1O2UA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2uA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2uA02
3RMOH 1S5SA 2FI4E 1MQ6A 2ZCHP 3RXLA 4NA8A 2YNAA 1C9PA 2PUQH 5EW2H 1C5MD 2Y7XA 2GT7A 1A46H 4MPWA 3TH2H 5L6NH 1YPLH 3EDXB 1UVOA 1CA8B 1LHDH 4K5ZA 1J15A 3ESTA 1O2VA 1QNJA 3LJJA 1TGCA 1XUGA 1XXDA 1OWEA 1TPSA 2WUBA 1NT1A 2XBYA 2PKSB 1UCYK 2PW8H 3E16B 1GDQA 1SQOA 1LPKB 2VIOA 1BT7A 1HGTH 3FP6E 1RIWB 2XWAA 1DE7H 1WV7H 1SMFE 3OX7U 1YLDA 2FX6A 1AMHA 1FNIA 1K1PA 1QGFA 3RXIA 3TNTA 1BTYA 1TMUH 5EW1H 4B71A 1U6QA 2Z3DA 2SNVA 4FUGA 3U98H 1O3KA 3Q77A 1K22H 1P8VC 4F49A 1TGSZ 1HBTH 5AHGH 1GVZA 1PQ5A 2BLOA 1HV7A 1BDAA 4ABAA 2GD4B 3OTJE 4I7YH 2HWLB 2BQ6B 3A87A 1Z7KA 1G2MA 2R2WU 3M3SA 4FU9A 2ZHWH 3PTNA 2GZ9A 3HK6B 1DSUA 2GDEH 1GMCF 1E35B 1V2JT 1AVWA 1BMMH 1ZRBA 5CHAC 2FYRA 5DP8A 1S85A 5ABWA 3S7HB 5EQSA 1HJ9A 2OCVB 1P10A 4DURA 1SGNE 8LPRA 1JWTA 5JBAS 3B9FH 1P05A 2H2ZA 1KTSB 1GI8B 1DS2E 5F6MA 2ANKH 5FCKA 4E7RG 1S6FA 2B0FA 3BG8A 1BTZA 2ZWLH 1D6WA 1O2TA 1SGYE 3M36A 1C5RA 2OXSA 1DT2A 3BTFE 5JPMH 3F6UH 5H4IB 2QYIA 1L0ZA 3D62A 4CHAB 3TGIE 4GAWA 5FBEA 1Z8RA 1BBRK 1MZAA 3MO3A 2FOHA 1ZMJA 1JRTA 1VGCB 1IQNA 1NU7B 2ZO3H 2G4TA 1E0FD 3ZZ9A 2RA0A 5ESBA 5BPEA 2XTTB 2FX4A 1MAXA 2QV1A 4BAMB 4I8LA 3SZNA 1SSXA 1ETTH 3MWIU 3UR6A 2Q6FA 4LZ4B 3FP7E 2Q1JA 3W94A 3A85A 1Z6JH 2HNTC 1K1LA 3M3VA 3MU4A 1LHCH 3BEIB 2GT8A 1TPOA 5CHAB 4JZEH 1ZRKA 2LNCA 2A7JA 1F92A 3A8CA 3UQVA 2TRMA 1W8BH 2HOBA 1BA8B 2CN0H 1O2RA 4VGCC 2FO9A 4DG4A 5C1XA 1T7CA 3SU3A 2ZFPH 2F9VA 1BHXB 1DDJA 3PLPA 1Z1JA 1JIMA 1UJ1A 4X8SH 2ODYB 3RXOA 2RCEA 3BF6H 1BMLA 1P11E 2A0QB 1VITF 4NSYA 2R0LA 1OWKA 3JZ1B 1HIAB 2H9EH 1IQEA 1BIOA 1NRQH 1KIGH 4NFFA 4K8YA 1YGCH 5J4SA 1BRCE 3A80A 1YPKH 2BY9X 2A1DB 5T6FA 1GL0E 1FXYA 4Y10E 3BTTE 2PV9B 2VJ1A 3P8OA 1O2QA 2P59A 1GI6A 2R3YA 1NC6A 4ZUHA 1O0DH 1HFDA 1UTNA 2CF9H 3E91A 3LC3A 3Q3XA 1GMHF 4M7GA 4WXVA 3SV2H 1XUJA 3VGCC 2PKAB 3TITA 1K1NA 1WSSH 1RFNA 2WPIS 4NA9H 5HM2A 1EJAA 2V35A 1Y3YA 4MQAA 4TY6A 4Y0ZE 1GHBF 1EZXC 5DPAA 4R0IA 2PUXB 3P8NA 3BEUA 2Z3CA 4NIWA 1C2FA 1O5CB 1SR5C 3RXFA 1UTJA 3GISB 2FTMA 1AKSA 3BG4C 1TOCB 4IW4E 4MPXA 3SHAH 2OQ5A 1UK3A 1O2HA 1BTPA 1OYTH 3BTKE 4KP0A 4I31A 4A92A 4DGJA 1IQHA 1ZHMA 3SNEA 4JYUH 3E8LA 3RXPA 3S7KB 2WPHS 4FXGH 2ULLA 3MMGA 1PYTC 2R0KA 3OSYA 3KEEA 1ORFA 1PPGE 1GMDF 1MH0A 3PWCA 1Z8GA 1AVXA 4B73A 2BQWB 3HKIB 5FXLA 4DIIH 3QZRA 4ISNA 2C93B 3LPRA 4OS4A 3RM2H 3ZVEA 2WV5A 2KAIA 4DOQA 1ACBE 5C5OA 4K1SA 3STJA 5HYOA 3QX5H 3ZV8A 2CXVA 4SGBE 3F9HA 3BTQE 3VGCB 4NIYA 3DFLA 4J2YB 1C5OH 4BAQB 1JBUH 4XBDA 1LTOA 1HLTH 1THRH 1UK2A 1MKWH 2QA9E 5GDSH 4WXIA 2G8TA 3C1KA 2P3TB 2ZZUH 1Q31A 1LKBA 4UFDH 3ATWA 4NIVA 1FZZA 5E8EH 1PPFE 3BG4B 2ZPRA 3MH7A 1TGTA 1OKXA 1PQ8A 1AWHB 3RXGA 3TJOA 3TK6A 1ZMNA 2ZHFH 4X6MA 1J14A 5C2ZA 1H1BA 3V13A 2IPHA 2UWPA 3M5LA 3RLWH 4WVPE 4AB8A 1OWIA 1BHXF 1THSH 4MNYA 1GCTC 1N1LA 3DUXH 1TFXA 2B5TB 4Z6AH 2BD3A 2CMYA 2PTNA 3ELAH 3BTGE 1AN1E 3PMHB 1FAKH 6LPRA 3NPSA 1P2QA 4O3UA 2FODA 3L6PA 2BXUH 1YYY1 5GJ4B 2FP7B 4AN7A 4AYYB 1SHHB 4FUIA 4I8KA 3P8GA 4CREA 1NY22 1OOKB 4FVBA 3UWIA 1TLDA 1SQTA 1ANBA 1VCQA 2WYGA 1QA7A 2PLXA 1EPTC 3HPTB 3SU1A 4X2YA 1UTQA 4ZH8A 2ZU5A 1ID5H 3PROA 1NRSH 1X7AC 4YTAA 4A1XA 1GI5A 3E3TA 1DLKB 1QHRB 2ZTZA 1O2WA 3O8DA 4GSOA 3T2NA 2TGPZ 2ZQ2A 4B76A 3RC4A 2BDAA 1HPGA 1SQAA 5A8ZA 1PPZA 2RDLA 1NRRH 2R3UA 3H5CB 3BEFB 1YCPM 3E1XB 3KQBA 2LPRA 5C1YA 2ZIQH 1S81A 1KLJH 2XW9A 4X6PA 4I8HA 1MTUA 1TNJA 1HXFH 2J9NA 2P3FH 3LH3A 1WTGH 2VIDA 3AW1A 1GCTB 2ZCKP 1O3FA 4JYVH 1O3HA 3OYPA 4KTCA 1OX1A 4RN6A 5EXNA 1AE8H 1AIXH 1ESTA 4PROA 3ATMA 4YT6H 2AMQA 3SJKA 3SN8A 2ZU1A 3V7TA 1O2ZA 1CHGA 2ZGXH 4A7IB 2J2UA 1GCDA 2ZDMA 2P93A 3QTOH 3FFGA 3QGJA 1W0YH 1TNKA 5AFYH 1P03A 3QDZB 3RXTA 1LVMA 3QWCH 2BLVA 3MO9A 1SPJA 1TA2A 1EPTB 2Z3EA 1O3DA 1S84A 2VWNA 1PQ7A 4Y7AA 4UONA 1SFIA 2QXGA 3GCTF 3FANA 2D2DA 5FHTA 3ZV9A 1V2RT 2FM2A 4LZ1H 4HFPB 2FI5E 3U9AH 4CR9A 1GG6C 3ODFA 1ZTJA 3V12A 1GJ6A 4UDWH 1SI5H 1FMGA 4CBNA 5JYIA 3SUGA 3LGYA 2CHAB 4ZROA 5J4QA 3DA9B 1UCYE 3TGJE 1OWHA 5DP9A 3HGNA 3HK3B 2ZTYA 5CMXH 1TGBA 3SU0A 5A2MH 1CT2E 1O5BB 4WH8A 3IWMA 2W7SA 1WUNH 1EQ9A 1OSSA 3RU4T 1DY8A 1EZQA 1KLTA 4ESTE 4Y76A 1ZJKA 2IJOB 1VCWA 3E0NB 1ZYOA 7LPRA 1UHBB 3FZDA 3HATH 1A0JA 2XBVA 2C4FH 1KXDA 4OS6A 4ABBA 2WUCA 1WTHD 3K9XB 1SLXB 2WPMS 1ETRH 2UUJB 1NESE 1QL7A 2ZQ1A 3Q3KA 1TB6H 3T26A 1V2LT 2PSYA 4B2CA 4ABGA 1IQLA 3URDA 1YBWA 3PO1C 3T29A 1P04A 3ZVBA 2F91A 1A3EH 1YKTA 1AU8A 2XRCA 1TALA 3KCGH 3M5MA 2EA3A 3A7ZA 3D23A 3LT3A 1AD8H 3ZZ6A 4OS2A 1IQGA 1GG6B 2BZ6H 8GCHF 3ZZ4A 4ZHMU 3SGAE 1H9LB 1C5YB 1G3BA 1G3CA 2ALVA 1GVLA 2ANWA 3E0PB 1Q3XA 2EI7A 1GGDC 1RTKA 1EOLA 1TX7A 3RU4D 1AY6H 2VU8E 4B2AA 2JETC 2AMPA 3A81A 4ASHA 3U69H 4BTTB 2D8WA 2ZU2A 3KQEA 4HI3A 2FS8A 1FLEE 1PPEE 2BDBA 2W26A 1ABJH 1Y5BT 1C1OA 5F8XA 1BUIA 2C3SA 1Q2WA 4MVNA 4H4FA 3RXHA 1SB1H 3MU1A 2A7HA 1N6XA 4NZLA 1EAUA 4YZUA 1OYQA 1O3MA 1SFQB 1BCUH 3MI4A 3ZVAA 1ESBA 3ZZ8A 1ZJDA 4UFEH 3MH5A 4IBLH 3PO1B 1ZGVA 1O39A 4H42U 1IAUA 2BB4A 2AEIH 1CO7E 3U1IB 1CHOG 1HJ8A 1LMWB 3DT0H 4WMFA 7GCHG 3MNSA 4J1YA 4NCYA 3VEQB 4NFEA 1BOQA 1ELEE 3K6ZA 3Q3YA 1SGDE 1A5IA 1K21H 1GJ7B 3BV9B 3GYLB 4ABEA 1MMJN 1MU6B 1XMNB 2FOAA 2GVFA 1GGDB 4X2XA 1UO6A 3SJIA 1CGHA 1GI9B 1MD7A 2Z9LA 4KKDA 1GI2A 4CRCA 4DJZB 1GBAA 2ZDAH 3ATLA 1G9IE 1P2JA 1JOUB 2ODPA 5AF9H 1DITH 3PB1E 2UUYA 3URCA 1TNLA 3ZVDA 2ZP0H 3T25A 1KXFA 1OWJA 1GJDB 3MFJA 3RXEA 1N6YA 4K8BA 1Z1IA 1AUTC 2H5DA 2ZFSA 2FS9A 3LOXA 1W3CA 1C5LH 2Z7FE 3PWBA 1RRKA 2ZGJA 2AERH 3BTEE 4CRAA 1C2KA 2XBXA 1O35A 2VGCC 4GCHF 2GCHF 3PYHA 1BQYA 5A0AE 3M35A 4O3TA 4TWWA 1K2I1 3BTHE 2V3HH 2I6SA 1GHAF 5F8ZA 1JRSA 4ABDA 5HGGA 2FZZA 1HAIH 1HIAA 3MYWA 1O32A 1CBWB 2I6QA 2O8WA 1AGJA 3O8RA 2BHGA 2SGDE 4FU7A 3C27B 4XDEA 1W0ZU 2O8MA 1CT0E 1GJCB 3SV9A 3GYMA 4AOQA 1H9IE 3LH1A 1SL3A 4X1NU 2BY5X 3GCHC 1DX5M 3RXAA 1TPAE 1HAXB 2G5NA 2JH0D 4X1RU 3MH6A 2V0BA 4IN2A 3STIA 1CQQA 1GJBB 3ZZ7A 3LGIA 4ZAEA 2A5IA 4AG2A 2FLBH 3BTWE 4Y6DA 1C4Y2 2PKAA 5B6OA 2OC0A 1IQJA 2J92A 3GY4A 3SOSA 1XUHA 1SVPA 1A7SA 2OBOA 3PLBA 1Y3XA 4X0WU 1C5ZB 1P9UA 3CENA 1EKBB 1Z71A 2RG3A 1XKBC 3TJUA 1VITH 2VGCB 1SGEE 2A5AA 5GCHF 1UMAH 3VB3A 4K1TA 1QJ7B 1ZHPA 1YPHE 4U2WA 3IITA 5TCAA 1ZSLA 1GBBA 4JK6A 1O2UA 1N8OC 4B1TA 3LGUA 3A8DA 3N7OA 2H9TH 3TGKE 1F5RA 3FAOA 4TWYA 1O31A 2F9UA 5I46H 1QA0A 1UTKA 3QTVH 1D4PB 3SNCA 3EA7A 6GCHF 5FCRA 4A6LA 1GBIA 1XVOA 2Y7ZA 3BIUH 4B75A 1SBWA 5DGJA 1UVUH 3KHVA 3SU2A 1HB0B 3Q76A 4MPVA 1NM6A 5GXPA 1DWCH 1NFYA 2G81E 3GCHB 1HCGA 3BIVH 3R3GB 1VR1H 5IDKA 1W12U 2AIQA 4LXBH 2ALPA 4K69A 3UR9A 1XX9A 3T5FH 3RMNH 1RD3B 4I8JA 1LPZB 3A7YA 2GCTC 3UNQA 1KYNA 1XKAC 2BY6X 2FYQA 4BAOB 3RC5A 4FUHA 1GBHA 2PHBA 5FX5A 4YOGA 4GVUA 4MNWA 1KXAA 2Q6GA 1Z6EA 3A7XA 1HUTH 2CJIA 3LC5A 3CP7A 2HPQH 1C5TA 3D65E 4AZ2B 1C5UA 2ZGBH 2BLWA 1N8OB 3ZZBA 1A2CH 1XM1A 1GBCA 4HZHA 2BVXH 2B8OH 2BMGB 1RXPA 5TJXA 2AFQB 2ZF0H 1C2EA 1V2NT 4FUDA 5DK1A 3TU7H 4FUEA 2J38A 3I78A 4IMQA 4X6OA 2ZHEH 4XBBA 1UK4A 1VJ9U 1C9TA 1TPPA 1QRWA 1UVTH 1HAPH 1FPHH 3A84A 3RU4E 4AYVB 1GI1A 4K2YA 4BXSA 3OY6U 2AIPA 1G30B 3P6ZB 3GY8A 1D3TB 2ZKSA 3A83A 3WY8A 5LH8A 1RTLA 2BXTH 2YOLA 5E0JA 1LKAA 1ELGA 3A86A 1MKXK 3MH4A 2J95A 4VGCB 1F2SE 4B2BA 2VB0A 2GMTC 4D7GA 2F9NA 2P3UB 2QF0A 1LVYA 1GBLA 2VWLA 1NFXA 2THFB 4I8GA 4AFZA 1O2IA 4O03A 1C2GA 2DE8A 1EP6A 4UFGH 4HGCA 3SNBA 5A0CA 3U1JB 4AX9H 4BXWA 4U30A 1TGNA 5BRRE 5LGOA 4X1QU 1DUEA 1O3CA 1UCYH 1W7XH 4ISLA 5DP7A 1NTPA 3NXPA 2ZU4A 1DANH 2VWOA 2J94A 1C1VH 1TX8A 1QBOA 1TRMA 2ZPSA 2AYWA 3O8BA 4X1SU 1G3DA 1E36B 1H8IH 1O5GH 1DOJA 2P95A 3MOCA 4FVDA 4KELA 2C8WB 1A1RA 1OP8A 2FOGA 2WPLS 1V6DA 1YC0A 1FPCH 1SGFG 1DICA 5LPRA 7KMEH 2FOBA 2C8XB 1P12E 3I77A 4UFFH 3UPEA 2A32A 1GJ9B 3RXUA 1A61H 2GDDA 1SC8U 1EPTA 3RXJA 1S0RA 1O38A 2Z9IA 1LO6A 1O2YA 1ELDE 2H6MA 2GMTB 1KSNA 1BB0B 1GPZA 1UTLM 4FUCA 2XBWA 1ELTA 3F9EA 8KME2 1GBFA 4OS5A 3TIUA 4OS1A 2WPKS 4IC5A 4YESB 1AO5A 1ZPZA 3QO6A 5C3NA 1WQVH 2C90B 1JMOH 2TBSA 4BNRA 3PTBA 2BY8X 2HVXA 3OU0A 1K9OE 1AZZA 4NIXA 4UEHH 3UREA 2BZAA 4I32A 3UQOA 1O2LA 1ZTKA 2SGFE 3Q00A 1F0TA 1UVPA 3MNCA 1EB1H 3TH4H 4MNXA 1GBTA 1PYTD 1LHGH 5FPSA 1O2NA 3L3TA 1AQ7A 2CV3A 5L2ZH 2P94A 1UHBA 2ZU3A 1C2MA 3VB6A 2B7DH 1ZLRA 3GY6A 1P2KA 5LPFA 4FUFA 4FUJA 1NZQH 2ESTE 2ZHQH 1BTHH 1PPHE 4F4OC 1PFXC 4NA7A 1O3JA 1FY5A 4FU8A 2XCFA 3SW2B 1UTMA 3GY5A 1K1OA 1S6HA 1FV9A 2PSXA 4Q7XA 1BRUP 3LDXH 1D9IA 2HNTF 4YLUA 2P16A 1QB6A 4IC6A 3NUMA 5E0GA 3A7WA 3MU5A 5HXFA 1PPBH 1MU8B 2R2MB 4U32A 2OC7A 2BY7X 1ZOMA 4O97A 1UTPA 4JK5A 1ARBA 1P01A 4JZDH 1O2SA 2ZC9H 1ZZZA 4WMDA 2OQUA 4BAHB 2SGAA 4NWLA 1FY8E 4WJG2 1EJMA 2F83A 1B7XB 1HRTH 4XOJA 3DHKH 2NU2E 1V2VT 2ZDNA 1J9CH 1MTNC 1QCPA 2GV6A 5DG6A 4Y79A 3FZZA 1HJAC 4Y71A 1W10U 2RA3A 1S83A 4CH8B 5EXMA 2QY0B 3AVZA 1ANDA 1O3BA 1C5VA 3E90B 4AGKA 2OTVA 1P06A 2FOFA 4UD9H 2XXLA 1BJUA 1WAYB 3RXCA 2W7UA 3TH3H 1GJ4H 5HMAA 3SGBE 1NFWA 1LDTT 4BOHA 2VIQA 2BDHA 1DXWA 3B23B 4JZ1A 4KTUA 4SGAE 1G37A 1TYNA 2ZG0H 1FIZA 3ZVFA 2BDYA 2G51A 3KGPA 4O9VA 4E05H 4E06H 1ABIH 5JBCS 3I29A 1H8DH 3MU0A 1GL1A 3RXSA 1QQ4A 4E7NA 1ZGIA 3AW0A 2ZFRH 2WPJS 3ENSB 3RM0H 2FOCA 2QXIA 3ZZ3A 3A82A 1QTFA 2ZCLP 3OY5U 1EZSC 2SGPE 1EATA 2H1UA 1V2QT 3UOPA 5EXLA 3VB5A 1FN8A 1WQSA 3QK1A 5F03A 1NRNH 2VVCA 2ANMH 2OD3B 3TLOA 4LK4A 1HJAB 2TGDA 1ELFA 5FBIA 1KDQB 5T6GA 1HAGE 2XC5A 1QL8A 2W3KA 3E6PH 2JH5D 2PFEA 1TA6A 2D26C 4FUBA 3RP2A 1QB9A 1ZPCA 2NU4E 1TBRH 1FY4A 4H6SB 1O2OA 3SUFA 1YCPH 3KN2A 1G32B 1MAYA 1TOMH 1CGJE 4Q80A 1T4UH 1MTWA 1P2NA 1WCZA 2FXRA 3UWJH 1T8MA 4BTIB 1AFEH 1JXPA 4DW2U 1O30A 3V0XA 3UNSA 1SLUB 1QJ1B 3EA9A 3QGNB 5C5NA 1NN6A 3VFEA 1BZXE 3SO3A 1F0RA 1TRNA 1G3EA 4WWYA 1ARCA 3SU6A 1H4WA 2ZEBA 1D3DB 2ZECA 1O3NA 2ZNKH 2XNIA 4NZQA 1DWBH 2K1QA 1A5GH 3EYDA 4Y0YE 4ZKSU 2HALA 5E0HA 3ZYDA 3UTUH 3GCOA 2FPZA 4WY3A 2V6NA 2JKHA 4A1TA 2FMJA 1NFUA 1C1TA 3B8JA 3TK5A 1C2LA 5C1UA 1O3PB 4YO9A 1QQUA 2GTBA 1EP5A 3D49H 2GKVE 3MTYA 1BBRE 1GMCG 1QFKH 2GGVB 3AASA 2GX4A 1S0QA 3SV8A 2ODQA 3ZZCA 2G4UA 1OPHB 3W95A 3KL6A 3RXDA 2QXJA 4ABIA 1YPGH 2EEKA 2F9BH 4AGJA 4MDSA 1YPJH 5L2YH 1V2OT 2TPIZ 1O2KA 2UUKB 1BMNH 5ESTE 4ISHH 1Y5UT 1V2PT 2VIWA 3PM3A 1TX6A 3TVJB 1LQDB 1SOTA 3GICB 1EASA 3M7TA 2PKSC 2QC2A 3QUMP 3MNBA 5DP4A 4NSVA 2IN2A 1RJXB 1YPEH 1EXFA 2BD2A 2ZI2H 3PLKA 2STBE 3F1SB 1GHVH 1RS0A 2HGTH 2H5CA 3V3MA 1SLVB 1HYLA 1C5WB 1C4U2 1O33A 1TMBH 2BVSH 2JETB 2Z9JA 1T32A 4K3JA 2ZDKA 6CHAC 2A4QA 2WV4A 1C5SA 2BDGA 3MU8A 2WINI 4KTSA 2GV7A 4ISIH 1O2XA 2AH4X 1K1JA 1F0UA 4DVAU 1TE0A 1NU9A 4AFUA 4X8TH 5JB9S 2CF8H 2G5VA 1SG8B 3SV6A 3M3TA 1XUKA 1MBQA 4XFQA 4AORA 1FIWA 1EOJA 5FAHA 2PWXA 4NG9H 4MLFB 3M5NA 4OGXA 2BD4A 1V2WT 1D6RA 2P8OC 1O3LA 5JDUB 2PTCE 2NWNA 1FQ3A 2Z94A 5FPYA 2XCNA 1O5DH 1B0FA 1NS3A 1DM4B 2ZGCA 4LOYH 1DY9A 3K2UA 5GWZA 4CH2B 4X2WA 1HAZB 1VITG 1GJAB 2OBQA 4Z0KA 5F8TA 2FI3E 3MO6A 2SNWA 1GHZA 2EI8A 1V2TT 2VH6A 3A7TA 1P57B 1QBNA 1O2MA 3M7QA 1IQIA 1MBMA 4UE7H 4INKA 5EPNA 4BTUB 2AGEX 3S9CA 3HGPA 4QT8C 4CHAC 3FP8E 2TGAA 4THNH 6CHAB 1P09A 1C5PA 1O36A 1VGCC 1O3AA 1Z8JB 3A88A 1GJ8B 5EQRA 4IGDA 3SJ8A 1ZMLA 3ATKA 5EQQA 1M9UA 4JZFH 4Y8ZA 1FDPA 1P9SA 2HLCA 2O8UA 1GMHG 1PPCE 3F9FA 1HAOH 1MKWK 3IG6B 3RDZA 1D3QB 2VVVA 4INLA 5ETXA 3UIRA 1A5HA 1F7ZA 3GCNA 2BDIA 4JCNA 4NGAH 2A2QH 2C8YB 2VWMA 4CRFA 1BITA 5JBTA 1GHBG 4D9RA 1GBDA 4GLYA 1GBKA 2P8OB 5I25A 4Q7YA 3BSQA 2ZHDA 1BRAA 2GP9B 4ZHLU 1FAXA 1DUAA 1GI4A 4K1EA 1BTWA 5A8YA 2F3CE 2Y6TA 3VB4A 1OXGA 4H6TA 4AFSA 1TWXB 1EX3A 2V3OH 1ZTLA 9ESTA 1O5AB 3BN9A 1T8LA 1WU1A 1CHOF 2SGEE 2BDCA 7GCHF 3VXEH 1INCA 1L2EA 2BOHB 1Z8IB 2ZFQH 1BTUA 1QL9A 1O2JA 1GMDG 1SGFA 2BTCE 2TGTA 5E2OA 4D76A 5C67A 2C8ZB 5A09A 2XYAA 3LGVA 4I33A 1W14U 2UWLA 3SNAA 1TRYA 2STAE 3U8RH 2ZFFH 1ZSJA 2DE9A 1QB1A 1A4WH 1TQ7B 4WH6A 1AHTH 1CE5A 3QLPH 1DPOA 3LGTA 1P02A 1UTOA 1V2MT 1BJVA 2A4GA 3RXMA 1EAXA 1SLWB 2FWWA 2ILNA 5TCCA 5DJ7A 6ESTA 1QRZA 1C1UH 3ITIA 1EAIA 1DXPA 2VNTA 4RKJB 4JYTA 4Y11E 2BX4A 1TABE 3VB7A 2A5KA 4XSKU 1ANEA 3TJVA 1BRBE 4NWKA 5G4BA 1S82A 1LQEA 1C1RA 4CRDA 2QGRA 4YM9A 1V2KT 3L33A 2NU1E 4HTCH 1SOZA 1HAVA 1GI3A 2BQ7B 3NCLA 1J17T 2AS9A 5DP5A 3GDUA 3SNDA 1K28D 3UFAA 4D8NA 4Y8XA 1P0SH 1J8AA 2TIOA 3EAJA 4RSPA 3DD2H 3PMAB 1L1NA 2W5EA 1KXCA 3PMJA 1QBVH 1ELAA 2UUFB 2FOEA 4GPGA 2BD9A 2SFAA 2OP9A 3RUOA 2GCTB 4BAKB 1GDNA 1T4VH 4XBCA 4JMYA 3GY7A 3LKWA 1IQFA 2ANYA 2OC8A 1IHTH 1FY1A 1QJ6B 3NZIA 2ASUB 2F9PA 1C1SA 3KF2A 1TNIA 2FTLE 2BM2A 1Y5AT 3KQDA 3LIWA 2Y5HA 2FIRH 1O2PA 4X8UH 1EJNA 1PQAA 1ETSH 5DO4H 2O9QA 5EOKA 1HXEH 1P2MA 4INHA 4D7FA 1TNHA 1GWAA 1QIXB 2ZDVH 4AG1A 1GVKB 1TONA 3M61U 2UWOA 1GI7B 2EC9H 2A4RA 1E34B 1IOEA 2FLRH 1ZR0A 4XE4A 4ZMAH 3U8OH 1C2HA 1E37B 1QURH 2Y5GA 1GHWH 1TMTH 3AAVA 2YNBA 5AFZH 1CSOE 1ZPBA 1LHFH 1CU1A 3UNRA 3P92A 1RTFB 3T27A 1ELBA 1MTVA 3MHWU 4RKOB 1F0SA 2J34A 1WBGB 3SGQE 1MQ5A 1DLEA 3K65B 5A8XA 3LU9B 1YCPK 1TAWA 1IQKA 1SGIB 1C5XB 4DIHH 1MCVA 3QN7A 3SQEE 1L1JA 2ZDLA 1YPMH 1KTTB 1MUEB 3M37A 4DCDA 5L30H 1PJPA 1LVBA 1JIRA 1THPB 2OUAA 2Z9KA 2H9HA 3G01A 1YF4A 2ZPQA 5E2PA 3SV7A 2HPPH 3GCTG 1UVSH 3NKKA 3PV4A 1TBZH 4TPIZ 5T3HA 3S0NA 1SGPE 1Y59T 1O5FH 1EZUC 4ZXYH 1W2KH 1A0LA 3A8BA 3PMBB 5JB8S 5EU8A 4ZHAA 4YT7H 2XC4A 1ZSKA 2A45B 1GBJA 2M5TA 4TYDA 4Y7BA 4R8TB 1KXEA 5DP6A 3SJOA 8ESTE 2BD5A 5CE1A 4X1PU 1HAVB 3NWUA 1EAWA 1FUJA 3RXQA 1B0EA 3GOVB 1W13U 4Q2KA 1KDQA 1C2IA 1AI8H 2XWBI 2CGAA 4MG3A 3K6YA 1P2OA 1QR3E 1T8OA 3ZZ5A 1OWDA 1XXFA 2A2XH 2Z9GA 1QY6A 1BBRH 4WF8A 5EGMA 4IN1A 3S69A 2BYAX 1Y3VA 2AGGX 1Y8TA 1C4V2 3H7OA 1AUJA 2VINA 2D1JA 1HAYB 3P95A 2B9LA 2FEQH 3CS0A 1XUIA 2J4IA 1L4ZA 1LVOA 1C1QA 3TK9A 2Y82A 2ZA5A 3EA8A 2GZ7A 9LPRA 1IHSH 3T62A 3SU5A 1L1GA 3GDVA 2DUCA 1O37A 1G36A 4ZKOU 1G2LA 1L4DA 4YLQH 3RC6A 3KIDU 2F9OA 1OS8A 4AFQA 3O8CA 4X6NA 1IQMA 1DSTA 5AVDA 1V2ST 1AFQC 1YLCA 2ZGHA 3ATIA 2VIVA 1YPHC 3M7UA 1WOFA 1A3BH 1FY3A 4IMZA 4OS7A 3ZVCA 1MCTA 5K7RA 3BTDE 8GCHG 1C1NA 3KQCA 1J16A 2BVRH 4B74A 2JH6D 4MNVA 3A7VA 1LCYA 2PGBB 3SI3H 1GBEA 4ABHA 2GZ8A 3TJNA 3U8TH 3TNSA 1O3IA 2QF3A 1AKSB 3JZ2B 5FPTA 2Y80A 2EI6A 1SGRE 2VVUA 1QRXA 1P3EA 1P3CA 1V3XA 2CHAC 1HDTH 2Q6DA 3ZYEA 1Y3WA 3EGKH 3UOUA 3CS7A 5LPEA 3LJOA 1HNEE 3A89A 2FESH 4U01A 1O3EA 1ELCA 1C5QA 2Y81A 1LPGB 4BANB 4YOJA 4MTBA 5FX6A 1MD8A 3SUDA 1O34A 2OINA 3QZQA 1TBQH 1P2IA 1B5GH 1C1MA 1DFPA 3F68H 1OP0A 7ESTE 1NO9H 1F5KU 5DP3A 3VXFH 1AE5A 3UY9A 2KAIB 4CRBA 3T28A 1DWEH 2W3IA 2BOKA 2ZFTA 1O2GH 1GBMA 1LHEH 3EQ0H 4Q7ZA 1ZHRA 1AFQB 1TIOA 1GDUA 3ZZDA 2NU3E 1BMAA 1NRPH 3UUZA 4ABJA 4YOIA 1MKXH 3LGWA 1CT4E 1ELVA 1EUFA 4ZKRU 5C20A 2O8TA 4CR5A 3RMMH 1AB9C 1O3OA 2BX3A 2SGQE 1GJ5H 3SUEA 1MTNB 1C5NH 2AMDA 5EG4A 2O8LA 1ESAA 1SGCA 1SHYA 3P17H 5PTPA 3M5OA 1TNGA 4A1VA 1VCPA 1OP2A 2Y5FA 3SORA 1KXBA 4A5TS 1FI8A 3BTME 1EB2A 3P8FA 1W11U 3RLYH 2FOMB 4GHQA 2HNTE 4AB9A 2G00A 1AWFH 1F5LA 1T31A 2QXHA 1A0HB 3AAUA 4OGYA 1TQ0B 1VZQH 5SGAE 3NK8A 3S9AA 1AZ8A 4IS5A 1VJAU 3GDSA 3HKJB 2R9PA 4Y8YA 4GCHG 2GCHG 5DKMA 3SBKA 3SHCH 2OLGA 2BD8A 5EODA 1C2JA 1GHAG 1GHXH 2IOTA 1D3PB 1FJSA 3SJ9A 1C1WH 4DY7B 4TY7A 5JBBS 2WYJA 1MZDA 5K0HA 3SQHE 4JZIA 2A7CA 2PGQB 3SU4A 2QIQA 5GIBA 2BLQA 3ZVGA 1CA0C 3GY2A 2G55A 1AB9B 2QN5T 2OC1A 1H9HE 3RXRA 2XC0A 1T8NA 2QCYA 4K60A 3A8AA 3RMLH 3RXVA 1GI0A 5EPYA 1DWDH 1CVWH 3P70B 3SI4H 1K1IA 1SGQE 1K1MA 3S9BA 1C2DA 3DFJA 2VH0A 1BTXA 1YM0A 3EE0B 3ODDA 2ZTXA 4TPYA 3ZZAA 4X8VH 1O3GA 1GHYH 1Y3UA 4CRGA 1RGQA 3R0FA 1KY9A 1KLIH 1NROH 1W7GH 4ABFA 1AVGH 1ANCA 1E38B 2HRVA 1MTSA 5IYTA 3RXBA 2NU0E 4D9QA 4X2VA 3TPIZ 1WYKA 4GUXA 3KNXA 4KGAA 5GCHG 3FVFB 1HAHH 2A31A 2A4OA 4ZKNU 1V2UT 2FDAA 2G52A 4MPUA 5GPIB 3MNXA 4ISOA 1FN6A 3H7TA 2AGIX 2BD7A 1O5EH 1RIWC 1DVAH 2QAAA 3VPKA 3RXKA 1C1PA 1SGTA 5A0BA 1NPMA 6GCHG 1XVMA 1CA0B 4ZXXH 3GY3A 5HM9A 2Z6BD 2PR3A 1YP9A 4CBOA 1FONA 4GHTA 1XUFA 4WMEA 2VIPA 3F9GA 1CBWC 1CGIE 3LONA 4DT7B 5T6DA
chains in the Genus database with same CATH superfamily
3RMOH 1S5SA 2FI4E 1MQ6A 2OK5A 4P02A 2ZCHP 3RXLA 4NA8A 2YNAA 1C9PA 2PUQH 5EJLA 5EW2H 1C5MD 2Y7XA 2GT7A 1A46H 4MPWA 3TH2H 5L6NH 1YPLH 3EDXB 1UVOA 1CA8B 1LHDH 4K5ZA 1J15A 3ESTA 1O2VA 1QNJA 3LJJA 1TGCA 1XUGA 1XXDA 1OWEA 1TPSA 2WUBA 1NT1A 2XBYA 5C0TA 2PKSB 1UCYK 2PW8H 3E16B 1GDQA 1SQOA 1LPKB 2VIOA 3VG8A 1BT7A 1HGTH 3FP6E 1RIWB 2XWAA 1DE7H 1WV7H 1SMFE 3OX7U 1YLDA 2FX6A 1AMHA 1FNIA 1K1PA 1QGFA 3RXIA 3TNTA 1BTYA 1TMUH 5EW1H 4B71A 1U6QA 2Z3DA 2SNVA 4FUGA 3U98H 2HVYB 1O3KA 3Q77A 1K22H 1P8VC 4F49A 1TGSZ 3W1EA 1HBTH 5AHGH 1GVZA 2J97A 1PQ5A 2BLOA 1HV7A 1BDAA 4ABAA 2GD4B 3OTJE 4I7YH 2HWLB 2QF4A 2BQ6B 3A87A 1Z7KA 1G2MA 2R2WU 3M3SA 4FU9A 2ZHWH 3PTNA 2GZ9A 1BMFD 3HK6B 1DSUA 2GDEH 1GMCF 4FETA 1E35B 1V2JT 1AVWA 1BMMH 1ZRBA 5CHAC 2FYRA 5DP8A 1S85A 5ABWA 3S7HB 5EQSA 1HJ9A 2OCVB 1P10A 4DURA 4ACAA 1SGNE 8LPRA 1JWTA 5JBAS 3F2HA 3B9FH 3ZIAD 1P05A 2H2ZA 1KTSB 1GI8B 1DS2E 5F6MA 2ANKH 5FCKA 4E7RG 5T1VA 1S6FA 2B0FA 3BG8A 1BTZA 2ZWLH 1D6WA 1O2TA 1SGYE 3M36A 1C5RA 2OXSA 1DT2A 3BTFE 5JPMH 3F6UH 5H4IB 2QYIA 1L0ZA 3D62A 4CHAB 3TGIE 4GAWA 2JDID 1Z8RA 5FBEA 1BBRK 1H8ED 1MZAA 3MO3A 2FOHA 1ZMJA 1JRTA 5HKKD 1VGCB 1IQNA 1NU7B 2ZO3H 2G4TA 1E0FD 3ZZ9A 2RA0A 5ESBA 1WXRA 5BPEA 2XTTB 2FX4A 1MAXA 2QV1A 4BAMB 4I8LA 3SZNA 1SSXA 1ETTH 3MWIU 3UR6A 2Q6FA 4LZ4B 3FP7E 2Q1JA 3W94A 3A85A 1Z6JH 2HNTC 1K1LA 3M3VA 3MU4A 3FOAA 1W0KD 1LHCH 3BEIB 2GT8A 1TPOA 5CHAB 4JZEH 1ZRKA 2LNCA 2A7JA 1F92A 3A8CA 3UQVA 2TRMA 1W8BH 2HOBA 1BA8B 2CN0H 1O2RA 4VGCC 2FO9A 4DG4A 5C1XA 1T7CA 3SU3A 2ZFPH 2F9VA 1BHXB 1DDJA 3PLPA 1Z1JA 1JIMA 1UJ1A 4X8SH 2ODYB 3RXOA 2RCEA 3BF6H 1BMLA 1P11E 2A0QB 2K0QA 1VITF 4NSYA 2R0LA 1OWKA 3JZ1B 1HIAB 2H9EH 1IQEA 1BIOA 1NRQH 1KIGH 4NFFA 4K8YA 1YGCH 5J4SA 1BRCE 2JIZD 3A80A 1YPKH 2BY9X 2A1DB 5T6FA 1GL0E 1FXYA 4Y10E 3BTTE 2PV9B 2VJ1A 2KCYA 3P8OA 1O2QA 2P59A 1GI6A 2R3YA 1NC6A 4ZUHA 1O0DH 2KCOA 1HFDA 1UTNA 2CF9H 3E91A 3LC3A 3Q3XA 1GMHF 4M7GA 4WXVA 3SV2H 1XUJA 3VGCC 2PKAB 3TITA 1K1NA 1WSSH 2PP6A 1RFNA 2WPIS 4NA9H 5HM2A 1EJAA 2V35A 1W0JD 1Y3YA 4MQAA 4TY6A 4Y0ZE 1GHBF 1EZXC 5DPAA 4TT3D 4R0IA 2PUXB 3P8NA 3BEUA 2Z3CA 4NIWA 1C2FA 1O5CB 1SR5C 3RXFA 1UTJA 3GISB 2FTMA 1AKSA 3BG4C 1TOCB 4IW4E 4MPXA 3SHAH 2OQ5A 1UK3A 1O2HA 1BTPA 1OYTH 3BTKE 4KP0A 4I31A 4A92A 4DGJA 1IQHA 1ZHMA 3SNEA 4JYUH 3E8LA 3RXPA 3S7KB 2WPHS 4FXGH 2ULLA 3MMGA 1PYTC 2R0KA 3OSYA 3KEEA 1ORFA 1PPGE 1GMDF 1MH0A 3PWCA 1Z8GA 3F0PA 1AVXA 4B73A 3F2FA 2BQWB 3HKIB 5FXLA 4DIIH 3QZRA 4ISNA 2C93B 3LPRA 4OS4A 3RM2H 3ZVEA 2WV5A 2KAIA 4DOQA 1ACBE 5C5OA 4K1SA 3STJA 5HYOA 2W6ID 3QX5H 3ZV8A 2CXVA 4SGBE 3F9HA 5HIYA 3BTQE 3VGCB 4NIYA 3DFLA 4J2YB 1C5OH 4BAQB 1JBUH 4XBDA 2KX4A 1LTOA 1HLTH 1THRH 1UK2A 1MKWH 2QA9E 5FL7D 5GDSH 4WXIA 2G8TA 3C1KA 2P3TB 3PRDA 2ZZUH 1Q31A 1LKBA 4UFDH 4RT1A 3ATWA 4NIVA 1FZZA 5E8EH 1PPFE 3BG4B 2ZPRA 3MH7A 1TGTA 1OKXA 1PQ8A 1AWHB 3RXGA 3TJOA 3TK6A 1ZMNA 2ZHFH 4X6MA 1J14A 5C2ZA 1H1BA 3V13A 2IPHA 2UWPA 3M5LA 3RLWH 4WVPE 4AB8A 1OWIA 1BHXF 1THSH 4MNYA 1GCTC 1N1LA 3DUXH 1TFXA 3EE7A 2B5TB 4Z6AH 2BD3A 2CMYA 5CDFE 2PTNA 3ELAH 3BTGE 1AN1E 3PMHB 1FAKH 6LPRA 3NPSA 1P2QA 2L74A 4O3UA 2FODA 3L6PA 2BXUH 1YYY1 5GJ4B 2FP7B 4AN7A 4AYYB 1SHHB 4FUIA 4I8KA 3P8GA 4CREA 1NY22 4ZCNA 1OOKB 4FVBA 3UWIA 1TLDA 1SQTA 1ANBA 1VCQA 2WYGA 1QA7A 4FOUC 2PLXA 1EPTC 3HPTB 3CNRA 3SU1A 4X2YA 1UTQA 4ZH8A 2ZU5A 1ID5H 3PROA 1NRSH 1X7AC 4YTAA 4A1XA 1GI5A 3E3TA 1YY3A 1DLKB 1QHRB 2ZTZA 1O2WA 3O8DA 4GSOA 3T2NA 2TGPZ 2ZQ2A 4B76A 3RC4A 2BDAA 1HPGA 1SQAA 5A8ZA 1PPZA 2RDLA 1NRRH 2R3UA 3H5CB 3BEFB 1YCPM 3E1XB 3KQBA 2LPRA 5C1YA 2ZIQH 1S81A 1KLJH 2WZQA 2XW9A 4X6PA 4I8HA 1MTUA 1TNJA 1HXFH 2J9NA 2P3FH 3LH3A 1WTGH 2VIDA 3AW1A 1GCTB 2ZCKP 1O3FA 4JYVH 1O3HA 3OYPA 4KTCA 1OX1A 4RN6A 3DSGA 5EXNA 1AE8H 1AIXH 1ESTA 4PROA 3ATMA 4YT6H 2AMQA 3SJKA 3SN8A 2ZU1A 3V7TA 1O2ZA 1CHGA 2ZGXH 2F43B 4A7IB 2J2UA 1GCDA 2ZDMA 2P93A 3QTOH 3FFGA 3QGJA 1W0YH 1TNKA 5AFYH 1P03A 3QDZB 3RXTA 1LVMA 3QWCH 2BLVA 3MO9A 1SPJA 1TA2A 1EPTB 2Z3EA 1O3DA 1S84A 2VWNA 1PQ7A 4Y7AA 4UONA 1SFIA 2QXGA 3GCTF 3FANA 2D2DA 5FHTA 3ZV9A 1V2RT 2FM2A 4LZ1H 4HFPB 2FI5E 3U9AH 4CR9A 5GNDA 1GG6C 3ODFA 1ZTJA 3V12A 1GJ6A 4UDWH 1SI5H 1FMGA 4CBNA 5JYIA 3SUGA 3LGYA 2CHAB 3UB0A 4ZROA 5J4QA 3DA9B 1UCYE 3TGJE 1OWHA 5DP9A 3HGNA 3HK3B 2ZTYA 5CMXH 1TGBA 3SU0A 5A2MH 1CT2E 1O5BB 4WH8A 3IWMA 2W7SA 1WUNH 1EQ9A 1E1QD 1OSSA 3RU4T 5DN6D 1DY8A 1EZQA 1KLTA 4XRNA 4ESTE 4Y76A 1ZJKA 3F3BA 2IJOB 1VCWA 3E0NB 1ZYOA 7LPRA 1UHBB 3FZDA 3HATH 1A0JA 2XBVA 2C4FH 1KXDA 4OS6A 4ABBA 2WUCA 1WTHD 3K9XB 1SLXB 2WPMS 1ETRH 2UUJB 1NESE 1QL7A 2ZQ1A 3Q3KA 1TB6H 3T26A 1V2LT 2PSYA 4B2CA 4ABGA 1IQLA 3URDA 1YBWA 5EIYA 3PO1C 3T29A 1P04A 3ZVBA 2F91A 1A3EH 1YKTA 1AU8A 2XRCA 1TALA 3KCGH 3M5MA 2EA3A 2KCAA 3A7ZA 3D23A 3LT3A 1AD8H 3ZZ6A 4OS2A 1IQGA 1GG6B 2BZ6H 8GCHF 3ZZ4A 4ZHMU 3SGAE 1H9LB 1C5YB 1G3BA 1G3CA 2ALVA 1GVLA 2ANWA 3E0PB 1Q3XA 2EI7A 1GGDC 1RTKA 4RT0A 1EOLA 1TX7A 3RU4D 1AY6H 2VU8E 4B2AA 2JETC 2AMPA 4OM9A 3A81A 4ASHA 3U69H 4BTTB 2D8WA 2ZU2A 3KQEA 4HI3A 2FS8A 1FLEE 1PPEE 2BDBA 2W26A 1ABJH 1Y5BT 1C1OA 5F8XA 1BUIA 2C3SA 1Q2WA 4MVNA 4H4FA 3RXHA 1SB1H 3MU1A 2A7HA 5KGOA 1N6XA 4NZLA 1EAUA 3F2GA 4YZUA 3UAIC 1OYQA 1O3MA 1SFQB 1BCUH 3MI4A 3ZVAA 1ESBA 3ZZ8A 1ZJDA 4UFEH 3MH5A 4DT4A 4IBLH 3PO1B 1ZGVA 1O39A 4H42U 1IAUA 2BB4A 4I86A 2AEIH 1CO7E 3U1IB 1CHOG 5EJ1A 1HJ8A 1LMWB 3DT0H 4WMFA 7GCHG 3MNSA 4J1YA 4NCYA 3VEQB 4NFEA 1BOQA 1ELEE 3K6ZA 3Q3YA 1SGDE 1A5IA 1K21H 1GJ7B 2LELA 3BV9B 3GYLB 4ABEA 1MMJN 2QF5A 1MU6B 1XMNB 2FOAA 2GVFA 1GGDB 4X2XA 1UO6A 3SJIA 1CGHA 1GI9B 1MD7A 2Z9LA 4KKDA 1GI2A 4CRCA 4DJZB 1GBAA 2ZDAH 3ATLA 1G9IE 1P2JA 2EQNA 1JOUB 2ODPA 5AF9H 1DITH 3PB1E 2JJ1D 2UUYA 3URCA 1TNLA 3ZVDA 2ZP0H 3T25A 1KXFA 1OWJA 1GJDB 5F53A 3MFJA 3RXEA 1N6YA 4K8BA 1Z1IA 1AUTC 2H5DA 2ZFSA 2FS9A 3LOXA 1W3CA 1C5LH 2Z7FE 3PWBA 1RRKA 2ZGJA 2AERH 3BTEE 4CRAA 1C2KA 2XBXA 1O35A 2VGCC 4GCHF 2GCHF 3PYHA 1BQYA 5A0AE 3M35A 4O3TA 4TWWA 1K2I1 3BTHE 2V3HH 1E1RD 2I6SA 1GHAF 5F8ZA 1JRSA 4ABDA 5HGGA 2FZZA 5C0UA 1HAIH 1HIAA 3MYWA 1O32A 1CBWB 2I6QA 2O8WA 1AGJA 3O8RA 2BHGA 2SGDE 4FU7A 3C27B 4XDEA 1W0ZU 2O8MA 1CT0E 1GJCB 3SV9A 3GYMA 4AOQA 1H9IE 3LH1A 1SL3A 3KQ5A 4X1NU 2BY5X 3GCHC 1DX5M 3RXAA 1TPAE 1HAXB 2G5NA 2JH0D 4X1RU 3MH6A 2V0BA 4IN2A 3STIA 1CQQA 1GJBB 3ZZ7A 3LGIA 4ZAEA 2A5IA 4AG2A 2FLBH 3BTWE 4Y6DA 1C4Y2 2PKAA 5B6OA 2OC0A 1IQJA 2J92A 3GY4A 3SOSA 1XUHA 1SVPA 4ACBA 1A7SA 2OBOA 3PLBA 1Y3XA 4X0WU 1C5ZB 1P9UA 3CENA 1EKBB 1Z71A 2RG3A 1XKBC 3TJUA 1VITH 2VGCB 1SGEE 2A5AA 5GCHF 1UMAH 3VB3A 4K1TA 1QJ7B 1ZHPA 1YPHE 4U2WA 3IITA 5TCAA 1ZSLA 1GBBA 5EJZA 4JK6A 1O2UA 1N8OC 4B1TA 3LGUA 3A8DA 3N7OA 2H9TH 3TGKE 1F5RA 3FAOA 4TWYA 1O31A 2F9UA 5I46H 1QA0A 1UTKA 3QTVH 1D4PB 3SNCA 3NRLA 3EA7A 6GCHF 5FCRA 4A6LA 1GBIA 1XVOA 2Y7ZA 3BIUH 4B75A 1SBWA 5DGJA 1UVUH 3KHVA 3SU2A 1HB0B 3Q76A 4MPVA 1NM6A 5GXPA 1DWCH 1NFYA 2G81E 3GCHB 1HCGA 3BIVH 3R3GB 1VR1H 5IDKA 1W12U 2AIQA 4LXBH 2ALPA 4K69A 3UR9A 1XX9A 3T5FH 3RMNH 1RD3B 4I8JA 1LPZB 3A7YA 2GCTC 3UNQA 1KYNA 1XKAC 2BY6X 2FYQA 4BAOB 4F48B 3RC5A 4FUHA 1GBHA 2PHBA 1E79D 5FX5A 4YOGA 4GVUA 4MNWA 1KXAA 2Q6GA 1Z6EA 3A7XA 1HUTH 2CJIA 4M9FA 3LC5A 3CP7A 2HPQH 1C5TA 3D65E 4AZ2B 1C5UA 3SZEA 2ZGBH 2BLWA 1N8OB 3ZZBA 1A2CH 1XM1A 1GBCA 4HZHA 2BVXH 2B8OH 2BMGB 1RXPA 5TJXA 3FN8A 2AFQB 2ZF0H 1C2EA 1V2NT 4FUDA 5DK1A 3TU7H 4FUEA 2J38A 3I78A 4IMQA 4X6OA 2ZHEH 4XBBA 1UK4A 1VJ9U 1C9TA 1TPPA 1QRWA 1UVTH 1HAPH 1FPHH 3A84A 3RU4E 4AYVB 1GI1A 4K2YA 4BXSA 3OY6U 2AIPA 1G30B 3P6ZB 3GY8A 1D3TB 2ZKSA 3A83A 3WY8A 5LH8A 1RTLA 5B6LA 2BXTH 3FKSD 2YOLA 5E0JA 1LKAA 1ELGA 3A86A 1MKXK 3MH4A 2J95A 4VGCB 1F2SE 4B2BA 2VB0A 2GMTC 4D7GA 2F9NA 2P3UB 2QF0A 1LVYA 1GBLA 2VWLA 2YMSC 1NFXA 2THFB 4I8GA 4AFZA 5C17A 1O2IA 4O03A 1C2GA 2DE8A 1EP6A 4UFGH 4HGCA 3SNBA 5A0CA 3U1JB 4AX9H 4BXWA 4U30A 1TGNA 5BRRE 5LGOA 4X1QU 1DUEA 1O3CA 1UCYH 1W7XH 4ISLA 5DP7A 1NTPA 3NXPA 2ZU4A 1DANH 2VWOA 4Q4LA 2J94A 1C1VH 1TX8A 1QBOA 1TRMA 2ZPSA 2AYWA 3O8BA 4X1SU 1G3DA 1E36B 1H8IH 3WWFA 1O5GH 1DOJA 2P95A 3MOCA 4FVDA 4KELA 2C8WB 1A1RA 1OP8A 2FOGA 2WPLS 1V6DA 1YC0A 1FPCH 1SGFG 1DICA 5LPRA 7KMEH 2FOBA 2C8XB 1P12E 2W6JD 3I77A 4UFFH 3UPEA 2A32A 1GJ9B 3RXUA 1A61H 2GDDA 1SC8U 1EPTA 3RXJA 1S0RA 1O38A 2Z9IA 1S6LA 1LO6A 2IPQX 1O2YA 1ELDE 2H6MA 2GMTB 1KSNA 2K8IA 1BB0B 1GPZA 1UTLM 4FUCA 2XBWA 1ELTA 3F9EA 8KME2 1GBFA 4OS5A 3TIUA 2YMSB 4OS1A 2WPKS 4IC5A 4YESB 1AO5A 1ZPZA 3QO6A 5C3NA 1WQVH 2C90B 1H8HD 1JMOH 2TBSA 4BNRA 3PTBA 2BY8X 3F0OA 2HVXA 3OU0A 1K9OE 1AZZA 4NIXA 4UEHH 3UREA 2BZAA 2JJ2D 4I32A 3UQOA 1O2LA 2L6OA 1ZTKA 2SGFE 3Q00A 2M2AA 1F0TA 1UVPA 3MNCA 1EB1H 3TH4H 4MNXA 1GBTA 1PYTD 1LHGH 5FPSA 1O2NA 3L3TA 1AQ7A 2CV3A 5L2ZH 2P94A 1UHBA 2ZU3A 1C2MA 3VB6A 2B7DH 1ZLRA 3GY6A 1P2KA 5LPFA 3OEHD 4FUFA 4FUJA 1NZQH 2ESTE 2ZHQH 1BTHH 1PPHE 4F4OC 1PFXC 4NA7A 1O3JA 1YWUA 1FY5A 4FU8A 2XCFA 3SW2B 1UTMA 3GY5A 1K1OA 1S6HA 1FV9A 2PSXA 4Q7XA 1BRUP 3LDXH 1D9IA 2HNTF 4YLUA 2P16A 1QB6A 3WWBA 4IC6A 3NUMA 5E0GA 3A7WA 3MU5A 5HXFA 1PPBH 1MU8B 2R2MB 4U32A 2OC7A 2BY7X 1ZOMA 4O97A 1UTPA 4JK5A 1ARBA 1P01A 4JZDH 1O2SA 2ZC9H 1ZZZA 4WMDA 2OQUA 4BAHB 2SGAA 3KYFA 4NWLA 1FY8E 4WJG2 1EJMA 2F83A 1B7XB 1HRTH 4XOJA 3DHKH 2NU2E 1V2VT 2ZDNA 1J9CH 1MTNC 1QCPA 2GV6A 4XD7D 5DG6A 4Y79A 3FZZA 1HJAC 4Y71A 2WV9A 1W10U 2RA3A 1S83A 4CH8B 1SQRA 3N7DA 5EXMA 2V3MA 2QY0B 3AVZA 1ANDA 1O3BA 1C5VA 3E90B 4AGKA 2OTVA 1P06A 2FOFA 4UD9H 2XXLA 1BJUA 1WAYB 3RXCA 2W7UA 3TH3H 1GJ4H 3PV2A 5HMAA 3SGBE 1NFWA 1LDTT 4BOHA 2VIQA 2BDHA 1DXWA 3B23B 4JZ1A 4KTUA 2IJD1 4SGAE 1G37A 1TYNA 2ZG0H 1FIZA 3ZVFA 2BDYA 2G51A 3KGPA 4O9VA 4E05H 4E06H 1ABIH 5JBCS 3I29A 1H8DH 3MU0A 1GL1A 3RXSA 1QQ4A 4E7NA 1ZGIA 3AW0A 2ZFRH 2WPJS 3ENSB 3RM0H 2FOCA 2KCPA 2QXIA 3ZZ3A 3A82A 1QTFA 2ZCLP 3OY5U 1EZSC 2SGPE 1EATA 2H1UA 1V2QT 2J98A 3N99A 3UOPA 5EXLA 3VB5A 1FN8A 1WQSA 3QK1A 3OFND 5F03A 1NRNH 2VVCA 2ANMH 2LP6A 2OD3B 3TLOA 4LK4A 1HJAB 2TGDA 1ELFA 5FBIA 2EY4C 1KDQB 2XNDD 5T6GA 1HAGE 2XC5A 1QL8A 2W3KA 3E6PH 2JH5D 2PFEA 1TA6A 2D26C 4FUBA 3RP2A 1QB9A 1ZPCA 2NU4E 1TBRH 1FY4A 4H6SB 1O2OA 3SUFA 1YCPH 3KN2A 1G32B 1MAYA 4P00A 1TOMH 1CGJE 4Q80A 1T4UH 1MTWA 1P2NA 4F55A 1WCZA 2FXRA 3UWJH 1T8MA 4BTIB 1AFEH 1JXPA 4DW2U 1O30A 3V0XA 3UNSA 1SLUB 1QJ1B 3EA9A 3QGNB 5C5NA 1NN6A 3VFEA 1BZXE 3SO3A 1F0RA 1TRNA 1G3EA 4WWYA 1ARCA 3SU6A 1H4WA 2ZEBA 1D3DB 2ZECA 3DSPA 1O3NA 2ZNKH 4B6EA 2XNIA 4NZQA 1DWBH 2K1QA 1A5GH 3EYDA 4Y0YE 4ZKSU 5KECA 2HALA 5E0HA 3ZYDA 3UTUH 3GCOA 2FPZA 4WY3A 2V6NA 2JKHA 4A1TA 2FMJA 1NFUA 1C1TA 3B8JA 3TK5A 1C2LA 5C1UA 1O3PB 4YO9A 1QQUA 2GTBA 1EP5A 3D49H 2GKVE 3MTYA 1BBRE 1GMCG 1QFKH 2GGVB 3AASA 2GX4A 1S0QA 3SV8A 2ODQA 3ZZCA 3FO8D 2G4UA 1OPHB 3W95A 3KL6A 3RXDA 2QXJA 4ABIA 1YPGH 2EEKA 2AHME 2F9BH 4AGJA 4MDSA 1YPJH 5L2YH 1V2OT 2TPIZ 1O2KA 2UUKB 1BMNH 5ESTE 4ISHH 1Y5UT 3OE7D 1V2PT 2VIWA 3PM3A 3U28C 1TX6A 3TVJB 1LQDB 1SOTA 3GICB 1EASA 3M7TA 2PKSC 2QC2A 3QUMP 3MNBA 5DP4A 4NSVA 2IN2A 1RJXB 1YPEH 1EXFA 2BD2A 2ZI2H 3PLKA 2STBE 3F1SB 1GHVH 2J98B 1RS0A 2HGTH 2H5CA 3V3MA 1SLVB 1HYLA 1C5WB 1C4U2 2CK3D 1O33A 1TMBH 2BVSH 2JETB 2Z9JA 1T32A 4K3JA 2ZDKA 4TSFD 6CHAC 2QE7D 2A4QA 2WV4A 1C5SA 2BDGA 3MU8A 2WINI 4KTSA 2GV7A 4ISIH 3DCLA 1O2XA 2AH4X 1K1JA 1WDIA 1F0UA 4DVAU 1TE0A 1NU9A 4AFUA 4X8TH 5JB9S 2CF8H 2G5VA 1SG8B 3SV6A 3M3TA 1XUKA 1VKYA 1MBQA 4XFQA 4AORA 1FIWA 1FX0B 1EOJA 5FAHA 2PWXA 4NG9H 4MLFB 3M5NA 4OGXA 2BD4A 1V2WT 1D6RA 2P8OC 1O3LA 5JDUB 2PTCE 2NWNA 1FQ3A 2Z94A 5FPYA 2XCNA 1O5DH 1B0FA 1NS3A 1DM4B 2ZGCA 4LOYH 1DY9A 3K2UA 5GWZA 4CH2B 4X2WA 1HAZB 1VITG 1GJAB 2OBQA 4Z0KA 5F8TA 2FI3E 3MO6A 2SNWA 1GHZA 2EI8A 1V2TT 2VH6A 3A7TA 1P57B 1QBNA 1O2MA 3M7QA 1IQIA 1MBMA 4UE7H 4INKA 5EPNA 4BTUB 2AGEX 1K0HA 3S9CA 3HGPA 4QT8C 4CHAC 3FP8E 2TGAA 4THNH 6CHAB 1P09A 1C5PA 1O36A 2KFWA 1VGCC 1O3AA 1Z8JB 3A88A 1GJ8B 5EQRA 4IGDA 3SJ8A 1ZMLA 3ATKA 5EQQA 1M9UA 4JZFH 4Y8ZA 1FDPA 1P9SA 2HLCA 2O8UA 1GMHG 1PPCE 3F9FA 1HAOH 1MKWK 3IG6B 3RDZA 1D3QB 2VVVA 4INLA 5ETXA 3UIRA 1A5HA 1F7ZA 3GCNA 2BDIA 1EFRD 4JCNA 4NGAH 2A2QH 2C8YB 2VWMA 4CRFA 1BITA 5JBTA 1GHBG 4D9RA 1GBDA 4GLYA 1GBKA 2P8OB 5I25A 4Q7YA 3BSQA 2ZHDA 1BRAA 2GP9B 2KM0A 1FAXA 4ZHLU 1DUAA 1GI4A 4K1EA 1BTWA 5A8YA 2F3CE 3OTPA 2Y6TA 3VB4A 1OXGA 4H6TA 4AFSA 1TWXB 1EX3A 2V3OH 1ZTLA 9ESTA 4ASUD 1O5AB 3BN9A 1T8LA 1WU1A 1CHOF 2SGEE 2BDCA 7GCHF 3VXEH 1INCA 1L2EA 2BOHB 1Z8IB 2ZFQH 1BTUA 1QL9A 1O2JA 1GMDG 1SGFA 2BTCE 2TGTA 5E2OA 3SYJA 3N7EA 4D76A 2XOKD 5C67A 2C8ZB 5A09A 2XYAA 3LGVA 4I33A 1UW7A 1W14U 2UWLA 3SNAA 1TRYA 2STAE 3U8RH 2ZFFH 1ZSJA 2DE9A 1QB1A 1A4WH 1TQ7B 4WH6A 1AHTH 1CE5A 3QLPH 1DPOA 3LGTA 1P02A 1UTOA 1V2MT 1BJVA 2A4GA 4AC9A 3RXMA 1EAXA 1SLWB 2FWWA 2ILNA 5TCCA 5DJ7A 6ESTA 1QRZA 1C1UH 2KR7A 3ITIA 1EAIA 1DXPA 2VNTA 4RKJB 4JYTA 4Y11E 2BX4A 1TABE 3VB7A 2A5KA 4XSKU 1ANEA 3TJVA 1BRBE 4NWKA 5G4BA 1S82A 5DSFA 1LQEA 1C1RA 4CRDA 2QGRA 4YM9A 1V2KT 3L33A 2NU1E 4HTCH 1COWD 1SOZA 2F4LA 1HAVA 1GI3A 2BQ7B 3NCLA 1J17T 2AS9A 5DP5A 3GDUA 3SNDA 4RI0A 1K28D 3UFAA 4D8NA 3WW7A 4Y8XA 4B6FA 1P0SH 1J8AA 2TIOA 2VBCA 3EAJA 4RSPA 5CHBA 3DD2H 3PMAB 1L1NA 2W5EA 1KXCA 2HLDD 3PMJA 1QBVH 1ELAA 2UUFB 2FOEA 4GPGA 2BD9A 2SFAA 2OP9A 3RUOA 2GCTB 4BAKB 1GDNA 1T4VH 4XBCA 2RFKC 1SKYE 4JMYA 3GY7A 3LKWA 3PV5A 1IQFA 2ANYA 2OC8A 1IHTH 1FY1A 1QJ6B 3NZIA 2ASUB 2F9PA 1C1SA 3KF2A 1TNIA 2FTLE 2BM2A 1Y5AT 2V7QD 3KQDA 3LIWA 2Y5HA 2FIRH 1O2PA 4X8UH 1EJNA 1PQAA 1ETSH 2GJGA 5DO4H 2O9QA 5EOKA 1HXEH 1P2MA 4INHA 4D7FA 1TNHA 1GWAA 1QIXB 2ZDVH 4AG1A 1GVKB 1TONA 3M61U 2UWOA 1GI7B 2EC9H 2A4RA 1E34B 1IOEA 2FLRH 1ZR0A 4XE4A 4ZMAH 3MQKC 3U8OH 1C2HA 1E37B 1QURH 2Y5GA 1GHWH 1TMTH 3AAVA 2YNBA 5AFZH 1CSOE 1ZPBA 1LHFH 1CU1A 3UNRA 3P92A 1RTFB 3T27A 1ELBA 1MTVA 3MHWU 4RKOB 1F0SA 2J34A 1WBGB 5HIZA 3SGQE 1MQ5A 1DLEA 3K65B 5A8XA 3LU9B 1YCPK 1TAWA 1IQKA 1SGIB 1C5XB 4DIHH 1MCVA 3QN7A 3SQEE 1L1JA 2ZDLA 1YPMH 1KTTB 1MUEB 3M37A 4DCDA 5L30H 1PJPA 1LVBA 1JIRA 1THPB 2OUAA 2Z9KA 2H9HA 3OAAD 3G01A 1YF4A 2ZPQA 5E2PA 3SV7A 2HPPH 3GCTG 1UVSH 3NKKA 3PV4A 1TBZH 4TPIZ 5T3HA 3S0NA 1SGPE 1Y59T 1O5FH 1EZUC 2YMSD 4ZXYH 1KMHB 1W2KH 1A0LA 3A8BA 3PMBB 5JB8S 5EU8A 4ZHAA 4YT7H 2XC4A 1NBMD 1ZSKA 2A45B 1GBJA 2M5TA 4TYDA 4Y7BA 4R8TB 1KXEA 5DP6A 3SJOA 8ESTE 2BD5A 5CE1A 4X1PU 1HAVB 3NWUA 1EAWA 1FUJA 3RXQA 1B0EA 3GOVB 1W13U 4Q2KA 1KDQA 1C2IA 1AI8H 2XWBI 2CGAA 4MG3A 3K6YA 1P2OA 1QR3E 1T8OA 3ZZ5A 1OWDA 1XXFA 2A2XH 2Z9GA 1QY6A 1BBRH 4WF8A 5EGMA 4IN1A 3S69A 2BYAX 1Y3VA 2AGGX 1Y8TA 1C4V2 3H7OA 1AUJA 2VINA 2D1JA 1HAYB 3P95A 2B9LA 2FEQH 3CS0A 1XUIA 2J4IA 1L4ZA 1LVOA 1C1QA 3TK9A 2Y82A 2ZA5A 3EA8A 2GZ7A 9LPRA 1IHSH 3T62A 3SU5A 1L1GA 3GDVA 2DUCA 1O37A 1G36A 4ZKOU 1G2LA 1L4DA 4YLQH 3RC6A 3KIDU 2F9OA 1OS8A 4AFQA 3O8CA 4X6NA 1IQMA 1DSTA 5AVDA 1V2ST 1AFQC 1YLCA 2ZGHA 3ATIA 2VIVA 3DSOA 1YPHC 3M7UA 1WOFA 1A3BH 1FY3A 5IK2D 4IMZA 4OS7A 4Q63A 3ZVCA 1MCTA 5K7RA 3BTDE 8GCHG 1C1NA 3KQCA 1J16A 2BVRH 4B74A 2JH6D 4MNVA 3A7VA 1LCYA 2PGBB 3SI3H 1GBEA 4ABHA 2GZ8A 3OEED 3TJNA 3U8TH 3TNSA 1O3IA 2QF3A 1AKSB 2J5UA 3JZ2B 5FPTA 2Y80A 3AK5A 2EI6A 1SGRE 2VVUA 1QRXA 1P3EA 1P3CA 1V3XA 2CHAC 1HDTH 2Q6DA 3ZYEA 1Y3WA 3EGKH 3UOUA 3CS7A 5LPEA 3LJOA 1HNEE 3A89A 2FESH 4U01A 1O3EA 1ELCA 1C5QA 2Y81A 1LPGB 4BANB 4YOJA 4MTBA 5FX6A 1MD8A 3SUDA 1O34A 2OINA 3QZQA 1TBQH 1P2IA 1B5GH 1C1MA 1DFPA 3F68H 1OP0A 7ESTE 1NO9H 1MABB 1F5KU 5DP3A 3VXFH 1AE5A 3UY9A 2KAIB 4CRBA 3T28A 1DWEH 4HG6A 2W3IA 2BOKA 2KZ4A 1O2GH 1GBMA 1LHEH 2ZFTA 3EQ0H 4Q7ZA 1ZHRA 1AFQB 1TIOA 1GDUA 3ZZDA 2NU3E 1BMAA 1NRPH 3UUZA 4ABJA 4YOIA 3H09A 1MKXH 3LGWA 1CT4E 1ELVA 1EUFA 4ZKRU 5C20A 2O8TA 4CR5A 3RMMH 1AB9C 1O3OA 2BX3A 2SGQE 1GJ5H 3SUEA 1MTNB 1C5NH 2AMDA 2WSSD 5EG4A 2O8LA 1ESAA 1SGCA 1SHYA 3P17H 5PTPA 3KYGA 3M5OA 1TNGA 4A1VA 1VCPA 1OP2A 2Y5FA 3SORA 1KXBA 4A5TS 1FI8A 3BTME 1EB2A 3P8FA 1W11U 3RLYH 2FOMB 4GHQA 2HNTE 4AB9A 2G00A 1AWFH 1F5LA 1T31A 2QXHA 1A0HB 3AAUA 4OGYA 1TQ0B 1VZQH 5SGAE 3NK8A 3S9AA 1AZ8A 4IS5A 1VJAU 3GDSA 3HKJB 2R9PA 4Y8YA 4GCHG 2GCHG 5DKMA 3SBKA 3SHCH 1QZ8A 2OLGA 2BD8A 5EODA 1C2JA 1GHAG 1GHXH 2IOTA 2WHXA 1D3PB 1FJSA 3SJ9A 1C1WH 4DY7B 4TY7A 5JBBS 2WYJA 1MZDA 5K0HA 3SQHE 4JZIA 2A7CA 2PGQB 1OHHD 2WPDD 3SU4A 2QIQA 5GIBA 2BLQA 3ZVGA 1CA0C 5KEDA 3GY2A 2G55A 1AB9B 5C94A 2QN5T 2OC1A 1H9HE 3RXRA 2XC0A 1T8NA 2QCYA 4K60A 3A8AA 3RMLH 3RXVA 1GI0A 2RDEA 5EPYA 1DWDH 1CVWH 3P70B 3GS9A 1K1IA 1SGQE 3SI4H 4Z1MD 1K1MA 3S9BA 1C2DA 3DFJA 2VH0A 1BTXA 1YM0A 3EE0B 3ODDA 2ZTXA 4TPYA 3ZZAA 4X8VH 1O3GA 1GHYH 1Y3UA 4CRGA 1RGQA 3R0FA 1KY9A 1KLIH 1NROH 1W7GH 4ABFA 1AVGH 1ANCA 1E38B 2HRVA 1MTSA 5IYTA 4YXWD 3RXBA 2NU0E 4D9QA 4X2VA 3TPIZ 1WYKA 4GUXA 3KNXA 4KGAA 5GCHG 3FVFB 1HAHH 2A31A 2A4OA 4ZKNU 1V2UT 2FDAA 2G52A 3PRBA 1YLNA 4MPUA 5GPIB 3MNXA 4ISOA 1FN6A 3H7TA 2AGIX 2BD7A 1O5EH 1RIWC 1DVAH 2QAAA 3VPKA 3RXKA 1C1PA 1SGTA 5A0BA 1NPMA 6GCHG 1XVMA 1CA0B 1NBME 3GY3A 4ZXXH 2Z6BD 2PR3A 5HM9A 1YP9A 4CBOA 1FONA 4GHTA 1XUFA 4WMEA 2VIPA 3F9GA 1CBWC 1CGIE 3LONA 4DT7B 5T6DA
chains in the Genus database with same CATH topology
3RMOH 1S5SA 2FI4E 1MQ6A 2ZCHP 3RXLA 4NA8A 2YNAA 1C9PA 2PUQH 5EW2H 1C5MD 2Y7XA 2GT7A 1A46H 4MPWA 3TH2H 5L6NH 1YPLH 3EDXB 1UVOA 1CA8B 1LHDH 4K5ZA 1J15A 3ESTA 1O2VA 1QNJA 3LJJA 1TGCA 1XUGA 1XXDA 1OWEA 1TPSA 2WUBA 1NT1A 2XBYA 2PKSB 1UCYK 2PW8H 3E16B 1GDQA 1SQOA 1LPKB 2VIOA 1BT7A 1HGTH 3FP6E 1RIWB 2XWAA 1DE7H 1WV7H 1SMFE 3OX7U 1YLDA 2FX6A 1AMHA 1FNIA 1K1PA 1QGFA 3RXIA 3TNTA 1BTYA 1TMUH 5EW1H 4B71A 1U6QA 2Z3DA 2SNVA 4FUGA 3U98H 1O3KA 3Q77A 1K22H 1P8VC 4F49A 1TGSZ 1HBTH 5AHGH 1GVZA 1PQ5A 2BLOA 1HV7A 1BDAA 4ABAA 2GD4B 3OTJE 4I7YH 2HWLB 2BQ6B 3A87A 1Z7KA 1G2MA 2R2WU 3M3SA 4FU9A 2ZHWH 3PTNA 2GZ9A 3HK6B 1DSUA 2GDEH 1GMCF 1E35B 1V2JT 1AVWA 1BMMH 1ZRBA 5CHAC 2FYRA 5DP8A 1S85A 5ABWA 3S7HB 5EQSA 1HJ9A 2OCVB 1P10A 4DURA 1SGNE 8LPRA 1JWTA 5JBAS 3B9FH 1P05A 2H2ZA 1KTSB 1GI8B 1DS2E 5F6MA 2ANKH 5FCKA 4E7RG 1S6FA 2B0FA 3BG8A 1BTZA 2ZWLH 1D6WA 1O2TA 1SGYE 3M36A 1C5RA 2OXSA 1DT2A 3BTFE 5JPMH 3F6UH 5H4IB 2QYIA 1L0ZA 3D62A 4CHAB 3TGIE 4GAWA 5FBEA 1Z8RA 1BBRK 1MZAA 3MO3A 2FOHA 1ZMJA 1JRTA 1VGCB 1IQNA 1NU7B 2ZO3H 2G4TA 1E0FD 3ZZ9A 2RA0A 5ESBA 5BPEA 2XTTB 2FX4A 1MAXA 2QV1A 4BAMB 4I8LA 3SZNA 1SSXA 1ETTH 3MWIU 3UR6A 2Q6FA 4LZ4B 3FP7E 2Q1JA 3W94A 3A85A 1Z6JH 2HNTC 1K1LA 3M3VA 3MU4A 1LHCH 3BEIB 2GT8A 1TPOA 5CHAB 4JZEH 1ZRKA 2LNCA 2A7JA 1F92A 3A8CA 3UQVA 2TRMA 1W8BH 2HOBA 1BA8B 2CN0H 1O2RA 4VGCC 2FO9A 4DG4A 5C1XA 1T7CA 3SU3A 2ZFPH 2F9VA 1BHXB 1DDJA 3PLPA 1Z1JA 1JIMA 1UJ1A 4X8SH 2ODYB 3RXOA 2RCEA 3BF6H 1BMLA 1P11E 2A0QB 1VITF 4NSYA 2R0LA 1OWKA 3JZ1B 1HIAB 2H9EH 1IQEA 1BIOA 1NRQH 1KIGH 4NFFA 4K8YA 1YGCH 5J4SA 1BRCE 3A80A 1YPKH 2BY9X 2A1DB 5T6FA 1GL0E 1FXYA 4Y10E 3BTTE 2PV9B 2VJ1A 3P8OA 1O2QA 2P59A 1GI6A 2R3YA 1NC6A 4ZUHA 1O0DH 1HFDA 1UTNA 2CF9H 3E91A 3LC3A 3Q3XA 1GMHF 4M7GA 4WXVA 3SV2H 1XUJA 3VGCC 2PKAB 3TITA 1K1NA 1WSSH 1RFNA 2WPIS 4NA9H 5HM2A 1EJAA 2V35A 1Y3YA 4MQAA 4TY6A 4Y0ZE 1GHBF 1EZXC 5DPAA 4R0IA 2PUXB 3P8NA 3BEUA 2Z3CA 4NIWA 1C2FA 1O5CB 1SR5C 3RXFA 1UTJA 3GISB 2FTMA 1AKSA 3BG4C 1TOCB 4IW4E 4MPXA 3SHAH 2OQ5A 1UK3A 1O2HA 1BTPA 1OYTH 3BTKE 4KP0A 4I31A 4A92A 4DGJA 1IQHA 1ZHMA 3SNEA 4JYUH 3E8LA 3RXPA 3S7KB 2WPHS 4FXGH 2ULLA 3MMGA 1PYTC 2R0KA 3OSYA 3KEEA 1ORFA 1PPGE 1GMDF 1MH0A 3PWCA 1Z8GA 1AVXA 4B73A 2BQWB 3HKIB 5FXLA 4DIIH 3QZRA 4ISNA 2C93B 3LPRA 4OS4A 3RM2H 3ZVEA 2WV5A 2KAIA 4DOQA 1ACBE 5C5OA 4K1SA 3STJA 5HYOA 3QX5H 3ZV8A 2CXVA 4SGBE 3F9HA 3BTQE 3VGCB 4NIYA 3DFLA 4J2YB 1C5OH 4BAQB 1JBUH 4XBDA 1LTOA 1HLTH 1THRH 1UK2A 1MKWH 2QA9E 5GDSH 4WXIA 2G8TA 3C1KA 2P3TB 2ZZUH 1Q31A 1LKBA 4UFDH 3ATWA 4NIVA 1FZZA 5E8EH 1PPFE 3BG4B 2ZPRA 3MH7A 1TGTA 1OKXA 1PQ8A 1AWHB 3RXGA 3TJOA 3TK6A 1ZMNA 2ZHFH 4X6MA 1J14A 5C2ZA 1H1BA 3V13A 2IPHA 2UWPA 3M5LA 3RLWH 4WVPE 4AB8A 1OWIA 1BHXF 1THSH 4MNYA 1GCTC 1N1LA 3DUXH 1TFXA 2B5TB 4Z6AH 2BD3A 2CMYA 2PTNA 3ELAH 3BTGE 1AN1E 3PMHB 1FAKH 6LPRA 3NPSA 1P2QA 4O3UA 2FODA 3L6PA 2BXUH 1YYY1 5GJ4B 2FP7B 4AN7A 4AYYB 1SHHB 4FUIA 4I8KA 3P8GA 4CREA 1NY22 1OOKB 4FVBA 3UWIA 1TLDA 1SQTA 1ANBA 1VCQA 2WYGA 1QA7A 2PLXA 1EPTC 3HPTB 3SU1A 4X2YA 1UTQA 4ZH8A 2ZU5A 1ID5H 3PROA 1NRSH 1X7AC 4YTAA 4A1XA 1GI5A 3E3TA 1DLKB 1QHRB 2ZTZA 1O2WA 3O8DA 4GSOA 3T2NA 2TGPZ 2ZQ2A 4B76A 3RC4A 2BDAA 1HPGA 1SQAA 5A8ZA 1PPZA 2RDLA 1NRRH 2R3UA 3H5CB 3BEFB 1YCPM 3E1XB 3KQBA 2LPRA 5C1YA 2ZIQH 1S81A 1KLJH 2XW9A 4X6PA 4I8HA 1MTUA 1TNJA 1HXFH 2J9NA 2P3FH 3LH3A 1WTGH 2VIDA 3AW1A 1GCTB 2ZCKP 1O3FA 4JYVH 1O3HA 3OYPA 4KTCA 1OX1A 4RN6A 5EXNA 1AE8H 1AIXH 1ESTA 4PROA 3ATMA 4YT6H 2AMQA 3SJKA 3SN8A 2ZU1A 3V7TA 1O2ZA 1CHGA 2ZGXH 4A7IB 2J2UA 1GCDA 2ZDMA 2P93A 3QTOH 3FFGA 3QGJA 1W0YH 1TNKA 5AFYH 1P03A 3QDZB 3RXTA 1LVMA 3QWCH 2BLVA 3MO9A 1SPJA 1TA2A 1EPTB 2Z3EA 1O3DA 1S84A 2VWNA 1PQ7A 4Y7AA 4UONA 1SFIA 2QXGA 3GCTF 3FANA 2D2DA 5FHTA 3ZV9A 1V2RT 2FM2A 4LZ1H 4HFPB 2FI5E 3U9AH 4CR9A 1GG6C 3ODFA 1ZTJA 3V12A 1GJ6A 4UDWH 1SI5H 1FMGA 4CBNA 5JYIA 3SUGA 3LGYA 2CHAB 4ZROA 5J4QA 3DA9B 1UCYE 3TGJE 1OWHA 5DP9A 3HGNA 3HK3B 2ZTYA 5CMXH 1TGBA 3SU0A 5A2MH 1CT2E 1O5BB 4WH8A 3IWMA 2W7SA 1WUNH 1EQ9A 1OSSA 3RU4T 1DY8A 1EZQA 1KLTA 4ESTE 4Y76A 1ZJKA 2IJOB 1VCWA 3E0NB 1ZYOA 7LPRA 1UHBB 3FZDA 3HATH 1A0JA 2XBVA 2C4FH 1KXDA 4OS6A 4ABBA 2WUCA 1WTHD 3K9XB 1SLXB 2WPMS 1ETRH 2UUJB 1NESE 1QL7A 2ZQ1A 3Q3KA 1TB6H 3T26A 1V2LT 2PSYA 4B2CA 4ABGA 1IQLA 3URDA 1YBWA 3PO1C 3T29A 1P04A 3ZVBA 2F91A 1A3EH 1YKTA 1AU8A 2XRCA 1TALA 3KCGH 3M5MA 2EA3A 3A7ZA 3D23A 3LT3A 1AD8H 3ZZ6A 4OS2A 1IQGA 1GG6B 2BZ6H 8GCHF 3ZZ4A 4ZHMU 3SGAE 1H9LB 1C5YB 1G3BA 1G3CA 2ALVA 1GVLA 2ANWA 3E0PB 1Q3XA 2EI7A 1GGDC 1RTKA 1EOLA 1TX7A 3RU4D 1AY6H 2VU8E 4B2AA 2JETC 2AMPA 3A81A 4ASHA 3U69H 4BTTB 2D8WA 2ZU2A 3KQEA 4HI3A 2FS8A 1FLEE 1PPEE 2BDBA 2W26A 1ABJH 1Y5BT 1C1OA 5F8XA 1BUIA 2C3SA 1Q2WA 4MVNA 4H4FA 3RXHA 1SB1H 3MU1A 2A7HA 1N6XA 4NZLA 1EAUA 4YZUA 1OYQA 1O3MA 1SFQB 1BCUH 3MI4A 3ZVAA 1ESBA 3ZZ8A 1ZJDA 4UFEH 3MH5A 4IBLH 3PO1B 1ZGVA 1O39A 4H42U 1IAUA 2BB4A 2AEIH 1CO7E 3U1IB 1CHOG 1HJ8A 1LMWB 3DT0H 4WMFA 7GCHG 3MNSA 4J1YA 4NCYA 3VEQB 4NFEA 1BOQA 1ELEE 3K6ZA 3Q3YA 1SGDE 1A5IA 1K21H 1GJ7B 3BV9B 3GYLB 4ABEA 1MMJN 1MU6B 1XMNB 2FOAA 2GVFA 1GGDB 4X2XA 1UO6A 3SJIA 1CGHA 1GI9B 1MD7A 2Z9LA 4KKDA 1GI2A 4CRCA 4DJZB 1GBAA 2ZDAH 3ATLA 1G9IE 1P2JA 1JOUB 2ODPA 5AF9H 1DITH 3PB1E 2UUYA 3URCA 1TNLA 3ZVDA 2ZP0H 3T25A 1KXFA 1OWJA 1GJDB 3MFJA 3RXEA 1N6YA 4K8BA 1Z1IA 1AUTC 2H5DA 2ZFSA 2FS9A 3LOXA 1W3CA 1C5LH 2Z7FE 3PWBA 1RRKA 2ZGJA 2AERH 3BTEE 4CRAA 1C2KA 2XBXA 1O35A 2VGCC 4GCHF 2GCHF 3PYHA 1BQYA 5A0AE 3M35A 4O3TA 4TWWA 1K2I1 3BTHE 2V3HH 2I6SA 1GHAF 5F8ZA 1JRSA 4ABDA 5HGGA 2FZZA 1HAIH 1HIAA 3MYWA 1O32A 1CBWB 2I6QA 2O8WA 1AGJA 3O8RA 2BHGA 2SGDE 4FU7A 3C27B 4XDEA 1W0ZU 2O8MA 1CT0E 1GJCB 3SV9A 3GYMA 4AOQA 1H9IE 3LH1A 1SL3A 4X1NU 2BY5X 3GCHC 1DX5M 3RXAA 1TPAE 1HAXB 2G5NA 2JH0D 4X1RU 3MH6A 2V0BA 4IN2A 3STIA 1CQQA 1GJBB 3ZZ7A 3LGIA 4ZAEA 2A5IA 4AG2A 2FLBH 3BTWE 4Y6DA 1C4Y2 2PKAA 5B6OA 2OC0A 1IQJA 2J92A 3GY4A 3SOSA 1XUHA 1SVPA 1A7SA 2OBOA 3PLBA 1Y3XA 4X0WU 1C5ZB 1P9UA 3CENA 1EKBB 1Z71A 2RG3A 1XKBC 3TJUA 1VITH 2VGCB 1SGEE 2A5AA 5GCHF 1UMAH 3VB3A 4K1TA 1QJ7B 1ZHPA 1YPHE 4U2WA 3IITA 5TCAA 1ZSLA 1GBBA 4JK6A 1O2UA 1N8OC 4B1TA 3LGUA 3A8DA 3N7OA 2H9TH 3TGKE 1F5RA 3FAOA 4TWYA 1O31A 2F9UA 5I46H 1QA0A 1UTKA 3QTVH 1D4PB 3SNCA 3EA7A 6GCHF 5FCRA 4A6LA 1GBIA 1XVOA 2Y7ZA 3BIUH 4B75A 1SBWA 5DGJA 1UVUH 3KHVA 3SU2A 1HB0B 3Q76A 4MPVA 1NM6A 5GXPA 1DWCH 1NFYA 2G81E 3GCHB 1HCGA 3BIVH 3R3GB 1VR1H 5IDKA 1W12U 2AIQA 4LXBH 2ALPA 4K69A 3UR9A 1XX9A 3T5FH 3RMNH 1RD3B 4I8JA 1LPZB 3A7YA 2GCTC 3UNQA 1KYNA 1XKAC 2BY6X 2FYQA 4BAOB 3RC5A 4FUHA 1GBHA 2PHBA 5FX5A 4YOGA 4GVUA 4MNWA 1KXAA 2Q6GA 1Z6EA 3A7XA 1HUTH 2CJIA 3LC5A 3CP7A 2HPQH 1C5TA 3D65E 4AZ2B 1C5UA 2ZGBH 2BLWA 1N8OB 3ZZBA 1A2CH 1XM1A 1GBCA 4HZHA 2BVXH 2B8OH 2BMGB 1RXPA 5TJXA 2AFQB 2ZF0H 1C2EA 1V2NT 4FUDA 5DK1A 3TU7H 4FUEA 2J38A 3I78A 4IMQA 4X6OA 2ZHEH 4XBBA 1UK4A 1VJ9U 1C9TA 1TPPA 1QRWA 1UVTH 1HAPH 1FPHH 3A84A 3RU4E 4AYVB 1GI1A 4K2YA 4BXSA 3OY6U 2AIPA 1G30B 3P6ZB 3GY8A 1D3TB 2ZKSA 3A83A 3WY8A 5LH8A 1RTLA 2BXTH 2YOLA 5E0JA 1LKAA 1ELGA 3A86A 1MKXK 3MH4A 2J95A 4VGCB 1F2SE 4B2BA 2VB0A 2GMTC 4D7GA 2F9NA 2P3UB 2QF0A 1LVYA 1GBLA 2VWLA 1NFXA 2THFB 4I8GA 4AFZA 1O2IA 4O03A 1C2GA 2DE8A 1EP6A 4UFGH 4HGCA 3SNBA 5A0CA 3U1JB 4AX9H 4BXWA 4U30A 1TGNA 5BRRE 5LGOA 4X1QU 1DUEA 1O3CA 1UCYH 1W7XH 4ISLA 5DP7A 1NTPA 3NXPA 2ZU4A 1DANH 2VWOA 2J94A 1C1VH 1TX8A 1QBOA 1TRMA 2ZPSA 2AYWA 3O8BA 4X1SU 1G3DA 1E36B 1H8IH 1O5GH 1DOJA 2P95A 3MOCA 4FVDA 4KELA 2C8WB 1A1RA 1OP8A 2FOGA 2WPLS 1V6DA 1YC0A 1FPCH 1SGFG 1DICA 5LPRA 7KMEH 2FOBA 2C8XB 1P12E 3I77A 4UFFH 3UPEA 2A32A 1GJ9B 3RXUA 1A61H 2GDDA 1SC8U 1EPTA 3RXJA 1S0RA 1O38A 2Z9IA 1LO6A 1O2YA 1ELDE 2H6MA 2GMTB 1KSNA 1BB0B 1GPZA 1UTLM 4FUCA 2XBWA 1ELTA 3F9EA 8KME2 1GBFA 4OS5A 3TIUA 4OS1A 2WPKS 4IC5A 4YESB 1AO5A 1ZPZA 3QO6A 5C3NA 1WQVH 2C90B 1JMOH 2TBSA 4BNRA 3PTBA 2BY8X 2HVXA 3OU0A 1K9OE 1AZZA 4NIXA 4UEHH 3UREA 2BZAA 4I32A 3UQOA 1O2LA 1ZTKA 2SGFE 3Q00A 1F0TA 1UVPA 3MNCA 1EB1H 3TH4H 4MNXA 1GBTA 1PYTD 1LHGH 5FPSA