1O2UA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2uA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2uA02
1SGQE 2NWNA 4FUBA 3HGPA 4GUXA 1ZGIA 4K60A 4OS5A 4CRDA 3A81A 5JB8S 1K1NA 1Y3VA 1TPSA 5G4BA 5GIBA 3CP7A 1HGTH 1HJAC 1P2QA 1WSSH 3KF2A 1P2JA 1SGFA 2ODQA 3SJIA 2CF8H 1J9CH 3C1KA 1CU1A 2P3TB 3SBKA 2QA9E 1BHXB 1WCZA 1HRTH 2GMTB 2ZDLA 3MWIU 4X8TH 1KXCA 1O5AB 4DVAU 1O2WA 4CRCA 4I7YH 4YTAA 1O3JA 3SU3A 1BRUP 1IQMA 1BB0B 1GCTC 3IWMA 4ZUHA 5F6MA 4MNYA 5FCRA 2KAIA 3QX5H 3KQDA 3BTQE 4X6NA 1AE8H 1ZPZA 5F8ZA 1GCDA 4JMYA 1ELCA 3Q3XA 2AIQA 1FAXA 1HXFH 3A8DA 3T25A 3DD2H 5C1YA 1S0RA 1SGIB 3M7TA 1PYTC 3SV6A 3T2NA 1SHHB 5E0HA 3RXOA 1W10U 1TA2A 1GDNA 2ODYB 1K1JA 3SU5A 6LPRA 1BTHH 5LPFA 2Y6TA 2AFQB 2A7HA 2VWLA 3KCGH 1W12U 4DOQA 2XBXA 1OXGA 1FQ3A 4MLFB 2GVFA 3PYHA 4X8SH 1YPMH 1CBWB 2ZQ2A 2ANYA 4NCYA 3MNBA 2BDGA 3NZIA 3PMHB 2D8WA 2HPQH 1E35B 3RXIA 4IS5A 4UFDH 1QB6A 1JIRA 3MU5A 4JZFH 1THSH 4TY7A 1XUGA 1Y5AT 3EDXB 1P2MA 1K1LA 3SU0A 3GYMA 4FVBA 1LVOA 4MPUA 1T31A 1WBGB 3P8OA 1GHAF 1H8DH 1GI7B 4JYVH 5L2YH 1UTKA 4A7IB 1PPBH 2WV5A 4H4FA 1BJVA 4Y79A 2ZU4A 1C5UA 2WPLS 2ODPA 3W95A 4GCHF 3ZYEA 1ESBA 1BRCE 3SU4A 2BB4A 5H4IB 2SGFE 1SQAA 2C93B 1FY5A 1XUHA 1HUTH 1O3OA 1O5DH 2JETC 2XC4A 2UWOA 4TPIZ 3A7WA 1F0RA 3QLPH 1TGCA 1QB1A 1KXEA 2P95A 3MH6A 3BSQA 1EAWA 1RGQA 1MTUA 3MYWA 1UJ1A 3S9AA 3VB5A 2V35A 1O3PB 3A83A 3VPKA 2AEIH 2F3CE 3ATWA 3GYLB 1O3CA 2OCVB 1LVBA 4AFUA 3SV7A 4Y7BA 1EJMA 2BLVA 3VEQB 2CHAC 1EX3A 1GHWH 1G3BA 1YCPK 1O34A 3K6YA 5JBCS 2O8WA 4NZQA 2A0QB 3SO3A 2Z94A 4KTUA 1G32B 4YLUA 1VJ9U 1C2EA 1Q3XA 1C1SA 1C2DA 2Z9LA 1SGEE 2WUCA 2Z9GA 1O5CB 1RRKA 1YGCH 4NGAH 2ZO3H 3GISB 3L6PA 2HOBA 1C1WH 1SI5H 3E91A 5FCKA 1GMCF 1ELDE 1HAOH 1SL3A 1OYQA 1V2ST 3CS0A 3KHVA 1V2LT 4YOGA 1RJXB 3MNSA 3P70B 3QN7A 3H7TA 1KSNA 4CH2B 1C5SA 2Y7XA 1T8LA 2BX3A 1PPFE 1THRH 1D3PB 2H9HA 3UNRA 1Z1IA 1GMCG 3GDSA 4AYVB 1HAHH 3MMGA 4BOHA 1RXPA 1MAXA 3TLOA 1J16A 3F1SB 5L2ZH 1B7XB 1PQ8A 1O2XA 5F8TA 1GI9B 4ISLA 1A61H 1JOUB 4A92A 4FUIA 1RS0A 1TMUH 3LPRA 2FDAA 3TJNA 1UTNA 7GCHG 3ELAH 3SHAH 4BANB 1C2MA 1W14U 2BY6X 3KIDU 1YPJH 1UTMA 2ZHFH 1TNKA 3TNSA 4DCDA 1C1QA 1TFXA 4FUJA 1Z8JB 2ZECA 2TPIZ 3LGTA 1C5LH 1O2OA 2BZ6H 1O2QA 2Y7ZA 4DG4A 1Q31A 2QXHA 2XBWA 2G51A 2PGBB 3TH3H 1Z71A 2SNVA 1ABIH 3ZZ9A 1GJ9B 2A5AA 4J2YB 4GVUA 4DY7B 1N6YA 3BG8A 1CGJE 1XX9A 1MTWA 1V2PT 4B73A 3RXJA 2NU1E 2ZEBA 1V2RT 2ZTYA 4ZHLU 1TRMA 2TGDA 3BTME 3QGNB 1AIXH 2FWWA 3S7HB 3PM3A 1W8BH 2FYRA 2VGCC 2EA3A 1GVZA 3I78A 2IOTA 1TGBA 1ZGVA 4U32A 1E36B 1O31A 1SLXB 2ZIQH 1ZMJA 1AWFH 1GMHF 3C27B 2O8UA 1ETSH 1BBRH 1F92A 2H5CA 1NU9A 1UTJA 3ZZBA 3QZRA 2J34A 2F9OA 4ZH8A 2O8TA 2FIRH 4OS6A 1UTOA 1TBZH 2HNTE 2XW9A 4A1XA 4INKA 2AGIX 2OC1A 4ABAA 2ZFFH 4D9RA 3LONA 2QF0A 4MNWA 4D7GA 1NFWA 3KN2A 3SQEE 4MNXA 1C4Y2 3M35A 5DP8A 2OC7A 3PMJA 1T8OA 3GY6A 4FUEA 1BQYA 1NFUA 4AFQA 1A0LA 1AU8A 1F0TA 1V2TT 5HGGA 3STJA 3SUFA 3I29A 1ZPCA 1EP6A 2ZGXH 2Q1JA 1DVAH 1UTLM 1MTNC 1TNGA 2A7JA 2J94A 1O36A 1HJAB 1C9PA 1O2TA 2O8MA 1GBIA 1QHRB 3LGYA 3HK6B 4JK6A 1CSOE 3M3SA 1VITH 3D65E 4NA9H 4X6PA 5GWZA 1FY3A 3EE0B 4UFFH 2PW8H 4UEHH 1ZMLA 1P09A 2BOKA 1AQ7A 1GHBG 1BMLA 3TK5A 4AFSA 1XUIA 3ZZAA 3F9GA 2NU4E 1FI8A 1GVLA 2FS8A 3S7KB 3GCHC 2XC5A 4E06H 1D3TB 1O3DA 1S0QA 1NESE 3MNXA 1OS8A 3RXVA 4I8LA 4BTIB 3WY8A 3P95A 4Q7XA 4I33A 1IQHA 3ITIA 5A0BA 1V6DA 2SGPE 4XFQA 1K9OE 2EI8A 4IC6A 4AFZA 2UWLA 3SUEA 1QJ6B 4CR9A 4CREA 5JBAS 1YPHC 2YOLA 1O2NA 2GDEH 5CHAC 1YCPH 1KY9A 3RMMH 3RP2A 5K0HA 3P8NA 4TWYA 1P06A 4ISOA 2DUCA 3A7XA 3BEFB 1HJ9A 1F5KU 1QCPA 3MU1A 5E8EH 1GBEA 3RMOH 1K28D 2SFAA 3N7OA 3EYDA 4B2AA 2FOMB 4TY6A 2QGRA 1C5QA 3VB3A 1DOJA 3ZYDA 3LOXA 1SG8B 1ZYOA 4B74A 4U30A 1A1RA 1UK2A 3FVFB 5I46H 2VH6A 1AKSA 2Y80A 1ARCA 4X1QU 3TVJB 2EI6A 4ABFA 3BV9B 1ZOMA 2FEQH 4OS4A 1A0HB 5BRRE 1G3DA 3Q76A 1G2LA 1AI8H 5FBIA 3A80A 1NRQH 1GG6B 3UQVA 1Z6JH 3GY4A 3RXMA 2PTNA 4YZUA 1W13U 2GZ7A 1EB2A 5J4SA 2FPZA 2WINI 1O2YA 2R9PA 4NSVA 1VITF 2GX4A 1TNJA 1ZSJA 2ASUB 2RCEA 1C2JA 1MUEB 1TX8A 1TE0A 1JMOH 1XUFA 3A82A 5EXLA 4X0WU 3TH4H 1V2MT 3OX7U 3A8BA 4D8NA 3BN9A 2WYGA 4MPXA 5C1XA 1QB9A 2BOHB 2PSXA 4YOIA 4AZ2B 3BTWE 3LU9B 3MHWU 4ASHA 3VXFH 4AGKA 2HALA 4NIYA 1O2JA 4BAKB 1GBKA 3U98H 3MNCA 1C2HA 1HV7A 1YPLH 3SNEA 1LHDH 1VCPA 4B71A 1A46H 3GDVA 2ZTZA 2OP9A 2TGPZ 4AGJA 1SGTA 2ZHWH 1B0EA 1EP5A 2FM2A 1O3AA 1Y5UT 1EAUA 1THPB 3URCA 1XM1A 1AVGH 3QTOH 1T8MA 4A6LA 2WYJA 1GI6A 2W7UA 3BF6H 1MTNB 2ZFPH 1D6WA 1RFNA 1QY6A 1LVMA 2BVXH 4CRBA 1CA8B 3K6ZA 1ZHRA 3HPTB 3LKWA 4X1SU 2BVSH 3RLWH 4CHAC 3QK1A 2AH4X 3AASA 5JBTA 5FX6A 4MPWA 2PTCE 1FNIA 1O2ZA 2FODA 2BD7A 1ETTH 1F2SE 4FVDA 1HFDA 1GBTA 4E7RG 6ESTA 1P2IA 3TGKE 5FPTA 4KTCA 1C1PA 2ZTXA 3FZDA 3TGIE 4U01A 1IHTH 2XBYA 1AZZA 2XYAA 3IG6B 2J38A 1KXBA 4XE4A 2XNIA 1OWHA 1DPOA 2FZZA 3RM0H 3RXLA 1G2MA 1O30A 2F9VA 1EPTA 1O3FA 1O3MA 1IQFA 1LPKB 1FAKH 2EI7A 2Z9KA 1LMWB 1O2SA 4FUFA 1O2RA 4I32A 1MD8A 2SGAA 3B23B 2OBOA 1FUJA 1W7GH 2O8LA 5JDUB 1QRZA 2BDYA 3SV2H 1SGNE 2FXRA 2PKAA 1F5RA 4BTTB 1GJ6A 2BHGA 2SGDE 3SJ9A 2UUYA 1C5MD 3M36A 1XXDA 1AN1E 3GY7A 3M7QA 1QBVH 2YNBA 2G00A 5HMAA 1SMFE 2P93A 7ESTE 2PFEA 4X8VH 4LZ4B 1FN8A 3UR6A 2VVUA 1BTXA 2PV9B 1OWKA 4H6SB 5DP6A 1JIMA 2VH0A 4O97A 2D2DA 2VWMA 1TBRH 1WAYB 1LQEA 5AFYH 3TGJE 2FESH 2XTTB 2VWNA 4ESTE 1TPAE 2OINA 2VVCA 1GBLA 3FZZA 5FHTA 1C2IA 1CA0C 1FJSA 1EPTC 1LPGB 5FX5A 3A8AA 2UUJB 2ZF0H 3PROA 3RXRA 1A5GH 4ZKSU 1V2JT 1K1PA 4KKDA 3LDXH 4Y10E 1LHFH 1C1MA 4Y8ZA 1HAVA 7KMEH 4X8UH 1IQJA 2BTCE 3VB6A 1MH0A 4UFEH 4AN7A 1HAZB 3BEIB 1ANBA 2EC9H 1G3EA 4AYYB 4ZKOU 1L0ZA 2IJOB 1YLCA 1DE7H 4CR5A 1O2LA 1BMNH 1TLDA 3GY5A 3NUMA 1BA8B 1PYTD 3SGAE 4ABEA 1SR5C 1O3NA 4WJG2 1ZHPA 1LPZB 1XVOA 5EQRA 2TIOA 3GCHB 3MO9A 5HM2A 1GI8B 3RXTA 1BITA 1O5BB 1TNLA 2HGTH 5FBEA 1XMNB 1O38A 1EASA 1MD7A 1ACBE 1YM0A 2F9UA 4HGCA 4B75A 1QFKH 1SFQB 2FS9A 1BTWA 3RXGA 1O2PA 2H1UA 5E2OA 1VR1H 1P2KA 2BD2A 3FP7E 1EAIA 2G52A 2ZKSA 3PO1B 3O8BA 3RXUA 1OKXA 1YPHE 1AB9C 2VU8E 2GDDA 5LGOA 1IAUA 1SLVB 2JH6D 2Y82A 2XC0A 1GI5A 3BTGE 5A8XA 2QIQA 1OX1A 4JYUH 3BEUA 1ESAA 2FI5E 1ZTJA 1P2OA 2WPJS 3KL6A 1IQLA 1TNHA 1ZHMA 1VGCC 1MZAA 3BG4C 4XDEA 3D23A 3K65B 1K21H 1O32A 1ELTA 2M5TA 3CENA 2VNTA 1O5FH 2J2UA 1EZSC 2BY5X 3VGCC 3ZV8A 3RM2H 2A5IA 2A45B 5E0JA 4GHQA 5B6OA 1GJ7B 1GI2A 3B8JA 1TAWA 4FU9A 2PR3A 3SI3H 1RIWB 2ZWLH 1EZQA 1L1JA 3HKJB 5C3NA 4CBOA 4DW2U 4NSYA 1C5PA 3LGWA 3GY8A 1NRSH 1PPCE 1FPHH 3P92A 1XUJA 2WV4A 2BQWB 1FONA 3UPEA 4INHA 1GCTB 1RD3B 1UVTH 1GBJA 3H7OA 4YT6H 1MCVA 1P3CA 1TX7A 1OP0A 1SGRE 2AIPA 1ZJKA 1DX5M 1XUKA 3PTNA 1T4VH 4WMEA 1DANH 1GI0A 1P57B 1QL8A 1C2GA 1ELFA 2BLWA 2ZHEH 1AKSB 1FIZA 2FMJA 3AW1A 1C1NA 1TNIA 1Z1JA 3SQHE 3QTVH 4GSOA 5DP5A 2TRMA 1J8AA 3L33A 3GICB 2ZFRH 4YESB 9LPRA 2BDAA 1YPKH 3RU4D 1GHYH 1TA6A 3TK6A 1CGHA 3NK8A 4Z6AH 4UDWH 1TMTH 2F9PA 2ZDAH 3MI4A 5EG4A 6CHAC 3TJOA 1DT2A 1YC0A 3O8CA 1E38B 2XCFA 5DO4H 2BMGB 1Z8GA 1SGYE 4J1YA 1AY6H 4FU8A 2FTLE 3H5CB 1V2QT 4MDSA 3V3MA 5DP3A 2AMQA 5C1UA 1SHYA 1EAXA 1MAYA 2DE9A 1L2EA 5L30H 4R8TB 2AERH 1INCA 4BXWA 1KDQB 3KEEA 1EUFA 2W3KA 4XBBA 2C4FH 4FUHA 1GG6C 3UFAA 3S0NA 1DXPA 3RXHA 2KAIB 1SOZA 2XWAA 1BTZA 3T62A 3RXEA 1LHGH 4KTSA 4X1PU 2CMYA 4Q7YA 2ZFQH 1UTQA 1O2VA 1J14A 4WH8A 4I8JA 1C1VH 2C8WB 1BUIA 1N8OC 3W94A 2OLGA 3ZZ6A 3SORA 1S85A 1MKXH 1P03A 1FDPA 2IPHA 1BHXF 2UUFB 1VITG 2BQ7B 1TRYA 5HM9A 1UCYH 3QDZB 3UQOA 1TBQH 3OY5U 1YCPM 4AX9H 4E05H 3R3GB 1PFXC 2DE8A 1DLKB 1GHXH 1KLJH 3FP8E 1NY22 2QN5T 4K8BA 4YO9A 2HNTF 4TPYA 1G37A 3BTHE 3P8GA 1C2FA 1QGFA 3T26A 1ZPBA 9ESTA 5E2PA 5I25A 1D3DB 2R0KA 4SGBE 1Y8TA 2GTBA 4CH8B 2FP7B 4Y71A 2FOCA 2QYIA 7LPRA 1ZR0A 2CF9H 4MPVA 5ETXA 1GBMA 1P2NA 4NG9H 2BQ6B 2TBSA 1FMGA 1GMDF 2FO9A 1WQVH 2ZC9H 1FZZA 1AVWA 4JZDH 2W3IA 4NWKA 3ZVEA 4WVPE 1GBAA 2ANWA 3URDA 3LC3A 3E8LA 2PKAB 1Y3WA 5F03A 2Z6BD 2WPMS 3BG4B 4CRGA 4WH6A 3SV9A 2OXSA 3MU4A 3ZZ4A 1NTPA 1YF4A 1P9UA 2BDBA 3T5FH 1GHVH 2C90B 3LGIA 5GPIB 3RXQA 8GCHG 3SUGA 3K9XB 5EXNA 2Z3CA 5FPSA 2HLCA 2STAE 1LKAA 4BAOB 1BDAA 3RXCA 3TJUA 5ESTE 3LH1A 1Y3UA 2OD3B 3Q3KA 2CXVA 2VJ1A 5EQSA 5LPRA 6GCHF 4GHTA 3RU4E 2GGVB 3JZ1B 1NS3A 1KLTA 4NFEA 4ABGA 3VXEH 1ZLRA 1EXFA 3RXKA 4U2WA 2XRCA 1GJCB 1ZJDA 1AUJA 1ZRKA 5AVDA 1RTLA 1TONA 2XBVA 4MQAA 1UCYE 3M5NA 3KGPA 3EA8A 4Q7ZA 4RSPA 3MU8A 1L1GA 1SGPE 1EATA 2ZQ1A 3OY6U 2ANMH 3UR9A 4OGYA 2ULLA 3M3TA 3MO3A 3NWUA 4H42U 1Y3XA 2FOEA 3ZZ8A 1O3IA 2Z3EA 3ATIA 1P9SA 2Z3DA 4I8KA 1TGSZ 4HZHA 4Y0ZE 3MH4A 5FPYA 3SGQE 1VCQA 1HNEE 1O5GH 1AMHA 2GV7A 3ENSB 2Q6FA 4FUCA 3UUZA 3UIRA 2Y5GA 2AGEX 1K2I1 2FLRH 1H9HE 1JRTA 1K1MA 1NU7B 1F5LA 1Z8IB 2BD5A 4DJZB 1HB0B 1JXPA 2C8XB 2ZDMA 3ATMA 4X1RU 2QXGA 1O2IA 4I31A 3PLBA 2V6NA 1AFQC 1SGFG 3MU0A 3P17H 1OOKB 1TIOA 5EPNA 1CGIE 3HGNA 4IMQA 2Z9JA 4XSKU 3NKKA 3S69A 2B8OH 1P02A 1A4WH 1ANCA 1BTPA 5JBBS 5IDKA 2F83A 1SVPA 4Q80A 3SU6A 5LH8A 4A1VA 4HI3A 1H4WA 2ZDNA 2Q6DA 1TB6H 3RLYH 1D3QB 1SLUB 1V2UT 4BAHB 2AGGX 1GHZA 8KME2 2ZG0H 1GHBF 1DY8A 3ZVCA 2AYWA 1N8OB 1GBDA 3DFLA 1E0FD 2JKHA 4YLQH 2C8ZB 2BD3A 5TJXA 3LT3A 4GCHG 5TCCA 1A2CH 2VIOA 5JB9S 3TITA 2WPHS 1ELAA 5SGAE 1QL9A 1CBWC 1UCYK 5C67A 1QJ7B 1F0SA 3RUOA 2ZDVH 1FY1A 1O0DH 1JRSA 4UD9H 2UWPA 1MQ6A 1TRNA 3DT0H 4WMDA 1PQ7A 4A1TA 3A7VA 1GI3A 2OTVA 4BTUB 2ZPSA 1E37B 1HCGA 4WY3A 1WTGH 2BY9X 4ZXXH 5ABWA 2SGQE 4AOQA 3BTDE 1NFYA 2G55A 3T29A 1AFQB 2QV1A 2ZGCA 3ZV9A 4ABBA 3BIUH 4LXBH 6GCHG 2CJIA 1O3GA 1GL1A 5FXLA 3Q77A 2GT7A 1DS2E 1MU8B 1QTFA 1QA0A 1BTUA 3SJ8A 1S5SA 3OTJE 2HPPH 3BTKE 2ZGBH 2PKSB 2NU2E 1PQ5A 1XKAC 3EA9A 2GZ8A 2QY0B 1W11U 1NO9H 3RDZA 1A5HA 2A32A 1UHBB 1NPMA 4MNVA 1ZTKA 5DGJA 3UY9A 3SGBE 3SNBA 5FAHA 1XKBC 1YBWA 5DK1A 2G4UA 5EOKA 4Z0KA 1BRAA 2ALPA 4Y11E 4NWLA 1BOQA 3HATH 4WXIA 6CHAB 4F4OC 1O3EA 2PHBA 3M3VA 4LK4A 1F0UA 1DWEH 1OYTH 4UE7H 1TQ0B 1O2HA 2OBQA 1O3KA 2GZ9A 1TWXB 2FX4A 2UUKB 2BLOA 5DP7A 3SV8A 3D49H 1TALA 3ZVGA 2NU3E 2A4RA 1DDJA 2CHAB 3P6ZB 1AO5A 1FIWA 2V3OH 2H9TH 2H9EH 5GDSH 5A0AE 3M5OA 3GY2A 4K3JA 3PB1E 3KQCA 5A0CA 3VB7A 2HVXA 1K1OA 3QUMP 3ZVAA 1SPJA 3A88A 2BXUH 3QO6A 4HFPB 1SC8U 3DHKH 1PPZA 1BBRE 2ZCLP 1QBOA 2GD4B 1HAVB 4AG2A 4Y6DA 2W5EA 1V2KT 4XBDA 5PTPA 3LC5A 1KDQA 2P3FH 1OSSA 1C5XB 1LCYA 4M7GA 4DIHH 5T6FA 1HAYB 1W7XH 4I8GA 4JZEH 1P10A 3O8DA 1GBFA 2FYQA 2Z7FE 3U9AH 4D9QA 1V2OT 4LOYH 3B9FH 1ETRH 3CS7A 2ZGHA 3VGCB 1QNJA 1GJDB 2YNAA 1UTPA 1H1BA 1ANEA 2BXTH 3L3TA 1E34B 4X2WA 2ZNKH 3PMAB 3NCLA 1EOJA 5GJ4B 1TMBH 3ODFA 3PLKA 1C4V2 4R0IA 1LDTT 3R0FA 4BAQB 2F9NA 3GOVB 3BIVH 1NM6A 3GCTG 4INLA 1BCUH 2D1JA 5C2ZA 1IQNA 1DFPA 2RA3A 1Z7KA 1G36A 2OC0A 2ANKH 3TIUA 1AUTC 1ZRBA 4OS7A 1GI1A 4Y0YE 1K22H 1LTOA 2P8OC 1HAIH 1ZTLA 1MBQA 3TJVA 5K7RA 3VB4A 1DITH 3RXAA 1NC6A 4SGAE 4FUDA 1TABE 1HJ8A 2V0BA 3EA7A 1O39A 2VVVA 4KP0A 2VINA 1UK4A 3IITA 1S82A 3D62A 3A89A 1QBNA 2FLBH 2QXJA 1CQQA 5JYIA 1ELEE 4ZXYH 3UOUA 1CA0B 2A2XH 3ZVDA 1OPHB 2B5TB 1P3EA 3I77A 3P8FA 2VIQA 2Y81A 3UOPA 1YYY1 2AMPA 2RDLA 1IQEA 2AMDA 3HK3B 1QIXB 4VGCC 3AVZA 2GV6A 1ELGA 4FUGA 1AVXA 3SUDA 1MQ5A 1W0YH 1C5ZB 1EZXC 4ZHMU 1QJ1B 1O37A 1WU1A 1QL7A 1VGCB 3RXDA 4AB9A 1QA7A 3QGJA 1AGJA 1C5OH 1GMHG 1TOCB 1P01A 4O3UA 2OUAA 1DXWA 1EKBB 3Q3YA 1PPGE 2P8OB 5T6DA 1KYNA 1UK3A 2ZCKP 4FU7A 2JETB 1SFIA 4D7FA 4Y8YA 2RA0A 5DP4A 4LZ1H 1KTTB 1HDTH 3E90B 3PWCA 4AB8A 1GJ5H 1LKBA 5EU8A 1HAGE 2OC8A 3RC6A 3ZZ5A 2G8TA 1G3CA 2J9NA 4B1TA 2RG3A 1GHAG 1YLDA 2PWXA 4WMFA 3OYPA 5CMXH 1DICA 4IMZA 2ZPQA 2G4TA 1X7AC 1A0JA 3A86A 3ATKA 4AG1A 3SJKA 1DSUA 3U8OH 1BZXE 4DIIH 3RXFA 2QF3A 2VB0A 4CRAA 5GXPA 2WUBA 2R2WU 3ATLA 3NXPA 1C5VA 4B2BA 4JYTA 1V2NT 5CE1A 1MBMA 2PGQB 1WQSA 1MZDA 4RKOB 2A1DB 1UVUH 2ZHQH 4O9VA 4K69A 1ELBA 3RU4T 1SLWB 1YPGH 1SGCA 3SOSA 3LIWA 1C4U2 1OP8A 4BXSA 4X6OA 1EB1H 3MTYA 2SNWA 1DWDH 3OU0A 1UO6A 2GCTB 2VIVA 4B2CA 1D6RA 1OP2A 3RXBA 1IOEA 3GCTF 3M37A 5EQQA 2ZFSA 1C1UH 1GBHA 1SQOA 3ODDA 3TPIZ 2R2MB 4ISHH 3V0XA 3UTUH 3ZZ3A 1GDUA 2J95A 2BY7X 4H6TA 1QQUA 3M5LA 2ZGJA 4KELA 1Q2WA 1J15A 2PUQH 2BX4A 1GBBA 2IN2A 2W26A 3BTEE 2JH0D 3EGKH 1O3LA 5A2MH 1TGTA 2PUXB 2Y5FA 2R3UA 2FOAA 1RTKA 5EPYA 1JBUH 2W7SA 5EODA 2BVRH 3UWIA 1PPHE 1P05A 1MU6B 1HAXB 1LHEH 2AS9A 3SU2A 1NROH 1GMDG 3NPSA 1U6QA 2BD8A 2XWBI 2FOHA 8ESTE 1ESTA 1YKTA 4OS1A 3SNAA 3STIA 1C9TA 4X2XA 1HBTH 2GCHG 4HTCH 2H5DA 1ANDA 2I6QA 2O9QA 4UFGH 2BM2A 1SSXA 4OS2A 3A7ZA 1RIWC 1XVMA 4WF8A 2LNCA 3SNDA 1O2MA 1BMMH 1S84A 1UHBA 3RXSA 1CT0E 3K2UA 1DUAA 2HNTC 4AORA 2B0FA 1TQ7B 2BDHA 3V7TA 5C5NA 2VIDA 1HIAA 2B9LA 1WYKA 1UVPA 8LPRA 1CHOG 1DWCH 1FY4A 1P8VC 1QURH 1GBCA 1GJ8B 1ARBA 4RN6A 3E1XB 3LH3A 4NA8A 3RXPA 2P94A 3U8RH 1L1NA 2ILNA 2GMTC 1QR3E 3RC5A 3VFEA 2ZPRA 5DKMA 3T27A 1UVSH 1QRWA 1Y59T 1NFXA 2JH5D 1CE5A 1IQGA 1L4ZA 1UVOA 1K1IA 1Z6EA 4TYDA 5T6GA 2G5VA 1P11E 4K1SA 4MG3A 1C5WB 4K2YA 1W0ZU 4K1EA 1O2GH 1DWBH 1CHOF 2GKVE 5C20A 1BMAA 1HLTH 1MKWH 3A85A 4NFFA 1VJAU 2ZI2H 2BD9A 1SGDE 1O3HA 1EOLA 4O03A 1BTYA 1AHTH 1A7SA 1TX6A 3Q00A 1GPZA 2ZHDA 5TCAA 2GCHF 3AAVA 4XBCA 4ABJA 3ZVBA 2GCTC 4ZAEA 3MH7A 2FX6A 1PJPA 3ZZ7A 3M7UA 1N1LA 1ZZZA 2QAAA 1O35A 1P0SH 1O2KA 3F9EA 3SNCA 3ESTA 3HKIB 5A8ZA 4ABIA 4E7NA 1IQIA 1BIOA 1HXEH 4QT8C 4PROA 1YPEH 2ZFTA 1OWIA 1MTSA 3OSYA 3DFJA 3GY3A 1GGDC 4IW4E 2STBE 1IQKA 2A2QH 1ABJH 4ZROA 3A84A 2C8YB 3V12A 5F8XA 4GLYA 1CT4E 4A5TS 3PTBA 4IBLH 5EW2H 4WXVA 3FFGA 4FXGH 1FN6A 4B76A 1TYNA 3UNQA 1KXFA 5EXMA 3JZ2B 2ZCHP 1KLIH 4TWWA 1EPTB 1P04A 3RMLH 3PV4A 3DA9B 2EEKA 2FI3E 2VWOA 3GCOA 2PLXA 1IHSH 1DY9A 3TNTA 4CHAB 4X2YA 1AWHB 1QQ4A 1JWTA 2GP9B 2BD4A 4ABDA 1GJAB 1LHCH 4IC5A 5LPEA 2FOBA 5DJ7A 3E16B 4O3TA 1GVKB 4NIXA 1J17T 3KNXA 3SJOA 1WUNH 3PO1C 1VCWA 2J92A 5GCHF 1Y3YA 2P16A 2BY8X 5C5OA 2A4QA 5HYOA 1LQDB 1V2VT 2I6SA 4Y76A 2A4GA 1B5GH 1L4DA 4Y7AA 1NRPH 3E0PB 3A8CA 7GCHF 4GPGA 4YM9A 1CT2E 5AFZH 1GGDB 2ZU2A 1O33A 1GDQA 4X1NU 3TK9A 2A5KA 1MCTA 1BJUA 3A7TA 1FLEE 1EJNA 4NIVA 5A8YA 4UONA 1OWJA 1T8NA 5EGMA 2F91A 5T3HA 1AB9B 4ISNA 3KQBA 3LGVA 3A7YA 2BYAX 4ZKRU 3A87A 1KTSB 3SHCH 5AF9H 3RMNH 1S6FA 3V13A 2OQ5A 3BTTE 2Z9IA 3PMBB 3QWCH 2HWLB 8GCHF 3ZZDA 1A5IA 1ZSLA 5CHAB 2F9BH 1FPCH 2FTMA 3UNSA 1SQTA 2VIPA 2A7CA 3FP6E 1C2KA 2BZAA 3GDUA 2H2ZA 1EZUC 3ZVFA 4THNH 4MVNA 1SOTA 1DSTA 1A3EH 2FOGA 2XXLA 4JZ1A 2R3YA 3E3TA 3M5MA 1HPGA 4IGDA 1HAPH 1DLEA 1C5YB 1WV7H 2CN0H 3G01A 1C1RA 4IN1A 1ID5H 4YOJA 3EAJA 1G9IE 3O8RA 2P3UB 2WPKS 1TGNA 3UWJH 2QC2A 1NT1A 1NRNH 1BBRK 4YT7H 3GCNA 2ZU5A 4CRFA 1KXDA 3LJJA 3FAOA 2THFB 4K1TA 3ZZCA 2QCYA 2ZU3A 5DP9A 2SGEE 2ALVA 1CVWH 2FI4E 2ZP0H 1CHGA 2PSYA 1FV9A 1T7CA 3MH5A 2ZDKA 3SW2B 3U8TH 3AAUA 4VGCB 4D76A 3AW0A 1GJ4H 5DPAA 2D26C 5HXFA 1LO6A 1C1OA 1XXFA 4K5ZA 3RC4A 1PPEE 2VGCB 3BTFE 1HYLA 1FXYA 3FANA 4ABHA 1BT7A 1M9UA 1O2UA 1ZMNA 2ZA5A 3S9BA 1LVYA 3UREA 5E0GA 1AD8H 2P59A 4NIWA 1H9LB 4NA7A 2VIWA 3MFJA 1TPPA 4Y8XA 5GCHG 2WPIS 5DG6A 1S81A 2CGAA 4BAMB 3F68H 3SN8A 1H9IE 1NN6A 1S6HA 1YP9A 2A31A 1W2KH 1WOFA 1ZSKA 3TU7H 1G30B 1O3BA 2Y5HA 5IYTA 2R0LA 2ESTE 5AHGH 2Q6GA 4DURA 2TGTA 2CV3A 3LGUA 1FY8E 3MOCA 3U1IB 1C5RA 5L6NH 1MTVA 4WWYA 1P12E 2J4IA 1GI4A 4ZMAH 1EJAA 2OQUA 1BRBE 3T28A 4K8YA 5EW1H 1MMJN 2PKSC 1EQ9A 1F7ZA 2LPRA 1RTFB 1GL0E 1KXAA 1TPOA 1D9IA 1MKWK 2G81E 2BLQA 1GJBB 1SBWA 2ZZUH 3SZNA 4Q2KA 1HIAB 1AFEH 1OWEA 3PWBA 2V3HH 4I8HA 4JZIA 4X2VA 4ISIH 3U1JB 2QXIA 3E6PH 3EQ0H 4MTBA 3U69H 1MKXK 1QRXA 2NU0E 4JK5A 1S83A 2A4OA 3F6UH 1DM4B 1V2WT 2H6MA 4JCNA 1AE5A 4ZHAA 3SU1A 5ESBA 1OWDA 1D4PB 4BNRA 1VZQH 1B0FA 2ZU1A 1NZQH 3DUXH 2B7DH 3F9FA 4IN2A 1ELVA 4OGXA 4XOJA 1AZ8A 5JPMH 2TGAA 4NZLA 1KIGH 5BPEA 2K1QA 1NRRH 1DUEA 4X6MA 2G5NA 3MO6A 2HRVA 4RKJB 1C5NH 4CBNA 5J4QA 1H8IH 5A09A 3M61U 1SB1H 4DGJA 3QZQA 2C3SA 1WTHD 1GWAA 1Y5BT 1Z8RA 2GT8A 1C5TA 1V3XA 2XCNA 2BDIA 1N6XA 1C2LA 3S9CA 3SI4H 4GAWA 2BDCA 4KGAA 3F9HA 1O5EH 1TOMH 3KQEA 4DT7B 1UMAH 3E0NB 1C1TA 3LJOA 4ZKNU 2FOFA 1W3CA 3TH2H 1T4UH 1ORFA 4F49A 1A3BH 1PQAA 1T32A 3PLPA 1CO7E
chains in the Genus database with same CATH superfamily
1SGQE 2NWNA 4FUBA 3HGPA 4GUXA 1ZGIA 4K60A 4OS5A 4CRDA 3A81A 5JB8S 1K1NA 1Y3VA 1TPSA 5G4BA 5GIBA 3CP7A 1HGTH 1HJAC 1P2QA 1WSSH 3KF2A 1P2JA 1SGFA 2ODQA 3PRDA 3N7DA 5B6LA 3SJIA 2CF8H 1J9CH 3C1KA 1CU1A 2P3TB 3SBKA 2QA9E 1BHXB 1WCZA 1HRTH 2AHME 2GMTB 2ZDLA 3PV5A 3MWIU 4X8TH 1KXCA 1O5AB 4DVAU 1O2WA 4CRCA 4I7YH 3KYFA 4YTAA 1O3JA 3SU3A 1BRUP 1IQMA 1BB0B 1GCTC 3IWMA 4ZUHA 5F6MA 4MNYA 5FCRA 2KAIA 3QX5H 3KQDA 3BTQE 4X6NA 1AE8H 1ZPZA 5F8ZA 1GCDA 4JMYA 1ELCA 3Q3XA 2AIQA 1FAXA 1HXFH 3A8DA 3T25A 3DD2H 5C1YA 1S0RA 3NRLA 1SGIB 3M7TA 1PYTC 3SV6A 3T2NA 1SHHB 5E0HA 3RXOA 1W10U 1TA2A 1GDNA 2ODYB 1K1JA 3SU5A 6LPRA 1BTHH 5LPFA 2Y6TA 2AFQB 2A7HA 2VWLA 3KCGH 1W12U 4DOQA 2XBXA 1OXGA 1FQ3A 4MLFB 2GVFA 3PYHA 4X8SH 1YPMH 1CBWB 2ZQ2A 5EJLA 2K0QA 2ANYA 4NCYA 3MNBA 2BDGA 3NZIA 3PMHB 2D8WA 2HPQH 1E35B 2CK3D 3RXIA 4IS5A 4UFDH 1QB6A 1JIRA 3MU5A 4JZFH 1THSH 4TY7A 1XUGA 1Y5AT 3EDXB 1P2MA 1K1LA 3SU0A 3GYMA 4FVBA 1LVOA 1H8ED 4MPUA 1T31A 3H09A 1WBGB 3P8OA 1GHAF 1H8DH 1GI7B 4JYVH 5L2YH 1UTKA 4A7IB 1PPBH 2WV5A 4H4FA 1BJVA 4Y79A 2ZU4A 1C5UA 2WPLS 2ODPA 1W0KD 3W95A 4GCHF 3ZYEA 1ESBA 1BRCE 3SU4A 2BB4A 5H4IB 2SGFE 1SQAA 2C93B 1FY5A 1XUHA 1HUTH 1O3OA 2PP6A 1O5DH 2JETC 2XC4A 2UWOA 4TPIZ 3A7WA 1F0RA 3QLPH 1TGCA 1QB1A 1KXEA 2P95A 3MH6A 3BSQA 1EAWA 1RGQA 1MTUA 3MYWA 1UJ1A 1BMFD 3S9AA 3VB5A 2V35A 1O3PB 3A83A 3VPKA 2AEIH 2F3CE 3ATWA 3GYLB 4ACBA 1O3CA 2OCVB 1LVBA 4AFUA 3SV7A 4Y7BA 1EJMA 2BLVA 3VEQB 3WWBA 2CHAC 1EX3A 1GHWH 1G3BA 1YCPK 1O34A 3K6YA 5JBCS 2O8WA 4NZQA 2A0QB 3SO3A 2Z94A 4KTUA 1G32B 4YLUA 1VJ9U 1C2EA 1Q3XA 1WXRA 1C1SA 1C2DA 2Z9LA 1SGEE 2WUCA 2Z9GA 1O5CB 1RRKA 1YGCH 4NGAH 5FL7D 2ZO3H 3GISB 3L6PA 2HOBA 1C1WH 1SI5H 3E91A 1KMHB 1GMCF 5FCKA 1ELDE 1HAOH 1SL3A 1OYQA 1V2ST 3CS0A 3KHVA 1V2LT 4YOGA 1RJXB 3MNSA 2QF4A 3P70B 3QN7A 3H7TA 1KSNA 4CH2B 1C5SA 2Y7XA 1T8LA 3F2HA 2BX3A 1PPFE 1THRH 1D3PB 2H9HA 3UNRA 1Z1IA 1GMCG 3GDSA 4AYVB 1HAHH 3MMGA 4BOHA 1RXPA 4F48B 1MAXA 3TLOA 1J16A 3F1SB 5KECA 5L2ZH 1B7XB 1PQ8A 1O2XA 2WHXA 5F8TA 1GI9B 4ISLA 1A61H 1JOUB 4A92A 4FUIA 1RS0A 1TMUH 3LPRA 2FDAA 3TJNA 1UTNA 3U28C 7GCHG 3ELAH 3SHAH 4BANB 1C2MA 1W14U 2BY6X 1H8HD 3KIDU 1YPJH 3OEED 1UTMA 2ZHFH 1TNKA 3TNSA 4DCDA 1C1QA 1TFXA 4FUJA 1Z8JB 2ZECA 2TPIZ 3LGTA 1C5LH 1O2OA 2BZ6H 1O2QA 2YMSD 2Y7ZA 4DG4A 1Q31A 2QXHA 2G51A 2XBWA 2PGBB 3TH3H 1Z71A 2SNVA 1ABIH 3ZIAD 3ZZ9A 1GJ9B 2A5AA 4J2YB 4GVUA 4DY7B 1N6YA 3BG8A 1CGJE 1XX9A 1MTWA 1V2PT 4B73A 3RXJA 2NU1E 2ZEBA 1V2RT 2ZTYA 4ZHLU 1TRMA 2TGDA 3BTME 3QGNB 1AIXH 2FWWA 3S7HB 3PM3A 4DT4A 1W8BH 2FYRA 2VGCC 2EA3A 1GVZA 2EQNA 3I78A 2IOTA 1TGBA 1ZGVA 4U32A 1E36B 1O31A 1SLXB 2ZIQH 1ZMJA 1AWFH 1GMHF 3C27B 2O8UA 1ETSH 1BBRH 2H5CA 1F92A 1NU9A 1UTJA 2F4LA 3ZZBA 3QZRA 2J34A 2F9OA 4ZH8A 2O8TA 2FIRH 4OS6A 1UTOA 1TBZH 2HNTE 2XW9A 3OEHD 4A1XA 4INKA 2AGIX 2OC1A 4ABAA 2ZFFH 4D9RA 3LONA 2QF0A 4MNWA 4D7GA 1NFWA 3KN2A 3SQEE 4MNXA 1C4Y2 3M35A 5DP8A 2OC7A 3PMJA 1T8OA 3GY6A 4FUEA 1BQYA 1NFUA 4AFQA 1A0LA 1AU8A 1F0TA 1V2TT 5HGGA 3STJA 3SUFA 3I29A 1ZPCA 1EP6A 1NBME 2Q1JA 2ZGXH 4B6FA 1DVAH 1UTLM 1MTNC 1TNGA 2A7JA 2J94A 1O36A 1HJAB 1C9PA 1O2TA 2O8MA 1GBIA 1QHRB 3LGYA 3HK6B 4JK6A 1CSOE 3M3SA 1VITH 3D65E 3F0PA 4NA9H 1NBMD 4X6PA 5GWZA 1FY3A 2KX4A 3EE0B 4UFFH 4ZCNA 2PW8H 4UEHH 1YWUA 2RFKC 1ZMLA 1P09A 2BOKA 1AQ7A 1GHBG 1BMLA 3TK5A 4AFSA 1XUIA 3ZZAA 3F9GA 2NU4E 1FI8A 3OAAD 1GVLA 1YY3A 2FS8A 3S7KB 3GCHC 2XC5A 4E06H 1D3TB 1O3DA 1S0QA 1NESE 3MNXA 1OS8A 3RXVA 4I8LA 4BTIB 3WY8A 1QZ8A 3P95A 4Q7XA 4I33A 1IQHA 3ITIA 5A0BA 1V6DA 2SGPE 4XFQA 1K9OE 2EI8A 4IC6A 4AFZA 2UWLA 3SUEA 1QJ6B 4CR9A 4CREA 5JBAS 1YPHC 2YOLA 1O2NA 2GDEH 5CHAC 1YCPH 1KY9A 3RMMH 3RP2A 5K0HA 3P8NA 4TWYA 1P06A 4ISOA 2DUCA 3A7XA 3BEFB 1HJ9A 1F5KU 1QCPA 3MU1A 5E8EH 1GBEA 3RMOH 1K28D 2SFAA 3N7OA 3EYDA 4B2AA 5HKKD 2FOMB 4TY6A 2QGRA 1C5QA 3VB3A 1DOJA 3ZYDA 3LOXA 1SG8B 1ZYOA 4B74A 4U30A 1A1RA 1UK2A 3FVFB 5I46H 2VH6A 1AKSA 2Y80A 1ARCA 4X1QU 3TVJB 2EI6A 4ABFA 3BV9B 1ZOMA 2FEQH 4OS4A 1A0HB 5BRRE 1G3DA 3Q76A 1G2LA 1AI8H 1WDIA 5FBIA 3A80A 1NRQH 1GG6B 3UQVA 1Z6JH 3GY4A 3RXMA 2PTNA 4YZUA 1W13U 2GZ7A 1EB2A 5J4SA 2FPZA 2WINI 1O2YA 2R9PA 4NSVA 1VITF 2GX4A 1TNJA 1ZSJA 2ASUB 2RCEA 1C2JA 1MUEB 1TX8A 1TE0A 1JMOH 1XUFA 3A82A 5EXLA 4X0WU 3TH4H 1V2MT 3OX7U 3A8BA 4D8NA 3BN9A 2WYGA 4MPXA 5C1XA 1QB9A 2BOHB 2PSXA 4YOIA 4AZ2B 3BTWE 3LU9B 3MHWU 4ASHA 3VXFH 4AGKA 2HALA 4NIYA 1O2JA 4BAKB 1GBKA 3U98H 3MNCA 1C2HA 1HV7A 1YPLH 3SNEA 1LHDH 1VCPA 4B71A 1A46H 3GDVA 2ZTZA 2OP9A 2TGPZ 4AGJA 1SGTA 2ZHWH 1B0EA 1EP5A 2FM2A 1O3AA 1Y5UT 1EAUA 1THPB 3URCA 1XM1A 2KR7A 2WZQA 1AVGH 3QTOH 1T8MA 4A6LA 2WYJA 1GI6A 2W7UA 3BF6H 1MTNB 2ZFPH 1D6WA 3DSGA 1RFNA 1QY6A 1LVMA 2BVXH 4CRBA 1CA8B 3F2GA 3K6ZA 1ZHRA 3HPTB 3LKWA 3WW7A 4X1SU 2BVSH 3RLWH 4CHAC 2QE7D 3QK1A 2AH4X 3AASA 5JBTA 5FX6A 4MPWA 2PTCE 1FNIA 1O2ZA 2FODA 2BD7A 1ETTH 1F2SE 4FVDA 1HFDA 1GBTA 4E7RG 5EJ1A 6ESTA 1P2IA 3TGKE 5FPTA 4KTCA 1C1PA 2ZTXA 3FZDA 3TGIE 4U01A 1IHTH 2XBYA 1AZZA 2XYAA 3IG6B 2J38A 1KXBA 4XE4A 2XNIA 1OWHA 1DPOA 2FZZA 3RM0H 3RXLA 1G2MA 1O30A 2F9VA 1EPTA 1O3FA 1O3MA 1IQFA 1LPKB 1FAKH 2EI7A 2Z9KA 1LMWB 1O2SA 4FUFA 1O2RA 4I32A 1MD8A 2SGAA 3B23B 2OBOA 1FUJA 1E1RD 1W7GH 2O8LA 2K8IA 5JDUB 1QRZA 2BDYA 3SV2H 1SGNE 2FXRA 2PKAA 1F5RA 4BTTB 1GJ6A 2BHGA 2SGDE 5EJZA 3SJ9A 2J97A 2UUYA 1C5MD 3M36A 1XXDA 1AN1E 3GY7A 3M7QA 1QBVH 2YNBA 2G00A 5HMAA 1SMFE 2P93A 7ESTE 2PFEA 4X8VH 4LZ4B 1FN8A 3UR6A 2VVUA 1BTXA 2PV9B 1OWKA 4H6SB 5DP6A 1JIMA 2VH0A 4O97A 2D2DA 2VWMA 1TBRH 1WAYB 1LQEA 5AFYH 3TGJE 2FESH 2XTTB 2VWNA 4ESTE 1TPAE 2OINA 2VVCA 1GBLA 3FZZA 5FHTA 1C2IA 1OHHD 1CA0C 1FJSA 2YMSC 1EPTC 1LPGB 2J98A 5FX5A 1S6LA 3A8AA 2UUJB 2ZF0H 3N99A 3PROA 3RXRA 1A5GH 4ZKSU 1V2JT 3SZEA 1K1PA 4F55A 4KKDA 3LDXH 4Y10E 1LHFH 1C1MA 4Y8ZA 1HAVA 7KMEH 1UW7A 4X8UH 1IQJA 2BTCE 3VB6A 1MH0A 4UFEH 4AN7A 1HAZB 3BEIB 1ANBA 2EC9H 1G3EA 2LELA 4AYYB 4ZKOU 1L0ZA 2IJOB 1YLCA 1DE7H 4CR5A 1O2LA 1BMNH 1TLDA 3GY5A 3NUMA 1BA8B 1PYTD 3SGAE 4ABEA 1SR5C 1O3NA 4WJG2 1ZHPA 1LPZB 1XVOA 5EQRA 2TIOA 3GCHB 3MO9A 5HM2A 1GI8B 3RXTA 1BITA 1O5BB 1TNLA 2HGTH 5FBEA 1XMNB 1O38A 1EASA 1MD7A 1ACBE 1YM0A 2F9UA 4HGCA 4B75A 1QFKH 1SFQB 2FS9A 1BTWA 3RXGA 1O2PA 2H1UA 5E2OA 1VR1H 1P2KA 2BD2A 3FP7E 1EAIA 2G52A 2ZKSA 2JDID 3PO1B 3O8BA 3RXUA 1OKXA 1YPHE 1AB9C 2VU8E 2GDDA 5LGOA 1IAUA 1SLVB 2JH6D 2Y82A 2XC0A 1GI5A 3BTGE 5A8XA 2QIQA 1OX1A 4JYUH 3BEUA 1ESAA 3UAIC 2FI5E 1ZTJA 1P2OA 2WPJS 5C0TA 3KL6A 1IQLA 1TNHA 1ZHMA 1VGCC 1MZAA 3BG4C 4XDEA 3D23A 3K65B 1K21H 1O32A 1ELTA 2M5TA 3CENA 2VNTA 1O5FH 2J2UA 1EZSC 2BY5X 3VGCC 3ZV8A 3RM2H 2A5IA 2A45B 5E0JA 4GHQA 5B6OA 1GJ7B 1GI2A 3B8JA 1TAWA 4FU9A 2PR3A 3SI3H 1RIWB 2ZWLH 1EZQA 1L1JA 3HKJB 5C3NA 4CBOA 4DW2U 4NSYA 2V7QD 1C5PA 3LGWA 3GY8A 1NRSH 1PPCE 1FPHH 3P92A 1XUJA 2WV4A 2BQWB 1FONA 3UPEA 4INHA 1GCTB 1RD3B 1UVTH 1GBJA 3H7OA 3UB0A 4YT6H 1MCVA 1P3CA 1TX7A 1OP0A 1SGRE 2AIPA 1ZJKA 1DX5M 1XUKA 3MQKC 3PTNA 1T4VH 4WMEA 1DANH 1GI0A 1P57B 1QL8A 1C2GA 1ELFA 2BLWA 2ZHEH 1AKSB 3FOAA 1FIZA 2FMJA 3AW1A 1C1NA 1TNIA 1Z1JA 3SQHE 3QTVH 4GSOA 5DP5A 2TRMA 1J8AA 2VBCA 3L33A 3GICB 2ZFRH 4YESB 9LPRA 2BDAA 1YPKH 3RU4D 1GHYH 1TA6A 3TK6A 1CGHA 3NK8A 4Z6AH 4UDWH 1TMTH 2F9PA 2ZDAH 3MI4A 3KYGA 5EG4A 6CHAC 5IK2D 3TJOA 1DT2A 1YC0A 3O8CA 1E38B 2XCFA 5DO4H 2BMGB 1Z8GA 1SGYE 4J1YA 1AY6H 4FU8A 2FTLE 3H5CB 1V2QT 4MDSA 3V3MA 3CNRA 5DP3A 2AMQA 5C1UA 1SHYA 1EAXA 1MAYA 2DE9A 1L2EA 5L30H 4R8TB 2HVYB 2AERH 1INCA 4BXWA 1KDQB 3KEEA 1EUFA 2W3KA 4XBBA 2C4FH 4FUHA 1GG6C 3UFAA 3S0NA 1DXPA 3RXHA 2KAIB 1SOZA 2XWAA 1BTZA 3T62A 3RXEA 1LHGH 4KTSA 4X1PU 2CMYA 4Q7YA 2ZFQH 1UTQA 1O2VA 1J14A 4WH8A 4I8JA 1C1VH 2C8WB 1BUIA 1N8OC 3W94A 2OLGA 3ZZ6A 3SORA 1S85A 1MKXH 1P03A 1FDPA 2IPHA 1BHXF 2UUFB 1SKYE 1VITG 2BQ7B 4OM9A 1TRYA 5HM9A 1UCYH 3QDZB 3UQOA 1TBQH 3OY5U 1YCPM 5KGOA 3FN8A 4AX9H 4E05H 3R3GB 1PFXC 2DE8A 1DLKB 1GHXH 1KLJH 3FP8E 1NY22 2QN5T 4K8BA 4YO9A 2HNTF 4TPYA 1G37A 3BTHE 3P8GA 1C2FA 1QGFA 3T26A 1ZPBA 9ESTA 5E2PA 5I25A 1D3DB 2R0KA 4SGBE 1Y8TA 2GTBA 4CH8B 2FP7B 4Y71A 2FOCA 2QYIA 7LPRA 1ZR0A 2CF9H 4MPVA 5ETXA 1GBMA 1P2NA 4NG9H 2BQ6B 2TBSA 1FMGA 1GMDF 2FO9A 1WQVH 2ZC9H 1FZZA 1AVWA 4JZDH 2W3IA 4NWKA 3ZVEA 4WVPE 1GBAA 2ANWA 3URDA 3LC3A 3E8LA 2PKAB 5CHBA 1Y3WA 5F03A 2Z6BD 3OFND 2WPMS 3BG4B 4CRGA 4WH6A 3SV9A 2OXSA 3MU4A 3ZZ4A 1NTPA 1YF4A 1P9UA 2BDBA 3T5FH 1GHVH 2C90B 3LGIA 5GPIB 3RXQA 8GCHG 3SUGA 3K9XB 5EXNA 2Z3CA 5FPSA 2HLCA 2STAE 1LKAA 4BAOB 1BDAA 1COWD 3RXCA 3TJUA 5ESTE 3LH1A 1Y3UA 2OD3B 3Q3KA 2CXVA 2VJ1A 5EQSA 5LPRA 6GCHF 4GHTA 3RU4E 2GGVB 3JZ1B 1NS3A 1KLTA 1W0JD 4NFEA 4ABGA 3VXEH 1ZLRA 1EXFA 3RXKA 4U2WA 2XRCA 1GJCB 1ZJDA 1AUJA 1ZRKA 5AVDA 1RTLA 1TONA 2XBVA 4MQAA 1UCYE 3M5NA 3KGPA 2IPQX 2YMSB 3EA8A 4Q7ZA 4RSPA 3MU8A 1L1GA 1SGPE 1EATA 2ZQ1A 3OY6U 2ANMH 3UR9A 4OGYA 2ULLA 3M3TA 3MO3A 3NWUA 4H42U 1Y3XA 2FOEA 3ZZ8A 1O3IA 2Z3EA 3ATIA 1P9SA 2Z3DA 4I8KA 1TGSZ 4HZHA 4Y0ZE 3MH4A 5FPYA 3SGQE 1VCQA 3F0OA 1HNEE 1O5GH 1AMHA 2GV7A 3ENSB 2Q6FA 4FUCA 3UUZA 3UIRA 2Y5GA 2AGEX 1K2I1 2FLRH 1H9HE 1JRTA 1K1MA 1NU7B 1F5LA 1Z8IB 2BD5A 4DJZB 1HB0B 1JXPA 2C8XB 2ZDMA 3ATMA 4X1RU 2QXGA 1O2IA 4I31A 3PLBA 2V6NA 1AFQC 1SGFG 3MU0A 3P17H 1OOKB 1TIOA 5EPNA 1CGIE 3HGNA 4IMQA 2EY4C 2Z9JA 4XSKU 3NKKA 3S69A 2B8OH 2M2AA 1P02A 1A4WH 1ANCA 1BTPA 1EFRD 5JBBS 5IDKA 2F83A 1SVPA 4Q80A 2XOKD 3SU6A 5LH8A 4A1VA 4HI3A 1H4WA 2ZDNA 2Q6DA 1TB6H 3RLYH 1D3QB 1SLUB 1V2UT 4BAHB 2AGGX 1GHZA 8KME2 2ZG0H 1GHBF 1DY8A 3ZVCA 2AYWA 1N8OB 1GBDA 3DFLA 1E0FD 2JKHA 4YLQH 5C0UA 2C8ZB 2BD3A 5TJXA 3LT3A 4GCHG 5TCCA 5GNDA 1A2CH 2VIOA 5JB9S 3TITA 2WPHS 1ELAA 5SGAE 1QL9A 1CBWC 1UCYK 4RT1A 5C67A 3WWFA 1QJ7B 1F0SA 3RUOA 2ZDVH 1FY1A 1O0DH 1JRSA 4UD9H 2UWPA 1MQ6A 1TRNA 3DT0H 4WMDA 1PQ7A 4A1TA 3A7VA 1GI3A 2OTVA 4BTUB 2ZPSA 1E37B 1HCGA 4WY3A 1WTGH 2BY9X 4ZXXH 5ABWA 2SGQE 4AOQA 3BTDE 1NFYA 2G55A 3T29A 1AFQB 2QV1A 2ZGCA 3ZV9A 4ABBA 3BIUH 4LXBH 4P00A 6GCHG 2CJIA 1O3GA 1GL1A 5FXLA 3Q77A 2GT7A 1DS2E 1MU8B 1QTFA 1QA0A 1BTUA 3SJ8A 1S5SA 3OTJE 2HPPH 3BTKE 2ZGBH 2PKSB 4RT0A 2NU2E 1PQ5A 1XKAC 3EA9A 2GZ8A 2QY0B 1W11U 1NO9H 3RDZA 1A5HA 5HIYA 2A32A 1UHBB 1NPMA 4MNVA 1ZTKA 5DGJA 3UY9A 3SGBE 3SNBA 5FAHA 1XKBC 1YBWA 5DK1A 2G4UA 5EOKA 4Z0KA 4ASUD 1BRAA 2ALPA 4Y11E 4NWLA 1BOQA 3HATH 4WXIA 6CHAB 4F4OC 1O3EA 2PHBA 3M3VA 4LK4A 1F0UA 1DWEH 1OYTH 4UE7H 1TQ0B 1O2HA 2OBQA 1O3KA 2GZ9A 1TWXB 2FX4A 2UUKB 2BLOA 5DP7A 3SV8A 3D49H 1TALA 3ZVGA 2NU3E 3W1EA 2A4RA 1DDJA 2CHAB 3P6ZB 1AO5A 1FIWA 2V3OH 2H9TH 2HLDD 2H9EH 1MABB 5GDSH 3M5OA 5A0AE 3GY2A 4K3JA 3PB1E 3KQCA 5A0CA 3VB7A 2HVXA 1K1OA 3QUMP 3ZVAA 1SPJA 3A88A 2BXUH 3QO6A 4HFPB 1SC8U 3DHKH 1PPZA 1BBRE 2ZCLP 1QBOA 5EIYA 2GD4B 1HAVB 4AG2A 4B6EA 4Y6DA 4P02A 2W5EA 1V2KT 4XBDA 5PTPA 3LC5A 1KDQA 2P3FH 1OSSA 1C5XB 1LCYA 4M7GA 3PV2A 4DIHH 5T6FA 1HAYB 1W7XH 4I8GA 4JZEH 1P10A 3O8DA 1GBFA 2FYQA 2Z7FE 3U9AH 4D9QA 1V2OT 4LOYH 3B9FH 1ETRH 3CS7A 2ZGHA 3VGCB 1QNJA 1GJDB 2YNAA 1UTPA 1H1BA 4RI0A 1ANEA 2BXTH 3L3TA 1E34B 4X2WA 2OK5A 2ZNKH 3PMAB 2KCAA 3NCLA 1EOJA 5GJ4B 1TMBH 3ODFA 3PLKA 1C4V2 4R0IA 1LDTT 3R0FA 4BAQB 2F9NA 3GOVB 3BIVH 1NM6A 3GCTG 4INLA 1BCUH 2D1JA 2QF5A 5C2ZA 1IQNA 1DFPA 2RA3A 5T1VA 1Z7KA 1G36A 2OC0A 2ANKH 3TIUA 1AUTC 1ZRBA 4OS7A 1GI1A 4Y0YE 1K22H 1LTOA 2P8OC 1HAIH 1SQRA 1ZTLA 1MBQA 3TJVA 5K7RA 3VB4A 1DITH 3RXAA 1NC6A 3VG8A 4I86A 4SGAE 4FUDA 1TABE 1HJ8A 2V0BA 3EA7A 1O39A 2VVVA 4KP0A 2VINA 1UK4A 3IITA 1S82A 3D62A 3A89A 1QBNA 2FLBH 2QXJA 1CQQA 5JYIA 1ELEE 4ZXYH 3UOUA 4HG6A 1CA0B 2A2XH 3ZVDA 1OPHB 2B5TB 1P3EA 3I77A 3P8FA 2VIQA 2Y81A 3UOPA 1YYY1 2AMPA 2RDLA 1IQEA 3F2FA 1E1QD 2AMDA 3HK3B 1QIXB 4VGCC 3AVZA 2GV6A 4TT3D 1ELGA 4FUGA 1AVXA 3SUDA 1MQ5A 1W0YH 1C5ZB 1EZXC 4Q4LA 4ZHMU 1QJ1B 1O37A 1WU1A 1QL7A 1VGCB 3RXDA 4AB9A 3FKSD 1QA7A 3QGJA 1AGJA 1C5OH 1GMHG 1TOCB 1P01A 4O3UA 2OUAA 1DXWA 1EKBB 3Q3YA 1PPGE 2P8OB 5T6DA 1YLNA 1KYNA 1UK3A 2ZCKP 4FU7A 2JETB 1SFIA 4D7FA 4Y8YA 2RA0A 4FETA 5DP4A 4LZ1H 1KTTB 1HDTH 3PRBA 3E90B 3PWCA 4AB8A 1GJ5H 1LKBA 5EU8A 4YXWD 1HAGE 2OC8A 3RC6A 3ZZ5A 2G8TA 1G3CA 2J9NA 4B1TA 2RG3A 1GHAG 1YLDA 5C94A 2PWXA 4WMFA 3OTPA 3OYPA 5CMXH 1DICA 4IMZA 2ZPQA 2G4TA 2WV9A 1X7AC 1A0JA 3A86A 3ATKA 4AG1A 3SJKA 1DSUA 4XD7D 3U8OH 1BZXE 4DIIH 3RXFA 2QF3A 2VB0A 4CRAA 5GXPA 2IJD1 2WUBA 2R2WU 3ATLA 3NXPA 2F43B 1C5VA 2GJGA 4B2BA 4JYTA 1V2NT 5CE1A 1MBMA 2PGQB 1WQSA 1MZDA 4RKOB 2A1DB 1UVUH 2KM0A 2ZHQH 4O9VA 4K69A 1ELBA 3RU4T 1SLWB 1YPGH 1SGCA 3SOSA 3LIWA 1C4U2 1OP8A 4BXSA 4X6OA 1EB1H 3MTYA 2SNWA 1DWDH 3OU0A 1UO6A 2GCTB 2VIVA 4B2CA 1D6RA 1OP2A 3RXBA 1IOEA 3GCTF 3M37A 5EQQA 1E79D 2ZFSA 1C1UH 1GBHA 1SQOA 3ODDA 3TPIZ 2R2MB 4ISHH 3V0XA 3UTUH 3ZZ3A 1GDUA 2J95A 2BY7X 4H6TA 1QQUA 3M5LA 2ZGJA 4KELA 1Q2WA 1J15A 2PUQH 2BX4A 1GBBA 2IN2A 2W26A 3BTEE 2JH0D 3EGKH 1O3LA 5A2MH 1TGTA 2PUXB 2R3UA 2Y5FA 4TSFD 2FOAA 1RTKA 5EPYA 1JBUH 2W7SA 5EODA 5CDFE 2BVRH 3UWIA 1PPHE 1P05A 1MU6B 1HAXB 1LHEH 2AS9A 3SU2A 1FX0B 1NROH 3DSOA 1GMDG 3NPSA 1U6QA 2BD8A 2XWBI 2FOHA 8ESTE 1ESTA 2KCYA 1YKTA 4OS1A 3SNAA 3STIA 1C9TA 4X2XA 1HBTH 2GCHG 4HTCH 2H5DA 1ANDA 2I6QA 2O9QA 4UFGH 2BM2A 1SSXA 4OS2A 3A7ZA 1RIWC 1XVMA 4WF8A 2LNCA 3SNDA 1O2MA 1BMMH 1S84A 1UHBA 3RXSA 1CT0E 3K2UA 1DUAA 2HNTC 4AORA 2B0FA 1TQ7B 3DCLA 2BDHA 3V7TA 5C5NA 2VIDA 1HIAA 2B9LA 1WYKA 1UVPA 8LPRA 1CHOG 1DWCH 1FY4A 1P8VC 1QURH 1GBCA 1GJ8B 1ARBA 2W6JD 3E1XB 4RN6A 3LH3A 4NA8A 3RXPA 2P94A 3U8RH 1L1NA 4Q63A 2ILNA 2GMTC 1QR3E 3RC5A 3VFEA 2ZPRA 5DKMA 3T27A 1UVSH 1QRWA 1Y59T 1NFXA 2JH5D 1CE5A 1IQGA 1L4ZA 1UVOA 1K1IA 1Z6EA 4TYDA 5T6GA 2G5VA 1P11E 4K1SA 4MG3A 1C5WB 4K2YA 1W0ZU 4K1EA 1O2GH 1DWBH 1CHOF 2GKVE 5C20A 1BMAA 1HLTH 1MKWH 3A85A 4NFFA 1VJAU 2ZI2H 2BD9A 1SGDE 1O3HA 1EOLA 4O03A 1BTYA 1AHTH 1A7SA 1TX6A 5DSFA 2LP6A 3Q00A 1GPZA 2ZHDA 5TCAA 2GCHF 3AAVA 4XBCA 4ABJA 3ZVBA 2GCTC 4ZAEA 3MH7A 2FX6A 1PJPA 3ZZ7A 3M7UA 1N1LA 1ZZZA 2QAAA 1O35A 1P0SH 1O2KA 3F9EA 3SNCA 3ESTA 3HKIB 5A8ZA 4ABIA 4E7NA 1IQIA 1BIOA 1HXEH 4QT8C 4PROA 1YPEH 2ZFTA 1OWIA 1MTSA 3OSYA 3AK5A 3DFJA 3GY3A 1GGDC 3GS9A 4IW4E 2STBE 1IQKA 2A2QH 1ABJH 4ZROA 3A84A 2L6OA 2C8YB 3V12A 5F8XA 4GLYA 1CT4E 4A5TS 3PTBA 4IBLH 5EW2H 4WXVA 3FFGA 4FXGH 1FN6A 4B76A 1TYNA 3UNQA 1KXFA 5EXMA 3JZ2B 2ZCHP 1KLIH 4TWWA 1EPTB 1P04A 3RMLH 3PV4A 2KFWA 3DA9B 2EEKA 2FI3E 2VWOA 3GCOA 2PLXA 1IHSH 1DY9A 3TNTA 2WSSD 4X2YA 1AWHB 1QQ4A 1JWTA 4CHAB 2GP9B 2BD4A 4ABDA 1GJAB 1LHCH 4IC5A 5LPEA 2FOBA 5DJ7A 3E16B 4O3TA 1GVKB 4NIXA 1J17T 3FO8D 3KNXA 3SJOA 1WUNH 3PO1C 5HIZA 1VCWA 2J92A 5GCHF 5KEDA 2KCOA 1Y3YA 2P16A 2BY8X 5C5OA 2A4QA 5HYOA 1LQDB 1V2VT 2I6SA 4Y76A 2A4GA 1B5GH 1L4DA 4Y7AA 1NRPH 3E0PB 3A8CA 7GCHF 4GPGA 4YM9A 1CT2E 5AFZH 1GGDB 2ZU2A 2V3MA 1O33A 1GDQA 4X1NU 3TK9A 2A5KA 1MCTA 1BJUA 3A7TA 1FLEE 1EJNA 4NIVA 5A8YA 4UONA 1OWJA 1T8NA 5EGMA 2F91A 5F53A 5T3HA 1AB9B 4ISNA 3KQBA 3LGVA 3A7YA 2BYAX 4ZKRU 3A87A 1KTSB 3SHCH 5AF9H 3RMNH 1S6FA 3V13A 2OQ5A 2KCPA 3BTTE 2Z9IA 3PMBB 3QWCH 2HWLB 8GCHF 3ZZDA 1A5IA 4AC9A 1ZSLA 5CHAB 2KZ4A 2F9BH 1FPCH 2FTMA 3UNSA 1SQTA 2VIPA 2A7CA 3F3BA 3FP6E 1C2KA 2BZAA 3GDUA 2H2ZA 1EZUC 3ZVFA 4THNH 4MVNA 1SOTA 1DSTA 1A3EH 2FOGA 2XXLA 4JZ1A 2R3YA 3E3TA 2L74A 3M5MA 1HPGA 4IGDA 1HAPH 5C17A 1DLEA 1C5YB 1WV7H 2CN0H 3G01A 1C1RA 4IN1A 1ID5H 4YOJA 3EAJA 1G9IE 3O8RA 2P3UB 2WPKS 1TGNA 3UWJH 2QC2A 1NT1A 1NRNH 3DSPA 1BBRK 4YT7H 3GCNA 2ZU5A 4CRFA 1KXDA 3LJJA 3FAOA 2THFB 4K1TA 3ZZCA 2QCYA 2ZU3A 5DP9A 2SGEE 2ALVA 1CVWH 2FI4E 2ZP0H 1CHGA 2PSYA 1FV9A 1T7CA 3MH5A 2ZDKA 4XRNA 3SW2B 3U8TH 3AAUA 4M9FA 4VGCB 4D76A 3AW0A 2W6ID 1GJ4H 5DPAA 2D26C 5HXFA 1LO6A 1C1OA 1XXFA 4K5ZA 3RC4A 1PPEE 2VGCB 3BTFE 1HYLA 1FXYA 3FANA 4ABHA 1BT7A 1M9UA 1O2UA 1ZMNA 2JJ1D 2ZA5A 3S9BA 2J5UA 1LVYA 3UREA 5E0GA 1AD8H 2P59A 4NIWA 1H9LB 4NA7A 2VIWA 3MFJA 1TPPA 4Y8XA 5GCHG 2WPIS 2J98B 5DG6A 1S81A 2CGAA 4BAMB 3F68H 3SN8A 1H9IE 1NN6A 1S6HA 1YP9A 2A31A 1W2KH 3N7EA 1WOFA 1ZSKA 3TU7H 1G30B 1O3BA 2Y5HA 5IYTA 2R0LA 2ESTE 5AHGH 2Q6GA 4DURA 2TGTA 2CV3A 3LGUA 1FY8E 3MOCA 3U1IB 1C5RA 5L6NH 1MTVA 4WWYA 1P12E 2J4IA 1GI4A 4ZMAH 1EJAA 2OQUA 1BRBE 3T28A 4K8YA 5EW1H 1MMJN 2PKSC 1EQ9A 3EE7A 1F7ZA 2LPRA 1RTFB 1GL0E 1KXAA 1TPOA 1D9IA 1MKWK 2G81E 2BLQA 1GJBB 1SBWA 2ZZUH 3SZNA 4Z1MD 4Q2KA 1HIAB 1AFEH 1OWEA 3PWBA 2V3HH 2XNDD 4I8HA 4JZIA 4X2VA 4ISIH 3U1JB 2QXIA 3E6PH 3EQ0H 4MTBA 3U69H 1MKXK 1QRXA 2WPDD 2NU0E 4JK5A 1S83A 2A4OA 3F6UH 1DM4B 1V2WT 2H6MA 4JCNA 1AE5A 1VKYA 4ZHAA 3SU1A 5ESBA 1OWDA 1D4PB 3OE7D 4BNRA 1VZQH 1B0FA 2ZU1A 1NZQH 3DUXH 2B7DH 3F9FA 4IN2A 1ELVA 4OGXA 4XOJA 1AZ8A 5JPMH 2TGAA 4NZLA 1KIGH 5BPEA 4ACAA 2K1QA 1NRRH 1DUEA 4X6MA 2G5NA 3MO6A 2HRVA 4RKJB 1C5NH 4CBNA 3KQ5A 1H8IH 5A09A 5J4QA 3M61U 3SYJA 1SB1H 4DGJA 3QZQA 2C3SA 2RDEA 1WTHD 1GWAA 1Y5BT 1K0HA 1Z8RA 2GT8A 1C5TA 5DN6D 1V3XA 2XCNA 2BDIA 1N6XA 1C2LA 3S9CA 3SI4H 4GAWA 2BDCA 4KGAA 3F9HA 1O5EH 1TOMH 3KQEA 4DT7B 1UMAH 3E0NB 2JIZD 1C1TA 3LJOA 4ZKNU 2FOFA 1W3CA 3TH2H 1T4UH 4FOUC 1ORFA 4F49A 1A3BH 1PQAA 2JJ2D 1T32A 3PLPA 1CO7E
chains in the Genus database with same CATH topology
1SGQE 2NWNA 4FUBA 3HGPA 4GUXA 1ZGIA 4K60A 4OS5A 4CRDA 3A81A 5JB8S 1K1NA 1Y3VA 1TPSA 5G4BA 5GIBA 3CP7A 1HGTH 1HJAC 1P2QA 1WSSH 3KF2A 1P2JA 1SGFA 2ODQA 3SJIA 2CF8H 1J9CH 3C1KA 1CU1A 2P3TB 3SBKA 2QA9E 1BHXB 1WCZA 1HRTH 2GMTB 2ZDLA 3MWIU 4X8TH 1KXCA 1O5AB 4DVAU 1O2WA 4CRCA 4I7YH 4YTAA 1O3JA 3SU3A 1BRUP 1IQMA 1BB0B 1GCTC 3IWMA 4ZUHA 5F6MA 4MNYA 5FCRA 2KAIA 3QX5H 3KQDA 3BTQE 4X6NA 1AE8H 1ZPZA 5F8ZA 1GCDA 4JMYA 1ELCA 3Q3XA 2AIQA 1FAXA 1HXFH 3A8DA 3T25A 3DD2H 5C1YA 1S0RA 1SGIB 3M7TA 1PYTC 3SV6A 3T2NA 1SHHB 5E0HA 3RXOA 1W10U 1TA2A 1GDNA 2ODYB 1K1JA 3SU5A 6LPRA 1BTHH 5LPFA 2Y6TA 2AFQB 2A7HA 2VWLA 3KCGH 1W12U 4DOQA 2XBXA 1OXGA 1FQ3A 4MLFB 2GVFA 3PYHA 4X8SH 1YPMH 1CBWB 2ZQ2A 2ANYA 4NCYA 3MNBA 2BDGA 3NZIA 3PMHB 2D8WA 2HPQH 1E35B 3RXIA 4IS5A 4UFDH 1QB6A 1JIRA 3MU5A 4JZFH 1THSH 4TY7A 1XUGA 1Y5AT 3EDXB 1P2MA 1K1LA 3SU0A 3GYMA 4FVBA 1LVOA 4MPUA 1T31A 1WBGB 3P8OA 1GHAF 1H8DH 1GI7B 4JYVH 5L2YH 1UTKA 4A7IB 1PPBH 2WV5A 4H4FA 1BJVA 4Y79A 2ZU4A 1C5UA 2WPLS 2ODPA 3W95A 4GCHF 3ZYEA 1ESBA 1BRCE 3SU4A 2BB4A 5H4IB 2SGFE 1SQAA 2C93B 1FY5A 1XUHA 1HUTH 1O3OA 1O5DH 2JETC 2XC4A 2UWOA 4TPIZ 3A7WA 1F0RA 3QLPH 1TGCA 1QB1A 1KXEA 2P95A 3MH6A 3BSQA 1EAWA 1RGQA 1MTUA 3MYWA 1UJ1A 3S9AA 3VB5A 2V35A 1O3PB 3A83A 3VPKA 2AEIH 2F3CE 3ATWA 3GYLB 1O3CA 2OCVB 1LVBA 4AFUA 3SV7A 4Y7BA 1EJMA 2BLVA 3VEQB 2CHAC 1EX3A 1GHWH 1G3BA 1YCPK 1O34A 3K6YA 5JBCS 2O8WA 4NZQA 2A0QB 3SO3A 2Z94A 4KTUA 1G32B 4YLUA 1VJ9U 1C2EA 1Q3XA 1C1SA 1C2DA 2Z9LA 1SGEE 2WUCA 2Z9GA 1O5CB 1RRKA 1YGCH 4NGAH 2ZO3H 3GISB 3L6PA 2HOBA 1C1WH 1SI5H 3E91A 5FCKA 1GMCF 1ELDE 1HAOH 1SL3A 1OYQA 1V2ST 3CS0A 3KHVA 1V2LT 4YOGA 1RJXB 3MNSA 3P70B 3QN7A 3H7TA 1KSNA 4CH2B 1C5SA 2Y7XA 1T8LA 2BX3A 1PPFE 1THRH 1D3PB 2H9HA 3UNRA 1Z1IA 1GMCG 3GDSA 4AYVB 1HAHH 3MMGA 4BOHA 1RXPA 1MAXA 3TLOA 1J16A 3F1SB 5L2ZH 1B7XB 1PQ8A 1O2XA 5F8TA 1GI9B 4ISLA 1A61H 1JOUB 4A92A 4FUIA 1RS0A 1TMUH 3LPRA 2FDAA 3TJNA 1UTNA 7GCHG 3ELAH 3SHAH 4BANB 1C2MA 1W14U 2BY6X 3KIDU 1YPJH 1UTMA 2ZHFH 1TNKA 3TNSA 4DCDA 1C1QA 1TFXA 4FUJA 1Z8JB 2ZECA 2TPIZ 3LGTA 1C5LH 1O2OA 2BZ6H 1O2QA 2Y7ZA 4DG4A 1Q31A 2QXHA 2XBWA 2G51A 2PGBB 3TH3H 1Z71A 2SNVA 1ABIH 3ZZ9A 1GJ9B 2A5AA 4J2YB 4GVUA 4DY7B 1N6YA 3BG8A 1CGJE 1XX9A 1MTWA 1V2PT 4B73A 3RXJA 2NU1E 2ZEBA 1V2RT 2ZTYA 4ZHLU 1TRMA 2TGDA 3BTME 3QGNB 1AIXH 2FWWA 3S7HB 3PM3A 1W8BH 2FYRA 2VGCC 2EA3A 1GVZA 3I78A 2IOTA 1TGBA 1ZGVA 4U32A 1E36B 1O31A 1SLXB 2ZIQH 1ZMJA 1AWFH 1GMHF 3C27B 2O8UA 1ETSH 1BBRH 1F92A 2H5CA 1NU9A 1UTJA 3ZZBA 3QZRA 2J34A 2F9OA 4ZH8A 2O8TA 2FIRH 4OS6A 1UTOA 1TBZH 2HNTE 2XW9A 4A1XA 4INKA 2AGIX 2OC1A 4ABAA 2ZFFH 4D9RA 3LONA 2QF0A 4MNWA 4D7GA 1NFWA 3KN2A 3SQEE 4MNXA 1C4Y2 3M35A 5DP8A 2OC7A 3PMJA 1T8OA 3GY6A 4FUEA 1BQYA 1NFUA 4AFQA 1A0LA 1AU8A 1F0TA 1V2TT 5HGGA 3STJA 3SUFA 3I29A 1ZPCA 1EP6A 2ZGXH 2Q1JA 1DVAH 1UTLM 1MTNC 1TNGA 2A7JA 2J94A 1O36A 1HJAB 1C9PA 1O2TA 2O8MA 1GBIA 1QHRB 3LGYA 3HK6B 4JK6A 1CSOE 3M3SA 1VITH 3D65E 4NA9H 4X6PA 5GWZA 1FY3A 3EE0B 4UFFH 2PW8H 4UEHH 1ZMLA 1P09A 2BOKA 1AQ7A 1GHBG 1BMLA 3TK5A 4AFSA 1XUIA 3ZZAA 3F9GA 2NU4E 1FI8A 1GVLA 2FS8A 3S7KB 3GCHC 2XC5A 4E06H 1D3TB 1O3DA 1S0QA 1NESE 3MNXA 1OS8A 3RXVA 4I8LA 4BTIB 3WY8A 3P95A 4Q7XA 4I33A 1IQHA 3ITIA 5A0BA 1V6DA 2SGPE 4XFQA 1K9OE 2EI8A 4IC6A 4AFZA 2UWLA 3SUEA 1QJ6B 4CR9A 4CREA 5JBAS 1YPHC 2YOLA 1O2NA 2GDEH 5CHAC 1YCPH 1KY9A 3RMMH 3RP2A 5K0HA 3P8NA 4TWYA 1P06A 4ISOA 2DUCA 3A7XA 3BEFB 1HJ9A 1F5KU 1QCPA 3MU1A 5E8EH 1GBEA 3RMOH 1K28D 2SFAA 3N7OA 3EYDA 4B2AA 2FOMB 4TY6A 2QGRA 1C5QA 3VB3A 1DOJA 3ZYDA 3LOXA 1SG8B 1ZYOA 4B74A 4U30A 1A1RA 1UK2A 3FVFB 5I46H 2VH6A 1AKSA 2Y80A 1ARCA 4X1QU 3TVJB 2EI6A 4ABFA 3BV9B 1ZOMA 2FEQH 4OS4A 1A0HB 5BRRE 1G3DA 3Q76A 1G2LA 1AI8H 5FBIA 3A80A 1NRQH 1GG6B 3UQVA 1Z6JH 3GY4A 3RXMA 2PTNA 4YZUA 1W13U 2GZ7A 1EB2A 5J4SA 2FPZA 2WINI 1O2YA 2R9PA 4NSVA 1VITF 2GX4A 1TNJA 1ZSJA 2ASUB 2RCEA 1C2JA 1MUEB 1TX8A 1TE0A 1JMOH 1XUFA 3A82A 5EXLA 4X0WU 3TH4H 1V2MT 3OX7U 3A8BA 4D8NA 3BN9A 2WYGA 4MPXA 5C1XA 1QB9A 2BOHB 2PSXA 4YOIA 4AZ2B 3BTWE 3LU9B 3MHWU 4ASHA 3VXFH 4AGKA 2HALA 4NIYA 1O2JA 4BAKB 1GBKA 3U98H 3MNCA 1C2HA 1HV7A 1YPLH 3SNEA 1LHDH 1VCPA 4B71A 1A46H 3GDVA 2ZTZA 2OP9A 2TGPZ 4AGJA 1SGTA 2ZHWH 1B0EA 1EP5A 2FM2A 1O3AA 1Y5UT 1EAUA 1THPB 3URCA 1XM1A 1AVGH 3QTOH 1T8MA 4A6LA 2WYJA 1GI6A 2W7UA 3BF6H 1MTNB 2ZFPH 1D6WA 1RFNA 1QY6A 1LVMA 2BVXH 4CRBA 1CA8B 3K6ZA 1ZHRA 3HPTB 3LKWA 4X1SU 2BVSH 3RLWH 4CHAC 3QK1A 2AH4X 3AASA 5JBTA 5FX6A 4MPWA 2PTCE 1FNIA 1O2ZA 2FODA 2BD7A 1ETTH 1F2SE 4FVDA 1HFDA 1GBTA 4E7RG 6ESTA 1P2IA 3TGKE 5FPTA 4KTCA 1C1PA 2ZTXA 3FZDA 3TGIE 4U01A 1IHTH 2XBYA 1AZZA 2XYAA 3IG6B 2J38A 1KXBA 4XE4A 2XNIA 1OWHA 1DPOA 2FZZA 3RM0H 3RXLA 1G2MA 1O30A 2F9VA 1EPTA 1O3FA 1O3MA 1IQFA 1LPKB 1FAKH 2EI7A 2Z9KA 1LMWB 1O2SA 4FUFA 1O2RA 4I32A 1MD8A 2SGAA 3B23B 2OBOA 1FUJA 1W7GH 2O8LA 5JDUB 1QRZA 2BDYA 3SV2H 1SGNE 2FXRA 2PKAA 1F5RA 4BTTB 1GJ6A 2BHGA 2SGDE 3SJ9A 2UUYA 1C5MD 3M36A 1XXDA 1AN1E 3GY7A 3M7QA 1QBVH 2YNBA 2G00A 5HMAA 1SMFE 2P93A 7ESTE 2PFEA 4X8VH 4LZ4B 1FN8A 3UR6A 2VVUA 1BTXA 2PV9B 1OWKA 4H6SB 5DP6A 1JIMA 2VH0A 4O97A 2D2DA 2VWMA 1TBRH 1WAYB 1LQEA 5AFYH 3TGJE 2FESH 2XTTB 2VWNA 4ESTE 1TPAE 2OINA 2VVCA 1GBLA 3FZZA 5FHTA 1C2IA 1CA0C 1FJSA 1EPTC 1LPGB 5FX5A 3A8AA 2UUJB 2ZF0H 3PROA 3RXRA 1A5GH 4ZKSU 1V2JT 1K1PA 4KKDA 3LDXH 4Y10E 1LHFH 1C1MA 4Y8ZA 1HAVA 7KMEH 4X8UH 1IQJA 2BTCE 3VB6A 1MH0A 4UFEH 4AN7A 1HAZB 3BEIB 1ANBA 2EC9H 1G3EA 4AYYB 4ZKOU 1L0ZA 2IJOB 1YLCA 1DE7H 4CR5A 1O2LA 1BMNH 1TLDA 3GY5A 3NUMA 1BA8B 1PYTD 3SGAE 4ABEA 1SR5C 1O3NA 4WJG2 1ZHPA 1LPZB 1XVOA 5EQRA 2TIOA 3GCHB 3MO9A 5HM2A 1GI8B 3RXTA 1BITA 1O5BB 1TNLA 2HGTH 5FBEA 1XMNB 1O38A 1EASA 1MD7A 1ACBE 1YM0A 2F9UA 4HGCA 4B75A 1QFKH 1SFQB 2FS9A 1BTWA 3RXGA 1O2PA 2H1UA 5E2OA 1VR1H 1P2KA 2BD2A 3FP7E 1EAIA 2G52A 2ZKSA 3PO1B 3O8BA 3RXUA 1OKXA 1YPHE 1AB9C 2VU8E 2GDDA 5LGOA 1IAUA 1SLVB 2JH6D 2Y82A 2XC0A 1GI5A 3BTGE 5A8XA 2QIQA 1OX1A 4JYUH 3BEUA 1ESAA 2FI5E 1ZTJA 1P2OA 2WPJS 3KL6A 1IQLA 1TNHA 1ZHMA 1VGCC 1MZAA 3BG4C 4XDEA 3D23A 3K65B 1K21H 1O32A 1ELTA 2M5TA 3CENA 2VNTA 1O5FH 2J2UA 1EZSC 2BY5X 3VGCC 3ZV8A 3RM2H 2A5IA 2A45B 5E0JA 4GHQA 5B6OA 1GJ7B 1GI2A 3B8JA 1TAWA 4FU9A 2PR3A 3SI3H 1RIWB 2ZWLH 1EZQA 1L1JA 3HKJB 5C3NA 4CBOA 4DW2U 4NSYA 1C5PA 3LGWA 3GY8A 1NRSH 1PPCE 1FPHH 3P92A 1XUJA 2WV4A 2BQWB 1FONA 3UPEA 4INHA 1GCTB 1RD3B 1UVTH 1GBJA 3H7OA 4YT6H 1MCVA 1P3CA 1TX7A 1OP0A 1SGRE 2AIPA 1ZJKA 1DX5M 1XUKA 3PTNA 1T4VH 4WMEA 1DANH 1GI0A 1P57B 1QL8A 1C2GA 1ELFA 2BLWA 2ZHEH 1AKSB 1FIZA 2FMJA 3AW1A 1C1NA 1TNIA 1Z1JA 3SQHE 3QTVH 4GSOA 5DP5A 2TRMA 1J8AA 3L33A 3GICB 2ZFRH 4YESB 9LPRA 2BDAA 1YPKH 3RU4D 1GHYH 1TA6A 3TK6A 1CGHA 3NK8A 4Z6AH 4UDWH 1TMTH 2F9PA 2ZDAH 3MI4A 5EG4A 6CHAC 3TJOA 1DT2A 1YC0A 3O8CA 1E38B 2XCFA 5DO4H 2BMGB 1Z8GA 1SGYE 4J1YA 1AY6H 4FU8A 2FTLE 3H5CB 1V2QT 4MDSA 3V3MA 5DP3A 2AMQA 5C1UA 1SHYA 1EAXA 1MAYA 2DE9A 1L2EA 5L30H 4R8TB 2AERH 1INCA 4BXWA 1KDQB 3KEEA 1EUFA 2W3KA 4XBBA 2C4FH 4FUHA 1GG6C 3UFAA 3S0NA 1DXPA 3RXHA 2KAIB 1SOZA 2XWAA 1BTZA 3T62A 3RXEA 1LHGH 4KTSA 4X1PU 2CMYA 4Q7YA 2ZFQH 1UTQA 1O2VA 1J14A 4WH8A 4I8JA 1C1VH 2C8WB 1BUIA 1N8OC 3W94A 2OLGA 3ZZ6A 3SORA 1S85A 1MKXH 1P03A 1FDPA 2IPHA 1BHXF 2UUFB 1VITG 2BQ7B 1TRYA 5HM9A 1UCYH 3QDZB 3UQOA 1TBQH 3OY5U 1YCPM 4AX9H 4E05H 3R3GB 1PFXC 2DE8A 1DLKB 1GHXH 1KLJH 3FP8E 1NY22 2QN5T 4K8BA 4YO9A 2HNTF 4TPYA 1G37A 3BTHE 3P8GA 1C2FA 1QGFA 3T26A 1ZPBA 9ESTA 5E2PA 5I25A 1D3DB 2R0KA 4SGBE 1Y8TA 2GTBA 4CH8B 2FP7B 4Y71A 2FOCA 2QYIA 7LPRA 1ZR0A 2CF9H 4MPVA 5ETXA 1GBMA 1P2NA 4NG9H 2BQ6B 2TBSA 1FMGA 1GMDF 2FO9A 1WQVH 2ZC9H 1FZZA 1AVWA 4JZDH 2W3IA 4NWKA 3ZVEA 4WVPE 1GBAA 2ANWA 3URDA 3LC3A 3E8LA 2PKAB 1Y3WA 5F03A 2Z6BD 2WPMS 3BG4B 4CRGA 4WH6A 3SV9A 2OXSA 3MU4A 3ZZ4A 1NTPA 1YF4A 1P9UA 2BDBA 3T5FH 1GHVH 2C90B 3LGIA 5GPIB 3RXQA 8GCHG 3SUGA 3K9XB 5EXNA 2Z3CA 5FPSA 2HLCA 2STAE 1LKAA 4BAOB 1BDAA 3RXCA 3TJUA 5ESTE 3LH1A 1Y3UA 2OD3B 3Q3KA 2CXVA 2VJ1A 5EQSA 5LPRA 6GCHF 4GHTA 3RU4E 2GGVB 3JZ1B 1NS3A 1KLTA 4NFEA 4ABGA 3VXEH 1ZLRA