH 3UNSA 1E0FD 1EPTA 3V13A 1SGNE 4B76A 1HDTH 1GBMA 3K65B 3SGAE 4GLYA 3U8TH 4ZKOU 1GJ4H 3S69A 2OCVB 5C1YA 5GCHF 4CRDA 1BMLA 1Y3UA 1O3GA 1OXGA 3T26A 1PQ5A 2C4FH 2CGAA 2ESTE 1S81A 1S6HA 3UR9A 1DE7H 2OP9A 2GZ7A 3O8DA 4ZKRU 2HLCA 4ISNA 3LDXH 2ZCHP 1C2IA 2ILNA 4WMEA 1AI8H 4PROA 1KTTB 2P95A 1W8BH 1A0HB 2VIVA 2FOMB 2ZGCA 1G9IE 1Z6JH 1O3KA 1DANH 3AVZA 5DJ7A 1PQ7A 1HAOH 3TJVA 1GHAF 1QA7A 1LHDH 1OWKA 3CS0A 4XDEA 1T7CA 3P8OA 1OP0A 1GJ5H 2O8UA 5LH8A 2EI8A 1C1SA 1NN6A 5C5OA 2FZZA 1QBVH 3RXRA 1LPKB 3PLKA 5FBEA 2OUAA 1A7SA 1UTQA 4X8UH 1P3CA 2ZPQA 1W2KH 1HFDA 3RXQA 1EOJA 5F03A 1C2EA 3MH4A 1GBIA 4GSOA 2CXVA 3ZZ7A 3LGUA 5HXFA 2V0BA 4WMFA 1K1JA 1C2GA 1TRNA 1ZRKA 2QGRA 5BPEA 2SGFE 1FY4A 1SG8B 1G3DA 1MU6B 1ETTH 3VXFH 2ZDMA 3K6YA 1NPMA 3MHWU 1PQAA 1QQ4A 1W12U 2C8XB 1DY9A 1F92A 1K1MA 1O31A 4UONA 4BNRA 3SU3A 1O3IA 1UCYE 2HVXA 1HV7A 5E8EH 1GWAA 1IQEA 1ANDA 2FXRA 1H9LB 3DFLA 3M5MA 1UVPA 1AY6H 1O30A 5EXLA 1TGNA 4AZ2B 4DT7B 1ZSJA 1EX3A 1DWDH 3IWMA 5C1UA 1IQNA 3RXSA 1D6WA 2GKVE 2IJOB 4D9QA 1CU1A 1EATA 3LPRA 2ANKH 1V2UT 1RTKA 1ZPCA 1HJAB 3M7UA 1GL1A 3GOVB 4X1NU 1O32A 1ANCA 2OC8A 1FLEE 1KXEA 1QJ7B 3Q3XA 1G32B 1A4WH 3EYDA 1EQ9A 1KLJH 1KLIH 4MVNA 2Q6GA 1WSSH 4JZEH 5EW1H 2O8TA 1Y8TA 2A7JA 1Z6EA 1Y3YA 1GI3A 4RKJB 1GI0A 2GCHF 2AIPA 1O3HA 4AGJA 1GI1A 1DXPA 2BDBA 1GPZA 3BIUH 3UR6A 2UUFB 1FDPA 1HAXB 1BTWA 4NFFA 1GJDB 1DS2E 3UWIA 1ARBA 2PTCE 1TGCA 2FOCA 3E0PB 3M36A 4K1EA 5ESBA 1V2KT 1A5IA 4RN6A 1PPGE 2GD4B 1YC0A 2BLOA 3AAVA 4INKA 4MNYA 1BT7A 2FDAA 2BY6X 3SUDA 1LVOA 3R3GB 3RMNH 1RTFB 1XX9A 1XUJA 3TH2H 4E06H 4YM9A 1BJUA 1MAXA 1B0EA 1OX1A 1UJ1A 4NIYA 1MBMA 4ABIA 4TWYA 2BM2A 2G52A 1C2MA 3M5OA 2SGDE 4X0WU 3P6ZB 2ZCLP 3TNSA 3A7VA 1NZQH 3SNAA 1SLUB 6CHAB 8ESTE 4JYTA 1UVTH 1F5RA 2BDAA 4F4OC 3BEUA 5DP9A 5TCAA 1SLVB 2BVRH 1O5AB 3M61U 6GCHF 1XMNB 1ELVA 1UK2A 5L30H 3LGYA 1JXPA 1O3JA 4NFEA 3ZVDA 1B0FA 3PMAB 3ATMA 4LOYH 1AU8A 1BRBE 2SGAA 2ZDLA 4VGCB 1L0ZA 1O3OA 2NU3E 4UE7H 3ZZDA 1J14A 1XXDA 1NROH 3TITA 1QL8A 1W13U 1V2WT 4MDSA 2F3CE 1HPGA 1NT1A 4BAKB 1AZZA 3A83A 1RXPA 1HAYB 1XVMA 3D49H 3O8CA 1O2KA 5DP6A 4ZH8A 1EAUA 4AFUA 4KTUA 2Z9KA 3A81A 1BRAA 1MQ5A 1V2VT 3M3SA 4YLQH 1QRZA 1HGTH 3ZZ8A 2G8TA 1Q2WA 4DIHH 3KQCA 1NY22 5GWZA 3MU0A 5LPFA 3VB7A 2P3FH 1Z8RA 2WV4A 2PSYA 3Q76A 1O5CB 3PMBB 4JMYA 1CGIE 1WU1A 4MNWA 2AIQA 2BXUH 1EZSC 1K9OE 2HRVA 1FY3A 3TNTA 3T5FH 3VEQB 1O5BB 2HNTC 1P8VC 4JZDH 1GJ6A 4H42U 5F8ZA 1SGDE 4ZHMU 2BZ6H 3SOSA 2CF9H 2QN5T 1C9PA 8KME2 4H4FA 4NIWA 1INCA 4B2AA 1K1OA 1HAHH 1GI7B 1H9HE 2HNTF 1GCTB 1GCTC 1LKAA 3A8BA 3TH3H 3VXEH 3LGTA 2G81E 2SGEE 5EXNA 3FP6E 2BZAA 4D7FA 1J8AA 1HXEH 2XW9A 2QCYA 3SJ9A 4BAHB 5FX6A 1C1TA 4UDWH 1SFQB 1L2EA 1AN1E 1GBEA 4AB8A 1Y3VA 3B8JA 1GI2A 5L2ZH 2Y5FA 2TGPZ 2C93B 3GCTF 1BTZA 2FLBH 1GG6C 4A7IB 2A4OA 4FUJA 4JK6A 1MTNC 2ZZUH 1C5XB 1BHXB 1GBFA 3I77A 1DVAH 1KLTA 4ZXXH 2Y81A 3TK5A 1G30B 5EPNA 3ZZ3A 1Z7KA 4BAQB 3SQHE 5C3NA 1DY8A 2BOKA 3A88A 3DFJA 2Y5HA 4DGJA 2Z9JA 1EUFA 2LNCA 2ZFSA 4A92A 1BTUA 2V6NA 3QGJA 3NZIA 3HGNA 3ZVBA 3M37A 2AEIH 1SQAA 1YPJH 2B9LA 3EA8A 3C1KA 1HIAB 3HKJB 3KQBA 3SJIA 3ZYEA 1ELTA 5ABWA 1O5GH 2WPJS 4A5TS 2J94A 2BLWA 1AIXH 1MUEB 1W10U 4BTTB 3O8RA 1C4Y2 1FIZA 1ZR0A 1DDJA 1O38A 2ZFTA 1IQGA 4U30A 4KTSA 1SPJA 2AH4X 3UIRA 2BD5A 4NIVA 3EAJA 1HBTH 1L4DA 1UVOA 2ZCKP 1G2MA 1NC6A 3PB1E 1VR1H 3G01A 4MPWA 1Z71A 2BLQA 3P8NA 1EAIA 1WQSA 2FI3E 2ZU2A 1LQEA 3MFJA 4RSPA 3GCOA 2W7UA 3HKIB 4VGCC 1SGQE 1FAXA 2ZKSA 2BY8X 2XXLA 3B23B 4WY3A 4BANB 3TGIE 1AZ8A 2A1DB 1AD8H 2ZHEH 4OGXA 1A61H 4Y6DA 2VINA 3GY4A 3PM3A 1XVOA 5GXPA 7GCHF 1O33A 1BQYA 2QAAA 1C5YB 1GBJA 3SQEE 3UREA 1YPKH 2VIPA 1AFQB 4MPXA 1C5QA 1TOMH 1SFIA 4IN1A 3NUMA 1GGDB 1Z1JA 2Y5GA 1Z1IA 1ZRBA 3RXMA 4NSYA 1P57B 1LHCH 1GBCA 2ZU5A 2XCNA 3S7HB 1FY8E 3RXCA 1O3LA 5I25A 1SOTA 2TIOA 1UTPA 5EW2H 1BTYA 1ELBA 1ELFA 2BDYA 4AYVB 2A7HA 1AMHA 1GJ8B 1SC8U 2PUQH 1AVWA 1TQ7B 1TBZH 3RU4D 4RKOB 1HXFH 3W94A 2J92A 4CH8B 1QL7A 3MH6A 5E2OA 1GI9B 3SHAH 5T6GA 3SUFA 3LH3A 2FEQH 3TJNA 1UVSH 1VGCB 1AVGH 3F6UH 3RP2A 4Y10E 4A1TA 1HAPH 2GCTC 4AN7A 1YBWA 2A32A 2RCEA 2QA9E 2PWXA 1GDQA 2Z9LA 4I32A 4AOQA 2BY7X 3SUEA 5AFZH 3OSYA 2NU2E 4ZKSU 1FQ3A 1BHXF 4BAMB 5DKMA 2B8OH 4X1RU 2ZC9H 3F9EA 1CVWH 4SGAE 5JDUB 4CH2B 1V3XA 4Y7BA 3SNEA 3SU4A 2QV1A 1C5UA 1LCYA 2GCHG 1GJ9B 1GMDG 3S9CA 1KY9A 3SBKA 3RM2H 1E38B 1O5FH 1DFPA 1UTOA 1BITA 1GGDC 1YPEH 2FMJA 2BYAX 1YLDA 5FXLA 4D8NA 5HMAA 3F1SB 3GYMA 3BIVH 1CSOE 1MBQA 1TNIA 2FLRH 4YT7H 1O3DA 1Y5BT 1CHOG 1QQUA 2VVUA 3PTNA 3SNCA 2FX6A 2SFAA 4X2WA 5FHTA 2J38A 3RXVA 5PTPA 2XBWA 3K9XB 1O2VA 2BX3A 2OTVA 2ZECA 1CT0E 5C2ZA 2XBXA 3ZZBA 1WCZA 3TJOA 1FXYA 3GDVA 4GCHF 5EQSA 1Y5UT 1GBBA 1K1IA 4A6LA 1TMTH 4KGAA 7GCHG 4Z6AH 5A8ZA 1H8DH 1YCPH 1YGCH 2XCFA 2KAIA 5EODA 1PPFE 4B2CA 3QK1A 4R8TB 4K5ZA 2QF3A 3BTEE 1SGFG 4OS1A 2PSXA 3F68H 1ZPZA 1NRSH 1A46H 4DOQA 2XYAA 4FUFA 3PMJA 2ALVA 1K2I1 1TNKA 1ZHPA 2ANYA 2EA3A 4WJG2 2QXGA 1KXFA 1XKAC 2BD3A 1NS3A 1VITG 1C1RA 1MKWH 1T8MA 1CT4E 1WYKA 2QYIA 4X6PA 1IQFA 1P03A 3ZZ4A 1UTMA 2ZGHA 2BVSH 1AWFH 2O9QA 1QFKH 1QY6A 4YO9A 3A84A 2ODYB 1C1PA 1PPZA 2AGIX 1C5LH 1BTHH 3S0NA 1BOQA 3RXDA 2ZPSA 5FCRA 4E7NA 2ZDNA 1C2JA 3T27A 4ABJA 5DP3A 2UUKB 1MTVA 5FBIA 3ZVAA 2STAE 4O97A 2OQUA 1TPSA 1PYTD 3RC5A 1CGJE 1YYY1 1O5DH 1S85A 1XUGA 1CA0B 5DP8A 3AW1A 3SI3H 4OS5A 3TPIZ 3A7ZA 1C5PA 2UWPA 3E6PH 1AQ7A 1BMAA 2A4GA 2FYQA 4ISLA 2PV9B 1O2WA 1DUAA 1SGIB 2BXTH 1MTUA 2BD2A 4AB9A 1IQKA 1D6RA 2A2XH 3S9AA 1ELGA 2VWMA 1RIWC 3SJOA 4I8LA 3RXUA 1EJNA 2CN0H 1TB6H 4XBCA 3TGKE 4NIXA 4BXSA 1L1JA 1GI4A 4KTCA 2ZU1A 5DPAA 3QZRA 4YOGA 1A0LA 5B6OA 1HAGE 1W3CA 3BN9A 1OWEA 1UK3A 2Z94A 4XFQA 5BRRE 2WPLS 4NWLA 2ZA5A 1Q3XA 3AW0A 1A0JA 1FN6A 1QA0A 3S7KB 1QRWA 5FCKA 4U2WA 3URCA 4Y7AA 3LONA 2R0KA 1ZGIA 4Y8XA 2O8MA 5AHGH 3DA9B 4O03A 1QJ6B 1V2QT 3SORA 1SBWA 3TLOA 1C5NH 1YLCA 4WF8A 2WV5A 3MH7A 1MQ6A 3CS7A 5L2YH 1BTPA 1YPHC 2TBSA 1C1UH 5A09A 1TAWA 1KXAA 4E05H 2H9EH 3EE0B 1UMAH 1SOZA 1BMNH 2ZDVH 4NGAH 4WXIA 2D26C 4YTAA 1DLKB 2Q1JA 5TJXA 1P9SA 4CRGA 2R2WU 3ATKA 3RXGA 4IMZA 3RXEA 3ITIA 1O2OA 4IS5A 1GBKA 1GBLA 4FUCA 4NA9H 1RGQA 1SSXA 1UO6A 4ABFA 1CGHA 6ESTA 1V2LT 2ZHDA 1EASA 1TONA 3STIA 4Y71A 3MWIU 1O3BA 1IOEA 1S82A 4AX9H 1Z8IB 1FJSA 4LK4A 5F6MA 3E1XB 1J9CH 1TIOA 2QC2A 2XBVA 5EU8A 2HNTE 3U1IB 1GJ7B 2GCTB 1ZTLA 3UWJH 2VGCB 1ELCA 3D65E 1YM0A 2UUJB 2ZEBA 2EC9H 2FOFA 1O3FA 5AFYH 1ZPBA 3A89A 1BDAA 1JRTA 2BD7A 2ODQA 1XXFA 1BJVA 1ETRH 3JZ1B 3B9FH 1DLEA 2GV6A 2W26A 1F2SE 4B71A 3LJJA 3MTYA 4NWKA 2IN2A 3RMLH 1MAYA 1UTLM 3UUZA 2ZG0H 1GL0E 3F9GA 4I8HA 3STJA 5EPYA 1OP2A 2C8WB 2P93A 1BRCE 3HK6B 2NWNA 3VB6A 3U1JB 2GT8A 1GCDA 2R0LA 1SI5H 5GIBA 3RMMH 4MG3A 1HYLA 4ZAEA 1A3BH 2B5TB 1OKXA 4M7GA 1LVYA 1F0TA 1YKTA 2D8WA 1Y3XA 1GHAG 3ATIA 4FUIA 4CRCA 1ANEA 4DCDA 1CHGA 3SUGA 1UCYH 3BTKE 1P0SH 2A4RA 5JYIA 1P2KA 2A31A 4GAWA 5A8XA 3JZ2B 5HM9A 5C5NA 4FU7A 4GVUA 5HM2A 4ISHH 2JH0D 1HLTH 2GP9B 1FAKH 2ZO3H 4AGKA 1GHBF 1C5TA 1MKXH 2V35A 3KF2A 1SGTA 2H9HA 4GCHG 2P94A 2THFB 3MOCA 2I6QA 3BG4C 3L3TA 1O3CA 4MNVA 1C5WB 3QX5H 3QGNB 2ZF0H 4CRAA 3GY3A 1Y3WA 3LGWA 1UK4A 2F83A 1A2CH 3SV6A 2STBE 4X6MA 3PMHB 5A0CA 5E2PA 3ZZAA 1O2MA 3A7YA 3SZNA 4BXWA 3A80A 1ABJH 1U6QA 2FESH 3GCNA 5FPTA 1OYQA 4Q7XA 4E7RG 5EQRA 1GDNA 3M5NA 4QT8C 7KMEH 9LPRA 3M35A 1KIGH 3L6PA 1QL9A 1NU9A 4Q2KA 3RLWH 3LGVA 2PKSC 1OWHA 1JMOH 2CMYA 2J4IA 4ISIH 4UEHH 1NM6A 2RA3A 3WY8A 1ELAA 1D9IA 3VPKA 1PFXC 5JBAS 2P3TB 1VJ9U 1O3NA 2BDHA 4GUXA 2G00A 1G3EA 1HRTH 2HPQH 4UFDH 3LC3A 3SO3A 1O37A 2C90B 2PKSB 2HWLB 4XBBA 4DIIH 2PKAA 1G2LA 4X8VH 4O9VA 3C27B 1YCPM 3V3MA 1C1VH 2ZFFH 4WH8A 1HIAA 3U69H 1ZMJA 2A7CA 4TWWA 2FP7B 4MQAA 1P2OA 1V6DA 1CBWC 2R3YA 3FZZA 3SU5A 2ZFRH 1ZMLA 6CHAC 2P8OB 5DK1A 3H7TA 3ZV8A 1ZGVA 3AAUA 1C5VA 1O39A 1WUNH 2WUCA 2ALPA 2C8ZB 2R3UA 4A1VA 1RTLA 3BG4B 4K1SA 4TY6A 3QN7A 5EG4A 1O34A 3RXJA 1HJ9A 1P2JA 3EDXB 1GHXH 1SHYA 3RXLA 4HZHA 4FUBA 4FU9A 4Y8YA 1VCPA 2GMTB 2ZTYA 1MMJN 5DG6A 4H6TA 1PQ8A 1G3CA 2A45B 1GJCB 4HGCA 4JCNA 1AB9C 2J34A 2VWLA 3ZZ6A 3A86A 3E0NB 3RXOA 2SGQE 2OBOA 2ZTXA 5A0BA 1MKXK 4NZLA 5K7RA 3BTDE 3M3VA 1O2JA 1DWEH 1K21H 4KELA 3PROA 1UCYK 1FMGA 2BLVA 1C1OA 4BAOB 5HYOA 2P8OC 5J4SA 2PR3A 3HGPA 2IPHA 3MH5A 5DP5A 1RRKA 2D2DA 2FTMA 4ZKNU 3RXIA 1C4V2 1DSUA 3BF6H 1O2UA 1P10A 2IOTA 2PHBA 2XC4A 1SQTA 1CA8B 5T6FA 4IC6A 3ODDA 4YOIA 2VIWA 3SW2B 3SV8A 4K3JA 1TX7A 1AO5A 1O5EH 2VIDA 2Z3EA 3Q3YA 2FOHA 1D3DB 2G5VA 3KQEA 4BTIB 1GG6B 3SN8A 1GMDF 2GZ8A 3A82A 2P3UB 1VCQA 3SGBE 4ABHA 4O3TA 3MNXA 1DITH 1SLWB 1LVBA 2ZQ1A 1F5KU 3GICB 1C2HA 1GHYH 1ZHMA 3A85A 4UFFH 1SGEE 4NCYA 1BB0B 3LC5A 4ZMAH 1JIMA 1C1NA 1XM1A 1BUIA 1VITF 2FODA 1IHSH 1GMCF 2FOEA 1C5MD 1V2TT 5FPYA 3TK6A 1V2PT 1UVUH 3QZQA 3SU2A 3A7WA 3P8FA 4WMDA 1AWHB 1ZOMA 2R2MB 4UD9H 1KXDA 1NFWA 4UFGH 2ZWLH 1FY1A 4Z0KA 4ABGA 2WYGA 4SGBE 3RU4E 3LOXA 1UTJA 5T6DA 1V2NT 1W7XH 4K2YA 2GGVB 4MPUA 5ESTE 1F7ZA 4CHAB 3BSQA 3Q3KA 5A2MH 4K8BA 1SGCA 3GCHC 3PWBA 1CO7E 4ZXYH 1OOKB 3S9BA 4CR5A 2XWBI 3QDZB 3KL6A 2GVFA 2SGPE 1P9UA 3PYHA 1LVMA 2PW8H 4FXGH 1EPTC 1A1RA 3RXKA 1B7XB 4TPYA 1MCVA 3E90B 1O2SA 3F9FA 1EZXC 1QB1A 1SGPE 1TMBH 1P2MA 2ZHQH 1NRQH 4D7GA 1ZJDA 1OP8A 1ELEE 2WPHS 1LKBA 1D3TB 1O35A 5G4BA 1V2RT 5K0HA 3KNXA 1ELDE 1EKBB 3PTBA 1O2YA 2QIQA 2OC1A 1H4WA 4KKDA 3E91A 4MNXA 1JWTA 1UTNA 3DUXH 4I8JA 4ZHLU 5JBBS 3TH4H 2BOHB 1TGBA 3VB5A 2ZHWH 1ZTKA 1O2XA 2AFQB 7LPRA 5LPRA 2ZIQH 5FAHA 2VU8E 3UQOA 1H1BA 2XBYA 4NZQA 2ASUB 1UTKA 3SU1A 3RUOA 1DOJA 5J4QA 4LZ1H 4JZ1A 3A87A 1EXFA 5IYTA 3RXPA 2FOBA 2KAIB 2QXIA 1TNHA 5DGJA 5EQQA 3FANA 2W5EA 3HK3B 2PGQB 4UFEH 3MO3A 2QXHA 4D76A 1FUJA 1VGCC 1LHGH 1CT2E 1BRUP 2ZDKA 1IQLA 2ZQ2A 3MNCA 5HGGA 1QGFA 3QO6A 1GBHA 1S83A 1E35B 1SGRE 2GZ9A 2ULLA 3RMOH 2ZFQH 1CHOF 3RXBA 1G37A 1ESAA 1BIOA 3TU7H 5C1XA 1O2NA 2FI5E 2VVCA 1NFUA 2G4UA 2GV7A 1MZDA 4AORA 2Z6BD 1L1NA 1YPLH 1PPHE 1WBGB 4INLA 4ZROA 1TOCB 3E16B 2K1QA 2RG3A 1SL3A 1KSNA 2ZU4A 2GDEH 2PKAB 1AGJA 2ANMH 2XC5A 2HGTH 4FUDA 5CE1A 2BVXH 4OS6A 3MO9A 1QHRB 4FVDA 3P92A 3RM0H 2Y7ZA 3U98H 1MD8A 2JKHA 1TRMA 2Z9IA 1HB0B 1FI8A 1P06A 1TWXB 1Y5AT 2O8WA 3UOPA 3LGIA 1DT2A 3VGCC 2WYJA 1TBRH 1GBDA 3SGQE 2OD3B 5E0JA 5ETXA 4CBOA 3GCTG 4XSKU 4CREA 2TGAA 1O2RA 1SB1H 3SU0A 1YCPK 4AFQA 3GY8A 3ZVEA 7ESTE 4I33A 1O0DH 2BX4A 3Q77A 1S84A 1KDQB 3KCGH 2BY9X 1Q31A 1JOUB 1K1PA 4X2XA 4IGDA 4FUHA 2G4TA 2SNVA 3BTGE 1TGSZ 3NCLA 4MLFB 3NK8A 1AB9B 2FWWA 1GMHG 4K60A 1G3BA 4J2YB 1GI6A 5FX5A 3R0FA 1O2QA 1L4ZA 4OGYA 2ZHFH 3BTFE 3PV4A 2AGEX 4DW2U 3ODFA 5AF9H 1K1NA 1GMHF 4XBDA 1QNJA 2WPMS 3URDA 1FONA 5JB8S 4X8TH 1O2PA 2V3HH 1QJ1B 2VH6A 2TPIZ 3AASA 4HTCH 1EAXA 3K2UA 2J2UA 3TVJB 1RS0A 4D9RA 4YT6H 1IQJA 2UWLA 4IBLH 3UOUA 1A5GH 1OWDA 5H4IB 1WTGH 2Y80A 1HNEE 2R9PA 2H5DA 3MU1A 2AMQA 2F9BH 3A8AA 1O2TA 1T4VH 1TA6A 1V2OT 1ORFA 1WOFA 4TPIZ 2RA0A 4LXBH 1N8OC 2H5CA 8GCHF 1D3QB 2EI7A 4DY7B 5C67A 1MD7A 1QRXA 1AE8H 4LZ4B 1FPHH 1ZSLA 2PFEA 2H1UA 4X2VA 2WINI 4IC5A 2FX4A 4X6NA 2GT7A 3PLBA 3GY5A 1T8NA 1P2NA 4IMQA 1HCGA 1X7AC 1TNLA 1P2QA 3A7XA 2VGCC 1Z8JB 5EGMA 1E37B 3FVFB 4F49A 4X1SU 2A5AA 2WPIS 1AKSB 1AFEH 1C9TA 3KEEA 2ZNKH 4ISOA 3ATWA 3FAOA 4X1PU 2BQ7B 3SJKA 4ABEA 4FUGA 1GBAA 1P3EA 1ZTJA 1H9IE 1YPHE 1C1WH 1C1QA 2J9NA 1FV9A 1MZAA 1EB2A 3GISB 3U8OH 3EQ0H 2TGDA 1J15A 3U9AH 1H8IH 1C2LA 1W14U 1SQOA 2YNAA 2ZTZA 3NPSA 1OS8A 3M3TA 4OS4A 1GHWH 1TX8A 4HFPB 5E0HA 4Q7YA 2FOAA 4AG2A 4ABBA 1TX6A 2D1JA 2OXSA 3GCHB 4X1QU 3ZZ9A 4I8KA 1WV7H 2ZGBH 2HALA 3T62A 3GY6A 5GJ4B 3FFGA 1GDUA 1P09A 5I46H 1Y59T 2HPPH 3GDSA 6GCHG 1NTPA 4AFZA 1C2FA 2F9UA 3SHCH 1NU7B 3KGPA 1ACBE 3MU5A 2SNWA 3KHVA 3SNBA 3ZZCA 2DUCA 2C3SA 3UFAA 3D62A 5EOKA 2VNTA 1O2HA 3GDUA 3UNQA 3TK9A 5IDKA 1N8OB 2FS8A 2XNIA 1MTNB 1V2ST 1O3AA 2OC7A 1MTSA 3P95A 3SI4H 2YNBA 3OU0A 4IW4E 2Z7FE 3P17H 5JPMH 5F8TA 3VGCB 1RJXB 1PPCE 3ZV9A 4DJZB 2OLGA 1V2MT 4TY7A 1D3PB 1MH0A 1W11U 1IQIA 4B73A 2H6MA 1AE5A 1ID5H 2OINA 3BTQE 1KYNA 1OWJA 5LGOA 3I29A 4ZHAA 3ELAH 1EOLA 4B2BA 3FP8E 4FVBA 1ABIH 4X6OA 1GVKB 1PYTC 5LPEA 3M7TA 3ZYDA 3OY6U 3KQDA 1W0YH 3CP7A 1XUHA 3FZDA 1HAVB 3OX7U 3DD2H 4JYUH 1LHFH 2W3IA 2Y7XA 5DP7A 1A5HA 1SLXB 1LMWB 2FIRH 2P16A 1XUKA 1CA0C 1QR3E 1W7GH 1K28D 5TCCA 4R0IA 1P05A 1QB6A 8GCHG 1BBRE 2VJ1A 1EZUC 1GBTA 3TIUA 4X8SH 1BMMH 4K8YA 1LTOA 2PUXB 3MU4A 3SU6A 3NWUA 2AGGX 2XTTB 2BD8A 3UY9A 1CBWB 3EA9A 2B7DH 3N7OA 4ZUHA 1RFNA 3E8LA 1J17T 2CHAB 4DG4A 1O2LA 2WUBA 1TA2A 1C2KA 3LKWA 2BD9A 1FNIA 3LT3A 1TALA 3MU8A 4CRBA 3ZZ5A 3PLPA 1J16A 2F9VA 1ZMNA 3OY5U 2H9TH 1M9UA 5DP4A 1LPZB 1P02A 1TFXA 1THRH 3OYPA 3ATLA 1S5SA 5GPIB 2A0QB 3A8DA 2O8LA 3BTHE 1K22H 1DM4B 2F9NA 2OQ5A 3MI4A 3HPTB 1JBUH 4Y0YE 2Q6FA 1O3PB 2YOLA 3SV2H 4U32A 1IQMA 1HAZB 2QY0B 3U8RH 1O3EA 2DE9A 4I31A 1FPCH 4ABAA 1TABE 4K69A 3V12A 1HJAC 2NU0E 1IHTH 5SGAE 2XWAA 4YLUA 1CQQA 1F5LA 1L1GA 4U01A 1QBNA 1ZLRA 3E3TA 1EP6A 1SGFA 3ZVGA 1DXWA 5FPSA 1VITH 1OWIA 3I78A 1O36A 3A7TA 1EP5A 4DVAU 2G55A 2BMGB 4WWYA 2JH5D 3LH1A 2BY5X 2TRMA 1BTXA 1C5OH 1P04A 1A3EH 3EGKH 1T8OA 1P01A 1TPPA 1AKSA 1RD3B 5T3HA 1FIWA 1T32A 1O2IA 2H2ZA 3VFEA 1BBRH 1BA8B 1BCUH 5GCHG 2F91A 1BZXE 4X2YA 4DURA 1GI8B 1ESTA 1GVZA 1YF4A 2A4QA 1JRSA 1TPAE 3P70B 1AUJA 1IAUA 3UTUH 1ANBA 4NA8A 3A8CA 4JK5A 1TQ0B 2Z3DA 3FP7E 2AS9A 1KDQA 1DICA 1FN8A 5CHAC 1QTFA 3DT0H 1YP9A 1ZSKA 3T28A 2F9OA 2JETC 3L33A 4KP0A 4JZFH 1VJAU 4YOJA 3BTTE 4Q80A 2ODPA 1EJMA 2BDCA 1JIRA 5C20A 5JB9S 1K1LA 1PPBH 4CR9A 4INHA 2BHGA 2NU1E 3IG6B 2VB0A 1YPGH 1BBRK 4NA7A 2G5NA 3RXHA 2ZI2H 1V2JT 1Z8GA 4JZIA 1AUTC 2GTBA 3RLYH 3V7TA 2FYRA 1MU8B 4Y11E 3RU4T 2Z3CA 3P8GA 3GY7A 1PPEE 1LPGB 1QB9A 1THSH 2J95A 2VWOA 2AMPA 3MMGA 2QF0A 3OTJE 3PWCA 1XUFA 4NSVA 3BV9B 2C8YB 2FTLE 3MYWA 1NESE 1OPHB 5GDSH 5CHAB 1GHVH 4ASHA 5A0AE 1W0ZU 1SMFE 8LPRA 3RXFA 4K1TA 2VH0A 1N6YA 1D4PB 3BTWE 3SV9A 2CJIA 2AMDA 4J1YA 1SGYE 2VVVA 1ARCA 3QWCH 2UUYA 1NFXA 4WXVA 3KIDU 1SHHB 1OSSA 2XRCA 1THPB 1WAYB 1KTSB 1P11E 3M7QA 3SV7A 2QXJA 2XC0A 2DE8A 3F9HA 3O8BA 2WPKS 1GJBB 4B1TA 3UQVA 1HAVA 1F0SA 2I6SA 1MTWA 1TLDA 1TRYA 2Q6DA 3T2NA 4OS7A 2AERH 4OS2A 2JETB 3LJOA 1C4U2 1PJPA 2JH6D 2RDLA 1O3MA 3MNBA 3KN2A 2G51A 1B5GH 4GPGA 2A2QH 3UPEA 3SJ8A 3TJUA 2FM2A 4WH6A 3ZVFA 1T31A 4NG9H 2EI6A 2ZU3A 3ENSB 3MNSA 2BQ6B 4I8GA 2BDIA 4MTBA 4Y76A 3W95A 3BEFB 1GMCG 2OC0A 4H6SB 2GDDA 1DWCH 1T8LA 2UWOA 1S0RA 1TE0A 3VB3A 1E34B 3V0XA 1RIWB 3QTOH 2CF8H 4CHAC 2Z9GA 3ZVCA 1F0UA 2VIOA 2ZGXH 1IQHA 1ESBA 1HJ8A 3T29A 2A5KA 2LPRA 2GMTC 3CENA 1AVXA 3PO1B 1TGTA 3DHKH 3M5LA 1N1LA 3MO6A 1G36A 1MKWK 1C2DA 3D23A 3HATH 2FO9A 2Y6TA 1O2GH 1TMUH 2F9PA 1NRPH 5AVDA 3GYLB 4AYYB 4Y8ZA 1TNJA 1EZQA 5JBTA 1FY5A 2W3KA 4BTUB 2BB4A 4Y0ZE 3SNDA 5DO4H 3K6ZA 3NKKA 1SR5C 4Q7ZA 3BG8A 1QURH 2A5IA 4CRFA 1KXCA 4YZUA 3QTVH 2BQWB 2FI4E 2V3OH 2M5TA 1NFYA 2BTCE 1EPTB 2GX4A 4A1XA 1GHZA 2PGBB 2B0FA 1S0QA 4GHTA 1LDTT 1TYNA 4AG1A 3T25A 3EA7A 1LO6A 1EB1H 3GY2A 3PO1C 3LU9B 4HI3A 4B75A 2TGTA 1GJAB 1EJAA 1C5ZB 4JYVH 2CHAC 1F0RA 1FZZA 3RC4A 3Q00A 1GI5A 4XOJA 4XE4A 4CBNA 2PLXA 1AFQC 1C5SA 1C5RA 6LPRA 2OBQA 2AYWA 3H7OA 3NXPA 2P59A 1QIXB 3VB4A 4FU8A 1E36B 1SVPA 2ZFPH 4ABDA 4YESB 1WQVH 1C1MA 2HOBA 4AFSA 5JBCS 1QCPA 1YPMH 1XUIA 1VZQH 4B74A 2EEKA 1O2ZA 1MCTA 3RDZA 3RXAA 1UHBA 5E0GA 1KXBA 5CMXH 1N6XA 1HUTH 5F8XA 2FOGA 2ZPRA 2NU4E 1NO9H 2BDGA 1LQDB 3RC6A 2BD4A 4BOHA 2ZGJA 4GHQA 1AHTH 1S6FA 3QLPH 1GVLA 4ESTE 1HAIH 1DSTA 1ETSH 2FPZA 1GHBG 1P12E 4Y79A 1ZYOA 3BEIB 5A8YA 4O3UA 1OYTH 1ZJKA 1DPOA 4TYDA 1DX5M 4WVPE 2VWNA 2W7SA 1T4UH 5EXMA 3UNRA 1VCWA 1CE5A 4THNH 4FUEA 1DWBH 1NRRH 4MPVA 2ZP0H 2Y82A 3ESTA 3RXTA 1TNGA 3TGJE 4IN2A 2FS9A 1ZZZA
chains in the Genus database with same CATH superfamily
1DUEA 1ZHRA 3BTME 1P2IA 1TPOA 1WTHD 1QBOA 1NRNH 5L6NH 3QUMP 1EAWA 2ZDAH 1TBQH 3LIWA 2EY4C 2V3MA 1UHBB 3IITA 3H5CB 3DSOA 2ANWA 2VIQA 4I7YH 9ESTA 2CV3A 1XKBC 2PTNA 1LHEH 3UNSA 1E0FD 1EPTA 3V13A 1NBME 1SGNE 4B76A 1HDTH 1GBMA 3K65B 3SGAE 4GLYA 2YMSD 3U8TH 4ZKOU 1GJ4H 3S69A 2OCVB 5C1YA 5GCHF 4CRDA 1BMLA 2VBCA 1Y3UA 1O3GA 1OXGA 3T26A 1PQ5A 2C4FH 2CGAA 2ESTE 1S81A 1S6HA 3UR9A 1DE7H 2OP9A 2GZ7A 3O8DA 4ZKRU 2HLCA 4ISNA 3LDXH 2ZCHP 1C2IA 2ILNA 4WMEA 1AI8H 4PROA 1KTTB 2P95A 1W8BH 1A0HB 2VIVA 2FOMB 2ZGCA 1G9IE 1Z6JH 1O3KA 1DANH 3AVZA 5DJ7A 1PQ7A 1HAOH 3TJVA 1GHAF 1QA7A 1LHDH 1OWKA 3CS0A 4XDEA 1T7CA 3P8OA 1OP0A 1GJ5H 2O8UA 5LH8A 5CHBA 2EI8A 1C1SA 1NN6A 5C5OA 2FZZA 1QBVH 3PV5A 3RXRA 1LPKB 3PLKA 5FBEA 2OUAA 1A7SA 1UTQA 4X8UH 1P3CA 2ZPQA 1W2KH 1HFDA 5F53A 3RXQA 1EOJA 5F03A 1C2EA 3MH4A 1GBIA 4GSOA 2CXVA 3ZZ7A 3LGUA 5HXFA 4RT0A 2V0BA 4WMFA 1K1JA 1C2GA 1TRNA 1ZRKA 2QGRA 5BPEA 2SGFE 1FY4A 1SG8B 1G3DA 1MU6B 1ETTH 3VXFH 2ZDMA 3K6YA 1NPMA 3MHWU 1PQAA 1QQ4A 1W12U 2C8XB 1DY9A 1F92A 1K1MA 1O31A 4UONA 4BNRA 1WDIA 3SU3A 1O3IA 1UCYE 2HVXA 1HV7A 5E8EH 1GWAA 1IQEA 1ANDA 2FXRA 1H9LB 3DFLA 3M5MA 1UVPA 1AY6H 1O30A 5EXLA 1TGNA 4AZ2B 4DT7B 1ZSJA 1EX3A 1DWDH 3IWMA 5C1UA 1IQNA 3RXSA 1D6WA 2GKVE 2IJOB 2LELA 4D9QA 1CU1A 1EATA 3LPRA 2ANKH 1V2UT 1RTKA 2KFWA 1ZPCA 1HJAB 3M7UA 1GL1A 3GOVB 4X1NU 1O32A 1ANCA 2OC8A 1FLEE 1KXEA 1QJ7B 3Q3XA 1G32B 1A4WH 3EYDA 1EQ9A 1KLJH 1KLIH 4MVNA 2Q6GA 1WSSH 4JZEH 5EW1H 2O8TA 1Y8TA 2A7JA 1Z6EA 1Y3YA 3FOAA 1GI3A 2KCPA 1GI0A 2GCHF 4RKJB 2AIPA 4ACAA 1O3HA 4AGJA 1GI1A 1DXPA 2BDBA 1GPZA 3BIUH 3UR6A 2UUFB 1FDPA 4P02A 1HAXB 1BTWA 4NFFA 1GJDB 1DS2E 3UWIA 1ARBA 2PTCE 1TGCA 2FOCA 3E0PB 3M36A 4TSFD 4K1EA 5ESBA 1V2KT 1A5IA 4RN6A 1PPGE 2GD4B 1YC0A 2BLOA 3AAVA 4INKA 4MNYA 1BT7A 2FDAA 2BY6X 3SUDA 1LVOA 3R3GB 3WWFA 3RMNH 1RTFB 1XX9A 1XUJA 3TH2H 4E06H 4YM9A 1BJUA 1MAXA 3F2FA 1B0EA 1OX1A 1UJ1A 4M9FA 4NIYA 1MBMA 4ABIA 2WV9A 4TWYA 2BM2A 2G52A 4F55A 1C2MA 3M5OA 2SGDE 4X0WU 3P6ZB 2ZCLP 3TNSA 3A7VA 1NZQH 3SNAA 1SLUB 6CHAB 8ESTE 4JYTA 1UVTH 1F5RA 2BDAA 4F4OC 3BEUA 5DP9A 5TCAA 1SLVB 2BVRH 1O5AB 3M61U 6GCHF 1XMNB 1ELVA 1UK2A 2F43B 5L30H 3LGYA 1JXPA 1O3JA 4NFEA 3ZVDA 1B0FA 3PMAB 3ATMA 4LOYH 1AU8A 1BRBE 2SGAA 2ZDLA 4VGCB 1L0ZA 1E79D 1O3OA 2NU3E 4UE7H 3ZZDA 1J14A 1XXDA 1NROH 3TITA 5CDFE 1QL8A 1W13U 1V2WT 4MDSA 2F3CE 1HPGA 1NT1A 4BAKB 1AZZA 3FN8A 3A83A 1RXPA 1HAYB 1XVMA 3D49H 3O8CA 1O2KA 2XNDD 5DP6A 4ZH8A 1EAUA 4AFUA 4KTUA 2Z9KA 3A81A 1BRAA 1MQ5A 1V2VT 2OK5A 3M3SA 4YLQH 1QRZA 1HGTH 3ZZ8A 2G8TA 1Q2WA 4DIHH 2GJGA 3KQCA 1NY22 5GWZA 1SKYE 3MU0A 5LPFA 3VB7A 2P3FH 1Z8RA 2WV4A 2PSYA 3Q76A 1O5CB 3PMBB 4JMYA 1CGIE 1WU1A 4MNWA 2AIQA 2BXUH 1EZSC 1K9OE 2HRVA 1FY3A 3TNTA 3T5FH 3VEQB 1O5BB 2HNTC 1W0JD 1P8VC 4JZDH 1GJ6A 4H42U 5F8ZA 1SGDE 4ZHMU 2BZ6H 3SOSA 2CF9H 1EFRD 2QN5T 1C9PA 8KME2 4H4FA 4NIWA 1INCA 4B2AA 1K1OA 1HAHH 1GI7B 1H9HE 1S6LA 2HNTF 1GCTB 1GCTC 1LKAA 3A8BA 2KR7A 3TH3H 3VXEH 3LGTA 2G81E 2SGEE 5EXNA 3FP6E 2BZAA 4D7FA 1J8AA 1HXEH 2XW9A 2QCYA 3SJ9A 4BAHB 5FX6A 1C1TA 4UDWH 1SFQB 1L2EA 1AN1E 1GBEA 3KQ5A 4AB8A 1Y3VA 3B8JA 1GI2A 4XD7D 5L2ZH 2Y5FA 2TGPZ 2C93B 3GCTF 1BTZA 2FLBH 1GG6C 4A7IB 2A4OA 4FUJA 4JK6A 1MTNC 2JIZD 2ZZUH 1C5XB 1BHXB 1GBFA 3I77A 1DVAH 1KLTA 4ZXXH 2Y81A 3TK5A 1G30B 5EPNA 3ZZ3A 1Z7KA 4BAQB 3SQHE 5C3NA 1DY8A 2BOKA 3A88A 3DFJA 2Y5HA 4DGJA 2Z9JA 1EUFA 2LNCA 2ZFSA 4A92A 1BTUA 2V6NA 3QGJA 3NZIA 3HGNA 3ZVBA 3M37A 2AEIH 1SQAA 1YPJH 2B9LA 3EA8A 3C1KA 4Q63A 4P00A 1HIAB 3HKJB 3KQBA 3SJIA 3ZYEA 1ELTA 3PRBA 5ABWA 1O5GH 2WPJS 4A5TS 2J94A 2BLWA 1AIXH 1MUEB 1W10U 4BTTB 3O8RA 1C4Y2 1FIZA 1ZR0A 1DDJA 1O38A 2ZFTA 1IQGA 4U30A 4KTSA 1SPJA 2AH4X 3UIRA 2BD5A 3SZEA 4FETA 4NIVA 3EAJA 1HBTH 1L4DA 1UVOA 2ZCKP 1G2MA 1NC6A 3PB1E 1VR1H 3G01A 4MPWA 1Z71A 2BLQA 3P8NA 5KECA 1EAIA 1WQSA 2FI3E 2ZU2A 1LQEA 3OTPA 3MFJA 4RSPA 3GCOA 2W7UA 3HKIB 4VGCC 1SGQE 1FAXA 2ZKSA 2BY8X 2XXLA 3B23B 4WY3A 4BANB 3TGIE 5FL7D 1AZ8A 2A1DB 1AD8H 2ZHEH 4OGXA 1A61H 4Y6DA 2VINA 3GY4A 3PM3A 1XVOA 5GXPA 5HIZA 7GCHF 1O33A 1BQYA 2QAAA 1C5YB 1GBJA 3SQEE 2QE7D 3UREA 1YPKH 2VIPA 1AFQB 4MPXA 1C5QA 1TOMH 1SFIA 4IN1A 3NUMA 1GGDB 2W6JD 2RFKC 1Z1JA 2Y5GA 1Z1IA 1ZRBA 3RXMA 4NSYA 1P57B 1LHCH 3GS9A 1GBCA 2ZU5A 2XCNA 3S7HB 1FY8E 3RXCA 1MABB 1O3LA 5I25A 3CNRA 1SOTA 2TIOA 1UTPA 5EW2H 1BTYA 1ELBA 1ELFA 2BDYA 4AYVB 2A7HA 1AMHA 2V7QD 1GJ8B 1SC8U 2PUQH 1AVWA 1TQ7B 1TBZH 3RU4D 4RKOB 1HXFH 3W94A 2J92A 4CH8B 1QL7A 3MH6A 5E2OA 1GI9B 3SHAH 5T6GA 3SUFA 3LH3A 2FEQH 1E1QD 3TJNA 1UVSH 1VGCB 1AVGH 3F6UH 3RP2A 4Y10E 4A1TA 1HAPH 2GCTC 4AN7A 1YBWA 2A32A 2RCEA 2QA9E 2PWXA 1GDQA 2Z9LA 4I32A 4AOQA 2BY7X 3SUEA 5AFZH 3OSYA 2J98A 2NU2E 1YWUA 4ZKSU 1FQ3A 1BHXF 4BAMB 5DKMA 2B8OH 4X1RU 2J98B 2ZC9H 3F9EA 1CVWH 4SGAE 5DSFA 5JDUB 3PV2A 4CH2B 1V3XA 4Y7BA 3SNEA 3SU4A 2QV1A 2F4LA 2WZQA 1C5UA 1LCYA 2GCHG 1GJ9B 1GMDG 3S9CA 1KY9A 3SBKA 3RM2H 1E38B 1O5FH 1DFPA 1UTOA 1BITA 1GGDC 1YPEH 2FMJA 1BMFD 2BYAX 1YLDA 5FXLA 4D8NA 5HMAA 3F1SB 3GYMA 3BIVH 1CSOE 1MBQA 1TNIA 2FLRH 4YT7H 1O3DA 1Y5BT 1CHOG 1QQUA 2VVUA 3PTNA 3SNCA 2FX6A 2SFAA 4X2WA 5FHTA 2J38A 3RXVA 5PTPA 2XBWA 3K9XB 1O2VA 2BX3A 2OTVA 2ZECA 1CT0E 5C2ZA 2XBXA 3ZZBA 1WCZA 3TJOA 1FXYA 3GDVA 4GCHF 5EQSA 1Y5UT 1GBBA 1K1IA 4A6LA 1TMTH 4KGAA 7GCHG 4Z6AH 5A8ZA 1H8DH 1YCPH 1YGCH 2XCFA 2KAIA 5EODA 1PPFE 4B2CA 3QK1A 4R8TB 4K5ZA 2QF3A 3BTEE 1SGFG 4OS1A 2PSXA 5HIYA 3F68H 1ZPZA 1NRSH 1A46H 4DOQA 3F2GA 2XYAA 4FUFA 3PMJA 2ALVA 1K2I1 1TNKA 1ZHPA 2ANYA 2EA3A 4WJG2 2QXGA 1KXFA 1XKAC 2BD3A 1NS3A 1VITG 1C1RA 1MKWH 1T8MA 1CT4E 1WYKA 2QYIA 4X6PA 1IQFA 1P03A 3ZZ4A 1UTMA 2ZGHA 2BVSH 3DSGA 1AWFH 2O9QA 1QFKH 1QY6A 4YO9A 3A84A 2ODYB 1C1PA 1PPZA 2AGIX 2L6OA 1C5LH 1BTHH 3S0NA 1BOQA 3RXDA 4FOUC 2ZPSA 5FCRA 4E7NA 2ZDNA 1C2JA 3T27A 4ABJA 5DP3A 2UUKB 1MTVA 5FBIA 3ZVAA 2STAE 4O97A 2OQUA 1TPSA 1PYTD 3RC5A 1CGJE 1YYY1 1O5DH 1S85A 1XUGA 1CA0B 2L74A 5DP8A 3AW1A 3SI3H 4OS5A 3TPIZ 2IJD1 3A7ZA 1C5PA 2UWPA 3E6PH 1AQ7A 1BMAA 2A4GA 2FYQA 4ISLA 2PV9B 1O2WA 1DUAA 1SGIB 2BXTH 1MTUA 2BD2A 4AB9A 1IQKA 1D6RA 1WXRA 1K0HA 2A2XH 3S9AA 1ELGA 2VWMA 1RIWC 3SJOA 4I8LA 3RXUA 1EJNA 2CN0H 1OHHD 1TB6H 4XBCA 4NIXA 5DN6D 3TGKE 4BXSA 1L1JA 1GI4A 4KTCA 2ZU1A 5DPAA 3F0OA 3QZRA 4YOGA 1A0LA 5B6OA 1HAGE 1W3CA 3BN9A 1OWEA 1UK3A 2Z94A 4XFQA 5BRRE 2WPLS 4NWLA 2ZA5A 1Q3XA 3AW0A 1A0JA 1FN6A 1QA0A 4ACBA 3S7KB 1QRWA 5FCKA 4U2WA 3URCA 4Y7AA 3LONA 2R0KA 1ZGIA 4Y8XA 2O8MA 5AHGH 3DA9B 4O03A 1QJ6B 1V2QT 3SORA 1SBWA 3TLOA 1C5NH 1YLCA 4WF8A 2WV5A 3MH7A 1MQ6A 3CS7A 5L2YH 1BTPA 1YPHC 2TBSA 1C1UH 5A09A 1TAWA 1KXAA 4E05H 2H9EH 3EE0B 1UMAH 1SOZA 1BMNH 2ZDVH 4NGAH 4WXIA 2D26C 4YTAA 1DLKB 2Q1JA 5TJXA 1P9SA 4CRGA 2R2WU 3ATKA 3RXGA 4IMZA 3RXEA 3ZIAD 3ITIA 1O2OA 4IS5A 1GBKA 1GBLA 4FUCA 4NA9H 1RGQA 1SSXA 1UO6A 4ABFA 1CGHA 6ESTA 1V2LT 2ZHDA 1EASA 1TONA 3STIA 4Y71A 3MWIU 1O3BA 1IOEA 1S82A 3F0PA 4AX9H 1Z8IB 1FJSA 4LK4A 5F6MA 3E1XB 1J9CH 1TIOA 2QC2A 2XBVA 5EU8A 2HNTE 3U1IB 1GJ7B 2GCTB 1ZTLA 5EIYA 3UWJH 2VGCB 1FX0B 3KYFA 1ELCA 3D65E 1YM0A 2UUJB 2ZEBA 2EC9H 2FOFA 1O3FA 5AFYH 1ZPBA 3A89A 1BDAA 1JRTA 2BD7A 2ODQA 1XXFA 1BJVA 1ETRH 3JZ1B 3B9FH 1DLEA 2GV6A 2W26A 1F2SE 4B71A 3LJJA 3MTYA 4NWKA 2IN2A 3RMLH 1MAYA 1UTLM 3UUZA 2ZG0H 1GL0E 3F9GA 4I8HA 3STJA 5EPYA 1OP2A 2C8WB 2P93A 1BRCE 3HK6B 2NWNA 3VB6A 3U1JB 2GT8A 1GCDA 2R0LA 1SI5H 5GIBA 3RMMH 4MG3A 1HYLA 4ZAEA 1A3BH 2B5TB 1OKXA 4M7GA 1LVYA 1F0TA 1YKTA 2D8WA 1Y3XA 1GHAG 3ATIA 4FUIA 4CRCA 1ANEA 4DCDA 1CHGA 4B6EA 3SUGA 1UCYH 3BTKE 3H09A 1P0SH 2A4RA 5JYIA 1P2KA 2A31A 4GAWA 5A8XA 3JZ2B 5HM9A 5C5NA 1NBMD 4FU7A 4GVUA 5HM2A 4ISHH 2JH0D 1HLTH 2GP9B 1FAKH 2ZO3H 4AGKA 5B6LA 1GHBF 5C17A 1C5TA 1MKXH 2V35A 3KF2A 1SGTA 2H9HA 4GCHG 2P94A 2THFB 3MOCA 2I6QA 3BG4C 3L3TA 1O3CA 4MNVA 1C5WB 3QX5H 3QGNB 1H8HD 2ZF0H 4CRAA 3GY3A 1Y3WA 3LGWA 1UK4A 2F83A 1A2CH 3SV6A 2STBE 2K8IA 4X6MA 3PMHB 5A0CA 5E2PA 3ZZAA 1O2MA 3A7YA 3SZNA 4BXWA 3A80A 1ABJH 1U6QA 2FESH 3GCNA 5FPTA 1OYQA 4Q7XA 4E7RG 5EQRA 1GDNA 3M5NA 4QT8C 7KMEH 9LPRA 3M35A 1KIGH 3L6PA 1QL9A 1NU9A 4Q2KA 3RLWH 3LGVA 2PKSC 1OWHA 1JMOH 2CMYA 2J4IA 4ISIH 4UEHH 1NM6A 2RA3A 2KZ4A 1ELAA 1D9IA 3WY8A 3VPKA 3F2HA 1PFXC 5JBAS 2P3TB 1VJ9U 1O3NA 2BDHA 4GUXA 2KX4A 2G00A 3U28C 1G3EA 3EE7A 1HRTH 2HPQH 4UFDH 3LC3A 3SO3A 1O37A 2C90B 2PKSB 2HWLB 2W6ID 4XBBA 2PKAA 5HKKD 4DIIH 1G2LA 4X8VH 4O9VA 3C27B 1YCPM 3V3MA 1C1VH 2ZFFH 4WH8A 1HIAA 3U69H 1ZMJA 2A7CA 4TWWA 2FP7B 4MQAA 1P2OA 1V6DA 4ZCNA 1CBWC 2R3YA 3FZZA 3SU5A 2ZFRH 1ZMLA 6CHAC 2P8OB 5DK1A 5C0TA 3H7TA 3ZV8A 1ZGVA 3AAUA 1C5VA 1O39A 1WUNH 2WUCA 2ALPA 2C8ZB 2R3UA 4A1VA 1RTLA 3BG4B 4K1SA 4TY6A 3QN7A 5EG4A 1O34A 3RXJA 1HJ9A 1P2JA 3EDXB 1GHXH 1SHYA 3RXLA 4HZHA 5KEDA 4FUBA 4FU9A 4Y8YA 1VCPA 2GMTB 2ZTYA 1MMJN 5DG6A 4H6TA 2KM0A 1PQ8A 1G3CA 3WW7A 2A45B 1GJCB 1W0KD 4HGCA 4JCNA 5EJZA 1AB9C 2J34A 2VWLA 3ZZ6A 3A86A 3E0NB 3RXOA 2SGQE 2OBOA 2ZTXA 5A0BA 1MKXK 4NZLA 5K7RA 3BTDE 3M3VA 3W1EA 1O2JA 1DWEH 1K21H 4KELA 3PROA 1UCYK 1FMGA 2BLVA 1C1OA 4BAOB 5HYOA 2P8OC 5J4SA 2PR3A 3HGPA 2IPHA 3MH5A 5DP5A 1RRKA 2D2DA 2FTMA 4ZKNU 3RXIA 3OE7D 4XRNA 1C4V2 1DSUA 3BF6H 1O2UA 1P10A 2IOTA 2PHBA 2XC4A 1SQTA 1CA8B 5T6FA 4IC6A 3ODDA 5IK2D 4YOIA 2VIWA 3SW2B 3SV8A 4K3JA 1TX7A 1AO5A 1O5EH 2VIDA 2Z3EA 3Q3YA 2FOHA 1D3DB 2G5VA 3KQEA 4BTIB 1E1RD 1GG6B 3SN8A 1GMDF 2GZ8A 3A82A 2P3UB 1COWD 1VCQA 3SGBE 4ABHA 4B6FA 1UW7A 4O3TA 3MNXA 1DITH 1SLWB 1LVBA 2ZQ1A 1F5KU 3GICB 1C2HA 1GHYH 1ZHMA 3A85A 4UFFH 1SGEE 4NCYA 1BB0B 3LC5A 4ZMAH 1JIMA 1C1NA 1XM1A 1BUIA 1VITF 2FODA 1IHSH 1GMCF 2FOEA 1C5MD 1V2TT 5FPYA 3TK6A 1V2PT 1UVUH 3QZQA 3SU2A 3A7WA 3P8FA 2KCYA 4WMDA 1AWHB 1ZOMA 4ASUD 2R2MB 4UD9H 1KXDA 1NFWA 4UFGH 2ZWLH 1FY1A 4Z0KA 4ABGA 2WYGA 4SGBE 3RU4E 3LOXA 1UTJA 5T6DA 1V2NT 1W7XH 4K2YA 2GGVB 4MPUA 5ESTE 1F7ZA 4CHAB 3BSQA 3Q3KA 5A2MH 4K8BA 1SGCA 3GCHC 3PWBA 1CO7E 4ZXYH 2RDEA 1OOKB 3S9BA 4CR5A 2XWBI 3QDZB 3KL6A 2GVFA 2SGPE 1P9UA 3PYHA 1LVMA 2PW8H 4FXGH 1EPTC 1A1RA 3RXKA 1B7XB 4TPYA 1MCVA 3E90B 1O2SA 3F9FA 1EZXC 1QB1A 1SGPE 1TMBH 1P2MA 2ZHQH 1NRQH 4D7GA 1ZJDA 1OP8A 1ELEE 2WPHS 1LKBA 1D3TB 1O35A 5G4BA 1V2RT 5K0HA 3KNXA 1ELDE 1EKBB 3PTBA 1O2YA 2QIQA 2OC1A 1YY3A 1H4WA 3SYJA 4KKDA 3E91A 4MNXA 1JWTA 1UTNA 3DUXH 4I8JA 4ZHLU 5JBBS 3TH4H 2BOHB 1TGBA 3VB5A 2ZHWH 5EJLA 1ZTKA 1O2XA 2AFQB 7LPRA 5LPRA 2ZIQH 5FAHA 2VU8E 3UQOA 1H1BA 3KYGA 2XBYA 4NZQA 2ASUB 1UTKA 3SU1A 3RUOA 1DOJA 5J4QA 4LZ1H 4JZ1A 3A87A 1EXFA 5IYTA 3RXPA 2FOBA 2KAIB 2QXIA 1TNHA 5DGJA 5EQQA 3OFND 3FANA 2W5EA 3HK3B 2PGQB 4UFEH 3MO3A 2QXHA 4D76A 1FUJA 1VGCC 1LHGH 1CT2E 1BRUP 2ZDKA 1IQLA 2WPDD 2ZQ2A 3MNCA 5HGGA 1QGFA 3QO6A 1GBHA 1S83A 1E35B 1SGRE 4YXWD 2GZ9A 2ULLA 3RMOH 2ZFQH 1CHOF 3RXBA 1G37A 1ESAA 1BIOA 3TU7H 5C1XA 1O2NA 2FI5E 2VVCA 1NFUA 2G4UA 2GV7A 1MZDA 4AORA 4Q4LA 2Z6BD 1L1NA 1YPLH 1PPHE 1WBGB 4INLA 4ZROA 1TOCB 3E16B 2K1QA 2RG3A 1SL3A 1KSNA 2ZU4A 2QF4A 2GDEH 2PKAB 1AGJA 2ANMH 2XC5A 2HGTH 4FUDA 5GNDA 2BVXH 4OS6A 5CE1A 3MO9A 1QHRB 4FVDA 3P92A 3RM0H 2Y7ZA 3U98H 1MD8A 2JKHA 1TRMA 2Z9IA 1HB0B 1FI8A 1P06A 1TWXB 1Y5AT 2O8WA 3UOPA 3LGIA 1DT2A 3VGCC 2WYJA 1TBRH 1GBDA 3SGQE 2OD3B 5E0JA 5ETXA 1QZ8A 4CBOA 3GCTG 4XSKU 4CREA 2TGAA 1O2RA 1SB1H 3SU0A 1YCPK 4AFQA 3GY8A 2HLDD 3ZVEA 7ESTE 4I33A 1O0DH 2BX4A 2WHXA 3Q77A 1S84A 1KDQB 3KCGH 2BY9X 1Q31A 1JOUB 1K1PA 4X2XA 4IGDA 4FUHA 3OAAD 2G4TA 2SNVA 3BTGE 1TGSZ 3NCLA 4MLFB 3NK8A 1AB9B 2FWWA 1GMHG 4K60A 1G3BA 4J2YB 1GI6A 5FX5A 3R0FA 1O2QA 1L4ZA 4OGYA 3FO8D 2ZHFH 3BTFE 3PV4A 2AGEX 2J5UA 4DW2U 3ODFA 5AF9H 1K1NA 1GMHF 4XBDA 1QNJA 2WPMS 3URDA 1FONA 2YMSB 4X8TH 5JB8S 1O2PA 2V3HH 1QJ1B 2VH6A 2TPIZ 3AASA 4HTCH 1EAXA 3K2UA 2J2UA 3TVJB 1RS0A 4D9RA 4YT6H 1IQJA 3WWBA 2UWLA 4IBLH 3UOUA 1A5GH 1OWDA 5H4IB 1WTGH 2Y80A 1HNEE 2R9PA 2H5DA 3MU1A 2AMQA 2F9BH 3A8AA 1O2TA 1T4VH 1TA6A 1V2OT 1ORFA 2M2AA 1WOFA 4TT3D 4TPIZ 2RA0A 4LXBH 1N8OC 2H5CA 8GCHF 1D3QB 4DT4A 2EI7A 4DY7B 5C67A 1MD7A 1QRXA 1AE8H 4LZ4B 1FPHH 1ZSLA 2PFEA 2H1UA 4X2VA 2WINI 4IC5A 2FX4A 4X6NA 2GT7A 3PLBA 3GY5A 1T8NA 1P2NA 4IMQA 1HCGA 1X7AC 1TNLA 1P2QA 3A7XA 2VGCC 1Z8JB 2KCOA 5EGMA 1E37B 3FVFB 4F49A 4X1SU 2A5AA 2WPIS 1AKSB 1AFEH 1C9TA 3KEEA 2ZNKH 4ISOA 3ATWA 3FAOA 4X1PU 2BQ7B 3SJKA 3VG8A 4ABEA 4FUGA 1GBAA 1P3EA 1ZTJA 1H9IE 1YPHE 1C1WH 1C1QA 2J9NA 1FV9A 1MZAA 1EB2A 3GISB 3U8OH 3EQ0H 2TGDA 1J15A 3U9AH 1H8IH 5EJ1A 1C2LA 1W14U 1SQOA 2YNAA 2ZTZA 3NPSA 4AC9A 1OS8A 3M3TA 4OS4A 1GHWH 1TX8A 4HFPB 5E0HA 2JDID 4Q7YA 2FOAA 4AG2A 4ABBA 1TX6A 2D1JA 2OXSA 3GCHB 4X1QU 3ZZ9A 4I8KA 1WV7H 2ZGBH 2HALA 3T62A 3GY6A 5GJ4B 3FFGA 1GDUA 1P09A 5I46H 1Y59T 2HPPH 3GDSA 3UB0A 6GCHG 1NTPA 4AFZA 1C2FA 3FKSD 2F9UA 3SHCH 1NU7B 2EQNA 3KGPA 1ACBE 3MU5A 2SNWA 3KHVA 3SNBA 3ZZCA 2DUCA 2C3SA 3UFAA 3D62A 5EOKA 2VNTA 1O2HA 3GDUA 3UNQA 1SQRA 3TK9A 5IDKA 1N8OB 2FS8A 2XNIA 1MTNB 2QF5A 1V2ST 1O3AA 2OC7A 5C94A 1MTSA 3P95A 3SI4H 2YNBA 4RT1A 3OU0A 4IW4E 2Z7FE 3P17H 3MQKC 5JPMH 5F8TA 3VGCB 2WSSD 1RJXB 1PPCE 3ZV9A 2LP6A 4DJZB 4Z1MD 2OLGA 1V2MT 4TY7A 3OEED 1D3PB 1MH0A 1W11U 1IQIA 4B73A 2H6MA 1AE5A 1ID5H 2OINA 3BTQE 1KYNA 1OWJA 5LGOA 3I29A 4ZHAA 3ELAH 1EOLA 4B2BA 3FP8E 4FVBA 1ABIH 4X6OA 3N99A 1GVKB 1PYTC 5LPEA 3M7TA 3ZYDA 3OY6U 3KQDA 1W0YH 3CP7A 1XUHA 3FZDA 1HAVB 3OX7U 3DD2H 4JYUH 1LHFH 2W3IA 2Y7XA 5DP7A 1A5HA 1SLXB 1LMWB 2FIRH 2P16A 1XUKA 1CA0C 1QR3E 1W7GH 1K28D 5TCCA 4R0IA 1P05A 1QB6A 8GCHG 1BBRE 2VJ1A 1EZUC 1GBTA 3TIUA 4X8SH 1BMMH 4K8YA 1LTOA 2PUXB 3MU4A 3SU6A 3NWUA 2AGGX 2XTTB 2BD8A 3AK5A 3UY9A 1CBWB 3EA9A 5T1VA 2B7DH 3N7OA 4ZUHA 1RFNA 3E8LA 1J17T 2CHAB 4DG4A 1O2LA 2WUBA 1TA2A 1C2KA 3LKWA 2BD9A 1FNIA 3LT3A 1TALA 3MU8A 1VKYA 4CRBA 3ZZ5A 3PLPA 1J16A 2F9VA 1ZMNA 3OY5U 2H9TH 1M9UA 5DP4A 1LPZB 1P02A 1TFXA 1THRH 3OYPA 3ATLA 1S5SA 5GPIB 2A0QB 3A8DA 2O8LA 3BTHE 1K22H 1DM4B 2F9NA 2OQ5A 3MI4A 3HPTB 1JBUH 4Y0YE 2Q6FA 1O3PB 2YOLA 3SV2H 4U32A 1IQMA 1HAZB 2QY0B 3U8RH 1O3EA 2DE9A 1H8ED 4I31A 1FPCH 4ABAA 1TABE 4K69A 3V12A 1HJAC 2NU0E 1IHTH 5SGAE 2XWAA 4YLUA 1CQQA 1F5LA 1L1GA 4U01A 1QBNA 1ZLRA 3E3TA 1EP6A 1SGFA 3ZVGA 1DXWA 5FPSA 1VITH 1OWIA 3I78A 1O36A 3A7TA 1EP5A 4DVAU 2G55A 2BMGB 4WWYA 2JH5D 3LH1A 2BY5X 2TRMA 1BTXA 1C5OH 1P04A 5KGOA 1A3EH 3EGKH 1T8OA 1P01A 3F3BA 1TPPA 1AKSA 1RD3B 3N7DA 2K0QA 5T3HA 1FIWA 1T32A 1O2IA 2H2ZA 3VFEA 1BBRH 1BA8B 1BCUH 5GCHG 2F91A 1BZXE 4X2YA 2HVYB 4DURA 1GI8B 1ESTA 1GVZA 3PRDA 1YF4A 2A4QA 1JRSA 1TPAE 3P70B 1AUJA 1IAUA 3UTUH 1ANBA 4NA8A 3A8CA 4JK5A 1TQ0B 2Z3DA 3FP7E 2AS9A 1KDQA 1DICA 3UAIC 1FN8A 5CHAC 1QTFA 3DT0H 1YP9A 1ZSKA 3T28A 2F9OA 2JETC 3L33A 4KP0A 3N7EA 1VJAU 4JZFH 4YOJA 3BTTE 4Q80A 2ODPA 1EJMA 2BDCA 1JIRA 5C20A 5JB9S 1K1LA 1PPBH 4CR9A 4INHA 2BHGA 2NU1E 3IG6B 2VB0A 1YPGH 1BBRK 2AHME 4NA7A 2G5NA 3RXHA 2ZI2H 1V2JT 1Z8GA 4JZIA 1AUTC 2GTBA 2KCAA 3RLYH 2FYRA 3V7TA 1MU8B 4Y11E 3RU4T 2Z3CA 3P8GA 3GY7A 1PPEE 1LPGB 1QB9A 1THSH 2J95A 2VWOA 2AMPA 3MMGA 2QF0A 3OTJE 3PWCA 1XUFA 4NSVA 3BV9B 2C8YB 2FTLE 3MYWA 1NESE 1OPHB 5GDSH 5CHAB 1GHVH 4ASHA 5A0AE 1W0ZU 1SMFE 8LPRA 3RXFA 4K1TA 2VH0A 4I86A 1N6YA 2JJ1D 1D4PB 3BTWE 3SV9A 2CJIA 2AMDA 4J1YA 1SGYE 2VVVA 1ARCA 3QWCH 2UUYA 1NFXA 4WXVA 3KIDU 1SHHB 1OSSA 1THPB 2XRCA 1WAYB 1KTSB 1P11E 3M7QA 3SV7A 2QXJA 2XC0A 2DE8A 3F9HA 3O8BA 2WPKS 1GJBB 4B1TA 3UQVA 1HAVA 1F0SA 2I6SA 1MTWA 1TLDA 1TRYA 2Q6DA 3T2NA 4OS7A 2AERH 4OS2A 2JETB 2XOKD 3LJOA 1C4U2 1PJPA 2JH6D 2RDLA 1O3MA 3MNBA 3KN2A 2G51A 1B5GH 4GPGA 2A2QH 3UPEA 3SJ8A 3TJUA 2FM2A 4WH6A 3ZVFA 1T31A 4NG9H 2EI6A 2ZU3A 3ENSB 3MNSA 2BQ6B 4I8GA 1YLNA 2BDIA 4MTBA 4Y76A 3BEFB 3W95A 1GMCG 2OC0A 4H6SB 2GDDA 1DWCH 1T8LA 2UWOA 1S0RA 1TE0A 3VB3A 1E34B 3V0XA 1RIWB 3QTOH 2CF8H 4CHAC 2Z9GA 3ZVCA 1F0UA 2VIOA 2ZGXH 1IQHA 1ESBA 1HJ8A 3T29A 2A5KA 2LPRA 2GMTC 3CENA 1AVXA 3PO1B 1TGTA 3DHKH 3M5LA 1N1LA 3MO6A 1G36A 1MKWK 1C2DA 3D23A 3HATH 2FO9A 2Y6TA 1O2GH 1TMUH 2F9PA 1NRPH 5AVDA 3GYLB 4AYYB 4Y8ZA 1TNJA 1EZQA 5JBTA 1KMHB 1FY5A 2W3KA 4BTUB 2BB4A 4Y0ZE 4RI0A 3SNDA 5DO4H 3K6ZA 3NKKA 1SR5C 4Q7ZA 4OM9A 3BG8A 1QURH 2A5IA 4CRFA 1KXCA 4YZUA 3QTVH 2BQWB 2FI4E 2V3OH 2IPQX 2M5TA 1NFYA 2BTCE 1EPTB 2GX4A 4A1XA 1GHZA 2PGBB 2B0FA 1S0QA 4GHTA 1LDTT 1TYNA 4AG1A 3T25A 3EA7A 1LO6A 1EB1H 3OEHD 3GY2A 4HG6A 3PO1C 3LU9B 4HI3A 4B75A 2TGTA 1GJAB 1EJAA 1C5ZB 4JYVH 2CHAC 1F0RA 1FZZA 3RC4A 3Q00A 1GI5A 4XOJA 2CK3D 4XE4A 4CBNA 2PLXA 1AFQC 1C5SA 1C5RA 6LPRA 2OBQA 2AYWA 3H7OA 2J97A 3NXPA 2P59A 1QIXB 3VB4A 4FU8A 1E36B 1SVPA 2JJ2D 2ZFPH 2YMSC 4ABDA 4YESB 2PP6A 1WQVH 1C1MA 2HOBA 4AFSA 5JBCS 1QCPA 1YPMH 1XUIA 1VZQH 4B74A 2EEKA 1O2ZA 1MCTA 3RDZA 3RXAA 1UHBA 5E0GA 1KXBA 5CMXH 1N6XA 3DCLA 1HUTH 5F8XA 2FOGA 2ZPRA 2NU4E 1NO9H 2BDGA 1LQDB 3RC6A 2BD4A 4BOHA 2ZGJA 4GHQA 1AHTH 4F48B 1S6FA 3QLPH 1GVLA 4ESTE 1HAIH 1DSTA 1ETSH 3DSPA 2FPZA 1GHBG 1P12E 4Y79A 1ZYOA 3BEIB 5A8YA 3NRLA 4O3UA 1OYTH 1ZJKA 1DPOA 4TYDA 1DX5M 4WVPE 5C0UA 2VWNA 2W7SA 1T4UH 5EXMA 3UNRA 1VCWA 1CE5A 4THNH 4FUEA 1DWBH 1NRRH 4MPVA 2ZP0H 2Y82A 3ESTA 3RXTA 1TNGA 3TGJE 4IN2A 2FS9A 1ZZZA
chains in the Genus database with same CATH topology
1DUEA 1ZHRA 3BTME 1P2IA 1TPOA 1WTHD 1QBOA 1NRNH 5L6NH 3QUMP 1EAWA 2ZDAH 1TBQH 3LIWA 1UHBB 3IITA 3H5CB 2ANWA 2VIQA 4I7YH 9ESTA 2CV3A 1XKBC 2PTNA 1LHEH 3UNSA 1E0FD 1EPTA 3V13A 1SGNE 4B76A 1HDTH 1GBMA 3K65B 3SGAE 4GLYA 3U8TH 4ZKOU 1GJ4H 3S69A 2OCVB 5C1YA 5GCHF 4CRDA 1BMLA 1Y3UA 1O3GA 1OXGA 3T26A 1PQ5A 2C4FH 2CGAA 2ESTE 1S81A 1S6HA 3UR9A 1DE7H 2OP9A 2GZ7A 3O8DA 4ZKRU 2HLCA 4ISNA 3LDXH 2ZCHP 1C2IA 2ILNA 4WMEA 1AI8H 4PROA 1KTTB 2P95A 1W8BH 1A0HB 2VIVA 2FOMB 2ZGCA 1G9IE 1Z6JH 1O3KA 1DANH 3AVZA 5DJ7A 1PQ7A 1HAOH 3TJVA 1GHAF 1QA7A 1LHDH 1OWKA 3CS0A 4XDEA 1T7CA 3P8OA 1OP0A 1GJ5H 2O8UA 5LH8A 2EI8A 1C1SA 1NN6A 5C5OA 2FZZA 1QBVH 3RXRA 1LPKB 3PLKA 5FBEA 2OUAA 1A7SA 1UTQA 4X8UH 1P3CA 2ZPQA 1W2KH 1HFDA 3RXQA 1EOJA 5F03A 1C2EA 3MH4A 1GBIA 4GSOA 2CXVA 3ZZ7A 3LGUA 5HXFA 2V0BA 4WMFA 1K1JA 1C2GA 1TRNA 1ZRKA 2QGRA 5BPEA 2SGFE 1FY4A 1SG8B 1G3DA 1MU6B 1ETTH 3VXFH 2ZDMA 3K6YA 1NPMA 3MHWU 1PQAA 1QQ4A 1W12U 2C8XB 1DY9A 1F92A 1K1MA 1O31A 4UONA 4BNRA 3SU3A 1O3IA 1UCYE 2HVXA 1HV7A 5E8EH 1GWAA 1IQEA 1ANDA 2FXRA 1H9LB 3DFLA 3M5MA 1UVPA 1AY6H 1O30A 5EXLA 1TGNA 4AZ2B 4DT7B 1ZSJA 1EX3A 1DWDH 3IWMA 5C1UA 1IQNA 3RXSA 1D6WA 2GKVE 2IJOB 4D9QA 1CU1A 1EATA 3LPRA 2ANKH 1V2UT 1RTKA 1ZPCA 1HJAB 3M7UA 1GL1A 3GOVB 4X1NU 1O32A 1ANCA 2OC8A 1FLEE 1KXEA 1QJ7B 3Q3XA 1G32B 1A4WH 3EYDA 1EQ9A 1KLJH 1KLIH 4MVNA 2Q6GA 1WSSH 4JZEH 5EW1H 2O8TA 1Y8TA 2A7JA 1Z6EA 1Y3YA 1GI3A 4RKJB 1GI0A 2GCHF 2AIPA 1O3HA 4AGJA 1GI1A 1DXPA 2BDBA 1GPZA 3BIUH 3UR6A 2UUFB 1FDPA 1HAXB 1BTWA 4NFFA 1GJDB 1DS2E 3UWIA 1ARBA 2PTCE 1TGCA 2FOCA 3E0PB 3M36A 4K1EA 5ESBA 1V2KT 1A5IA 4RN6A 1PPGE 2GD4B 1YC0A 2BLOA 3AAVA 4INKA 4MNYA 1BT7A 2FDAA 2BY6X 3SUDA 1LVOA 3R3GB 3RMNH 1RTFB 1XX9A 1XUJA 3TH2H 4E06H 4YM9A 1BJUA 1MAXA 1B0EA 1OX1A 1UJ1A 4NIYA 1MBMA 4ABIA 4TWYA 2BM2A 2G52A 1C2MA 3M5OA 2SGDE 4X0WU 3P6ZB 2ZCLP 3TNSA 3A7VA 1NZQH 3SNAA 1SLUB 6CHAB 8ESTE 4JYTA 1UVTH 1F5RA 2BDAA 4F4OC 3BEUA 5DP9A 5TCAA 1SLVB 2BVRH 1O5AB 3M61U 6GCHF 1XMNB 1ELVA 1UK2A 5L30H 3LGYA 1JXPA 1O3JA 4NFEA 3ZVDA 1B0FA 3PMAB 3ATMA 4LOYH 1AU8A 1BRBE 2SGAA 2ZDLA 4VGCB 1L0ZA 1O3OA 2NU3E 4UE7H 3ZZDA 1J14A 1XXDA 1NROH 3TITA 1QL8A 1W13U 1V2WT 4MDSA 2F3CE 1HPGA 1NT1A 4BAKB 1AZZA 3A83A 1RXPA 1HAYB 1XVMA 3D49H 3O8CA 1O2KA 5DP6A 4ZH8A 1EAUA 4AFUA 4KTUA 2Z9KA 3A81A 1BRAA 1MQ5A 1V2VT 3M3SA 4YLQH 1QRZA 1HGTH 3ZZ8A 2G8TA 1Q2WA 4DIHH 3KQCA 1NY22 5GWZA 3MU0A 5LPFA 3VB7A 2P3FH 1Z8RA 2WV4A 2PSYA 3Q76A 1O5CB 3PMBB 4JMYA 1CGIE 1WU1A 4MNWA 2AIQA 2BXUH 1EZSC 1K9OE 2HRVA 1FY3A 3TNTA 3T5FH 3VEQB 1O5BB 2HNTC 1P8VC 4JZDH 1GJ6A 4H42U 5F8ZA 1SGDE 4ZHMU 2BZ6H 3SOSA 2CF9H 2QN5T 1C9PA 8KME2 4H4FA 4NIWA 1INCA 4B2AA 1K1OA 1HAHH 1GI7B 1H9HE 2HNTF 1GCTB 1GCTC 1LKAA 3A8BA 3TH3H 3VXEH 3LGTA 2G81E 2SGEE 5EXNA 3FP6E 2BZAA 4D7FA 1J8AA 1HXEH 2XW9A 2QCYA 3SJ9A 4BAHB 5FX6A 1C1TA 4UDWH 1SFQB 1L2EA 1AN1E 1GBEA 4AB8A 1Y3VA 3B8JA 1GI2A 5L2ZH 2Y5FA 2TGPZ 2C93B 3GCTF 1BTZA 2FLBH 1GG6C 4A7IB 2A4OA 4FUJA 4JK6A 1MTNC 2ZZUH 1C5XB 1BHXB 1GBFA 3I77A 1DVAH 1KLTA 4ZXXH 2Y81A 3TK5A 1G30B 5EPNA 3ZZ3A 1Z7KA 4BAQB 3SQHE 5C3NA 1DY8A 2BOKA 3A88A 3DFJA 2Y5HA 4DGJA 2Z9JA 1EUFA 2LNCA 2ZFSA 4A92A 1BTUA 2V6NA 3QGJA 3NZIA 3HGNA 3ZVBA 3M37A 2AEIH 1SQAA 1YPJH 2B9LA 3EA8A 3C1KA 1HIAB 3HKJB 3KQBA 3SJIA 3ZYEA 1ELTA 5ABWA 1O5GH 2WPJS 4A5TS 2J94A 2BLWA 1AIXH 1MUEB 1W10U 4BTTB 3O8RA 1C4Y2 1FIZA 1ZR0A 1DDJA 1O38A 2ZFTA 1IQGA 4U30A 4KTSA 1SPJA 2AH4X 3UIRA 2BD5A 4NIVA 3EAJA 1HBTH 1L4DA 1UVOA 2ZCKP 1G2MA 1NC6A 3PB1E 1VR1H 3G01A 4MPWA 1Z71A 2BLQA 3P8NA 1EAIA 1WQSA 2FI3E 2ZU2A 1LQEA 3MFJA 4RSPA 3GCOA 2W7UA 3HKIB 4VGCC 1SGQE 1FAXA 2ZKSA 2BY8X 2XXLA 3B23B 4WY3A 4BANB 3TGIE 1AZ8A 2A1DB 1AD8H 2ZHEH 4OGXA 1A61H 4Y6DA 2VINA 3GY4A 3PM3A 1XVOA 5GXPA 7GCHF 1O33A 1BQYA 2QAAA 1C5YB 1GBJA 3SQEE 3UREA 1YPKH 2VIPA 1AFQB 4MPXA 1C5QA 1TOMH 1SFIA 4IN1A 3NUMA 1GGDB 1Z1JA 2Y5GA 1Z1IA 1ZRBA 3RXMA 4NSYA 1P57B 1LHCH 1GBCA 2ZU5A 2XCNA 3S7HB 1FY8E 3RXCA 1O3LA 5I25A 1SOTA 2TIOA 1UTPA 5EW2H 1BTYA 1ELBA 1ELFA 2BDYA 4AYVB 2A7HA 1AMHA 1GJ8B 1SC8U 2PUQH 1AVWA 1TQ7B 1TBZH 3RU4D 4RKOB 1HXFH 3W94A 2J92A 4CH8B 1QL7A 3MH6A 5E2OA 1GI9B 3SHAH 5T6GA 3SUFA 3LH3A 2FEQH 3TJNA 1UVSH 1VGCB 1AVGH 3F6UH 3RP2A 4Y10E 4A1TA 1HAPH 2GCTC 4AN7A 1YBWA 2A32A 2RCEA 2QA9E 2PWXA 1GDQA 2Z9LA 4I32A 4AOQA 2BY7X 3SUEA 5AFZH 3OSYA 2NU2E 4ZKSU 1FQ3A 1BHXF 4BAMB 5DKMA 2B8OH 4X1RU 2ZC9H 3F9EA 1CVWH 4SGAE 5JDUB 4CH2B 1V3XA 4Y7BA 3SNEA 3SU4A 2QV1A 1C5UA 1LCYA 2GCHG 1GJ9B 1GMDG 3S9CA 1KY9A 3SBKA 3RM2H 1E38B 1O5FH 1DFPA 1UTOA 1BITA 1GGDC 1YPEH 2FMJA 2BYAX 1YLDA 5FXLA 4D8NA 5HMAA 3F1SB 3GYMA 3BIVH 1CSOE 1MBQA 1TNIA 2FLRH 4YT7H 1O3DA 1Y5BT 1CHOG 1QQUA 2VVUA 3PTNA 3SNCA 2FX6A 2SFAA 4X2WA 5FHTA 2J38A 3RXVA 5PTPA 2XBWA 3K9XB 1O2VA 2BX3A 2OTVA 2ZECA 1CT0E 5C2ZA 2XBXA 3ZZBA 1WCZA 3TJOA 1FXYA 3GDVA 4GCHF 5EQSA 1Y5UT 1GBBA 1K1IA 4A6LA 1TMTH 4KGAA 7GCHG 4Z6AH 5A8ZA 1H8DH 1YCPH 1YGCH 2XCFA 2KAIA 5EODA 1PPFE 4B2CA 3QK1A 4R8TB 4K5ZA 2QF3A 3BTEE 1SGFG 4OS1A 2PSXA 3F68H 1ZPZA 1NRSH 1A46H 4DOQA 2XYAA 4FUFA 3PMJA 2ALVA 1K2I1 1TNKA 1ZHPA 2ANYA 2EA3A 4WJG2 2QXGA 1KXFA 1XKAC 2BD3A 1NS3A 1VITG 1C1RA 1MKWH 1T8MA 1CT4E 1WYKA 2QYIA 4X6PA 1IQFA 1P03A 3ZZ4A 1UTMA 2ZGHA 2BVSH 1AWFH 2O9QA 1QFKH 1QY6A 4YO9A 3A84A 2ODYB 1C1PA 1PPZA 2AGIX 1C5LH 1BTHH 3S0NA 1BOQA 3RXDA 2ZPSA 5FCRA 4E7NA 2ZDNA 1C2JA 3T27A 4ABJA 5DP3A 2UUKB 1MTVA 5FBIA 3ZVAA 2STAE 4O97A 2OQUA 1TPSA 1PYTD 3RC5A 1CGJE 1YYY1 1O5DH 1S85A 1XUGA 1CA0B 5DP8A 3AW1A 3SI3H 4OS5A 3TPIZ 3A7ZA 1C5PA 2UWPA 3E6PH 1AQ7A 1BMAA 2A4GA 2FYQA 4ISLA 2PV9B 1O2WA 1DUAA 1SGIB 2BXTH 1MTUA 2BD2A 4AB9A 1IQKA 1D6RA 2A2XH 3S9AA 1ELGA 2VWMA 1RIWC 3SJOA 4I8LA 3RXUA 1EJNA 2CN0H 1TB6H 4XBCA 3TGKE 4NIXA 4BXSA 1L1JA 1GI4A 4KTCA 2ZU1A 5DPAA 3QZRA 4YOGA 1A0LA 5B6OA 1HAGE 1W3CA 3BN9A 1OWEA 1UK3A 2Z94A 4XFQA 5BRRE 2WPLS 4NWLA 2ZA5A 1Q3XA 3AW0A 1A0JA 1FN6A 1QA0A 3S7KB 1QRWA 5FCKA 4U2WA 3URCA 4Y7AA 3LONA 2R0KA 1ZGIA 4Y8XA 2O8MA 5AHGH 3DA9B 4O03A 1QJ6B 1V2QT 3SORA 1SBWA 3TLOA 1C5NH 1YLCA 4WF8A 2WV5A 3MH7A 1MQ6A 3CS7A 5L2YH 1BTPA 1YPHC 2TBSA 1C1UH 5A09A 1TAWA 1KXAA 4E05H 2H9EH 3EE0B 1UMAH 1SOZA 1BMNH 2ZDVH 4NGAH 4WXIA 2D26C 4YTAA 1DLKB 2Q1JA 5TJXA 1P9SA 4CRGA 2R2WU 3ATKA 3RXGA 4IMZA 3RXEA 3ITIA 1O2OA 4IS5A 1GBKA 1GBLA 4FUCA 4NA9H 1RGQA 1SSXA 1UO6A 4ABFA 1CGHA 6ESTA 1V2LT 2ZHDA 1EASA 1TONA 3STIA 4Y71A 3MWIU 1O3BA 1IOEA 1S82A 4AX9H 1Z8IB 1FJSA 4LK4A 5F6MA 3E1XB 1J9CH 1TIOA 2QC2A 2XBVA 5EU8A 2HNTE 3U1IB 1GJ7B 2GCTB 1ZTLA 3UWJH 2VGCB 1ELCA 3D65E 1YM0A 2UUJB 2ZEBA 2EC9H 2FOFA 1O3FA 5AFYH 1ZPBA 3A89A 1BDAA 1JRTA 2BD7A 2ODQA 1XXFA 1BJVA 1ETRH 3JZ1B 3B9FH 1DLEA 2GV6A 2W26A 1F2SE 4B71A 3LJJA 3MTYA 4NWKA 2IN2A 3RMLH 1MAYA 1UTLM 3UUZA 2ZG0H 1GL0E 3F9GA 4I8HA 3STJA 5EPYA 1OP2A 2C8WB 2P93A 1BRCE 3HK6B 2NWNA 3VB6A 3U1JB 2GT8A 1GCDA 2R0LA 1SI5H 5GIBA 3RMMH 4MG3A 1HYLA 4ZAEA 1A3BH 2B5TB 1OKXA 4M7GA 1LVYA 1F0TA 1YKTA 2D8WA 1Y3XA 1GHAG 3ATIA 4FUIA 4CRCA 1ANEA 4DCDA 1CHGA 3SUGA 1UCYH 3BTKE 1P0SH 2A4RA 5JYIA 1P2KA 2A31A 4GAWA 5A8XA 3JZ2B 5HM9A 5C5NA 4FU7A 4GVUA 5HM2A 4ISHH 2JH0D 1HLTH 2GP9B 1FAKH 2ZO3H 4AGKA 1GHBF 1C5TA 1MKXH 2V35A 3KF2A 1SGTA 2H9HA 4GCHG 2P94A 2THFB 3MOCA 2I6QA 3BG4C 3L3TA 1O3CA 4MNVA 1C5WB 3QX5H 3QGNB 2ZF0H 4CRAA 3GY3A 1Y3WA 3LGWA 1UK4A 2F83A 1A2CH 3SV6A 2STBE 4X6MA 3PMHB 5A0CA 5E2PA 3ZZAA 1O2MA 3A7YA 3SZNA 4BXWA 3A80A 1ABJH 1U6QA 2FESH 3GCNA 5FPTA 1OYQA 4Q7XA 4E7RG 5EQRA 1GDNA 3M5NA 4QT8C 7KMEH 9LPRA 3M35A 1KIGH 3L6PA 1QL9A 1NU9A 4Q2KA 3RLWH 3LGVA 2PKSC 1OWHA 1JMOH 2CMYA 2J4IA 4ISIH 4UEHH 1NM6A 2RA3A 3WY8A 1ELAA 1D9IA 3VPKA 1PFXC 5JBAS 2P3TB 1VJ9U 1O3NA 2BDHA 4GUXA 2G00A 1G3EA 1HRTH 2HPQH 4UFDH 3LC3A 3SO3A 1O37A 2C90B 2PKSB 2HWLB 4XBBA 4DIIH 2PKAA 1G2LA 4X8VH 4O9VA 3C27B 1YCPM 3V3MA 1C1VH 2ZFFH 4WH8A 1HIAA 3U69H 1ZMJA 2A7CA 4TWWA 2FP7B 4MQAA 1P2OA 1V6DA 1CBWC 2R3YA 3FZZA 3SU5A 2ZFRH 1ZMLA 6CHAC 2P8OB 5DK1A 3H7TA 3ZV8A 1ZGVA 3AAUA 1C5VA 1O39A 1WUNH 2WUCA 2ALPA 2C8ZB 2R3UA 4A1VA 1RTLA 3BG4B 4K1SA 4TY6A 3QN7A 5EG4A 1O34A 3RXJA 1HJ9A 1P2JA 3EDXB 1GHXH